4JDVA

Crystal structure of germ-line precursor of nih45-46 fab
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
231
structure length
227
Chain Sequence
VQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGKYCTARDYYNWDFQHWGQGTLVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab heavy chain
publication title Structural basis for HIV-1 gp120 recognition by a germ-line version of a broadly neutralizing antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 50
structure length 227
sequence length 231
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jdvA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jdvA01
1F3RB 4FQXA 3SY0A 2XACC 4CMHC 3X3GL 2F54A 1K4CA 5D71L 3RKDC 3EAKA 1ODAA 3BESR 4ODXA 4BK5A 1AO7B 1CXEA 4X5WA 1JPFB 1HEZA 2PXYD 3C5ZD 1U8LB 4P5TC 1CFBA 3QA3A 5F88B 3L3JB 5B39A 4G8FB 3KPRE 4YEFA 3AREA 3SDDB 1RJLB 4CN6A 2NY1B 5TDOB 4P23D 3TO4C 3FFDB 2V6HA 4WW2C 5GHWH 5BZWA 3HPLB 1AP2A 4LIQL 1KCVL 5GZND 4BFIA 2VXSH 4F7EA 2Q8BH 4YX2H 2ED9A 2EDKA 5T1LB 5E00A 4GAGH 1WFOA 2CKBA 4HX1B 4Z7QE 1MIMH 3OKDB 5I1AA 2HA1A 5JO5B 3IKCB 4L8SA 1LEKA 4RGMC 4CKVX 2I27N 4JN2B 3ZDYF 3IS1X 1JWSA 1JRHH 1JN6B 2PW2B 3BP7B 3CDCA 4P49A 4MD5A 1PKQA 3HI1A 4JFDD 4L4TB 5E2VL 3IRPX 1XF4A 4HWBL 3EYSL 3ES6B 4J4PA 2AVGA 2J8UA 3GI8H 1S7VB 4G6FD 3RX5A 3UTSD 4MQXC 1AR2A 5FUOL 5DVKA 4B50A 1FFOB 2JJVA 3S36X 1WZMA 1TJGH 4KKAD 1XGRB 5GRYA 4HGKC 3CDGA 4F33B 2BCKA 5KAQG 1GZPA 4R0LC 4UTBH 2FIKB 1T0NB 1G7QA 1MHHA 3U6RB 2RQ8A 4D9LH 4DKAA 5A2KH 5GZOD 3T0XA 1QYGH 1FORL 1VGEL 3RTQA 1UM4L 4CMMA 1E4JA 1JNNL 4XWOC 3T0EC 1NAMB 5CD3B 4KTYA 1WJ3A 3TFKC 1WBZA 3AU1B 4FABH 3V6ZB 2AQ1A 3DUUB 4G9DA 2J8OA 1OD7A 3WLWD 1TFHA 3QIBA 4NPYA 5EOCH 5KSAA 4TSAL 3UYOD 5AZEL 4JZJC 1B88A 1ERNA 2V7NB 4KDTC 3MJ8A 4QHMB 4NQVA 4M7LL 5E2WL 4CDGC 1NDMA 3DVFA 2E7HA 5J12C 3SBWA 4QCIB 5E9DD 3DWTA 3VXOB 1A6ZA 1OGTB 1Q9WB 1AJ7L 2LTQC 4YBHA 1XCQA 4MVBC 1C16B 3MSPA 3OB0H 2XNAB 2E6PA 4M48H 4D94A 3ISWA 1CD0A 1OSZB 4FXGB 4L8BA 3BRDA 3MV9D 3C6SA 3SOBH 4BKLB 2IADA 4Z5RA 4H26A 3PGFH 3MBXH 1FHGA 1CFVH 4G42A 3BH8A 2Z35B 1MQKL 3ARTA 5F9OH 1ZLVH 1HSBA 4DJMA 4KUCF 3HZKB 5TPWH 1IAII 4AENB 4K23H 2X7LB 1T2QH 4XPHH 3QXWA 1EGJH 4XCFL 3OB8A 4XMPH 4LSSL 3KS0H 3DVGA 4TRPH 3D18A 5EA0H 1Z5LB 4R4BA 1A2YA 3ARDC 1Z9MA 1U58A 2V5YA 1Q9KB 4JM2B 4XCCH 1C1EH 5TQ2L 5I8EA 4X7SH 4YR6B 1IEAA 3QQ3A 3CC5B 4P48A 4P9MH 3MZTA 3DURB 3IETA 3MGOB 2EIDA 2VDML 1WFNA 2VWEC 4DUWA 5DQ9B 4R9HA 1P4IH 4OLUL 2EIEA 2EDDA 4K8RC 5HVGB 2BNUA 5KSAD 4C56B 3RIAK 1UEYA 2EYRA 3I2CH 4JN1L 5A1AA 2EYSA 3ZT6A 1UM6L 5BS0A 4A6YL 4HPOH 1I1FB 4UIMB 2GSIB 5I17A 1NFKA 5I1GH 3H9HB 3STLA 1KT2A 1XF2A 4NO0B 3GFUA 5C6TH 4LMQE 1JZ6A 4ZDHA 4LEXH 1RZIB 4U1SB 1MREH 2CK0L 2HRPH 5CZKA 5TDNB 1H5BA 5D5MB 2Q7YB 2FJFB 2PYEB 1X5YA 5D1ZC 1BD2A 4LSQL 4S1SH 5D7LA 3FB5B 4NZTL 3B9VA 1DEDA 2V5RA 2X44D 3PWVA 4LSPL 2D9QB 2V5TA 2H9GB 3KYMA 2E7LA 1DQLH 1KJVB 4GS7B 1B90A 3ZSTA 2FWOB 3KPMB 4GG6E 2DAVA 4Z7UF 3QFJA 2AEQL 2R23B 5F9JB 4KJWD 1I3RA 1BX2B 5DJ6B 2NPLX 1F4YH 2GY5A 3OBAA 3QWRA 5EC2B 3SO5A 3S4SB 4YHYB 1NMBL 2BXZA 4H1LA 3VXMB 3EOYG 4JRYD 4LQFH 4TNVF 1FL5A 4LU5L 3ULUF 1CDBA 4CRPA 4V1DE 2CUIA 1PSKL 5D7JB 5L2KE 4Z7VE 1BQSA 4CU6A 1IC1A 5ISZE 5SWSE 4EN3A 3WDJA 3WO3B 2ZUTA 4OZHF 1RIVL 5C0FA 1NBZB 3JV6B 1JTPA 1T20B 5DWUL 4I0PC 5BS0D 1ZTXL 3EYFA 1T21A 2PR4L 4Z8FL 2H8PB 2UVFA 3L3HB 1EEUA 4PGEA 4JKPH 3W9DA 4RBPK 1DBKL 3P0GB 5C0IA 2AGJH 5I16A 5E99H 3TPKA 4PGBA 3T4AB 1PQZA 4OTXH 3OAYK 3FB7B 4K8RL 4LLAA 3WKNA 1SMOA 1W0YT 3SDXA 3C60C 1QSEA 1U2CA 3W0WD 3V8OA 4PGJA 1NAKH 4ZG1A 3HAEB 3KPSB 4TUKH 5C2UB 5J1SC 3JTSB 1U3ZA 5EBGA 3IFPB 4OCXL 5E6IA 2BMKA 1J88A 4OV6F 3LV3A 4PRIA 3WIIL 2YHGA 1AO7D 2CD0A 1NLDH 3EIFA 3H9YA 1T3FB 3KJ4C 3MRPA 3MOBL 1ND0B 4PJEF 2CDEB 4IRZH 2NYYD 3SDDD 4IS6B 3RWDB 2X4SB 3U36A 3CZFB 4E0RA 1U93A 1BECA 4KQ4H 3UJJL 4XC3H 5D93B 4HS3B 3FB8B 1UADC 2OQJA 3BUYB 5TF1L 3OHXB 4NNXA 1W72H 5HHQA 5T1LD 3CCHA 1FVEB 1PZ5B 4UIKL 5DD5L 2LV4A 5IKCA 4WHTB 4PRPB 5FKPA 1MUJA 1IC7L 1ZSDA 4WY7H 2G9HA 2YMXH 4ONFH 4X6FA 3CFCL 3ZT5A 1DQQB 1ZHNB 1BBDH 5ETUA 5T3ZH 1EA9C 4U1IA 2MPAH 4R90H 3KPNA 3HRZA 4UT9L 5DJAB 2BNQB 4L4TD 3LDBB 5F3HA 5DMYA 1KB9J 1NBVL 4KRLB 2DL9A 2X40A 5T5NF 3V52H 4NHUB 4QYOB 1NBYB 1B6DA 4HGMA 1H15A 2BK8A 1F42A 1W8OA 5JA8B 3UBXB 1F90H 4M43H 4ZPVA 4APQB 3SKUD 2Q3ZA 1SJHA 4ZUVB 3BGFC 3BRGC 1T89C 3RVVC 5D1QA 3R1GH 1CGSH 4UU9B 3D2UB 2GI7A 4MJ6B 3A67L 3P9LA 4P57B 2VKWA 3A6CH 1WSST 2CLZB 1BZQK 4LF3B 5D7IA 1JPGA 3MBEB 4DAGH 1OARH 2AJUL 4QO1A 3VWKB 1EHLL 3U30B 4QRTA 1D5ZB 1G6RL 2W0LA 2A2QT 5CGYD 3BZEB 1R3JA 1NGQL 4JFHE 4LNVA 1S7XA 1Q0XH 4S1RL 2B1HH 2AXFB 2NTFA 4M02A 5HYJA 2IANA 5CZVH 2I9TB 5DRZA 3PHOA 1J8HE 3BO8B 3L9RB 2JJTC 1NUFA 4NN6B 4D8PA 4RDQG 2OX5A 32C2A 4PV9A 2X4RB 3VG9C 4O51B 4N9GB 3MLSH 3NIGF 4MB3A 2JELH 2NY5L 4FZEL 1KIQA 3OJVC 4MJIE 1QO3A 5FDYA 3MREA 4JM2F 1IGIL 3BYTA 3NTCH 4HUVB 1S5HB 1I8IB 1NCWL 4RX4A 2VLJA 3GGWA 2PTUA 3MRNB 5CMAA 2VTFA 4PJ9C 2C3VB 5ITFA 5D6CA 4AQ1B 4JLRB 1FO0A 1G7MA 4UBDC 3VFVB 5GHWL 5SX5K 4WU7A 3LEYH 3T8XA 2QL1A 3L5IA 3QZWG 4JM2D 3D85B 5MI0C 4YX2L 4EI5C 1CN4A 2P5EA 3BD4A 4LCWA 4HFWB 1FNGB 3BMWA 3KPLB 5A3IC 5E4IA 3SO3B 1UB5A 3ZKXC 3TESA 1NKRA 2A6KB 5A2IH 5D5MF 1YJDC 4WJ5B 4W6WB 1F00I 4RNRA 4XGZB 1JZ8A 5D72L 1RHHA 3VFMB 4C56D 1Q38A 1BPVA 3MJ9A 2ZUXA 1KTDA 3GI8L 5KW9H 4IMKA 3TPUB 2NW2B 5BQ7B 4A2LA 2UWEE 1RFDH 5FGBA 4PREA 1HOCA 4NO0D 4Z7WE 5ICXB 4NN5C 4EXKA 4OM0H 1TJGL 1L4IA 4MAYC 5IFJB 4PJXA 2OL3L 2PNDA 1IGMH 2RR3A 4IRJA 3R8QA 4UTBL 3VXQB 3F7VA 4G6KL 4HLJA 2FEEI 5T5NG 3EOTL 2PYED 4PY8I 1S7UB 1HSAB 4D9LL 3SQOH 2XN9B 1A3RH 1RQ5A 4HKJB 1QYGL 3V5DA 1VEMA 3BKCH 4I2XB 1UWGL 5DFVC 3IDXH 4EKXA 1NUDA 4FABL 3JVGA 5HYIA 3SDAA 5L8KB 2AJVL 3VG0H 4Y89A 3PJSA 2AKRA 3DV4A 4FQLH 4I18B 3WIFA 1IT9H 4KMTH 1D6EA 4X8JA 3PG2A 3WLBB 1RJZB 4K7FB 3S96A 2WUCH 4WHDA 5GS0H 5F6IC 5IUSA 3HLAA 3CFEA 1ZVHA 5FO9B 5MENE 1CVRA 5HGAB 4M48L 1NEZB 2ZUQB 4PFEA 5IJVA 3IAQA 1YEKH 5ACLA 4NRYB 5DSCA 2WUBH 4HHAB 1CGUA 1XFPA 3H7LA 1ZLWK 1A7OH 1YEFH 3TVMC 1UZ6F 4ODSH 4NC2B 3TA3C 1N0LA 4L9LA 4MNGB 1J11A 4ZSOB 3PGFL 2P46B 2FO1A 1DLFH 3O3BB 1KPVB 1UJ3B 5F9OL 3QPQC 4XZUA 3MLRH 3MXWL 1K5NB 4Q6IB 5TPWL 1YDPA 2HKFH 1T2QL 4PY7B 4XPHL 1EGJL 1EFXB 4TRPL 4HIEB 1MFEH 5IVZB 3BISA 1YJDL 2R1YB 3Q2CA 2QADC 4HGWB 4XCCL 1C1EL 4X7SL 3U7YH 1RZKH 3FO9B 1TLKA 1F3JA 2YZ8A 3AC0A 3NZHL 4P9ML 2EKSB 3HI5H 2R2HA 1X5LA 4X99B 4Y4KB 3KPSD 3O2VH 4K2UH 3IRZA 2AJ3A 4KRPC 3D5OF 4OFVA 1SEBB 3GJFB 1P4IL 4U31A 4KK9D 2VQ1B 3S3SA 2Q76B 5HHME 4W70A 3W2DL 5T3XE 3MACH 3CSGA 5HVHB 2C1PA 2R56H 1II4E 4LLWA 2EICA 4ETYA 1N4XL 3NCBB 4PTUA 4NCDA 3T08A 2KL6A 1UKQA 1MREL 2E7BA 5F1NB 2HRPL 4HMEA 1JTTA 3DGCR 3FOMA 3BP6A 4QY8B 5D2LB 1XF5B 3DROB 3C2AH 3DBXA 3PF2A 1I1RA 4K7PX 3WUWA 2HWZH 2RGSA 4MB5A 3BPNB 3V0WH 5IR1B 5INCB 2VJXA 2XXMB 1LK3H 3VXNA 3VRJB 3EFFA 4C83B 2BNQD 4OJFH 3FRUA 4P4KA 3ZZ1A 3D3VA 4MXQC 1OY3B 4PGCA 5EOTB 3S34L 3VH8B 3QEUB 1I1CA 3TEUA 5DJDA 3OKYA 1GGIH 3QNXA 5KTEH 3MTRA 4W4OA 5I1DB 4APQD 4XP1H 1T1YB 5ADOL 1R5IA 3QUKA 1ORSA 5KSVA 2C5DC 4Y16C 5C2BH 3AB0B 4UQ3A 5EBWB 1URLA 2JCCB 3NAAL 4NZJA 1WTGT 1PX4A 3PL6A 4URTB 4RIRB 1WICA 4LPYA 3CX5K 3IVKA 1Q94A 4RAVB 2RB8A 1KJMA 1YPZB 5DQDH 1QFWL 3MBED 5C0AB 2YC1A 4HDIA 3DETC 4K7PY 4I0KA 3T0WA 4WFED 4QRSB 1TVBB 1OAUL 5ENWA 2EDEA 4JKPL 5B38A 3ALXA 3Q5TA 1E28A 2AGJL 2ZSWB 4LLUB 3MOQA 1NBQA 5E99L 3H42H 1YC7A 4OZFB 1NCDH 5AG9A 5C0RL 3X17A 1OW0C 2A74A 3IXTB 1BM3H 4L29A 1U92A 5DURB 2CKBH 3DX6B 4OI7A 4DZBB 4HULB 1NGWA 3KLAA 2KKQA 4L3EB 3KPPB 4P2RE 4PJBB 1EEYB 3ET9F 4AM0A 1G1YA 1F4HA 4DTGH 4QHLB 3WS6C 3HZMB 1NLDL 4L1HA 1WGOA 2IGFH 3U79A 4Z78A 5DQJA 3NFPB 3DI2B 1WAAA 2IPTH 1U95A 1VFBA 1W0VB 4IRZL 5IBUG 3MNWA 3WNOA 2DL2A 4QF1B 2QSTA 3RWHB 4Z9KB 4KQ4L 4Z77A 4NQDE 3UYRH 5EU6A 2YKLH 3MJ6A 1BQHB 4Y5VB 4X6BB 1W72L 4MYWB 3PL6D 4MXWH 4AJ0A 3ZDYE 3OKMB 4KTEH 4NOFA 4BH8A 4CU7A 1IGYA 1MJ8L 4WGVB 4LDOB 2GJZA 2DMBA 4WI5A 3QHZL 2YMXL 3V4VH 2WWMD 5A16A 4M5ZL 3QXAB 1BBDL 4MCZA 4G43A 2D7NA 5T3ZL 5BV7C 2MPAL 4U6HA 4R90L 5DJXB 3T0AA 5IT2H 1GVIA 4OD2A 3OKLA 3DNKA 1NCCH 5AAWA 4Q97A 3V52L 5SWQB 4PUBH 1MLCA 3UBXI 3UTQB 1QLFA 1MCKA 3RNKA 2FSEB 4P4RA 3S7GA 2GAZB 4ZOBA 1F90L 4M43L 3GMQB 2OM5A 2YZ1A 4OCWH 3S36H 2VSDA 3SPVA 4PJCF 5KZCB 3R1GL 3EUUA 4NQSB 5FYKD 3BN9C 2R9HC 1FSKC 1LQSR 1AGDB 8FABA 2XN9D 5C1MB 1IGFH 3L7FB 1P5VA 1DQML 4DAGL 1U36A 1OARL 4NKIH 1KB9K 3SHSA 3V6FA 2J6EL 2R1XB 4O58H 5AEAA 3MLPA 2AJSH 2P8LA 4LLMB 4POUB 4Y1AB 3W39B 4PLJC 1T66C 1BJ1J 4Y4FC 1P4BH 1YMMD 4WFHD 2B1HL 5FM8A 5EG6C 5CZVL 5DFWH 5KVGH 1S7WB 1QUNA 1S7RA 3GMPB 1T7YA 1QSFA 2CLRB 3B4NA 3QDMB 5DUPH 4DK6A 2YWZA 1EUUA 3MLSL 3NFNA 4B7LA 2FR4A 2EDLA 4D0BA 3K0WA 1CFTB 5FOBA 3PDDA 1E27A 4G5ZH 4NJAH 3P77B 2W60B 4XXDB 2FH6A 4F7TB 1J5OH 4JDVA 4JCMA 5ICYB 5GS0C 4G7YH 3MA7B 2H26A 3QRGH 3ZKMD 3OQ3B 1P7HL 3RP1A 3RWFA 1BREA 4LKXB 3WS3B 2EDNA 1A7BA 2YD7A 4OKDA 1IL1A 4G8GB 1UQSB 3MMEB 2NR6C 4FQQA 4LSUH 3PXHA 4YBLC 5BV7L 3EDDA 3LEYL 1AP2B 2I9LA 4PJHA 5FYJE 1NGPH 3PGCB 5I66B 1TZIB 4GMSH 4PBXA 1T7VA 3CAFA 3HZYB 4JPVH 3ZE2F 1YEEL 5DJ8A 2CIIB 4M7LT 1BGXH 4Y4KD 4IBLT 2DKSA 2W65A 4LRIC 2VLRA 1MRCH 2BNRB 1OD9A 3G6JB 4FFWD 4GQ9H 4GW4B 5DGQA 3OB0K 3FZUC 3QNYB 3EBAA 4BUGA 4PJ8C 1MRDH 3WIHH 2X89A 1UXSB 3DX7B 4H0GA 4CW1B 2QSCH 4FQ2L 4AEFA 1RFDL 1ZT1B 3S97C 4OM0L 4U6YB 5TDPB 3TN0B 1GOFA 3D25A 5D70H 3RVTD 2RHEA 5DD6B 1QFUH 2F19H 1IGML 3X11B 4H1LH 4HIXH 3ILPB 5E7BA 1JI1A 3QDJB 2O26U 5T1MB 4PJIB 2PXYC 2WQRA 4M1GL 1A3RL 1M05B 1V8HA 3J7HA 5EZOH 3SQOL 1KCUL 3T09A 1X5HA 4XBEH 3BKCL 3RTQB 4Z7UE 2LU3A 2JCCF 4F37F 4DCQB 1Z3GH 1FJ1A 3NCCB 3OKKB 4P23C 2VL4A 3D6GA 1XGTA 4DZ8B 5DUMH 3MLZH 3QFDB 3F12A 4DGYH 5F7MC 2V5SA 1YPZF 3NCJH 2P24A 4JDZB 5I1JH 5IB5B 1HCVA 5I71B 1KACB 4FQLL 1IT9L 3FO1A 3ULUE 1S78D 1RI8A 2EYTB 2VO5A 3OTTA 2AW2A 2N56A 2IMMA 5I1LB 4FXKA 1CR9H 2MFNA 4MA8H 5GS0L 1H3UA 1VA9A 5DHYA 4GRWB 1VFAB 2V9TA 4AEHH 1ZLUK 5JDSB 1SY6A 4MNQE 3C2SA 1GC1H 1LO5A 2YUVA 4OZHE 1YEKL 1I9RH 1U41A 2CDFB 4YHLH 1GGYA 1PDKA 3VXUE 5EO0B 3H9SE 1SMAA 2PO6A 2YRPA 1A6AA 3H7BB 4D2NA 1ZT7A 1CDCA 3DSFL 4R96B 1BBJB 3WO4C 4JZOA 1M6OA 2VLKE 4BQ8A 4ZXBA 2EE3A 5F89B 3IDMB 4R97C 3FQXA 4M7ZB 1A47A 2HG5B 1J18A 1T7XA 2HT4D 3RWGB 1KIPB 3MJ7A 3UO1H 1RZKL 3QQ3B 4O2FA 1N8ZB 4NZDA 5DURD 3IFNH 5BOPA 3GMOB 4ELKA 3HI5L 5HYSA 2X41A 2FLRT 5E8DH 3O2VL 2C26A 4L3ED 3U0TA 3WLWC 4AYFA 2Y7QA 4PJEE 2EC9U 4Q2ZB 3O3EA 3GO1H 2FBJH 4JG1H 1MWAB 1T5WB 1EZVY 3VRLF 1G7PA 3NABL 2WP3T 1P7KB 1AD9A 3MACL 5FB8A 1VDGA 3RL2A 1I4FB 5FUZH 3A6BH 2R56L 3WN5B 1TJHH 4CVWA 2WQ8A 4OI8A 3CH1A 5E1HB 1BZ9A 1T2JA 2XTJB 3STLB 4JFEE 5IHZB 2E7CA 3VFUA 2H2SC 1XGQB 2UY7A 3K4ZA 4BH7B 4M6AA 1YEDB 3IFLH 3CFDA 4HXBH 3Q6GH 3PHQA 5GS1B 1PG7W 5J11B 1H3VA 1BOGB 4Q74A 1R6VA 2OTWA 2HWZL 1TDQA 2PO6D 3FN0L 3NACH 3V7AE 4GRLB 5T5FH 1OWWA 3FOLA 3OGOE 1VKXB 1LK3L 1XGUB 4F58H 1AIFB 1Y0LB 3MV8E 1D9KB 3KDMB 4PPTA 4RAUB 5F7EH 4ESKA 3DJ9A 4NNYA 1BVLB 2W9LA 5CBAB 1V3KA 2F58L 3O6MH 5DJZA 1DVFB 1LP9A 1SYVA 2C9AA 1GGIL 4M8VA 5KTEL 4X5LA 1P53A 4XP1L 4OGYH 4PGDA 5C6WH 4KVCH 5C2BL 4PS4H 1ONQA 5KZCD 4BSWB 1I1AA 1CICB 1NCAH 2IF7A 5EFIB 3V4PH 4KZDH 5C09A 2PETA 2Z91B 2DQJL 4NDMB 1BLNA 3TBYA 4K94C 1XH3B 4HWZA 4HLZH 1JGEB 5CSBA 1BAFH 5DQDL 3SGKA 4P99A 4XWGH 5C0JB 1ADQA 4Z0XA 1I8KA 4FQHB 1ACYH 3DUSB 2ERJC 4UB0H 2DQTL 4Y1AD 3T3PF 1OWRM 1ZHLB 2HFFB 4GAYA 4XVTH 2IH1A 2UUDK 5EULV 1U91A 3FTGA 3OJDA 5I18H 4PJ5A 5IB1B 5EIIB 3BPLC 5HVWA 3NIGE 4JO3H 3RZCA 1A22B 3DX8B 1C08A 3H42L 1OGAE 4D0DA 3QDMD 1NCDL 3VCLB 1INEH 3ZKSD 5LGHH 1MAMH 4NRZA 4PD4K 4WI4A 4YE4H 1BM3L 1IZKA 2EEDA 4NZUL 4QRRE 1EJ6A 3QUMA 2GJ6A 1T80A 1FV1B 4Y2OA 5CAYB 4HWUA 2ADFH 4HJGA 3L6FA 5L8LB 1NH6A 1YNLH 5K33A 2FZ3B 4DGVH 4XP5L 2BMKB 3WFHB 5KS9A 3REVA 4DTGL 4XBPB 4X6EA 6CGTA 3B9KA 4KPHH 1HHGA 5HGHA 2IGFL 3FKUS 1K4DB 3C9NB 1KJ2L 1ZHBB 2UZYB 3ARFA 3G6JF 2V9QA 4WV1C 4Z6AT 3CD4A 2IPTL 1I75A 5E4EB 2CUMA 4P3DA 4X83A 1BQHG 3L5WA 3UYRL 1WK0A 1AD0B 3U83A 2YKLL 5KVFH 1U8QA 1MCEA 4MSWB 1DN0B 1KCSL 3KPTA 1O0VA 4MXWL 1JHLH 4KTEL 1FGVH 3C6LC 2NY6B 5D5ME 3WFZA 1JL8A 1T1XB 1MUJB 3V4VL 3CDFA 2BNRD 2P5WB 3BYYA 2B2XH 3HAEH 3P11L 1C8PA 5IT2L 5F7FA 2R0ZH 5CEYA 3UTTE 4PJIF 1NCCL 1RZGB 3FO0H 3U0PB 1D3CA 4PUBL 4OLVH 1NEUA 1F11A 2NY3B 3QH3A 4AG4L 4U1MB 4EI6A 2P4AB 3CU1A 4ZPVB 4OCWL 3S36L 2DDQH 3E6FA 5DEGA 4P3CH 4U6XA 4QEGA 3TN0D 1IQDA 2KQMA 1DBMH 3OGCB 3I85A 1PD6A 2ARJQ 1J1PL 2MCPH 3SKNA 2Q3AA 4N0UB 5IMLB 3LVEA 4XNYL 3ULVF 5GPRA 5I15H 4L4VE 4F9PA 1R3LA 3WUZA 3NCYP 2FATH 4EDXB 4U6VL 3SDCA 2QBWA 1JP5A 5KN5B 3MPCA 5JIPA 2EO1A 4J8RA 2NYYC 3HE7A 4NKIL 3SDDC 5JR1H 2D03H 2NY1C 3ZTJH 5ITBH 3OV6A 2AJSL 4OBRA 2N7AA 4YIQB 4LPCA 2HLFC 2H2PD 3NIDE 3T04D 3PV6A 5BO1H 5GIRA 4YDKH 4Z76A 3K2MC 3G08B 5KVGL 3EO9H 3IDYC 1H3WM 4RSVA 4HWEL 4UV4L 3DSNA 1VEOA 2V2XB 2EDTA 2FEDD 2A0LC 1AGCA 2BVTA 2CKNA 5GJSH 2FD6H 2JJSA 5DT1H 4X7TB 5I8CB 2GSGB 1INQA 5JW3H 4P3WA 4G5ZL 4NJAL 3O3UN 3CLFH 5J1AA 3KGRA 4KXZI 4JVUA 3LN4B 4XVSH 5EU7E 1J5OL 1BIIA 2VDQL 5IM7A 3I84A 5DXWA 4Y5YA 4NT6A 1KPRB 3MX0A 1OLZA 4G7YL 1AE6H 2Z31A 4CDHA 1NLBH 5B39G 3QRGL 4XP4H 5LAXA 1KPUA 3MFFB 3OF6A 3PWPA 4YZFF 5IQ7H 3G5ZA 5ITFB 1BEYH 1LK2A 2XWBB 5HI4C 1YN6B 1SM3H 5CINH 5D4QA 4MWFA 1LO0L 2B7DT 1CQYA 3QUZA 4PY8J 3QO0B 1ETZA 4UILH 1R3KB 2VOTA 1UWEH 2R39A 1KLFA 3QCVH 5GGQH 5C0BE 4JPVL 3T77A 1A6TB 1FE8H 1R3IH 4PJAB 4PRPE 3NH7H 1T4KB 3EOBB 5CGYC 3SDCD 3T65B 4EDWH 4JO1H 5J1TC 5JPNA 4AT6A 4JFPA 1R3HA 3DVIA 4JKMA 5F96H 2W0FB 2P44B 3IDJA 2DYPA 4ISVB 1MRDL 3WIHL 2GTZB 1BWWA 5IEHB 4PRHB 4KROD 1KN2L 2ADGB 5IHUL 1OOAA 2C7UA 3MRDA 5GSRA 2QSCL 1QP1A 3WSQH 4WTWA 4E41A 4PJFE 3AUVA 1T5XA 2XTJD 3GSXB 1UZ8A 4CN1A 4JJ5B 4FP8H 3DYMA 4WTXA 5D70L 1IAOA 1K3ZA 1QFUL 4NWUH 2F19L 2YEZB 5L0QC 1EX0A 4HIXL 5KG9A 3MRKB 2CSPA 4TVPD 4OV5B 4K7PH 1FZOB 5EZOL 1ZT4B 2NX5B 4XBEL 5DI8A 4IOIB 4Q0XL 4GRLD 1FZMA 2H6PB 4PJ7B 4ZQKB 3FQRB 2QQNH 2HRLA 4X4YB 5JXAH 1D9KD 4MS8D 4JY4A 3LRGA 1MIEH 2D31A 3I50L 3OF6D 3PWPD 3MLZL 4DGYL 3SDAB 1H3PL 5DTFA 2ICCA 4L8DA 4JM2C 3A0OA 5I1JL 4YDJA 1IEHA 1DVFD 3HS0A 3G9VA 2ESVE 2BSTB 4WI7A 4ZFFB 3VXRA 2C3GA 4NQXB 1CR9L 4HUXB 2P48B 4MA8L 4XRCA 1IKFL 3SKOA 3X14B 5IW6B 4Z7OF 4MA7H 1S9WB 1GC1L 3DVNB 4MZ3A 4AEIH 4JRXE 4FZ8H 2VISB 4OLEA 1ZGLP 4I3GA 3GSNB 1I9RL 4YHLL 5FYKH 4JPKH 4MDJB 2VUOA 2Z8WC 2VAAB 4QHKJ 2XY2A 4MA1C 4LCYB 1L7TH 2Z92A 3CVHB 3LSOA 1FZJA 4Z95H 4TULH 2BVOB 5TE4H 1QFHA 5C07A 5JOFA 1NAML 3B9DA 4WNQA 1QLRA 4OFYA 1FPTH 4E41D 2X9YA 4QWWD 1F45A 3V8CA 3HA0A 1I7UA 2VXTH 1G6VK 4KK8D 5KJRH 1V7ML 2C4FT 4FTVB 4JEGB 3GMNB 1C12B 4I0CC 2FGWH 1NANH 5DYOA 3QHFL 3KWWA 3RPKA 3HE6B 1I9JL 2Y06H 1CXLA 2YD2A 3FQNB 3UO1L 5EBMB 2Q6WA 1J9CT 1JPSH 2NCMA 2XT1B 1L6XA 4H20L 4YHNB 3H0TA 3IFNL 3P3YA 4GS7C 3LKQA 4CVUA 3SE3C 4XPTH 4M1CD 1D5BB 5C0DA 5AAMA 2FBJL 4JPIB 1XCTB 1JGDA 5INDA 4JE4B 4ODHH 3HFMH 2F53A 4DKEL 1OPGH 5FF6B 3OR7B 1BFSA 4YHYC 4HW6A 1WWAX 3GMRA 1YEHH 4NKDA 3A6BL 3VE0B 5IV2A 5KSBA 2JTDA 2XKSA 4LVHC 4HC1H 3LKOB 5LG1A 3BMVA 5HGBB 3QUYB 5D7JC 5FO8A 3BDYL 1N5AA 4OFPA 2BY1A 3QISA 1ZVSA 1S7QA 3UTPE 1C5DB 2A9NH 2WANA 3S35X 3O6FA 2VDOH 1REIA 1QBML 4AY0A 4KHXL 3U46B 2YR3A 5T5FL 3MRMB 2P5WD 3GI9H 4X5XA 2HN7B 4I2XE 1ZOXA 1A1NA 5HSFA 3BH9A 3LKNA 3MCKB 4ZODA 5EC1A 4U3XA 3ARBB 4OFYD 3PGDA 3GJFH 3PDOA 4N0FB 4WDIB 5JXED 5CCKH 4XNUH 3HMXA 1LHZA 1A3LH 2NY3D 4WU5B 1RPQA 4PJCE 1MH5B 3O6ML 4JRWA 2NLJA 2A73B 5EUOA 4HK0A 1QG3A 1Q9OA 1KXVC 2YA1A 1QKZH 2ARJB 4H1LG 3U4AA 4OGYL 3TO4B 2P45B 2OZ4A 3CIQA 3PP3K 5BJTA 4KVCL 5E8NB 5DEFB 1I8MA 3WEXB 5F93C 1NCAL 1MI5A 3OAUH 4NIKB 5T1DH 3V4PL 3RJDA 4UDUA 2VDKH 4LKCB 4KZDL 4I5BA 4U7KA 1C7TA 1WEJL 3JUZA 2YPLB 4KK9C 3QG6B 3FQUB 2Y4SA 3HHRB 3GUTB 2DTMH 1OAZH 4OGAD 1AHWC 4K07A 4NZRH 3DXAE 1BAFL 3C08L 4XI5D 3MUY1 3AFLA 3LN5B 4J1UA 4ZTPH 4UB0L 5C3LD 5D93C 3QIWD 5FV2A 4EUPB 3QIUA 5ENWB 2IC2A 4XVTL 1MJJA 3MRFA 5IFHH 5I18L 1ZEAH 3JSSA 4PP1C 4G3YH 3GHBH 3VXTB 3EFDL 5JDJA 4JO3L 1HHHA 1JF6A 1BVZA 3L5HA 4YH6A 1TZHB 3MRRB 4PRDA 3NPSB 1INEL 1RK1A 5DUBA 3S5LA 3DRQA 4CVXB 5LGHL 1MAML 5LQBH 1ZGLM 4YE4L 3DV6B 5L6YL 4IIQA 4JFFA 2EDOA 3LDBC 4BZ1H 43CAA 5J4MA 2X4QB 4ZUTA 1AC6A 1S9KC 1TIUA 5FO7A 4JQIH 1YNLL 1YN7B 4DGVL 3ZHKA 4AM0B 1B0GB 4MQ7B 3MR9B 3RVUD 4JFQA 4DOHE 3ROOB 1OM3H 3KPOB 4LSTH 4F3FA 4N0CD 4OUUA 1DBAL 4APQC 1IM3B 2CDGB 5BRZB 1GHFH 1KGCD 3ELAT 1NDGB 2DQGL 4MD0A 4PV8B 2VZ3A 3KXFB 4PRBA 1E0OB 4DEPB 3ZE2E 1EO7A 5KVFL 4CUCA 3TZVB 3MBEC 5GJTH 3W5NA 1JHLL 3OKOB 3VWKC 1FGVL 4OZFH 3U30C 4QNPE 1M7IB 4OFIA 1FGNH 1AGFB 2Q7NA 3CNKA 1RMFH 2A83B 4FMFA 2B2XL 3DIFA 5JW4N 3O2WH 5JHDB 1A4KA 2R0ZL 2I07A 2X4UB 1QRNA 1BJMA 3QO1B 2IALB 4BA8A 4PRHD 4WO4A 4NN6C 2XYCA 3D9AH 3FO0L 5CKAA 3V79C 4OLVL 5CHNB 4PJ7F 1JMZA 3HG1E 3JWOH 4GG8B 1SVZA 1UACH 5J6GB 1ZS8A 2DDQL 1D5IL 4P3CL 2FGZA 5CEZE 3ARDB 3SPVB 1DBML 5C0CD 2MCPL 1QHOA 4MJ4A 1OB1B 3QI9B 4UV7H 2JCCE 2NXYB 1SY6H 3MNVA 2ZP0T 4ZPTB 3LRHA 3CFBA 1KTRL 5I15L 4TNVK 2A9MH 2NX5D 4KWUA 4TQEH 4HWBA 3INUH 4IOFC 3VXSB 3RWEB 2OSLB 4ODUB 1VGKB 1YPZE 4I8DA 5C0AE 5B8CA 2O61A 3QQ4B 3MCLL 1I3VA 2D03L 3BZ4B 3QULA 4NQCB 3DX9B 2YSSA 1WBYA 3ORJA 3MNZB 3MO1A 2ZPKH 3KHQA 4DW2H 3QNZA 4LLQA 2GTWA 3FT4B 4LQ1A 1FH5L 4XTRD 5BO1L 1PEWA 2G5BB 4YDKL 3LZFL 4OAWA 3I6LD 3KYOA 3QXTA 4GBXA 3V6OE 1MFCH 1H0DB 1ZMYA 3HZVA 3MXVH 1P2CB 1VSCA 4XCNA 4ONHB 4QOKA 5CIPA 2WWMC 1QFOA 1HXYA 1M4KA 4F9LC 1JYNA 2FD6L 5DT1L 2DTSA 5D1ZB 5HD8D 1MCDA 4XVSL 1X5XA 3WXVH 1V7NL 4GUPA 3N1MC 4XH2A 4XP4L 3TBSA 3WXWH 3PABA 5IQ7L 5IMOA 4ONGH 4PBVC 5MEPA 3MC0A 3MRGA 4ZMAT 1QD0A 1BEYL 1K8IB 1F4WH 1IGTB 2VLLA 3C5SA 4P5TA 1SM3L 4QHNB 5CINL 1IILE 4FTVD 2B1AL 4JKKA 2VR5A 2R2EA 5DJCB 1TVHA 3HE6D 1ZE3C 4WW2A 1UWEL 2DWDA 2EDWA 3QCVL 5GGQL 1LNUB 1S9VA 1FE8L 1YC8A 3NH7L 3VRLE 4EDWL 3NN8A 3EYUL 4MHHG 5F96L 4I18C 2DN7A 3KPRB 2YBRA 2YPKA 4P9HH 2XG5A 4ZO7A 3MYJB 4RGNE 5E6ZA 2J88L 4UUJA 4KXZH 5D9SA 1WBXB 3SKJH 2WAHA 2W9EH 2H32A 5FHBH 1YY8B 2QSVA 2ZUQC 5DHVB 5J13B 5HI3D 5GSVA 1NFDA 1RSFA 4DK3A 5CEXB 4NWUL 2WWKT 1CT8A 4LCUB 5TGBB 2HVKA 4YK4C 5D6DC 1UJ3C 3B83A 4R0LA 3VFPA 4K7PL 1K85A 3D39E 5E6YA 4HJ0D 4Q6IC 4JM4L 3QEHB 2Z4QB 3O9WB 4DVBB 3N9GL 4A6YA 2X4TB 2AK4A 1EEQA 3SGDI 1ADQH 1DDHA 2X70A 5JHLH 1I9IH 5JXAL 4Z7NF 1MIEL 4HH9A 3ARBD 3I6GA 3TWCH 3ECBA 4N8VB 4P5TD 4IJ3B 2Z93A 5C7XH 2ICWB 4PG2A 1JWMA 2CRMA 1NGZB 3TO4D 4JZJA 2FCBA 2RIKA 4X9HA 5E7FA 4QHUA 3FN3A 4MA7L 4EBQH 4AEIL 3BDXA 4FZ8L 4LEOA 4KZEH 2YPLD 2AK1H 5FYKL 4HCRH 4JPKL 1Z6JT 3T3PE 3L5JA 2F15A 5HVHC 4U3CA 4Z95L 4TULL 4LPVA 2F54E 5TE4L 1MSPA 4RWHA 1F8TH 4KI5F 5C8JA 3BW9A 1R24B 2EZ0D 1GRWA 1KLUB 1FFPB 2VXUH 1MFAH 1FPTL 1EV2E 4MAUH 4MA3A 5IB4A 1DEEB 4O4YH 5CP7A 4WI8A 4QT5A 4LCCA 4G8GE 1CFSA 4MQXD 4Y19A 3QAZB 2FGWL 2W91A 1F02I 2Y06L 1CIDA 1WAAF 3QJHA 2RJMA 3GMMB 4GRWH 2CH8A 3D0VA 4KI5D 1GGCL 4ZFOB 2MQCA 4JQXC 4NM8H 4LPTA 1W8NA 2YD8A 3G6JE 3MLYH 5MHSD 3BXNB 3O3EB 5HGDA 1EAPB 1G0YR 1QNZL 4XWOD 3T0ED 1PKQE 1CDYA 5FK9A 4ODHL 3TFKD 2R69H 4HV8A 5F7DB 3MROA 4R26H 4HUKB 3AB0C 3WJJA 1YEHL 1MCOH 4HC1L 1AGBA 2B4CH 4S11A 2X5PA 5LVEA 1QBLH 1FCCA 3RL1A 1CLOH 2IBGA 2VYRE 1Y6KR 3D87B 3L1OH 5HHNA 3GIZH 1NCTA 3LS5H 3OX8A 4ZUSB 2YPVH 2WW8A 2A9NL 2JB5H 3WUWG 3JTTA 3QDJE 5J9PA 2VDOL 3ZE1F 1NC2B 4WWKA 2NTSP 3GI9L 4MJ5A 4NQEA 5D7KE 1HWHB 2OJZL 5IMKA 2DBLH 4BFBD 1UH2A 3B3IB 4HIJB 3U7WL 5C6PB 2EDJA 1MWAH 4ZFZB 3MRJA 5CCKL 4XNUL 15C8H 5EZJB 5H94A 4EOWL 1BVKB 3S3PA 1JK8A 1KTLB 3ULVE 3B2VH 4HXAH 4F15C 4KGJA 1QKZL 3Q1SH 3C5JA 4WI9A 3K3QA 3ARDD 1HYRC 5FYLD 1SJEB 3U2SB 2BOBB 4YHIA 1IAKA 3S3JA 2O5XL 3TBVB 3F58H 4GQPH 2NXYD 3WFEH 5MI0B 5DD3H 2VDKL 3HTLX 3BE1H 2VDNL 4RA0C 4AIOA 1OAZL 3MFGB 4CVZA 4PRNB 5E5RB 4NZRL 2QLVB 3AY4C 3NZ8B 4U1KB 3Q6FA 1I1YA 5D1XA 4Z0XB 1LEIA 4OZIB 3QG7H 4OZGB 5EZLB 4XCEB 1AGEA 3SCMC 5ESAB 4PLNC 5B38G 5IFHL 1ZEAL 1A6VL 4NO5B 2X4OA 2M2DA 2ATPB 3GHBL 4I0PA 5EIVA 4TNWF 1KELH 4V1DB 1JF1A 1S9XA 3ROLA 4I48B 1GZQB 4KTDH 3BQUB 1A14H 5L2KB 3QDGA 5ISZB 3CU7A 4N1HB 1N59B 5LQBL 3L5XH 2B39A 4M9PA 4C4KT 3OJ2C 4BZ1L 2E6JA 4KKBC 4RGNC 2L7JA 4YHMH 1G6RA 4IDLA 2QKIA 1I7TB 2R0LH 5EDXA 1N3NB 3C60A 3GMLB 5D1ZD 1KC5L 4PJHF 4YZFE 4JQIL 5KSUB 3TLRA 1HQRB 1F2XK 4JHZA 3ULSB 4N1CA 4DVRH 4WTZA 1OM3L 1B0RB 4LSTL 1TENA 1U3HA 1DE4B 1EFQA 1H8OA 2PYFB 5JNYB 3E8UH 3S6CA 4D9QE 1ZA6A 3VXPA 2ZCKL 3TYGH 4RRPA 2VXVH 3UXFA 2YXMA 1KIUA 1MHCA 1U8MA 5F6IB 3BP5A 1XR9A 5GJTL 4Y4HB 1WZ1H 4IDJH 3CZJA 3O3DB 4P5KB 4L3CA 1INDH 2ITCB 2WIMA 1WZLA 3GJEA 4JGJA 4MNHA 1KJ3H 1FGNL 2F74B 1BD2E 5D7LE 3BKYH 1RMFL 1HXMA 4PG9B 4YPJA 4G80B 3O2WL 1B4RA 4ZO8A 3KPRD 4E5XA 1G7HA 3DHJA 2ZCLL 3AS1A 5DJ0B 1U8KA 2BVQA 2HT2C 3SE4C 3D9AL 3AGVA 5B3NA 1G7LB 3QFJE 4NP4H 3JWOL 5HPMB 3I02B 1UACL 5IQ9B 2BERA 1JGVH 2FDBP 4AQOA 5IW1A 3L3GB 5FXCH 1FVDA 4K9EC 4H88H 5DLMH 5TQ0H 3OXRA 5HHXL 4HUUA 1SY6L 3ARWA 5CJQH 5FA3B 1MRFH 4OF6A 1HH6A 1T89A 1Z9OA 4YQXH 3O6KH 3C60D 3IU3B 1B0WA 3FONB 3DTXB 4TQEL 3DOSA 3INUL 2GW5A 2ITDA 5DJ2A 1WF5A 1R5WA 3AREC 3IJHA 1HIMH 1QZ1A 1RVFH 3T4YB 1RK0A 5GRJL 4ZD3L 2ZPKL 4DW2L 4CN4A 5IHLB 4LNRB 2ADIA 2OL3A 5LXGH 4ZYKB 4Z7OE 5GGTL 2YD5A 3RX7A 1MFCL 4FFYL 3MXVL 3PQYA 3AS2A 3U9PH 4ZNCD 4L8SC 4GAJH 1HNFA 2JJTA 3SDXE 1AGCB 1QSEE 3EZJB 1FNEB 5I75B 3MUGB 2ARWA 4CGTA 3EYOA 4M61A 2VLME 3WXVL 1F6AA 5AYUH 3EOAA 4YXHH 4RFNC 4PRIE 3B8YA 3VFOB 3WXWL 5HJ3B 4NN7B 4ONGL 5C0EA 4WUUA 1F4WL 2OTUB 4PJ9A 3V5KA 2P8PB 1A6UH 5C08B 1SYSB 4Q9BA 5DR5H 3F5WB 1NMAH 3R06B 4MJIB 2R2CA 4QRPA 3BWUC 5FOJA 3RTQC 3CFKB 3G04A 3CXHJ 4Y16B 1DUYA 5FUCE 5HHPA 5HY9B 1BHGA 3K46A 4EI5A 4RMWA 1P7QB 2ZJSH 2OR8A 4X6DA 2H2PC 4JZNB 1QBBA 5GS3A 5I71C 3PNWB 1EGJA 2IFFH 3VWJA 4GG6A 3ULVC 5KANI 1KFAL 3N06B 1RUPH 4R7NB 2P1YA 3KYKL 3UDWC 3BPOC 2HVJB 1CF8H 1T0MB 1WT5C 4LLYA 3MRDB 3PWUA 3SKJL 5BCAA 2W9EL 1NQBA 2FEDC 5LCVH 1B2WH 5CJOH 3IAPA 1IRAY 2ZNXA 2APWA 4AEEA 2CPCA 3QJFB 5DMIH 5GRZA 1CVSC 2ZG1A 4Z7VA 3S35H 4F7MB 1LP9F 4MAYA 5SWSA 4MD4B 2VC2H 4RBPH 3MYZA 5K9QG 1NC2D 4HKZB 2DI9A 5D7IE 3P4MA 2A6DA 1EEZB 3OAYH 5BVPL 4V2BA 3FT2A 3JWDC 4M7ZC 5JHLL 2UWEB 4D0CA 1BQUA 3MRQA 43C9B 3BKJH 3TWCL 1YUHB 1WCBB 2ICWI 4Z7WB 5ID1B 4J7RA 5I73C 1FL3B 3RPIA 2QJDA 4R4NC 3H3KA 4M6NH 4PJ9D 3R0MA 4M5YH 5C7XL 3REWA 3VJ6A 4RMUA 1IZJA 5ILTH 3UTZA 4OZIF 5HYJE 4OZGF 1HK6A 2YUXA 3IKKA 2IANE 3H6JA 3KNBA 5DEZA 5E8EB 3W11C 3GB7B 5IF0A 3D0LA 2XI9A 3QDHA 5EU5A 1P6FA 5FHAH 1FVCA 3QCUH 1GYAA 2VDRH 4WFFE 4JVWA 3HC3H 4EI5D 3RBGA 4NYLB 4JKLA 4KZEL 2AK1L 3DRTB 4HCRL 5J6HA 2BVPA 4XMLH 1A4JB 5E94A 3EJZD 3RNQA 3OR6A 1RUQH 5IB3B 1UWXK 3WN5C 1HWGB 3IJYB 1F8TL 5CSZA 3TVMA 2VLJE 3VFRB 3TA3A 2GUOB 4NC1E 5JUEH 4XCYB 1VEPA 5I76A 4MAUL 2H3NB 3RZWA 1NGXA 1X5GA 5KS9F 4O4YL 3CX2A 5AZ2H 1G9MC 3SGDH 5MENB 1I7UB 1FYHB 5GS1C 4V1DD 2JF1A 5DK3A 1NC4A 5CP3H 5LGJA 2Y9RT 5L2KD 4GKZA 4GRLC 4OCSH 4PR5A 5ISZD 4MAYD 5SWSD 2IH3B 1U8HB 1KNOB 3F6LA 4MLSA 5HYSG 2P5EE 1NFIA 3X3GH 1CIUA 1HH9B 1D9KC 2FHBA 4P2QB 1UFUA 4LCWE 1OAYH 2CK2A 4NM8L 3GSUA 4U0RB 1EUTA 5ERWB 3EHBD 3BIBX 1PW3A 3MLYL 5E56A 2GT9B 4FNLH 1E4XH 1DVFC 3L95A 5DFVD 5DJYB 2ZUWA 3BP4A 2HJLB 4K3DH 4G7VH 3CVHH 3FRPA 3TCLA 5EU3B 2F53B 2R69L 2Z8RA 3BIKA 1MHEA 3VMPA 4R26L 1HHJB 4LIQH 3RWJB 3GMRB 1KCVH 1MCOL 4O2CB 1BWMA 1CICC 4F2MB 3QXDA 5E8OB 1KIRB 3STZB 5IHBA 2B4CL 2J1KA 3AAZA 1QBLL 1GH7A 3JWDL 1CLOL 1ZHKB 1PG7X 5FO8B 3L1OL 3EO0B 3QR2A 3ARZA 3IFOB 1HI6B 3LS5L 4OD1H 4PJXE 4LCIH 2APBA 4Y4HD 2WNGA 2JB5L 4RA3A 3RHWF 2ICES 3JV4A 2H41A 3O6FB 4M4RA 4NKQB 3STBA 1HQ4B 5JLZB 3I75B 5HHMB 5IVXA 4JFXB 5ESVA 5DC0A 1IQWL 3EYSH 2DM2A 4PJ7E 4LMQI 2PCPA 1PGRB 3V6BR 4P46B 4XP6H 3WE6A 4F37K 5JORB 1X6NA 5FUOH 1CBVH 1MWAL 1J8HA 3ZKND 15C8L 4YBQC 1W72A 4Q58C 1NC4D 4HXAL 1WITA 5I1KH 2MCG1 1Z2KA 3QXVA 1MCRA 3O41A 4NSKA 4Z18A 4GLRI 4G9FA 3F58L 5CIPH 3WFEL 4P2OB 4DWHA 5DD3L 4UDUB 1JNNH 3BE1L 1YA5A 4FOMA 4YPGB 1G9ML 3SEPA 1OF2B 3GSWA 4TVPL 5SX5H 4XHQA 4M93B 4MB4A 3R8BB 4RFEA 5E4EC 1XZ0A 4TSAH 4I1NB 3QG7L 3UPCA 2Y25A 2A6IA 5FKAA 1ZA3A 5E2WH 2JK5B 2W07A 3VFWA 5HHOB 5JOPE 1AXSA 1ED3B 4YFLF 1JI2A 5SWZA 1M7DA 2NY6C 4OGXH 2Q87A 1X7QB 4KTDL 1HILB 1A14L 3GSVB 3BSZL 2NW3B 3L5XL 3PWLA 4PIRF 1RIHH 2J6EA 3I6KB 1OW0A 4YHML 1AQDB 5T1KB 1MQKH 5EPMA 5JXEC 1FG2B 4JFHD 2NY3C 5AUMA 3EGSA 4HUWB 4TUOB 4XNQB 4DVRL 1IBGH 4KH2A 1A7QH 3TNMB 3O2DA 1J8HD 3E8UL 3RAJH 3WS6A 4P59L 4G8IB 5GRXG 3E6HB 3TYGL 2VXVL 1JGUH 2GK2A 1FG9C 1I7ZA 1SHMA 2XQYG 3LKPB 4OGAC 2JIXA 4MJID 3VGAB 4AK1A 1ES0A 1M71B 3O11B 4ZUUB 4Y16D 3F7YA 3KJ6H 2VDMH 4OSUL 4DN3L 1WZ1L 4XI5C 4IDJL 1P9MC 2L7UA 4NBYB 4P2RB 4TUJB 2BSSA 1INDL 1S9YA 4JHBA 3MRIA 1KJ3L 1P7QD 2G5RA 1T1ZA 2V2TA 3BKYL 4E42A 4MLIA 5HYQB 3L3OB 3M1BA 1OTSD 1KENH 4JANA 1YZZA 3VGBA 1QQDA 4NQDB 5DRXB 2X42A 3D3VE 3L3KB 1WTLA 4OIBA 3L3DB 4NP4L 2VXQL 2LAGB 1ZLWH 3WO4B 2XKNA 1JGVL 4FA8A 4HJJH 1FYTB 3Q3GB 4Z7WF 3UPRA 2XPGA 4M03A 4U1LA 3U4EB 5TQ0L 1CG9A 3RY5A 1X5FA 5CJQL 4YHPB 3M07A 3RVUC 3TBTA 4LHUA 4OB5L 2GK0A 4N0CC 3LKSA 5IMMA 5H2BB 4Z7NE 4NC1C 3FFCA 1T2XA 3IDIA 1HIML 3BEWB 1G7JB 3ILQC 1VESA 3KR3L 3SJVA 4BELD 2XWTB 5F8RC 2VABB 3FB6B 1RVFL 2DM4A 2D7QA 1CE6B 5DRWA 1CE1H 1U8PA 1DQDH 3RGVB 3K7UA 5E5MA 4ZAKB 5F7NC 2OMBA 3LB6D 2BY2A 3LY6A 4Y4FA 4C54A 5FDWA 3DLQR 3LQZB 3QWOA 5F1IB 2ZOLA 3U9PL 4GAJL 5CJXC 1I7RB 2VR4A 1U8JA 5FYLH 1KG0A 4GKSA 3KYNA 4AIXA 1JF5A 2AI0H 1L7IL 1QR4A 3RIAF 3TIEB 3LD8C 2I60L 4UNUA 5AYUL 1H8SA 4IMKC 2PR4H 4YJZL 4YXHL 3H3BC 4Z0BH 5FGBC 1DBKH 3ARPA 4ODWB 5E2UL 5BRZE 5HYFA 5L88H 3O4LA 1FFNB 4GW1A 1OP9A 1WAAE 2AEPH 4K8RH 4YAQB 5MEND 2WV3A 1XR8A 1DQJA 3KXFE 1P4LA 1A6UL 2AXGB 2MSPA 4WW1B 5C0GA 1ULVA 2CQVA 3RBSA 4EVNA 5EU6E 2EIZB 3QEQA 2R2EB 2XZZA 1NJ9B 5KSBF 2E6QA 1UCBH 5BVJB 3BN9D 4HS6A 5GRWA 4AIZA 5EO1A 5IK3B 3RWCB 2ZJSL 2WIIA 3O8XB 3SDAC 1FNFA 4JJHA 1ORQB 3MOBH 2GFBA 1EHNA 2IFFL 1UM5H 4LRIA 5JHDE 1EAJA 4X6CA 2MOVA 1AFVH 1K8DB 1A9EA 1KCLA 3LQAC 5EN2B 3V5HA 4F7CA 3GSQB 1CF8L 4PJ8A 3K8KA 4ZUWA 1PYWB 2AXJA 4PLJD 5A2LH 4N5UA 5TF1H 4KMQA 1B2WL 1XT5A 5CJOL 2C4FU 5DD5H 1YMHA 3CXHK 3ZE1E 4GRMA 5HD8C 1MHPH 3NA9L 1IC7H 1MLBB 1IM9B 1CFQA 1UG9A 5DMIL 5ESQA 3S35L 4GMTL 4L9LC 3IDNA 4ELMA 4OF3A 2VC2L 4N5EC 1CFNA 1TJIH 2IPKA 4YDIH 4HZLA 1MCLA 4JDTL 2K7PA 4TTDD 4DKFH 4NFDA 5HHMD 2AJZB 4OZ4A 2DWEB 5T3XD 4OCNC 3VXSE 2VN7A 2SEBA 2PXYA 1DDHB 1MPAH 4NQCE 2JE8A 4P46D 3FQWA 5TH2B 3UPAA 2HAZA 1JPST 4X7CC 1MNUH 3ARRA 2DRUA 3P2TA 5IG7B 5DRNB 4P23A 1TITA 3HE6C 2OXGA 1BFOA 4TYUA 4YHZH 4JAMB 5ILTL 4H5SB 1LEGB 3FJTA 3IDGA 2C4XA 2CLVB 2UV3A 2XY1A 1FNHA 3A67H 5B3JF 4XT1C 1QSFE 2WP3O 1TQBC 3TO2A 1HDMA 4O00A 3CPLB 5FHAL 3QCUL 4U1NA 2VDRL 4P2OD 3HC3L 4LBEB 5GGSB 1XF3A 1FN4B 1VFMA 3LQMA 4S2SA 4JFDA 4JB9H 3BZFA 1RUQL 1NGQH 4XBGB 2WBJB 4M7KH 4DFIA 3FZUD 5FECB 4EIZC 3QUYC 3NCEB 3UTSA 4MCYB 4X7EC 5IP4A 4LPWA 1A6WL 1VACA 2YA0A 5AZ2L 4RZCA 4MNQB 3ZHDA 4ETQB 1OT2A 5M95B 4MJ2A 1FBIH 1JWUB 3U9UB 3W9EB 5AD0A 1T04B 2FO4B 4Y19B 1MY7A 3ZE0F 4HZAA 4OCSL 2NY7H 4PJHE 1K6QL 1T22A 3LQAL 3VXUB 3WYRA 3H9SB 1IGIH 1D5MA 2GQHA 4G8EA 4BSVA 1J0YA 3ARBC 1BZ7B 1NCWH 1OAYL 1ZWIA 5T1KD 5TFSH 2VRAA 3CFJB 1GIGL 3GSNL 2VLRE 2VLKB 3MRBB 1G0XA 4FNLL 5EO9A 1E4XL 1RZJC 3WFCH 2PN5A 2HJKB 2HTKC 3CVHL 4G7VL 4K3DL 4W4OC 1KLGB 4JFOA 3PWJA 1QPPA 1LWRA 3B9AA 3L3IA 1PJ9A 3EJYC 5JW5A 4G6JH 2X9WA 4YO0B 5E9DA 3O4OB 1RUAH 3DO7B 3QZWB 1MVUB 5IEKB 1CTNA 1MJ7L 4WHYH 3IDYB 4OD1L 3RQ3A 4LCIL 4OQTH 4PJEB 3MV9A 4P2RD 1TPXC 4XHJD 1DQTA 4N0YH 4RMQA 2D0FA 2EEAA 1S7SB 3CMOL 2EZ0C 3MRCA 2DD8H 9CGTA 4S10A 5D72H 1KJ2A 2ZG3A 2EE9A 1FQ9C 3SGEH 1LE9A 5CWSB 5K9JH 2ZOKB 3G6AB 4OKVA 4XP6L 1NPUA 3EO1B 3IDUA 3ARGB 1CBVL 4O9HH 1LMKA 4NQDD 4JFEB 3FCTB 4ENEC 3NPSC 2VL5A 1A21A 2OL3H 5ID0A 4X9BA 3P4NA 4K3HA 4P5MB 4KI5C 4NKOB 4UQ2A 5I1KL 4G6KH 3C5JB 2XFXB 4PJGA 4U1JA 2FECL 3EOTH 3AXLA 3HMWH 2IWGA 2PW1B 3TNNA 4KJYA 3HUJA 5F7WC 1HHKA 1UWGH 4HSQA 2ID5A 3MV8B 2ZSVB 4PTTA 2ICEB 3UJTH 4HIIA 4CVZB 4HKBB 4CNIB 3THML 2FL5A 3UMTA 3JUYA 5DK2A 2AJVH 4L9DA 2E9BA 3K1DA 3SE9L 5K9KB 2IPUK 1UYWH 2QEJA 1N26A 4DEPC 1JZ7A 2ADJA 1SJXA 3R0NA 4QXUH 3RGVD 3GSOB 4ZAKD 3TZVC 4QXTA 1CCZA 4MQTB 3RDTB 3UZEA 2GCYA 4OGXL 4YNYA 1Z9SA 1A9BA 3BHBB 3S5LG 4BYHA 2BSRA 1G9EA 2H2SD 1EXUB 4XXCC 4OD3H 3BPCA 5L0QB 1RIHL 5DMKA 1JNHB 1NL0L 4B0MM 4NQUA 4PJDA 3MXWH 4IHOA 1BMGA 3G6DH 1CD1B 2V7HA 5EWIL 3RWIA 1IBGL 1A7QL 3TYFB 1U3HB 1LDSA 2A6JA 3VFNB 4F7PB 1MCQA 4JFYA 3RAJL 1OGAB 1YJDH 3QPXH 1LD9B 3MGTB 4W81A 5F7LB 3VFTA 4NCC1 3QI9C 4HT1H 2NXYC 1UVQB 4ODVH 1VADA 1JGUL 4WV1A 3PWNB 4JRYA 4QRRB 3NZHH 5H35B 2UYLA 4PB0H 4KUCD 3KJ6L 4D3CH 5I2IA 5GRUL 3H9ZA 4Z7UA 5IIEA 1FDLL 1NFDF 2DQCH 3O8XD 2AV7A 3C6LA 3W2DH 2R1WB 3BEVA 1AQKH 4MA1B 5IB2A 2HFGH 5KOMC 1ZLUH 5IROC 4MDIB 1G7HB 2CGRH 1KENL 5GGSY 1N4XH 1A1OB 2OJEB 2WINA 5I0DA 1IEBA 3BJ91 4XPBH 5FYJD 5FM5M 3BGMA 5SX4I 4M8QA 1CL7I 1LP9E 4HJJL 3IJSB 1OT1A 4YHOH 2XWJB 4X4XA 4OZHA 1MFDH 2AQ2A 4PBWD 3W0WA 3GRWA 1IM9D 3O3AB 4YHKH 5CBEB 3CX5J 3W82A 2AV1A 2DJSA 3KAAA 3WIHA 5C09E 4CADB 5JIIA 1U9KA 4FQCH 3UTTB 2GITB 2FB4H 3T2OA 3S34H 1AO7A 2AS5M 1JPFA 1U8LA 3GHEH 5IOPB 3L3JA 4OZIE 4G8FA 4OZGE 2X1OA 1MEXH 1JPTL 1CE1L 1RJLA 4IMLB 3SDDA 4S1DC 1DQDL 5TDOA 5ADOH 3FFDA 1UB6B 2FYYB 3BFOA 3RIFK 1UT9A 4PJ5E 3HPLA 1YNTB 3NAAH 4LVHB 4TSCH 3VI4F 2VITB 5T1LA 2Q1EA 4L4VB 4HX1A 1V3JA 4XNZB 1WISA 3OKDA 1DL7H 5JO5A 3IKCA 4XNXH 1G7IB 1QFWH 4RDQF 5FYLL 2Y1VA 4KJQD 2ATKB 2AI0L 5I74B 2GJ6E 3C6LD 1JN6A 2PW2A 4NKMB 4KQ3H 4L4TA 1OAUH 3RU8H 1Y6NR 4JY5H 3TBWB 5KS9E 1R5VB 3CMGA 3ES6A 2PF6A 4Z0BL 5J13C 3ULUD 4R3SB 4NUGH 1S7VA 3GNML 1D5XB 3MJGX 3T2NH 1OCWH 1BF2A 5L88L 1FFOA 4DGIH 2MTPA 4GKNB 2AEPL 3HPJB 4MNQD 1XGRA 4JCLA 3HC0B 4MZ2A 1G9NH 5C0RH 4F33A 3DMMB 1J87A 3KG5A 4JY6B 4WCYH 1T0NA 4CL7A 4KY1L 4X0KB 5EBLB 3U6RA 2Y5TB 3O9WC 3G04B 3NOIA 3TH2T 3VXUD 3H9SD 1UCBL 4RAHA 4LLVB 5D2NB 2O93L 3NCFB 3EYVB 3SKMB 1NAMA 5CD3A 3AS3A 1XEDA 2ICWJ 3AU1A 1AHWB 3V6ZA 1B9ZA 4IJ3C 3DUUA 3HCVB 2VLKD 5GGUB 1UM5L 2WSKA 4N90E 1DLHB 1AFVL 4WFGE 3WHXB 4KI1A 4TSBH 1JVKA 5LBSH 2HLAB 2NY1D 4KDVA 2V7NA 5IBUB 3TIDB 3WFDL 1CDUA 2HLFD 3IGAB 5L9DH 2APXA 4QCIA 3VDAA 2V2WB 3VXOA 1OGTA 3C8KB 1OSPL 1Q9WA 2IAMB 2VIRB 5BZDB 3TJEH 5C0BB 1C16A 2XNAA 1PG7H 1MJ8H 2CRZA 1MHPL 1S7TB 4PRAB 3QHZH 3LRSB 2UUDH 1OSZA 1RZ7H 3QDAA 4FXGA 4M5ZH 4U3HA 2EH7H 1QA9B 4HF5H 1TJIL 2IQAB 4YDIL 1JIBA 2A0LD 1QVOB 3OKNB 4DKFL 2GY7B 4UDTB 5F44A 3GKWH 2Z35A 3E0GA 3HZKA 1U8NB 1MPAL 2BOCB 4PJFB 4AENA 4TTGA 2X7LA 1MNUL 3ARGD 4OI9A 4X9GA 3QAZC 3RA7H 4JFED 4ONOA 5J56B 1Z5LA 3RPIB 4YHZL 1CXHA 4HKXB 5GS2D 1C5CH 5HI4D 1Q9KA 4JM2A 4YR6A 3CC5A 4HIHB 4Y2DB 3DURA 1FVCB 3MGOA 1DQMH 2YD1A 3MV8D 2J6EH 3RFZC 5DQ9A 4JB9L 3BVNB 2ZKHH 2XKUA 4M7KL 4C56A 5IESH 1WIOA 2IFGA 2ESVB 2OR9L 1MCWW 3VRIB 1I1FA 5K59F 4UIMA 2GSIA 3H9HA 3O2DH 5HDBF 3IU4H 4NO0A 3M17B 1QR1B 4YDVB 5DDHB 3QYCA 4KKLC 4B5EA 1RZIA 4JRXB 4U1SA 1FBIL 2F8XC 1JUFB 5C08E 1F5WA 5TDNA 1KEMH 2Q7YA 2FJFA 1IGCL 4BM7A 2PYEA 2NY7L 2N7BA 2LAAA 3O6LL 3PIQB 3FB5A 1K3IA 1QEWA 4JR9H 3B2UC 2ZUVA 4K71B 1GJIA 3FT3B 1T6VN 2H9GA 5TFSL 4OIAA 1KJVA 1NMCC 1MAKA 3MV7B 2F8VA 5BXFB 3NIFF 2FWOA 3KPMA 4Y5XB 3SE3A 3WFCL 3MLTB 2R23A 5C86A 5F9JA 2DKUA 3TCLB 1IGJB 1DTUA 5DJ6A 5BV7H 1OGAD 3VFSB 4G6JL 5EC2A 3C09B 3S4SA 5DVOA 3VXMA 1RUAL 1UKTA 4QRRD 4KU1A 5B22A 1YEEH 1WV7T 3EJZC 1MCNA 3HKFA 2JB6B 3P4OB 2CXGA 4OQTL 5D7JA 5IWLA 4N0YL 4OLXH 1UENA 2DD8L 2QQLH 1Q1JH 4WI2A 3BAEL 1NBZA 2CIKB 3JV6A 1NCBL 4ZFOL 1T20A 5K9JL 4FQ2H 3RX8A 1J05B 5C9JB 3UC0H 2H8PA 3RZCC 3L3HA 3UCRA 5F1KC 4O9HL 4U7MA 5ECJE 3BQUC 2J7LA 4JREB 4J3OC 3T4AA 5ACZB 3FB7A 1JGLH 2D9CA 4KK5D 3VXRE 4KVNL 1BJ1H 3HMWL 5EIQA 5F3BB 4PP2B 4M1GH 3EHBC 4NSKB 1KCUH 5E8PB 3G5XB 2IQ9H 1X3DA 3HAEA 3KPSA 4N68A 3UJTL 3UTTD 1KXTB 2OTPA 1U8IB 3D48R 2L0DA 2FJGB 3L7EB 3DGGB 2BHUA 3VDBA 4XAKE 1H3XA 1T3FA 4PJCB 1ND0A 1UYWL 2DLTA 5I1CL 2CDEA 5T3XH 1RJYB 5JPMB 5C07E 4IS6A 3RWDA 2X4SA 4QXUL 2DJ4A 2X4NB 3CZFA 1UXWB 3NIDF 4HS3A 1HZHH 3VXMD 4Y4HC 3BUYA 2DKMA 3OHXA 5HTSA 5EU4B 4L4VD 1FVEA 4HQQH 1PZ5A 5D7JD 4HFUH 1OTTC 4WHTA 3DXAB 2YA2A 4PRPA 3UAJD 2R0WH 4OD3L 4U1HB 3EYQC 3P9MA 4HD9A 1DQQA 1ZHNA 4YK4B 4P2QE 4RQQA 2H45A 4KJPC 4Q6YA 1ZK9A 3DSFH 5D96C 1AXTL 4XPGL 5DJAA 2OS7A 3ZKNC 2BNQA 1JJUA 4Q7DA 2HYMA 3G6DL 2B5IC 2VQTA 1AKJB 4NHUA 1NBYA 3MRHB 2QR0B 1A1MB 2F53E 1N0XH 4X6DF 3DI3B 1KEGH 3UBXA 3QPXL 4RRPG 4APQA 4HT1L 5KSBE 3CUPB 1WZKA 5DZLA 4ODVL 4ZUVA 3DMMD 1ZXQA 1JHTA 2MWCA 1JV5B 4UU9A 1WC7B 3D2UA 4UNTA 4MJ6A 4PB0L 1W0WB 3RUGB 4D3CL 4P57A 2CLZA 2P8MB 4DOHB 2HT3D 3QBTB 1LVEA 3MBEA 2P7TB 4KKNA 2DQCL 1N2RB 3VWKA 3BWAB 5CLWA 1G9NC 3NABH 1DBBL 1D5ZA 3RY4A 4NBXB 1AQKL 3GSRB 3BZEA 2HFGL 3LN9A 1Z0NA 3CSPA 2C1OB 2CGRL 4YLQT 2AXFA 2I9TA 4XPBL 3BO8A 1IAIH 3L9RA 4WHYG 1H3GA 4PJFF 4PP1D 5EUOE 5BW7C 2X4RA 2JJSC 4YHOL 4O51A 5EOQH 5C0BD 4N9GA 3UPRB 1MFDL 2XPGB 3MLWH 4PRPD 1JRHI 4MX7B 5I75C 1PFCA 2R4RH 2AEWA 2MHAB 2BJMH 3FN0H 4LLDB 4YHKL 2NY2B 1MI5E 4JVPA 1WIUA 2Z31C 4J3TA 4HUVA 1DANT 4K3JH 4KHTL 4FQCL 1S5HA 3FFCB 1F4AA 1I8IA 2FB4L 4N0RA 4NN7C 4HAFA 1N5YH 3FO2B 3MRNA 3X12B 3HG1B 3GHEL 3WL9B 2C3VA 2F58H 1MEXL 3QUZC 2J12B 1U3YA 4JLRA 5B3JE 3VFVA 5E5MB 5HHOE 3T3MF 3FQTB 5DVMA 3IAGC 4TSCL 5KOVC 4UI2A 3D85A 3D2UD 1PLGL 1B3JA 1Q72L 5EB9A 1S3KL 2DQJH 4PD4J 1IARB 4TNWK 4Y2DD 5E2JA 3LHPL 4OF8A 4HFWA 1FNGA 3KPLA 5SX4H 1DL7L 4M9OA 4GW5B 4XNXL 2EECA 3GIVA 1OTSC 3VWKD 2VE6B 4JFFE 1K2DB 2A6KA 2YD6A 4WJ5A 3FAXA 4F9LA 2DQTH 4KQ3L 2UY6A 4XGZA 3RU8L 4JY5L 3LIZL 3VFMA 4QRUB 1MCFA 2ESVD 4NUGL 4JO4H 3TPUA 2NW2A 4I4WB 3T2NL 5BQ7A 1OCWL 3ZE0E 5M7QA 3V0VB 4OLYH 4DGIL 5ICXA 5IFJA 1G9NL 5ANMB 1CQKA 4F57H 3OXSB 4JRXD 3T1FB 1P1ZB 3VXQA 4NZUH 3SGJC 2DLFL 4F15B 4WCYL 3CFIC 2FJHB 4X9FA 4OBSA 2HFEB 3LEXB 5DS8B 4UNVA 1S7UA 4KDWA 1HSAA 2XN9A 4GFTB 5E5UB 4S0SD 1ZGLB 2LFGA 4HKJA 3IF1B 4HMCA 1EO8L 2G75B 4XP5H 2P43B 4I2XA 5EO1B 4Q9QH 3V7MA 4U1GB 3PP3H 4IOFD 1FZKB 4RISL 3LB6C 1KJ2H 2IJ0C 4LGSB 4X98B 1YMMA 4XNMB 4TSBL 1QRNE 5LBSL 3X13B 1MCHA 1HYSD 3D69B 4I18A 2Q86A 1WWCA 2KDGA 4PLKC 3ZMRA 5CJ5A 1LE5B 5IVXF 3SCMB 3WLBA 5L9DL 1RJZA 4K7FA 1KB5B 1NGYB 3O0RH 5MERB 3D85D 1KCSH 4QRQB 2OMNA 1ITCA 3TJEL 1FYTE 5FO9A 5HGAA 1PG7L 5MEOB 1NEZA 1JBJA 4NRXB 4NRYA 1OL0A 4ZFGH 1RZ7L 4HHAA 2V5MA 4FQJH 2EH7L 4HF5L 3P11H 4IRSB 1I85C 4MNGA 4ZSOA 2FRGP 1RZ8B 4RGNB 5D6DA 3B8SA 4GH7B 3O3BA 1KPVA 1UJ3A 3GKWL 5ICZB 4ODTH 5F21B 3C5ZB 4HC1A 1J1XH 1K5NA 3QUXB 4K94H 4AG4H 4LARH 4K3EH 4PY7A 2DIJA 4UMGA 3RA7L 3LKRB 5JQHC 1EFXA 4HIEA 4MXVE 1PZUB 3MV01 2Q20A 4LAQH 3U48A 5IVZA 2R1YA 1J1PH 1C5CL 2F5AH 3UTPD 5L2JA 3T2PA 3C8DA 4HGWA 4XNYH 5FYJH 1A6PA 3NMEA 3FO9A 1LDPH 1CDHA 4U0RC 3D39B 2VMFA 2AP2A 4QOKE 1I9EA 2EKSA 4X99A 4U6VH 2X09A 4Y4KA 3CSYB 1HCFX 3MRLB 3IS0X 5FA4B 1SEBA 3GJFA 3TT3L 3HR5B 2VQ1A 1Z9LA 2QHRH 2RFXB 5DK0B 3QT2A 1MCCA 2Q76A 2PTTB 2ZKHL 1BOYA 2AABH 1XIWB 5IESL 4LL9A 1C5BH 2ORBH 1MCJA 1L9MA 3ARYA 3O2DL 3QQNA 4PLOB 2QHLA 4NM4H 4FMKA 3IU4L 3K1KC 5JTWA 3K4AA 4GSDL 4HWEH 4UV4H 4AH2B 1S8DB 2HJFB 3O6FC 3UYPA 3O45B 2X4PB 3OKEA 5F1NA 4NUJB 3WNMA 2BC4B 4QY8A 1KEML 4OQ1A 5D2LA 4TTDC 1XF5A 3DROA 4XPFL 4BZYA 3DXAD 1T22B 5ABDE 4FQXB 3SY0B 2VDQH 4JR9L 1TZGH 2F54B 1K4CB 4P46C 4WGWB 5INCA 3VRJA 3ESVF 1AY1H 4ODXB 3AS0A 4C83A 4X5WB 1QRKA 3NGBB 4WI3A 1HEZB 3RUGF 3QA3B 5B39B 4JQXA 3FRPG 3VH8A 1VCAA 1BIHA 3AREB 3QEUA 1EFXD 1LO0H 5BZWB 3ULUH 2WBKA 1BQLL 4BFIB 1T1YA 1NCNA 4F7EB 4P2OC 3VD7A 3WJLA 5E00B 1FFRA 5SV4A 5EBWA 5T33H 4XVJL 2CKBB 1DBJL 4JHAH 1NFDE 4M93C 5I1AB 4L8SB 1LEKB 1J7VR 3GRWH 2VR9A 4RAVA 4X8XA 4OLXL 1YPZA 1JWSB 5C0AA 5K9OA 4MD5B 1PKQB 3HI1B 4QNPF 2QQLL 1Q1JL 3PDGA 3QIUC 4J6RH 2EDFA 1KN2H 5IHUH 1XF4B 4QRSA 2W38A 1VB9A 1TVBA 2AK4E 2J8UB 1EMTH 2X10A 4OT1L 3UC0L 1X5KA 4C4KO 4M00A 4RFNB 1GAFH 1GSMA 3VA6A 2ZSWA 3F7RA 4OIIL 4LLUA 3CDGB 5C92A 2BCKB 3ZLQC 1GZPB 2D7MA 4OZFA 3WBDA 1JGLL 1B4JH 1G7QB 3IXTA 1MHHB 5EUKA 5M94B 4FN0A 3DX6A 1NSNH 2IQ9L 3N85H 4Q0XH 4DZBA 2NY2D 3MLXH 4CMMB 4L3EA 3KPPA 5J8OA 4PJBA 4ZS7H 1EEYA 1WBZB 3I50H 4QHLA 1YYLL 4G9DB 1KULA 3HZMA 1H3PH 3QIBB 4NPYB 4UT7L 5KSAB 3GK8H 3HG1D 3NFPA 5T3XL 2XZQH 3VDCA 3AY4A 3MJ8B 4NQVB 1W0VA 1NDMB 2APFA 5DGRA 3VI4E 3ZSSA 4QF1A 3RWHA 3VGAC 3BPOB 5CEZD 3T1WA 1A6ZB 1IKFH 5F9WC 1HZHL 1XCQB 5IBLC 4XHJC 4Y5VA 4X6BA 5GS2H 4Y19E 3OKMA 4HQQL 4HFUL 4L8BB 1DP0A 1EZVX 3C6SB 2R0WL 5C0AD 2IADB 4Z5RB 4H26B 3QXAA 4LVNB 2XA8H 4G42B 2Z9TA 5DJXA 3BH8B 4F80A 1NAMH 1HSBB 3D1MC 2E9JA 5SWQA 1UJTA 3UTQA 5GGTA 4CBPA 2FSEA 3DVGB 1T83C 1V7MH 3D18B 2GAZA 4R4BB 1N0XL 2VWEE 1A2YB 1KEGL 4JFYB 3GMQA 1U58B 3PXJA 5I8OH 3QHFH 5I73B 1I9JH 1VADB 4X6CF 5I8EB 1G0DA 1IEAB 2RBLA 4H20H 4NQSA 2X1PA 3GKZA 4TPRH 3A6OA 1IC4H 1AGDA 3S37X 1SQ2N 1RURH 4KK6D 3IETB 3TP4A 3L7FA 3R4DA 3RHWK 2BNUB 3RGVC 4DKEH 1UCTA 4ZAKC 5DVLA 4L5FL 2EYRB 4LLMA 4Y1AA 3W39A 2EYSB 4ELMF 5BS0B 4NQEE 5LKNA 4WEBH 4S0TD 5I17B 1GGTA 3QWQB 1XF2B 1KT2B 4HG4J 4R2GB 1S7WA 4ZDHB 3SCMD 3EDEA 5J3HC 3BDYH 1IAIL 3GMPA 3SE4A 3GBLA 2CLRA 3LH2H 4BFGA 3QDMA 5EOQL 1H5BB 4LSRH 3MLWL 2DMKA 1QBMH 4NJ9H 1BD2B 1CFTA 2KPNA 3NFSH 2R4RL 4KHXH 5D7LB 4ORZC 2BJML 4LHUG 3P77A 2W60A 3PWVB 4XXDA 4F7TA 4IRSD 5F1SA 3KYMB 4K3JL 5ICYA 4F8TA 4KKBD 4RGND 3MA7A 3MODH 4YDLB 1N5YL 4L8CA 5E2TH 3CXDH 3QFJB 4TN9A 3SN6N 2CRIA 1I3RB 3QUXD 4LKXA 5CS7A 3WS3A 1OHQA 4G8GA 1UQSA 2YN3A 3MMEA 5H8DA 3QHTC 5FYKU 2G60H 1GOGA 4H1LB 1KSRA 1FL5B 5FEBA 3PGCA 2ENSA 5I66A 2YK1H 1TZIA 1WEJH 3O8XC 3D39D 3HZYA 3ETBF 2Y72A 3QDGE 3QRFM 2CIIA 1RUML 3P30H 4EN3B 3C08H 1CL7L 2BNRA 2ZUYA 3G6JA 4GW4A 4OFKA 5C0FB 1DSFH 1AI1H 3QNYA 5K59E 5E70A 5HDBE 3EYFB 1A0QH 1UXSA 3DX7A 1CDIA 1T21B 4CW1A 1XIWD 4PGEB 3W9DB 2C3HA 3EFDH 4JO4L 5C0IB 3ZHLA 1U8OA 4KC3B 3B9EA 2J5LB 5I16B 2HT2D 4OCYL 4OLYL 4PGBB 3Q5YA 1PQZB 1ZT1A 1OLLA 5TDPA 4H8WC 4U6YA 3WHE0 3TN0A 5DD6A 4F57L 3SDXB 3X11A 5L6YH 1QSEB 4HCRA 1P84K 3ILPA 1I8LC 3QDJA 5DO2C 5T1MA 4XPAL 4FQXD 4PJIA 5HVFB 1M05A 3NIFE 5GRVK 5E6IB 2F54D 3LV3B 4PRIB 4V2CB 4J3WA 4DCQA 1DBAH 4Q9QL 3OKKA 3MRPB 4DZ8A 2JLLA 1LO2H 3QFDA 5JW4M 2DQGH 3ARED 4JDZA 4G8GD 4CJ1A 5IB5A 4PG2C 3U36B 4E0RB 1U93B 2I24N 2EYTA 4WUKL 5I1LA 2OQJB 3O0RL 3UDWA 2J8UF 3ZYOA 4NNXB 1WT5A 5HHQB 1VFAA 4KJQC 3RVXD 2E9WA 3CCHB 4PYGA 5JDSA 1MAJA 5IKCB 5FKPB 5CILL 2CDFA 1ZSDB 2AJXH 4ZFGL 2G9HB 1EIBA 4KRNA 2WBJC 4X6FB 2BRQA 4FQJL 4J2XA 5ETUB 5EO0A 3VGEA 3ULUC 4GT7A 4MGXA 4U1IB 3KPNB 3HRZB 3K81A 4PJGF 5F9AC 5F3HB 5DMGC 3H7BA 1T6WA 4FHBD 1OP5K 2UVEA 2DI7A 4IEFB 4J4PD 1BBJA 4ODTL 4R96A 3UEZA 3HUJF 2ED8A 1J1XL 4LCCC 4KKCD 1H15B 4K94L 3W5MA 4LARL 4K3EL 5F1OB 3G5YA 5F89A 3IDMA 1D5IH 2HG5A 3S98A 4LAQL 1SJHB 1HKFA 2F5AL 3RWGA 5D1QB 1KIPA 2FH8A 3QCTH 4LHJB 5I9QB 5FYJL 4NFBA 3QDJD 4I9WE 1LDPL 3P9LB 3P73A 4GAFB 2D2OA 3OG4B 1N8ZA 3PQYE 3GMOA 3MOAL 5D7IB 3RTQD 1JPGB 1J0HA 1MCBA 5D7KD 3MCLH 4Q2ZA 1A5FL 4H8WL 3ARVA 1SEQH 2Q8AH 4QRTB 1MWAA 1T5WA 1CYGA 1R3JB 2QHRL 3WJJC 1ZANH 3QIBD 4YWGH 1FH5H 2AABL 1S7XB 3O4OC 1C5BL 1OVZA 1P7KA 2ORBL 2NTFB 3V2AR 5HYJB 1I4FA 2IANB 5FGCE 3LZFH 3TCXA 3K2UH 3ULVD 5DRZB 3WN5A 3PHOB 4CJ0A 1CLYH 2EO9A 5A2JH 4PJDF 4NM4L 1YY9C 4D8PB 2UZIL 3I3BA 25C8L 32C2B 5IHZA 4PV9B 4WUUE 3BT2H 1QFWM 4RCAA 3ZL4H 1XGQA 4BH7A 4JHWH 3LAFA 1YEDA 3VD4A 1KIQB 3QB7C 1M1SA 5CKGA 4WWKC 5GS1A 1GOHA 4QRPE 1QO3B 1BOGA 1CK0H 1MELA 3MREB 4DQOH 5CJ8A 3LS4H 4BQ9A 1QEWB 1V5JA 1TZGL 4GRLA 1VKXA 1V7NH 1XGUA 3ARGC 5D2NE 1AY1L 2VLJB 1CGTA 2FBOJ 3GGWB 2EIBA 2Y5EA 1AIFA 1Y0LA 2DQHH 1D9KA 4X6DE 3KDMA 5CMAB 4RAUA 5D8JH 5D6CB 2DQUH 4RMRA 5CZXD 1BVLA 5CBAA 1FO0B 1G7MB 2B1AH 1DVFA 2J3SA 3WKMH 4WU7B 3ULUL 3T8XB 2QQKH 1A8JH 3BKMH 4BQ6A 4R4ND 5L7XH 1F2QA 2P5EB 4W68A 4BSWA 5T33L 1CICA 5EFIA 4OCRH 1BF8A 4JHAL 4LCWB 2R29H 2Z91A 4NDMA 3W11D 1UB5B 3EYUH 4J3XA 1XMWA 3GRWL 1XH3A 3P9WB 2A1WH 5D1XC 1JGEA 4LHQB 3F7QA 5C0JA 4RNRB 4FQHA 3OZ9H 4J6RL 3DUSA 1RHHB 4D9QD 2J88H 3LD8B 1ZHLA 2HFFA 1KTDB 1EMTL 3RDTC 1OP3K 5IB1A 5EIIA 1GAFL 4Q9RH 3LEVH 4PREB 1HOCB 5DHXB 4R2GD 3DX8A 3HC4L 4PJXB 4IRJB 3S8WA 3VCLA 3F7VB 4JFZH 1B4JL 3GDBA 1BD2D 4M6MH 4L3AA 5D7LD 5LGKA 1FV1A 1NSNL 3N85L 4JM4H 3V5DB 3MLXL 3N9GH 1U3HC 4ZS7L 4ZNEA 2FZ3A 5FGRA 3WFHA 1ZLSL 5JW4R 2BXYA 4XBPA 4N1EA 1KYOJ 2D7TH 3M8OL 4NGHL 4LASH 3QFJD 3PJSB 3T3ME 3GK8L 1K4DA 5DA0B 2AKRB 3C9NA 2VUYA 2XA3A 3DV4B 2NY5C 1ZHBA 1MJUL 2CJUH 1J0KA 2XZQL 4J3UA 3WIFB 1FAIH 1D6EB 2A77L 4X8JB 3WHE1 4L4JA 3S96B 3QWRD 1CXKA 1ITBB 3HLAB 3CFEB 1AD0A 1CICD 5IGXH 2FNBA 2OR7A 4MSWA 1DN0A 5IJVB 6FABL 4ZO9A 5DC9B 5DSCB 2Y36H 4S1QH 1QTYT 2B20A 1UA6H 1T1XA 4EN3D 1J0JA 3P9MB 5J06A 3SDXF 4L9LB 1E4KC 2P5WA 3OPZH 2FEEL 35C8L 4RQQB 2XA8L 4GXUN 2XV6B 3CH8A 4XZUB 5BOZG 3MV7E 1RZGA 4B41A 4KUZH 5ELIA 3U0PA 1YDPB 1J12A 3ALWA 2B0SL 5JXEA 2BDNL 4KK5C 4U1MA 4HWNA 4M3KB 4YXLH 4TVSa 5I8OL 2Y6SD 4YBQD 1IKNA 3OGCA 1JHTB 4N0UA 5IMLA 1F3JB 1QSED 1GGCH 4TPRL 1IC4L 2R2HB 4NCC2 1RURL 2J8HA 1X9QA 2AJYH 1TQBB 2AJ3B 2DQIH 2M1KA 2VLMD 4M7JL 4EDXA 5E6ID 3IYLW 3VFGH 5KN5A 7FABH 4PRID 4ZS6C 1QNZH 3KVQA 1P9MA 3DHMA 1KCKA 1N64L 4U49A 5IVXE 3RY6C 3QIWA 5ADPH 4YIQA 5DZNA 2NMSA 2WZPD 5HXMA 4WEBL 2C1PB 4LLWB 1KCRH 4PTUB 3G08A 4NFCA 4XNZC 3P0YH 4HAGA 3UAJC 2K1MA 3LH2L 1UWXH 3FOMB 1EBAA 3HNSH 3BP6B 5I74C 3ZDZF 2NY6D 4LSRL 5F7YC 3DBXB 5EOCJ 2V2XA 4NJ9L 1U0QA 3NFSL 3WUWB 2Y23A 4X7TA 2GSGA 5I8CA 4G9FE 5T3ZE 3VXNB 3LN4A 3EFFB 5AG8A 4LSVH 2OJZH 3I3DA 1KPRA 4P4KB 3FRUB 3D3VB 3MODL 4PGCB 3U7WH 5E2TL 3CXDL 5D7IF 2KBGA 3F65A 4P2YA 3MFFA 4O5LH 4EOWH 4J3SA 3DMMC 5DJDB 4HG4K 2BP3A 2XWBA 3QNXB 3OAZK 1YN6A 1R5IB 3QUKB 1ORSB 5KSVB 5EU7C 2G60L 4X80H 2R0KH