4JDVA

Crystal structure of germ-line precursor of nih45-46 fab
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
231
structure length
227
Chain Sequence
VQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGKYCTARDYYNWDFQHWGQGTLVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab heavy chain
publication title Structural basis for HIV-1 gp120 recognition by a germ-line version of a broadly neutralizing antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 227
sequence length 231
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jdvA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jdvA01
4ETQB 2YA0A 1IAMA 1MAKA 3Q5TA 4MNQA 2GCYB 4GH7B 5T3ZL 1OPGL 1ZS8B 2VDQL 3RX5A 4LBEB 3ULUH 2V17H 3WD5H 3RGVD 1IGFL 5E2UL 4Y4KC 3TA3A 4HKJB 5TQ2L 2W91A 3GMRA 2A6IB 2IAMD 5F9WC 4J12A 2F53D 4X5XA 4DCQB 3TH3T 5DVLA 4B7IA 4LEOB 4JDVB 4JGJA 3RY5A 4Z77A 2CQVA 5LKNA 1N6QH 4PGDA 2D7TL 1P9MC 3G5ZA 2ICWB 4OLZL 4PS4H 3QQ9D 4JJ5A 2ORBH 4BFIA 5DEFB 1I3GL 1I9IH 4JY6B 4BZ1L 5FECA 4IRJC 3ZHKA 2AKRB 1EK3A 1ZSDA 3WUWB 4IRJA 3WLBA 4PJXA 2NY1C 2FSEA 4JFDE 4R96A 4U0QB 1DQML 3RJDA 1J0IA 4NO0D 5EBWA 1UJ3C 3MO1B 2MMXA 1UJ3A 1OAXL 1LE5A 2P44B 3B43A 5J13B 3S7GA 5D1ZB 5EBGA 2O5ZL 4LSDA 4M8VA 1FZMB 4XNXL 4RBPH 2NLJA 1FSKC 2C1OB 4GSDL 4XPBL 3BDBA 1CLYL 4HH8A 3UPAA 5CFHA 3ROLA 1N5AA 2NY0C 3MOAL 4YBQD 2O93L 3OQ3B 5KSVB 3RL1B 1OB1B 3QUMH 5D6CB 1CDIA 3DV6B 5F8QC 3FCTA 4N8PA 5IQ7L 3HHRB 4WW1A 1CU4L 1A4KB 4L8SC 1T04B 4LVHC 1I1AA 1NUNB 4OLWL 4L8SA 2C7UB 1CCZA 2ZZUT 3SKMB 1GZPB 1KCKA 4HUXB 5IHUL 1BBDH 2V9TA 3NZHL 4HX1A 3ULSB 1WBZA 3JWOL 3FAWA 4OBSA 5C09E 1E6OL 1HDMB 4X98A 1P84K 2W38A 2VJXA 1E4XI 4KRNA 4MXQD 4LSUL 3VXPA 3MRRB 3FQXA 2GHWB 4JFDA 4ZNCD 3U9UB 1CG9B 1RUKL 1NFDB 5BW7C 1G7MB 2VUYA 5FA3A 5BW7A 4DN3L 4EVNB 3HZVB 5T3ZD 3HZKB 3VI3F 4OZIF 4ZQKA 3MBXL 5GZOD 5DSCA 3D85B 4MA1C 5HHXL 3K3QA 3RWJA 2G5RA 1NAKL 5MENE 4N0CC 5C0DA 2YKLL 5JUEL 4GT7A 2H26A 4WUUA 3VGDA 4EQ3A 2AJVL 3G5YB 3Q5OA 2GI7A 3OF6D 2EIZB 3LKRA 1X5HA 3I75B 5C0EA 2B4CC 1G9ML 1FYTD 3SKJL 4OF7A 1EEQA 1OP5K 1QVOB 3T0XA 4X7TB 1EHXA 1FRGH 3Q5YA 2MQ0A 1UWGH 5LXGH 1AGBB 1T6WA 4K3JL 2ZSVB 5IHBA 5C09A 1HSAA 2D0FA 4RFOH 4RGNB 2ERJC 5TF1H 4JN2B 1H3PL 1JF1A 2NTFA 1A6VL 4X6FA 1KPRB 5GGRB 4LQ1A 2DLEA 2VAAA 1PGRB 1CQYA 5T1KB 2R2HA 1N64H 5DJ8B 2EECA 4XVUC 4J3VA 1JGVH 5KAQF 1F45A 4QRPE 5IT2L 1H8SA 1GGIH 3QWRD 3U2SB 2HA1A 5MENA 1KCSH 2YXMA 4UAOC 2FO4B 3O4LB 4PUBH 5I1AB 2FO1A 4Y1AD 3RNQA 2CGRH 4TUKL 1F8TH 5BVJA 4XI5D 1RZ8A 5MERB 1KNOB 1CDYA 1JMZA 2AXHA 3MJ6A 3BVNA 3DNKA 4I77L 3BKCL 4TSCL 4KDTC 5IB3A 1WGOA 3NIDF 3LRGA 1G9NL 3U0PB 3FQUB 4ZS7L 1A14L 4MMZC 3L3DB 1RJLB 4NOBA 1TNMA 5FYJH 4B5EA 1WSST 4GKOA 4GKSA 1KENH 5FCUL 5JW4N 4OF0A 2OLDA 3SDYH 1NJ9B 1WZ1H 1CE6A 4L1HA 4PP2B 4KK8C 4M8QB 3HR6A 3BPNC 1PJ9A 3BIAX 3B5GA 4WWID 5KJRH 3DOSA 4KDWA 4ALAH 4HKXB 4NGHL 5DRWB 3TJHD 3HG1B 1T2XA 2HN7B 3DRQB 4JVUA 5CBEA 4PRID 3O3AB 5I1DA 1QBLH 3VGEA 5IW6B 3CFDB 2CPCA 1EHLH 4QRPA 3VWKB 3B8SA 3GUTA 5JHLH 4LASH 3FFDA 1XF3B 2E7HA 5H37H 4X7EC 3V5DA 4WJ5A 1UGNA 2AQ2A 2Q86A 4TSBH 1BVKA 4HT1L 3FN0H 4XP9L 2BSTB 2BDNL 3CJJA 2R8SL 3UZEA 2AJ3B 2BVPA 4UNUA 1VKXA 4A6YA 4KRLB 1NANH 3MLPA 3AB0C 4ETQA 1NC4D 4UNTA 5FOBB 2UZYB 3C9NA 4IMLB 4P57B 5FK9A 3HS0B 3UTQB 4KTDH 4LBEA 1RV6X 3H9HB 4UV7H 5HHVL 2ZPKL 5F7DB 1JYXA 3T4AB 3DGGA 5JQ6H 4HKJA 3CVHB 2YRLA 1JPGB 1K2DA 4NQEE 3NTCH 4GBXB 3MLVL 4DCQA 1OAKH 1G7LA 3LEYH 1WBXB 4OCLC 3MX0A 1R0AH 3Q2CA 1EO5A 3DV4B 2ICWA 2YD9A 4QXUL 3FO0L 3IJYB 1ZA3A 3MLUL 2X1QA 3F8UB 5SWSD 4LKXB 2AKRA 2XZQH 4JDTL 4F9LC 3OKKA 3WUWA 3R06B 3F12B 1NBYB 4F9LA 2RJMA 4XCNA 3IRPX 3T2OA 1NFDE 3MFGB 3MO1A 1XGUB 4K71B 4RMVA 2A83B 5J13C 2GSGB 4W70A 1T0MB 5DO2D 4NJ9L 5D1ZC 1ZLSH 1MFAL 5GGQH 4LGRB 4UBDC 1NBZB 4PJ7B 5D1ZA 3D87B 3EYUH 4LHQB 1X5JA 5FYLL 4HFUL 5TE6L 2C1OA 3KPOA 4XNZB 4EZMA 3MA9L 4B53A 1G6RL 4KUCF 4OZFB 2K1MA 4PJGF 2PYED 5KSVA 4XP4L 3RL1A 3QFJE 4N8CH 4YDVA 2AGJL 1NGYA 5I1HL 3DV6A 4HBCH 5FHBL 4JRYB 4LK4A 4ZD3L 2F5AL 5GPRA 1ORQB 1T04A 2BY0A 1EIBA 5D2LB 2IJ0C 4UILH 1FLRL 1YYML 3BSZL 4NQEA 4XP1H 2VDPL 3QXAA 4IDLA 1GZPA 3P9WB 1A7QL 3DO3A 3VGAB 1NAMB 1ZK9A 4F8TA 5J56B 4U1JA 1RHHB 2NZ9C 1DQDH 3B2VH 1U95A 3BAEH 4XNYH 3C60D 4RGNE 3OG4B 7FABH 4J3TA 3STBA 3MRRA 3WYRA 3U83A 1CICB 4AEHL 3FB8A 3LRSB 2VDLL 2W9DH 4GRLB 1G7MA 4MNHA 5EU6E 1A47A 1N8ZB 5L2KB 5SX5H 4LLVA 3BP4A 3KPTA 2DJSA 3HZKA 2APTA 2JJSC 3MRLB 4LCIH 4FQCH 4EN3D 1U8HB 3D85A 5IVXB 2JJSA 1RU9H 12E8L 2NY5C 3D25A 4LLDB 4HDIB 1MCOH 1HK6A 3O4LE 1ETZB 1RZJH 1FL3A 4Y88A 3QFJA 2EIZA 3REVB 1UQSB 3I75A 4Q6IB 5F1OB 4ZXBB 5CEXA 2BCKB 4XPFL 5L2JB 2NY2B 4JHZA 3RHWK 1QVOA 1IJ9A 2EH7L 2Q76B 1CF8H 2AXFA 1R3HB 1BZ7B 4XGZB 5E9DE 5IB2B 1AGBA 1MCKA 5HYIA 2ZSVA 4PJDF 1CL7L 1FG9C 4RGNC 2J7LA 2UY6A 4G6AC 2IH1B 3VFUA 4S1QL 2YOCA 4U1NB 5LAXB 4KK6D 4JN2A 4P5MB 3ZDXF 3GRWA 4Y89A 3O3BA 4RQQA 1KPRA 3OWEA 5FFLA 1PSKL 2ZCLH 5D1XB 5EU6A 3MLWL 1B2WL 3FOMB 5T1KA 4D8PB 1HZHH 3BEVB 3NVQA 2YD8A 1Z3GH 5DJ8A 3MROB 2BRRL 4LLQA 3EDEA 1BQSA 4U6VL 4U6HB 4JKKA 4G5ZH 3QNYA 4PV8B 5E2WL 3SE8H 4P3CH 3V8CA 3CFEB 4Z7WE 5CJOL 1IGTB 3O4LA 4OLVH 1FBIH 3L3HB 1YNKL 4F2MB 4PJEB 1VA9A 1KNOA 3GFUA 3ROOA 3C08H 4PPTA 1CLCA 4KRPB 2VRAA 1IBGL 3F7QA 1KCVL 3I50H 4OZ4B 3U0PA 5FUCE 5E9DA 1T83A 1AD9B 3L3DA 1RJLA 2FD6H 4H25A 4E41D 4MA3B 2AV1B 3VXRD 4YEFA 2BY3A 4U1IA 3TWCH 3WIFB 1AXSB 1R5WB 1NJ9A 3O0RL 4H1LH 1MF2H 3KLAA 4R8WH 1ZVSB 1LMKA 1EZVY 4GW1B 1QEWB 1JE6A 1MJ8L 1ZHBB 2CKBL 4HKXA 3EOAA 5F1KC 4ZTOL 5DEGB 2CDEB 3MV11 3MR9B 4LPTA 3LQAL 2HLFD 1A9BB 3VWKC 5HDBF 4JM2F 4O51A 1L6ZA 3WKML 3CFDA 5IW6A 3MYJB 1VACB 1S7WB 3OL2A 1TJIL 4M6MH 3DURA 5B4MD 4Z7WA 3QUZD 4K3GA 4POUB 4OT1L 5EU3B 4NM8L 1JBJA 2W60A 2VZUA 5L88L 4PJ7E 3VA6A 3PJSB 2AJ3A 4LFHD 3M17A 3P11L 5EPMB 4X6BB 5I30L 3IDUA 5LBSL 5FOBA 3H8NA 5FUCC 4D9RD 4QWWC 4IMLA 4P57A 1SBSH 3CZJA 3ES6B 1YPZB 3HS0A 4UTBL 1X5YA 1A22B 4M62L 1CLOH 1WWAX 4JRYE 2OQJB 4ZUTA 2IQAA 4JPWL 4R26H 3RDTA 3WDIA 3TZVD 5J6HA 2ATKB 5D2LE 4JANA 1GGYA 1HHKA 4LLWB 2R1YA 5BJTB 1YEJL 3UCRA 4DUXA 5BMFH 1CXIA 3X13B 1G7QA 2ADGA 4TVPH 2G75B 3KPSB 4CAGA 4PJFE 3FO2A 3DV4A 1N0XH 5EO1B 5K33A 2IQ9H 3VWJC 3IJYA 4NFCA 4IM8A 4KZDH 5F93C 2ED9A 2OJZL 3VWJA 2ED8A 3GO1L 3UMTA 2X5PA 4XTRD 5FDWB 3F12A 2D9CA 1LO3L 1NBYA 1WIUA 3O9WD 4K71C 1J1PL 5L2KE 3GBMH 2ADIB 1XGUA 2RCSL 3F6IA 2X4OB 2GSGA 5IFHL 4LCYB 3L5JA 2FJGB 4PR5B 1EPFA 1CGWA 3O3DB 5A1AA 4Z7NF 4PJ7A 2YA2A 4TOYH 1JPFB 3DETC 1S3KL 5GGTH 3CGTA 3P9MB 4M5YH 2EDBA 3ESVF 5JW3H 4XVSL 3DO7B 4XWGL 4OFYA 1ZHKB 4HIIB 4WDIA 2ZCHL 3WNKA 3GSNB 1RZIB 4RMRA 2HKFH 2XXMB 2AK1L 4JRYA 3W82A 1OGTB 1T5WB 5D2LA 1QFWI 4TNVF 2AV7B 5FUOL 3VW3L 3DYOA 1LO4H 1LQSR 2VXUH 1MFBL 4TNWK 4LEXH 4PYGA 4PJFA 1AI1H 1RHHA 4QHMB 4KFZC 1AIFA 4POZC 4NPYB 5C0AE 4DJMA 5LGHH 4YHIB 4XNMB 1DVFA 1CICC 3H9YA 2Q8BL 4GRLC 1T20A 4X4XA 1CICA 3LRSA 5F7NC 1QYGH 1NANI 4PJCF 5JQHC 1CD1A 1TZIA 2I5YH 4ODWA 1KB5L 3M1BA 2ZKHH 1RIUL 5F70A 4KTYA 4EI5B 4N0UB 4M6OH 1JHTB 1U8HA 3ULVD 5E03A 4HIXH 5GHWL 4LLDA 4I1NB 5BXFB 3MRNA 1ETZA 3WIIH 3IDJA 5AYQA 3U4BH 3RDTD 3UTPE 1X4XA 4Q6IC 4PJEE 5FYKU 4ZXBC 3REVA 4QOKB 5DD6B 4DK6A 2NY2C 2Y1VA 1X7QB 1P7QD 2DS4A 1A6AB 4Q6IA 2SEBA 3QDJB 3RGHA 1S7VB 4MNGA 5L2JA 3PGFH 5D5ME 2OCFD 4Q9RL 1SY6H 5DD1L 5AEAA 1IC5H 4YHYB 4RAVA 4HXAH 3OX8A 1F4WL 1R3HA 1BZ7A 5IB2A 4LIQH 4HJ0C 1AFVL 4UT6L 2BVYA 2JCCE 1AO7E 5I1CL 2MHAB 4O2EA 15C8H 2IH1A 5C0AA 3TVMB 4U1NA 5KW9L 4LLYB 2HVJB 4UQ3B 5D1XC 5KS9E 3HNVH 2F9BT 2Z31C 4EDXB 4BZ2H 4AH2B 3FOMA 3Q3GA 2Z31A 2VWEE 1PX3A 3MROA 5AD0B 4U1HB 4GRWB 3SGKC 2XY2A 4ZTPL 4U6HA 3OAYK 2OZ4H 3B9KB 3SGKA 3VH8B 2FWOB 4GOSA 4NT6B 1URLA 1FO0H 3MLZL 2YD5A 3L3HA 1T1XB 3I6LE 3LMJH 1D5BA 4PJEA 4RX4D 4X6CB 1DBKL 2QADD 2BVOB 4U2ZA 2VLRB 4DKDC 1S7RA 4JDZB 5D5MA 1KJ2B 5MEQA 4YHMH 2NPLX 3GSRA 4OZ4A 3QRGL 1OVZA 1DQQB 4JCLA 1KULA 2PNDA 1YPZE 4JY4B 3W2DL 2X70A 4WWKD 4JRXD 2X4UB 2DQGH 4PBVC 4PJHB 1DBBH 4MA3A 5GRUL 5ADPL 2JCCA 1AO7A 1ZT7B 4O2CB 4QYOA 3WIFA 1AXSA 3MLYL 1RJZA 4F58L 3MRCA 4IRSA 5FAAA 1G7JB 1ZVSA 1NGZB 4LVEA 5GZND 5KS9A 3KPSE 3DROA 5DD3H 1CFSA 2LFGA 1ZHBA 3EUUA 4M7LH 2VWEC 1FNEB 5DEGA 2FGWL 1G0YR 2CDEA 3OZ9L 5CP3A 1AE6H 1R5IB 3LAFA 3PGDB 1CFTB 3MYJA 1VACA 1S7WA 6FABL 1OAYH 3RWEB 3PGCB 4HUMB 3EOTL 4R4NC 2B0SH 4D0DB 2YD1A 4G7YH 5EU3A 3JUZA 1C5CL 3S37X 1IAIH 3T0VA 3WXVH 4EDWL 5TDOB 1C08B 3PJSA 4BM7A 5TJWK 5D8JH 5EUKB 1IE5A 1Z9LA 3TPUA 5HI3C 4HJGB 1EO8H 1OGAB 5EPMA 3S4SG 4X6BA 3FOLA 5D7JD 4MVBD 4URTB 5MHSD 3W81A 5DHXB 3ES6A 1YPZA 2DI9A 4PJBF 4V2BA 4NJAL 3CNKA 3FKUS 2EDJA 1NCWL 5J1AB 2QSVA 4NQSB 4OFPA 4M00A 2BRQA 5ITBL 2Y36L 4MDIB 2HRPL 4K9EC 4Y4FA 4LLWA 4ZFZB 2ZWLT 3D0LA 5KOMC 5D1QB 3BWAB 3ABZA 3QEQE 3A6CH 1RZKH 2YSSA 1ROWA 5ESVB 4LARL 2Q3AA 4KMLB 1YJDC 3FTGA 2VQTA 2EH8L 3MLTA 4Z5RB 5I15H 2YEZB 4IOSD 4XAKD 5FDWA 3HC3L 3OTTA 5D4QA 1Z6JT 3O2DL 2BP3A 3DI3B 3T0AA 2ADIA 1T0NB 4FXGB 3HAEA 2N56A 3HE6B 4L4JA 2X4OA 3QEHB 5CJXA 5JZ7D 3RL2A 1QTYT 4LCYA 2FJGA 3MODL 1FH5H 2NXZC 2AEQH 5F3BA 4N0UE 3U7YH 1JRHL 1ACYL 1PBYA 3P9MA 2HLAB 1HQRB 5DLMH 4OKVA 3ZKMD 3DO7A 2D03H 2AW2A 2F5BL 3D2UB 1K8DB 4P3DA 4U31A 1KBGH 4WI3A 5DYOA 1A7OH 1LK3H 3RI5K 4DK3A 5IW1A 1QFWM 3SJVB 3QDJE 4MCZA 4WFED 4ACPA 5FGSA 1OGTA 4CW1B 4X8JA 2VZTA 4MJIB 2ZSWA 2C3VB 1HINH 4OGAC 4K23L 1MNUL 3HFMH 5HY9B 4M93B 2YPLE 2LE9A 3TN0B 1LO0L 3QEQA 5IMOB 1D5XB 4N0FB 5KVMC 4F7EA 5C0GB 1R24A 4NPYA 4IOFC 3KNBA 3THML 1J0YA 5D7SL 5EU7C 4Z7QF 1CXLA 4XC3L 4PLJC 2CO7B 1YN7B 5AUMB 1YZZA 3N1FC 3T04D 1CK0H 1K4CB 5AZEH 4EI5C 3ARSA 1MAML 4EI5A 1SEBB 4N0UA 4BH7A 3IJSB 1V3MA 3CLEH 4JKPL 1FNAA 3I6GA 5FHAL 3RAJL 2FB4H 1KN4H 2JB6A 5BS0D 4FZ8H 2MWCA 4MJ5B 2VXVH 4XNUL 4ZUUB 4PIRF 1KIPA 4X6CE 3L3OB 1E4KC 2YR3A 2WMPA 2UZIH 2DQUH 2K3TA 2VLRE 4WNQB 5TDPA 3QDJA 4Y4FD 1E4KA 5TDNA 1S7VA 4P2OB 2VR5A 4NO2B 1U2HA 1BHGA 2FX9H 4HZLA 3QJHA 1SMAA 1MI5D 5E8PA 1VHPA 4M43H 3WS3B 1M7IB 4ZFOB 1XR9B 4PJHE 5IBUB 2YPLA 1XZ0B 2A6DB 2OL3A 1MJUH 1EAJA 1RVFL 4U33A 1T7YA 1U3HD 4S1SH 3TVMC 2X89A 1WLHA 3ZL4L 4NO5B 3CCHA 2MHAA 2CUHA 5E6IB 5INCA 2OI9B 3TVMA 1CFNB 2ZJSL 1M05B 1PX4A 4X9IA 1GAFH 3JSSA 4KV5F 4KMTL 4RWYL 4BFBD 4J4PD 3QHFH 3F58L 3EFFB 5DRXB 4LSSH 5I17A 3ARWA 2FYYA 5IVNA 4XP6L 3CFCH 4FQLH 4U1HA 5AD0A 1EFXD 4CMHB 1SHMA 3B9KC 3CSPA 3LPWA 3RTQA 1CTNA 2XPGB 1DCLA 2H2PC 3B9KA 3LEXB 4KQ4L 2GY5A 4TUOA 2YRZA 4XCFH 3EKCA 3AU1B 4MJ6B 4U05A 4FTVE 1K3IA 3ZKNC 4Z78B 2BVOA 4OI9A 3OMZA 2VLRA 2HMIC 4D9LH 5F9AC 2P8LA 3SGJC 4MZ3A 1OGAE 4X9FA 2ZG3A 3GHBL 1H8NA 2OBGA 3RZCD 4ZUVA 2F19H 1JNNH 5GRJH 1DQQA 3U7WL 1KELL 4W81A 4CRPA 5CD5C 4Z7UF 2VISA 4N90E 3X3GH 1IEBB 1DL7L 5J57B 4V1DB 2DL9A 3TV3L 1ZT7A 4AMKH 1YEEL 5IFAL 4NNYB 3NCYP 1NKOA 5T33L 1ES0B 5E2VH 3QIWD 1G7JA 4GW4A 1NGZA 4A2LA 4N8VA 1XGTA 5EZLA 4ODBD 4NC2B 5DHYB 1IT9L 4YDIL 4HCRH 2BFVH 2JELL 3TO4D 1ZLVK 3NN8B 5GS0L 3PABB 1FNEA 3EOBA 3WEXB 4TQEL 2HT4C 4ENED 2ZUWA 4KKAC 1R5IA 1I7TB 1WFTA 3PGDA 4UU9B 1CFTA 2X2YA 4JFZL 4NC1E 5FUZL 3IF1B 3RWEA 3PGCA 5DMKA 4R7DA 3MV8D 3HC0A 1AGEB 4K7PX 4FTVA 4U1GB 5SV4A 3VD7A 4LRIC 1C08A 1SYVA 4OZHF 3CAFA 2ZUYA 4NM4H 5EUKA 1L9MA 4HJGA 4KKLD 2AK4A 1X5IA 1NMBL 2E8ZA 3EYFB 1W72A 3PP3H 1KCUL 3RVVD 4JFHD 1Q72H 3CPLB 1SEQH 4GQ9H 2ZUXA 3V6ZB 3SJVE 4M3JA 5C6TL 5J1AA 4NQSA 2LU4A 3PWJB 2CIIB 4IHOB 3SO5A 1O7SA 4Q0XL 1IVLA 2ZOKB 2EXWD 3EJJX 4MDIA 1I8KB 1OARH 3S5LG 1CLZH 4AT6A 1F4HA 3EFDL 4ZFZA 5D1QC 2J4WH 3INUH 4FMKA 4G6JH 5AG9A 4KAQH 2XWJB 3P0VH 4AY0A 3FO9A 5L8LB 2VE6A 2XKSA 4Y2DB 5D1QA 1H3XA 5DJ2B 3TBSB 4HWEH 5JR1H 4K8RC 2J88H 3CFBA 3NCYS 1WAAE 3D5OF 5HYSG 5DR5H 2G5BB 3CXHJ 1MRFL 5A2KH 2R1WB 4WFFE 4GS7B 4Z5RA 5EZIH 2YEZA 1NCBL 4NC1C 1WIOA 3HE6C 2UVEA 4XNQA 5IEKB 1T0NA 4FXGA 4NZUH 1BVZA 3MV01 4AEEA 3H0TB 3LV3A 3OJDB 1I1RA 3QEHA 5JIPA 5KVEL 2D31B 1YNLH 1P2CA 4JQVA 3S96A 3KPRD 5HD8D 2C4XA 4LDEB 4MMXC 2ESVB 1HQRA 1NEZA 5IHLB 1KEGH 4WFHE 5GSRB 4FABH 3ZHDA 1K8DA 3MGTA 3RZWA 2HT3D 4AIZB 3GSVA 4R97C 2DDQL 5EO9B 2B5IB 3SJVA 3VGGA 3WUWG 2EDRA 4CW1A 3TJEH 5FF6B 1VGKB 5E4IA 4KJPD 2E3VA 3OAZK 2C3VA 2DBJA 4PTUA 5E8DL 2FHCA 4M93C 2XN9D 3QDMD 3UP1A 3TN0C 4OLUH 3MRGA 5HY9A 5DD0L 3TN0A 3HZYB 3WKNA 3I84A 5IMOA 3K4DA 1VPOL 1UB5B 4HIJB 1WAAA 2BY2A 5T1MA 1IAII 1I4FB 1G84A 5C08B 3MCG1 1LVEA 3GI8L 5T3XD 4NQTA 2IPKA 5CJQL 4K3EL 3H3KA 3RBGA 2R9HD 1NCDL 1YN7A 3L3GB 5JTWA 3FJTA 2VXSH 4JY5L 1A7NH 5CEZH 5EZJA 4CDGC 3GK8L 4V2CB 1QLFA 1N4XL 3BE1H 5ALBH 1RK0B 4WGWB 3IJSA 4ODUB 1QHOA 1UWEL 2WBJB 1L7TH 5DJAB 4FNLL 3SBWC 4OD2A 2F74B 3C8KA 1XCTB 3WCYA 3SBWA 1SJHA 1QFUH 4P2OC 1WJ3A 3VI4E 4F57L 4XMKH 1FVEB 1OQOA 3MGOB 1FDLL 3V6FB 3IXAB 5C07D 5ACLA 3B9VA 1X4ZA 3L95A 4JKLA 4KROB 3WS3A 2B4CL 3BWUC 2W9EL 2ZUSA 3QUYD 4ZFOA 1RUQH 1XR9A 3KYOA 1EGJL 3CU1A 5E6IC 5F1NA 4V1DE 4QRRB 5DVNA 4POYA 5E6IA 1WK0A 1TQBB 3GHEL 4DAGL 3J7HA 4YX2L 1NGWB 1BOYA 5I8EB 4O9HL 4JAMB 5I19L 4X7CC 3PHOB 4EIZC 4F80A 3JUYA 1DBMH 4PJ5B 4UT7L 4HKBA 2P5WB 4CMHC 3GSXB 4WU7B 2DKUA 5F89A 2DLFH 3VFWB 5MEPB 1KJ3H 5J6GB 2R29L 2E9IA 2V6HA 4OV5B 1D5IL 4XAWL 1XGQA 5HI4C 1IZKA 4IOIA 4LHUB 3MJGX 4MDJB 4HS8L 2XI9A 3ARGD 4M7KH 4Z78A 2BVTA 5ABDE 3O41B 1CT8B 4ZO9A 3CDFA 3QB7C 2IAND 1GCFA 3CUPB 1QR4A 5DF0A 2J6EL 5C6PB 1QBMH 4PJ9B 1JPTH 3VXTB 5HI5C 1OLLA 1N7MH 1JNHB 4M6NH 4XBEL 5IGXH 3VXUB 3HR5B 4WI7A 3LPGA 3U82B 3IFNL 4I13B 3EHBD 4V1DA 2ITDB 5D70L 4BFEA 5I8CA 4PTTB 1NLDL 3ULUE 5SWQA 4X5LA 4KJWD 2EDKA 3A6BH 3QFDB 3IDXH 1GOGA 5DMIL 5DHYA 4I0CC 1LO2H 4GAGH 1BQHB 1AJ7L 4Z0BH 2E27L 1J88A 3PABA 4I0PB 1OWRM 1ZXQA 5DT1L 3LH2L 5ACZA 5FOJA 3NA9L 3LN5A 1ZHLA 3IF1A 5GISL 4U1GC 4P59H 3ZZ1A 1PVHA 2NZIA 1DN2A 4OQTA 5JOFA 3RWDB 1AGEA 3WXWH 1JVKA 4G9FE 3RKDD 3IKCA 3VFTB 4TYUA 5DFWH 2ESVE 4CN4A 3O2WH 2GIYA 4F9PA 1KUMA 1J1OL 1E6JL 3AREA 5F97E 5CMAB 1I8MA 1F6AA 1YEIL 1PZ5B 1WC7B 3CPLA 4A6YL 1KXQE 2AXJA 3BKYH 4HS6B 5EU4B 1HYRC 3IXTB 2Z8RA 2OR9H 1KSRA 1ZWIB 3Q6GH 3ULUC 1I8KA 4Y2DC 1HHHB 3MBEB 1LGVA 4ZPVA 1QRNB 3GKWL 4OFIA 1YY9D 2H8PB 5IM7A 1CGUA 1U91A 5T3ZH 3QQ4B 4GS7C 5H2BB 2P5EB 4WHTA 4ELMB 4XVUD 2VITB 4DKFH 3BW9A 1V3LA 4D0BA 5JA9A 3SGDH 1H9VA 3IDYB 2LVCA 5E70A 5GJTH 2KKQA 5HGHA 3PHQB 2IBGA 5IEKA 3VXMD 4WEUD 3ZDYE 4O5LL 5EOQL 1B0GB 3OJDA 4DZBB 2L4OA 4JLRA 5ADOL 4Q2ZA 3DXAB 3TFKC 3OKOA 2XA8L 3QG7L 4G9FA 1HHIB 4Z95L 1Q0YH 2L7UA 2CLVB 4OLZH 4BQ8A 1KJMA 2VNCA 1M7DA 3PDOB 3IB4A 3QEGL 5GSRA 3Q1SL 4YE4L 2PW1B 2AABL 4RIRA 5F9JB 2B5IC 3PWUB 4AIZA 2VABA 1XGPA 2R23B 3OHXB 2XV6B 5HYFA 1Q1JL 1U2CA 1ADQH 5C0CD 3CDGA 2ENYA 2GITA 3QUMA 1ZLVH 2RB8A 2XRAL 3ILPB 4XNXH 2MPAL 1WCBB 3X14B 3GSUA 4B50A 4Q9CA 2AI0L 2N4IA 1D6VL 3BPOC 1IAIM 1UH3A 4XMPH 3ARTA 3ARDD 3W11C 2DI8A 4QRRE 1MRCL 4Q97A 4JFQA 4HIJA 4UNVA 3D6GA 1OTTC 1X44A 1TIUA 5IQ7H 1KFAH 3QXUA 4OZFG 1WIPA 2VKXA 1NC2D 2H6PB 1CXFA 2HFGL 5HHOB 3L5WB 1T03H 4OSUL 1GC1H 3OPZL 5DD5H 4D3CH 1GRWA 3BJLA 3RWCB 4PJ5E 1Q9LB 1NFDF 1YY8B 2VDNH 3WFCL 2C3WA 3NZHH 2MCG1 3R0NA 3V5KB 1RK0A 3JWOH 1FP5A 3ARZA 2WBJC 1E6OH 1AKJA 4ODUA 3MACL 3GMMB 1A1OA 3AY4A 1X5FA 4X4ME 2AXGA 5DJAA 4G43B 3W9DA 1XCTA 3ALPA 4WUKH 1NFIB 4WTXA 1RUKH 4E0RB 5E2TL 3MOBL 3L9RB 1MREL 2NY5L 2A77H 3IDGA 1FVEA 3SY0B 1FFNA 1RFDH 5BVPL 1ACZA 1GYAA 3SDDB 4L5FH 4LRNL 3V6FA 4U1KB 3IXAA 3MBXH 4KROC 4QXGH 2DMBA 2GQHA 3VXUE 5CBAB 1H15A 3VXSD 3V95A 4OCXL 4Z7VE 4DVBB 2YKLH 5JUEH 4HAFA 4ZUWB 2CLZB 2UV3A 1TQBC 3IAQA 2AJVH 3CX5K 4Q9QH 3CK0L 3FQTB 3G08A 5B3JE 1HXYA 4G8GD 2O5YL 1NGWA 1G9MH 4W4OC 3SKJH 4JR9L 5JXED 5FYJE 1TVDA 1D5MB 4W4OA 1NGPL 2I27N 1S7SA 5C2UB 2OSLB 4PJ5A 4WU7A 3T1WA 4UBDD 1SJXA 5E6ZA 1WWWX 5MEPA 5J6GA 4OV5A 2NY6D 4UOW1 2CR3A 5E99L 5IMMB 4ERSL 1VADB 4ZS6D 1NCAH 4X4MA 4XWOD 4NWTL 2ITCA 4MDJA 1K3ZA 3OAZH 4PV9B 2FX7L 5FM5O 1KG0B 1CT8A 4PJ9C 4WEBL 3CUPA 2DLHA 5EH1A 1S9YB 2DTMH 5IB1B 4PJ9A 3O4OB 1MUJB 1UM6H 1Q9KA 3E8UH 1R3IL 1RHFA 3AUVA 5IT2H 3VXUA 3HR5A 4OJFH 5DK2A 1F58H 2EE3A 4Z7VA 3PIQB 4X0KB 2NZ9D 1MLCB 1JGLH 4G3YL 2VIRB 1VFOA 1A7RL 3ALWA 1BD2B 2ZOLB 3FN3A 3QFDA 3ZYJA 4I77H 3BKCH 2W0LA 2I9LB 2H45A 5GGVL 2ADJA 4I0PC 1G9NH 4TULH 2DJ4A 4ZS7H 4H1LB 4G8FB 3QUKB 4BFGA 4QNPE 5FCUH 1GIGH 2WINA 2E6QA 1P4LB 1F5WA 2JIXB 4L3AA 1KCRH 3DXAE 4Z7WF 3VFGH 1AQKL 4F15B 4Y5VB 3VFTA 4MB5A 1FN4B 2WUBH 4N9OB 3TIEA 5CMAA 1T2QL 2RHEA 1I1FA 4G6ML 1PZ5A 4IDJH 2KPNA 4K3DL 4XX1E 1S5HB 5EC1B 1SJEB 3X11A 1PG7X 3KJ4C 5KOVC 3HNSL 3B83A 3BZEA 5EU4A 1ORSA 4L4TE 4YFLF 1OCWH 3TBTA 1MCIA 2Y9RT 4JPIB 1ZWIA 2X4RA 3KPQB 1L0YA 4G6AD 5DUBA 2ZNWA 2XZCH 4XP9H 1WEJL 3LKSB 2BDNH 1M6OB 4BQ6A 3EJZC 4EBQL 4LSPL 1I3RB 5TE7L 1BECA 1HHHA 5DI8B 3REWB 3CVHL 3VGFA 1KOAA 3QHZH 3UYOD 43C9B 2CDFB 2H8PA 2F8OA 3QQ4A 5F72S 5H2BA 4YAQB 3IDYC 4WW2A 2YXFA 3MJ9H 5J1TC 3FN9A 1JTPA 5HHOE 5DMJB 5IMLB 2VLLA 1OD7A 1B88A 1B0GA 3S88H 2XWBB 4DZBA 4R4FH 3DXAA 1MCDA 1V8HA 3MREB 1AGFB 4PRHB 2HT2D 3KPLA 3SE9L 1DSFL 5I1IH 3DECA 3KJ6L 3FO0H 4PJ7F 3UXFA 5IHZA 3LKOB 3T0ED 1I3VA 1BP3B 3QQ3B 4JDTH 2FCBA 4EI6B 2PW1A 2DQCL 3PQYB 2OTUA 3OKLB 1FFPB 3T1FA 1JWUB 1E4WH 3GBNL 1MIMH 4L4TA 3LEVH 1T1ZA 3U36B 1ZLUH 3G04B 4P46C 4ZDHB 3ILPA 3PDGA 4FQXB 1BEYH 1WCBA 5D2LF 4P46A 4HFUH 3EYQD 4WU5B 3L5IA 3GMNA 3MA9H 3QAZB 1QG3A 1JFQH 1EXUB 1G6RH 3HG1D 4WO4A 1RURL 2AGJH 3E3QE 4PJFF 1CZ8H 1CVSC 2HFTA 5FO9A 1NAML 2XQYK 4S1DC 5FHBH 3VWKD 1PY9A 4ZD3H 1MJ7L 2F5AH 1CDBA 2VDOH 2I24N 2H6PA 2GUOB 3C6LB 3OAUH 5HHOA 5C92A 3L5WA 3BSZH 5A3IC 3T2NH 2LAGB 2ARJB 1A7QH 1NPUA 1Q9LA 4WRLA 1YY8A 1BQLH 4OGXL 3V5KA 3TNMA 1EVUA 2EE2A 5E24E 2DD8H 4P2YA 5IVXF 3BRFA 2COQA 4MQ7B 5CLWA 2X41A 4G43A 4QWWD 5I8KL 5TGBB 2H41A 1DP0A 3QRFM 4AEHH 4M5ZH 4L4VE 5DJCB 4E0RA 3PHSA 4HW6A 3ESUF 1S9KC 2V9RA 1X3DA 4U6YB 3SDDC 5KSAB 3SE3C 8CGTA 4K55A 2Y25A 4GBXD 1MH5B 4I3SH 3AS1A 1ONQB 1WTLA 1KIRB 4XPAL 3SDDA 4U1KA 3EO1B 4LPWA 1JV5B 4O2FA 3IDMA 4JO4L 4PREB 3TBVA 12E8H 3UBXI 1V7ML 3BIKB 4P9ML 2V5YA 1J1XL 5CD3B 4OF5A 4XB7A 4ZUWA 2CLZA 3E3QC 2YUXA 4KHTH 1ODAA 3FQTA 4RAUB 5F7UA 4ONFL 1FNSL 1BD2E 1KT2B 2MJWA 4MAYB 3BKML 4XPFH 1FE8L 4APQD 2BXZA 4YUEL 1D5MA 3I02B 5F7YC 1ED3A 2EDLA 2EH7H 2EO9A 3W0WE 3IVKB 1J10A 3FRPG 2ARJQ 1JJUA 5KVGL 4D94A 4JN1L 1K6QH 1NGQL 5GGSY 5EORL 1LEGB 1CFBA 3TCLA 1YEKH 3ZKSD 5IMMA 3OXSB 5C0IB 3W5NA 2V7NB 5E5RB 1A7PL 1VADA 2JJWA 4FZEH 4YHLL 5JOEA 4PV9A 1D3CA 1KG0A 4HPYH 4L4VA 4CN6A 1J0JA 1HHGB 4PJEF 4Y16D 1S9YA 1VGEL 3O4OC 5DJ6A 3ZTJH 1FO0B 4WI5A 1CBVL 2EDNA 1MUJA 4XCCH 3JTTB 4DN4L 3R1GL 1S9VB 2AJUL 3MRHB 2IMMA 4N9GB 1MCWM 4TTDC 3PIQA 2HH0L 5FGRA 4ETYA 2DF3A 1WZKA 4HQQL 3BZFB 2VIRA 2Y7QA 1YNKH 1F3RB 3CH8A 3VH8G 3MUHL 2JCCF 3QWOA 5IVZA 1JZ3A 4JZJB 1BD2A 4GRLD 4KUZH 5L2KD 1UKTA 2GY7B 1A2YB 1IBGH 4X4YB 2IH3B 3W0WA 4H8WH 5E5MA 1A3QA 4H1LA 2X9WA 3OV6A 1SVZA 1WQVT 5HDOA 4OF3A 4TVPE 5D71L 1U8NB 5HDLA 1EO7A 3FMGL 3VFMB 3NCJL 3TP4A 3T65B 4FFWD 4XHJD 4F15C 4YHOL 4ZXBD 3P0GB 3K81A 2AJZB 2DM7A 2NY2D 4L8CB 1JNJA 4PRHE 1FN4A 3BMVA 2R4SL 3FAXA 4JKWA 1QBAA 4QT5B 4MCYA 4ZTOH 3WHXB 1WUNT 4FQ2H 5GGUB 2HJLB 3LQAH 5CGMA 1AHWB 3F65A 4NFDA 3MUGA 4ODSL 2PO6B 1SJEA 5EC1A 4GXUM 2I60H 1XH3A 2EYRB 3JVGC 1GL4B 1YPZF 1FZOB 4OT1H 3FFCD 3P73A 4JPIA 4PRDA 5CUSL 2DQHH 4HGWA 3KPQA 3RQ3A 1Z0NA 2KZ1B 1UH2A 1P7HL 1HXMA 1K4DA 1UCTA 4JM2B 3ELAT 1D7FA 3LDBC 1MEXL 5D1XD 1OP3H 1I3RA 3NCFB 3WN5B 1UEYA 5DI8A 3REWA 4RA3A 4AM0B 5F1IB 4PG2C 2XKNB 2EDTA 4Y0GA 2CDFA 4OGYH 4OCYH 1VFAA 5DZOA 4K9EL 4WGVB 3TC9A 3ULVH 1XAUA 4QRQB 2BSRB 4JPWH 3ARBB 2XNAA 1P69B 5ANMB 4K7FB 4BSJA 2A9NL 5LJYH 3DUUB 4NCC1 4UIMB 3MREA 1AGFA 3OGOE 2DL2A 4JCMA 4LDLB 4PRHA 4KRPD 3UTZB 1U8KB 3PNWA 5F88B 4UOJA 4YLQT 2OJZH 4BH8A 2EKSB 3GO1H 3C2SA 1C5BH 3VFSB 4BSVB 1LO3H 1ZGLA 3OKLA 2VXTL 1TJHL 1F3JB 1FFPA 5GGTA 1JWUA 1QR1B 4XCYB 2LAAA 2QQNH 1R3JB 4MD5A 5ESQA 4LAQH 2RCSH 5JLZB 4FQQA 4J1UA 2Y6SD 3GMQB 2D4DA 4FQXC 1JHKH 3GSNL 2W92A 2ZCKH 2FIKB 4ZDHA 4YQXL 3QAZC 4FQXA 3F7RA 4KI5E 4WU5A 3HI1B 2DYPD 4LLMB 2DQJL 5E94A 2Z35B 5KN5A 1EXUA 3QPQC 5L6YH 1FIGL 4OZGE 1IAKB 1JGUH 4Z8FH 3ZHLA 4CVZA 4JQXC 5BOPA 4N68A 3WJLA 3BX7C 4JQXA 3HNTH 3K2MC 4L1DA 4HUVB 4JO1H 4LIQE 2AK1H 3C6LC 3V0WH 1LDPH 4NBYB 3ZE2F 2A6JA 3RY6C 3QHTC 2WIIB 2GUOA 3C6LA 3D3VB 5HHPA 5C6WH 3RVTC 3RY6A 1LNUB 2GAZB 2ARJA 4H20L 5EC2B 1BVLB 5DA4A 3RIAK 2ENSA 4ORZC 4NCDA 5I66B 1CGYA 4DOHB 2EDQA 4Z7OE 5DFTA 4ZFFB 3QUXB 2IBBA 2EE9A 4W6WB 1U8LA 2W0FB 2Q8BH 5TGBA 5D9SB 5IW3A 1MWAB 5IESH 5DJCA 1FL5B 3IFLL 1DUZB 4WIQA 2EZ0D 4JE4B 5DJ0A 4PRPB 5C1MB 4XRCA 1MH5A 2VC2L 3V4VH 1ONQA 1KIRA 1Q0XH 2DJUA 4AQOA 1LEIB 5J3HC 3GI9H 3KPSD 1B0RB 2R4RL 3EYSL 4FFVC 4NRZB 5B38B 3O6FB 1RY7B 1F4YL 4ZO7A 4OZGA 3OSKA 1SY6A 3RVWD 4JVWA 1QPPA 1RQ5A 2M26A 1K5NB 1U8OB 3OR7B 3QXVA 2VXQH 3CSBA 2EXYD 4X99A 1DN0A 1FQ9C 5HDQH 3HA0A 2XTJB 4FP8L 4M7LT 2ZP0T 4OF6A 3HMXL 1NDMA 4UI2A 1V5JA 2BHUA 3H9SB 4RGOL 4G6FD 4Z18A 1QA9B 3O6ML 3IVKA 1CQKA 4OIIH 1RK1A 3BISA 1IGML 2V7HB 4ODXB 1AFVH 3CFJB 3QXWA 2NY3D 1BFOB 1NDGA 4L8DA 5I1CH 2A9ML 4PJ8B 3OXSA 4LSTL 2V7NA 4GRWF 3UTSB 1U6AL 1SM3H 3GIZL 4F3FB 5IBUG 4CJ1A 3L1OL 1J11A 5ESAA 2AJYL 3SGEH 4NUGL 3QIBB 4NQDE 1HHGA 2CXKA 1C8PA 3KGRA 5DEZA 3RIAF 4X6CF 4CU7A 2IBZY 3EJYC 2IGFH 1XF2B 1FO0A 5B39B 4OGAD 3DMMA 1JPSL 3WFDH 3MRHA 3LCYA 2D2OA 2GK2A 4CKVX 4N9GA 4GKZB 3BUTA 3MNZA 1KJ2L 3BQUB 1BOGB 2ZUTA 2D0GA 4DVRL 4L3CB 2CK0L 3MRFB 1ZT4B 4UOW0 3MLZH 5L9DL 1OD9A 4R4BA 5I16B 4PJHF 4JZJC 5C7XH 4RISH 1DBKH 2WWMC 2P7TA 3EW3B 4EOWL 3H6JA 5HHQB 5MEOA 4PLJD 3EYOA 5IWLC 4QTHB 3BGAA 4X6DB 4EXKA 4PY7A 3HUJB 5GQBA 5IWLA 3OB0K 2A74A 1TJGH 1YMMB 2OXHA 2QBWA 4Y5YB 4XC1L 4MX7A 1R5VA 4KPHH 2DICA 4Z9KB 5KVDH 4ZSOB 1AH1A 3FB7B 3W9EA 5ANME 5BV7H 4F58H 3T65A 4HEME 4QOKD 5DC9B 4HMDA 1X5XA 4M48H 3ZE1E 2FH6A 3X12B 2AJZA 4XB8A 4NQDA 4L8CA 1G7HB 4C56B 3SDAB 2FBOJ 1RUPH 4LSVL 1IQWL 4QT5A 1AHWC 3KYNB 3SDCB 4KZEL 1QSFD 1JUFA 3OZ9H 4C54A 2PO6C 1UCBH 3HCVB 5DJDB 2MKLC 2PO6A 3GSWB 4M03A 5D7IE 2EYRA 2BNQB 1FZOA 3G6DH 2DM4A 5TQ0L 4IJ3B 4D0CB 1Y0LA 1C5CH 4I9WD 3FRUB 5EU5B 2FEEI 4KVNL 1JZ7A 4HUWB 1JP5A 4I4WA 1HWHB 3QDGD 2BNRB 4NNPH 1ZVYA 3WN5C 3SCMB 1X5LA 1UVQB 1OM3H 3PWNA 3QISA 3SDXB 5EN2A 4AM0A 2GTZB 5FA4B 5F1IA 2VL5A 3NABH 2XKNA 4M1DH 4U3CA 3HZMB 4FXKB 3P0YH 4P23C 3C5ZD 3F5WA 3O45B 4OLXH 4P23A 1N26A 4QRQA 3ARBC 4LCWD 2BSRA 3NCEB 1DTUA 3BI9X 4YDJB 5AZ2L 4C4KO 5AAWA 1XIWB 3ARBA 3D3VE 2DN7A 4K8RL 1FLTX 5C3TA 4ELKB 4LNRB 4JFOB 4JZOA 2Z4QA 2HRPH 3BP6B 1I85C 3C09B 3C5SA 4S0SD 4J23A 1I85A 2ZUQB 4UIMA 3UTZA 1QKZL 1T5XA 3KWWB 3WFZA 3DMMD 1N5YL 5ERWB 4C59B 2YD3A 2DWEB 2BJMH 1F02I 3HE7D 4JHWL 3SKNB 4ODVH 1QR1A 1NL0L 3UTTE 4XZUB 1R3JA 4GFTB 5D7IA 5HHME 3BUYB 5CCKH 5DUPH 4B0MM 1MCHA 1CIUA 3O3UN 5JLZA 2BVEA 3MODH 2FIKA 1QSED 3LKNA 2P8PA 3HI1A 5EBLB 2B8OT 3CH1B 3LHPL 4LKCA 3OGCB 5SWZD 4XHQA 1J86A 1RZ7L 4NQVB 1AR1D 2QSCH 3WMSA 4DGYH 1Z2KA 3QCTH 1GGTA 4KKAD 4KJQC 2FATH 1UACH 4HUVA 2XTJE 5C9KA 2R69L 2Q7YB 1WF5A 2BNUB 1BIIA 3D3VA 3H9SE 1UB6B 1I7ZB 3J8F7 1NH6A 3MXWL 5EWIL 5K9KB 5EC2A 2VZ3A 3V7AG 5IOPA 1QLEL 4N0RA 1LP9A 2MKWA 3EO0B 1MHHA 1OGAD 3QUXC 1W2KT 2EIEA 4ZFFA 5F8RC 3NFSL 5FKAA 3QUXA 3V5HA 2W0FA 3RPIA 2GYSA 5B21A 3ZT6A 1MCBA 1MOEA 1IC4L 3UTTA 4DUVA 1A8JH 1B0WA 3EDFA 3QA3B 1DUZA 3VG0L 2VQ1A 3EGSA 1EMTH 5FGCE 1LEIA 1N59A 3L7EB 5C0RH 4GXVH 3O6FC 3BJ91 1A1NB 4Q9BA 4TPRH 3O6FA 5B38A 5FHAH 3MXVL 1INEL 4JQIL 4NQCB 4XNUH 5CP7B 3SOBH 2B2XL 2NYYC 3AXLB 5DRZB 5H35A 4QXTB 2OR7A 1F4XH 1U8OA 2XTJC 4MA7H 4WHYG 5J06A 2CJUL 4ZFOL 2DTSA 2R0KH 4JFFB 4X6DE 3HE6D 3HUJE 1VFUA 2J1KA 3GMLA 1YMME 3ECBB 1QA9A 3RWIA 3JZ7A 3PL6B 4KXZI 4ODXA 3EO9L 1QSVA 4PRBB 1IGYB 1RVFH 2UUDK 1KC5L 2WZPD 1V3KA 3D2UD 5D93B 4Y4HD 4HKZB 3CXDL 4YBHA 2UWEB 2YUVA 1XF4B 5FCSH 2NCMA 4YXKH 3FO1B 2AP2A 4RWYH 1PAMA 4MJID 5CGYC 1BBJA 4UDTA 1T4KA 3BH8A 2FEDC 5EG6C 3VI4F 3S37H 4G8EA 3BQUC 3P4MB 2BHZA 4JG0L 4GKZA 2FBJH 3R8BB 1RUML 5TPWL 3UYPA 2F53B 2H3NA 2IFGA 3MRFA 4O58L 1S7XA 1ZT4A 5ISZE 5I16A 1U8MB 4Z76A 4LHUG 3DX9B 2F58L 5FKPB 3VJ6B 4QLRA 3SDXE 5KANI 2QKIB 4QTHA 3LKPA 3LQZB 3PWPE 1ZV5A 4Y5YC 1KLUB 3UO1L 3ZYZA 5HGDB 1N3NB 2GEEA 4I18B 4Y5YA 2NNAB 4HPOL 5A16A 1IEAB 3GJFH 5BOZG 4M1GH 3VDCA 2GJZB 4YHZH 3TV3H 3O3EA 3FB7A 4HCRA 4WFHD 4ZODA 4P5TA 4ZOCA 1YEEH 3KLSA 3UEZA 5F7EL 4NKDA 4KKBC 3PP4L 4QRTA 4Z7UB 3SDAC 5F96H 3K8LA 2Y07H 3X12A 3QCVL 1TVBB 1G7HA 3WJJC 3LIZL 4J6RL 3SDAA 2JELH 3MRDB 1T6VN 1TZGH 4OQTL 3WJJA 5JPMB 4MAUH 4TQEH 4OTXL 1TVHB 5DJDA 3T2PA 4GUPA 1BFVL 1BQHG 1IGIH 3LB6C 5F1SA 5FYKL 5HGAB 5C2BL 4JFZH 5D2NB 2NX5D 4IJ3C 4EIGB 1ZT1B 4I5BA 4DGVL 4UUJB 4D0CA 5L7XH 2CDGA 1MCSA 3FRUA 2BSED 1A4JB 5ISZA 4NHCH 1SYSA 3SCMC 4HUWA 5D7LB 4ZAKB 3U4AA 4MA8L 5T3XH 3QIUB 1JNNL 1YEDA 3RA7H 3SDXA 3TLRA 3ULUF 5FA4A 1OAZH 1QUNA 3G5XB 3OKYA 2W07A 3PWPA 2GJ6A 1MPAH 3HZMA 2J8OA 4FXKA 5CIPB 3W39A 3ULUL 3H3PH 5HYQA 3TM6A 1I9JH 4WI9A 1NUFA 3O45A 3PUCA 5H37G 2VDKL 4HIHA 3WD5L 2MCPL 3STZA 1EBAA 5EOTB 2V2XB 5C6TH 2R39A 4YDJA 2C5DC 5HI4D 1FORH 2GK0B 4P2RB 4JFOA 1CGXA 5IQ9A 2ZUQC 3HI5H 2FGZA 3NFNB 1P1ZB 2VN4A 1I7RB 3UBXB 4MNQB 3HPLA 4P4RA 1N2RB 1RD6A 1I9IL 4WY7L 1UXSA 3KWWA 1HE7A 1U36A 3TA3B 3ORJA 4K7PY 4WENB 2VSCA 4R7NA 1FYTB 2VLJA 1J8HD 4X5XB 4AG4H 4M6AA 4Z77B 1VB9A 1PLGH 3LSOA 4PGCB 2LU7A 3G5ZB 1FVDB 3DSNA 2R0WH 3D9AL 4JJ5B 4BFIB 5FECB 1FC2D 3CLFH 3LPFA 1CWVA 5JHDE 1H8OA 4L8BA 2D3VA 1ZSDB 1S9XB 4PJXB 3KDMA 1BZ9B 2FSEB 1DQJB 1WFUA 3CH1A 4R96B 2HWZH 3OGCA 1DQTA 4JFXB 4NQCE 4ZPTA 5EBWB 3ISWA 4WFGE 3X17A 2EYTA 3RKPA 2H32H 4P5TD 4P2QA 4XPHH 4JFFE 2VN7A 2DWDA 2O26U 5C0NC 1J0HA 3QEUB 1WBYB 1I7ZA 1J0KA 5AAMA 1BBDL 2NW3A 5K9KA 2NY7L 5KVFL 3ZDYF 4OUUB 5FYKD 1H0DB 2F54A 5DD0H 2WWKO 1D9KD 3FCTB 5D72H 1VPOH 5JA8B 2EE6A 4GW5A 3SKOA 1RULH 4ZOAA 1YC8A 2UWEE 1I1AB 4FG6D 4IEFB 1C5DB 1E0OB 1WTGT 5CJQH 4K3EH 1EUUA 5K9OB 4PB0L 2C3GA 3VD5A 1MJJA 3FL7A 1MCPH 5SV3A 4JY5H 4HX1B 5DWUH 4G6KH 1WBZB 1N4XH 3V0VB 3L7EA 4Y2DD 3RNKA 5JHDA 5HYEA 5FEBA 3K7UA 3ILQC 3VXPB 4HK3N 3FQXB 2A1WH 4JFDB 3QT2A 3RWGA 2E7LA 1FPTL 2F53E 4RFNC 4NQCA 5CP7A 4OFVA 3AXLA 3O6KH 5DRZA 4UQ2A 5FA3B 5DVOA 5GJSH 5K9QI 1JF5A 4GMSH 4JFFA 5IMKA 4YGVB 3K2UH 3NIFE 5DSCB 1UM5H 1HCVA 5DJZA 5I76A 1FFRA 1FRGL 1G0XA 3PL6C 3ECBA 4FFYL 4WUUB 2H26B 5LXGL 5EOCJ 2B4CH 1AGCB 2ESVD 3ZLQC 1IGYA 4X9BA 5D93C 2GFBA 3U9PH 5C0EB 2HTLC 1A6TB 1CN4A 4MD4B 1U58B 4HKZA 1MFNA 2VLJD 2UWEA 1XF4A 1LDSA 5IROA 4CBPA 1N64L 4UT7H 3TNNA 5C09B 1HSAB 3IRZA 4K7PH 3RGVC 4QTIL 1AP2A 1KCSL 3P4MA 3RGVA 5D2NE 1B4JH 1BREA 4JPVH 2ERJB 2NTFB 2IAMA 2CGRL 4X6FB 2F53A 1F8TL 1C7TA 4RRPA 5C08D 3DJ9A 1AXTL 4HS8H 1J5OH 2BMKB 3PE9A 3QQ9C 1ZGLP 2C4FT 5FKPA 5B3JF 1S78D 2J6EH 4P2CG 5DS8B 5SWSB 3T0WA 2F54D 1GGCH 4JFED 5E95B 5HGDA 5MENB 2HVKA 1CDCA 1J05B 1E4JA 5E6YA 5FYJL 1IEAA 3RNQB 1J87A 1KENL 2O5XH 3P77B 4NO0A 5BVJB 2WBJD 3IFNH 3SDYL 4C58B 4CGTA 5D70H 2Y72A 4P2RE 1WZ1L 2K7PA 4HBQA 1JZ5A 4Z0XA 4BK5A 5T3ZE 1XCQB 1A3RL 3K8MA 3LS5L 2A38A 5IB3B 2NR6D 4YBQC 5DMIH 4PRNA 4ALAL 3VDBA 5KAQG 2R2BA 1QFWL 3LZFH 3MRDA 2PYEB 2E27H 3T09A 1QBLL 2PW2B 3LH2H 3TT1L 4KROD 1EHLL 1TVHA 2VH5H 5D2NC 1IGJB 1FYTE 4KC3B 5ILTL 1EEUA 1CE6B 1RMFL 4LASL 5BRZD 4QRRD 4F7TA 2QQLH 1ZT1A 3P30L 2P42B 4UUJA 3V6BR 4TSBL 3FN0L 1F13A 5LVEA 2QJDA 3HI6H 3QIUC 1J7VR 1QOKA 3CMOL 1KPVA 2Z91A 5CBEB 3DUHA 4LHJB 3LVEA 1J1OH 5I1DB 3MCKA 3VRLE 2J12B 1YEIH 3G5XA 4MXQC 4GKNA 4TUJB 4D2NA 4Y5XA 2P5WD 1HKLH 2YPVL 5DJYB 4KTDL 3GUTB 4ZG1A 4HGKC 3FFDB 2VERN 4UV7L 3W5MA 3GJEA 4DTGH 5JQ6L 1BVKB 2V2XA 4LHUD 1PD6A 1FAIH 2BVPB 3VMNA 2GK0A 4QNPF 5GZOC 4PJIB 4MD0A 3WFEH 2DLIA 5SX5K 3LEYL 2OMNA 4EN3B 3NFNA 3WFBL 1P1ZA 1F11B 1I7RA 3UBXA 3AB0B 3C9NB 5DC0A 5FK9B 5GRWA 1PDKA 1N2RA 3TA3C 2WW8A 1X5KA 2ICEB 4Y1AE 3DTXB 3DGGB 1OT2A 3OF6A 5F44A 1WITA 5BQ7A 3NGBC 5GGRY 1K2DB 1FYTA 3SE4A 1F4AA 3OJVC 1G7LB 2X42A 4NHUB 1ZLSL 3N1PC 4RCAA 5EOQH 5GGQL 4PGCA 1T3FA 4XPTL 5IR1B 1RIVH 1FVDA 3EOYG 5JXAH 3EYUL 1JZ4A 1ZA3B 1EAPA 3S36H 5CZVL 3OKKB 2N1KA 1S9XA 4PGZA 1BZ9A 1DQJA 1FCGA 1ADQA 2PXYD 1MRDL 3QEGH 4JFXA 4XCNB 1YUHA 2DQFA 2WIMA 4HBCL 3UPRA 4D9QD 1DBJL 1OOAA 3CX2A 4UILL 2IG2H 4AJ0A 3X3FH 4LPVA 1XF5A 3KPOB 3QEUA 5CZXC 1WBYA 4TTGA 3HB3C 4WUUE 1EBPA 7CGTA 4PRAA 2AI0H 4OUUA 1DQDL 3QWRA 1H0DA 1D6VH 4NWUH 4YDVB 1GC1C 1VDGA 1NGYB 2BOBB 3B2VL 3ZO0A 2P8MB 4O4YH 3TIDA 3BAEL 4XNYL 2I9TA 3V9FA 4XI5C 4Y1AA 2VDMH 7FABL 1I1AC 2JB5H 3QO0A 4MXVE 4NNXA 2X40A 5CSZA 1C5DA 3MV9D 4NQEB 2G60H 2W9DL 3QXAB 1TTGA 1YQ2A 2HFGH 5K9OA 2IALA 1NUDA 2V5MA 4U1JB 4LCIL 1U93A 4FQCL 1RI8A 3WFCH 1ZA6B 4W6YB 2IPTL 5JIHA 1RU9L 1U95B 2V5SA 3V0VA 4E41B 3MBED 1JZ2A 3VXRB 1QRND 3TPKA 2FHBA 5F6IB 3MACH 1Q8MA 5B22A 3FB8B 2P5ED 4MNHB 3NIGE 5IBTL 4LLVB 1L9NA 5E2TH 3MOBH 3BP4B 2JJVA 4OZIA 1MREH 1V05A 2NY5H 5SX4H 4YGVA 4XP5H 5SWSE 4KMQA 3D25B 1CF8L 1JMXA 4PRIA 1G9MC 1Z9MA 3QG6A 1UENA 4YJZL 1BLNB 4LCUB 4NN7B 4OCXH 1AGCA 1FL3B 3EIFA 3QFJB 3OR6B 1I8LC 3QUZB 1A6TA 3MV7D 1I8LA 5CEXB 3CK0H 5D7KD 4MD4A 1U58A 1G7IA 5MP6L 4KTEH 3NIDE 2GSIB 4JR9H 2ZCLL 4H88H 4HC1L 2AXFB 1NC4A 1HZHL 5FV2A 4X80H 1XF1A 2PYEE 1Z3GL 3S8WA 3IDNB 1EZVX 3T3MF 4NRXB 1FHGA 4G5ZL 3SE8L 3VFUB 1NSNH 4IS6B 1RZFH 1YEGH 4UDUA 1IM9D 1BWMA 3TZVB 2IF7A 3BD5A 4OLVL 3EDDA 2NXYD 3O3BB 1FBIL 4RQQB 3IGAA 5EU6B 2FX7H 4PGEA 2VLKD 3C08L 2AAVA 1EJ6A 2BMKA 1PKQE 5FM4A 2YBRB 4LLQB 3I50L 3S6CA 5DS8A 3QNYB 5SWSA 4P4KD 1J05A 3TH4T 2FD6L 1AD0A 3MNWB 4X6EA 3CSYA 2P49B 3O9WB 3KPMB 1WCQA 4DGIH 3IFOA 3TWCL 3P77A 5DO2C 1G9NC 2CRMA 3ROOB 3AM8C 3ETBF 2VB5A 3KS0H 4JO3H 4PJIE 1XCQA 2F8VA 3AM8A 4R8WL 5DZNA 3PV7A 3FZUD 4K94H 1WV7T 1YN6B 2QV2A 5E9DB 4OF8A 4H25B 4J8RB 2PYEA 3VFRA 1A1MB 1GGUA 1CE1L 4U1IB 4HFWB 2PW2A 4BUHA 2PTTA 1IGJA 2DIJA 2I07A 4M6ML 1MLBB 3D69A 3KLAB 2CRZA 5GRVK 4BQ9A 1HH6B 1S7TB 3CXHK 4HLZH 4MXWL 4QGTA 2Y5EA 4CN1A 4WI6A 5T1DH 3WLWD 3EOAB 4OQ1A 2VL4A 1PKQA 1P4BL 5L8JB 3TBYA 4O51B 1U3YA 1T2QH 2ZG1A 3VFNB 3C60A 4TUJA 1UXWA 1SBSL 4N5ED 3HPJB 3U0TB 4K3DH 5DJYA 3DURB 4Z7WB 2HTKC 4NZDA 1NKRA 1CLOL 1EJOH 3HNSH 5TH2B 4LSRL 3GEWB 3ZDZE 2W60B 4WEMB 4YDLB 3V52L 5C0JA 4EQ2A 5ECJE 4EN3C 2A6KA 4PJIA 1WEJH 1FL6A 2LV4A 3M17B 5BMFL 4EN3A 2P1YA 5MI0B 4C4KT 4YDKL 1F11A 1G1YA 3MJ9A 2I26N 4X83A 1F2XK 3CVHH 4NZJA 1N0XL 2IQ9L 4OD3H 4KZDL 2YN5A 2EDDA 1VSCA 2ICEA 3O11B 3DTXA 4ZUTB 3VRJA 2IQAB 3RDTB 4PD4K 5J6HB 5JPNA 4JANB 1HHKB 1P7QB 4LPCA 2R1YB 4HHAA 3AS0A 4L3ED 1C16B 4NHUA 1G7QB 2ADGB 2R2EB 5IR1A 3FO2B 4TOYL 1YQVH 5GGTL 1NCUA 3BDYL 4E41E 3D39D 3SE9H 3VXRE 1DSFH 3VWJB 5JW3L 3FB5A 3KJ6H 4OCSH 3AAZA 1FNLA 5KZCD 4U1MA 4XVTL 2Q6WA 2YC1A 2DQTH 1L6XA 1DLFL 1KF9B 3C8DA 2HKFL 3GBNH 5JNYB 4OZFH 3DSFL 2JIXD 3DRTA 3K80A 4FQHA 1G6RA 4N5UA 1OF2A 2WQ8A 1PQZA 1LO4L 2OTWB 2XFXA 4ONGL 1ZKAA 3JWDH 4WDIB 5H8DA 4I3RL 1AI1L 5AG8A 2BOBA 2P8MA 3JV6A 4G7VL 2GT9A 4O00A 1RURH 1HIML 3MA7B 4EKXA 1AC6A 4PLNC 2QADB 2QQQA 5JW4Q 3WDHA 4NBZB 1X9QA 1QFHA 3VGBA 2I5YL 5CS7A 4WI2A 4XMLH 2YWYA 4D9RE 4LMQE 4WTZG 2X9XA 4PJFB 2YZ8A 1ZA6A 1AIFB 4JRXB 3K4AA 5F6IC 2PF6A 5EDXA 4E41A 4HWBL 3VXRA 3MPCA 1DVFB 3V79C 1T20B 3WIIL 3T8XB 3CVIH 4X4XB 3L5XH 3RRQA 1U8JB 2JF1A 3BZ4A 4BA8A 4HUNB 1CD1B 1TZIB 3K1DA 4ODWB 4AL8H 4OZGF 2ADFH 3M1BB 3MGAA 2FNBA 4NSKB 5DGQA 2KH2B 1SY6L 3LN9A 3WS6C 1IC5L 2HLFC 4HXAL 5DVMA 4NN7C 3WS6A 1INDH 1FFOB 1BLNA 4KU1A 4LCUA 4LIQL 3DVNB 3WNLA 3MRNB 3IDJB 5B4MC 4WCYL 3QUZC 1TMCB 1T66D 3OR6A 1UZ6E 3B2UC 3QUZA 1S9WB 2KQNA 2SEBB 4MNGB 3PQYD 3OKMA 1FNSH 1JWSA 1OAQH 4Z7OF 1VEMA 2GSIA 3BKMH 4HMEA 4RAVB 3HNVL 3OX8B 4JHBA 4M61A 4ZOEA 4BZ2L 4ZFGH 4GMTH 1T7WA 3VFOA 3UPCA 1YNTB 1TETL 2GKIA 5D7JB 5B3NA 3IDNA 3Q0HA 4NRXA 2OZ4L 4O2EB 3TZVC 5C0AB 1NGQH 4IS6A 5EORH 1T1YA 3MRMA 3TZVA 1NUGA 1FO0L 3ZSSA 5FYLD 5IB5A 4YHLH 1DE4B 3LMJL 5ID1B 3GIVB 1AGDB 4QY8A 3Q3GB 1H5BB 2Z31B 4XBPA 1PG7H 1W0VB 2OP4L 4DKEH 4KUCD 2YBRA 1VGEH 2Q87A 4CUCA 2R56L 4ODTH 4XTRC 3RIFK 5IUSA 4DN4H 1KN2L 3R1GH 3O9WC 2DQDH 2DQGL 3MNWA 1DBBL 5T5NG 3O9WA 3KPMA 5B39G 4ZO8A 1D5BB 5DHVH 1P4IH 1UA6H 4H8WC 1A02N 35C8L 1BZQK 1FAKT 3BGMB 1S7RB 5D5MB 5MEQB 1L7IH 3FT3B 3OKNA 1XGRA 3ULVE 4U1LA 3GSRB 4CL7A 4MQXD 5DD3L 1T83C 5KSAD 1MHEB 1YN6A 2X70B 4M7LL 2DQIH 1GVIA 4J8RA 1A1MA 5BV7B 4RNRA 1AE6L 2JCCB 2CXGA 1AO7B 4HFWA 4LU5H 4QYOB 5TFSH 5J3HD 3RHWF 1RJZB 5SX4I 3MRCB 4IRSB 1KJVA 3FMGH 1MLBA 3UJJL 2CKBA 3KR3L 4G7YL 1HH6A 2X1WL 1S7TA 5KS9B 1IAIL 1J18A 3DROB 1PY4A 2MNUA 1EHAA 1TTUA 1CFSB 4YHOH 4OB5L 4MAYD 4NKIH 1TPXB 5D8JL 3RVUD 2R4SH 4KWUA 1EO8L 1HNFA 3VFNA 4HJJH 3U0TA 3HPJA 4M1CD 4ODSH 4YDLC 5J8OA 5TH2A 3I3EA 1YDPA 4KJYB 3AROA 4PLKD 5CUSH 3K1KC 5AYUH 1IGCH 3K8KA 3TPUB 3ULVC 5MI0C 3KLHD 4E5XA 3FQWA 3TBWB 3FOLB 3QXDA 2JJTC 3A6CL 4MSWA 2JJTA 5BS0B 2DQEL 3RDTC 3ZE1F 3EJYD 3MLSH 3O11A 1MCRA 3P4NA 4QRSA 1MHPH 3VFVA 2Q20A 5I15L 5DK0A 4N0YH 5HJ3A 5JOPD 4M02A 1P7QA 4Y4FB 2X1XR 1RSFA 4JZNB 3D0LB 2AEWA 5GGSA 4JO2H 2DM3A 1C16A 3NPSB 1HWGB 1II4E 2X4PB 4S1RH 2R2EA 2X4TA 3VCLA 1FJ1B 1YYLH 2QR0A 2A9NH 25C8L 3QQNA 1MI5B 2YSSB 3U7YL 4JRXE 5EZOH 3S3JA 3FTGB 1BWWA 3MLTB 2OJEA 2FZ3A 1U3HB 3IYLW 1KBGL 1A7OL 1FGNL 1LK3L 3HAEB 1TJHH 1H3GA 3VRIA 3RL2B 4R90H 5JNYA 1KTLA 4R6UA 3WV0A 1MFDH 5F3BB 2P43B 2NXZB 4FQIL 1QFOA 5ENWB 3GSNH 4MHHI 4HGMA 1UWXK 4YQXH 3HFML 4OKVB 2YS4A 2OTWA 4I2XE 5DQ9B 4P3DB 5DYOB 4LPXA 4H26A 4XXCC 4HXBH 5CILH 5IW1B 3KYAA 4MCZB 4XXCA 4MNGE 2QADC 3MA7A 3F62A 4RX4A 4X8JB 2GW5A 2ZSWB 5HYJD 2WWKT 4QRUA 1S5IL 2FHFA 3I3DA 5CKAA 5FGBA 1IFHL 3VFPA 3A67H 3FB6A 1EH9A 1DEDA 3RZCB 5MHSE 4WWKC 3PV6A 3SQBA 3QEQB 4JM2D 4WWKA 1MWAL 4JRXA 4F7EB 1DVFC 1R24B 3CLEL 5I1KL 3DI2B 3KNBB 4FFZL 2FB4L 2YPKA 3NA4A 3MLXH 3GGWA 5KTEH 4KK5C 3T8XA 4KKCD 1U8JA 3DUSA 1WZLA 3BH9B 1RUAL 5BZDB 1JL8A 3IFLH 4NSKA 3KPNB 4FRWA 3TO4B 4BH7B 1W8OA 3MJ7A 4PGBB 1TCRB 2FX9L 2X44D 1DZBA 3CZFA 3I6GB 1FFOA 2JB6B 4XAKE 3NOIA 3DVNA 4CADA 3EYSH 4I2XA 3F7YA 5EBMA 4J3SA 1MJUL 1KIPB 3JXAA 3LD8B 1OT1A 4KY1H 4CMMB 4QHLA 3MV8B 1HYSD 1S9WA 3MRPB 5TDPB 3EAKA 1PEWA 5EB9A 5TDNB 5E08H 2YMXH 4OCRH 2VLMD 5F9OL 5ICZB 1GAFL 4OM0H 1AC0A 1FZJB 4CVXB 2LVEA 4HZLB 3QJHB 4F7MB 2NQCA 5D7JC 3HMXH 5E8PB 4RGOH 1YNTA 2VKWA 1O0VA 5D7JA 4LSSL 2YPLB 1DANT 2PR4H 3CFCL 4FQLL 1UYWH 2OL3B 3PP3K 3CCHB 3GMPA 3KS0J 5INCB 5T5NF 4WFEE 3BGFB 1C7SA 3P40A 2A9MH 1JIBA 5C0BA 4LSTH 4XCFL 3GIZH 1MCNA 3VDAA 4UTAL 4AEIH 1A0QL 2KZWA 1J12A 4GRWH 1DE4A 1H5BC 2IMNA 4TNWF 5ID1A 3GIVA 1AGDA 4PP1D 1H5BA 1MCJA 4DQOH 5I17B 2FYYB 1W0VA 1MCCA 3RTQB 2B1AL 2V2WB 5GRJL 2F19L 4TUOB 1EHNA 4ZOBA 1JPSH 4X6DF 1NBVL 3HUJF 4M3KB 2MTPA 3O8XD 4UB0H 2XT1B 5JZ7C 4DVRH 2CK0H 3HN3A 4AMKL 5L9DH 5E2VL 3BP5B 1OWWA 2P8LB 2E6PA 3BGMA 3FT3A 3GJFB 2WBKA 4QGYA 4RRPG 3ZKMC 4ZUVB 2FR4B 2AVGA 1MHEA 2BFVL 4TRPH 4PRPD 5BV7C 5BS0E 3WDJA 2MFNA 2VISB 3EDKA 3P3YA 2RQ8A 1A6UH 5DMGD 2DLGA 2Z92A 4GAJL 4IRSC 4JVPA 4JPKH 4H0IA 2KDGA 1JN6B 5JDJA 3WIHL 4GW4B 4KK9D 4N8VB 1A6WH 1XGTB 5EZLB 3CC5A 1KGCD 2B7DT 3QDMB 1TPXC 1MI5E 1IL1A 3NFPA 4FQ1H 3EOBB 4HF5L 1JGDA 4LSVH 3H9SD 2LQRA 5GSVA 5TE4L 1Q9WB 4YR6B 1Q72L 2JLLA 3SDXF 1FGVH 1K85A 4X7DC 1SEQL 5DMKB 4R7DB 3HC0B 5BZWA 4FTVB 1OTUD 4PJ8D 2KL6A 3LKQA 3UTSD 4KJYA 5IIEB 5TQ0H 1CDUA 2HKHL 1SYVB 1OARL 1CLZL 4KVNH 3INUL 4G6JL 4KAQL 4YK4B 5KSUB 2FRGP 2AK4B 4BKLA 5DTFA 3QIBD 3F7VB 3ARXA 2ATPA 3TBWA 3QWQB 1W72B 3BD4A 4HWEL 5JR1L 2J88L 3RFZC 1B90A 4NYLA 3HC4L 3MRBA 5DR5L 5BS0A 2P45B 1UM4H 1KV3A 2X9YA 5C0BD 2CMRL 5EZIL 4Y4FC 2PYFA 3BQUD 4AT6B 3FQRA 3NPSC 3KXFD 4JZNA 4LLUA 4NZUL 4NDMA 1HEZA 3FO9B 4LVOC 2VE6B 2X4PA 2Q7NA 1FJ1A 5C07B 3CFBB 2R15A 1MI5A 3QO1A 1D5ZB 4Y2OA 3ME0A 1U3HC 5CEYA 3R8QA 1QKZH 2AS5M 1LE9A 1U3HA 3FONA 3UBXG 4FABL 3H42L 4RMSA 1GGBH 4JHWH 1ZMYA 5CJXC 4XNQB 5KG9A 2X6MA 4J4PC 3LV3B 1QO3B 1MQKH 1P2CB 4J4PA 3S96B 2RR3A 3OG6B 5ENWA 2E9BA 1NEZB 1XFPA 1EFXA 4OLUL 2H32B 3BT2H 2EYSA 5EFIA 5DQ9A 4C56D 3MGTB 3T77A 3LHPH 2P47B 3GSVB 5ICXA 3SDCD 1UJTA 3MV8E 5GS3A 2DKMA 4R97B 1Z9OA 2RIKA 3MJ8B 4YO0A 5DUML 3ARGB 4MQTB 3TYFA 4P99A 2IANB 4PTUB 2BNQD 2VXSL 3RZCC 2APWA 4OCWH 4YNYB 1G9EA 3MRGB 3MRJA 4IMKC 4WV1A 3S97C 5IVOA 3RZCA 4JFHE 1ZANH 2BNRD 4IMKA 4O02H 2G9HB 3BE1L 5CWSA 3SCMD 1Q94A 1QLEH 2BC4A 1QLRA 5T1MB 5D6DA 4HMCA 4IRZH 5FYJU 3ARFD 3NFSH 1L7TL 4KV5E 3QIWC 2IPKB 1F90H 4JB9L 3BH9A 3QIWA 2FECI 4R2GD 4Y19D 5EZJB 1XIWD 3TO4C 2JKXA 3R0MA 5BZDA 1W0WB 3I2CH 1QLFB 3KPNA 3TO4A 4ENEC 1Z5LA 3D18A 4PGBA 4OM1H 4YXLH 5C9JA 3QPXH 1TCRA 4NKOB 2Z8VC 5I1LB 4KGJA 3I9GH 3QI9D 1RUQL 3LD8C 4OD2B 3C8KB 3TT3L 1EEYA 1SJHB 4CMMA 1MCWW 3MV8A 3MRPA 1H3VA 4MS8D 5IK3B 3KPRE 2CJUH 1WWCA 5ICZA 2FX8H 2R1XB 1QNZH 2AEPH 2XG5A 1FZJA 4CVXA 4KKLC 3B4NA 3O2VH 2UWEF 4F7MA 2VDRH 3L95B 3RVVC 3KYOB 4J3UA 2DLFL 3RI5F 2D4FA 1KJ3L 5F1NB 2X4NA 1T7VA 1TENA 3BGFC 3EO9H 3UZQA 5IFJB 3M8OL 2H9GB 4UV4L 2EXWC 5IF0A 3CXDH 4P9HH 1KB9J 3PXHA 3UYRH 5CINH 1YECH 2XN9E 3QDME 3V4PH 3GNMH 4YHKL 1UWXH 2H1PH 4HK0B 5LQBH 2CSPA 4HKBB 4ONHA 4YBLB 5F89B 4JG1L 1RZGB 3RTQC 5C0ND 2X05A 1N7ML 3QH3A 2V2WA 1HNGA 1XGQB 5IGXL 4IOIB 1HH9A 3NIFF 5T3XE 1YEFL 4QCIA 4JJHA 1RUMH 2F15A 4ZUSA 4B41A 1KTDB 3VXMB 3AS3A 1UG9A 5JO5B 4NN6B 2ZUVA 1JHLL 3UAJD 3BP5A 4NP4H 2HJKA 4KQ3L 3KPRA 3VXOA 4H5SB 2AK4E 2DIAA 3GJFA 3S34L 5FIEA 3BKJL 2FR4A 3GSQA 4GAGL 3L6FB 4Z0BL 3ARVA 2HT3C 5I0DA 1A9EA 4OLYH 1NGXA 5CHNB 4YEEA 5T1LD 1UZ8B 4CDHA 5I8CB 1U41A 5SWQB 5IB4B 2VZSA 1JN6A 4KJPC 3UJTH 2ID5A 5F7EH 1CGSL 3WXWL 4K07A 5C07E 5I75B 3GZKA 2XN9A 3QDMA 3S4SA 1A7BA 1CDGA 4GG8B 1NCCL 3HRPA 3RWFB 3O2WL 2PN5A 4J6RH 4Y8AA 3ARDB 2ICES 1IC7H 5ACZB 3LN5B 1Q9WA 4YR6A 1J9CT 4RFEB 3U0WH 4OBRA 1A3LH 1ZHLB 3PL6D 1JYNA 1KPUA 5C2BH 4XXDA 5FYKH 1RJYA 5JOFB 2NY4D 2OR9L 5IIEA 3IKCB 3FHAA 2HTLD 1KCLA 5AWNH 3TYGH 4YK4C 3NCMA 4UINH 3DGCR 3AREB 3QSKB 1I8MB 1F6AB 4LNVA 4ONOA 5KSUA 3F7VA 1FNGA 2RAMA 3IU3B 1MELA 2EIBA 4M7ZC 4A2MA 3CFKA 4C57C 5E00B 5F7KC 4DKFL 2E5EA 2VDKH 2MCPH 2VR4A 2GJJA 2H2SD 3OJMB 3KYMA 2W59A 2IANE 5GJTL 3FHQA 4Y4KA 2EEDA 1DDHB 1SMOA 2EO1A 4YHPA 4ZPVB 5C07A 1JTTA 3QUYC 5IM7B 1D5ZA 4LOUD 1U91B 3VXSB 1Q0YL 3UJIL 3QUYA 4WHTB 3DX8B 3B6SB 1P9MA 1J0ZA 4WY7H 1TLKA 3BW9B 2QTEA 5E8NA 4D0BB 4M7JH 4PJXF 5HGHB 4G8GB 5L0QB 3VRLF 4JQVC 5INDA 1QO3A 2APFA 2WUCH 4JLRB 5DQDL 4Q2ZB 3ZSTA 1D6EB 3OKOB 1ADQL 1JYWA 4G9FB 4XCEA 4U49A 2CLRA 4LVNB 2HFFA 2R0LH 3D9AH 4TVSa 1KJMB 3DVIA 1M7DB 2B20A 2H32A 2NY6B 3BDXA 3VGHA 1BQUA 4XMPL 4RIRB 2VABB 1LD9A 1XGPB 3GSOB 4CJ0A 3ARGC 3MJ8A 1SBBA 5A43C 1KFAL 2Y06H 3ARGA 3HTLX 4ODHL 5LCVL 3CDGB 3BOVA 5GS0D 2GITB 2IANA 3QUMB 1T03L 2WNGA 1GC1L 5DD5L 3GSUB 4BUGA 4D3CL 4PD4J 1Y6MR 4P3WA 4YNYA 4AIXA 5D7LD 4ZAKD 2VDNL 1A6ZB 1S8DA 2NY7H 2G9HA 5KVFH 3BPOB 3QIUD 4JFQB 5CLTA 5JORB 1KLGB 3BEWA 2E6JA 3EHBC 3S35H 3MMEB 1QFPA 3VXNB 3NMEA 3B8YA 3MCLH 1OSPL 3WSQH 2APVA 2IPUK 4WUKL 4KJWC 1OSZB 4LQFH 4LLAA 2A77L 4PB0H 5I8OL 4WHYH 1RFDL 1W0WA 4DKAA 3BMWA 4P2RD 1NMAH 1MVUA 2NTSP 4L5FL 1EFQA 2N7AA 1C12B 1INQB 5CKGA 1T0PB 4QXGL 3KPPA 1AKJB 1OTSD 4NKOA 1A1OB 4MNQD 5I1LA 2AXGB 2XZZA 1M1SA 4ISVB 3W9DB 3PWVB 3MRIA 3VXME 4X5WA 1FPTH 4Q9QL 3TA3D 1R3LA 2IADA 3RKDC 9CGTA 3HRZA 4XH2B 3IDGB 4Y4KD 1FFNB 1Z0MA 2CKNA 5IK3A 1I7UB 1NCNA 2R1XA 2XTLA 4KHXH 1GHFL 1EGJA 4MXVF 2DBLL 4U1SB 2EDYA 1TZHA 1H15B 4LAJH 5CJBA 3NAAL 3DX6B 1V7NH 4FFYH 4UT9H 1VEPA 4I0KA 2QQKL 1ZGLM 1DFBH 5IFJA 2CIKB 3G08B 1M4KA 4IRJD 1HXYB 1T22A 2H9GA 1NCAL 5I18H 2NY1D 5C0CE 3MUY1 2E7MA 3C5JB 3HMWL 5EO0B 4YWGH 4K3HA 2VAJA 4YBLC 1YY9C 4HK0A 5M94B 1S7SB 3DBXB 4NUJA 2DTML 1M7XA 4JFPB 3NIGF 1RZGA 3N85L 5BO1H 5E1AA 4LFHG 1UM6L 3E8UL 5CZXD 1X5AA 3BRGC 1CIDA 5FV1L 4OJFL 4QTIH 4LSQH 3HB3D 1F58L 2ZNXA 2NY0D 4DFHA 2ITCB 2J6EA 4NN6C 2ED7A 1EA9C 1JGLL 1KTDA 3VXMA 5JO5A 1AXTH 1AQDB 1I1AD 5ALCH 3WO4B 3F6LA 1S7UA 2DRUA 3ZTJG 4H5SA 2IWGA 1Q9KB 4HH9A 1CVRA 3T0EB 4NZRL 4NKQB 5A2IH 3L6FA 1E28B 4KDTA 4TULL 5DK2B 4Z7VB 1Y6KR 5J0BA 5CHNA 5IJVA 1FNHA 1UZ8A 1OL0A 2FL5A 5K59E 1CDHA 1GIGL 4JFDD 3QJFB 5IB4A 5DURD 4FQPA 1XR8A 5C0CA 4X7FC 1KCRL 5I75C 4U6XB 1A3RH 1ZLUK 3VFGL 3LS5H 2ADJB 1IKFH 1P7KB 4GG8A 3ARDC 2WUBL 3VXSE 3D48R 4X9GA 3RWFA 1K8IB 3WBDA 3ARDA 1QFWH 1JF6A 4IDJL 1TFHA 2XOTA 4WUUD 2WINB 3TT1H 3JV4B 4YC2B 4RFEA 4N0CD 4G8GE 1B6UA 3S5LA 5ILTH 1RMFH 4H0GA 1I9RL 1NC2A 1OCWL 4PG9A 2YK1H 5C8JA 3P30H 4RGMB 5DDHA 1HQ4B 4F9PC 2XZCL 3VG9B 3AREC 3STLB 4E42B 3TIEB 3GM0A 5HYSA 3CMOH 2EDOA 5C71A 1KIQA 1I1FB 1B9ZA 2B1HH 2YUWA 4PJIF 3QHZL 3IU3A 3X11B 2GCYA 3BZEB 1ZS8A 2YPVH 5C09D 1ORSB 3KJ4B 5E00A 4BSWB 3TBTB 4NQXB 3I3BA 3MJ9L 2X4RB 3ZMRA 1MY5A 5DUBB 1NFKA 4G42B 5E4EB 2A6IA 1KXVC 4EUPH 1DDHA 5LGKA 3S88L 4LEOA 4R4FL 4JDVA 1XMWA 3BO8B 2IC2A 4UIKL 1A5FL 3WFBH 4JGUA 3VXSA 1OPGH 5I1IL 2VDQH 4PB9L 3DX8A 3B6SA 5DEFA 4JY6A 4WW2B 1DJSA 5MEND 1IGFH 2YN3A 5E2UH 5L0QC 5TQ2H 2VLLB 5JXEC 4G8GA 1E4WL 1FFQA 5JXEA 1MIML 4APQB 3LEVL 1CFVL 1CS6A 1D6EA 4LVNC 3OKEB 4JM4L 5ITFB 4MYWB 2A0LC 4XPTH 3KPLB 2D7TH 5I71B 3ZDZF 1FZMA 5IHZB 1BEYL 2NY6C 4BZ1H 1I3GH 1BM3L 4KGLA 4FXLA 5CZVH 4ZS6C 1JFQL 2YWZA 2OTUB 1OAUL 1DQMH 4XWOC 5DK3A 3T1FB 1MRDH 1OB1A 5D6CA 3GSOA 2XACC 1CZ8L 4L4TB 1JWMB 1T1ZB 1OAXH 4PLOB 1DBJH 2VDOL 1A4KA 3DX7B 3OAUL 1UC6A 2O5ZH 4Y16B 4OD1L 2C7UA 3T2NL 4P46B 4KK8D 3SKMA 4FMFA 3GMNB 2AJSL 4GSDH 4XPBH 1CLYH 4HUXA 1A6ZA 1BQLL 3ZTNL 4U6TA 3MOAH 5FO7B 3ULSA 3PDDA 4WO4B 5JORA 1KLGA 5D96B 4LPYA 5FO9B 3MMEA 2DD8L 4QRPD 1HDMA 3VXNA 1CU4H 1AY1L 5HPMB 3U9UA 4OLWH 4M5ZL 1CG9A 1OSZA 2HTKD 3CIQA 1NFDA 1O7VA 5IHUH 4EVNA 3HZVA 4I3SL 3TNMB 5KANG 2RBLA 1C12A 3AY4C 5F9DC 1INQA 5F7FA 1PFCA 2MQCA 2IPTH 1L0QA 4ISVA 4LSUH 4KHTL 4PBXA 3PWVA 3G5YA 3VMPA 5ETUB 1IM3B 3OXRB 2C9AA 4Y8DC 5IBTH 4XH2A 1CR9L 2J3SA 3NPZB 1I7UA 4DN3H 2R2CA 1U92B 3DARA 5FO8B 4X7TA 4O2FB 3EZ8A 4U1SA 3IDMB 4GRMB 3T0EE 5HHXH 3TBVB 2FEEL 1NAKH