4OD2A

Crystal structure of the fab fragment of an anti-dr5 antibody bound to dr5
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
209
structure length
209
Chain Sequence
SELTQDPAVSVALGQTVRITCSGDSLRSYYASWYQQKPGQAPVLVIYGANNRPSGIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSADSSGNHVVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis/immune system
molecule keywords Fab fragment of drozitumab, light chain
publication title Structural and functional analysis of the interaction between the agonistic monoclonal antibody Apomab and the proapoptotic receptor DR5.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od2A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od2A01
3DX7A 1JJUA 1EX0A 3WLBA 1CFBA 5JHDB 3RU8L 2HTKC 3HN3A 5D7JD 2EDJA 3SO5A 2XWBA 3KPQA 1QTYT 32C2B 3QDMA 4DGVL 1T21A 2IAND 4HZAA 3CDCA 4JDZA 5B8CC 3HC4L 3ARBC 4OF8A 3TGXA 3D85D 1EHLH 3C5ZA 5HYEA 4WHTA 3VFTA 4DFHA 4HWZB 1E28B 3VU2A 1QZ1A 1NFDE 4KY1H 2AEQL 4RAVA 1S7QA 4LVOC 3U4BH 3EOTL 3GJFH 4OF0A 3SDXA 5JOFA 5DD1H 1WBYA 3MLSL 5IF0B 3TNMA 2MPAL 5MERA 1QNZH 5FGCB 1EO8L 1HHKA 2NW3B 4S1QH 4YEEA 1IKFH 2ZUVA 4K7FA 3TPUA 3VWJC 1D5XA 3FZUD 1VB9A 2X4RB 5IHUH 5GS0H 1ETZA 2NLJA 5F9DC 4U1JA 3MODL 1X7QA 5INCA 2W38A 3KYAA 4JRXB 4JO1L 1MHPL 1JZ7A 4BK4A 3INUH 1XGYL 3GRWH 3PHOB 3QNYB 1IGJB 5SX4I 2ZG3A 3CDGB 5D7IA 5HVGB 3QH3A 3L5HA 4RDQG 1U8JA 3BJ91 2FECI 3IU3B 2HJLB 4X80H 5GRUH 3ZKND 2EE3A 2FYYA 3HFML 1LP9F 4P5KA 4Y2DD 2EDNA 4OFDA 3KGRA 3PP3H 1EGJA 1GGCH 4MDIA 3OKEB 1U8PB 3RAJL 4LEXL 4UBDC 3X11B 4IJ3C 1N5YH 4Y4KB 4YZFE 4RBPK 5IFAL 4OM0L 3RGVD 4QOKA 3TYFA 4TQEH 4RGMC 5C07D 3D39A 1HCVA 5JQ6H 5FGBC 1VACB 4LRIA 4X8XA 3C2SA 2JELH 4G8IA 3TH4T 3WSQH 5EU3B 5CEZL 3GSQB 1INDL 4NIKB 3EDDA 4U0RC 4X7EC 1KLGA 2ZUYA 3UXFA 1KULA 2NY3D 4XAKE 4LQ1A 2PXYD 3P0YH 1T83A 1CU4H 4P9HH 3IFNH 1AXIB 3MZTA 3WDIA 4UAOB 4E9LA 3D87B 4NGHH 3O6KL 2VE6A 5I9QB 3QFDB 1AI1L 4MXVF 1N0XH 4YHZL 5DVOA 1LHZA 5D5MA 4TNWK 3U0PB 2KBGA 4ESKA 1E0OB 2MNUA 3OR6B 4X6BA 2J4WL 4YHLH 2IBZY 2ICWJ 4TTDC 1U92A 2IEPA 4GSDH 4NKOB 3MRRB 5EFIA 4TNVF 3CVIH 1NBVH 4K3JL 2LU3A 1FG2A 1ADQL 3QUYA 1R5WA 3VGGA 3I2CH 3QEUB 1EJ6A 3MNWA 3DXAA 3O2WL 3RWEB 2A6DB 2RB8A 4FP8H 3V5KB 4QKXB 4KTEL 5F1SA 4LCUA 1PG7W 4J7RA 2E6QA 1KYOK 1MHCB 2VISB 1PZ5B 2CK0H 2GCYA 2NY6D 2Z91A 4AG4L 4HUMB 4KK8D 5KS9F 3HNVH 4G6FD 2EIZA 2P7TB 2XIDA 5HGBA 5GS1A 5K59E 3EFFB 3OKKA 3NGBC 2HRPH 4OZHA 2A0LC 3CVHA 4NC0B 2FLRT 1KYOJ 3SE4C 3QUZA 2BFVH 5DJAA 5FYKH 1OAZL 4M6MH 3O3DB 1AP2A 1C1EH 3H9ZA 5DZNA 2YEZA 5C0GB 4ODBD 4LHUB 1ZGLM 1KIRA 3D3VE 1DQJA 5DZLA 4AZ8A 4G9FD 1NCTA 4L9DA 1T7VA 3T0VA 2GHWB 3QULB 1HILA 3UPCA 5IW6A 1RUKL 4NQCD 1HXMA 4PR5A 1P7KB 3O4LD 3O4OB 5I19H 4L3EB 1MSPA 2FD6H 1T04A 4EQ3A 3B6SB 4PJBB 1P7QD 3KXFD 5AG9A 1C5BH 1EERB 3L5WA 4ZFOA 5IBLC 5D7KE 5SWSB 3JVGC 4MXWH 4OD1L 1PKOA 4XVTH 1OTUC 3BAEL 2HMIC 5ALCH 1W72H 4PGEB 5FKAB 3ZE1F 3O0RL 2EICA 5DYOB 3TV3H 2BHUA 2EYRA 3RBSA 3RWCB 1ZA3A 4UI2A 5I1GH 3HR5A 4ZG1A 2CJUL 2F74B 4K8RC 5JMRA 3FO2B 4P4KA 2JJWA 2VABA 3WDJA 5IW1A 3GI9L 1MHHB 5ALBH 4M7LL 2KDGA 4AIZA 1JNHA 3LRSB 1WUNT 1J05A 1U93A 3PWUB 1P5UA 4JY5H 3T4AB 4U1KB 3ZT7A 4RMWA 4L8BA 5HHXH 5TH2A 1TNNA 2HA1A 3BXNA 1AKJB 1IGCL 3WS3B 4MSWB 5DA0B 3TVMD 3BRDA 1OD7A 5CHNA 4IRJD 3FO9A 5FCSH 5T1LB 1FZKB 1IJ9A 1J12A 2HLFC 4YGVB 5L9DL 4LOUD 4LVNC 5ESAB 5IG7A 1OTTC 3WIHL 3PGCA 3PQYB 3I6GB 3MFFA 3K2UH 4Q97A 3ARZA 3D48R 5D71L 3FRUA 2V2WB 2PYFB 3CFBA 3BZEB 1FE8H 4UNTA 3PP3K 1N0LA 4GXVL 5JIHA 5KSVA 3UPRB 1GVIA 3QEQA 2VERN 2FCBA 3MRQB 3BGMB 4LLMB 1CGVA 4OFYA 3IDXH 1ZWIB 5IVXF 2G75B 1QKZH 3BH8B 4D9LH 4HWEL 3BPNC 3IJYB 1I7UA 3QCTL 2VDKL 4WFHD 4JFFE 3OHXB 2JIXD 3U1SH 3BEWA 2R0WL 5FCUH 2NMSA 1IAOA 3MRFA 3VE0A 5FUZH 3ULUF 2VXQL 4ZTPH 4EN3D 4ZXBD 2RFXA 3PWPD 3FQWB 1J0IA 5EUOE 3MRJB 1CXHA 3EDJA 4L4TB 1ED3B 2AJVL 4NQXA 3LQAH 4M1CC 1EJOH 2VDQL 3P9MA 3W0WB 2PO6B 3GMQA 4JAMA 2F5BL 2IMNA 2PTTB 1T5WB 4EI5C 5BMFH 5EOQH 3BVNA 4Y5VB 3RNKA 3IAPA 4DKDC 2B1HL 3MV9D 4WFFD 1UB6B 4K3DH 1T83C 3QISA 1XF2A 1BZ7B 1LWRA 3IDJB 4JANB 3QJHB 4OCWH 5CILH 1ZLVK 2CDGA 5DT1L 4ENED 1NCNA 1IGFL 1TZHA 2ZSVB 2OP4H 3HI1A 3MRNA 4DN4H 2ZUXA 2P8PB 1FFOB 5C08A 1P4BL 4LKXA 1TMCB 3CNKA 5I1EH 4LMQE 1DLFH 5SWZB 1NCDL 3GUTA 2X9WA 4N0UE 1XMWA 1FVCA 4JFQB 4UTAH 2DYPA 5DUBB 3MGOB 4OAWA 3TFKD 3QUYC 3B9VA 5AYUL 5FKPA 1QFWH 4JM2B 3RZCA 1NMAL 4NNYB 4R90L 4WTZA 1U58B 2ZZUT 5GRVK 3ES6B 4NBYB 3SDAB 1G7HB 1XCTA 3ZKXB 1RULH 4PJAA 1IEAB 2AAVA 1NC2D 4JFOA 3T0WA 4Y16C 1A2YB 3VGAB 2EH7H 3PWJB 2ICEB 3VW3L 3JZ7A 4RFOH 3KLAB 4MJ6B 4H1LA 2APBA 1T7YA 3QDJD 5GS1C 5HDOA 1NGPL 3B2VL 3BT2L 1J0ZA 1J8HB 5EU5B 2A1WH 4UT7L 4YWGH 1WAAA 5GJTH 5EC2B 2L0DA 3RUGE 5C6TL 1BVZA 2A74A 1IEBB 3CIQA 5T1KB 4POYA 3BE1L 3PL6B 3F7YA 4KQ3H 2BXZA 1JPFA 4NP4L 3MQIA 4RISL 1B6UA 4GG6B 4HIJA 4BUHA 5EU6A 2P5WE 3UTQA 1IL1A 1VCAA 2CMRL 5C0AE 2C4XA 3FOMB 1NKRA 3BQUD 4GG8B 5EN2B 5ILTH 5GGRB 2P42B 4V1DB 3RWFB 1F4XH 2XQBH 4NQDB 2E27H 1JGLH 2VXSH 2CRMA 1MUJA 1B2WH 3QRFM 3K4AA 4KMLB 4ZO9A 4UIKH 1IC7H 4RRPG 5FM8A 3NPSC 4PBWD 5I73C 1YN7B 4JHAL 1P4LB 1Y0LB 3LRGA 4DQOH 2VZTA 5TPWL 2B8OT 2EDBA 1F3JA 2EEAA 4EIZC 5DJ6B 4ZMAT 3HG1B 3B9KC 4F7PA 3UYRH 1CK0H 1JHLL 3TN0D 1MVUB 5KG9A 3JWDC 2FGZA 1NC4A 4WI2A 5DZOA 4BKLB 1PDKA 4U1MB 4ZYKB 4DZ8B 5JZ7D 3FONA 3TO4A 4WFGD 4DCQB 2ZCHH 3VFGH 1Q9OB 1Z9OA 3LS5L 1RUPL 1PY9A 2HTLD 4EOWH 3SY0A 1FNGA 4GQ9H 4Z76A 1YMHB 1KC5L 3QWOA 1MCCA 4PY8J 1QBML 1RURL 4QNPF 2H2SC 3N1PC 4MVBC 4HIIA 5ADOH 1Q38A 4XMPH 5IESL 3DVFA 3QO0A 5IROC 1QLFB 4UTBL 1RJCA 5GGVY 1YUHA 3MCKA 4A6YB 1FZJB 2J88L 5EORL 1K8DA 2OL3B 4FTVD 3X3GH 3ROLA 2XNAA 3MGTB 1UC6A 1HEZA 1UWGH 2QL1A 1YEHL 4Z0BL 1S9XA 3S35H 3MZGB 3SDDA 3L3OB 5F71A 3ABZA 4R96B 4PG2C 1UA6L 5FECA 3VXTB 2VDNH 3O2DH 4Q6IB 5IMLB 4X0KB 2XXMB 2YPKA 4XPBL 4PGCA 4X8JA 4EI6B 1LE9B 1R24A 4DUVA 1X5AA 3ARFD 2APTA 4UDUA 2E8YA 2J8UF 2FBJH 5CMAA 1L6ZA 5FF6B 5D2LF 1RAMA 2FGWH 4D9QE 5DHVB 1CE1L 3UJIL 4CADB 4ZPTB 5I2IA 3L3DB 4U0QB 2I25N 4PJ5B 4WI4A 1JYWA 5E6ID 4QXUL 5EO0B 1Q9KA 2BVOB 1N6QH 1EGJH 2W60B 3NVQA 4NO0A 4OGYH 2CLZB 2C7UB 2HYMA 4N8PA 4P5TD 1E4KA 2XZAL 1OGAB 5HYJD 4HAGA 3I02A 3S96A 1UKTA 3CSBA 4IHOA 1RHFA 4JPWL 3GIZL 4HLZH 1NCAH 2AK4D 1YQVH 3BKJH 3K1KC 5IV2A 1RU9H 3WKNA 4JB9L 1INQA 3QI9D 2VXUL 4I4WB 2OQJB 2W59A 4NHCH 4APQC 1A1OA 1MEXH 4PJFA 1S9VB 1CL7L 4PGBB 1Q9LB 4F9LC 1SHMA 1G9NH 3MBEC 2HFEA 4MJIE 1DQDH 4D94A 5INDB 4XCFH 4TSCL 1BIIB 4KQ4L 5KSBB 3IGAB 2YD1A 2YZ1A 3IDUA 3U83A 5D6CB 4QRSB 1J1PL 2VDMH 3P77B 3FB6A 4Y4FB 5EIIA 5HVWA 3T0EE 1MPAH 4HLZG 3FB7A 5DUPL 3PGDB 3CLEH 4GMSL 1NBYB 1T0PB 5TDOA 5KTEH 5MEND 1CLOL 3EGSA 5L7XH 5K93A 4N8VB 1KPUB 3TNNB 2NXZC 1T89C 4HS3A 4A6YH 2DM4A 3QO1A 2OL3H 1HSAA 3AUVA 1S78D 2IADB 1M6OA 4P23C 5T3ZD 5TE6H 5D1ZA 3VRJB 1A7QH 2WBJA 2Z4QB 2IBZX 4MXVE 3W5MA 1RUML 4OZGA 2VQUA 3RTQB 3CVHH 3QQ3A 1PSKH 3VFNA 1HHHB 4XNUL 4PFEA 1R5VB 3HCVA 4LFHG 1IGMH 3EDKA 3DGGA 4MNQB 3VFSA 3FQTB 4C54A 4MZ2A 2OJEB 1GGBL 5DTFA 4JN2A 4IM8A 3C09C 3WNNA 4LNRB 5BVJA 2X10A 1OHQA 5I1LA 4JG0H 3C5SA 5IK3B 2BXYA 3VXUA 5C0BD 3T4YB 2H32A 5ESQB 5SX5H 5TE7H 3HNTH 4OD2A 3IVKA 3UBXA 3MLVL 4XP6H 3EHBD 2YS4A 4WI7A 1VADB 1QR1A 1ZHLB 4JFEE 1D5MA 4JQIL 1T66C 4XPFL 3TCLB 4KI5D 1MH5B 4RA0C 3DROA 3O3EA 3GGWB 1ADQA 2EECA 5KS9E 5CKGA 3DUUB 4YDVA 1I8KA 1EK3A 4WEBL 4F9PA 5A3ID 4OT1H 3S37L 3CH1B 1NGQL 1XR9B 2YPLB 2UYLA 4UB0L 4FFZH 1U8NB 2GFBA 1QRNE 1T0NB 4HULB 1WZ1L 4L9LB 1YMMB 1FFQA 2VLME 4XHJC 2NY1D 5GZOC 3QFJE 3WS6A 4BFGA 3TO4C 3HI6H 2IANA 1AHWB 1L9MA 4NWTH 3MLWL 4XT1C 1PYWB 2IPTH 3GSXA 5L2KB 3P4OB 4R2GD 4Y19B 1I7ZB 1MCOL 1AGFA 3ARTA 5EULV 5CD5C 1ZK9A 5KSAD 5DRZB 3TBVA 5KOVC 5EZLB 1ZT7B 4Y8DC 5E99L 4X9IA 1DFBL 1T6VN 3FQNA 3AS2A 1UQSB 3WO3B 5DJYB 2GJ6E 3MO1A 4N90D 4HG4K 4K3HA 2Q87A 5D7LD 1CZ8H 4PRIE 2X1XR 2WK2A 1UEYA 1IAIH 5B4MD 4FFVC 3QIBB 4PLKC 2YA2A 1CICB 1XIWD 2KQMA 1P4IL 3V6FB 3BZDA 3RL1B 1C08A 3BO8A 5DR5L 4N0YL 2A6KB 5D6DA 4QYOB 2I24N 3MRKB 3PDOA 1MI5E 1D7FA 4HG4J 1TETH 3NIGF 2BNRA 4Z95L 3UTSB 5A43C 3BPLB 2X4UA 2P4AB 4M93C 3NN8B 2R1XA 5LBSH 2J3SA 1RK0B 4DKEH 5HHVH 3T65A 5IB3B 5GGSB 3CFEA 5I1IH 1RZFH 2BERA 2X44D 3VGDA 2AQ2A 2B4CH 2DQIL 1S7WB 1CD1A 2NY4D 3H0TB 3QG6B 3O41A 1AH1A 2VR4A 3LSOB 3HE7A 3SPVA 4NT6A 3KYNB 2EXWD 4OF7A 1GL4B 2GJZA 4L1DA 1WWAX 5ANMA 5C07A 3GMPB 3U6RA 1EH9A 1JGVH 5I17B 3ZSSA 5DI8A 4MDJB 4OKVA 2NNAA 2M1KA 4JREC 1PKQB 2B7DT 4WVRA 3TZVB 4HFWB 2PXYA 2Q8AH 1Q0XH 3ULVF 4TULH 4Q9QH 1SYSB 4QT5B 4X6CA 1OM3H 4CDGC 1NLDH 1RK1A 5MEPB 4JZOA 4UT9L 4N0CD 3IETB 3KJ6H 3T08A 4EDXB 5EUKA 3KPOA 1E4XH 1GOFA 3QXUA 3VFOB 4O9HL 4R3SA 1DUYA 1N4XL 2BP3A 3MNZA 3ILQD 4TNWF 4H26B 4GKZB 1JPSL 2FEEL 3PF2A 3RKDC 3EYSH 3QPQC 4QEGA 3ULUE 3UROR 3FFCB 3FOLA 5CJQH 5DJZA 2P44B 2JCCA 5DD6A 4EBQH 3V0WH 4CAGA 4R4BA 3ETBF 2DQTL 5BOPA 3QIUC 3DVNA 1YEGH 3CFKB 2WBWB 3PXJA 3BWAA 5KZCB 1EVUA 3O11B 3G04B 5F1OB 1OSZB 4LCWD 4RGNB 4G43B 1C7TA 5F7HA 1TZIB 5IOPA 2CIKB 3DX8A 3MUZ1 3X12B 4C58B 2G9HA 3BZ4B 4OKDA 3DUSA 5DMIH 4P46B 1FFPA 4H1LH 5F96H 4MB3A 1MWAL 1WZLA 1NH6A 2PNDA 2WBJC 4POZC 3ECBA 3WN5A 5EWIH 3IF1A 5SX5K 3O6FD 4O02H 1F4YL 1CT8B 2WWMD 1NBQA 1A9BA 1C5DA 1U2CA 5DQ9B 3BH9A 3QUXC 5CZVL 3DV4A 1FSKC 2WIIA 4Q0XL 1KB5L 1OPGH 2XZQH 2NY7H 4MD4A 3PDGA 4NKMA 2CUIA 5LGKA 1T2JA 5CINL 5I8EB 3BHBB 4LPCA 4XH2A 3LKQB 2XTJD 2FX9L 4X6DB 2FBOJ 3GSVB 1MF2L 3LB6C 2VYRE 4GS7B 5IP4A 1DQQA 5H94A 4KV5F 4XVSL 4UV7H 4PJGE 1T0MB 1AO7E 4NQCA 4DVBB 3O4LA 4QGYA 4NQEE 4KJQC 4WUUB 4M7LT 5KVFL 1E6JH 4AY0A 3Q6GH 3MV8D 4ZAKD 3KXFA 1RY7B 3P73B 5E9DB 5TGBA 1JWSA 1J10A 2Q7NA 3AB0B 4F9PC 5CD3B 4ETQA 2OK0L 2RQ8A 3HMXL 1PQZB 3B2UC 4KRPC 3AREA 2Y23A 1MREL 2VDLH 4LNVA 1FJ1A 4X6EA 4GLRH 5DQDH 2ZWLT 3W9DB 1MCDA 43C9A 3C8DA 5E00B 4XP1H 1TJHH 3WS6C 1BX2B 4F33A 3C9NA 1Q1JL 3S4SA 8CGTA 1FAIH 4HMDA 1RUAH 4PJEA 3L7FA 2QADD 1JUFA 1EFXD 2IPUG 4RNRA 3RI5K 3RVXD 3LPGA 1NLBH 1I1FA 5HHOE 2V5MA 1TTFA 1UWXH 4LPXA 4FXGA 2BNQA 3DNKA 1JZ6A 4MX7A 2OS7A 3TVMA 2X4QB 1QFWI 4HV8B 1MCBA 4IRJA 2GTZA 3IDYC 4JR9H 4QHUA 4HD9A 4L8CB 1JHTB 5F1NB 4YE4H 2ZUSA 4GRLD 2E6PA 3PWVB 4FZEH 4OIIH 3IFPB 3TEUA 1RZIA 4X9GA 1H3UA 3BKCL 1VFAB 1EEZA 1YY9C 2O5ZH 1G0DA 1QP1A 2EEBA 1PY4A 4PB9L 4Y5YB 1B0WA 2JK5A 2I26N 5E8DH 4M6OL 3ARGA 5D6DC 1A6VH 4OCMC 5F89A 4PJIB 4QNPE 4ZPVB 5IB4B 4F3FB 4HUVB 4DN3H 4KZDL 5BZWB 2D7TL 3X13A 4Z7VA 4KKAC 4U3XA 1YDPB 1LDSA 3QRGH 2IAMB 3D25B 1WK0A 1MRCL 2XN9E 2NR6D 1XGRB 2BVQA 3BIKA 3U0WH 3EJZD 4PRPB 3RU8H 2R9HD 2HKHL 3VRIB 1K8IB 1C16A 4KK9C 3KPMA 4YX2H 4OF6A 4DGVH 4PB0L 3F12A 3CFJA 4EN3A 3HUJF 3P9WB 4ZXBA 2QTEA 1KCVL 4OZFB 1BWWA 3PWPA 4PJXA 3LOWA 3C6LA 1OGTB 2EDHA 5D7SH 3NA4A 1GOHA 1NANH 2F54D 4MCZA 3HZMB 3HE7C 4XNXL 2Z31D 4Y4KC 1X4YA 3E0GA 5F7NC 4NNXA 1A9EA 3I84A 2X4SB 2XWJB 4L3AA 3P4NA 5D7JB 1PG7X 2AEQH 3TA3A 4CMHC 3CCHA 4PJDA 5DURB 4RWYL 4ELMF 4HMEA 1A6UL 3GMRB 3N85H 1KCSH 4KKCC 3MV9A 1ZGLB 3MLSH 3GBNH 2XXCB 5J1AA 1MJJA 3L3IA 3LH2H 1EO8H 1YC7A 1AD9B 3D85B 3K81A 4DWHA 4M9OA 5AAWA 1U8HA 4DTGL 4Z7UB 4HJJL 5J8OA 3CXDH 1S7UA 4BH8B 4G8GB 4TVPL 4FFWD 4XMKL 4G5ZH 5I9QC 1MFCL 4XTRD 1WBXA 2UWEF 5E2JA 1N7MH 4DOHE 4JO1H 1ACYL 3P0GB 5F9AC 1UWEH 3AS3A 4XVUC 5I15H 5HHPA 3WD5L 5FM5O 3RL2A 1BQLH 4AH2A 1RZ8A 4I13B 1G7JB 2H8PA 3QJFA 1NGXB 5ID0A 4CU7A 4IRSD 2AI0H 2AV1B 1TTUA 5DC9B 4PGJA 1YEDA 2Y7QB 4BQ8A 1MCEA 2V9RA 4Y4HD 4TRPH 3RAJH 5HYSG 3EJYC 3LKSB 4LEXH 5C09A 4R4ND 2GEEA 5CFHA 3CC5B 3VMNA 3MRGA 5IFAH 3RNQA 4JJ5B 3GMMA 2C3HA 1HWGB 1GZPA 4P2OD 2DKUA 4GO6B 4UQ3A 1HHIA 2CKBL 4YXLL 4W4NA 2AJUL 2QEJA 3GM8A 2BNUA 1I3VA 4XNQB 2X1OA 3QDJA 4Y2DB 5CEZH 2HT4C 3ARDA 4YC2C 2VL5A 1RIUL 2GAZB 1FAKT 2X4NB 5JOPD 5EDXA 4MA3A 4J4PD 5T3XD 3RGVB 2R2BB 3PIQA 2EZ0C 2IPUK 5LQBL 4JRYA 1OL0A 3O6KH 2NZ9D 2H32H 3DV6B 1TNMA 5EBGA 4F37K 2ARJA 3DIFA 1V3KA 1JV5B 1XCQA 4JKKA 2NY3B 1QBLL 4UDTA 1WVZA 4HBCH 4AEHL 1TZGL 4K3JH 4LIQL 5DMKA 4HGMA 1LNUA 4BSWA 1S7TB 3ZDZE 1ADQH 3GEWB 5B38B 4H0GA 4LSVH 4ERSL 4ETYA 3I50H 3O4OC 4BQCA 1DE4A 3LCYA 4MS8C 1QFUL 5GSRA 3BP7B 3MRDA 4X4ME 4KTEH 3ZKMD 4U1HB 3LKOB 3BPCA 4OM1L 2BJML 5DS8A 2ZJSH 2RJMA 4AIXA 4W6YB 3V0VB 3G6DH 4JDVA 5C8JB 3H9HB 3FQXB 4AG4H 2ESVE 3ZSTA 3AREC 4WWKA 4C56A 4N9OB 1P9MA 1UWXK 1INEH 2ADIA 4RFEB 3UBXG 2DQHL 2BOCA 4LARH 1A6TB 2ZOKA 4U6YA 3SBWC 3R0MA 2AABL 2AERT 3FMGL 2BDNL 4JFYB 5IQ9B 1DBKL 1ZSDA 1UXWB 3DMMD 2E8ZA 2VDRH 1OAZH 3VDAA 2NY6B 3RJDA 2ZOLB 2QSCL 5DK2B 2V2TA 4NUJA 3D0LA 2LV4A 4P59L 2NY0D 3HZVB 2ERJC 43CAA 2IF7A 1QSFD 3DRQA 5F93C 3CGTA 1YNLH 4ZS6C 1S5HA 1SY6L 3H7BA 1IAKB 4M3JA 4LLQB 1FZOA 5KAQG 1N2RB 2VNCA 2FL5A 1HHGB 5K9OB 5EOTB 1H5BB 2HFGL 2AJ3A 3HHRB 4HJGA 5D1XD 5DSCA 4GMTL 1SYVA 5LAXA 4PJ8B 1FP5A 1DR9A 2VXTH 3FB8A 3MRMA 5IEHB 3RPIB 4YHOL 1QLRA 3E1F1 3ARGC 4JDTH 4LLWA 1JWMB 2X89A 4Q2ZA 4U1GC 4G9FB 2YSSA 3L3KA 4OD1H 4X5WB 2QLVB 3BAEH 1GC1C 3C60D 3V6OA 1K4CA 4Z7WA 4YHPA 2FZ3B 2NYYC 5E6IA 3H9SB 1BEYH 3TBTB 1KTLA 15C8L 5DFVC 4P2RE 3L3JA 2DD8L 2VITB 1P7QB 4FQJH 5DLMH 1RZKH 4LVHB 2CJUH 4NDMB 4MWFB 4KUZL 1EO7A 1HH9B 3GI9H 4M5YL 4B5EA 5AAMA 1M7IB 2MSPA 3C6LC 4YNYA 2MHAA 3D3VD 4PP1D 3IJHB 3U0TA 4R7NB 1A6AB 2YKLH 5C0CD 4CVZA 3L3GA 1K4DB 4BYHA 4DKAA 4FABL 4XI5C 3QI9A 3NIGE 4UIMB 1RIHH 4N8CL 1MFDH 1KXTB 3TA3C 1JNLL 2Z8RA 4FRWA 2IGFH 4LLYB 3STLB 1XZ0B 3BSZL 3KPSE 1JGEB 2FJGB 3M07A 5K9JL 2MKWA 1NKOA 1U8MB 3AROA 3AXLB 3IKCB 2VZ3A 5GZNC 2AJYH 3VXMA 1T6WA 4ZOCA 3I3DA 1MQKL 5C0DA 2A6JB 1LGVA 2OTUA 4GXVH 3GHEL 3V4VL 4KKLC 1DVFD 5JW4Q 2YXMA 4RFNB 5IMMB 4HH9B 2X4PB 5AZEH 4HWEH 1CFSA 5IJVB 2VDKH 4WU5A 5ITFB 4G80B 2R0WH 4IRZL 4O5LL 3WNLA 1LK2A 3CU1A 1G6RB 1A7RL 1ZT1B 3QR2A 1IAII 4RWHA 1KOAA 3OKMA 4X98A 3GKWH 5CEXA 4NC1C 1IM9D 2I07B 3E8UH 1D6EB 2F5AL 5IM7B 4NN7B 5B22A 1DQLH 5TDNB 3OKOA 3VGAC 1T1ZA 1Y6KR 2V9TA 1TJIL 1F00I 5BRZB 3F7VB 3N1QC 4L5FL 2R69L 2JIXB 4H25B 5JPMA 5ETUB 4FOMA 4XMLL 3Q1SL 4QRQB 3MRBB 1N64L 3F5WA 5TQ0H 4PJ9B 3SE3A 4YK4B 4L4VD 4XBGA 1AQKL 4XPHH 2P5EA 2B1HH 4GW1A 4HJ0D 4F7CB 1PJ9A 2GIYA 1S8DB 3P9LA 3G5YB 2LVEA 1FN4A 5C0BA 3U2SB 2GITA 4BQBA 4Q9CA 1T2QH 4DK6A 2HFTA 1I9IL 4MD5B 3TJEH 1YPZE 1P4BH 3PWNA 3MLPA 2ADJA 1FYTE 2I27N 2C3XA 3V52L 3S6CA 4JFFD 1NCDH 4GXUN 1WZMA 1ZHNA 4MQXC 4HKXA 3ZE0F 1E27A 4JG1L 3TBYB 3RWIB 1F6AB 3WFHB 3LZFL 4YGAB 2FEDD 4G6AC 3UDWA 4NKDA 2BY1A 2D7OA 3WFDL 1NMAH 3QZWB 4LBEA 3K4ZA 1KJVB 4R90H 2VOTA 3KLHD 4JPIA 4LSPH 4ODXA 4IMKA 5CJ8A 2W92A 4NBZB 2HLAA 1AFVH 1HYSD 4XVJL 1LK3H 4NQVB 5E08H 3HZYB 3PDDA 1RD6A 4WWKC 4LP4A 3KPRE 1BVKB 1G0XA 4K7PH 3BIAX 1UCBL 1JNNL 4LU5L 4FQHB 4JFXA 1YYML 1MWAA 3SDXF 4JVPA 5F3HB 3BPOB 4M8QB 4ZUVB 5DGRA 3BP4B 1I7RA 5BQ7A 4JHWL 4Q7DA 3CMOH 3UJJL 4UT7H 1BGXL 5KSAA 1HI6B 5IWLA 1NC2B 1KB5A 2V7NB 4WDIB 5ID1B 5HDBF 4JM2F 4HEME 2O5XL 1DN0B 5FUCC 5IKCB 3PHQB 2UZIH 1LD9B 3UC0L 2FRGP 1KTDA 4RISH 4NP4H 3OG6B 5FM4A 1R3LA 3FKUS 4XC3H 4J2XA 5D7LA 4ZDHA 4JZJA 5AYQA 2CMRH 4KGJA 1AJ7L 3IDIB 3GO1L 2GY5A 4GBXB 4QCIB 2DMBA 1YEEL 1G7IB 2ZPKL 1E4WL 4HC1A 4NN6B 5D7IF 3KWWA 4YHMH 2YD2A 3X14B 2R0ZH 1K2DA 3RWGA 3R8BB 5I18L 1S7XB 3MX0A 1KTKE 4M9PA 1VKXA 1FO0A 4JHAH 3S4SG 3L7EB 4BK5A 3N1GC 4Z6AT 3NPZB 5TPWH 1IQWL 3BUYA 3TIDB 4D0CB 3NOIA 3VXSA 5EC1B 3HLAB 1KPVA 4NJ9L 5K33A 3BQUB 1QVOA 1JRHI 4CU8A 5IMOB 4DKFL 4HUKB 3X3FH 1RV6X 3CSYA 3SGEI 4X7DC 1P2CA 4NQSB 2BRQA 2WWKO 3KYMA 1MAMH 1CGXA 1RUPH 4WFEE 3EUUA 3BISA 1HIML 4N9GB 1IE5A 1M4KA 1KC5H 1JPST 1QSEE 2H3NB 4NN5B 1BF2A 4P2QD 3V5DB 1F3DJ 1F13A 3T0AA 1S3KL 3TN0B 3G6JA 4K71C 4IS6B 4UTBH 4NPYA 2HN7A 4KHTL 3UTPD 5C3LD 5EORH 5I1JH 2FJHB 3JTTA 5E94B 4WI6A 3BOVA 1FVEB 8FABA 3SE8H 4QRUB 3ZDYF 4WW2A 1YEHH 2Q76A 2JE8A 4Z0BH 4ZUSB 1JI2A 2GK2A 3DVGB 3O3AA 4YR6A 3GMLB 3MCLH 2AW2A 5DJ8B 2D4FA 1R3JA 2AXFA 2G2RB 4WHCA 4U2ZA 4LRNH 3SO3B 1B4JL 4QRTB 3H8NA 3MRIB 3SQOH 1FFNA 3T1FA 4GLRI 4FTVB 1MRDL 1GCFA 1XF3B 5DJDB 3S35X 4Q9BA 5BS0A 4OZIE 5CWSB 2CDEA 5E7BA 4Z7NF 3SJVA 1CE1H 4J3XA 4ZUWA 1YEIL 1T1WB 5B21A 4C83B 3SE9L 2ARJQ 5FA3A 4ONHA 3QWRD 5DD3L 4DZBB 2DIAA 5HGHA 2IH1B 3EDEA 5DVNA 3U36A 4ZS7H 3ARFB 1SEBA 1Z6JT 1QUNA 3E6FB 1TPXB 1A4JA 5JA8B 1RFDH 3OR7A 1X5YA 2NXYD 4ELME 1MQ8A 4XAWH 4K23L 2R0LL 2OTWB 3DSNA 5JHDE 3CUPA 3RY6A 3VI3F 3MA9L 4X4YB 3HE6A 3MR9B 1EAJA 5IT2L 1GIGL 1H3VA 3CK0L 2VC2L 3PNWB 1ZVSB 4X5LA 3S34L 2OBGA 3GIZH 2C3WA 2CDFB 4ODUB 3O6FA 4FQXA 2AK1L 1RJYA 4JB9H 2MFNA 1A5FL 5FO7A 1G7QA 4OCRL 4P3DA 4WUKL 5HD8D 3N9GL 3NCBB 4DJMA 5JOEA 4P5TB 4QRPD 3WEXA 3NH7H 4QY8B 5FIEA 3DGCR 5HYJB 5F88B 1X6LA 4D9QD 2DQUL 1A3RH 5D2NA 3VH8B 5L2JA 1OB1B 5C0JB 2IFFH 2AK4B 4K3GA 4TSCH 1P6FA 2LVCA 1J0JA 3MA7B 1AGDB 4Y5XB 2FIKB 4G7YL 1PGRB 3VXOA 4ZUUB 2XT1B 2EYTA 1GGIL 4MHHG 1DJSA 4ZAKA 5JW5A 4HS6B 1BFOB 3DI2B 3UTTE 5DUPH 3N1FC 1EEQA 1CR9H 3GNML 4JRXE 4OB5H 4XCCL 3U79A 2IWGA 1JK8A 3CLFL 1WBZB 3QNZB 4D0DB 5T1MB 2CGRL 3LEYH 3UDWC 3O9WD 4PY7B 3FQUB 2PETA 4MAYD 3DO7A 2Y25A 4FQQA 5F7LB 4AM0B 1I3RA 4D2NA 3DBXB 4O2FB 5F9WB 3W9EA 1HSBA 3LQZA 4L9LC 4FQ2L 3WJLA 1P1ZA 2YC1B 4QF1B 2CKBA 5JIKA 5DMJB 5KSBF 4PLJD 5FYKD 1B0GA 1CGYA 4KTYA 1IGTB 4U3HA 2F19L 5MENB 3RI5F 4KVNH 4QHKJ 1DBAL 4X7FC 1AHWC 3MLZH 4P3CH 3RVWC 1F58L 5I1AB 3QDGD 5C9JA 1EFXA 4XNUH 1RHHB 3B5TA 2YZ8A 3MV7D 1LP9B 4MJIB 4TOYH 2Y9RT 4QXTA 3LKRB 1BZ9B 5IWLC 4I48A 1MY5A 3ESVF 3ZO0A 1EAPB 5BO1H 2Y36L 3HA0A 3OF6A 3WHE1 4PJ7A 4Z8FL 5B3JF 3T0EB 1OAQL 2G5BA 2VLKA 3BP5A 5DVMA 3H42H 4ODHL 3U7WL 1A1MA 1UM6H 2ZCKL 3V5HA 1KXVC 1G1CA 2AXJA 4NO5A 3SKOB 5J9PA 3VWKA 2Y5TB 4WJ5A 5E4IA 3K3QA 4S11A 1KJ3H 1UG9A 1XF5A 4XBPA 4WEBH 2W9EL 2HTKD 3QYCA 1UXSB 3IDMB 3O8XA 4M6NL 3S37H 1A0QL 2J2ZA 5F3BB 3VJ6A 4UB0H 5DRWA 1LE5B 3KS0H 2XFXB 3BPLC 1N6UA 2OSLB 1IILE 3E2HC 3ZE2F 1K3ZA 3ARBD 3OXSA 4ODVH 4LCIH 1B88A 4HIEA 4IIQB 2B1AL 2IQAB 4Z5RB 4XPGH 2ZSWB 3MLWH 4NRYB 4D0BB 4LF3B 5GQBA 4MA1B 4UOW1 4BFIB 5DC4B 1OW0C 2F54A 3NMEA 2HKFL 3FT4B 3LN5B 3TWCL 4U3CA 3W11C 3CZFB 2Q20A 3P11H 5BW7A 4WIQA 5E99H 5C0IB 1DFBH 2I60H 3VWJD 4E41D 1OWWA 2X1PA 4LSRL 4P57B 5IFJA 4JFED 1CWVA 3B9EA 1S9YB 4GFTB 5HGDA 1OP3H 5T1DL 4PP2A 4WW2C 2R15A 3KG5A 1II4E 2XRAH 4PJHA 4WTXA 3TZVC 3TYGL 4R2GB 4U6TA 5E8EA 4PRHA 3D0VB 2CK2A 1JMXA 1KIPA 2VH5H 3JXAA 5MEQA 4N5EC 2VLRB 5J3HD 4R6UA 4N0YH 4KDTA 4YHNA 1IKNC 4JKMA 1JZ4A 2VQTA 1G7MA 3LKPB 5D8JH 2X9YA 4FXKA 4J8RA 4UBDD 2XZCH 1AXSA 12E8H 1EPFA 3R4DA 2D7NA 5DVKA 4L3EE 4LDEB 3NBNA 1QLEH 4RMRA 4PJBE 1XIWB 1QHPA 1XR8B 1MAJA 4XCEA 5EU4B 4OLVL 4U1LB 2Q7YA 3QG7L 4LVEA 4DW2H 2QR0B 1D6VL 5SWSE 4Y4HA 2J12B 4I5BA 4RGNC 1YZZA 2DQIH 2NX5B 4G9DB 2APVA 2EDOA 4XZUA 3S3SA 1FNLA 1F45A 1WT5A 4JFPA 5C3TA 1BD2E 1KJ2L 1SVCP 1WAAF 4HDIA 1NFDA 1YECL 4BM7A 3QXAA 2GJ6D 5T3ZH 1NFIA 2VLJB 4P2OA 1XGPA 1ZTXL 4Z77A 5JLZB 1BBDL 5E8NB 4PRID 2CRIA 3RY6C 2LQRA 3I6KA 3HE6C 5J11B 4AEFA 3DX6A 4P46C 2EKSB 3OAUL 3OPZH 3QBTB 4ORZC 4MA8L 1CIUA 4LLVA 3WIFB 1HHJA 4FQXC 2WLZA 5BXFB 2C1PB 2NY4B 1JTTA 4J4PA 3RVUC 4TTDD 2ICES 1MI5D 4LCYA 5KANI 3TT3L 5H2BB 3HPJB 1AGEB 1N4XH 3SKJH 3RPKA 2BHZA 2FO4A 1SEQH 3MOBL 4FQPA 5CJXC 3GJEB 1RJZB 4QHNA 3L95B 5JDSA 4AT6B 1TQBB 3BGFB 3GMNB 1N3NB 1B9ZA 5KOMC 4GS7C 3WIIL 1VEOA 2Y06L 3EOBA 3PQYE 2DQTH 4XNMB 4D3CL 1Q72L 1DBML 3MLXL 3SDYL 2WLYA 3IXAB 3OSKA 3QNXA 1T1XB 4F7MA 5FA4A 1NGYB 2Z93B 4LHJB 2Y6SC 4OLYH 4ORGB 1JZ2A 4U1IB 3AB0C 4ODTL 2A0LD 1TIUA 4S0SD 2AJZA 4P4RB 3DHMA 5GIRB 4CNIA 3L5JA 2F53B 3G6AB 2Q6WB 4HWBA 3KHQA 3RWDA 1FPTL 4LCWB 5F9OH 4YAQA 3ET9F 3JV4B 5E6ZA 5EO1A 1KT2B 3IFLL 3ZTJH 5IVXB 3F7RA 2GYSA 2AKRB 4L4TE 2DLFL 5FO8A 1RSFA 5HI5C 4Q0XH 3EAKA 3W0WE 3UO1H 1X4ZA 3A6BL 5CINH 5ISZD 1KN4L 3HC0B 1KPRA 3Q0HA 3QDME 1NJ9A 3CDYA 1KENL 1YEFH 4ODWA 3LIZL 5GSVA 5CS7A 4MCYB 1MF2H 1JWUA 1A14H 4KROC 1KLUA 1AQDA 3QA3B 3RX5A 5IBLD 5FO9B 1BAFL 4R7DB 3GK8H 4HC1H 1UM5L 2ORBL 1OTUD 1FNFA 4Y1AD 4GAJL 3GHBL 3HB3C 1FV1A 3VCLA 1KG0A 2HMID 3SCMA 3V6ZB 4QTHB 5FB8A 1FO0H 4OCYH 3VWKC 1QFOA 2YA0A 1CD8A 3ZTJG 3OG4B 5F7DA 5CEYA 2EDXA 2XTJB 1CG9A 3G5XA 3FQRA 3NFNA 3R06B 4CN6A 4K8RD 4NO2B 5SWZE 2EDQA 3GI8L 2OK0H 3O8XC 4OGXL 4I1NB 3QP3A 1FORL 1V8HA 3KS0J 4OUUB 3WUWA 1MREH 2BMKB 2VL4A 3MJ8B 1U95B 2Y07H 5DHXB 1HN1A 1ITBB 2HJFA 3MV8B 1C5CL 2C3VB 4G7VL 1MNUH 4R97B 3SKMB 2WIMA 1T4KB 1B4RA 1WFUA 1OP3K 1XGUB 1HCFX 4OFPA 3D18A 1JN6B 4JFDB 4PJFF 3D3VA 5IHZA 3IFOB 3TJHC 4KJWC 1G9EA 3MXWL 1RMFL 2HLFD 5DC0A 1S7SB 1I1AA 3NZHL 4L8SA 3EO0A 3MLTA 3OXRB 4ZD3L 4OBSA 1OTTD 2R29L 5CCKL 4JKLA 3RWHA 5BW7C 1JVKA 3NZ8B 4KJYA 4NQEB 1HXYB 3HI5L 4JPVL 1J8HE 3A6CL 1FGVL 4HPYL 3S5LA 4OTXL 3U4EA 2F58L 1R0AH 3LDBB 1U3HA 2QADB 4ZTOL 4KHXL 1S7VA 1QBBA 1T20A 4QOKE 5CBEB 5BZDA 1MAKA 3F7QA 3GSNA 1KB9K 4GG6E 1H3WM 1K5NB 1Z3GL 2OM5A 1PD6A 3SDCA 4M6OH 3OKNA 4V1DE 2HJKA 4O4YL 5CP7B 4NQDE 3C6SB 3BKYH 3KDMA 2OJZL 4ZNEE 4GKSB 3VFWA 1KGCE 1Y18A 3EDFA 4P0DA 4PUBH 4S2SA 1MRCH 1X4XA 1CQYA 3JTSA 4GRLB 1OWRM 1KB9J 2A9ML 4G8FB 4QWWC 4I18A 2G5RA 4M1CD 5DEGA 4BSJA 4F7TB 2P8MB 2GT9B 5F21B 4RIRB 1OAYH 3HG1E 3D69B 1LEGA 3FO1A 4U31A 3D39D 4WU7A 5I74C 4EI5D 2I9TB 2XKUA 4PBXA 5CGMA 1KCVH 1MCFA 2X7LA 1JGDA 1MFNA 4OV5B 4EUPA 2GSGB 5I8OL 1WT5C 1A1NB 3B5GA 3JV6B 5F7MC 3E6HA 3QHFL 4JHZA 2ITCB 2JB5L 1CN4A 2DJ4A 3FN3A 2NY2C 4LSQL 2X70B 1YEJL 5C7XL 2OR7A 2BK8A 1MLCA 1BLNB 1A6UH 5CSZB 1GGUA 1JGUL 2A9NL 3IXTB 2DQFA 5EBWB 1JF6A 4NYLA 2WM0A 3ULUL 4YIQA 1BQHA 4YO0A 4GW5A 2Z31B 2D7MA 2EYSB 3VDCA 1FNSL 4WV1B 4DTGH 1IRAY 1XT5A 1YA5A 4LFHD 4TUOA 3QUYD 3VFRB 4IOSD 1G6VK 3WE6A 2DF3A 3DXAD 1ACYH 4ONGL 3KNBB 1T3FA 4JFFA 3O3UN 4LLUA 4KUCD 1DL7L 5ITBH 1JF1B 4J3UA 1TFHA 3WD5H 4ONOA 5HHMD 5KAQF 4ZSOB 3VI3E 4Y16D 3MLYH 3KLDA 5IQ7L 3OBAA 5EUOA 3VI4F 2DIJA 1UENA 1DZBA 1YC8A 2GKIA 4TSBL 1OD9A 5D1QB 4PJ5E 3O3BB 2J8UB 5C0EA 1CQKA 1R3IL 3EOAB 4NQUA 5DHYA 5D2LB 3VGFA 4KGLA 3VFUA 4I2XB 3FCTA 3RIAK 4HK0A 2CKBH 3KPPA 3DHJA 5IB5B 4S1SL 1R3KB 3IDGA 2K9UA 4IRSB 1J1XL 4YFLF 5DJ2A 5DO2C 4J12A 3AU1A 1UH3A 1X5LA 2BCKB 2NW2B 5ICXA 3U82B 1HE7A 1NBZB 1RIUH 1AE6H 1OGAE 3OZ9L 2DL9A 1WC7B 5GGRY 1ZMYA 2D3VA 4GUPB 4Q6YA 3TIEA 2QQLH 5K9KB 2GUOA 2FECL 2OX5A 2R1YB 4L1HA 4N0UA 3NFPA 1TVDA 3S88H 2D31B 1ZV5A 2DM2A 1KEMH 3B9KD 4ELKB 2WSKA 3OJDB 3WFCL 1FC2D 5I1CH 2R4RL 2EDKA 1A6ZB 3CFIC 3RP1A 1TZGH 4QXWA 4OF5A 2PTUA 1GAFL 2K1MA 2JJSA 2YBRB 3BDYL 4MQTB 1QG3A 2V2XA 3SCMC 4ERSH 5I1HH 1JE6A 5A2IH 1JIBA 4WI3A 1DDHB 4UINL 4Z0XB 5KSBE 2JJTA 4Z7QF 2ATKA 2ZG2A 4NRZB 3BYTA 2O61A 4PJ8C 2H2SD 5E2TL 4JO4L 5DJXA 1NPUA 3STZA 3JWOL 2BJMH 4OGAC 2YD7A 4F15C 1A6WL 3C5JB 1BECA 1JYNA 1O7SA 3EYOA 5C92A 1MVFA 1Q9WA 1TITA 2BY0A 5IIEA 2Z9TA 4YHIA 3RUGA 1PEWA 3VFPB 4X4XA 4AENB 3RWJB 1EIBA 5B3JE 5IB1B 3GSUB 1O5DT 1BJMA 3U48A 3QXVA 2P5WA 2C1OB 3MJGX 4Q74A 5C0AA 4JEGB 5LGHL 1IFHH 2QHLA 4E5XB 4P2YA 2I5YH 5DRNA 1ZEAL 3MYJA 1I1AC 4R8WH 5EBLA 1TXKA 4GKNA 3DOSA 4QXGL 4U1SA 5I8CB 4G8EA 1U8LA 4MNQE 4L3CA 1T7ZA 2JCCF 2ZKHL 4LKCB 2FX8L 4KDWA 2DJUA 2BSSB 1YEKL 2DKSA 3ZE2E 1IAMA 2IALB 1LDPL 1U3HC 3DMMB 5AWNH 1CFTA 5C71A 3KYKH 4LLDB 3A67L 3QEQD 3DX9A 1NDGA 2APFA 1AGCA 4ZFFA 5ESVA 4OFYD 4QRRD 4OZFG 4CJ0A 3ALWA 1HQRB 1AY1L 4OIBA 3PHSA 1SMOA 1E6OL 3SDCC 4CW1B 4KAQL 1QSFB 5JMOC 4DEPC 1FVDA 2KL6A 3QWRA 4DVRH 2J6EL 5I16A 4YQXH 3N50A 1V5JA 4BSVB 4RFNC 15C8H 3VXRB 3FHAA 5J13C 2QHRH 5D1XB 1SM3H 2YPLE 4OSUH 4D8PA 3K8KA 5MI0B 1T22B 4GAYB 1YMME 2WINB 2YK1L 4M5YH 3GMOB 1B0RB 3C60B 4OFIA 2Q3AA 4MQ7B 1RZGA 1MFAL 4WCYL 4HGWA 5GGUA 3VFMB 3TBSA 2NTSP 2XPGB 4NZRL 1I3GL 3HAEA 5CGTA 3MBED 5L2KE 1DBJL 2Y1VA 4Y19E 2Q8BL 4N8CH 1AR1C 2ADGB 4U6XA 2AV7B 1JNLH 1UVQB 1P53A 1I9RL 4PJ9C 4Y7MA 4YK4C 2DWDA 3BSZH 3RKPA 3U30B 4M7KH 2QKIA 5DA4A 5KN5A 4G6JH 5I75C 5C0CB 3MRCB 4GH7B 5DGQA 1TTGA 1FNEB 1ZT4A 5KANG 2NXZD 3S36L 3EO1A 4JO2H 1DTUA 4G6ML 4P2RD 4ZFZA 3V4VH 1F4HA 1REIA 1MELA 3TH2T 1ND0B 1M71A 1WISA 4WY7L 3GSRB 2E7CA 3T77B 4P23D 4O2EB 2VJXA 4WNQB 5GS2D 1F5WA 1EXUA 4Y89A 4IRZH 1LEIA 2PYEB 2WV3A 4FQLL 5E4EC 1TVBA 4MAYA 4PJEF 1BM3H 5FOBB 2CRZA 1A7RH 4X5XB 3VXQA 4JE4B 3REVB 3AAZA 4HUWB 1KJ2A 3LN4B 1H3PL 3VGEA 1DVFB 3UZEA 3AS1A 5HHNB 4HWBH 3VA2C 2F5AH 5JIIA 2H6PA 1JFQH 1S9WA 4O00A 4KK5C 2APXA 3BKML 3OKLB 4JY6A 2R69H 3OJVC 4LPYA 3Q1SH 4OCSL 3QDGA 3G5VB 4KVCL 1I8IB 5EU6D 4DGYH 5CIPB 3BPOC 1UB5B 3DRTA 1AQKH 1FL6B 5B38G 3RX8A 4LDOB 1F8TL 1IM9B 1KUMA 2VQ1B 1T66D 1WEJH 5M94B 2ID5A 1IBGH 1PKQE 2JKXA 1CXLA 4TN9A 2GK0B 1MJ8H 4JRWA 4OFVA 1G7PA 1IGIL 3MUHL 1AIFA 5A16A 1LO5A 2DOCA 3WHXA 4S1RL 2F15A 3QEHA 4PRBA 4GOSA 3IU4L 4U6HA 4WWID 2EDDA 1XF4B 4H8WL 3MUGA 4L4VB 5GGQL 1F2QA 4K9EL 4GBXC 1UZ8A 4UT6H 3FT3A 2ICWB 2QSQA 4NN6C 4GRMB 2MQCA 3P4MA 3M1BA 2PW1B 1NC4D 3LZFH 4PGDA 4XHJD 3UYOD 4HQQH 5GZOD 2JJSC 3TO4D 5I0ZA 3FFCE 2IQ9L 3WFDH 4PJXF 2JJTC 2A73B 1UZ6F 4NCC1 3W39B 4B53A 3UTZB 4ZNCD 1EZVY 1IM3A 4RGNE 1HYRC 4NZUL 2AJSH 5CD5D 2I9LA 5DUML 4XVJH 3RVTC 1RIVH 3NA9H 5KSUA 4PRAA 1JNNH 4PJDF 4L29A 1YYMH 2BSTB 3ZHDA 4BZ2L 1MHEA 4FG6C 3EO9L 4HUXB 5F7YC 2YRLA 4QHLA 4R4FH 4JHWH 4XRCB 3UMTA 3UJJH 4FQCH 1NUGA 2Z92A 1CIDA 4FFVD 5D72L 2YWZA 2QQQA 3B3IA 4PLKD 3FN0H 1JZ8A 1HDMA 1KELL 1KIQA 2O5XH 2ZP0T 1OARH 4MNGA 3VWJA 2RBLA 3BX7C 4JFEA 3UC0H 1L7TL 1FYTD 2GTWA 5DJ0B 4JKPL 4RQQA 1CDBA 2M26A 1IEHA 1Y6NR 2HP4A 4YJZL 4HZLA 3WUWG 4FZ8H 1S5IL 3GO1H 1CE6A 3HS0B 4PV9A 5KS9A 1U3YA 1E4WH 1I8MA 2VZSA 5LJYH 2XTLA 5KVEL 1O0VA 2MTPA 3GSNH 3SKNB 2CIIB 1ES0B 3OKDB 4NUGL 4X6DE 3KPNA 3SO3C 1QRNA 1FZMB 5ENWA 4IDJL 3ZDXF 4L4JA 4KTDH 5GGSY 1C12B 5FUOL 1I9JL 4JKWA 3QFJA 5DJCB 4WUUE 4H5SA 5EZJB 4NO0D 2V6HA 5DK0A 4DKFH 1QA9A 3G5ZA 3KPRD 5JO5B 2R1WB 5E9DE 3TF7C 5HGAB 3EKCA 4CUCA 1F6FB 5FGBA 4XNYL 4H88L 4UU9B 4XXDA 4YLQT 1HIMH 2PW2B 3S5LG 3HZKB 1U8KB 5HYIA 3H3PH 4LASL 4F7EA 1J7VR 1HQ4B 2G60H 4GRWB 1S3KH 4EUPH 2GJ6A 3AVEA 2RR3A 1D3CA 4PRIA 1SBSH 2XA8L 5GJSL 3BI9X 5CP3A 4F2MB 5TQ2L 4JY4B 4NFBA 3QHZL 4N5UA 1OLZA 1MJUL 3RA7H 3WL9A 3RKDD 3QPQD 2JB6A 4P2QB 3ZYIA 1QO3B 1OOAA 4M61B 2BC4A 1MI5A 3F65A 3QQ9C 6FABL 2DQCH 4XCYB 3UYPA 3EYVA 4PRNA 1B4JH 1Q0YL 2YA1A 3QXDA 3QIUD 3CPLA 5J56B 4MJ5A 4W70A 3NABL 2OI9C 2DLTA 4KU1A 5DRXA 4FNLL 4MNHB 4NM8L 1YEIH 4M1GH 5T33L 1WWBX 3CFDA 4O2CA 4LIQE 3SE9H 5D96B 4R0LB 3EYUL 4Y5XC 3CX5K 5DD3H 2VUOA 3M17A 3O45A 3VXUE 1TCRB 4XP9L 4PJIE 1SJEA 2P24A 4EDWL 1ZANL 1DLHA 2CLVB 2XKNA 5TFSH 1NEZA 1P84K 5JUEL 5JXAL 1QEWA 4POZD 2WBJD 5ACZB 4OLUL 3VGHA 4YBHA 1YNTA 2PR4L 3MGAA 1OF2B 1BQHG 4E0RB 4K23H 3SE4A 5CEZD 3CX5J 4PRPE 2CKNA 3QUXD 3H9YA 3PGFL 3P4LA 4W4OC 3QUKB 2R2CA 3MA9H 3ULSB 1EEYA 5IT2H 5F9WC 3QQ4B 1GIGH 3S34H 1P84J 3CDFA 1AGBA 2BHYA 1WTGT 5L0QB 5E5MA 3PV6B 4M43L 4OD3L 4NZTH 5E5RB 3MROA 3LB6D 4WUKH 5IEKB 2SEBA 4J1UB 1W0VB 4LGRB 3ARYA 5HGGS 3IDNA 1K6QL 2XACC 4JZNA 2EXYC 5GGVH 2WNGA 3HUJB 5ISZA 4KJQD 2DQUH 3L3HB 4PV8A 3WDHA 3ARPA 2EIEA 1YN6B 4WW1B 1XH3B 3I3EA 3VI4E 2BSRA 1VFBB 3U7AA 1Z5LA 2ZNXA 3T0EC 4Z78B 4XGZA 1D5BB 4G7YH 4QRPB 2ATPB 4HPOL 4EEEA 4KRPD 2CQVA 4JN1H 4HHAA 4ELMB 4G8GE 4PRDB 3OX8A 3GNMH 5J6GB 2D0HA 1DEEB 3CLFH 2FSEA 3MNVB 4CMMA 2Q3ZA 2DM3A 4GRWH 4RAHA 4P5MB 2E9JA 3LD8C 3BGAA 1PG7H 2R2HB 4E42A 1J1OL 2OXHA 2DWEA 4GW4B 4N0FB 5HPMA 4YDKL 2YD8A 2YUXA 4PTTA 4RX4A 5JORA 2UWEB 5CJOH 3LV3B 4FQ2H 4O58H 3EFDH 2PCPB 2P43B 1MLBB 2W9DL 2F19H 4M7ZB 4NHUA 1RZJC 3FTGA 3O6ML 1F58H 3O9WB 2Q86B 3RZWA 3NIFE 4MA1C 4P9ML 4ZQKA 3K80A 1CFQB 1NAMA 5AD0A 4YXKL 3NTCL 4XWOC 3GSWA 3V8OA 4FQ1L 4OQ1A 1YY9D 4PJGA 1AO7A 3UZQA 5H35B 1EHLL 1FIGH 5HJ3A 2EIDA 2Y36H 4Z7QE 3OJMB 1AD0B 4XCNA 4Z8FH 2IPKB 3UTTB 4ODHH 5T5NG 5F6IB 1U8OA 2GI7A 2ZUUA 2BNRD 3NACH 2ZCKH 3MV7B 4JRXD 4KKAD 5LGJA 4NC2B 2IMMA 3L5XL 5DD1L 1A47A 3ZHLA 4DK3A 5ICYA 4YHKH 3DYPA 4M03A 1LO2L 4WHDA 4S1QL 4KK9D 3DTXA 1A0QH 5EPMA 5GS0L 2CO7B 4BH7A 2WZPD 4RZCB 5K9QI 3MRLA 1FL5B 3P3YA 2HG5B 3G08B 4RMSA 4HXBH 3FFDA 3INUL 4LL9A 3HE7D 3AY4C 1I4FA 4Y4KD 4OZ4A 3BW9A 3S37X 4UQ2B 1WCBB 4EI5A 1W72B 5HHOA 2FH6A 3NCJL 4HKZB 3OGCA 5T5FH 5GRUL 4U49A 5TDPA 2BOBB 4KKCD 1BVLA 1GGCL 3L6FB 1ZS8B 3TWCH 1OCWH 5B8CB 5BJTA 3ARBB 1MRFH 3QXWA 3BD4A 3QPXL 1WQVT 4ZFGL 3BUTA 4NRXB 5DD5L 5F7EL 3RDTA 3HAEH 3DURB 1W0WA 4TQEL 4ONFH 1HOCB 5FK9A 2BVYA 4F58L 5JQ6L 1NGWB 2UZYB 2RHEA 3PJSA 1IMHC 3WSQL 2JELL 4RGOL 4QTIH 1MCWM 5F1IA 3DI3B 4KI5F 1LO4L 5IMKA 2XQYK 1D5ZA 3RHWK 2NY4C 4XVUD 1KJMB 4WGWB 1ZLVH 2EXWC 3TESA 1CU4L 2NTFA 4P9HL 1Z0NA 4I77L 3VXNB 3IFNL 2R2EB 4E41B 2FB4H 5D9SB 2XN9A 3I75B 4NSKB 5DEFA 5F9JA 2BY3A 3H3BC 4NGHL 4LEOA 5BV7H 3V4PL 5F7KC 1ZHBB 1IARB 3P2TA 1N0XL 4GAGH 5IVZA 1I1YA 3ARWA 3EJYD 1FLRH 5E2UH 3BGFC 35C8H 2J6EA 4Y16A 4YH6A 4EVNB 1I7TB 2H1PH 3HAEG 3H3KA 5H8DA 4PTUB 4OLVH 5DVLA 1D9KA 4XHQA 2Z35A 4TTGA 1T5XB 3CVIL 1D6VH 4HKBB 2CLRA 5HSFA 3GSOB 3ILQC 1IGYA 4G9FE 4MD0A 3DSFH 4AK1A 4RAUB 3TO2A 2BVPB 3GDBA 2HT4D 2W0FB 4FP8L 3H9SE 4IJ3B 4L8DB 3RIAF 1YECH 3VH8G 4LSUH 4MAUL 1IVLA 2XWTA 1ZHKB 2HVKA 4W6XB 4I9WE 2EZ0D 5MP6L 5EBMA 2R23A 1K3IA 4WO4A 2CK0L 2DRUA 4FHBD 1ONQA 3QAZB 3OAUH 1AC6A 5TF0A 1M05B 4MA8H 2XY2A 1OTSC 4HX1B 3HNVL 5SWQB 4U0RB 5I66B 1I1CA 4ODSH 4ISVA 1A4KB 1M7DB 1A7PH 3U46B 3MACH 2LTQB 1ZAGA 5E8OB 1TLKA 2EO9A 3BN9C 2JLLA 3ULUC 3U9PL 2HT3D 2HVJB 4LAJH 4MS8D 1R5IA 5IUSA 1G9MH 2L7UA 3HPLB 3MRPA 5FDWA 2JF1A 3B9KA 1FCCA 3FB5B 4WTWA 3MJ7A 1A3QA 1V3MA 3WIIH 3Q5YA 1CLZL 1DUZB 5AUMA 3TBWA 2X9XA 2Y06H 2FH8A 4UOJA 1IZKA 2YUVA 3MLXH 1DBMH 3ARED 1BD2B 2DAVA 2F8OA 4IMLA 3VDBA 2X4OA 2OR9H 3U9UB 1X5GA 4U7MA 5I19L 4PJCB 2Q1EA 1KNOA 3G6JF 5GGTH 3DPBA 4ODTH 1R3HB 3E3QE 3LKNB 3PABB 1N8ZA 5IROA 4ZUTB 4G3YL 4HKJA 5IBTL 2BVEA 1KCLA 3ROOB 2RIKA 5JNYB 1UKSA 3T8XB 4MXWL 4XVTL 4ZOBA 1FPTH 5J6HB 5F6HI 5ALCL 1W72L 2BNQD 1FL3A 5ABDE 2VDPH 4QHMB 3MRHA 2DLFH 4PG2A 5BVPH 5IR1A 1KIUA 5HY9A 4ZS6D 5I1GL 1AKJD 1MCNA 4LP5A 1NEUA 1T1YA 4OCXL 4Z7OE 4HS8L 5GRJH 4XB8A 2P8LA 5BRZE 5ALBL 1LEKB 1KN4H 3MMEA 4HIHB 3LIZH 1OAXH 3UZVB 1F11A 3PQYD 1EZVX 3KPLB 4YFEA 3ARGD 5HHXL 1BOGB 2DI7A 3SOBL 4GAJH 3ZKQD 4X4MA 3MLUL 3LDBC 1NUDA 3VD9A 1Q94A 3UJTH 2UY7A 1SJHA 2NYYD 4MMZC 3Q6FA 3DO3A 1U3JA 5TE4L 4QRRA 1P6AB 1KV3A 1J8KA 5DFVD 3LEXB 3WYRA 3L9RB 2ITDA 1OP5H 4W6WB 2ESVA 1VGKA 3K2UL 2A83B 1FORH 2BZDA 2GSIA 2MOVA 5ICZA 4OV6F 2CXKA 4KPHL 4Y1AB 3ILPB 3C6LD 3JWOC 1HH6B 2X2YA 4X7SL 5IJKA 1PLGL 2V7HA 4BA8A 5HVHB 1YQ2A 3VFVA 2W65A 1C5CH 3DX7B 4FMKA 3WLBB 2Y5EA 3MJ9H 1QKZL 3W0WD 1S7RA 4D9LL 4XI5D 4OGZA 2XWBB 3KPQB 1H0DA 3QDMB 3U1SL 3TA3D 1T21B 4APQA 3HR6A 4NZDA 3QUMA 4HCRH 5KVDL 5C0NC 4JDZB 4F9LA 3NZHH 5CP3H 2V5SA 1LO0H 3FRPA 3MBEA 3C5ZB 3RDTC 3LQAL 4JPVH 5GZND 4WHTB 4X99A 2CUHA 3VFTB 4HPYH 4OTXH 3OWEA 1QPPA 2F58H 5HYQA 3BP6A 4RAVB 1S7QB 3WXVL 3DECA 4KHXH 5EO9A 2VIRA 3I6LD 3Q3GA 5EOQL 3SDXB 1HK6A 4X7TA 5JOFB 1F6LL 3GKZA 1WBYB 4XBEL 3TNMB 1Z3GH 5DDHA 5DWUH 5MERB 4K3DL 4LVNB 4YBQC 1HHKB 4RMVA 2WUCH 2FO1A 4K7FB 5ERWA 4WV1C 3TM6A 3TPUB 1D5XB 4JVWA 5C86A 1UJTA 1ETZB 2NLJB 1NFKA 4U1JB 1NMCB 4M62L 2OJZH 1X7QB 1T89A 5INCB 4P2RA 4YDJA 3T3MF 2YRPA 5C09D 2XV6B 4LPWA 5EZIH 2A9MH 4J3WA 5GISL 4P23A 5FHAH 1NQBA 1DLFL 5E5UB 5D7IB 1D9KC 4UTAL 1MIMH 3QH3B 5FYLE 3REWA 1U8JB 4CDHA 1U8IA 2BSED 2FYYB 2W9LA 2H26A 3DUHA 4LCCA 1QFWL 4P5KB 4X6FA 4MYWB 3ARDD 5D1QC 4MDIB 5I8OH 1U91A 4MXQC 1J8HD 2DQJL 1G7LA 1RULL 3ELAT 3WFEH 3WLWC 1H8OA 1KCRH 2E7LA 5JXEA 2JB5H 2P47B 1X5FA 1FHGA 1GZQA 4QOKB 3TYFB 5E8PA 4PJ7F 3KPSA 2EH7L 4WO4C 3KYOA 4JRYD 3D39B 2YD5A 5E03A 3CJJA 5FAAA 4G8IB 3MSPA 1AXTL 2DS4A 1KLGB 4U1NA 3HRPA 5H37G 3VG0H 1ORSA 4V1DD 4MQXD 1NEZG 4NQDD 2J1KA 1FNSH 2A77H 4YWGL 3QIWA 5GJTL 1MFBH 3T2OA 3BEVA 4G6AD 1CFNA 3EYFA 3W2DL 2VE6B 3LMJL 1XGQA 1GC1L 2VMFA 5D5MB 5CAYB 1DL7H 3HG1D 2DBJA 4X6BB 4FTVE 2FHBA 3IJSA 1U92B 4MB4A 5EFIB 2E27L 1JGLL 3EIFA 2VXSL 2VAAA 5KBNC 2MMXA 1B2WL 1FG2B 4WWKD 5LKNA 4K8RH 3QUYB 1OY3B 1R5WB 1F90L 4C56D 4TNVK 5FYJE 3T3PF 3MNWB 4YPGA 3DXAB 3GIVA 3AMKA 1R3IH 3VXPA 2ICWI 2IH3A 1UH4A 3UEZA 4LCUB 3UYRL 1D5IH 1W0YT 5HHMB 3BZFA 5CBAA 3D2UA 1JPGA 1BFSA 1ORQA 2GCYB 2Z91B 4CVXA 5I1DA 2HFFA 4PJHF 2EIZB 3RIFK 5HGBB 4EOWL 5GS1B 1H9VA 3HRZA 4GQ9L 3OZ9H 2D2OA 3OKKB 1AC0A 4OZHB 3X17A 1NAMH 4NCC2 3CVHB 4G42A 2IFGA 4BFEA 1NAKH 5HPOA 3F62A 1YPZA 4XMPL 3H7LA 3QUZB 5SX4H 1IQDA 1FYTA 5DJAB 1TVHA 3P30H 1U41A 1FC1A 4TUJA 1AP2B 5EIVA 2YEZB 5JPNA 5C0RL 1DEDA 1OP5K 1KIRB 5HYJE 5IB2A 3WFCH 1DQJB 4IOIA 1H15A 2X89D 4H8WC 2FR4A 1FFRA 1L4IA 2X4TA 1FRGH 4K9EC 3IRZA 5J7CC 1U8QA 1HILB 4PREA 3VG9B 2AK4E 1N5AA 3MREA 5I76A 4PJ5D 5IW6B 4JLRA 4NO3A 3O2DL 4OLWL 3G9VA 3NPSB 4UINH 1HXMB 4PR5B 5I73B 1VERA 1NGZA 3DWTA 1ZA6A 1T04B 4TPRL 2B0SL 5MEOA 3QCVH 5E1AA 1NFDF 1EBAA 3L5WB 1RVFH 4KDVA 4B41A 3KPRA 4KKBC 4ZFOB 1QQDA 1MCSA 5CSGA 1PX4A 1X5ZA 1OGAD 5IJKC 5FV2A 3WBDA 1GSMA 2EYRB 1CTOA 1ZA3B 3IS0X 1N6QL 3HR5B 2WWKT 1RJLA 4P4KB 1ACZA 4KMTH 2VABB 1YNKH 1QACA 5HYSA 5IW1B 3ZZ1A 5MENE 5IBUB 1YY8A 4HUUA 4AIZB 1WFTA 1JNHB 1JL8A 4QXGH 1J05B 1U93B 1XAUA 2DN7A 2FWOA 1C8PA 1LP9E 1I8LC 1XGTA 2ZKHH 1T03L 4L8BB 3LPFA 3VXMD 1NCAL 5TH2B 3BXNB 1YQVL 1RU9L 2QBWA 2YUZA 5T3ZE 3V0AC 5CHNB 3GJFA 3QIUA 3FO9B 4NHCL 4YZFF 1MEXL 3QHTC 3FT2A 1I1RA 1N59A 5IG7B 1AY1H 1E6OH 3F8UB 3PGCB 4KAQH 2IG2L 3MFFB 1BHGA 4GAFB 4S10A 3FRUB 5HHQA 1QSEA 3CFBB 4DAGL 4W81A 3C8KA 3P0VL 3O6LH 2NQCA 4O51A 5KSVB 2DTSA 3BDBA 3QEQB 1UJ3A 4MMXC 2VDML 2N7AA 5AG8A 1I7UB 1L9NA 5KTEL 3PXHA 2AGJH 2A6IA 3BEWB 3QUXA 3WNPA 4Q9RL 1YJDC 1IAOB 4KI5E 4F8TA 4LCCC 5L7XL 3MRFB 3VE0B 3NCMA 3PWLA 3OV6A 2RFXB 4LPTA 4MNQD 5JR1L 2P5ED 4A6YL 5C0FA 4NQXB 2E7LC 2OL3L 4C59B 2DIBA 1V3JA 4HT1H 5JXEC 3RX7A 2VLLA 1NDMA 3P9MB 5DQJA 4UUJA 3J7HA 1A7QL 3GMQB 4JAMB 1NCUA 4LQFL 1J11A 4PLNC 2H9GA 3CSGA 4I0PA 1H3GA 2AXGA 1I9RH 1F4WH 2P48B 3HKFA 4OZIA 2FJFA 3BVNB 3MUY1 3RNKB 1IGML 5KJRL 3NCEB 4OBRA 3GB7A 3T0XA 5HBBA 3V7AE 1XF2B 2C26A 3QIWC 4JG0L 2CDGB 4R26H 1TZHB 3JWDH 1BFTA 3HNTL 2HH0H 2XOTA 3HI1B 1GPOH 2VLRE 3MRNB 4NWUL 5C08B 2YPLD 4LKXB 4WY7H 3BMWA 4PG9A 4N90E 1JNJA 3GUTB 5D7LE 5JHDA 1FBIL 4UV4H 1FVCB 2WANA 3ULVC 1FIEA 2DYPB 4YUEH 5FDYA 2X09A 4FQLH 4OAWB 4ZOEA 32C2A 2MWCA 1DCLA 5FKPB 4OT1L 3RZCB 2D03H 4JCMA 1XCTB 3F6IA 2YD9A 4PJAB 1B90A 4JFOB 2NX5E 1M1SA 2QSTA 3BKMH 5L88H 5HI4C 2R0KH 4HWZA 1E28A 1EUTA 4KVCH 4H1LB 2VLJE 3K46A 4NWTL 4XNZB 4DGIH 4J6RH 5IF0A 1F8TH 4AEIL 4LGSB 3BN3B 3OB0H 4NKIL 2NW3A 3ZE1E 1IGIH 2X4RA 2A74B 2D0GA 5BOZG 4YDIH 5B39G 4N68A 3F7YB 3S3PA 1JPFB 2OLDA 5J1TC 4HIJB 5EU6B 4JRXA 3UTQB 1IL1B 3UTSD 3VXSD 1KEGH 1CZ8L 1IAIL 3PHOA 3QNYA 1IGJA 1A3LL 2W0PA 1JTOA 3CDGA 3QSKB 4WEMB 2R4SH 1MUJB 4EQ2A 3IU3A 2HJLA 3MOAH 4JFHD 1CDHA 5DD0L 1X3DA 1NUFA 1IC5L 1KCUH 3OKEA 1U8PA 4FMFA 1F3JB 4S0TD 3J8F7 4XB7A 3X11A 2DM7A 4F7PB 4Y4KA 3W11D 5KG9B 1DSFH 1NC4B 3QDAA 1BQSA 4XP4L 1K9TA 1KN2L 3FONB 3GBMH 3TO4B 5HHVL 4DKEL 4J3VA 4BZ2H 1VACA 4XWGH 2EDFA 1CDYA 5EU3A 3GSQA 3SY0B 1WLHA 1FNGB 4Z76B 3QWOB 3QUMH 2F53E 2B4CL 3TZVD 3N1MC 5D72H 4YDLC 2VZ1A 4HIIB 4XX1G 4LCWE 3IYLW 2YWYA 3QO0B 2WMPA 4N5ED 4D9RD 1L7TH 1MJ7H 5EU7E 5IVXE 3EW3B 4JKPH 1YUHB 3MCKB 4KH2A 3WIHA 1K8DB 3LEVL 3QFDA 1JGVL 3ROLB 2XNAB 3RY5A 1VGEH 3RHWF 1S5IH 5BS0D 3U0PA 4PY8I 1HEZB 3OR6A 1S9XB 2O26U 3SJVD 3SDDB 3HMWL 2P49B 3ZLQC 5J4MA 1Q0XL 4NKOA 3MRRA 4K3EH 4TULL 3MV01 5FECB 1CGWA 5HI3C 5EUOF 1QYGL 3QEUA 2YPKB 4NNPL 4PGCB 4X8JB 1I9JH 1U6AL 1V3LA 1R24B 5KZCD 3RWEA 2A6DA 3V5KA 4RGND 4UDUB 5GPRA 5CMAB 4KK6D 3EYSL 5KW9H 5GS0C 5D93C 3I3BA 4M1DL 1J5OL 5LWYH 3FRPG 5D2NE 3VA6A 1MHCA 2VISA 1PZ5A 2KZWA 5I2IB 5GS2H 2XTJE 3LHPH 4EIGB 1BJ8A 1U42A 3RJQB 4H88H 4K2UH 3HE6D 1YEGL 4M6AA 1UJ3C 2P7TA 3STBA 4P46D 3ARRA 4LASH 1CFVL 1Q9KB 3EFFA 2CXGA 4FQXD 1ITCA 4NO0B 4JGJA 2VR5A 4HXAH 3RVUD 4J23A 3MV8E 2ZUQB 2XA8H 5GJSH 1U9KA 2J8HA 4YXHH 3O3DA 5TQ2H 4B0MM 3IAGC 3I02B 1MJUH 4I0CC 3S96B 5C0GA 4LHUA 2UVFA 4JFDE 5F96L 4H0IA 4IHOB 2B20A 5IV2B 4TVPD 4V2BA 4I0PC 1G84A 5FV1L 5LCVH 1INQB 3T3ME 6FABH 1JRHL 3QULA 1QRKA 5C2UB 5GHWL 3NCFB 1A1OB 1P7KA 4DFIA 3NABH 4PJFB 2VDOH 4C55A 4HWUA 4L3EA 4P9HC 1CXFA 4GRWF 5I1KH 3B6SA 1MCPL 4PJBA 3ALXA 2Y6SD 2HFEB 4JHBA 5SWSA 3IKKA 3IB4A 3ZYZA 4UV7L 5JW3L 4PGEA 5FKAA 3RUGF 1ZANH 1E6JL 5DYOA 2N4IA 3SBWA 4KXZH 3FB6B 4HH8A 5EIIB 4MA7L 5JUEH 3RWCA 4RDQF 2DQEH 3BESR 3FB7B 4OLUH 3EYQC 1UM4L 4M5ZL 2PR4H 3FL7A 5TDOB 2F74A 3FO2A 2AXHA 4RMQA 3EGSB 4RCAA 5HI5D 1MHHA 1KLFA 5KVMC 3NFSL 1I75A 3MXVL 4HS3B 4HAFA 4TSAH 1JI1A 3LRSA 2DLIA 3QO1B 4LLAA 1HSAB 2VDLL 3PWUA 3CZJA 3VD3A 3OB0K 1M6OB 3T4AA 4M43H 4OD3H 5D1ZB 4U1KA 2WBJB 4M7ZC 1AKJA 4KROD 3WS3A 1TJHL 4OZGB 3OF6D 4MSWA 4JGUA 4W68A 2LU4A 2D4DA 4AJ0A 2VLKD 3QQ3B 5T1LA 3VFNB 1FAIL 1FZKA 3HCVB 3HB3D 2A2QT 3DGGB 3VFSB 4YGVA 3VWKD 2CO6B 2AP2A 5ESAA 5DTFB 4JN2B 5BVJB 3LS4H 3PQYA 3I6GA 2W91A 3ZT6A 5I1LB 3C5SB 4HK3J 3T3PE 3VXUB 2VSDA 2H32B 2V2WA 1MCJA 2PYFA 3O8XD 3BZEA 4OD2B 3IVKB 5F6IC 2WQRA 3UBXB 3HTLX 2FLBT 4HPOH 4JR9L 1UKQA 3UPRA 3RRQA 1QR1B 5CGYC 1D5MB 3MRQA 3BGMA 4LLMA 4OIIL 1ZWIA 2WP3O 2G75A 3BH8A 2DQDL 3DROB 3IJYA 4MQSB 2O5ZL 3O3EB 2O93L 2DL2A 3OHXA 4GT7A 4YDVB 1I8KB 4PJHE 3ORJA 4ZSOE 1A6VL 1NL0L 4FA8A 4M02A 4DN3L 3FQWA 3HC4H 2UYLB 3TJHD 1ZOXA 3MRJA 2J5LB 4KJWD 4L4TA 4YDKH 2GFBB 1ED3A 2W9DH 3U0WL 3W0WA 2PO6A 3CXHK 2P46B 2J8UE 2PTTA 1T5WA 3O6MH 4YX2L 5D2LE 2IANB 3EOTH 4P9MH 4I2XE 2X1QA 5DURD 4Y5VA 2MPAH 4YXKH 3GSXB 1UB6A 3NTCH 5D7SL 5IGXL 4PRHD 4FQ1H 4Y8AA 1BZ7A 1AGFB 3IDJA 4JANA 3QJHA 3TBVB 3T0BA 3CXHJ 3DETC 4UAOC 3BWUC 3FQNB 3MODH 2ZSVA 4ZO6A 4G8GD 1WCQA 3MO1B 2P8PA 1FFOA 3IDYB 1Y6MR 1MHPH 3WKML 1JMZA 5CUSL 1XGYH 3L5XH 3T2QA 3CX2A 3N85L 1KCSL 2X40A 5SWZA 1KBGL 3GBNL 4QWWD 5HVFB 4JFQA 4OF3A 2M8XA 1LO2H 5DUBA 4GXUM 3LH2L 3O2DA 1C08B 3MGOA 3PP4L 3BO8B 1MIEL 5JOPE 3HFMH 4JM2A 3DYMA 4FFYL 1FNAA 3CXDL 3PDOB 4NNYA 5T3XE 3GBLA 1U58A 3IRPX 3ES6A 3SDAA 4G5ZL 2BNRB 1G7HA 2VXVL 2X4UB 5DMGC 1IEAA 1N7ML 3KR3L 4OM0H 2R1XB 1UWEL 5J0BA 5I15L 3ME0A 2ICCA 1A2YA 3PWJA 2ICEA 5J3HC 1BQLL 3KLAA 2NY2D 3FAWA 3NCJH 4MJ6A 3T65B 5JW4R 3CFEB 1INDH 2AI0L 3R8QA 3ARUA 4TRPL 3SQBA 2R39A 1CD1B 1J8HA 2OR8A 5EU5A 3O41B 1HKFA 1JHKL 3HE7B 3QPXH 3SPVB 4NT6B 5EC2A 4ZFGH 1GYAA 2GJZB 1VPOL 5DD5H 5F7EH 5I30L 1WGOA 5ANMB 1IEBA 5C07B 5T1KA 3U6RB 3PL6A 2V17L 4F58H 1VDGA 1AI1H 2FATL 4GG6A 4YHZH 3QAZC 5DI8B 4OKVB 4CMHB 2NNAB 4RGOH 3LQAC 3QEGL 3FOMA 2J4WH 1LO4H 1PX3A 4GG8A 4RA3A 5EN2A 5GGRA 4V1DA 5GXBB 2PXYB 2A38A 3RWFA 3R0NA 4NQDA 2LTQC 4X6CB 2DLHA 1RK1B 4ZNEA 4I77H 4JZOB 5EUKB 3KPOB 4JCLA 3MV11 3WFBL 1YN7A 2OTPA 4R3SB 1P4LA 1Y0LA 1DUYB 2Z8SA 3O2WH 1Z9SA 3MNZB 3V4PH 4JFZL 2DLGA 5DJ6A 1FQ9C 4HSQA 3HG1A 4AQOA 1MVUA 3FOLB 4XX1E 5DJZB 2JCCB 5DD6B 4BKLA 4LK4A 4U1MA 4ZYKA 4DZ8A 4HBCL 4R4BB 4DCQA 1NUNB 1Q9OA 2DI9A 3DVNB 1QSFE 3BWAB 4XAKD 5DO2D 4LSVL 1YMHA 3I50L 3TLRA 3IAQA 3SGDH 4MAUH 3VXRE 4NOFA 1QLFA 5IOPB 5I8KL 1WTLA 2ZJSL 3DX8B 1MCRA 5MP6H 4A6YA 1FZJA 1E4JA 2G9HB 3G6DL 3RIFF 2OL3A 3DUSB 4G6FB 3TH3T 3MGTA 1FFPB 1INEL 3U7YL 4LARL 5DK3A 4YC2B 3ECBB 3LRHA 3L3OA 3WN5B 3IF1B 4R96A 4ZO8A 1A9BB 3VXTA 1C5DB 4F57L 1W8OA 3BH9B 1RUKH 3DV4B 3NAAL 4Q6IA 2WIIB 5IMLA 4X0KA 4EI6A 3U9PH 1LE9A 2VDRL 3SCMD 4MD4B 4NKMB 2R8SL 1X5IA 1T7XA 4AMKL 4CRPA 3A6OA 5FF6A 2E9WA 4XH2B 2E7BA 4PJ8D 5DHVA 4OGAD 1UYWL 2BX5A 1CLZH 4CADA 1TCMA 4ZPTA 1DQQB 3CU7A 1YNLL 2COQA 5H94B 3L3DA 5C0CE 2H2PC 4PJ5A 3T0DA 2W07A 4NQCB 1Q8MA 3O4LB 4MJ2A 3O0RH 3H9SD 5EO0A 2BVOA 3L1OL 3O2VL 3KXFB 2C3GA 4OCLC 2W60A 5TGBB 1JWSB 1F3DH 4I9WD 2VXTL 4G3YH 2CLZA 2D9CA 4ETQB 4JDTL 2C7UA 5IBTH 5CLTA 2MQ3A 4M7LH 1OGAA 2PYEE 3AREB 4UZGA 1FJ1B 4S1DD 4X6EB 1I1AD 5HVHC 1BEYL 1CVRA 2PO6C 43C9B 1IGCH 1XF1A 3C08L 4FQJL 5DLML 4F33B 1RZKL 3C9NB 1KFAL 2V5TA 1TQCB 3S4SB 4I4WA 2OQJA 4OCXH 1IZJA 4HS8H 4PJEB 3L7FB 1U3HD 1JUFB 4RNRB 4Y5VC 3GJFK 5L9DH 1S9VA 4PGBA 4PJCF 5A2JH 4NJAL 1Q9LA 4F80A 1I1FB 3AS0A 5D7KD 3WIHH 4FXGB 1TJGL 2BNQB 2YKLL 5D71H 3C5ZC 5INDA 3HNSL 3SDCD 4MX7B 2X6MA 2ERJB 1BIIA 4TVSa 4CKVX 3TVMB 5KSBA 1MCQA 3SOBH 3D5OF 3IGAA 4IRJB 1RIHL 2GTZB 1MFDL 3MLUH 4QHUB 2WAHA 3RFZC 2IGFL 4GJTB 5D6CA 4QRSA 2ZG1A 4X4ZA 5TE4H 3P77A 1RZIB 4Y4FA 3PGDA 1EEZB 3QCTH 4HEPG 1NBYA 4L4VE 3BRFA 1N6VA 2JK5B 4JM2C 3ARGB 4H0HB 2AJYL 4N8VA 2VXQH 5F89B 2LAGB 1KPUA 4KPHH 4U1GB 3TNNA 1NMCC 3ULVE 3OQ3B 3SDAC 3X13B 4Z7VB 4N1EA 4X7SH 3ZKXC 2AJVH 3BFOA 1PLGH 1OT2A 4AIOA 1U0QA 2IADA 1UFUA 2BVQB 3BIKB 2VDQH 3KAAA 3LY6A 3VRJA 1NSNL 2Z4QA 1ZLWH 2F5BH 5AZEL 1C16B 1ZLUH 5BRZD 3KPMB 1EFQA 3RTQA 1AR1D 1HHHA 3F12B 3CFJB 4EN3B 3THML 1R5VA 4ZXBB 2FDBP 4MNQA 4PJ9D 5KVDH 3PWPB 3FQTA 4PJXB 2EDYA 3C6LB 1JYVA 2OJEA 1IT9L 3GKWL 4LNRA 4MCZB 5LXGL 3E8UL 5IK3A 4FS0A 5DT1H 4NNXB 3T4YA 1X5KA 1A9EB 1IGFH 5ESQA 1DQLL 3PL6C 1BZQK 3P4NB 3WXVH 3TA3B 4LRIC 3CCHB 2YD6A 4PJDB 1VADA 5TQ0L 1ZHLA 3MV9B 4P99A 4XBEH 1X5XA 1DBBL 4AYFA 4XPHL 5J1AB 1MJJB 3TCLA 1MH5A 3L3IB 3GGWA 3DUUA 5AYUH 1IC1A 1U8HB 1BFVL 1GGYA 4YFDB 4NBXB 1S7UB 1T2QL 4M62H 3CH1A 1QOKA 2YRZA 1CDJA 1XR9A 2YPLA 1WBXB 3TJEL 1G9NC 1U8NA 1T0NA 4UNUA 5GISH 5E2VL 4L9LA 1YMMA 1QHOA 4LHUG 1A64A 2EO1A 5HHPB 1E4XI 3RL2B 3VW3H 4KK5D 4AH2B 1RZ8B 2BY2A 4PS4L 2H8PB 1OT1A 3QJFB 1AHWA 4KWUA 5ID0B 25C8L 1YEDB 1WJ3A 1NGPH 3B2VH 4UILL 1PYWA 3BT2H 1NCWL 5L2KA 3P4OA 4KV5E 2AQ1A 5C09B 4Y19A 1I7ZA 1L0QA 1VHPA 2DQJH 4LSPL 4PJGF 4TYUA 3MRGB 5DRZA 5C6TH 3RNQB 5EZLA 1ZT7A 3GMMB 1AFVL 4KKNA 3BE1H 1GZPB 1UQSA 4GRWE 4UQ3B 1LK3L 1HHIB 5E08L 5DJYA 2BNUB 1AXTH 3QDJB 4K7PL 1LO3L 3ARDB 3PV7A 4GBXD 2VL5B 3QIBA 4HLJA 4MA3B 3CMOL 1CICA 1CXEA 4KJPC 5I0DA 3V6FA 3RL1A 5HDQL 5FYJU 2VTFA 3QUZC 4Q6IC 3PIQB 4P2QE 1A02N 2A6KA 4QYOA 3W2DH 3MRKA 4JRYB 2UZIL 2NY5L 4U2YA 3LMJH 4XC3L 1GC1H 3UTSA 2VUYA 4JPKL 2ARJB 3DIFB 3UTPE 3D9AL 1XCQB 1JHLH 3HMXA 3NN8A 1S9KC 1G0YR 2V5YA 5FYLD 4RMTA 4UDTB 1RK0A 3OGOE 4YHML 4CJ1A 3RVTD 5DMKB 1BIHA 3LS5H 1LNUB 3VG9C 4BSWB 2R0ZL 1F90H 5IB3A 5GGSA 1DE4B 1QBMH 1RURH 3DLQR 5GSRB 4FG6D 1S7WA 1G6RL