1F8TH

Fab (lnkb-2) of monoclonal antibody, crystal structure
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
220
Chain Sequence
GVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYITYSGSTGYNPSLKSRISITRDTSKNQFFLQLNSVTTEDTATYYCASYDDYTWFTYWGQGTLVTVSAAKTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ANTIBODY FAB FRAGMENT (LIGHT CHAIN)
publication title Spatial structure of a Fab-fragment of a monoclonal antibody to human interleukin-2 in two crystalline forms at a resolution of 2.2 and 2.9 angstroms
pubmed rcsb
total genus 40
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2000-07-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f8tH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1f8tH01
1PAMA 5KSAD 4G80B 3T1FA 4U1GC 2BSRA 2O5YL 4X99B 3K8LA 1A4KA 3P3YA 4YBQD 3W2DL 4LGSB 1OF2A 4HIXL 3QAZC 2NY5L 1BQLH 1F42A 5E6ID 5IVXB 4MQ7A 4NQDD 3R4DA 1P4LA 1QSEE 1RSFA 3BPOB 4U1LB 4NOFA 5T5FH 1FNFA 2LE9A 1XF5A 1SEBB 2X4QB 2J6EL 1KNOB 4LCYA 4JM2C 3O2WH 1X7QB 2VB5A 4Y89A 4MA1C 1FVEB 3PWVA 3RWCB 2IG2H 3B9DA 2AABH 3VFNA 4AIOA 4MQSB 1HYSC 1MCSA 3IDXH 5ELIA 1CT8B 5K9JL 2OS7A 4QT5A 1N7MH 3FB8A 4NKMB 3UMTA 4X0KB 3GHEH 5I1HL 2IANA 2CD0A 1QSFA 4I9WD 1PQZB 2BY3A 3MV7E 3SCMD 5ID1A 1M7DA 6FABH 3MNWB 1WUNT 5DURD 4WW2C 5KTEL 4YQXL 1YJDL 2EE6A 3GJFA 2A9ML 2YWYA 5E70A 3LEYH 4JM2A 5JHDE 3CUPA 5BJTB 3QULA 3HLAB 3VE0A 2C4FT 3TJHD 3EJJX 1HH9B 1FJ1B 4OCXH 1RHHB 5BMFH 5C3TA 4X6EB 1JYNA 5T1MA 3C5JB 1EEUA 4YGVA 2OJEB 3JV4B 3WIIL 4OTXH 4OKVB 4WW2A 1LDPH 1U8JA 3VGBA 1QLEL 4TVPL 3MOBL 3C2SA 1FNSL 3FB5B 1FO0B 3R1GL 2KUTA 2J8HA 1BD2B 1N5YL 4MXVF 4HC1L 5DD3H 2NR6D 4ORGB 5C6PB 5C0CD 1IAOA 5D7IE 4HWZA 4LEOA 3S9DB 3QUKA 1HINL 2ADIB 2AJYL 2AQ3A 1FNHA 2MPAH 3GJFH 3KPRE 1QSEB 3NCYP 4NQED 2A73A 1A5FL 3AS0A 3RJDA 5EO1A 1RUQH 4RMRA 1G1YA 2P7TB 5AD0A 2OP4L 1DN0B 4PGJA 1L7IH 4U05A 5I1EH 4PJHF 4UIKH 2ADJB 4LCWE 4QY8B 4OD1L 5INCB 4Y16B 1GZQB 3TBWA 1Q9WB 2IGFH 4EI6A 1P7HL 5LGJB 1KT2B 1FFRA 4QO1A 3HPLB 2APVA 1CD9B 4F37K 4G6FB 3MV7B 4Z78B 2Z93B 3DWTA 5F9JA 1EO5A 2EH8H 2D9QB 4OBRA 5JPMB 1HCFX 3LQAC 5ENWA 4MNQB 4KZEL 3SQOH 3ZDYE 4O51B 1XZ0B 1YN6A 3FHQA 5JHDB 2X4SA 3HFMH 3G5XB 4XI5C 4WEUD 5FUZL 2Z8VC 5I1LB 3QR2A 4ERSL 2R2HA 4JJ5B 3D2UB 5GIRB 4BA8A 2NQCA 2HFGL 4LOUD 5JW4M 5CP3A 4OZFG 2R9HC 1FFNA 4CMHB 4R4ND 3KLSA 1ZHLB 5D7LA 4UT6H 1TCRA 4LVEA 1NCAH 5I15L 1IGFL 2XQYG 3EO1B 2Q8AL 5L8KB 5GS2D 4JG0L 1B90A 1P7KA 5L2KE 2DI8A 1INDL 1FAIL 5D7IB 5HTSA 4OZGE 1MPAL 1GYAA 2HFTA 1A2YB 1HSBA 3KPRB 4P0DA 3F65A 2BVYA 3IDMA 1E4XL 3EJYD 1K8IB 5ID0A 2RJMA 1ETZA 3BD3A 1PX4A 3QXAB 1VGKA 1U3HB 1FVDA 1H5BB 3GSXB 4MA7L 4P59L 4ZUTA 4LCWB 3NIGF 5CP3H 4ETQA 2OR9H 4P5TC 3ZHLA 3IT8D 3OKLA 4P4KB 1LO5B 3HI5L 2YA1A 5JPNA 2VDQL 2PYFA 4PS4H 4BFEA 3MGTB 4NO5B 3LQAH 2ZUSA 1CGSL 1GGTA 2BFVL 3G6JB 3V5HB 3VCLB 4LAQL 4LSRH 2NY4C 4KI1A 3T77B 4DKFH 3W11D 4V1DA 2YUZA 4LMQE 3QUMB 3VXSB 3U4EA 1Z0MA 4U1SA 5A3ID 4NWTL 4PD4J 4YLQT 1NUGA 2UZXB 4P5TA 3KXFA 4P2OB 1IBGH 2NTSP 1GGIL 2F15A 1SY6L 1FNEB 4LASL 3E8UH 3H9HA 1KIRB 3A67H 4XXCC 5FYJL 3L5JA 3L3JA 4ZTPL 5FKPB 4HGMA 4YPJA 3DV4B 2XN9D 1F97A 4KK5D 1FH5H 4I18C 1E28B 4MNGE 5KBNC 2ERJC 2IMNA 1I7TB 2YD4A 1Z9OA 4LSDA 4MDIA 3U30C 4OV5A 4LIQE 4KKAC 1FZOB 5L2KB 1IILE 2HLFC 3L3HB 2LQRA 4OZGB 2ZKHH 1KJ3H 1S7TB 5CUSH 3MLZL 1BZ9B 2EEBA 1PDKA 3BOVA 1C5CL 3OTTA 1YEKL 3HAEA 4XXCA 3O0RL 1KIUA 4XX1G 5INDB 3IU4L 2CXGA 4I18A 1FDLH 2OJZH 4X8JA 5FOJA 4LLWB 4MJ6B 3U83A 2JJWA 4JFZL 1BAFH 4IOIB 5L6YH 5C0EB 3O8XB 3W9EB 1I4FA 1DDHA 2CIKA 4K7FB 4FFVC 5ETUA 3SDDB 3BAEH 5D8JH 1YEEH 2P8MA 4MQTB 3IU3A 1DQJB 3SKOB 5KJRH 3DUUA 2CRYA 1C12A 1AHWC 3ARXA 3I02B 1TZIB 1T7YA 4DZ8A 1GOFA 1FLRH 3WXWL 3IF1B 1EAPB 1YDPB 2SEBB 4RAUA 3IDJA 3B2UC 3BPNC 1A9EA 1I1AC 2FJGB 1QO3A 1DQQA 4N8VG 3HAEH 4XAKD 1BREA 1YEJH 2B0SH 3R06A 5GXBB 4ZO7A 4G6JH 1EO8H 1UWEL 5DJ2A 4S1RL 5EZLA 4KDWA 2F58L 1R3JB 5HVWA 4XCNB 4DVBB 3PWUB 5ACZB 1CF8L 3PIQB 4QCIB 3D0LA 3IFNL 4KK6C 3VFTA 4UMGA 1KJ2B 5C0DA 4H1LG 1AHWA 4KI5C 4EDWH 4MNGB 5MENA 1ZGLP 3O4OB 1VPOL 1CTOA 1U8LB 5F3BA 1MLBB 1GIGH 4R90L 1I1AA 3HS0A 5IK3B 4U1HB 1JIBA 1IC7H 3CU7A 1Y6MR 3VDCA 5I30L 3K7UA 1HEZB 1X44A 1U8MB 4PLJD 1CDBA 4G6AD 4WFEE 4D0DB 4J8RA 1U93B 3KJ6H 3KPSD 2EDXA 4X6CB 3HZYA 3L3DB 1R0AH 3ZTJG 1RUPL 4ONGH 12E8L 3BMWA 3B5HA 1R24B 1E4JA 1JCKA 1RI8A 3EFFB 4Z5RA 2K3TA 3JSSA 4R26H 1BWMA 3LN9A 1XFPA 3PHQB 5ITFA 3RI5K 3WYRA 2VXSL 4B5EA 4I9WE 2RFXA 4QYOA 1Q9LA 5DSCA 4WO4B 2Y23A 3FB6B 2D0GA 1CE1H 1CFQB 1R3KB 4UIMA 4Z7VA 4KTDH 2CJUH 1IZJA 3ZL4L 5K9OA 2Q76B 5DGRA 3RWHA 4FABL 2CLZA 4Q7DA 3W39A 4FNLL 4IM8A 4O2EA 1DQLH 1TJHL 2B2XH 5AZ2H 5T1DH 1RFDH 1N59B 3BWAA 4WRLA 3JWNC 1BWWA 1BM3L 3BIBX 1EJOH 2DICA 2J7LA 2R1XB 4NWUH 5IIEA 1OD9A 2X41A 2CUHA 1U8PA 1NAMB 4P2QE 1KULA 4YDJA 2QQKL 1A6ZB 2HVKB 1IE5A 2JELH 2WWMC 3GBML 4P4RA 3KDMA 4NN7B 5KZCB 2E6PA 1T20B 3HZMA 4NQSA 3QHFL 3MO1B 1CXIA 3KYKH 2BOBA 4NSKA 1KLFA 3ULUH 4RAHA 4M7LH 4CVXA 4MX7B 2AAVA 1CVRA 2FNBA 1VHPA 4IRSC 4C4KO 3F7VB 5IB5A 4L4VE 2V7HA 1MOEA 5CP7B 5F97E 1J8HD 3QUZC 2NW2B 3GMQB 2VDNL 4YAQB 4LVOB 4LHUG 3WLBB 3WUWB 1CDJA 4IRZH 4BFIB 4IMLA 1OTTD 5KVMC 5KN5B 2D0FA 2DLFH 4GT7A 3UBXI 3FN0H 1Z9SA 1FL3B 1NC4A 2ZG2A 2NW3B 1P69B 3DTXB 1JFQH 3OBAA 1N2RA 1U42A 2AVGA 1W2KT 2QV2A 2ICWB 3HNVL 1H3VA 5GS0D 5KVFH 3QUZA 4JVUA 4GBXD 4MAYB 1WFUA 1F6AB 3MROA 3QDGD 5I1AA 1N5AA 4L29A 3RU8L 4HUWB 3WKNA 1JK8B 2W38A 4MJID 4Z0BL 5J7CC 4Z7VF 4F7MA 4Q74A 2V2WA 4X9BA 2HRLA 1QNZL 1OARL 1Q9OA 3VFSB 4P2QB 1L9NA 1NGWB 3IAPA 4XCFH 5E1HB 3LEVH 2Z31B 2DMBA 4Z7WE 3WS3A 1UWGH 5HHOE 3UJJL 1BX2A 5IVNA 4YXLL 1JWMA 3BYYA 2XFXA 2W0FB 3W5NA 1S5IL 3EYVA 1MHPH 3RNKA 4L4VB 4YK4B 5C6TL 3MCKB 5H94A 3VD4A 2YUVA 1BHGA 1RZFL 3QXWA 3P11H 1T5XB 3HZKB 2YD6A 3CFJA 5MEQB 3HB3D 5C0AE 1R5WB 4JDVB 4XNQA 4KROD 3L1OL 2F5BL 4QRQB 3L5WA 1KXVC 5EU6D 3MZGB 4YHYC 2VLJE 3ARQA 3UPRA 1KB9K 3AXLB 1NJ9B 2AK4D 2H2PD 2X4TB 3QA3A 5FK9B 1HNGA 5F9WC 2ZUXA 2FSEA 1HHJA 3ZSTA 5C0BD 1JGLL 2PTUA 1MCOH 1DQMH 2FO4B 1FYHB 4RIRA 4U1KA 3D25A 5DJ6A 5B38G 5D1ZD 3D18A 2NXZC 3OG4B 4DJMA 2EDYA 4GO6B 1G1CA 5E2UL 2YUWA 5F6HI 1H8OA 1N4XL 4YHOL 1DUYB 5I1KL 1QYGL 3WCYA 4GRMA 1SBSL 4Y2DC 4G6ML 5GRWA 1W0VA 3S35L 1J87A 1YEGH 3MOQA 5DK0A 5DRNB 3CLEH 4HH8A 4M8QA 1P1ZA 3LQZA 3ARWA 1ZWIA 4AQ1B 4Z7WB 3GI9H 2BMKA 5HHOB 4M1GL 4LLDA 1BJ8A 2AK1L 3REWB 4PJDF 4DFHA 3EKCA 1RZ8A 5DXWA 3P4NB 4MSWA 3FRPA 1XF1A 3QSKB 3O41B 4K3EL 3MMEA 4Y2DA 3LKQB 2VKWA 5KSVA 2DQJH 3LPWA 5B8CB 1IQDA 1HCVA 4ZPTB 4HS8H 4PJIE 3VWJC 3HI6H 4YHIA 3E6HB 1NFDE 5C0AB 4X6DE 5IF0A 4KVNL 2FJHB 4NNXA 4RFNC 5EOTB 5ESVB 2CLRB 4FHBD 1S8DB 1G7JA 1JWUB 4LLMA 3H2WA 3GJFK 3ZHKA 2VLJB 4JRXA 4K3HA 1J05B 1OHQA 3CU1A 4NM4L 1CLOL 3VD9A 2GHWB 1KOAA 3TNNB 3WL9B 1KCLA 3S37L 2ATKA 2ICWJ 2WUBL 4JPIA 4DQOH 1RHFA 3VWJA 4EDXA 1MHCA 5DEGB 3L3KA 3QJFA 1IGTA 3KYNA 5L8JB 2Z4QA 3D3VA 3ISWA 3Q3GA 4OJFL 1TQCC 5CIPA 1A6VH 4UT9H 2GUOA 4ORZC 3BDBA 3NFNA 5TGBB 1JNHB 3VGEA 2YD8A 1YN7B 2Q86B 1L9MA 2IH1A 4FQPA 4NQVA 2LABA 4UOJA 1A64A 5IG7B 3L5IA 1JHKH 1MFBL 3QI9B 4S1SH 3HI1A 4TSCL 4UT7L 1SYVA 1CG9A 5DR5L 4QXWA 3VXPB 3SKJH 5MP6L 2AXGB 4JPWH 2AJUL 2VN7A 3D6GA 4ZAKC 1BBJA 3HC4L 2W60B 4A6YB 1FRGH 4M48H 5D6DA 3WD5L 5E8DL 4PJIB 4PJ5E 1M6OB 4JZOA 1NFDB 5CIPH 3M1BB 3BISA 4X6DB 3DMMC 2DIJA 4EI5B 1PYWB 3BGMA 1I9RL 5F96L 4YEEA 1BFTA 5F1KC 1GC1L 1X5JA 4F7PB 4ZAKA 1MCJA 1B0RB 4WW1B 1G7MB 1S3KL 5GHWH 3S6CA 1S7VB 2XNAA 2Q7YB 1A0QL 4EBQL 2XKNA 3O3DB 4GW1A 1TMCB 3X11A 1UKSA 5DZNA 3AS1A 3M8OL 2G2RB 4MXWL 2Y4SA 4KHXH 5D2LE 1N64L 4FFYL 4HXBH 3TLRA 3DMMA 1IC4H 2AV1A 1NCNA 1QQDA 4MGXA 3WNPA 5HHXH 4C57C 3MV8A 1HHGB 5IESL 1S7UA 1YMMD 1XF2B 2OTWA 1KUMA 1JNNH 2GFBB 5FUOL 4TSAL 5BZWA 1OQXA 3WO4B 4AH2A 3NCEB 2YK1H 4OD2A 3S88H 3ZMRA 5FDWB 1SVCP 4NPYA 1DQDH 5CZVL 5J6GA 1BVKB 1CWVA 4G3YL 4OQTA 2GCYA 4NJAH 5CBEB 3RWDB 5EZOL 2ZOKA 3NAAH 5C8JB 1NLBL 4FQ2H 4X7TA 3GIVA 3BPOC 3AS2A 5EZJB 2ZUTA 4HWNA 1OB1A 4PJ5B 3W0WA 1FP5A 4XTRC 1KCSH 5JXAH 2VDPL 2IQ9H 3N1MC 3MYZA 3EO0B 4P99A 2X6MA 2VNCA 5D7JD 4X7EC 1QFUL 5H2BA 3VXTB 1V3MA 3F6LA 5ICZB 3ET9F 4N1HB 1SEQH 4X99A 5ERWB 3MRKB 5CINL 1ORQA 4F57L 5IVXA 1FGNH 2HKHL 5CMAA 3T0EC 5GGQH 4M6MH 1AJ7H 1ZHKB 1IC5H 4U1LA 2ZCHL 4OQTH 43C9B 3PDGA 2HMIC 1JRHH 4KUCD 5D2LB 1OVZA 2X4QA 3X3GL 1KNOA 4QHNB 3E6FB 4MJIE 5DI8B 1X7QA 1T6WA 3CDFA 1UXWA 3QDME 4OCSH 1FVEA 1ZT1B 4L3CB 1XR8A 3MODL 4ENED 2DB8A 3SJVA 1CT8A 4YDKH 3SE9L 4X0KA 1J11A 2NYYD 5TDNB 1PQZA 3HCVB 5AZEL 1I7ZB 3T0EA 2OM5A 3MNWA 1GOGA 3WFEH 3IB4A 1JGEB 1P84J 2H2SD 2E9BA 1HNFA 5BJTA 3HLAA 2CK0H 5E03A 5L2JA 3C2AL 2R69L 1SYSB 1MFNA 1FJ1A 2FEEI 5D5ME 1RHHA 3TFKD 3AS3A 5DJCB 3TN0D 1OAZL 3LCYA 2IAMD 5D1XB 1JZ8A 2XWTB 3C5JA 4Z7OE 5BVPL 5FFLA 4WNQA 3JV4A 2X44D 3GM0A 4Y8DC 4OKVA 2WP3T 5CLWA 5A2FA 1LMKA 2AK4E 1G6RL 1S78D 4HFWB 4Y16C 3QNZB 2I5YH 2CDGA 2LV4A 4KAQL 1BD2A 5C0BE 1QP1A 3CX5K 5HGBB 1A3RH 1QSEA 1A1MB 2DMKA 1T1ZB 2Z35B 4HK0A 2Z8WC 2P7TA 4MJIB 1DN0A 2OTUB 1U95A 2YPLD 1QHPA 3QDMB 3ZT7A 1RJYB 4JREB 4KJQC 2V5YA 3V0WL 4NJ9L 4XPGH 3DYOA 3O9WD 2R29H 5INCA 4Y16A 1GZQA 1EEZB 2A77L 5AG8A 5HI3C 1KT2A 5LGJA 4OT1L 4F9LC 1I1CA 1XF4B 3HPLA 5F7NC 4LRNL 2YD5A 1CLZH 4CMHC 4U2YA 2W0LA 1OGAA 2Z93A 3HR6A 2CDFA 3U7YH 5DVLA 1S7RB 4IIQB 5JPMA 1OPGL 4MNQA 3TPKA 2FYYB 4GMSL 4O51A 1XZ0A 3WDIA 1EFXD 4D0BB 1YNKH 5KVDH 1UZ8B 5C0JA 2FIKB 3TF7C 3PWPD 5D5MB 5L7XL 5I1LA 5TPWH 4JJ5A 3CMOL 3GSQB 4JO3H 1UADC 3TIDB 3TPUB 4F9LA 3C5ZD 1F00I 1MH5B 3G6DH 5I8KH 1U3HC 4HF5L 1ZHLA 3QFJB 4M62H 1H5BC 1SJVA 1G0YR 4K2UH 5HGGS 3TO4B 3SHSA 3IRPX 3W81A 2NX5E 5AYUH 2G9HA 3O3EB 3BE1L 4ZXBB 3BZEB 1GGUA 1JTPA 2AK4B 4KK9C 4RWHA 3SPVB 4P4KC 1LHZA 5HYSA 4LAJH 5D7IA 1G9NL 1PY9A 3KPRA 1A2YA 1KCVL 1MJ8H 3CMGA 1VFBA 2DKUA 4DTGL 2ZPKL 1K8IA 3A6CL 4X5XB 1FPTL 3EYQD 1PX3A 1INQB 1ZKAA 3WS6C 4ZFGH 1KXQE 1U3HA 3BWUC 4U6VH 1H5BA 5I76A 2W65B 25C8H 5F70A 2EZ0C 4WU5B 1RUMH 3BX7C 1ZS8B 4P2OC 1BQHG 4P4KA 1PLGH 4MQXC 4XVJL 1LO5A 2ORBL 3UTTA 3EYSL 4C54A 3MGTA 4NO5A 1MCWW 3G6JA 3VCLA 4KRPB 5E2WL 3T77A 5HHPB 1DN2A 3C87A 1ZVSB 4TRPL 5EUKB 1CK0L 3WS6A 5B3JE 3DRTB 4OZ4B 3QUMA 4HAFA 3VXSA 1EK3A 1Q72L 2OL3L 4Y4KD 3L7EB 4OCWH 4P2OA 3DROB 3IJYA 1GPOH 1IGYB 5DRXB 1FNEA 1YPZB 1JRHI 1MCNA 1KIRA 4N8PA 4R3SA 5FKPA 4W6XB 3SDXA 5A16B 3S36X 3U0TB 4GRWE 1E28A 1I75A 3KPQA 4GSDH 4MD0B 2NX5B 1MWAA 2VXTH 2VQUA 4GXVL 2WMPA 1JUFB 3MLWL 3QCVH 5ADPL 3O8XC 1I1FB 4M5ZH 5L2KA 1FZOA 3SDDC 3L3HA 4OZGA 2XZZA 2FWOB 3RWEB 3QCUH 3DO7B 1BZ9A 3QUMH 5FM8A 3BPCB 4Y8AA 5CJOH 4RMVA 2XZCL 4I3SH 2VDKL 5ISZA 2YS4A 2ICES 4QOKB 5INDA 5KVGL 2ZSVA 3S34H 1X5LA 1YMME 4LLWA 2CLVB 4G5ZL 4YC2B 1YY9C 4CGTA 4IOIA 3SGJC 5C0EA 1XGUB 2VZUA 3O8XA 4FRWA 5CJBA 3SDDA 3NACH 4MD5B 4YFEA 1GVIA 1RK1A 4N0FA 5A2KH 3WFBL 4DUWA 1MWAH 4FOMA 3QRFM 1UB5A 1VKXB 4LPVA 1DQJA 3QIUC 1I9JL 1EUTA 4S11A 4DUVA 3I02A 1PZUB 3ETBF 2I9LB 1TZIA 4CVZB 1MEXH 3R8BB 5FM4A 1EAPA 1OAKL 1X5YA 1YDPA 2SEBA 2O5XL 3O4OC 3OL2A 5CD3B 1OW0C 1I3GH 1Y18A 3T3PF 4L8DA 2EE2A 1AE6H 4G9DB 2VH5H 4WJ5B 3SGJA 1RUKL 3G6JF 4ZS7H 4I77H 1R3JA 3DRQB 4RNRB 2E6JA 4XCNA 4DVBA 3PWUA 2HTLC 4CDHA 4QNPE 3PIQA 4QCIA 5IBUG 3QIUA 3O3BB 4EXKA 1ZLSL 1KJ2A 1CR9H 3K1KC 1K5NB 4ZS6C 4NO0D 1CFNB 4G43B 5F7EL 4MNGA 3CFBB 3OGOE 2MSPA 1OW0A 1MLBA 3BIAX 5LBSH 2FDBP 1JZ6A 5GGTL 4GAJH 5IK3A 1HILB 2E9IA 4LLYB 2ITCB 4U1HA 2KH2B 5C0NC 3SDXF 3E3QE 3RVXD 1HEZA 3LD8B 1I3VA 3H8NA 4BKLB 4Z9KB 3JUZA 1KIPB 2V9QA 1B88A 1ZVYA 2AEIT 2GT9B 4D0DA 1AY1L 2A9NH 4G8GD 4M3KB 1NBQA 2BVOA 4FQIH 1U93A 4P5KB 4X6CA 1FE8H 3L3DA 5FYLE 4HQQH 1QBML 3DYMA 4J4PD 5H37G 4D9RD 3NA9L 1YMMB 1R24A 3EFFA 1T21B 4YHKL 4IDLA 5DO2D 3PHQA 2R0LL 1KJ2H 5TF0A 5B4MC 3RP1A 1B9ZA 3FB6A 1R3KA 1CFQA 5ACLA 1U91B 2FBJH 4NN7C 2EECA 2Q76A 2QQNH 4TNVK 3H42H 4MWFB 5C86A 3LB6D 1J10A 1EHLH 4MA8H 5LGHL 5F71A 1FN4B 3D9AH 4OM1H 43CAB 4F58L 4Q9CA 1B0WA 1GGBL 1BF8A 4ESKA 2J8UE 4F2MA 1NAMA 4HAGA 4LVOC 2HVKA 5D7JB 1OSZB 4M1CC 3DBXB 5E99H 2ZCKL 4GFTB 4CBPA 4WFGE 4HKZB 1R6VA 3GUTB 3RA7L 3MO1A 4FQJL 2X4PA 5KAQG 4PUBH 2WP3O 2GTZB 2V5RA 4MX7A 3RTQD 3GI8L 2EDQA 1J1XH 3TT3L 2AQ2A 3F7VA 2IALB 2W9EL 3BMVA 3VDBA 5LG1A 4M4RA 5CP7A 3RZWA 1IARB 1YJDC 3FFDB 1DVFC 2NW2A 5HJ3B 2APFA 3GMQA 3WUWA 3WLBA 4MAYC 1NGZB 4NNPL 5E56A 4H0GA 5DUML 2DQDL 2BJMH 1LO4L 5KN5A 1NAMH 3K8KA 4YXHH 5F8RC 3ZSSA 5FCUH 2NW3A 1MLCB 2VZTA 3DTXA 4X6CF 2R0WH 2WK2A 3HG1D 4F8TA 2Z31C 4KY1H 3ZKXB 2ICWA 4GLRH 4PIRF 1YC8A 1MCRA 3H7LA 1RIHH 3STBA 1DVFA 5DLMH 3O3AB 4OSUL 3QDJD 4MAYA 5JORB 1FHGA 4XH2A 4DW2L 1Q1JL 1G7PB 1P9MC 1ERNA 1JK8A 4M93C 4E5XB 5CGYC 4AT6B 1QLRB 3VFUA 4KZDH 3ZE1F 1II4E 4UOW0 1AC6A 2AI0H 2J8UB 3VFSA 4P2QA 3ILPB 1NGWA 1Q0YL 4DEPB 2Z31A 1HKFA 4XB8A 5H35B 2W07A 3RKDC 5I0DA 3STLB 3FO0L 3VXMD 1NEZG 1I8LC 4JHAH 1UCBL 4Y1AB 5KTEH 1P9MA 2R2EB 4BQ6A 1JTOA 1QPXA 2DN7A 3N85H 4YQXH 3ZKMD 2P49B 4KVCH 4L4VA 4K07A 3MCKA 3T2PA 2JCCE 4M7KL 5GSVB 4U3CA 5HSFA 1T5XA 3HZKA 2BY1A 5MEQA 5F3HB 1SVZA 1CQKA 4GQ9L 1R5WA 4JDVA 1FYTE 5EUOB 1PG7W 2VDLL 1GHFL 3PWJA 4QRQA 4JGMA 4QXUH 3T0AA 1I8LA 5CJQH 3V7AG 2VDOL 4I1NB 3AXLA 3QB7C 1NJ9A 4JFDD 3WIIH 1QR1B 4CKVX 2AJXH 4O58L 3SE4C 5FEBA 5IQ9B 1QLEH 4WUUA 5IVZB 4NKIL 1ODAA 1FNSH 4WFHE 5JR1L 5DD1H 5DC0A 2FO4A 1LO3H 5JW3L 4U6HB 4OLUL 4KMTL 4OGAC 1KLGB 3AREB 5LCVL 4E41D 4PB9H 1I7RB 4IOFD 1T2JA 1RAMA 2J5LC 2DKSA 1INEL 1NMCB 2XXMB 3O2DA 1DUYA 3NCJL 4FMKA 4OGZA 3KPNB 5E7FA 3BN9C 4LMQI 2WV3A 2F5AL 3MRGB 4UB0H 5GQBA 5B8CC 4ZFOL 5JTWA 4C56D 1T89C 1T04A 5DRNA 3SE4A 5TDOB 3ES6B 3GMNB 4OD1H 4LPUA 2BERA 1M4KA 1BPVA 1F4WH 4HBCL 5HHOA 1H3PL 4XGZB 4ELME 4XPHL 3ILQD 1MVUB 3REWA 3P4NA 3TWCL 3MRHB 5ITBL 2V2TB 4JY5H 1RURL 3LKQA 2JCCB 3QZWB 3KYMB 3K46A 4NGHL 5B8CA 3VA2C 4ZPTA 4DGIL 1HHHB 1T89A 5C08D 4PY7A 3O2DH 3LS4H 1AFVH 3E6HA 5C0AA 5EOTA 5ESVA 1FYTB 2CLRA 5E4EB 1BFOA 3GMMB 2GAZB 1JWUA 1XCTB 4DFIA 2RCSL 3B43A 3G5YB 4P23D 3CDGB 3QIWB 1J05A 4NZDA 1RULL 3IDYB 1SM3H 3ARDD 4LQ1A 3IJSB 3TNNA 4MJ4A 3WL9A 2QSCH 1IGFH 4JKWA 3TVMC 2X10A 5CHNB 1BVLB 3QI9C 3OX8A 4RMQA 5DEGA 5D70L 5GSRA 1MPAH 3QUXD 1T66C 4Y19A 4YBLC 3T1WA 1G7LB 1NGPH 3RX5A 4OIAA 4GAGL 5LWYL 4YWGL 2EEAA 2H6PB 3HE6D 4XHJC 4P46B 5IW6B 2XIDA 5DMJB 1T03H 3SO3C 4G9FD 1UZ6E 3GSVA 1T1XB 5TGBA 1JNHA 3GO1L 4MA7H 1NFIB 2VSCA 1YN7A 4P59H 2Q86A 3VDAA 2B1AL 5IG7A 4WEBL 3TVMA 1O7SA 3QI9A 1IQWL 4EI5C 4KHTH 4LKXB 3HMWL 1QFWH 5B22A 2C3WA 2YD2A 2P5WD 4ELMB 4PJEE 4XWOD 1Q8MA 1PW3A 3F12A 1MCBA 3ZYIA 5I2IB 4LSVL 2BFVH 3EZJB 1JGVH 4A6YA 3NPSB 4M6OL 3ARGC 4GLRI 1T0PB 4N8VA 2VC2L 1M6OA 4D9RE 1NFDA 3F7RA 4B0MM 4X6DA 4IDJL 4EI5A 2A0LC 1PYWA 5IB1A 1XEDA 3KG5A 1TZGL 1CN4A 3OKYA 1T1WB 5I18L 4ZTPH 3K4DA 2D9CA 4F7PA 2OQJB 1OWWA 3OR6B 3WO4C 1G7MA 4N9OB 5ALBL 5T3XE 1DSFL 4QKXB 4BJLA 3RL2B 2Q7YA 2FBOJ 3RIFF 2XOTA 4GRLB 3FRUB 3O3DA 4DWHA 3VGDA 1HQ4B 1GL4B 4A6YH 2G2RA 4YUEH 4U3XA 4G8IB 1KTRL 1LP9E 4X9HA 3HMXL 3I3DA 1DLFL 2VERN 4LLUA 1A7NL 1HH6B 2Y36H 1PSKL 1F4YL 4YX2L 1XF2A 5HYFA 3OGCA 4Y88A 3IU4H 1M71B 4JDZB 3UEZA 1UYWL 3ORJA 3V4PH 2PO6D 5SWSD 3S3PA 2D2OA 4NZRL 3JTSB 2BNRA 4U33A 1Z5LB 4PRDB 1BVKA 2BDNL 3E2HB 4N0CC 3BPLC 1X5KA 3ZYZA 4LLVB 5CBEA 2ZZUT 2BP3A 4Q9BA 4XC1H 3RWDA 1BEYL 4JFQB 5C8JA 3LKOA 5EZJA 4PJ5A 2XZQL 1Y6NR 3LMJH 2VKXA 3EO0A 2FECL 4TN9A 3ZTJH 2F58H 2H3NA 3VXTA 5F8QC 1IAIL 3IFNH 3CVHB 5ERWA 3WLWC 2BX5A 1A14H 3RBSA 1VADB 3MRKA 4WI4A 3ROOB 5EWIH 1NFDF 5CEXB 1F45A 2KBGA 3EDEA 1HQRB 1ZHKA 2IEPA 2M26A 1A7PL 43C9A 1EBAA 4EN3D 3AFLA 5DFVC 5JDSB 1I8IB 4U0RC 5I30H 5D2LA 4QHNA 1LP9B 2EXYD 4JANB 3MRDB 5DI8A 4TQEL 1NLDL 1K4CB 4G7VL 4LHUA 1ZT1A 5ILTL 1I7UB 3U48A 4L3CA 5GS0L 2VDRH 2DQGL 5D1XC 3HR5A 2HT3C 1I7ZA 1AKJD 2VLKE 2HKFL 2VXSH 4KFZC 3EOBB 5DF0A 2VUYA 3MBXL 4G8FA 5I19L 1DBBL 1AGFB 3RTQB 2PYED 1J0ZA 1ZEAL 4R97B 4PLNC 4MCZA 3RX8A 4IMKC 1SYSA 4N0UE 4FABH 1GXEA 5JA8B 2A1WL 3G04B 3NPZB 2Y9RT 5DJCA 1RY7B 2VABA 3I75B 5D1XA 2XWTA 5D96C 5DFTA 5A2JH 3I6KB 3V4UH 2W59A 4JFHE 2V9TA 3ZYJA 4HFWA 3OAUH 1OT2A 4JO2L 4JM4H 1DJSA 1DLHB 5HHMD 3GEWB 4HWBL 4IMKA 5HGBA 4AENB 2YEZB 4KJYA 5J4MA 1QFWI 4IIQC 1CXFA 2VXUL 2AKRB 3UTSD 2XQBL 1PJ9A 3I2CH 1ADQL 5B21A 5CKAA 2OTUA 3BH8B 4ZUSB 3QDMA 3S96B 1RJYA 1EVUA 1U3YA 2YZ1A 1TQBC 3V5DB 3WN5B 1VENA 3BKJL 1EEZA 2APTA 3LKNA 1L0QA 4LKCB 5IB4B 1F3DH 3EYUH 4R4FL 1W0WA 3MJ8B 2NY0D 4LSSL 4WWKB 3BUYB 2VLKB 2XXCB 1OY3B 2H32B 4QXGL 3ECBA 1S7RA 3TO4C 1I85C 2HVJB 4IIQA 4PGZA 3QG7L 4ZXBC 5D9SB 3LS5H 2FYYA 3ARBC 4JHWL 1HWHB 3MLSH 3EUUA 1UZ8A 3HNVH 4NZTH 4DVRH 2FIKA 4N0UB 2J4WL 2GY5A 5D5MA 5L88H 4PJAE 1KB5B 5C08E 4X7FC 3GSQA 3TIDA 3TPUA 2FH6A 1RMFL 1NMAL 2VDML 4HIHB 3QFJA 4B7IA 5EOCL 3TO4A 1I85A 1TITA 1OARH 2BOCB 4G42A 3BZEA 3O3EA 3QT2A 4ZXBA 1N0XH 3ARBA 5ESAB 3SPVA 4P2RA 2P45B 3VI3E 5JZ7C 4NRZB 4R7DB 3S37X 1RIVL 3ZE0E 3IS0X 4J3OC 4NQCA 4IS6A 1CE6B 2IAND 1QSFD 4OLYH 5C6WH 1BIHA 4KRPC 4X5XA 3K8MA 5E0QA 1S5IH 5E8OB 3WJLC 5JQ6L 4OI7A 3JV0A 5GJSH 1BIIB 1INQA 1UACH 1EEQA 2FATL 2KDGA 3GSOB 4FFZL 1RZFH 4JM2D 1T0NA 4X4ME 2W65A 4JPKL 4KJPC 5CS7A 4PB0H 4WU5A 4XNUH 5DEZA 1ZS8A 3G9AB 1HYSD 3OV6A 2WINB 1J7VR 2WBJC 2HJKA 3HUJA 3S7GA 2OXGA 3VH8B 4YH6A 1U8OA 3UYPA 3TBYB 3SE8L 1XR9B 3BSZL 3HC0B 3WJLA 3QPXH 5EUKA 4NKOA 3BFOA 3DRTA 4X9GA 3OAZK 5DQJB 4XMPH 5CGTA 4P9ML 5E8NA 2X5PA 3P77B 4N0YL 4RMWA 2OTPA 4HXAH 3L7EA 4PJAB 5DJXB 4TOYH 5C08B 1U41A 4M7JL 1IGYA 5DRXA 4AEFA 1YPZA 2WBJA 3S5LB 1RJZB 5I1KH 1X5FA 4HCRL 3GJEA 5E2JA 3U0TA 4QHMB 4ZO8A 1HI6A 2LVCA 4APQC 1OAXL 2CH8A 1QBAA 3GK8H 1UA6H 5D1QB 1RZKL 2NX5A 1HSAB 3N50A 3F7QA 3ARDB 1JUFA 1MAKA 4ZDHA 1UFUA 2ARWA 1CFSB 1I1FA 1FFQA 4ZYKB 2AP2A 3GDBA 3ULVE 2JK5B 5GRVL 2FWOA 4PPTA 3GIZH 3AAZB 1T3FB 2VAJA 3BPCA 5I66B 1IFHH 4QOKA 4K3EH 5E6ZA 4APQA 4CU8A 5MERB 4NP4L 1G6VK 1FBIH 2NNAA 3JWDL 3IGAA 2CLVA 3OPZL 2IPUG 1I8MB 5BV7L 1XGUA 3QEQE 4MD5A 4QRPA 2CRZA 4XBEH 1A7OH 5M95B 3SDCB 2XG4A 5JHLL 1KPVB 2I9LA 5D7LD 2G60L 2Z9TA 1JYVA 1MNUH 5CD3A 1KCUL 3WBDA 4TULH 1IGCL 3HUJF 2AW2A 2PNDA 4P3CL 4XI5D 4LHQB 2PW2B 4F7TB 2DBLL 3Q6GH 4WJ5A 5EN2B 5EO0B 3LD8C 2DLGA 5EU4B 2VZVA 2XA8L 1E6OH 1KBGH 3S4SG 3EYOB 1IM9B 2GK0B 2R9HD 2YD9A 5F44A 1DEDA 3O3BA 4JQIL 4ZTOL 3TYGL 3PNWB 4QF1B 5IFHH 1CFNA 1DFBL 3I84A 4G43A 4DK3A 3MRJB 3CFBA 4L8CA 5K59E 1WZMA 5DVNA 3QBTB 2ZSWA 1F58H 2GEEA 3INUL 1YPZF 1HHKB 1HILA 4LLYA 5DR5H 2ITCA 3MUZ1 4UNVA 3E0GA 5GRXG 1WFTA 5MP6H 1IMHC 3HC3L 2AEQL 3LEXB 4QTHB 3MQIA 2GT9A 5BOZG 4V1DD 1MJ7H 1NBZB 1EEYA 3MA7B 3QCTL 4PJXA 5E8DH 2WIIB 1T21A 1GRWA 1AXSA 3KXFD 3VFOA 3KR3L 5F7HA 3QEQB 4LARL 3FJTA 2EDHA 4H26B 2HFFB 3GB7B 2VZ3A 5FUCE 1T7ZA 1U91A 4UTBL 5J13B 2IH3B 1F3JB 4ZOCA 4CU7A 2OK0H 2NY4D 1JZ2A 3FQUB 2COQA 4IEFB 4FQHB 4OUUB 4LSUL 3RIFK 3RRQA 4EBQH 1FN4A 4KWUA 1KTKE 43CAA 3E3QC 5GZNC 2EYSB 3I9GL 5DMGC 5D72H 4BELD 3DX9B 3FMGL 1T5WB 3FONB 3QH3B 1OSZA 1CICB 3VGGA 4LEXH 1ZE3C 5FUOH 4RGND 4IJ3B 5DQDL 4HKZA 3GUTA 2ZG3A 1GSMA 5HHME 1IL1B 3EGSB 2GTZA 3U0WL 1FZJB 5JXEC 4KKAD 3MLRH 2HLFD 1BJ1J 5CZVH 4G6KH 3ZKXC 4Z76B 4G3YH 1DBAL 3FFDA 3ARVA 5EU7E 4OLVH 1NGZA 4K3JL 5EZOH 4L8SB 3OSKA 3N1PC 1NKOA 3V52H 2ZCLL 5TE4L 4U4BA 2RGSA 1KG0B 5E2VH 3GZKA 3QQ9C 4O9HH 1WITA 1WWCA 4MXVE 1YMHB 1HZHH 2D7TH 3P9LA 4HX1B 3FHAA 4I2XE 4Z18A 2B1HL 4CN6A 5JXEA 4JVWA 4FFVD 1MLCA 1NL0H 4WTZA 1QFUH 4PJXF 3UP1A 5I1CH 4NO3B 4DEPC 2YBRB 4X4YA 5I9QB 2N7AA 2FX9H 4LQFH 3RY5A 1DL7H 3BD4A 5CINH 3O3AA 3LH2H 2A38A 2DS4A 4AIXA 5MEND 4RWYL 4LSTH 3LKRB 3SBWC 5DMIL 3B2UD 2HKHH 4PJHE 1W72B 1G7PA 1I1AD 2W1NA 3KPPB 3FT3B 4XWGL 3TBVB 4E5XA 4AT6A 1QLRA 2VLLB 3VW3H 5FYLH 1TETH 2J8UA 3Q1SH 1YEHL 3ILPA 2X1OA 2EDRA 4KPHH 5D7KE 3GM8A 5H35A 4KK6D 3MODH 4KI5D 4HFUH 4Z7QF 4KXZH 4F7EA 1WIPA 4RMUA 2YOCA 3STLA 3SE9H 5HHMB 4KU1A 2ZUUA 3NZ8A 3T0DA 4J7RA 3SBWA 5AZEH 2YD7A 4Y1AA 3NFPA 2IANE 2R2EA 4CADA 4QNPF 4WGVB 1KFAH 5F1SA 3GSRB 3ULUD 2I25N 1CXLA 3V6ZB 2YRZA 4AEIH 5F3HA 4NNYB 1B6UA 3AREC 5I6XB 4R96B 5FB8B 3QRGH 5EUOA 3QPQC 1YECL 2E27L 1NMCC 1UM5L 1P7QA 3MUGB 4PREA 2Y07L 2NY0B 1V05A 2DWEA 5LKNA 4I2XB 1QR1A 4X80H 5IQ9A 5L8LB 4MNHB 5IVZA 3T1FB 1ACZA 4PJCF 2Y06H 2WLZA 3IXTB 4U6HA 1UM4H 3RWGA 4MZ2A 1KLGA 3AREA 1I7RA 3VGHA 4PJHB 3P0YH 4ODUB 2DQFB 3NIGE 2F54E 3KPNA 2NY2D 2E6QA 1P4LB 2Q8BL 4OCRL 4R2GB 3MRGA 3DXAE 4TUKH 3H0TA 2R0KL 5JUEL 5TDOA 4XT1C 3WSQH 3ES6A 3GMNA 4V2BA 1NUNB 2UY6A 1NCTA 4N8CH 4NJ9H 1DUZB 3V0WH 3QEHB 2WWMD 3J8F7 4U1GB 4K7PH 4XNYL 3GSNL 3VFNB 4HIIA 4PRIA 4XGZA 1KYOJ 1EO7A 1MVUA 4ODTL 3QIWC 4QT5B 1U8NB 3LSOB 2IANB 3IDYC 3IFOB 4NO2A 4HZLB 5F7FA 1NC4D 5AAMA 1M7DB 3MRHA 1KN4H 2V17L 2V2TA 2JIXB 3IKKA 2JCCA 2CIIB 3KYMA 3MRNB 5FV2A 4X8XA 1HHHA 3MLUL 2RB8A 3PGDB 3QUZD 2D7MA 4MA1B 3CMOH 4M00A 1FYTA 5TH2B 2GAZA 1MVFA 4P46C 1Z6JT 3G5YA 4K23L 1RIUL 3CDGA 3QIWA 2AJSL 4HF5H 1WQVT 1D5IL 1U36A 1ZLWH 3VI4E 1FCCA 3IJSA 5HPMB 3BE1H 5JOEA 4ALAL 3AMLA 5CHNA 5EUOF 5DHVA 1BVLA 1W0YT 5J3HC 1QRNE 5EH1A 2E9WA 1G7LA 1UJ3C 1IAOB 4HWZB 4ZD3H 4LEOB 3U1SL 1RU9H 2F54B 2IFFH 2KZ1B 2H6PA 2ZPKH 4WI2A 3CVIL 1FPTH 3NPSC 4P46A 5IW6A 4PRPE 3MC0A 5HD8C 3DXAB 1QKZH 4CMMB 1MAMH 1T1XA 3HNSL 1NFIA 5E00B 1NH6A 2XWBB 5IT2H 2YKLH 2ORBH 3DVFA 4LKXA 1X5GA 5IMMA 4L8BB 3F58L 4ELMA 3EYSH 3SKUD 5I1DA 5GGSB 3P73B 1UJ3A 4LNRB 4AEHL 4NN6C 1PGRB 5DHVH 3CFCH 2L7UA 2DQIH 3NABL 2CSPA 4JFXB 5F9JB 4TRPH 5F1OB 1CK0H 1B4RA 5DT1H 5CEZE 4GRLC 4DKEL 5ENWB 4PRBB 1KB9J 2W92A 1EXUA 1D9KB 3ZDZF 2HRPL 3VXOA 1JBJA 4JKMA 3QO1B 2R2HB 1T1WA 3S4SB 3N9GL 2C1OA 5D2NB 5C9JB 2OQJA 1FFNB 1QVOB 3OR6A 4M7ZB 4JN1H 3OKNB 5ADPH 4N90D 1C16B 3P4MB 4GRLA 3FRUA 1ACYH 5JMRA 4KXZI 5I16B 3MTRA 1QRNB 4HS6B 2CUIA 2GSGA 3FQTA 4G8IA 4S1DC 5D71H 2NXZD 3X14B 4HSQA 3OAYH 4JZNA 4XVTL 1HH6A 2XZCH 4PRPB 1A6WH 4Y2DD 3V6OC 1M71A 1DBKL 4JDZA 5CKGA 3VFWB 4LVNB 3BZFA 4TSBH 3ZTNH 4ZSOB 4Q9QH 1FVDB 5EOQL 4DN3H 5IHBA 3MR9B 4S1QL 4ZUTB 3BZ4B 3JTSA 4Z95L 3O45B 1JF5A 1Z5LA 3OKLB 1JYWA 3VXRE 1KJMB 1LILA 1R3HA 3DVGB 4XC3L 3WMSA 5GGVL 4D9QD 3T4YA 1RZGA 4JRXD 2IQAB 4J3XA 4UTAL 1ZGLM 5EDXA 4LLVA 3JVGC 3H9ZA 5IQ7H 4JFQA 3V6OA 4P49A 1F8TH 5I1JH 3B9KC 2HN7B 3MCLL 3VWJD 4ELMF 1PG7X 3DLQR 3C08H 1RUKH 1LEKB 3D3VD 4P5TB 1QFPA 2WWKO 4F33A 4KRLB 5HHVL 3I6LD 2YPVH 5DS8B 3EOTL 3CVHA 3MYJA 4U0QB 1UH3A 1VADA 3NH7L 3ROOA 3JVGA 4QHUB 3H3PH 1F6LL 5FO9B 1HQRA 3TJHC 3B9KA 1IRAY 1Z2KA 4WU7B 5JDSA 1I8IA 4OV5B 5C0RH 3IVKB 1LP9A 5E2TH 1J1PL 3GNMH 1WBZB 4AJ0A 1K4CA 2NY6B 3P2TA 4EUPB 3CK0H 4I5BA 4I4WB 1AY1H 2VR4A 1I7UA 3HAEB 3IFPB 1BECA 1QBMH 5T33L 3QWOA 4TTDC 3MJ6A 1CL7H 4YHKH 4RRPA 2WBKA 4ZQKB 3CVHH 1BBDL 5FHBL 2DD8L 2IFGA 3VXRB 1I4FB 5T3XH 2VXVL 2CIKB 1BZ7B 1QFHA 4F80A 4HJJL 1CDIA 4Z7VE 2FGWL 4ZAKD 3O11B 1C12B 3MUHL 3G04A 5GRUH 4U49A 4YBHA 3I75A 5GS1B 1UM6H 3B2VH 3PG2A 3G9VA 5JOPD 1DQQB 3R06B 2DQUH 4PJ8B 3DMMD 2IPTH 3WN5C 3MV8D 1G0DA 5EC1A 5D6CB 3D0LB 1DLHA 3TBTA 3LRSB 3VFTB 4WWKC 5C0DB 3DI2B 2YEZA 2F8XC 5GGRA 2NY3B 3DETC 4MHHI 3TNMB 3RWFA 4N1CA 1FLTX 2AKRA 3BP7B 3DOSA 3MLYH 2RAMA 1MFCH 4YHNB 3VRLF 2W9EH 4LL9A 4NBYB 2EDEA 5HDQL 3P30H 1K4DB 4EVNB 4ZUSA 3S96A 1FGVH 5IWLC 2F9BT 5KAQF 3V5DA 4LPTA 3WN5A 4LKCA 3LIZH 3MOAL 5KOMC 4J8RB 3CDCA 1PG7H 3MJ8A 5HYQB 4WWKA 4FQLH 3W0WD 4JO4L 1BGXL 3TJEL 1CGYA 3BUYA 2VLKA 3V4VL 4Z5RB 2DTMH 2H32A 4QGYA 3U4AA 4HV8B 3HRZB 1KACB 5FF6A 4DAGL 4FP8L 1D6EB 1Q9LB 1WLHA 2Q1EA 4UIMB 1H3GA 4Z7VB 5IWLA 1KB5A 2XRAL 2E5EA 4KUZH 1IGML 4R6UA 4K71B 2EH7H 4HEME 4XTRD 4O2EB 3UJTH 4HIHA 3WFDH 5F7WC 1MFDH 3K2UL 2BOCA 4LF3B 1KLUA 5IIEB 3MUY1 5ESAA 4PJDE 4U1IA 4GXUN 1Q0YH 1XF3B 3CXDL 1QLFA 2H32H 4R7DA 4YDJB 1KC5H 3RPIA 3SJVD 3OF6A 3PL6B 2J12B 4LFHD 1F90L 3HZMB 3VFVB 4UQ3A 3T0ED 1AD9B 4ZUWB 4AL8L 1KB5H 2C3XA 3O2VH 5IB5B 2EO9A 3LPFA 5DZLA 2QSTA 1YNLH 4AG4L 5D93C 2V7HB 3PV7A 5ACMA 1ZOXA 2VOTA 2MCPH 5IBTH 1W8OA 5T3ZL 4OIIH 4PBXA 3VH8A 1V7ML 1YEIL 4YDIL 3TBYA 1HN1A 4IMLB 1XR9A 4ZFZB 5D1QC 3HC0A 5J6HB 3TA3B 1EV2E 5DQJA 2DLHA 4HIEB 4IRSB 2QADB 1BD2D 3P77A 4PJAA 1L0XA 4Z6AT 1JF1B 3OXSB 3BJLA 3DSFL 2X40A 4ONFH 4H5SB 4CU6A 4NZUL 1QSED 1TFHA 1INEH 1N5AB 3CX5J 2F5AH 4QHMA 2D7NA 5D1QA 3QFDA 5I73B 4J3SA 4PJDB 1EHNA 3H9SE 4Y16D 2J88L 2FLBT 5EU3B 4N90E 5F88B 3JV5A 5LQBH 4UDTA 2JK5A 1YY8A 4XPHH 3SDCC 3AAZA 4G6FD 4Z0XB 2E7CA 1T3FA 1CBVH 1G84A 4JRYE 1JZ4A 4JPVL 1UH4A 3TWCH 5HHQB 3VJ6A 1FC1A 4MNQD 1CD0A 4XAWH 1S7QB 3GGWB 3OZ9H 1GAFL 4X4MA 3EYVB 1JZ7A 4JVPA 4KQ3H 4NGHH 5DVKA 4R0LB 1LO0H 4MMZC 4DGIH 3S3SA 1I8MA 4KJQD 5IMKA 3PHSA 2I07B 3F5WB 1TXKA 5AEAA 1WFNA 4OLZH 5HI3D 3U2SB 3SDCA 1KXTB 3EFDL 1WZ1H 2EIZA 1KPVA 1OTUC 4D9QE 2EXWC 4HJ0C 5C0IA 4EZMA 4JRXE 2OCFD 1I9IH 2F19L 4M43L 4G6AC 1G9ML 1E6JL 2Z92B 2FSEB 3ULVC 3WHE0 4F7TA 2PW2A 3L5XL 4MXQC 1Q0XL 1TJIH 5EN2A 5EO0A 1KENH 4U1KB 1OP9A 3D25B 1LE9A 5EU4A 3WDJA 1IGJB 3KPRD 5I75B 4GAGH 4NFCA 3D18B 4PRHA 4YWGH 4JFPB 3CFKB 4LLAA 1IM9A 1NBYB 3FT2B 1U3HD 3I6LE 3PNWA 4GRMB 4QF1A 5IW1A 1LK3L 5E24E 4PJAF 1OP5H 3MRJA 1MQ8A 4KK9D 2IWGA 3H9SB 4P4KD 2CXKA 3V6BR 1HHKA 4M8QB 4BFGA 4PGDB 1ZWIB 3NGBB 2O26U 3UTTD 2W9DL 2HJLB 5DWUH 2BMKB 5J13C 3KLDA 4LLDB 3LEXA 4QTHA 1XGQB 4JRYB 4X9FA 3VG9C 1D5XA 3MA7A 4QRRE 4DN4L 1QBLL 3VXSD 2CKBL 2WIIA 4MS8C 1ZLWK 3NN8B 3MNZB 2EZ0D 1YC7A 2R39A 3CGTA 5DD0H 1KEGL 4YHIB 4P2OD 3QEQA 4YE4L 4D9LH 4H26A 4MQXD 4KGJA 2HFFA 3GB7A 4BH8B 2HT4C 3H7BB 4XP4L 5F9OL 3WV0A 2IH3A 1F3JA 3EJZD 5IHUH 3CZJA 1WEJL 3ULVH 4JRXB 4IJ3C 3GHBH 5ALBH 4OUUA 7FABL 4HEPG 4XP9L 2XI9A 5CCKL 5I1GH 4FZ8H 1X5AA 5L2KD 3CD4A 1IT9L 3PP4H 2EYSA 2B39A 4RGOH 1MHCB 2PTTB 4JG1L 1H3TA 3L3KB 1C5BH 1T5WA 2Z4QB 4RFNB 3VG0L 2CUMA 3FONA 3QH3A 1PSKH 1CICA 5GJTH 1F4YH 5IGXH 4L8SC 1LGVA 2OI9B 2GUOB 4H8WL 3RX7A 1UYWH 1A3LL 1IL1A 1UCTA 2UZIH 3O8XD 1FZJA 3N1QC 3SDDD 2VZSA 5FUCC 3HI1B 1SYVB 1CG9B 4NFDA 2FL5B 5I9QC 1HIML 4Z76A 2BDNH 2OSLA 1QUNA 1X5HA 5J12C 3DIFB 4QRRB 1A7QH 1TQCB 4L8SA 1BEYH 1QEWB 3Q5YA 5BVJA 3ULVF 1IEAB 3OMZA 4X9IA 2XZQH 3RZCB 4P57B 1KG0A 1YY9D 1YMHA 4JZOB 2BSTB 2CGRH 1BQLL 4FQQA 4U6YA 1NANH 4H20H 3BEWA 3QIUD 5TE6L 4YHMH 4XP5L 5T5FL 4WHCA 2D7OA 1TZHA 3O2WL 1J12A 3LKRA 3GSUA 1W72A 3KPPA 3WE6B 3FT3A 2IG2L 3TBVA 1A7PH 4DGYH 2AABL 3TESA 2DJUA 2EDWA 3CC5B 3IDXL 2VLLA 4AK1A 4CVWA 1CIDA 3OWEA 3GHEL 5CSZB 4JY6B 5EU7C 4G7VH 3DMMB 6FABL 5ILTH 1UGNA 2YC1B 4HKJB 2DQGH 4ZS6D 1S7UB 5JW5B 3LEYL 2YMXL 1KEMH 3SJVE 5TDPA 3VRJB 3BRDA 1K85A 3KGRA 3L3IB 4POYA 5GISH 1TPXC 4OD2B 5DHYB 5F7YC 2GI7A 4HWBA 5I71B 4H0HB 3T0EE 3MBXH 5C0ND 5I19H 3FFCE 3CLFH 3GSRA 4YIQB 3V6ZA 1W72H 5E8EB 1BFVL 3T2NH 4XMKL 4NNYA 4RFEB 2A1WH 1X6NA 4OTXL 3A6BH 5K9KB 4R96A 1T83C 1ZT7B 3QXDB 3MUGA 1KIQA 3F7PC 4R2GC 2BNQE 5HI5C 4CJ0A 4I2XA 5EORH 3FL7A 5B4MD 2MPAL 4MNHA 1EA9C 3MV9E 5KZCD 1RUQL 5H2BB 3VXUE 3IXTA 1WF5A 3BKCL 3PXHA 4LDEB 5I8OH 1MRDL 4HWBH 1BD2E 2AEPL 1L7IL 1S7XA 1M7IB 3PP3H 5IHZB 1XAUA 4PJHA 1T83A 4UIKL 1ORQB 4ODUA 1MHEB 4WY7L 2DQFA 2EIEA 2OR8A 1FZKA 5CMAB 2VXUH 3STZB 2XQBH 5MEOB 5IW3A 5SX4H 4JEGB 1F4XH 1JVKA 4FTVE 4GS7C 4A2MA 2B20A 4OCNC 4WFED 1UQSB 4OLXL 1DUZA 1Z3GL 3ZT6A 3QEHA 3SN6N 2EH8L 1UXWB 4P3DB 4M1CD 4NDMA 1MUJB 1N6UA 3KWWB 1XR8B 2FD6H 3D5OF 4LSSH 3SJVB 2UWEB 1CGTA 5FIEA 5A2LH 3HFML 1U8NA 1WC7B 3LSOA 1KCRH 3IFOA 4HZLA 2H26B 3MXWH 3T0EB 5HXMA 1OGAE 3FFCB 2JIXA 1A9BB 1XIWB 4JHWH 2CIIA 3MRNA 4MNQE 3EDKA 4ZFFA 3PGDA 3TCLB 1DVFD 5L2JB 1KPUB 4YGAB 1NMBH 4MAYD 4C83B 4UT6L 5J89A 5TH2A 1JWSB 1NCAL 4UDUA 1JHLL 1ED3B 4HKXB 2BNQB 3Q5OA 3BZDA 1AGBA 1TVHA 4OFYA 4M8VA 4HKBB 3U7WL 4PV9A 2K7PA 1LO2H 4WNQB 3WFHB 5IR1B 4P2QD 5HPMA 1ZTXH 3ARZA 4L4TE 5FA4B 1J5OH 3MV9B 2E7HA 2XWJA 1JGDA 2Z31D 1CFBA 3VXUB 4C4KT 4JGJA 2CDGB 1VACB 2VITB 3BP4A 1U8KA 1MFAH 2OZ4A 3VA6A 2F54A 1MCIA 3HA0A 3O6ML 2OR9L 1S9VB 2QHRH 5JW4N 1YZZA 5CGYD 4JJHA 4R8WL 2FX8H 3DXAA 2X09A 4L4VD 4CMMA 4HK0B 5L9DH 2EDNA 4FTVB 5E00A 3LQAL 2N4IA 2XWBA 1D9KC 1U95B 4HCRA 4HPOL 4LSRL 4PGCB 1TVBB 1A6UH 4GKNB 4L8BA 4QRTB 1IGIH 5GGSA 3P73A 5D2NC 3SE8H 4LNRA 3T3PE 3RDTB 3UTTE 5JQHC 4M7ZC 4JFXA 1NANI 1OGAB 4Z7UA 3G6JE 2VWEE 2CDFB 4OFVA 4OFPA 4WUUD 4HG4J 1DR9A 4Y4FB 3E8UL 4PRBA 2OZ4H 2ARJQ 4P48A 1D9KA 3VXSE 1Q94A 1FH5L 4OGXH 3RUGF 5C0JB 5E5RB 3QO1A 3ARPA 3MFFA 3S4SA 3V79C 3RVVC 4HCRH 5D2NA 2X42A 5C9JA 5EULV 2NZ9C 4LVNC 4KRNA 1JPTH 4CVUA 1QVOA 3SDXE 1CGXA 1KJ3L 1U3JA 1O5DT 5ADOH 3OKNA 4L4TB 4NCC1 3VXNB 5EO9B 1C16A 3P4MA 1A1NB 2G9HB 3IFLL 1EJ6A 5I16A 1QRNA 4HS6A 1F02I 5HHOD 5HYSB 1S9WB 3UBXG 4RISH 5FM5M 2OJZL 4OGAD 3X14A 2AXHA 3GMPB 1JMZA 1MIEH 1BAFL 1REIA 1U6AH 4PRPA 1VFBB 4WV1B 3P4OA 3BN9D 5DFWH 2GK2A 2MTPA 3BAEL 5D8JL 3VFWA 4KDVA 4MLSA 5ISZE 2B7DT 4YNYA 2D03L 1WWBX 3OPZH 3EDFA 4QEGA 4ZSOA 4Q0XH 5KJRL 3C8DA 5I76B 3CJJA 3K1DA 2XZAH 3MR9A 5C0AD 3BZ4A 1FLRL 3O45A 2JB5L 1KJMA 4ETYA 3LKPB 3U9UA 3DVGA 3UTTB 2VLJD 3TIEA 2IQAA 2E7BA 4MJ5B 5JO5B 4G6JL 1EO8L 1NUDA 2Q87A 4DGVH 1XCQB 3PJSB 3D39E 3GFUA 2HN7A 2G75B 32C2A 2R4SL 2MKLC 3Q48A 3ZKNC 3RY6C 4EDWL 4Y19D 1LEKA 1WZKA 4Z7UF 2NY6C 4WCYH 3IJYB 3BJ91 1VDGA 1GIGL 5T1LA 5DS8A 4FQXB 5DHXB 3CH8A 5SX4I 1TNNA 4R3SB 1IC7L 4XXDA 3SDXB 1A8JH 4QHUA 3KPQB 1LK2B 1MWAB 5FO9A 3TVMD 3INUH 4UV4H 2HLAB 3QI9D 4GW5B 4OKDA 3KJ6L 4WU7A 4AEEA 3HE7B 1R0AL 1PY4A 5F1NB 3RY6A 5CEZH 3IVKA 1DP0A 1T66D 4ONGL 4WTXA 3VI4F 3W82A 1WBZA 5JLZB 3FCTA 4R26L 4OB5H 4UILH 4EUPA 4YHLL 4I4WA 3RHWF 2DIAA 4XHJD 5FYKE 5JIIA 3IFPA 4FZEH 4J3TA 1YQVH 4HPYH 1NCUA 1G7IA 3B83A 5ISZB 3HNTH 1CE1L 5I0ZA 5GS1C 2ZSVB 4X6CE 4NC1E 3MSPA 4ZQKA 4JFEA 2QSVA 2NY1C 1LD9A 4LARH 2DQHL 3D48R 4PJ8C 4EI5D 3VXRA 4KQ4H 5IFJB 5B3NA 1O7VA 5AZ2L 1RK1B 2B2XL 1BZ7A 3BDXA 1RFDL 4K8RC 4N0FB 2L7JA 5CD5C 2D31B 3SQBA 1EJOL 1UB5B 4RA3A 1T2QH 4WENB 3O11A 2ILLA 3ZE1E 2NY3C 2Z8SA 4LSUH 4OF6A 2P4AB 3D39B 1UT9A 5HY9B 1OP5K 5GS1A 2JELL 4EUPH 1IEHA 1Y18B 1AD0B 4L8DB 5TQ2L 4N5EC 3FQWB 4DCQA 5DJ0A 4PJ8A 5CWSB 2A0LD 5JW4R 3PXJA 1FG2A 3KYKL 4KH2A 3EOAA 4O2CB 5DUBA 3ULUL 2AERT 2N56A 4M7LL 1ZT4A 1KCKA 3K0WA 4JKPL 5D6CA 3QIUB 3LRSA 5IEHB 1CS6A 2IPKB 3BDYH 3TNMA 2BNUB 4WFFE 4FN0A 1UKTA 3O4LE 5BO1L 2BNRD 3BP7A 4YHNA 1P5UA 3A6OA 4FQCH 1C08B 4IRZL 4KUCF 2AJVH 1K4DA 4EVNA 4OAWB 2DLFL 5KSBF 3S98A 3MNVB 5EIQA 3VD7A 2Z91B 2KL6A 2BVOB 4BZYA 5HYQA 4K71C 1JFQL 4PJ5D 4P2YA 15C8H 2FX7H 2YRLA 1AGCB 4MA3B 1NC2B 2W0KA 4F7CB 4K8RH 1J88A 4OD3H 4HV8A 3HRZA 3WFCH 5IFAH 1VGEH 1D6EA 2R0ZL 4N0CD 3PL6C 2ITDA 1HWGB 1TTUA 3C60B 2MQ3A 3QWQB 4RWYH 3N06B 2AGJH 2C3VB 3WKMH 4XWGH 5DGQA 4UNTA 4P9HC 1UWGL 4X7DC 4I3RH 4LF3A 4XZUA 5DC4B 3MPCA 3QNXB 4LHUD 1IAIM 4ONHA 4F2MB 4M1DH 2ZUQC 1XF3A 1AXTH 3WLWD 1MHPL 1WISA 3PL6A 5DYOB 3KYOB 3VFVA 3P11L 5DK3A 3RVWC 4TVPE 2FHBA 3O4LB 4YFLF 3RFZC 4LCIH 1AD9A 1AO7E 4PBWD 4ZUWA 2ICCA 2X4PB 3TA3C 1ZLUH 5DFVD 4FXKB 1LNUA 2QADC 2RIKA 3JBG7 1CIUA 1E27B 1KYOK 4HK3N 4W6WB 3U9PL 4FG6C 4JZJB 3BIKB 3BKMH 4JFOB 4WVRA 5D1XD 1DBML 1MCOL 1DQML 2PR4L 4NM8L 3EO9H 2HT3D 4Z8FH 3K4AA 4ZFZA 3VFRB 4QRSB 2WSKA 4CL7A 3GSNA 5BRZE 3X3FL 5J6HA 3TA3A 5I73C 3NFSH 1JP5A 4HIEA 4IRSA 2IBGA 4WUUE 2DF3A 1EFQA 2PUQT 1MFEL 3MRBB 4X5LA 4EQ3A 1JF1A 3OXSA 1YEGL 4TNWF 4H88L 1DVFB 2A6DB 2OXHA 3CLEL 4H5SA 4P9HH 4C59B 1JNJA 3GSWB 4XH2B 4URTB 3P4LA 2APBA 4OCRH 3SOBH 3GI9L 3NCYS 3CSBA 3VFUB 2CQVA 4R0LC 3QDMD 4PJDA 4E9LA 3ZHDA 4HS3B 4GW4B 4WUKL 2EYTB 2ZNXA 3VGAB 2QKIB 5EU3A 4XNYH 2J1KA 4G8EB 5F88A 3GSNH 4HT1H 1RUAH 3HKFA 4K3DL 5CSBA 4ODTH 4Z0XA 3HI6L 1AO7B 5HHQA 1MCCA 2ZUWA 4YZFF 3V6FB 3KPLB 3OHXB 2HWZH 4M93B 5DEFB 1S7QA 3GGWA 4R0LA 2R4RL 1TTGA 3RVTC 3BH9B 1MCQA 2I07A 3F5WA 5I75C 1FORL 1MCPL 1ZV5A 2FEEL 2WQRA 1SJHB 3U2SA 3WIFB 3PP3K 5AAWA 4OZFB 4WTWA 3PWJB 4NT6B 5BRZB 3QFJD 1D5IH 1X6LA 1L6XA 3TO4D 3VD3A 1XGTB 4ZXBD 1VEPA 3ARBD 4P5MA 4ALAH 1CDGA 4P2RD 4WUUB 2Z92A 2XY2A 1A6VL 4UT9L 1RV6X 4OM0H 3NGBC 3UBXB 2HH0L 4XMLH 4HW6A 4NQCD 2MFNA 1IGJA 5B39G 2A6IA 4YO0A 4Y19E 4JFPA 1UWXH 3CFKA 3CVIH 3BRGC 4KV5F 1NBYA 4S1SL 4AM0A 3FT2A 5I17B 4XX1E 3SKJL 3UCRA 4MB5A 4UV7H 4JPWL 1M1SA 5KOVC 1P4BL 4CRPA 5E1AB 2DYPB 3H9SA 1T04B 4JDTH 4POUB 5FYJE 5HHNB 5JZ7D 2C3HA 4PGDA 2ADFH 3QUYC 2D0HA 3PWNB 2HJLA 1X4YA 3IYLW 4NIKB 3Q0HA 2EDKA 4KRPD 1XGQA 4JRYA 1FNGB 3NABH 3RY4A 2J5LB 3WNKA 3MLVH 4FQ1H 2VSDA 2XY1A 4DKEH 2ZJSL 2F53A 2X4OB 3G5ZA 3NN8A 4KJPD 3MNZA 4MYWB 1N6QH 1ROWA 1A6TB 5MI0B 1AGDB 1PFCA 1FNAA 3TBSB 4PY7B 3LVEA 5GHWL 4FXLA 3FO2A 4BH8A 2WBJD 4C55A 3FAXA 3N9GH 2KQNA 3H7BA 3QUYA 4R7NA 1BFOB 4ZUUB 1LVEA 2OI9C 5C07A 4X7SH 4MMXC 4KHXL 2NX5D 4E0RB 2Y5TB 4HXBL 2X1QA 1IC4L 1ZANL 3UPAA 2DKMA 1YYLL 1J8KA 4XP1H 3OX8B 1JNNL 4PLOB 5C70A 3UAJC 5DD5H 2PTTA 1IM3A 5GSRB 3CH1A 4Y19B 2YK1L 3BYTA 1T80A 4L4JA 4XVTH 3X12A 3WNOA 1OP3K 4QOKD 4XB7A 3S88L 4APQD 1DQDL 3RZCC 3GSVB 5EOQH 2EIBA 5FO7B 1N3NB 4U7MA 1MREH 4S1QH 5GGUB 3TVMB 4QRPD 1C8PA 3LN5B 1JZ3A 4S0TD 5GGVH 2BNRE 2ED7A 2FL5A 1A6AB 2VTFA 3KJ4B 1KCSL 3KAAA 4YBLB 4LHJB 3F12B 4ODSH 2IPUK 5JXAL 4G7YH 3DIFA 4BSJA 4QRRA 1NAKH 2Y72A 4PGBB 2I60H 4L9LB 1QEWA 5ANME 1EMTH 3SEPA 1IEAA 3SO3B 1AI1H 3FZUC 3MCLH 3RZCA 3CFIC 4P57A 1SEQL 4N8VB 5CBAB 3QEGL 3MV11 2BSTA 1F4HA 4KK8C 1WK0A 3T0WA 5LXGH 4KJWC 3KLAB 1FGNL 4NHCL 5GRVK 3ULSB 5GGQL 4M6ML 1AJ7L 5IB1B 5IMLB 1IC5L 4X4XB 3ZKMC 1X4XA 4OQTL 1V3LA 1JRHL 3MJ9L 3IETB 4H1LB 3VMPA 1NSNH 4OCSL 3RWIB 4MB3A 3WE6A 1NCCH 3ARGB 5I71C 2M1KA 4OGYH 3CC5A 4RFOH 2EDTA 4YDKL 3KNBB 3VXMA 5EU5B 1TLKA 5F7UA 5CSZA 2QSQA 4JY6A 1KJVB 4LLUB 2YC1A 3WFEL 4HKJA 2D3VA 1KTLB 3GBNL 2NXYB 3OGCB 5JW5A 4NRYB 5T33H 3UJIL 3VRJA 2CK0L 3CPLB 5EIIB 4MDJB 4GG6B 1JGUH 4PRAB 1WBXB 2P1YA 3L3IA 1BBDH 5FHBH 5DHYA 1RZ7L 4UINH 2GJ6A 1D6VH 4FFWC 3HRPA 1JNLH 1J0JA 2BNRB 3UC0L 1NGYA 4YIQA 2DDQH 5E8EA 1OOAA 4HIJA 4O5LH 1NUFA 2FGWH 2P47B 4RDQG 4HLZG 3HHRB 1CGWA 4PJFF 1FAKT 1JPSH 4RFEA 3ARRA 5JIKA 5K9KA 5ANMB 3PGCB 4ODHH 3G6AA 1ZT7A 3QXDA 4NQTA 1VFOA 3LKOB 2I5YL 3TV3H 4TPRH 2XTJB 2R8SH 3L3OA 1A3RL 1NDMA 1ZHNB 4XPFH 4RAVB 2P8PB 1RVFL 1CDCA 2H3NB 4PY8I 4J2XA 1EGJA 1MJUH 2HTKC 3BPLB 2R2BB 1M7IA 4NBZB 5IHZA 2W0PA 4XNMB 1MHEA 5CSGA 2R29L 3STZA 3OJVC 4U6TA 5GZND 2Q6WB 5MEOA 2F8OA 1XIWC 5DMGD 5HDQH 4F37F 4LFHG 1UQSA 5C2BH 4NUGL 1FO0L 4P3DA 5FYLD 4LHUB 3MOAH 5FCSH 1MUJA 3KWWA 1JN6B 4GXUM 4AMKH 4WHDA 2UWEA 3KHOA 5TQ0H 5KVDL 1WC7A 3HR5B 3LHPL 5GRJH 3RL1B 5DC9B 2WQ8A 5JXED 2H26A 4Y4HC 1EGJH 2CO7B 3FFCA 5TPWL 4YHZH 2FCBA 4JO3L 4FP8H 1A9BA 1XIWA 4G8FB 4U0RB 1Y6KR 3HPJB 3G6DL 3TCLA 5I8KL 4M62L 3LOWA 1KPUA 4WI7A 2O61A 1H9VA 4MCZB 1OAYL 4C83A 1JWSA 5A1AA 1NFKA 1ED3A 5FXCH 1JV5B 4HKXA 5FGBC 2FIRT 2BNQA 2VABB 3L7FA 3UYRH 4OF7A 4HKBA 1A3QA 2QTEA 4M02A 3WFHA 3WDHA 4Y4HA 5IR1A 1MCDA 2OR7A 3QFJE 5BXFB 1MJ8L 5FA4A 2AS5M 4JFFE 4N9GA 1UENA 3MV9A 3CXDH 5C2UB 4RSVA 3VXUA 1P6FA 3JV6A 4ZFGL 2BHYA 4Y7MA 5DQ9B 5I8CA 5KVEH 4P2RE 4WFGD 1VACA 4Z7NF 2VITA 3VWKC 2R2CA 3JWOC 4POZC 1F90H 3CSYA 5FHAL 3RDTC 25C8L 1C5DB 3TC9A 1RUML 4NQCE 2EYRB 4Y1AD 3UDWC 4KJYB 2LU3A 1S9VA 5FGBA 3NMEA 4FA8A 2FB4H 1MCWM 4Y4FC 1BOGB 5D96B 1DBJL 4FTVA 2P46B 1T1YB 3OG6B 4K7PY 5D7SH 1S7SA 4I0PB 4AG4H 5FGCE 4PGCA 3W9DB 5ESQA 4OLWL 1TVBA 3P0VL 5T3ZH 4GKNA 4QRTA 2X89A 3LKNB 1P7QD 3VWKA 4BZ1H 1L6ZA 1W0WB 2X4NB 5C7XH 3HUJE 3RDTA 1E0OB 2X4UA 3UDWA 4OCWL 5T1KB 1GPOL 4D94A 3ECBB 2HT2C 3F7YB 1WT5C 4Y4FA 5K9QI 2B4CC 1RK0B 3VFGH 3O6FB 2UWEF 1AC0A 2HJFB 4M4PA 3VRIB 2A74B 5B38B 1NCWH 2XKSA 3ARED 1G9MC 4TNWK 3RWJA 1TQBB 4WHYH 2DL9A 3QPQD 4WV1C 4D3CL 4M5ZL 2X70B 3EHBC 1YPZE 2YN3A 1FL5B 2VZ1A 3RVUC 4OF0A 5JDJA 4S0SD 3QCUL 1CFVH 3NZHL 1ZLUK 4L4TA 3VXNA 4K94C 5EO9A 4G42B 3QUML 4JFFB 1WT5A 5DJZB 1A1NA 3JWOH 3MBEC 1L7TL 3WHXB 3ARBB 4I3SL 5I1IH 2FR4B 4P2RB 2FZ3B 4PRID 1S9WA 3S34L 4RMTA 5IM7B 4KTYA 4UZGA 5FOBB 3GMPA 4NQCB 4IS6B 5E08H 3X17A 4JPVH 2VWEC 4WV1A 3B8SA 4XPBL 1JPGB 5CZKA 4QOKE 4KKBC 4YXKH 5FGCB 4UQ2B 1T0NB 5IUSA 3V5KB 1NDGB 4PJ7A 1ITBB 3MBEA 4TUOB 1FYTD 2BK8A 3T8XA 3LKPA 4ZG1A 4RX4A 4BQ9A 3B3IB 4QRPE 2HJKB 3HUJB 4FQXC 4UUJB 1TDQA 3RPKA 3QIWD 1U8OB 2YPKA 4MJ5A 5JO5A 2B4CH 3MLTA 4ONOA 4M43H 1O0VA 4ZS7L 4I77L 3ESUF 3WIHA 4JCMA 1XCQA 3PJSA 4WFHD 1GZPB 4NKOB 1G9MH 3THMH 3GKWH 2G75A 2DM7A 2K9UA 4BZ2L 3HE7C 5E8NB 5AWNL 2DIBA 4XPAL 1F11A 2DAVA 3VFMB 1WTLA 1JE6A 4P46D 5LBSL 3PHOB 2VUOA 2WBJB 4K94H 4FQXA 3GJEB 1F3DJ 1HI6B 4JFYA 1LK2A 2ESVB 3OB0H 4LP4A 2N7BA 2HLAA 4H8WC 4GW5A 4ZDHB 5J3HD 3PWLB 1FE8L 3HE7A 4WI6A 5F1NA 4ODXA 3WIHH 3VMNA 4Y5VC 5JLZA 2ATPB 2GIYA 3R8QA 3L95B 3TP4A 3SY0B 5JOFB 5CZXC 1I3RA 1J0IA 5HD8D 4DN4H 3V8OA 1QBLH 4HGWB 2BRQA 3D87B 4APQB 1T2XA 4PJXE 3H3BC 4E42B 4NYLB 3HZVA 2FBJL 2GITB 3NA4A 4LSPL 5CFHA 2NNAB 3IGAB 1KEGH 4LIQL 2QQNL 5J1AB 3H42L 1JPFB 1YYMH 4AQOA 5FM5O 1JJUA 5IFJA 4PTTB 4QRPB 1C7SA 1OLLA 1FFOA 3D9AL 2IBBA 3IRZA 4OM1L 4Y5VA 2D31A 1WEJH 1UWXK 4PJ7F 4PJGF 3MA9L 3D39A 4GRLD 5DD6A 5HY9A 3V9FA 1NCDH 4LU5H 3ARFB 4L3EB 1IT9H 2WUCH 1N6VA 5E99L 4ODBD 1AD0A 1YUHB 1EUUA 2W91A 3FQWA 1BF2A 4Z7QE 2A6KA 4JG1H 5HI4C 4EKXA 4XP6H 5CWSA 3L3GB 2A6JB 4PP1C 1MIML 4O2CA 1HOCB 1XGRA 3VG0H 4PUBL 3E1F1 3MLXH 4ZO6A 4MLIA 4GMTH 1B2WH 1J1XL 5HBBA 3QHZH 4H8WH 5IEHA 1EH9A 3HTLX 4NC1C 4X98B 1ZLVH 1A3LH 2IPKA 1P4IL 2BNUA 35C8H 3RAJL 4L8CB 5FYKU 2H1PH 2ZSWB 3PE9A 3R0MA 1C08A 4GKZB 4S1DD 4I48A 1NAML 4OAWA 4AZ8A 3BO8A 2BY0A 3MNVA 3C60C 5CILH 5C09E 5FCUL 2MKWA 5EZIH 3QYCA 2Z91A 2XICA 1EEYB 4PJXB 1QG3A 5C71A 2R0WL 4M5YH 1D5MA 4KY1L 1AGCA 4MA3A 1NC2A 4PJCE 4F7CA 4XCCH 2C4XA 1RIHL 3DX6B 2YR3A 3D0VB 5DLML 3M07A 1AXSB 1DZBA 3RGVB 1OAUL 3VFOB 2X4RB 3SKMB 4M61B 3S36H 2BRRH 5TE6H 3OKKB 4XP5H 1F4AA 3TZVC 4KZDL 2VLRE 5T3XD 5DMKA 2AI0L 3C60A 3KHQA 1GOHA 1XGYL 2C3VA 3P9MB 4RZCB 3B9KD 1J1OL 2PXYC 5FYKH 4LDOB 1OAQL 2R56L 1D5ZB 4PP2B 1MCKA 2NY5C 2M2DA 2D4FA 3QNXA 2M8XA 4OZHF 4JHAL 3N85L 4KVCL 4JZJC 5TFSH 3ARYA 3TZVA 5DYOA 3KYOA 4OCYH 3AY4C 3DX8B 2YMXH 1AQDA 3QQNA 3O4LA 5LVEA 3WJJC 1Q9KB 1RJCA 3C8KA 4QTIH 4UBDC 2PXYA 3WUWG 2VZOA 4FXKA 2NLJA 4Y1AE 3C6LB 3UO1L 1NBVH 4BQCA 2ZWLT 5CAYB 5IEKB 3LV3B 4OFKA 5IOPB 4QXUL 1BFVH 5C1MB 4XMKH 2IBZY 1E27A 5CJQL 5C09B 2WM0A 2AJXL 5EPMA 2NMSA 2GJZB 2P24A 2J6EA 4JZJA 5SWZE 3BQUC 3BIKA 2CRMA 3ZO0A 4JFOA 1A22B 3BKYH 3AY4A 4PJCB 4TTDD 5DD1L 1LO3L 5EUOE 1KN2H 3VFRA 4EOWH 4QRSA 1MRFL 3WJJA 5GGRY 3P9LB 5DJAB 4PB9L 2YA0A 3SDYL 3FO9B 1WBYB 3VGAC 2MQCA 1ND0B 3ZKSD 4X4YB 2VLRB 3BKCH 4RBPH 2O5YH 3MRBA 4LPXA 4UB0L 1MRDH 2HG5B 4QLRA 2AEPH 1IZKA 3U6RB 3BP5A 2J3SA 2A6DA 3W2DH 1BFSA 4WY7H 3BQUA 4HIXH 3GSWA 2BVUA 2NY5H 4OQ1A 1K2DB 3LDBB 2GW5A 5J1SC 4TVSa 4IRJB 1F4WL 3OAZH 2J6EH 2PTVA 1H8NA 4OI9A 4OLXH 4ZUVA 1Q38A 2I24N 4HS3A 4GW4A 2EYTA 1Z3GH 2QKIA 3JXAA 4XNZC 4G8EA 3EW3B 2YZ8A 4JY5L 1Z0NA 4WWKD 2V5SA 3D85B 4F7EB 5K9JH 5DDHB 3DETD 4PRIE 2VLKD 5IJVA 5HVGB 1ZXQA 5I1HH 3O2DL 1AO7A 1G6RB 1AFVL 3LS4L 3NZ8B 3PV6B 3ZDZE 1LE5B 2MNUA 3B5TA 4HC1A 3V6FA 3NFPB 4CADB 3KPLA 3OHXA 5DEFA 1YJDH 5SWQB 4ZOAA 5MHSE 2A9MH 2QLVB 3IAQA 4JM2F 4CAGA 1YEFL 4WWID 3BH9A 1SM3L 2QHLA 5HDBF 5SWZB 2QSCL 1JHLH 1SJHA 4ELKA 3HN3A 4MCYB 3WIFA 1JF6A 4OZFA 3EBAA 1P7QB 4HG4K 4NT6A 4ZMAT 4PREB 5BRZA 4L1DA 3U7WH 1WTGT 4JFHD 2DWEB 1NGPL 3GRWL 1XGTA 1VA9A 5BQ7B 4WW2F 2Z0BA 4TVPH 3MOBH 3R0NA 4LLQB 3ZT5A 1T03L 3R1GH 3OF6D 3UBXA 1N5YH 4HC1H 1QA9B 4LGPB 3RWGB 1OGTB 1FIGL 1HINH 2AJYH 5ECJE 4KRMB 3O6MH 2PCPB 1A7RL 4M6NL 4R8WH 1OT1A 1A5FH 5I17A 4KHTL 2FGZA 5J9PB 3U0PB 1QFWL 5LAXB 5EBWA 2ICEB 2OP4H 4OCLC 5MI0C 4PYHA 4HPOH 5E1AA 2DYPA 3H0TB 4OZFH 1JGVL 5HHNA 1BQHB 1RJLB 4LVHB 1AR1C 2BHUA 3PWNA 2X9WA 5TE7L 4HIIB 4PRIB 5IV2B 1SMAA 1FNGA 1Z9LA 4GJTB 2BSSB 4BH7A 1AGEB 1U2HA 4XPTL 4R4BB 1DEEA 4NO2B 3NIDF 2I27N 4KZEH 2LTQB 2X4OA 1A6TA 3UTPE 1ZHBB 1AGDA 3TBSA 4RGNC 5FUZH 4F9PC 4FMFA 3UTZA 4ERSH 5H8DA 5KANI 4OZIA 2HFGH 4HUUB 4ZUUA 3OKOB 3ME0A 4HUKB 4JHBA 1H8SA 5E9DE 1FV1B 4KKCD 4A6YL 2GY7B 1ONQB 5D1QD 4YUEL 4E0RA 2Y5TA 3IFLH 1J9CT 4LRIC 4HUVA 1GCFA 3T04D 5I15H 4J6RL 2Y36L 1KTDB 2Q8AH 4JG0H 5DHVB 2UUDH 4XVSL 1FIEA 3TEUA 1INDH 1FAIH 3KJ4C 3QO0B 4U1JB 3OKDB 1KGCE 3T3MF 4F9PA 3V4PL 5FYJU 1E4XH 4U6XB 5E5MB 2OL3B 4TYUA 4L9LC 3PQYE 4JN2B 1T0MB 5IMOB 2Y5EA 2GTWB 2EDDA 2YRPA 2D03H 1IAKB 1SY6A 5FO7A 1P2CA 3H6JA 1N3NA 1MI5E 4WDIB 5GGUA 4LRIA 2JB5H 5HYJE 5IB2B 4XC1L 2EE3A 5F6IB 5DTFB 3LN5A 3HI5H 2VDQH 5IMMB 1A6AA 3FQXB 3SDCD 4M9PA 5I1DB 4AY0A 1UJ3B 1CGSH 3LMJL 4LAQH 4NHUB 4PGBA 4L9LA 4JHZA 4B50A 2B5IC 4GUPB 2MHAB 2QQQA 4XBGB 3V6OE 2R4SH 1QOKA 3PABB 5CBAA 1UVQB 4NWTH 1A14L 1EXUB 2GQHA 5EWIL 4N68A 3VXOB 1MJJB 4PRHD 3KLAA 1GGIH 2H9GB 2EKSB 3ULSA 2MOVA 1SY6H 1IM9D 5IMLA 4LASH 4B7LA 1U8HB 4X4XA 5E9DB 5FYJH 4NQDE 5IBUB 3OJMB 2C1OB 3REVB 5TF1L 1CI5A 3IETA 1OTUD 4H1LA 2NXYC 2EXWD 4HJ0D 4JY4A 3VRLE 4NN6B 3ULUC 5AUMA 1ES0A 1LEIB 1RZJL 5DVOA 3RWIA 1OM3L 3ARGA 5FGRA 3ULVD 4YFDB 4B41A 4OZIF 4MXQD 2VDRL 3DX7B 3DHMA 3FQRB 1C1EL 4IHOB 3KNBA 5EU5A 3T4AB 2GSGB 3FQTB 2ICWI 3MLZH 4YHLH 1KELL 3L6FB 3WNMA 1C5CH 1KJVA 1YEKH 4JZNB 3PQYB 5E8PB 3OXRA 1KTLA 3CSPA 3O0RH 1S9XB 2HFEB 5MEPB 4NRYA 3LN4B 3QWRA 3BZFB 2YHGA 3CPLA 1MI5B 4MDJA 5EIIA 4GG6A 4PRAA 1WBXA 2XTJC 3QEQD 4JFZH 5HGDA 2DQHH 1UJTA 5HYJB 3U46B 1ZVHA 4H1LH 3V8CA 3MJGX 2EC8A 2EC9T 3FOLB 2NY2C 1R3HB 5HVFB 2R1YB 3T4YB 1RZGB 1WWAX 1OWRM 3UXFA 5ICXB 1F5WA 3V4UL 5ANMA 3PGCA 3WXWH 1AQKL 3KVQA 3Q2CA 4MS8D 5KSAB 5EC2B 3TYFB 3BXNB 4CW1B 3BUTA 3OAUL 3OB0K 3ARSA 5TQ2H 4PJ9C 4JM4L 2P48B 1P5VA 2DM2A 3QNYA 1UWEH 1ZHNA 1N8ZB 5C0CE 1NGQL 4S1RH 4W81A 1VCAA 2HT4D 4RAVA 2P8PA 3BGFB 4F33B 1CICD 2R15A 5E6IB 4NQDB 1DANT 4JKPH 1CF8H 1J0KA 3CZFB 3I2CL 4NQEE 4I3GA 3MYJB 2R2BA 5ICYA 4XNMA 1BQUA 2VAAB 5DA0B 1VPOH 4FS0A 3FTGB 4Z77B 5BO1H 5M94B 4H25A 4R90H 4Y5XC 2Q6WA 2YN5A 3B9KB 5HGHA 4PJ9A 3EYUL 3MZTA 3T0BA 2KKQA 3O6LL 2YXMA 2QBWA 1VFAB 5DK2B 3SDAC 2B8OT 5IB3A 5ALCL 2VL4A 4I5BB 4CNIB 3SCMB 3LS5L 1JN6A 5DURB 3V7MA 4RGMB 4YDLB 4OF3A 5J06A 4KI5F 3MLSL 1RUPH 12E8H 1HKLL 3RL1A 3QWOB 4NZTL 4DVRL 2BZDA 4J3UA 5L88L 5EFIA 3V7AE 4Y5XA 2YA2A 3J7HA