1C5DA

The crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPPSLSASLGDKVTITCQASQDINKYIAWYQQKPGKAPRQLIRYTSILVLGTPSRFSGSGSGRDFSFSISNVASEDIASYYCLQYGNLYTFGAGTKLEIKRADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSSPVVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the Fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor.
pubmed doi rcsb
molecule tags Immune system
molecule keywords MONOCLONAL ANTIBODY AGAINST THE MAIN IMMUNOGENIC REGION OF T
total genus 49
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 1999-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5dA01
5J4MA 3BFOA 1EAJA 3DURA 1CVRA 4DFIA 3RVUD 3GRWH 43CAA 2QQQA 4P23A 3C2AH 1CL7H 2NTFB 2PYEB 4Z7UB 5ETUA 1B0GB 1E27A 2LABA 3VRJB 3X14A 4KY1L 1T7WA 3DROB 2BNQA 3FZUC 4GBXD 1XGRB 5K9JL 3SDXF 1PGRB 2GFBB 4MQ7B 1NEUA 2XN9D 4KTEH 1KIQA 5C08A 4JVWA 3VXSE 1BAFH 5EZOL 4PGBB 3U7WL 4P2OB 1H5BA 3SE3C 4YJZL 1ZTXL 3V9FA 2AK4A 3IFOB 3GSRB 4U1NA 1IGJA 3D69B 1UXSB 4YZFF 5J57B 4NQSA 3F5WA 4QTIH 3H9SE 1CGUA 2BHYA 5CHNB 3MODL 1AP2A 4IIQA 2EDNA 5ALBH 3MLUL 1D5ZB 4N5ED 5IEKA 3SPVB 1PYWB 2X4QA 4HIIA 4NQDE 4GBXA 4OFYA 3SDDD 2WBJD 4DKEH 1DN0A 2EDDA 5CZVL 3E3QC 3S3JA 3O3EB 4NT6B 4JFPA 1BEYL 4X6CB 5I1CH 4FQIH 1JPSL 1EJ6A 1YZZA 2RFXB 5AAMA 1IQDA 5I76A 4MJID 5HDOA 1M6OA 5C0JA 5TQ0L 5K9JH 2IAMC 1KBGL 1L9MA 2DDQL 1NCWL 1JWUA 4JR9H 3SDCC 3MC0A 3IFPA 4BZ1H 4IOSD 1INDL 3O4OB 4OCXH 4JKKA 5FYJH 2VXUL 2XQBL 3KPSE 3V4PL 3WIFB 1DBAH 2APFA 2CKBA 3FONA 2RBLA 4JFZH 1AR2A 2DTSA 3ULVC 3QEQE 1X44A 2AK4D 3LEVL 3P9WB 5J89A 1QFWM 4G9FD 1I9RH 4TRPL 3DPBA 3EFDL 4RISH 4YWGH 4TVPL 5DVNA 5E1HB 3RA7H 2JK5B 3GIZL 2H2PD 1QYGH 1NMAH 3FN0H 1PKQB 1B4JH 3S5LG 4P5TA 3DIFB 3CC5A 5D7IF 1DQJA 4P2RA 5SWZB 2NY7H 1B4RA 3X13A 3CZFB 1ULVA 1IEBA 1EXUA 4I3RL 5A43C 5IW6B 3GK8L 3BPNB 5IW1B 3U30C 5BXFA 3FONB 5DI8B 4J3VA 1OGAB 4M00A 4JFED 1KBGH 5C9JB 1K8IA 1OAKL 4JFOB 4JG0H 1P4IH 2OTUA 4WEMB 2VR9A 1NBVH 5KANI 3GBNH 5DEFA 1HIML 3T4AA 3TPKA 2A77H 5I19L 2BXYA 3G5VB 3MRJA 5GS2H 5C6PB 1XF2A 1GH7A 2BJMH 1XGQA 1NGPL 3MNWA 2BSTA 4HK0A 4BELD 1KB9K 3PWPA 5CP3A 1LO3L 5HI4D 2XWBB 2P1YA 1LK2B 5EUOB 4M62H 5D1XA 3UDWA 4H1LG 5ICZB 3WHE1 3IF1B 4G80A 4OSUH 3QNZB 5MI0B 4H8WC 4QOKA 4M9PA 1SMOA 2WZPD 4W4OC 4PJ9A 2PN5A 4N8VA 2IPKA 3QXDB 1JTOA 4U1NB 1NL0L 2NY7L 3LKQA 1UENA 4BH7B 3DTXA 4MJ6B 5I74B 1FZOB 3EOTL 1FV1B 4YXHH 1CZ8H 1F4YH 4XPAL 4GRMB 1KV3A 4RDQF 2LFGA 3M1BA 6CGTA 3VFOB 4F58H 3TA3C 1I8MB 4M48H 5ENWB 5DJYB 4I13B 5EN2A 4JFFD 1YECH 2ZSVA 4XTRC 4A6YH 2P8MA 3C8KA 4DKFL 3BGFB 3TBYA 4IRZL 1CGTA 5C71A 3HLAB 2P5EA 2BVTA 1N59A 3C5SA 4JHAH 2VSDA 3LPGA 4RQQB 4G6AC 4MLIA 5KANG 3K1KC 1KCKA 5H35A 4EDXA 1U93A 2ZSWB 1GGIL 3IGAB 4EKXA 3ARDA 2ZUYA 2VLRE 5EORL 4JM2C 4MA8L 2D7PA 2VDNL 2R2EB 4IRZH 1Z2KA 2K9UA 2BVYA 1HYRC 3I6KB 3TPUA 1BQHB 5K93A 4YPJA 1HQ4A 4KROC 4BZ1L 1YA5A 2WLYA 1G7JB 3VD7A 2X42A 1HKFA 4LBEA 4NZRH 3AFLA 1VADB 1QOKA 1X4YA 3VFOA 4R3SA 2X70A 7FABL 1XCQB 1PVHA 4CNIB 4N1EA 4OIIH 5T3ZH 1NEZB 2VL5A 4I2XE 3SGDI 3PDGA 3TBSB 2OL3A 1V5JA 2PR4L 1VA9A 1FGNH 2NY5C 1MHHB 4HXAL 3Q0HA 4J1UA 2IPKB 4M7ZC 4EQ3A 3EOAA 4ONGH 3QFJE 1CXLA 3C5ZA 3D3VE 2F8XC 1GPOH 3BX7C 3OKOA 2QQKH 3OKNA 2O5YL 4Y16A 2XNAB 1RHHB 3STZB 5ECJE 5ITFA 1Y6MR 3GB7A 4IOFC 5HYIA 1RULH 3NBNA 1CT8B 3WV0A 4Y4HD 3O6LH 1F3DJ 1TQBB 1J18A 3QIWC 2WIMA 3UTQA 4HX1B 4GRLD 1JVKA 3GI9L 5E2WL 2CKNA 5BV7L 2WIIA 4LCUB 1HSAB 3KYMA 5LGJB 5DJCB 4YC2B 1IM9D 2MKLC 5I1GH 4AMKH 4M4PA 4U3XA 4OLYL 3CMOH 1P4IL 3NCMA 4K3EH 4NM8H 2Q7YA 3QWRA 4O02L 4LCWE 2PCPA 2D7NA 3MRRB 4XT1C 2IAND 1XIWB 4NO0B 1HKLL 1ZMYA 1HDMB 5EOTB 5KSAB 2J8OA 4UV4H 5I8KL 4AENA 3MLPA 1K6QH 1X3DA 3IU4H 2XTLA 5IG7B 1R6VA 3K4DA 2GAZB 4P9HC 3VFMB 3H7LA 2ID5A 2YUWA 4KKLC 1A6PA 3W5MA 5HHQB 4X83A 3S34H 3QFDA 3FFCE 5F70A 3EFDH 4YWGL 4LGRB 1OAYL 1HKLH 4I0PC 3RA7L 4U1GB 4M8QA 5HYQA 4PJCA 5FYLL 4WFHE 1ZT4A 5FUCE 1HDMA 4XPHL 4HJGA 3RP1A 4IDJL 4QXTB 4YBHA 5D7LA 2JB6A 3F58H 3CMOL 4PJBF 5MP6L 4F7MB 1FO0B 1F90H 2VZSA 5LXGL 2HT4D 3BWUC 3VI3F 2GUOB 5LG1A 1U0QA 3UTTA 1I3VA 2DQFA 1A6AB 4W6XB 1RUAL 5ESVB 1OTSD 1CCZA 4PRPB 2NNAA 5DJCA 2DI9A 3VDCA 2UZIL 4PJFB 3U0WH 1JZ2A 4PJCB 4JREC 2B1HL 4U0RC 4D8PB 4HUUB 5E2TH 2Y23A 3EO1B 1MJ8H 5DUML 4U1HA 4IMKC 4U6VL 4JO3H 4LVOB 4NKOA 5FECA 1AGDA 2V5TA 5J8OA 2DQCH 5ITFB 4AEIL 3GBNL 4YFLF 3W5NA 2Z8VC 5DD6B 3QFJB 4Y4FD 2F5AH 2VISA 4BSVA 1ZA6A 1OAKH 2D7OA 4GXUM 2EC9U 3E6FA 5I8CA 2HVJB 1NC4B 1QSEE 4KK9D 3GIVA 4QRRE 5ACLA 4HBQA 1JYWA 1G0YR 4HW6A 3B9VA 1V3LA 4JO2H 3ZKND 3D2UB 2WWKT 5T1LA 4F7EA 1KSRA 4ZXBB 3TBSA 1N6VA 4OLVL 5IBLC 2AV7B 1OHQA 5FYLH 3U0TB 5D2LF 2X4PB 5DA4A 1A3LH 1YEDB 4WWKC 1NLBL 2BHUA 3RVVC 4WIQA 5KVEH 2J1KA 3DGGB 4X4ME 3TN0A 5C08B 2DLFL 1J10A 1FVEB 3EIFA 3GNML 3ZMRA 4YNYB 1TVHB 1G7JA 3T0VA 4X80L 3N0PB 1RU9H 4JLRB 1BQHG 1KULA 1G9NH 1T1ZB 2VOTA 3NGBB 1ZHNB 1GOFA 3L95A 3OKLA 5BRZE 1MRCL 5HHVH 4YDIL 3HPLB 4YHZH 3QXAB 5GQBA 3U1SH 3H3PL 3ZKQD 5EULV 4M93C 5JA9A 2BSED 3EOAB 2H32B 3CU1A 4PJXF 5IEHA 5GS3A 3P4MB 5LWYH 1RULL 4NUJB 5F6IC 3BOVA 4A6YL 3GJFK 2PYFA 1WBYB 4D0DA 3CLFL 4J7RA 3O3BB 4Z8FL 4QHLA 1J7VR 3OKLB 3ULSA 3UO1L 5HHPA 4LVOC 1FLRL 4NNXB 3VH8G 4JHBA 1HILA 1MI5B 1F6LL 4P46A 1MREL 1VENA 5CSGA 3FT4B 3QUMA 2VDPL 4NQEB 5FHBL 1U8IB 2R23B 1BM3L 3MLTB 3PQYE 3B2VL 1ZT7A 1QQDB 2JCCA 2WMPA 3FCTB 4PP2A 4M5ZL 3S3SA 4FG6C 4F3FB 4X6DB 4PP1D 4OD1L 2I9TB 1I8LC 1QEWA 2R15A 3JWOC 4G8IB 4V1DD 2FEDD 3DX6A 5JOFA 3L5XL 4O2FB 2AW2A 4QKXB 1B6UA 3GJFH 1FNAA 4WEUD 5HHOD 3U4EB 2CO6B 3RVXC 5EOCJ 3C5JB 3F6LA 3LVEA 5FO9A 2XWTA 2XN9B 3VMNA 4WFGD 5GSRB 5ERWB 2VH5H 4LCCC 4CADB 4OD3L 2ZG1A 4IRSB 3K80A 1KT2A 4PB9L 5D72H 5CWSB 3K1DA 1ZOXA 3SE9L 1UZ6E 4XMPH 3RI5K 5EB9A 2R69H 2L4OA 3BWAA 4PRHE 4E5XB 1KN2L 1IAIH 1CLZH 3PWVA 3OZ9L 3GUTA 1OM3H 4DOHB 4H20L 4QT5A 4YHYB 2AK1L 2OL3L 3D9AH 2KZ1B 4G5ZH 3INUL 1JGUH 3EO1A 3X3GH 1TVDA 3FQUB 4Z8FH 3BAEH 3DXAD 5JLZA 3GMMB 5HYSB 4MB3A 4OLEA 4MGXA 4NQCA 4OJFL 4XNXH 1HOCA 2X4OB 4HUVB 1SY6H 2C9AA 1CGSH 3UTTB 3ZYOA 5C0EB 3MLRL 2OL3H 2WAHA 1BF8A 1NFIB 1YEEL 2V9TA 4JY5H 4ELME 1E28B 2C3VA 3MCKB 1OPGH 2QQLL 3P4OA 1X6LA 1A6ZA 3QUML 4PJDA 4HK0B 1NFDB 5JW3L 2VLME 3QULB 3K4AA 1JNHA 3CIQA 3BP7B 1K6QL 3F7YA 4KKLD 4DK6A 3I02B 5KSVA 5DFTA 4Q2ZB 1HZHH 2J88L 3TWCH 2BNQD 1YEEH 2Z31D 1EA9C 4MJIA 4Y2DB 5FUZL 3GMQA 4GAGL 3GIZH 4L3EE 2ZOKA 1QSFB 4RRPG 5I66B 1I7UB 3GSXA 4QTHB 1WAAF 4I0PA 5CGYD 4U6TA 3MR9A 5DFWH 1ND0B 3O6ML 2OMNA 5HY9A 1IRAY 4Y16C 1IC7L 2AKRB 3SDXA 2ATKA 1J0YA 3LS4H 3KXFD 4E41E 2X1XR 3QEQD 1F3JA 3R06A 2E9WA 3WD5L 1P4LB 1A7NL 4XPBL 4GAFB 3ZT7A 5DGRA 3UTSE 4G9FA 1LP9F 3ZDYF 5SWZA 4FQHA 1CTNA 1G7IA 3N85L 4DAGL 2EXWD 5KSVB 2B8OT 3LS5H 3B8SA 2ENSA 4WW2A 4OF6A 1YNLL 4L8DB 1T1WA 2VDLH 3EO9H 1DEEB 5T3ZE 3VW3H 4LVHB 3MRFB 5FYKE 4U6VH 2HT3C 1MCWW 4UILH 4QNPE 3QDAA 5IEKB 2Q8BH 1AY1L 3PL6B 1RK1B 4EQ2A 3JV5A 3TNMA 4LNRB 4GAGH 3G5ZB 2B1HH 2J5LB 3C5ZB 4O51B 3CH1B 2ED9A 3I3BA 5J1SC 1I1FB 5ILTL 3VFWA 2EYTA 3EO9L 2X1WL 1YEJH 3AS1A 1LO0L 2Z35A 1UCTA 3P4NB 5IBLD 4NZTL 4U33A 3QHZH 4NQVA 4TTDD 3T0DA 2R1YB 4HEPG 4MS8C 1A6TB 1FVDB 3DETD 3HRZA 2EEBA 2AS5M 1U8NB 1V8HA 5GRJH 2C4XA 4OCRH 1FZKA 4Z78B 8FABA 5C07E 1I1AB 3NH7L 4YHKL 3QIBD 3BHBB 3GMPA 1SJEB 1S9WB 4FQ1H 4WW1A 1TJGH 4LDOB 1CFNA 4NGHL 4OFIA 1T5WB 4HEME 3NCCB 1C12B 1GIGH 1WT5A 1A9BA 2DS4A 3ARUA 2LTQB 2NXYC 4L8CA 1FE8H 4ZYKB 1HH6A 2EO9A 2XN9A 4DKAA 4ODSH 3Q6FB 3WO4B 3WN5B 1Q9LB 4J2XA 4NQSB 2FO4A 2XTJC 4LCWA 1WBXB 1P69B 1E4XL 4CVWA 3L6FB 1IL1B 3D39A 2IPTH 4NKMB 1U92A 3I85A 1GIGL 2DL9A 1RMFH 3HS0A 1KLUA 3FQWB 4HXBL 1AC0A 1H0DB 1GC1C 4NO3B 4YHZL 3NFPA 3PUCA 1G9MC 2AXHA 3GSWB 4OQTA 5D1XC 4JANB 1DBML 1FL5B 3MBXH 3ARSA 5FDWB 1X5ZA 1OT2A 4HGWB 4X5XB 3VRJA 3MLRH 5IGXL 3IDXH 3O81A 4P23B 3WKML 3BYYA 1BOGA 2DQHH 4ZDHA 3OAZH 4M6AA 1IGFH 1CF8H 1MCKA 5DHVB 2X89A 4DCQA 1MLCA 4JKPL 4LPUA 4OD1H 3MV7D 1WWBX 4POZC 5KVGL 1GAFH 4NO0D 3K46A 5EFIA 3WS3B 3TH4T 1ZK9A 4N9OB 1BVLB 2J6EA 3WE6B 5JW4R 2HG5B 1AQDA 3DV4A 1B2WH 1LEGB 5CZKA 3TA3B 3WJJC 3VFTB 2IPTL 3SGJA 5TJWK 3K8LA 4FFVD 4JKLA 4WO4D 3IJHA 3RPIA 4WU5B 3RKPA 4UTAH 3I02A 3STLA 4HS3A 3L7EB 5DDHA 3WJLA 1KCRH 3BXNA 4KV5F 1RZJL 4MWFB 4NNYB 5DZOA 3T4AB 4KK8C 2QV2A 5LAXA 3AUVA 2D7QA 3TIEB 4HUMB 4NSKB 5FGSA 3QIUC 1B2WL 1F2XK 4M61B 5KN5A 3KVQA 3BI9X 4PIRF 1OARH 5I18H 1KTLB 4HS6A 2EXWC 3L3JB 4KUCD 5BMFL 2RGSA 5MI0C 3MOBH 1IC4L 1FYHB 3GSNB 2APVA 3ARZA 1JZ4A 4YDJB 4LCIH 1R5VB 4X6FB 4JAMB 4KK6C 1FBIH 3VXME 5MEQB 4OJFH 3BDXA 4XNXL 3PIQA 1ROWA 1Q9KB 2B7DT 5F88A 3TJEH 4Z7WE 1OTUD 2XZCH 4PJ8D 3MGAA 4NC0B 5BQ7A 4EDWH 5F3HB 1ZA3A 3X13B 4C58B 2AXGB 1G0DA 4NRZB 1FIGL 3O3AA 2EYRA 5D7JB 2BOBB 3MA9L 3Q3GA 5M94B 4NKQB 1KIUA 2YHGA 3JWDH 4LASL 3Q1SL 3QEQB 4BUHA 2PUQT 4OGXH 3BDYH 5AYUH 3MPCA 1J0ZA 5E4IA 4RGNE 5DK3A 4BQ6A 2DYPB 2A73B 3O0RH 1HNFA 5DTFA 3IVKB 4CVXB 1WQVT 1CWVA 1KFAH 1UM5H 4U1MA 3OG4B 4HGKC 3ZL4H 2VITA 3TO4C 4ODTL 3PWPD 3ME0A 4HWEL 5IVXA 4WUUE 3UYRL 4O5LL 2X4SA 1JNNL 5J3HC 3RL1B 4HPOL 1DBKL 5HGHA 5C0ND 4TSAL 5SWZE 1ZT4B 4WFHD 2X05A 2NY0D 3KR3L 1D5XA 5JTWA 1OVZA 1WFUA 1QLRB 1OT1A 1DQLH 1ZS8B 1HHHB 2R23A 4LHUB 3HE7B 4ZUTA 3BP5B 1IGIL 3NA4A 3AB0B 4ORGA 2LU4A 3QWRD 2BNRD 5F44A 5I6XB 3O3EA 4G6MH 1MIEH 4UDUB 4YPGA 2Z9TA 3SY0A 5FO8A 1P4BL 4LSVH 4X0KB 2IFGA 1ZANH 4OF8A 3QZWA 3VWKB 4OGXL 1T3FB 1VGKB 2W92A 1TMCB 5FF6A 1NAML 5JO5B 3O0RL 4EIGB 1PLGL 2FL5A 1MSPA 4YDKL 1WITA 5BZDB 5C09E 4DN3L 2EDOA 3Q1SH 4P2RD 4PG2A 4MCZA 4Z95H 3RUGA 5DMGD 4Z18A 5EBGA 2VDQH 5FIEA 5TQ2H 5DRNA 4PJGA 2WLZA 2DQHL 2EKSB 5LBSL 4NO2A 4PJBB 1MCIA 3LB6D 1KB5B 2BY3A 2JLLA 2PO6D 3GBLA 4NNPL 4XCYB 4OI8A 2XZAL 3OL2A 5C0RH 1NMBH 3SKNA 4L4TB 3QEUB 4U1LA 5IMMA 2I9LB 4S1QH 3ROLA 4MCYB 1DSFH 3X14B 3V0AC 3MFFA 3SCMC 3RUGB 4H0GA 3G6JB 4MCZB 1J5OL 4QHMB 3SKJH 4XNYH 3CSYB 3LSOA 3FO0L 1OOAA 2BERA 4TVPE 3BKCL 4N90D 4KDTC 4BUGA 3DGCR 3BZEB 1T3FA 1VGKA 1GVIA 3H2WA 2BDNH 3MA7A 1T03L 4JDTH 1KCRL 4PLJD 2CO7B 1RZJH 4P9HH 2G75A 4RWYH 3EOBB 5J6GB 4PRDB 4WY7L 1WWCA 4D2NA 4LCYA 1DQMH 2B1AL 1CICB 3IDNB 5DJ0B 1MQKL 4M6MH 1PLGH 3ARFB 1BP3B 3KYKH 4OV5B 4UT9L 4E42A 5I1EL 2V5SA 1HYSD 4NYLA 1HXYA 3I9GH 4OFDA 1BX2B 2BOCA 4LARH 4P4KA 4ONOA 2VZ1A 4Z95L 1DLFH 1TCRB 1T4KB 3K2MC 5ESAA 3BKML 1QHPA 1KTRL 2VDQL 1T6VN 2BSRB 3HI5L 1P84K 1A02N 3D18B 4PRPA 5F1NB 4OTXL 1BQSA 1TPXC 4NQDA 4X6DF 4NFCA 4YHNB 1T6WA 2FEDC 3FN9A 1NMCC 3L3IB 1KENH 5I1EH 3QI9B 3QDJD 4JY4A 4JHWL 1P7QA 2NY1C 3TH3T 5H37H 4HKJB 5I0ZA 4OBSA 5B4MC 1KLFA 2X09A 4DGIL 5SV4A 3V6FA 2IANE 4LSSH 1OW0A 1G6VK 1LE5B 3EHBC 2OXGA 5KTEL 5LVEA 4YEEA 5ID0A 4F7TB 1ETZB 5HGAB 1OGTB 2BOBA 2CQVA 1ORQA 3VXPA 2V7HB 1EVUA 3MCLL 3ZE0F 1IKNC 1AIFA 4JB9H 4KRPD 3V5HA 3V4VL 1Z5LA 4GRLC 2EDQA 3CNKA 5E8DH 2NY0C 1OWWA 3UYRH 5KS9F 4LK4A 4KK8D 2A74B 4NN5C 1DDHA 4TPRH 4LSSL 2DQDL 2ATPB 5B8CA 4ZOEA 1A6WH 4G6FD 2GY7B 3GSVB 1IGMH 5C0CD 5DD0H 4MNQA 3MXVL 1IARB 1N8ZA 3MLWL 4AM0A 5C0FA 1YN7B 5FYKL 2HFGL 1WGOA 1XGTB 4KJPD 4N8CH 4OKVB 2OQJA 3O41A 3T2PA 3AGVA 1ACYL 4FTVE 3MFGB 3BZEA 4KK5C 4HQQL 1FBIL 3HPJA 3LQZB 5CD5C 1INEH 4OM1H 3UTTD 4XPGL 3MNZB 1TIUA 4P4KD 3QB7C 4XP5L 4X7SL 3U79A 2G2RA 1K9TA 5D7LE 4P46D 5J6HB 3MJ7B 1FIGH 2D2OA 3GKWL 1EZVY 2VLKB 1BBDH 1NGXB 2VQ1B 5FB8B 4NHUA 3MRCB 1CE6A 4TN9A 1JV5A 1LE9A 4LRNL 1UC6A 2DBJA 1P2CB 4KTEL 1QSVA 2YA2A 3FT3A 3KPTA 1MLCB 1BWWA 3RZCA 4J23A 2XA8H 3F62A 2XYCA 4WU7B 3RKDD 3BQUB 3BD4A 3SO3C 4LLQA 5ITBH 2DM7A 1Y0LB 3P9MB 1JNNH 3RWDA 1DBKH 1CG9A 1YDPB 4QRRA 5GGRY 3ZL4L 2P46B 5F7NC 1A7NH 5H2BB 2PXYA 4Q6IA 4AQOA 1RURL 5KSBA 4FQLL 1QLFB 2D7MA 3TN0D 1DCLA 3WFBH 4NJ9H 1JF6A 4YHOL 3I6KA 3QISA 3KPQB 3F8UB 3UPCA 1CGYA 2IANB 2FZ3A 3BPOB 1HYSC 1QNZH 4R9HA 1TJIL 1CE1L 1U93B 4M6ML 4ONHB 3TVMB 1EHLH 2W60A 4QRTA 3QT2A 5E24E 4I2XA 5EZLB 5FA3B 4XTRD 2UWEF 2A6KA 4KC3B 3RL1A 1C12A 4WTWA 1I4FA 5AZ2H 4HPYL 2DIBA 4Q74A 4CMHC 1P4BH 5KVFL 2WWMD 1JFQL 3TBYB 4MMZC 4NCC1 1LEIA 1JMXA 1TENA 2ICWI 4ODVH 1SVZA 2NY6B 4ZSOA 5AD0A 3GMNA 12E8H 1YY8B 5DRZB 4NQTA 5FYJL 1MCOL 5HHOA 1EMTH 2OI9B 3Q6GH 4L5FH 1NMCB 1OTTD 2X4QB 3ZDZF 1FC2D 5C0CE 5KVFH 2DTMH 5C0RL 5D7JA 1JRHH 3PXJA 4N0FA 1HN1A 1I1FA 5C6TH 15C8L 1QFWH 5D5MA 4LLAA 3QIBB 2X5PA 4Q0XL 2F53B 2DIAA 3PGDB 5HHOE 2AJUL 3EO0B 1NKRA 5IFHH 4YDLB 3FOLA 3KWWA 1KXVC 4CJ1A 1CDBA 4WO4A 3DO7B 1GSMA 1VFAA 3FJTA 1R5WA 1T5XB 3L3GA 2XQYK 4C56A 1H3WM 1JN6A 3QQ3B 4L8BB 3H9YA 4Z6AT 2R4SH 3VGAC 1UWGH 4G7VH 4WCYL 1T89A 3O6FB 4KVCH 4PTTA 3W39B 4LVNB 2ZKHH 2BHZA 2R56L 3FO1B 1IGCH 5HTSA 3T3MF 3LQAH 4XC1H 2ZG3A 3V52L 4N0FB 5CILH 4HS8L 5HHMD 1FH5L 4G6JL 3M8OH 4L3EA 1JZ7A 2X89D 1MJ7L 5J9PA 5DWUH 4LCCB 2R0ZH 1BFTA 5JW4Q 4E9LA 5D1ZB 1C5BL 4HIEB 4X9GA 3CFKA 4NQEE 5GGVH 4D0BA 4ZSOB 1LO3H 5FK9B 2YSSB 1J9CT 4M62L 1RIUH 1U6AH 2Z92B 3NIDE 2K3TA 2W0LA 4RMWA 4MHHG 1S7XA 4ZOAA 1ZLWK 2ITCA 4XXDA 3VXUA 4XMKH 4JO1H 1IAMA 1PKQA 3AROA 1JNHB 2V2WA 2DDQH 2OI9C 1H3XA 4PJIB 2R0WL 5EU7E 3ULVD 3OJDA 4XWOC 4WGWB 3NFSH 4DQOH 3CVHA 3U7YH 5FM5O 3SE4C 3BUYA 1T2QH 5EU5B 4D9LL 1YNKH 3MCKA 1G9EA 2FATL 4HMDA 3SO5A 4R2GB 3NTCL 1A7QH 5F7MC 1M1SA 1VERA 3UZVB 4FQXB 1CXIA 4HKBB 5BZWB 4JFQA 1A7PH 3MOAH 4M6NL 1J1OL 4PYHA 5GISL 3CH8A 4JHAL 2FIRT 1MCWM 1RHFA 4Y19A 5DD0L 1YMHA 1J1PH 1HQRA 1QG3A 3P9MA 1DTUA 1Z3GL 4XCFH 1IFHH 2MOVA 1HCVA 5F7LB 2CRYA 2B0SL 1F4WH 4F7CB 3TJHC 3AREB 3RTQD 3CD4A 4L8CB 3MRPA 2P24A 2E5EA 4K2UL 5C0GA 3WMSA 1SEQH 1YYLH 4WFFD 5IOPA 1KACB 4YXKL 4GKNA 4LL9A 1QR4A 3BWAB 2XY2A 1MJUL 6FABL 4ZQKA 3SPVA 5D1QB 3LEYH 3K3QA 4QHNB 1PZ5B 3ARBB 2F58H 2YC1A 3VGHA 2NY2B 1DR9A 4LHQB 2EXYD 2W91A 4F33B 1BIHA 1BJ1J 3DARA 4HMEA 3CXDL 2A6KB 3LRSB 3AMLA 4CVZB 5EZLA 1H5BB 4YE4L 1ZLSH 3FB7A 3PWPE 4DZBA 3VRIB 5TPWL 3ECBB 1A2YA 4WW2C 4RNRB 1DUYA 3RGVA 3WS6A 3KNBA 1CQYA 2AEIT 1KIRB 4MVBD 4HPOH 1U8IA 4YX2H 4X7CC 4HFWA 3O8XB 5JORB 2XQYG 3FT4A 1MRDH 4KJYA 5CEZE 3G9VA 4OIAA 3WLWD 5F21B 4N5EC 4J6RL 3VG0H 4L8DA 3O3BA 3QAZB 4HCRL 1G6RH 2EIDA 2VO5A 3RX5A 2DQEH 3RVVD 1MFBL 3TO2A 4AIZB 1ZWIB 4U6YB 1NMAL 2EDRA 3U9PL 2CLVA 2XIDA 4TNVK 4X4YA 3DSFH 4ODHH 1NGYB 3SJVD 1KGCE 3DWTA 5EBWB 4OLWL 3HPLA 4QNPF 4BM7A 3F7RA 3MNVB 4HIEA 5D1ZA 3BH8A 1D6EB 1UGNA 5TPWH 2DICA 5T5NF 1CE6B 3V4PH 4JFZL 3K8MA 4WHYG 3VFSA 3MUGB 5C3LD 2A6DA 1QSFA 3VMOA 5I66A 2HKFH 3BN9D 1LP9E 3QUYB 3RL2B 1F8TL 2MHAB 4FABL 2Y9RT 2F5BL 3KLHD 5J56B 1I9RL 4G7YL 4JFFA 5C8JA 1YMMD 4GUPB 1WFTA 4M3JA 3IJSB 1B90A 4KJQC 3HI1A 3FQRA 12E8L 1CXKA 5BS0A 5T1LB 4F7EB 1AH1A 1G7HB 3ZE1F 1QO3A 5D2LA 4F8QA 3AU1A 4K3JL 1EEYB 4TULL 4ZG1A 3BESR 1A1NA 1XGTA 2F5BH 4P59H 1M05B 4K8RC 1CDYA 3S34L 1T0MB 1C7TA 4Y5VA 3NCJH 5T5NG 5GIRB 2NY4D 5DK2A 4LCYB 4H5SA 1UKSA 2CIIB 1KUMA 2BK8A 4PRIE 1WTGT 5I74C 3LKSA 4OZGE 1W0WA 4WWKD 1AGDB 1N7ML 3HZMA 3T1FB 7FABH 3JWOH 3GMMA 5HYSA 1HEZB 3JTSA 4E0RB 3MV11 3ORJA 2BRRH 2H32H 4L4TD 5DVOA 3D0VA 5D7KE 2BC4A 4JVPA 1IGYA 4ELMF 5JHDE 1A6AA 5I75B 4F7TA 5B3NA 2BNRB 4L4TA 3REVA 4PG9B 5E2TL 1T7YA 1S3KH 3P11H 1EX0A 4WTXA 4K3JH 3T0AA 5SWSE 2AP2A 4XPTH 4BSJA 3QSKB 4WWKA 1PEWA 4AEIH 4ORZC 3BH8B 3FO2A 3ILQC 5DRWB 5DK0B 1JYNA 5L0QC 5FV1L 1AD0B 3U4EA 1FJ1B 2RIKA 3LKPA 4XRCB 3SKUD 5A3IC 3CVIH 5KSBB 3DECA 4Q58C 4HUXB 4U6YA 4XWOD 5EIQA 3HG1B 4WTZA 4NYLB 5EG6C 4PD4J 4Q6IC 1E4JA 3VGBA 1IMHC 4PB9H 1WFNA 4JM2B 1WUNT 1B0WA 1DVFA 3S88H 5SX4I 3LKPB 5F93C 2O5XL 5HHVL 1JF5A 1AXTL 3HNVL 1WCBB 5AYQA 3HMXL 1BECA 3ARFC 5DRWA 4ZS6C 4RBPH 5C0IA 3ARBD 1DUYB 2Z91B 1P5VA 3OAYH 3ECBA 5J1TC 3RU8H 1NQBA 4K3HA 1JZ5A 4I77H 4QHMA 2FJHA 4MNHA 5FAAA 5DJ8B 4PYGA 5KS9A 4X4MA 5SX4H 3ALWA 2DIJA 3TGXA 3UPRB 4HBCH 2CKBH 4NC2B 5DYOB 1TPXB 3VD4A 4S1DD 3QA3A 4LCIL 5GS2D 2CK0H 3C87A 2E8ZA 4M5YH 2I27N 2RR3A 1R3KB 5TQ0H 4CGTA 4LDEB 1FDLL 4OFYD 1SJXA 4X9IA 2D03H 1EHAA 4E0RA 1K8DB 3MZGB 5HVGB 3V8OA 5F7UA 4OT1H 4XNQA 3U0TA 3ZT6A 1XGPA 2VL5B 3PWNB 4QXGH 3VG9C 1VGEL 5L0QB 4HIJB 3L5WB 2W38A 1MCFA 3HTLX 2E7MA 5FGCB 4RDQG 3AXLB 2XA8L 3OKDB 2BNRE 5D8JH 1XAUA 5AUMB 1YUHA 1HQ4B 5E56A 1U91A 1KFAL 1UM5L 5IJKC 3SDYL 5GS1B 3LMJH 3S35H 1FNSL 3LAFA 4MQTB 1BFVH 4HFUL 1JHTA 4QRQB 5E94B 1MRDL 1Z9OA 4NKOB 1H3VA 4HAFA 1UJ3A 4WW2F 3I50H 3CVHB 3DETC 5L2KA 5L88L 3IU3B 4G8GB 4MSWB 4PJIF 4I3RH 2VXQH 3TYFB 1OB1B 1W8OA 2NNAB 2D31A 3VI4E 3JWOL 4Y89A 5IFJB 1U3YA 1VESA 4GW4B 1G7PA 3BIKB 4OLUL 1JZ8A 2ORBH 4XXDB 3QCTH 4OV6F 3VFTA 2V17L 4OCWH 4U1MB 1OAUL 1NAMB 3BAEL 5DJYA 1I8MA 2PETA 1U3ZA 5MEND 1G7QA 2IMMA 1MHPH 4OM0L 1N64L 2AEQL 2VRAA 4XCEA 5C09B 2XKNB 1MHCB 4YK4C 1FZOA 3VI4F 2P49B 2CD0A 2I07A 4ZDHB 2FX9H 4GAYA 2B5IB 3EFFB 2EEAA 4NZTH 2NXZC 1U8MB 3FO1A 4WENB 4JFYA 5E0QA 3TZVD 1RK0B 5BVPL 1NCDH 3V95A 5BOZG 3WIIL 4PJBE 4PLOB 3QUXA 3BD3A 2Z31C 4MMXC 3Q6GL 1MNUL 4DN4H 3UTOA 5LBSH 1H15A 1P7KB 4WV1B 3OR6A 4ODXB 4XCCL 3DUHA 1S7UB 2JJSC 3GSWA 3MRDB 2NW3A 5E6ID 1XIWA 1I9IL 4LSUH 4OCRL 1G9MH 5DS8A 3NH7H 4AIXA 2HN7B 1R24B 4HZLB 1X6NA 2ZUSA 1TVBB 3RQ3A 2CLZA 4HIXL 4NJAL 1KXQE 4HUNB 3PHSA 2BNUB 4QYOB 4OCWL 3TESA 4PJHB 1NSNH 3G5VA 1EBPA 1LDPH 4NSKA 5L2KE 1FQ9C 1LO5A 4ZOCA 2I9LA 1OSPL 3Q6FA 2W9LA 4XBEL 1SYVB 4JFOA 1XZ0A 3RY4A 2H2SD 1PZ5A 1LGVA 1KCLA 4QHNA 1DUZB 3MRIB 4JN2B 1RVFL 4L3ED 5DC0A 1PQZA 2JCCE 4HIXH 4JG1H 1CI5A 2NLJB 3B9DA 5FGCE 1ONQA 3N1PC 4P2QD 5EOCL 1MCDA 1D9KC 2ESVB 2HT3D 5KBNC 4JCLA 4H1LB 5EPMA 2P24B 3T0XA 1IEBB 5IHZA 2EC8A 5HGGS 4XI5C 1U8NA 4R0LB 5BZDA 2F74B 4Z77B 5JXEA 4DZ8B 4GW1B 1FL6B 1NCDL 1YMHB 4I9WD 4L3CA 2G60H 3UBXI 1MHEA 1T7XA 3FB8A 3OBAA 3AM8A 2IH1A 4PBVC 1X4XA 3C2AL 3MACL 4ZFOB 4GG8B 2VZOA 4H8WH 4O51A 4H0IA 3A6CH 3RDTA 5JXAH 4OT1L 4I18A 4IDLA 1IM3A 4MNGB 5CIPH 4L8SC 4S2SB 2DQJL 2CRMA 4XGZA 5I75C 4JY5L 4MA1C 1QLEL 5H2BA 4PJIA 1K4CB 2VZ3A 2DLTA 3VG9B 4NPYA 5IB4A 1IL1A 2PR4H 1DQTA 2UY6A 1WIOA 5EDXA 4KH2A 3WHXB 5FEBA 2OZ4L 1BVKB 1HH6B 3MOAL 5IR1B 3P0YL 1MCHA 2DM2A 5AEAA 3KYAA 4XAKD 1AXSB 4MAYC 5CZXD 4WNQB 4JN1L 1A9BB 3RDTD 3S4SG 1C08A 2ESVA 1OARL 5I18L 1XF5B 1A7OL 4M43L 3KPRA 3T77A 3KYOB 3PP4L 4GRWH 1QBLH 1KN2H 2Y36H 1MREH 1E4XH 3AREA 4XB7A 2I5YL 4X8JA 1OL0A 2OJEA 3FZUD 4GBXC 4NQCE 4HULB 4Z7VB 5D1QD 5EZJB 4CDHA 1OSZB 1LO5B 1X5JA 2E6QA 1HHIA 2Z4QB 3MACH 4PGDB 4R90H 2LU7A 1SMAA 1YN6A 3X3GL 1FC1A 3DVGB 2Z35B 2W59A 2A6JA 3KLAA 1N5YH 4R7DB 1IM9B 1WBZA 2H9GB 3BPCB 4XNZC 5JNYA 5J3HD 4UTBH 4LVEA 3HPJB 3I6GA 3UXFA 1MFCL 1OAZH 1A8JH 1LNUA 4ZUUB 1IBGH 4LNRA 3OAZK 1UG9A 4Q9CA 1MY7A 3WJLC 5D72L 5C0EA 1D5MA 1NCCH 3BZFA 3HMWH 3OJDB 1BAFL 5EZOH 5IB1A 5C07D 2NXYB 1HHJB 4D3CL 1NC2A 4CN1A 1MELA 5EZIH 4HWEH 5FOBB 2I60H 3T4YA 2CXGA 5ILTH 5A16B 3QPXL 3NIGF 4LP4A 2ITDA 3PP3K 4EIZC 1LEGA 1IGTA 2ICWJ 3WUWG 3AVEA 3CK0L 4P3CL 5JPNB 3L3OA 5JA8B 3TVMC 3C09B 4EUPG 4PTUB 3FRUB 3IKCB 3IXTB 1FHGA 2JJWA 4NN6B 5IB2B 4OZFB 1FORH 2PXYC 1NGWB 1U8KA 3LEXB 4L4VB 4MD5A 4IRSA 4QXWA 4PJ7A 4HWZB 5J13B 4UUJB 2HLAB 1S7QB 1XGYL 2PO6C 3MOBL 4UIMB 5IK3B 3RI5F 3ZKMC 3WHE0 1MF2L 1OY3B 5C0BA 3DIFA 4Z7NF 1HHKA 5GXBB 3GMLB 4Z7VF 2F54E 1MFCH 1OAZL 1YEHL 3D18A 4ZFOL 4L4JA 3LN5A 2FYYA 4G8IA 4NDMA 1R3HA 2OP4L 3V4UH 4K7FA 3WKNA 2HMIC 4DOHE 4TUOA 2V7NA 3IB4A 4N9GA 3FQTB 1FG2B 3THMH 1D6VH 4NNXA 1Q9LA 3WN5A 3WNPA 3EOBA 5E2VL 5J6GA 3DRQB 2NY3C 3BQUA 5DMGC 4NQCB 3GMRB 4IMLA 4J3WA 1QTYT 3WXVL 1KCVL 5HHOB 2KBGA 3BDBA 2MPAL 3VFVA 4YBLB 1F3DH 3VFUA 3OB8A 4I4WA 1JI1A 1N7MH 4Y2DC 3BRGC 4ZO6A 3D48R 4MD0A 5JW4N 1QRND 2YOCA 5GRYA 4ALAL 5DJ2B 1WIPA 4GBXB 1X5AA 3BEWA 4OZHA 1YEIH 2R4SL 2R0KH 1YQVL 4MNHB 2AJXH 4WUUD 1PFCA 2VLRD 4R6UA 1YMMB 2J6EL 4PGCB 3BQUD 2VR5A 5ACMA 1UCBL 4ONHA 3TT3H 5LWYL 2B4CC 1FFNA 1I1AC 4RMUA 2FR4A 5JPMA 3F65A 2AK4B 2M8XA 5F7DA 4JO4L 5HYFA 4X5WA 1FNGA 1JGDB 2BVUA 2WP3O 4N0CC 1KJ3L 3P0VH 2EDTA 4KRPC 3T2NL 2DQIH 3MLTA 1XGRA 1S9VB 3JXAA 4JHWH 3SJVB 4CAGA 4P4RB 1A4KA 5ISZA 4NNPH 3SY0B 3JV6B 3OTTA 4JPIB 2HTKD 2EDKA 1EFXD 1FZJB 3QNYA 4KDTA 4XRCA 2KQMA 3Q5OA 4YH6A 3DBXB 3B6SA 3QDMA 4ERSH 1CBVL 1OGTA 4PRPD 5HHXL 5CJ5A 4WI8A 4APQC 4FNLL 4LKXA 1CZ8L 1BBJA 1F4YL 1DANT 2NX5B 5KVMC 5SWSD 3L5JA 5E9DD 1EK3A 2PTTB 4F58L 2LVCA 1T83C 3SE9H 4NQCD 3SQOL 4HKXB 4UOW0 5E2JA 1MVFA 4V1DE 4QRSA 5F1IB 4P48A 1DL7H 4NCDA 5E8EB 5EC1A 3H0TB 1J1OH 4DW2L 3WFHB 5HI4C 3DUSB 3NABH 4NQDB 1JGUL 4PJ7E 3NCFB 1BWMA 4OB5H 3ULUC 2BP3A 1AJ7L 4UTAL 4ZFGL 5DD3H 2ZWLT 2ZOLB 2G5BA 3FO9B 4LLDA 3P4OB 3PWJB 5I1GL 1VEMA 3L3HB 5F7EH 2NTSP 3KYKL 3H6JA 1PSKL 1UADC 4LEXH 1IAKA 5DQJA 1YYML 1CF8L 2DQUL 3EZ8A 3MMEB 4MNQB 3E3QE 1IKFH 4IRJA 1Y18A 2HH0L 1FRGH 2Y25A 1M05A 5GGUB 3F7PC 3IXAB 4AH2A 3KS0J 1J0HA 4KMQA 2F58L 3VXRB 3KPSB 3HE6A 1M7IA 3KXFE 3MJGX 2MQ3A 3DV6B 3FHAA 2ADGA 2MTPA 3O6FC 1NDMB 3CSPA 3SKMA 4G43B 3CJJA 4HS6B 3HNSH 4Z0XA 4JRXD 3V0VB 4ZD3L 1EV2E 4F9LC 5T1MB 5I73C 3TIEA 5DZNA 3P9LA 2JELL 3ZTJH 1R3LB 3C9NB 3GHEH 3TBVB 3DSNA 2LVEA 4UIKL 5DRXB 3VU2A 3ZHLA 4CU7A 5J12B 5DD3L 2I60L 4LSQL 5CJQL 5A2JH 4KHXH 1QRNB 2FBOJ 1R3KA 1WEJL 3CFCH 2VAAB 4P2OD 3RWIA 3H0TA 1CICC 5IESH 1EEZA 2DBLL 2XWTB 4X6BA 3SCMD 3OQ3B 1MIMH 3VFGH 2AJ3B 4U0RB 2H1PH 5B21A 4ENED 3QEGL 4MXWL 1KPRA 3VA6A 4EI5D 1N4XL 1A47A 1CVSC 3DX6B 5I15L 5JOFB 5IM7A 3QWQB 3QUKB 4IRSD 4ZNEE 2UWEE 3EYUL 4PJEB 2J8UE 2HFGH 5D96B 4IS6B 1XEDA 2HH0H 4OLWH 3D85D 4WHYH 4YLQT 1S8DB 4HSQA 1NGQL 2FIKA 5D7KD 3ULSB 4JRYE 1JJUA 4JJ5B 5D7IB 5HVFB 1JHKL 2EE6A 3BP5A 3TFKC 4G6KH 5CJXA 4UIKH 1PY9A 3MV8A 3BDYL 5AYUL 3P73B 2V6HA 5FA4A 4X7DC 3J8F7 5LGHH 4CBPA 5D7SL 3B5GA 1PG7X 1KLUB 2ICES 2Q8BL 3FQWA 3JV4B 3NIFE 4JDZA 4AIOA 2WK2A 3FB7B 4X5WB 2XXMB 2C26A 3EYOB 3WN5C 3DMMB 4DN3H 4OF0A 2YRZA 1KPVA 4O00A 4Y5XB 1U41A 1W0VB 1YEJL 5IBUB 1QFWI 5ICYA 1UB5A 3HZVA 1CT8A 1I1CA 1CDHA 1HH9A 3FFDA 1CGWA 2AI0L 2VXSH 4HC1A 2OK0H 1ZANL 2NY1B 5L2JA 5D6CA 3RHWK 5I1IL 3DGGA 1A1MA 4FZ8L 4KI1A 2KDGA 4Y4FC 5KSBF 4UI2A 3VXMD 5MEPA 2FSEB 2UZIH 3QRFM 3D25B 2ZCHH 4F7CA 5I0DA 1UJTA 2CDFB 2BVOB 4X9BA 1X7QB 4GRMA 3GMOA 4WRLA 3NABL 4FQPA 3V5DB 2YZ8A 5F7KC 4HWUA 2AXFA 4RGMC 5F97E 3O8XD 3HC4H 5E8DL 4AEHH 4HIHA 5IB5B 1T03H 4N8VB 1F13A 1QRNE 2ZCHL 4WVRA 4ORGB 3TBTB 4QY8B 5FCUL 1KTLA 3FQTA 3GDBA 1MWAB 5F6HJ 3CSBA 4N8VG 3NIDF 4LBEB 2V9QA 5EU5A 4K71C 2DJSA 2Q86B 1T22A 3A67L 2ERJC 5KOMC 4Z7OF 2ICWB 3CSGA 2ZOLA 3EUUA 4RAVB 3O2WH 4LF3A 2HJKA 2V2WB 2VR4A 3FQRB 3E6HA 5F9DC 4EN3D 3H9HA 4KDVA 2LQRA 4GKOA 5FUOH 1HHKB 5DD1L 1VEPA 3IFNH 3WFEH 3IDXL 2R9HD 2GUOA 2UWEB 4G9FB 4MJIE 2GK0A 4Z7UF 2DQIL 3WEXB 4WY7H 2M2DA 5DTFB 5GJSH 3LIZL 4KXZI 4GKSA 5T1DH 5T3XL 1S9XB 4O58L 2JELH 2CRIA 4YXLH 1IAOB 5F7HA 4GS7B 3VWJC 3TC9A 5J13C 3S6CA 5FO7B 4X98A 3M17B 2EDLA 5IBUG 1QBMH 4EUPA 3B5TA 2EYSA 2WUCH 2NXZD 4TVSa 1CLYH 5DT1H 2BZDA 2JIXD 1NUDA 3RIFF 1KXTB 2DYPD 4RFNC 3N9GL 3O4LB 43C9A 3VXMA 3RWGA 5F3HA 5I1KL 2JB5H 4BH7A 1CLOH 5BW7C 3M8OL 2OX5A 1NC2B 4R8WL 4NO0A 2R2HB 3MUHL 3E8UH 3ZDZE 1NFDA 2Q6WA 1TTGA 1JZ6A 1N5AB 3RVTD 3QHFH 2VDOH 5MENA 5K9KB 5E8OA 1S9XA 4YDVB 5JORA 3RGVC 1MJUH 5HVHB 3CDCA 1E4XI 5EIIB 4LCWB 1KIRA 4M5ZH 4ZFGH 3KHOA 4NN5B 2CKBB 1HSAA 3KYMB 4DGIH 2EH7L 4CJ0A 1UVQA 5FKPA 1NCTA 4KY1H 4A2MA 4ZYKA 3E8UL 1F00I 2YPLB 1G7MB 4DZBB 4HD9A 1KYOK 1JNLL 3BKJH 3BP6A 1YN6B 4RAVA 2Z0BA 1HHIB 2Z4QA 4PGDA 4L29A 4UBDC 2ICWA 4XP5H 3MX0A 3QDME 3D39D 1FYTE 3FFCB 2IADB 2QSCH 4JGMA 4D9LH 1NGZB 2J2ZA 2YN5A 1K8IB 1UFUA 5ICXA 4JFPB 4GXVH 4PLJC 4Q9RH 4MAYB 4OCSL 2DKUA 5I8OL 4JCMA 1LEKB 2HA1A 3CDGA 1CFTA 5IW1A 1ACZA 2AABL 3HI6H 2Z93A 1EJOL 3JUYA 4M03A 4CADA 4NHCL 1N6QL 4HV8B 3O2VL 4E41D 4U6HA 4X5XA 1XCQA 1GRWA 4PRAB 5IT2H 1W72H 3KPMB 3ROOB 2X1PA 5SX5H 4KKAC 1JCKA 2ARJB 5ISZD 1JGVH 4BZ2H 3FL7A 3MGOB 3X12A 2VN4A 2X1OA 2JK5A 3OXRB 3ZHDA 1D9KB 5HHME 2IQ9H 2I9TA 2GTZA 5L2JB 2I24N 1A14L 1YY9D 5DSCB 4NDMB 2LAGB 5E7BA 1A21A 4YXKH 1OAUH 4P46C 1QD0A 5MENE 4TUKL 5CZVH 3E2HC 4Q97A 1I1YA 4MNGA 4JZJC 1AKJD 2F8VA 3HE6C 3B4NA 1U58B 2N7BA 4OFKA 2HLAA 4LPXA 1Q9WA 4LLQB 4WCYH 3OX8A 5E5MB 1SJHB 1ZHBB 4MJ4A 5GJTL 3MLXL 4DTGL 2R56H 3BUTA 3C5SB 5E5MA 4N0UB 2YD8A 4PUBL 4G9DA 4TSBL 2YPVH 1AR1D 2ZG2A 5ITBL 4C83B 1IQDB 4NJ9L 2VERN 3RY6A 3ULUF 5D7SH 3BSZH 4EXPX 3QNXA 4LSUL 2D4FA 1AGBB 2R4RH 5D2NA 3NCJL 3WLWC 4XX1G 5CEXB 5J6HA 3QG6B 2NXZB 2XKUA 5D5ME 1S9YB 4J6RH 3VG0L 2W0PA 5JXEC 1URLA 3BRFA 1W72L 4ZTOH 4R4NC 4W4OA 5K33A 2ARJA 3BKCH 1HHJA 3LDBC 1HI6A 4LLUB 1XR8B 3QDGB 3OJ2C 5F1SA 1UXSA 3MV7E 1AI1H 2IPUK 3EYQC 1J5OH 3O41B 3O6FA 3ILQD 3ZE0E 1NANI 4U1GC 4Q0XH 5D1XB 3GFUA 1WZMA 2Y06H 1EEZB 5AZ2L 5DS8B 4PUBH 3DSFL 4ODHL 2NY5H 3CLEL 4QWWD 2F8OA 2M1KA 5E9DE 1CYGA 2OCFD 5GZOC 4H25B 5HJ3A 3NZHH 1P7KA 5TE4L 3LKOB 3MRJB 5EBMB 2QHLA 3M45A 2F53A 1J11A 5HYSG 3C9NA 5ALCH 1RZKH 1MQKH 4QRRD 3T04D 3BSZL 4Z7VA 3W0WD 1UM4H 1NBZA 3QDMD 2VB5A 4GQ9L 3EYSL 4X6DE 3KPPA 1YPZA 3PWVB 2NY5L 1WVZA 1AHWB 4HUUA 3KPRB 5FYJE 5F89A 3T77B 4D8PA 3LY6A 2R9HC 5DI8A 1MJ7H 2H45A 5JXAL 3KLSA 4NBXB 1CQKA 4PR5B 2P43B 4RX4D 5IHUL 4Z0BH 1K3IA 4GLRH 4B7IA 5B38G 3MV01 1PBYA 1TQBC 2P45B 2UUDK 3WHXA 5DVMA 2FWOA 3OB0H 1W0YT 2JB6B 3ARQA 2E7BA 3DUUB 4KTDL 3MZTA 4KVNH 3VXQB 4QRPA 2ZUUA 3V4VH 4POUB 3TYFA 2W9EH 2G5BB 4M1GH 1P6AB 1JPST 5IHUH 1T21B 4BK4A 3BPLC 5DXWA 5E00B 1RZJC 3JTTA 3QO0B 4K8RD 1BX2A 2FZ3B 2BFVL 1EDQA 2EYSB 1CIDA 5F8QC 1CFVH 1SEBB 1AJ7H 3IJYB 2GAZA 4X7FC 5EBLB 4JRXE 3WIFA 5SWQB 4KVNL 4MQXD 4AEFA 4XBGB 4ZFOA 1BZQK 4NRXB 1CL7I 1S3KL 2AXFB 4UV7L 2ILLA 4KK5D 1MUJB 1U2CA 4KZDH 1RZ7L 4I9WE 2OS7A 2VLLB 4BFBD 2NX5A 3AS3A 3DHMA 3QUZC 4NIKB 4Z0BL 2F74A 1J8HD 2NY2D 3PXHA 2FJFA 3KPLA 3MYJB 4CMMB 3BIBX 4ZPVA 4J4PA 4HQQH 1FLTX 3I6LE 4FQQA 5ADPH 3BYTA 4L9LC 5EBMA 1JNLH 1M7DA 1PYWA 2CGRH 4HIIB 4NO5B 3MRCA 1TVHA 3PWLA 3ARDC 5DJAB 2XTJD 5KAQF 3SEPA 1O7SA 4PJAF 5GSRA 2ZCLH 2CLRA 1NCCL 4OGZA 5D71H 1QSFE 1CFVL 4JVUA 2A0LC 2R2BA 4K3GA 3OF6A 1P7QD 5IF0A 4OZHE 5IJVB 3VRLE 4Y19D 2BNUA 1AD9B 3BP4A 2HFEA 3HZYB 2C3HA 4EBQH 1E6JL 2GTWA 4ENEC 4ZMAT 5CUSH 5F9WC 3I75A 2RCSL 3PWLB 3GIVB 4KWUA 2OQJB 1NBYA 1A5FH 2DI8A 1C1EH 2FSEA 2AAVA 4J3UA 5D71L 5MEPB 5TFSL 2PYEE 3ULUE 3QIUB 2IMNA 3MV8E 4P46B 4Y1AE 3QUXB 4OQTL 1AGBA 5D2NB 2YMXL 2YD7A 3TCLA 1S78C 1U8MA 3HC0B 4PJDE 4XP9H 2UY7A 5TDNB 1ITCA 4J8RA 4EEEA 2GI7A 3HG1A 4HGMA 3GSOB 4ZO8A 4CMMA 5CKAA 3VCLA 4CL7A 1TETL 2XKNA 1LWRA 5C09A 3QUKA 5A2LH 1BIIA 3LHPL 3P30H 1WZ1H 4GXUN 1UZ8A 5HGHB 1A4JB 2A6IA 2AJZB 2EC9T 1U58A 4EI5B 1AXIB 4NQXA 3PHQA 3GRWA 2HWZH 5ACZB 2VZTA 3GSOA 4HJGB 2Y5EA 4MVBC 1C1EL 4OCMC 3ARTA 4O2CA 4MSWA 1L0YA 1I9IH 3LN5B 4LSDA 5F9JA 2R8SL 4ZAKC 1GGUA 3VXQA 1SHMA 5CUSL 5E6YA 5C0BB 4ELKA 1TTFA 4ZXBA 3O11B 4PRAA 5EOQL 1NDMA 3BQUC 2JIXA 4JFFE 1FZMB 1H3PH 3V6ZA 4KTDH 3UTSD 1K3ZA 2BOCB 1J05B 2Q3ZA 3LKNB 3UJTH 1Q9KA 4PJFF 4WFFE 5F88B 3WNLA 1QFWL 4X4XA 3RAJL 4JRXA 4S0SD 4YBQC 4KI5F 5IB2A 3QXDA 5E99L 4JG0L 1WC7A 1CD9B 5GGTH 3WO3B 3RY6C 4KMTL 4HIJA 2EE9A 2PF6A 3MV9B 3RWIB 5FOJA 2X10A 4KPHH 1GGCH 4M61A 1VEOA 4NO5A 3X3FH 3GSQB 3KHQA 2DLGA 2VC2L 1OCWL 1OLLA 2Q1EA 2AK4E 4HX1A 1YJDH 5GRVK 4D0CB 3BKYL 3IJSA 2E6PA 5ALCL 2VN7A 1MCSA 4IEFB 5A2FA 2E9JA 3MRMA 4TUJA 1UM4L 1J87A 3JVGC 5DYOA 3VGAB 4JQIH 1WZLA 2QTEA 4RA3A 5FGBC 3RZCC 1J0JA 2R29H 1JPGA 3QDHA 5H94B 3Q48A 5CIPA 3V5KB 1H3PL 4PY8J 1LNUB 5GGUA 3JZ7A 1PG7H 3RWHB 1OWRM 3MQIA 4LEOA 2G9HA 4LLMB 5HYQB 3ARED 3RTQB 2Z91A 2V5YA 1FZMA 1UZ6F 4Y4HA 5E6IA 3V6OA 4LLYA 1P5UA 4RMSA 4ZNEA 5D70H 3UC0L 1NEZG 3WIHA 4XP6H 1D7FA 1WZKA 4JO1L 5F9JB 4NZRL 1JI2A 1KTDB 1CDJA 4YHPA 4KXZH 2JKXA 1QBML 5HYJA 1V3KA 4X99B 3T0WA 1NSNL 4X5LA 3OKKA 4GO6B 3OPZL 1E6OL 2CDEB 2WBJC 3DX8A 3MJ6A 2Y7QB 3QCUH 4EI5A 3SE3A 3EDJA 2BMKB 3LN4A 5CP7A 4DGVH 1OCWH 1ZHBA 3PP4H 3OHXB 2R2EA 3H9SA 4HKXA 1FYTD 5IR1A 3V6BR 3AM8C 1Z3GH 4JG1L 3FB5B 3S35L 1BIIB 5HD8C 2O5XH 2E7CA 1IT9H 2GJ6E 3RDTC 3TO4A 4X7SH 1G1YA 4LVHC 5MHSD 3LRSA 1IKNA 1BM3H 1T1XA 3SKOA 4PJXE 2PW1A 4H88H 5IQ7H 5EU6E 3SGDH 2GT9B 1QR1A 3UO1H 1UT9A 3G6DH 3P30L 3GMPB 1S5HA 3VGEA 1A4KB 1NFDF 3QH3A 4YFLI 3I3EA 4UMGA 3ZYZA 3D39E 1F2QA 5C6WH 6FABH 1DN0B 3RY5A 1LD9A 3KPOA 4KRMB 5SWSA 5C92A 2AV1A 2VAJA 5JHDB 1CDGA 3Q3GB 4D3CH 1A0QH 1AO7D 1F6AA 2BY2A 3TBWA 2E9IA 2EYRB 2QSQA 3UYOD 4OZIB 2YR3A 4RZCB 1KGCD 1M71A 2HRPL 4S1RH 5E2UL 3PP3H 3R1GH 4R4BA 4QXGL 1WLHA 4Q9BA 4UT7H 5TE6L 1CDCA 2X9WA 4QOKB 3P77A 3TJHD 1S7SB 1JF1B 3FT2B 1OM3L 5EOQH 4I77L 2JJSA 4R7NA 2FB4H 3AU1B 4ZUSB 1QO3B 1ZVSB 1T1XB 4YHOH 3PABB 3CZJA 3S8WA 3L3JA 3KJ6L 3D6GA 2CK0L 4HF5L 3SN6N 1NCBL 3DROA 3RGHA 3MYJA 4PJEE 5HPMA 2EEDA 4LVNC 3U6RA 4HS3B 4A6YB 3QUZB 1OSPH 3MJ8A 2P5EB 2HN7A 3D3VB 3VWKC 1OAYH 4MA3B 1KLGA 4BH8A 5ANMA 4KZEL 3H7BA 1I7UA 4YHPB 3VD3A 4LRNH 1N3NA 3GMQB 3F12B 4L9LB 3JTTB 1JYXA 4N0RA 1BFSA 2O5ZL 3W0WB 2J8HA 5D8JL 2VZUA 3EFFA 1NPUA 1OGAE 4G6FB 4S1RL 1R3IH 3R1GL 5FO7A 4LFHG 1RUAH 5EO9A 3IS0X 1RUKH 2GJ6B 4U1JB 4JRWA 2NY4B 4XNMA 2ZPKH 3P4LA 4TULH 3S36H 1JUFA 3PF2A 2FH6A 1F90L 3ARBC 4LKCA 1FL5A 3V8CA 4GMTL 4PJXB 3LRHA 4JKWA 5INDA 4YGVA 3CFDA 2P5WB 4LPYA 1B88A 1P84J 4YFEA 4X6BB 2Q87A 4RFOH 4MDJA 3SDDA 3AY4C 4EZMA 2WW8A 4GW4A 4GMSH 1DVFC 2H9GA 3EJYC 3QCTL 3D39B 1FORL 1FAIH 3DNKA 5I1DB 3X11B 3CCHA 5FM8A 1IJ9A 2HT2D 2E8YA 1RU9L 1MCQA 5T1MA 2YXMA 5L9DL 2EDBA 1UJ3B 2I25N 5HD8D 5F71A 5BVPH 3CLEH 3G08B 1EO8L 5H8DA 1AY1H 2IAMB 3HR6A 3SKMB 3GUTB 2DJUA 4Z7QE 4B0MM 4QEGA 4O2EA 3LEVH 4X7TA 4R26L 3VXRA 2QQNH 1SJEA 4JO2L 4ODVL 2P4AB 3OWEA 5I1AA 3MSPA 3MO1A 5CHNA 2NMSA 4PJEF 1OP3K 4IHOB 5GRXG 3THML 1F02I 3G6DL 2GYSA 4HJJH 4LLUA 3BH9A 4DVBA 1I4FB 4GS7C 2FX8H 5DO2D 4WFGE 4BQBA 1ZEAL 4U31A 4RGNB 1FN4B 3S98A 4PJ7F 4XVJL 1L0XA 3UJJL 2C3WA 1KJ2L 4NGHH 5KZCD 2X4UB 3BE1H 1QQDA 3G5ZA 5IVOA 1KEML 2VLRB 1ZT1A 3ELAT 3LIZH 4ONFH 4GLRI 4EUPB 4YIQA 3E0GA 3LCYA 4YO0A 5T3ZL 2C1PB 3MODH 4Y19E 1HCFX 4YXHL 1C08B 1UZ8B 4G3YL 4NUJA 1OAQH 3E1F1 4M6OL 4YC2C 1TQCB 5GPRA 4MDIA 4G8EB 4PV9A 1GPOL 2F5AL 4Y2DD 3KJ6H 3KS0H 1QVOB 2BY1A 1U8OA 2GSGB 4JJ5A 5HI3D 3UEZA 4K2UH 1EO7A 3FT3B 3HAEB 4L4VD 5C0AE 1S8DA 4AMKL 4P4RA 5TE7L 4APQB 2F19H 2K1MA 4I8DA 2HP4A 4XP4H 1I3GH 2OTPA 3ZZ1A 3B5HA 4PJGE 3GI9H 1PD6A 3CFEA 3VFRA 1CL7L 2OTWB 4I18B 1JP5A 4MA8H 4U1IB 5DJDB 4U0QB 1NDGA 3PL6C 4XMKL 4EVNA 1J12A 3W39A 1H8SA 1F4XL 4OZIA 2G2RB 2YD2A 1S7VB 2VE6A 1QLEH 3IDUA 4HCRA 3GRWL 4PB0L 1RJLA 5FKAA 2HMID 3MUJA 2P8LA 3FTGA 3HN3A 4R97B 4GW1A 1TVBA 5JQHC 1VFAB 1CIUA 3DXAB 3SGKA 3ABZA 1F45A 1FPTH 1JIBA 1A7OH 4M43H 4KKCD 2XPGA 1R3IL 1NC4A 1IAIL 2HVJA 2XFXA 1F58L 4GRWF 4BKLB 4PG9A 2BNQB 2GITA 3MJ9L 4O4YL 4JFYB 4HH9A 3RX8A 3VI3E 2GT9A 3PQYB 3CFIC 1KCSH 4IDJH 4OZGA 2NZ9D 4P2QE 5TGBB 1PQZB 3T09A 1MPAL 1MFBH 3FFDB 1DBJH 1RZFL 1LMKA 5HSFA 1FL3A 4TYUA 5JOPE 5DRZA 5C2UB 3OB0K 2PTUA 4C57C 2H2SC 4IMKA 2IGFH 3T65B 3QXTA 4X8XA 3QQNA 4NBZB 3RWCA 2YPLD 4QCIA 4YBLC 1AQKH 2BMKA 3LN4B 5MENB 2WINA 5JIHA 1MPAH 1H3UA 1HZHL 5I19H 2CXKA 4HG4J 4XZUB 3L3HA 2BJML 4PRHB 4OLZH 1CK0H 4LEXL 1FVCA 1FAKT 1G1CA 1F58H 1MCLA 2HTLC 4OGAD 1BGXL 4LDLB 1Z0NA 2P8LB 3FTGB 4K3EL 1MCJA 2VABA 4N0CD 1FPTL 1RY7B 3DUUA 4GUPA 3HNTH 4KKBC 1Q38A 4KI5E 5IMLA 1CD8A 3HMXA 3RL2A 1EAPB 5C0CB 3DX9B 4ODTH 2CIKA 4L4VA 4HMCA 4CU8A 1ZT7B 4AEEA 4IJ3C 4PJ9D 1TNNA 4APQA 3EJZC 3EOTH 4QGYA 2FGWH 2F53E 1BQLL 2FLRT 2R4RL 1LO0H 4FP8H 3EGSB 2ADIA 4CUCA 3L5WA 4BJLA 4EN3C 2WANA 3WFDH 1Q94A 1R0AL 3KDMA 2VIRA 1I7TB 1MJJA 4GRWE 2JJVA 1IGTB 2YRPA 3E6HB 4JPWL 4CN4A 4JPKH 4MDIB 3U9PH 4ISVB 5TH2B 5CINH 4F37F 4NJAH 3MV7B 1CK0L 4G3YH 4JFDA 4BK5A 3TP4A 1OP9A 3G6JA 3ZT5A 4KPHL 4M6OH 5GRUL 4RMRA 5FYJD 5IB3A 3U0PB 2X9XA 1WV7T 3QPQC 4G43A 3BZFB 4YIQB 4X9HA 4WWID 2H2PC 3W9DB 4JY6A 4XCYA 4OZIF 1SY6A 3A6BH 2CUMA 1GZQA 3ULVE 3BJ91 3DVNA 2BXZA 3W9EB 3RPKA 1LK3H 4P2QB 1T2XA 5TQ2L 3U46A 1AE6L 3KLAB 3PL6D 4LNVA 2MJWA 5DHVH 4PJDF 1QFOA 1XGPB 1S9YA 3F7QA 3WDHA 3UTSB 3O3UN 4ZAKB 5GRJL 5HYJE 5EZJA 4TQEH 5I9QC 5CJOH 2X70B 4M7LL 5E9DA 4X4ZA 3D85B 3OSKA 4XNUH 5LXGH 4MD4B 3LS4L 3E6FB 3T2QA 2AI0H 3VFVB 1YEIL 1IEAB 3ARWA 3MJ9A 4JY6B 2VH5L 3PHQB 1XGUB 5SWZD 2Q76B 3QIWB 3RNKA 3FRPG 1V7MH 3PWUB 5IQ9A 5A40E 3U0PA 3SBWC 2HLFD 2F53D 1SJHA 5KS9B 2APXA 1BZ9B 3FAWA 3U82B 3VXSD 2IBGA 4UNTA 4WGVB 5JQ6H 2SEBA 3PNWB 4KUCF 2OZ4H 5DK0A 4XPAH 3WYRA 5J0BA 1HQRB 2WUBH 1FG2A 5DC9B 3V6FB 3HC3H 2YD1A 4HXBH 5IGXH 2V7NB 3SDCD 1I7TA 1MJJB 1RI8A 1S5IL 3T3PF 2BY0A 4P9HL 1FZJA 3QNYB 4KJWC 4LMQI 3SGEH 3WBDA 4ZUWB 1D5BB 4PRHD 5ADOH 3C8KB 3L3IA 1FFOA 5ISZB 5C07B 3S37L 2XN9E 2HJFA 4AQ1B 5HPOA 2APTA 3BUYB 4IRSC 3M1BB 4OI9A 3LPWA 4KQ3H 5KVDL 3BD5A 4AEHL 2D03L 5IP4A 1SYSA 1C5DA 4ETQB 5BJTA 3DMMC 1N5YL 1NGWA 3QDGD 3QJFB 4LPWA 2C3GA 3DTXB 1T7VA 1D3CA 1RUML 5F7DB 3CDGB 3KLDA 4FXGA 5F9OH 2FR4B 4Z77A 1ZLUK 3W0WA 1W2KT 2JJTA 4H5SB 2Y5TA 2WP3T 4PJ9B 3G04A 1DL7L 4RGNC 4WWKB 4BFGA 3F7VA 5F1OB 5I16B 1SVCP 3QO1A 5LGKA 4M7JH 3IF1A 4MB4A 4CVUA 2W9DL 3EYFA 4KKAD 3LKRB 1J1XH 1MRFH 1YJDC 1ONQB 4FQQB 4P2YA 3RWJB 4OB5L 1G7HA 4KQ4H 5GGSY 4A6YA 3PE9A 3QDJE 3W82A 3ULUL 1Z9LA 4UBDD 4MB5A 4OUUA 4LQ1A 4F15C 3MFFB 3SOBH 3IRPX 1T66D 3MLSL 5DJZA 5CP3H 4J4PD 4CMHB 4LOUC 2A38A 4M93B 1S7WB 3GHEL 1CU4H 4V2CB 2VDMH 3T1FA 5D2NE 3AMKA 2FECL 4YR6A 1S7RA 4R7NB 1U9KA 2PYED 2PNDA 1MJ8L 5DUMH 5DMJB 3OG6B 4NUGH 1VACB 4G5ZL 3VXNB 1BVLA 3V6OE 2VDLL 4BFIA 3G04B 4M02A 4J3TA 5T5FL 1DQLL 3PWJA 4R8WH 4XP1H 4X4YB 4M7JL 3LS5L 3K8KA 1EO5A 3DRTB 3B2UD 4YBQD 3GM8A 4QF1A 3NPZB 1NEZA 1XGYH 4LHJB 5FO8B 2FGZA 5TF1H 3S37X 1YNTA 2VLJB 4N0YL 1G7QB 4PREB 4R3SB 1BHGA 3MLSH 3QUYA 2OTWA 1QFHA 2BVQB 3Q5YA 4PJ5B 2A6DB 3OKEA 3PV6A 1U8KB 3LEXA 4UB0H 1FFOB 3UCRA 5KVEL 4ZFFA 4GAJH 1BGXH 1SBSL 1I75A 3BT2H 2PTTA 4MXWH 4LFHD 2KPNA 4F57H 1FNSH 4PJIE 2QSTA 2VQTA 1WICA 4XCNB 5IHBA 5GZNC 4OD2A 1JWSB 2FGWL 4B7LA 4L1DA 1XF4B 3ILPB 4PRIB 1XIWC 3KJ4B 5DA0B 3IU3A 3UYPA 4R2GD 1E4WL 1DFBH 1DANU 5E03A 1TFHA 5BV7B 4I0KA 2YD9A 3BT2L 4FQJH 5IIEB 4F57L 3KPQA 3IDGA 3UJTL 3ULVL 5CINL 4X6CA 1N59B 5F6HI 2Q76A 1Q72L 2WQRA 4I3GA 1T04A 4S0TD 3OKKB 5GHWL 1YUHB 1AGFB 2DL2A 1FFPB 3WFBL 2P8MB 4QGTA 3QEHB 1QZ1A 4YDKH 5F96H 1CGXA 1UCBH 4MAUL 5FYLE 1EGJL 4NOBA 2UYLA 3SDXE 4LGPB 1YPZF 1P9MA 5JW4M 3MRNB 3P40A 5KOVC 3QDJB 1KJMB 4X6EB 2R0KL 4ZAKA 1NMBL 2X40A 5JZ7C 1VSCA 4JO3L 3QUYD 2J6EH 1JZ3A 2IFFL 1ZXQA 5L8KB 3S35X 5KW9L 4LAQH 4YDJA 3W9EA 2BCKB 2EDWA 5CEXA 5BO1H 2YPKA 4C59B 4MQ7A 2GFBA 5ID1A 2YA1A 2UYLB 5EO0B 5T1KA 3OKYA 3HZVB 2VNCA 4G80B 4JGUA 5KVGH 3PJSB 4KHTL 3QUZD 1T2JA 1AGFA 1AC6A 1CICD 5EU7C 4JZOB 4NNYA 25C8H 4U7MA 5DJ8A 4WW2B 3K81A 3CFBB 4X80H 4UU9A 3B9KD 3DURB 2W9DH 2IAMA 2HLFC 2NY0B 1AXSA 3MV9D 3VXUB 1YEFL 1BD2B 1Q9WB 5C0IB 2ITCB 1S7XB 4G6ML 4KHTH 1A6UH 5GS0C 3L9RB 5HBBA 1JWSA 1FO0H 4TUOB 5DSCA 3HC4L 3PV7A 3TZVC 1MRCH 2GW5A 5JXED 4LAQL 4OCYL 2R39A 5BXFB 2I07B 4YXLL 1U8PA 4XBPB 1IC5L 2BVQA 1SYSB 3IDYB 3OAUH 1A6WL 5ADOL 1XFPA 2EECA 3WSQL 4P2RB 4RSVA 1RUQH 4W68A 1PSKH 4OUOA 2HKHH 4HHAA 3ZLQC 1RJCA 1IC1A 3N1FC 5T5FH 2O61A 1BJMA 32C2A 4Z9KB 2FX7H 1R5WB 2NCMA 3WCYA 1MAMH 4PFEA 4L9DA 5JW3H 3HS0B 3Q5TA 4ZODA 5I71B 1U8QB 4LPCA 1C5BH 5GGVL 2MSPA 1DSFL 4BFIB 5IHZB 5KTEH 4GQ9H 4P9MH 35C8H 1RQ5A 1C16B 3U36A 2L7UA 2APWA 5DT1L 5INCB 4QCIB 4JZJB 4UQ2B 2WQ8A 4WTZG 1HOCB 4GRLA 3PGCA 3T0ED 5E94A 5IJKA 4JRYD 3NN8B 5FOBA 3SE8H 4PBWD 4XAWL 1A3QA 2LE9A 5DD5L 4PV8B 4WI5A 2C1OA 2ZCKL 4PTTB 2RFXA 2VDOL 3D85A 4OZGB 4FG6D 5IMKB 5ID1B 1IAII 3N1MC 2LAAA 3I9GL 4JEGB 1LEIB 3HRZB 3I6GB 3L7FB 5T33H 3MBXL 2BCKA 3ULUH 2YMXH 1QSED 3LOWA 1D5ZA 2D4DA 3IAQA 3MREA 4OM1L 5CMAA 5I16A 4G8FA 1NCBH 4JE4B 1A7BA 1KJMA 4X6EA 3O4LA 5FHAL 5BS0B 2HFEB 3HZYA 1ORSB 4LSTL 3QI9C 3B2UC 4FXGB 5GGQL 3VXUE 4H26A 1PX3A 1EGJH 3WFHA 2VQUA 3M17A 2DF3A 2OSLA 4NKDB 4XPFH 3NOIA 4PRBA 3QR2A 1RZ8A 1UH4A 5J7CC 1WFOA 4OGYH 3KAAA 2WV3A 3MLYL 5KJRL 3EYVA 1DEEA 4OLXL 2DKSA 1TJHL 2F15A 3SE8L 4MXVE 1QSEB 4QRRB 2FJHB 2CGRL 4XVTH 5CBEB 4N90E 3TWCL 3W0WE 1GCFA 4M7KH 5E5UB 3RJDA 2LTQC 3WEXA 2O5ZH 4KU1A 4YHYC 1BVKA 4FOMA 1Y0LA 4K7PX 4HWNA 5IMOB 1UWXK 4TSCL 1WBYA 4D0DB 4M1DH 1SBSH 1B4JL 4HJ0D 4BQCA 5IB4B 2XT1B 5IEHB 3P2TA 2Y07L 3IFLL 1U8JA 4M1CD 2ATKB 4F7PB 4PJ8A 5CSBA 4P3CH 2IQ9L 1JV5B 1MUJA 2XG4A 3T0EB 2JTDA 4FQLH 2XA3A 1G6RL 2IANA 5D9SB 1JHTB 4QRQA 1R5IA 3VRLF 5CP7B 5GS0L 4ZNCD 3N85H 4DAGH 4Z5RB 1FNFA 2FEEI 1T1ZA 4GMSL 4OGYL 1T20B 2A9NH 4NZUL 1CE1H 4JLRA 4OLXH 3VE0B 1YDPA 2CSPA 1AD0A 3WD5H 1ORSA 1HWGB 4PJAA 3KNBB 1XT5A 4YFDB 5I1CL 4TSBH 3UTSA 4WU7A 5D1ZC 3DVFA 3GO1H 2X4RA 3U83A 1KNOA 5GJTH 2X4TB 5F3BB 3C6SA 5EU3A 2PXYD 1P53A 1UQSB 4JR9L 2NLJA 3ARBA 5LKNA 3DVNB 2J8UF 2HWZL 4QHUA 4ZPTA 2R29L 3BN9C 2DWDA 2BC4B 4FTVA 3D0VB 4V2BA 1RJZA 4XC1L 4ZO9A 3V52H 1JPGB 1MH5B 3LZFH 3UDWC 1PG7L 2XTJE 4MNGE 5J11B 2VDKH 3UPRA 4J3OC 2GCYA 3UJIL 1I85A 1CBVH 1MCCA 2CMRH 3A67H 4JFHE 4F9PA 4D0CA 1HE7A 3RZCD 4Z76B 3GBML 2QBWA 5BO1L 2HAZA 3RWJA 3RJQB 1KJ2H 1JMZA 4NCC2 1K5NB 1G7LA 3BVNA 4K8RL 2CR3A 3LQMA 4WHTA 1A1NB 1QYGL 3ARYA 2KQNA 2VIRB 1KPUB 3WLBA 4HDIB 4NZUH 4MDJB 1UJ3C 4ZAKD 5BW7A 4YQXH 4NP4H 5TE4H 2UVEA 2DQDH 2QKIA 2Z31A 1VFBB 3L3KB 1E4KA 2RHEA 3HI1B 1CLYL 2DRUA 3GSVA 4O2FA 5BMFH 2Q3AA 1J05A 2BSRA 1YECL 5EC2A 3TT3L 4U1JA 1WT5C 1P6FA 1A6UL 4F3FA 2HTLD 4OGAC 2OLDA 3O45B 1CLOL 3WFCL 5H37G 3OKMA 4NP4L 4OZFA 3DMMD 2V9RA 2GEEA 5BOPA 3U36B 5C9KA 4L1HA 1AFVH 4PRDA 1N3NB 2P7TA 2F19L 1U8OB 3P11L 1YEKH 4HDIA 2A83A 1JHLL 3KGRA 5KSAD 2BVPB 1ZGLP 1KC5H 2ITDB 4CDGC 1GAFL 1INEL 5DRXA 2J5LC 4CW1A 4P5KA 1R3LA 3NMEA 3V7AG 3RIFK 1IGFL 4TNVF 3IETA 1LQSR 1ZHKA 2B4CH 4I1NB 1F3RB 1L0QA 4JZOA 3NCYS 1ZLVK 1FGNL 1JBJA 3QEUA 4U1LB 3SKNB 4AK1A 2YKLH 1NCAL 2EIEA 5F9AC 5JIPA 2VLRA 5GS1C 4M6NH 5FGBA 2IALA 5GISH 5T3ZD 4E42B 3UAJC 1EPFA 4QHUB 2D3VA 3SOBL 4CN6A 2Y07H 1H0DA 4KVCL 1MCPH 4D9QE 5C0BD 1D9KA 1PW3A 2X4TA 4CVZA 4Y5VB 4E41A 2YD4A 1WWWX 3S88L 4M7ZB 4H1LH 2H8PA 3NPSC 4DVBB 1KB9J 3KPRE 5DUBA 4FQIL 3LEYL 1T0NA 4PS4L 5D7JC 1BD2A 1JGVL 3TBWB 5I30H 4L4VE 3HI6L 4LU5L 1AFVL 2NW2A 4ZQKB 4DJMA 5E6ZA 2MQ0A 1U8HA 1BLNA 1S7VA 2VE6B 3VXOB 4TTDC 1ZA6B 4Z5RA 2OBGA 3ULVF 3FQXA 1WJ3A 4I0PD 5C0DA 2F54B 8FABB 4N1HB 5B39B 4Y1AA 3VFSB 2XY1A 4WHCA 4LASH 4PJBA 3NZ8A 2X44D 5K9OB 3ZO0A 4BZYA 3RIAF 2R1YA 3MLVL 1WSST 1TETH 4OD2B 3B8YA 2LV4A 4TOYL 3H8NA 4R96A 4XCNA 1NCAH 2WBKA 5A2KH 2XZAH 4UV4L 5I8KH 3QDJA 4DGYL 4X6CE 5IBTL 3NFNA 4QO1A 1P7HL 1TLKA 2ZJSH 5F7WC 2QR0A 2P8PA 1QLFA 2UVFA 3I50L 3LD8B 1EAPA 5C0CA 1G0XA 5ANME 1FNEB 1KELH 2VUYA 1MHEB 3FB8B 3HRPA 4KJYB 3LMJL 1JGDA 4GRWB 3GSUB 3S36X 3RNQA 1FL6A 2FJGA 1ZT1B 3UPAA 3B3IB 4FZEH 5JOEA 3D2UD 1MIEL 4IM8A 3NFNB 4TNWK 5E00A 3IAGC 5I1JL 2CH8A 5D70L 1CFQB 4D9RE 4JQVA 1PY4A 4U49A 1HIMH 4HG4K 4BH8B 3MUY1 1L7TL 1ZLWH 1F42A 3RTQA 4Z7VE 2C3XA 5GRWA 1UACL 4Y5YB 4Z7NE 1N0LA 4KZEH 2QQNL 1XZ0B 2BRRL 1ZSDB 3H9SD 1SYVA 3QNZA 3BW9A 2R0ZL 2A73A 5IROC 1NH6A 1JGEA 5IW3A 1MI5D 3MNWB 4Q2ZA 1II4E 4HS8H 4KI5D 4NQDD 5AWNH 1FL3B 5DDHB 5IBTH 3QQ4B 1Q1JL 4RCAA 1XF2B 4GQPH 5DD1H 1ERNA 1NL0H 2VZVA 3RPIB 2FX9L 3FKUS 4PJDB 3STZA 1AO7E 1T22B 1OP5K 4PJ8C 1K2DB 4KK9C 3P77B 4S10A 3X11A 4GMTH 4OF7A 3PGDA 3BZDA 3OJVC 4AM0B 1EEYA 5CGMA 4PRNA 1FSKC 3O6KH 5IB5A 1GGCL 1H8OA 1T2QL 4K7FB 2DAVA 4FMFA 3B9AA 2IALB 3FOMA 4LQFL 2FHBA 3LD8C 4KMTH 4ZSOE 3QQ4A 4RGOL 3SDAA 4PJXA 4PJ5D 4RWYL 3GK8H 3C08L 4CNIA 1ADQA 1Q9OB 3S96B 4XB8A 1JTTA 4ESKA 3C5ZD 4Z7UE 4R0LC 4HWZA 4PJ7B 3BXNB 2RAMA 1CXFA 4P5TB 1EEUA 3QH3B 2GJ6D 2HJFB 3O6KL 3REWB 2A9MH 1S5IH 3QJHB 3EDFA 4M4RA 5C3TA 1CR9L 4NO3A 4O2CB 2VDRH 4DUVA 5ISZE 4XPTL 3QNXB 4G7YH 5FA3A 2X2YA 5CGTA 3QWOB 3ES6B 4DKEL 3RHWF 3SDAD 2AJVH 4C4KO 2FBJL 4G6JH 2XACC 5D7LD 2AJZA 3H9SB 1H3TA 4OTXH 1QHOA 1V7NH 3VXRE 4DCQB 5J9PB 3L5XH 3ARPA 3F6IA 1KENL 1MLBB 4P2CG 3U6RB 2CDEA 3DX8B 4LRIA 4X6DA 3RKDC 4QHKI 3HE7C 1JHLH 5T3XH 2ZZUT 5F7YC 2R1WB 5KAQG 3O4OC 3NAAH 3OKDA 5FDWA 3QCUL 5K59E 3QUXC 3AXLA 4TNWF 4ONFL 5C07A 2ZUVA 3HC0A 4XVUC 3SDCB 4DGYH 2A9ML 2QKIB 2Z31B 4XVJH 2FIKB 2MWCA 5DO2C 2A1WH 3TN0C 4JFDD 3GHBH 2EYTB 1EJOH 4JQXA 4Y4HB 1MOEA 3BGMB 4UNUA 4JZNB 2YKLL 2FCBA 4FTVD 2AGJL 4U6HB 5HYJD 1I8LA 5B4MD 4HBCL 3LH2H 3V5KA 3GSRA 1VDGA 2IEPA 4P2OA 2GHWB 2EZ0D 2MKWA 4TTGA 5D4QA 3MRFA 1BF2A 3PWPB 1FCGA 4C56D 1XGUA 3KYOA 1ZHNA 2E7HA 4KKBD 3NIFF 5EU4B 1XIWD 5EORH 1KCUL 5EO1A 1U95B 2IG2H 3MBEA 3BPLB 4FQHB 1F4WL 4XP1L 2NPLX 5F3BA 4Y16D 4PG2C 3WNKA 4ZPVB 3ZE2F 43CAB 5KSUB 2GJZB 1OAXL 2MCPH 3MV9A 5GZND 2W07A 4IBLT 3TIDA 3T1WA 1NJ9B 1EVTC 3WDJA 4ZFZA 1K4CA 1YNKL 5F6IB 1A22B 2DMKA 2XZQL 5DMIH 3SDDB 5JW5A 3AY4A 3FB5A 2FB4L 1ND0A 4X4XB 3TNNB 1FSKB 1Q1JH 3DX7B 5HYEA 2MFNA 1BOYA 3NVQA 3V6ZB 4L4TE 5TE6H 3LN9A 4BSVB 1JUFB 2WBWB 3SCMA 1I8KB 1ZHKB 4P59L 1F97A 2VLKD 3VFPB 3TF7C 1ETZA 5EU6B 1A7RL 3WO4C 4GT7A 3EJJX 4NM4L 4PBXA 2Q8AL 2VL4A 3U30B 3OZ9H 1MHPL 4OM0H 3NPSB 2IQAA 4XZUA 3C5ZC 4MYWB 2A83B 2ZPKL 5HGBB 1IEHA 5CBAA 3O6LL 3CFKB 4PJHF 1FO0A 1QACA 2NX5D 3KJ4C 3QQ9D 1L4IA 4POZD 1A4JA 2A6IB 3RWHA 5F1NA 3T65A 4K7PY 5JOPD 3VH8B 5H94A 2G5RA 4UT6H 4LKXB 4UZGA 2HRLA 1G84A 4P4KB 3RVWD 3MTRA 3RZWA 3HZMB 2YUVA 2VC2H 4NRZA 2Z8WC 2HJKB 4X9FA 4JPIA 2COQA 3L3KA 3H3KA 4XHQA 2CLZB 2DM4A 1RJYA 5IVZB 3VD9A 3V4UL 1L6ZA 2Q8AH 2Q86A 4W4NA 1KTKE 1GHFH 1KPUA 2X4NB 4JREB 4FABH 1EGJA 3ARRA 4ZS7H 4D94A 3WUZA 2C3VB 3K4ZA 4XNUL 3QIUD 2J88H 3EJZD 3L7FA 2G60L 3OAYK 4NKIH 1I3GL 2Y72A 2XV6B 5MEOA 4L8SA 1EMTL 4HIHB 5IVXE 4U1KB 2HT4C 3RWCB 1FGVH 3UBXG 3MRHA 5IJVA 1LP9A 1JRHL 4W6WB 3WL9A 2P5EE 1BD2E 3A6CL 2W0KA 3QJFA 4XAKE 4XPHH 1A7QL 3NTCH 4KROB 5B8CB 4LCUA 5SWSB 2CRZA 3HE6D 2Q7NA 4PGCA 2HFTA 1NC4D 3V5HB 1AIFB 3GHBL 3B9KA 1OQXA 4NKIL 2DWEB 4TVPD 3WJJA 3PQYA 1S5HB 4FFYH 5DJ2A 3TA3A 4XCFL 4ZUWA 1F11B 3ARGC 3GSNH 1LE5A 2NXYD 2GITB 4XH2B 2R1XB 4Y4HC 4GSDL 3MROB 5C2BH 2JJTC 2XRAH 4WHDA 3HG1E 3CVHH 4I2XB 1GHFL 4M1CC 4DUXA 1CGVA 2QHRL 2H3NA 2FD6H