1C5DA

The crystal structure of the fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPPSLSASLGDKVTITCQASQDINKYIAWYQQKPGKAPRQLIRYTSILVLGTPSRFSGSGSGRDFSFSISNVASEDIASYYCLQYGNLYTFGAGTKLEIKRADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSSPVVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY AGAINST THE MAIN IMMUNOGENIC REGION OF T
publication title The crystal structure of the Fab fragment of a rat monoclonal antibody against the main immunogenic region of the human muscle acetylcholine receptor.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 213
sequence length 213
chains with identical sequence L
ec nomenclature
pdb deposition date 1999-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5dA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1c5dA01
3SE9H 1W72H 1T2QH 1YY8B 4XZUB 3AVEA 1KT2B 1OAXL 3MYJB 2QHLA 5JOEA 4BSWA 4LEXH 3W2DH 4XVTH 4OB5H 5ACMA 2G5BA 2Q8AH 1OOAA 5DJAB 3JVGA 5IROA 5C08E 4N0FB 5F21B 2EDEA 4KROD 2ZP0T 4N9GB 3KPLB 2WUCH 4NO5A 4OZFG 3VGFA 1QRND 1S3KH 4X4ME 1H3PH 1FL5A 4L4TA 3OJDA 1IAII 4LSQL 4QLRA 2VITB 1QRNE 5ISZA 1HN1A 2VZ3A 5IOPB 3BN9D 3MUGB 4ZQKA 1DBML 2B2XH 2FNBA 4KXZI 1FNSH 1XF3B 1A4JA 5JO5B 2R1XB 3UDWA 2DLGA 2VLJB 2X6MA 3EJJX 3SGJC 2VXTH 4NQED 5IBUG 3U83A 3VXPB 4YXHH 1N2RA 5TQ2H 5J13B 1NAMH 2HYMA 4JO3L 1P7HL 4NQEE 3FZUC 5EOCH 2GQHA 2J8UF 5I19H 4Y2DB 3MV01 2NNAB 2XTLA 4HKXB 4H88L 1EMTH 1WK0A 4R90L 4PREB 2BY0A 3TN0B 1OQXA 2R4RL 2GFBB 3MX0A 5IT2L 5J7CC 4F7CB 4YHZH 4OZFH 3BXNA 4UTAL 3B9EA 5KSAD 1SBBA 1VACA 1YMMB 5DWUL 1R6VA 1EZVY 3TIEB 2RIKA 1MJUH 4YHIA 4UNVA 1NGXB 5DJ8B 3H7BA 3RTQB 4WW2B 3W0WA 2R1YB 5F9AC 4MA3B 4LLWB 1S5HA 4BUHA 1L6XA 4UQ3B 3U0PB 1S7TB 4N0YH 5TJWK 3BKML 2HJFA 4RAUB 4IIQA 2ARWA 3P4OA 5L7XH 4RFEB 5AAMA 4IHOB 5E5MA 4OI8A 4I4WB 1A2YA 2W91A 2NY1D 4IMLA 4UTBL 5E7FA 3WFHA 4MXWL 1DQMH 1S7VB 3EJZC 3SEPA 3FO2B 4QYOA 3N1GC 3CDCA 3RBGA 1HOCB 4HS3B 5EO9A 2GYSA 4KDTA 4PYHA 4QXGL 4WWKD 3VXRE 1OAYH 5HHOB 4ERSL 5CEZL 1A22B 3K1DA 4GAFB 4CVZA 3DVGA 5EZIH 1TIUA 4U1LA 5C09B 1YPZB 4P4KA 4UT7H 3IDXH 4HAGA 1JHKL 3HNSL 5I71C 5D96B 2AV1A 2ZUYA 3AB0B 4LCYA 3GRWL 4PJ8A 4OLZH 3LEVH 4XP6L 2Q6WB 4X99B 4PG9B 1YY9D 2PYED 3QUXC 4W6YB 1T22A 4AMKH 3UC0L 2J88H 5ELIA 2PYEE 1UZ6F 5HDBE 3P30H 1GZQB 1ONQA 3CK0L 4CMHC 3RNQB 2YMXL 1U8HB 4R97B 2V17L 4Y5YC 5DC4B 4L8DA 1MRFH 1DANU 1T3FA 3ZKSD 3VFOA 1B2WH 4HFWB 1BX2B 2ZZUT 4D0DA 5BXFB 3OKOA 1CK0L 4X6CA 3ROLA 3FB6B 3ULUF 2M26A 1QLRA 5DJYA 1JCKA 1FORH 1RIVH 4HJGB 4WTZA 1NGQL 3TBYB 5IB1B 4Y5VC 2OTPA 3HZMB 4YEEA 5HI4D 4LCCA 1D5MB 5GS1B 3B83A 3GSNB 3RY5A 1MJJB 3S35L 1KULA 3PGFL 3DVNA 2QSTA 5CWSA 3MRQA 1IM3B 4H5SB 5LAXB 5MI0C 1A21A 5F7MC 2FL5A 3H2WA 5DT1H 3CLEH 4HPYH 3WO4C 2VDOH 3W11D 5T1MA 1T1YA 3BWAA 3QQ3B 1NMBL 3DX8B 1I8IB 3FB8A 4Z7VA 5JQ6L 4QRPA 5EIIB 1OT1A 4LPWA 4E41D 4N8VG 3RL1A 4PTUB 4E41E 1VHPA 4HD9A 3J8F7 3VWKB 3O41B 5KVGH 1EGJH 2VR4A 5I8OH 1JWMB 4BFGA 1EXUA 3WHE0 3IJSB 2EKSB 4D0CB 1OQOA 4PD4J 3HLAA 4KDWA 2CJUH 2WV3A 3WHXA 3WN5C 2YEZA 1DBKL 1CFNB 4Z7WE 4WHTB 2LU7A 4K9EC 3G6JB 4G42B 3H3BC 2V5TA 5JW3H 3ARBD 3RVXD 1N4XH 3CMGA 4X6EB 3ZKXB 5GSVA 4D94A 3BPLB 3KS0H 2OL3H 3PABA 2C1PB 4I0KA 4KUZH 5EBWA 2DQDL 5CZVH 5LQBL 4MA8L 4K2UH 4D9QE 2DL2A 2VLKB 1MUJB 2UZXB 3CFKA 3T2QA 3U36B 1U8MB 3RDTA 3MLRL 5D5ME 4FFVD 1JFQL 4WFGD 2GI7A 4I18B 2Z0BA 3FOMA 4EN3B 3MC0A 3K80A 2YA2A 4OBSA 2C7UA 1IGYB 2BSSA 3MJGX 4WFGE 5D7SH 4NKIH 3TGXA 2XWTB 2VZOA 4P2QA 3TJEL 2LVCA 4Y8DC 4LSDA 2ARJA 3ROOB 4EEEA 4LF3A 2VDLH 1RAMA 4PJIB 3HB3C 4KV5E 3D85B 1UCBL 1RU9H 5DYOB 5E1HB 3VH8B 3MBEB 2DIBA 5DSCB 5CP7A 4KVNL 4M3KB 4EVNB 1DQDL 5IJKA 5D1XA 2ADFH 5C0GB 3QNZA 4Y16A 2CUIA 1U3YA 1P6AB 4Z18A 1PLGH 35C8H 1JWSA 3RPIA 1P69B 2YXFA 4JFYA 4MQ7A 3S37H 2HT4D 1NDMA 1MI5E 3QFJD 3F58L 4QWWD 1NLDL 1PSKH 4ZUUB 1DBBH 1L7IH 1OGAD 1L0QA 5EBGA 1KB5H 4XP1L 2CO7B 3ARFD 2CO6B 1LEKA 5JOFA 2XQBL 3QFJE 4LHUD 3SJVD 4O5LH 1OGAE 4EQ3A 1UH4A 5C0DA 3PWUB 3BDBA 2VZSA 2P49B 5F1IB 3HR5A 5D1QC 4JR9L 3UYPA 3GGWA 1FNLA 1ZT4B 4TNVK 3U30B 1J8KA 4ZAKC 5DGRA 5K9JL 4S1RH 3R06B 3IDGB 4G8GA 4LIQH 4NM8L 1RK0A 3L5JA 4HULB 3B2UC 4G7YL 3MRGB 1XT5A 3A6OA 3CDFA 5HI3C 4XMPH 4HG4J 3MLXH 5EOCJ 4YHLL 5BVPL 2X1XR 1HHKB 4BH7A 5FECB 1AP2B 1L0XA 4U3XA 5SWZB 4P2RD 3NFSH 4GQ9H 2IPTH 2JB6A 4OV5B 4K7FB 4OJFH 3TC9A 4C57C 1YEDB 4P2RE 3VXQB 2FX8L 3HZYA 5GHWL 4XVUC 1ZVHA 1Z3GH 1GL4B 4NBZB 4WGWB 1FNGB 3BD3A 3DHJA 3SKMA 2JB5L 5L9DL 2IJ0C 1XFPA 3RWIA 2VC2L 3ZMRA 3TVMC 3WFDL 3LS4H 2VDPL 4R7NA 2IQAA 4OCYL 2NY3B 4DWHA 3K0WA 4K71B 4S0TD 1INDL 1EEQA 4OCMC 4YZFF 3UBXA 4Q9QH 3V79C 1EJOH 1KN4H 1FAIH 4L9LA 5DTFB 3QWQB 2N7AA 2D7OA 2Q8BH 4R3SB 4MCYB 1CTOA 5K9OB 3FKUS 4JZNB 5A2FA 5I30L 1M7DA 3BWUC 5FA3A 2PXYA 3O6ML 1BIHA 1E0OB 1NJ9A 2BDNL 5ABDE 1KYOJ 3UAJD 5TDPA 3LV3B 2Z8WC 4N0UE 1QO3B 1CLZL 3RHWF 4YHYB 4PUBL 4Z7UA 2WBWB 3Q48A 2EYTA 4B7LA 4X7SH 1AHWB 2WWKT 3LPFA 4WUKL 4XBGB 3AY4C 4LNRA 3QCVH 4NJAH 3H9HB 4C4KT 4HX1B 1CXIA 3C6SB 5DD6B 2FLBT 1MIEL 4U1KA 1U8IB 1NL0L 4M6NH 4HXAL 1T0NA 1RJCA 1O0VA 3GBLA 1F90H 3FHAA 3ZDZF 1RZFH 4JREB 2YD3A 3C8KA 1FG9C 3SE9L 5M94B 1T2QL 5F7UA 1CZ8L 4N8VA 1J0IA 1JYXA 3WD5L 4KKCC 1FIGL 3WS6C 2FZ3B 4LEXL 4XVTL 3BE1H 4KROB 2Q8AL 4D8PB 2QKIA 2ZJSH 3VRIB 1QRNB 3BP6A 5D6DA 4YAQA 3A67L 1I8KB 2YS4A 5HXMA 5KSBE 5E4EB 4BSVB 4O58H 2WUCL 2R0KH 1J0JA 3OKDB 4HH8A 2ZSVA 3F5WA 4YX2L 4C83A 2GIYA 4NQEB 1XGPB 1PEZA 1H3PL 3O8XD 2AK4D 2MCG1 2IH3A 4Z5RA 2VSDA 4K8RH 1RZ7H 1U8KB 1A1MA 1NUGA 5D2LB 3ILQC 3V4VH 3OQ3B 4PRBB 3REVB 3BGFB 5BW7A 4YXHL 1JPSH 1NAML 3LZFH 2EXWD 3NCCB 5C0IA 5E6ID 1P2CB 4JG1L 5EOCL 5I19L 3TBSB 3TJHD 3VFPA 4PJXA 1XR8B 3LRGA 1KB5A 4KI5F 2FYYA 4XMKH 4EI5A 4DQOL 4NC1C 5CBAB 4MB4A 2XFXA 3O4OC 1Z9MA 2ITCA 3BSZH 2GK0A 4H8WH 3QXUA 1PG7L 3H9SA 3JUZA 4PJEE 3HZVA 3SO5A 1NCAH 4Y1AA 4YHZL 2C3VB 3OR6B 4OI9A 2D31A 3T0ED 1JK8A 4P9HH 4YIQA 3S36H 3CJJA 3IJHA 3S5LB 2W07A 3T0EE 5I76A 5CJBA 4KTEH 4PG2C 4P5TA 3OKKA 5M7QA 2P8PA 3KS0J 4L5FL 5DI8A 2NY1B 3BIBX 4OFVA 3CH1B 1ODAA 2B1HH 4TSCL 2IAND 2WP3O 2IANE 4WWKB 3CD4A 4ORGB 4JFED 5EUOA 1TCMA 3L3JB 3GB7B 4O51A 1IZKA 4JFPA 2BX5A 4JFEE 1DQML 3BAEH 3BZFB 5HD8C 1U6AL 3ZHLA 2J8OA 4KJYA 1IRAY 4PJGE 3KPRA 3OG4B 4KK6C 4LSTL 4YK4B 4KRPD 3QJHA 4IRZH 3FAXA 5CJOH 1ADQA 2X4NA 5EZIL 4GKSB 4MQXD 1RJLA 1HHJB 2PYEB 4Y4HD 3IDXL 2YD6A 2Y25A 2CDEB 1KELH 4DCQA 5BRZA 3RNKA 5E6ZA 1NMCC 3MO1A 1GRWA 3LEVL 2OZ4H 3M17B 5E94B 1JL8A 3OAZK 3CSBA 4I2XE 4R96A 4HKBA 3SDDD 5E2TL 5IBTL 3T0WA 3V0WH 4IDJH 5IEKA 3LKPB 1NBQA 3A6CH 2E6JA 3SDXA 3VI3E 4FG6C 3MZGB 1JTOA 2P24A 5JLZB 1BQHG 1WUNT 5ESAB 5KSUA 3CFEB 2H2PC 3TO4D 2GY5A 4S0SD 5E8NA 5KJRH 1MRFL 2OR8A 3MLWH 4GRLA 1B2WL 3OR7B 5FYKL 5IMOA 1F3JA 1GXEA 5MP6L 3GHBH 2YXMA 4AZ8A 1IEBA 2FJFA 2AEQL 4LLAA 1RIVL 3VXMA 3FQRB 2DLTA 1VFOA 4M02A 5C3TA 4CADB 3LN5A 4E41B 4FQLH 1UM6L 1ZA3A 1H5BB 2MOVA 2NTFB 2HWZH 2VLRE 1KFAL 3CLEL 4HJ0C 4MWFA 4HPYL 1G6RH 2EYSA 2N1KA 3QUYA 3H8NA 2AERT 5HVWA 4DTGL 4FOMA 4ISVA 4X7TB 3IDNB 1HDMA 1ZLVK 3MJ8B 2P7TA 4BZYA 3L5XL 2OL3B 1EGJL 5D70L 5I8OL 3ARBB 1NFIB 3UMTA 3E1F1 4HMEA 4L3CA 3BEVB 3WL9B 4OGYH 5C8JB 1DR9A 3FQTB 1SVCP 3C5ZC 3CFDA 3SKNA 3LEYH 4U1SA 2X9WA 5H35B 2MKWA 2XOTA 2NW3B 4D3CL 5DRNB 3UTZA 4YGAB 3MGAA 3UYRL 3CLFL 4HKZA 4YDLB 1WBZA 5GJTH 4J8RA 1A9EA 4OF6A 3SN6N 2VR9A 5D5MB 4R8WH 2DKMA 1YUHB 4WFHE 2AJVH 4XXDB 2ADJA 4KUZL 4HWBA 4GMTL 4PJBB 3MRLA 5EU3A 1C5BH 3K1KC 4K2UL 1QSFD 5J56B 2XKUA 1I9IL 3KJ4C 5H2BB 4WDIB 4XNXH 5B8CA 3HFMH 1QLEL 4H0HB 1YEHH 2PKDA 5K33A 4PJFA 3GMNB 4WHCA 1I7ZB 4OZ4A 1T2XA 1LP9B 4IRJA 3RVUD 4I0PA 2F74B 4NKIL 3X11A 2IEPA 4RNRA 5TE7H 5DEZA 1XF4A 3SDYH 5I75B 1DN0B 3EYSH 1KIRA 1D5XA 2VDLL 2P8LA 2NY7L 4UNTA 1U8LA 1RU9L 3QJFA 1JGEA 4ZXBA 2JCCE 4RAVA 2OTWB 3NCEB 4OUUA 3QFJB 1CFTA 1OGAB 2ADFL 1NKOA 1HZHH 5D6CA 5TE6H 3CFJB 1FG2A 2AABH 3ARFB 3MUY1 4M1GL 5AUMB 4LHUB 3SJVB 5L8KB 1P7KB 1I85A 1PLGL 2FIKA 35C8L 1GOFA 3CDGA 2EE2A 4KKAC 5D7IF 2HFGH 2BNQD 5IK3B 3HE6D 4PJHF 3V7AG 1PSKL 1DBBL 1L7IL 5JXAH 2AGJH 1KB5L 4YH6A 3PL6A 3JTSA 4ZFOA 1XCTA 1JRHH 5FYLD 4L1HA 1R3KB 2V5MA 3L5IA 3UTSD 2B5IB 1F3DH 5FYLE 1K5NB 1AO7A 1T1ZB 1V3KA 4G8FA 4WV1C 2Z31C 3TBTA 1G7JB 2VXQL 4S1RL 4U1IB 1FIEA 2XZZA 1UQSB 5IBLD 4LIQL 5C6TH 3PQYD 5I1LB 4NKDA 1QRKA 3DX6A 3SOBH 1R5IA 1PAMA 3PQYE 4P2RB 4EBQL 1EAPB 3RFZC 4FFWC 4MS8D 2CIIB 4XMPL 5EZLB 3MLXL 3NZHH 4Q9BA 4ETQA 1FYTE 1KIPB 3VMPA 4JO4H 4YXKL 2GSIA 5B39A 5DURD 4CMMB 4M7ZB 2BVOA 3GJEB 2DQIL 3NFSL 4LVOC 1C7SA 2IPTL 4HSQA 4OJFL 1QEWA 4ODHL 1KEGH 1QR4A 4MDIB 5D7JC 1BLNB 4PLJC 2CRZA 1Z3GL 3FO9A 2LTQB 3MUHL 3D18A 2NY0D 1NMAH 2NR6C 3T0XA 4F57H 1ADQL 3FTGB 4S1QL 3LS4L 4G43A 2HP4A 4L3ED 1AC6A 3HMXA 4UBDC 4YHOH 3GMMB 1HWGB 4XX1G 1FAIL 3BZEB 1LE9B 4XCEA 4N0UB 5BS0D 3RUGA 3W9EA 4XT1C 3DJ9A 2XRAL 3ARTA 2PW1A 1TQCC 1MWAH 2NX5A 2VTFA 4WJ5B 3PDOA 1T66C 4Y4KA 1B6UA 3SKUD 1CIUA 3L5WB 3UPRA 4PY7B 3Q6GH 4XPTH 2X44D 4HWZA 5B38B 2WQRA 1B4RA 1C5DB 3HUJB 4Z78B 4GBXA 4WHYG 4WVRA 1CGTA 3CU1A 4MCZA 2QSVA 4HLJA 3X13A 5CJQH 5JOPD 4QHLB 3WEXA 4OCWH 5JOPE 4P57B 3TO2B 5F71A 1VCAA 1EAJA 4K7PL 4X7SL 3U0TA 3O2DH 4LMQE 4ZO9A 3BH9B 2HVJB 1MCHA 3HG1E 4YC2C 2R9HC 1MPAL 1T7XA 2FEEI 5I1AB 4NJAL 1X5AA 4L4JA 5DRWB 5FOBA 4OM1H 4U1GC 1TXKA 4XZUA 4G6JH 5FYJD 1SY6A 3NGBB 1F90L 3TT3H 4ENED 5FYJE 1RZ8A 1HYSC 5GRVL 1YN7A 1BZ9B 4NBXB 1CR9H 3BPCB 2D2OA 1JNLH 5L0QC 3BE1L 5E2WH 3DX9B 3VDBA 2CK2A 2G60H 3G6AB 5DJ2B 3KPLA 3IKCA 5TDOB 4Y19D 2FX9H 4HIEB 2EDWA 5ENWB 3O8XB 2AK4B 5GGQH 4RGOL 1EHLL 4Y19E 1UXSB 4Q2ZA 1YEEH 2MFNA 4O58L 4GKNB 4LCWD 4NN6B 5CSGA 5ICZB 5IOPA 4ZSOA 1Q9WB 4J2XA 4NT6A 1QA9B 1SEBB 2BOBB 1XF3A 2WLZA 4LCWE 2IQ9H 1A3LH 1RZIB 4K8RL 1RUMH 3VXPA 5E6IB 2J3SA 1U3HD 4M5ZH 2WBJD 1DFBH 12E8H 1ZEAH 4OZGF 1KCUH 3V4VL 5BV7C 4UZGA 1IARB 2NNAA 3KPNA 4LK4A 4HWBL 2VWEE 4HKXA 4PJEB 1OAZH 1JPSL 3Q5TA 1TNNA 1S9XA 2CSPA 3LZFL 2X4SB 2JJSC 1U3JA 3W82A 3U1SH 3EHBC 1T1WB 2H3NB 3WS3B 3GI8L 2GFBA 4JCLA 3T0EB 5A3ID 3SKJL 1FFQA 5GGRB 1JMXA 5J8OA 4H8WL 4JQVC 3VXNB 4LCIH 3QNYB 4MDJA 1NCAL 3IGAB 2Z35A 1N0XL 4WW2A 4P9HL 4MA3A 4LLWA 4JKWA 2IANB 3CZFB 3S36L 1ORQB 5I2IA 4KQ3L 4UQ3A 3U0PA 1S7TA 4KTEL 5DZLA 1RZJH 5F9JA 1I1AC 4JFEB 4RFEA 2H8PA 1B88A 2FGWH 2J12B 3IVKB 5C92A 3B8SA 1KLFA 2B1HL 5DD3H 5A2IH 4JRXE 5FGCE 1PW3A 1QFUL 3VGBA 3FO2A 5F1NA 4IM8A 5TF1H 4KRPB 2APWA 1HOCA 3RX8A 4HS3A 3D9AL 3L1OH 5HHOA 2A9NL 4GRWF 4FQXC 4L29B 2VWEC 5J6GB 4NWUH 3K4DA 1WF5A 4JHZA 4Y4HB 5CCKH 1ES0B 5F7NC 4NKMB 4ZFOL 1INQA 1UWEL 4RBPK 5F7HA 1YPZA 3WDJA 2NMSA 1C5CH 3BO8B 2FHBA 5I16B 1WV7T 4PRID 4I2XB 5ESVB 4JFDA 5CJOL 2A0LD 4PJ9A 1NCNA 3TA3C 3VD7A 4PRIE 5CJ8A 5GGRY 3EOYG 3L3KA 3SDDB 3LN4B 4PG9A 4NHCL 3U7YL 4X0KB 1ROWA 3AS1A 5C0RH 1VGKB 3FRPG 4QHKI 3VD3A 5AWNH 1GZQA 5EU6D 4ONFH 2DOCA 1E6JL 4DGVH 3TO4B 4DK3A 4IDJL 5CMAB 1MWAA 4P3WA 2H9GB 3T77B 2AJUL 1ACYH 2AXHA 4OAWA 3GSRA 5FHAH 1YEKH 3ARDA 2JLLA 5A1AA 1MCNA 2A6DA 1BFTA 1MFEH 4AIZB 4LLMB 3EOTH 5ERWB 5IB1A 3NAAH 3FO0L 4XWGL 1FPTH 5EU7C 1D5MA 5GS1A 1IAKA 3PHQA 3GSNA 4HH9A 1BQHB 3GHBL 1CICD 4U6TA 1M6OA 1IM3A 3HMXL 4H5SA 5LAXA 5JXED 2OK0L 4RFOH 1Q9OB 4NCC2 2BNRE 2VUOA 4LLQB 2F54D 2YPKB 2FB4H 3QQ3A 3O2WL 4K3GA 1I8IA 1BVKB 1DUYB 2MCPH 4EDXB 3RWDB 5EIIA 3KR3H 1G7IB 1YEGH 5IHZB 1A1OB 4PTUA 3HI6H 5J11C 1JWUA 1JWMA 1B0WA 4OSUH 1S9VB 1N5AB 4D0CA 1MCOH 4ELKA 5I1HL 4GXVL 3QG7L 2M1KA 4HQQH 1S8DB 1CFNA 4UT6L 3SDCC 4WHTA 3IYLW 4G42A 4XGZA 1E4WH 5C07E 4NQVB 4BZ1L 3LEYL 3R0MA 4L8BB 1D6VL 5JIPA 4QF1B 5FGRA 1UJ3C 3ARYA 2BY1A 3MRRB 2WQ8A 5DFWH 1T83A 3GMOB 1QSFB 3DOSA 4OF8A 3S98A 3KG5A 4GMSL 1K6QL 4M61A 4R8WL 2VLKA 1CDYA 1MUJA 2BMKB 5TGBB 3P9LB 3U36A 1X5HA 4WI4A 1U8MA 4U0QB 5TPWH 2KQMA 4BQ9A 2PR4H 1WZ1H 4P2OD 4I18A 4EN3A 2HG5A 4EUPB 4XVJL 1IGYA 3HFML 2IAMC 1YEHL 2ICWJ 4LRIC 2BNUB 2XWTA 1YQVH 4XNQB 3KPPB 1QFWI 5DUPH 3ROOA 1ZHKB 3JWOC 1IMHC 1IEHA 4PJIA 4W4OC 5IMKB 3D85A 3ZSSA 4F3FA 1BBJB 5DYOA 3VH8A 3KVQA 3O45A 5DSCA 4NN5B 5EC2A 4EVNA 3UO1L 3LRHA 4KRMB 5C0GA 4N1EA 1SHMA 3LS5H 4R0LC 3R0NA 3GI9H 2BNQB 5DD5H 4NQCD 3QUXD 3HE6B 1CWVA 5TFSH 2EZ0D 1G7HB 3FT2B 3WUZA 4NQCE 1HZHL 2ZUTA 3P9MB 1WISA 1X5IA 4ZUUA 1FZKB 1HH6B 4MNHA 3QISA 2R4SL 3VFNB 3HI1B 3UTSB 2HFGL 1FFPB 2G75B 4P46C 3KGRA 3PWUA 5F1IA 5F44A 5JXAL 2AGJL 2APBA 1UWGH 4F37F 3BKJH 2UWEA 3C5SA 5CD5D 2KQNA 3RWEB 3R06A 3PQYB 1QR1B 2XTJC 5GISL 3E6HA 4LLYA 1MHHB 2HAZA 4OD1L 1YDPB 3D6GA 3TP4A 5D72H 3WUWB 4PGDB 5KZCD 4RBPH 1IE5A 5D2NE 1MLCB 1LO5B 3UP1A 3ECBB 4KJWD 3OF6D 1AGFA 5CGYD 3SGKC 4JLRB 2D7NA 2XZAH 3O3AA 3OKMB 5DURB 1XR9B 4U0RB 1HHKA 3BP4A 5CINH 1AP2A 4OFYD 5E9DD 3UTOA 5SWZA 2NY5C 3NZHL 5BCAA 4K7FA 5DJCB 1OGTB 5E9DE 4DKFH 2R0ZH 1LO2L 1YEDA 3FT3A 2HLAB 3LD8B 3VXQA 2D0GA 2NY0B 1X7QB 2HA1A 1LO0L 5KVFH 5KOMC 4J3OC 5AZEL 4L3EB 1KEGL 1NQBA 1IBGH 1BZ7A 3I6KB 1NMAL 2DIAA 1D7FA 2ADGB 2BERA 2W9EH 4Z7QE 1G9MC 4F57L 3WXWH 2DLFH 1YNTB 5BS0B 4XB7A 4R3SA 4MCYA 3V6OC 3MA7B 1CI5A 4YHOL 4X5WA 3ESVF 3MZTA 5K9OA 3G04A 4K9EH 4WY7L 1Y6NR 4BFEA 4EOWH 1F4XL 2GJ6E 3D69B 3U48A 2P5WE 5CAYB 2A83B 1MWAL 2VDQH 4TRPL 4DKEH 2AXJA 2WIMA 3LV3A 3SGJA 1QO3A 4DEPB 5LKNA 4YFEA 4Z8FH 1PJ9A 2NW2B 3O11B 3VI4F 3KLHD 4DKDC 5DUML 4HUKB 3VFMA 1OAQH 5F7YC 2YN3A 3SE3C 1F45A 2EIBA 2IPUK 4TTDD 3H9HA 3WSQH 4OCWL 3C6SA 4F7EB 1FP5A 1MHCB 2DAVA 4NYLB 1A6AA 1AJ7H 1U8IA 3O2DL 4K94C 4JVWA 4PJCE 2AP2A 5DMJB 3WDHA 5C08A 4OM1L 1A0QH 3Q6FA 4XBEL 4Q0XL 4MD4B 4P0DA 5GGVH 4DKAA 5C0FB 4G6JL 3B8YA 1JNNH 4ONGL 3OXRA 1NC4A 3W81A 5KVEH 3TT3L 3H9YA 3IJYB 4N0CD 5CGMA 4X4MA 4ZDHB 4D8PA 4PRAA 4Y19B 1EDQA 5BO1H 2YC1B 5HDLA 5SX4I 1CR9L 1DP0A 3OKEA 1QRNA 3RVTC 4W6XB 3O6FC 1RK1B 1JNLL 2UY7A 1MFBH 2X4UA 4R7DB 4HIXH 4LCWB 2IMMA 4BSVA 3DI3B 3OB0K 1FRGL 3OKDA 2Y5TB 2FX9L 4PGCA 5GJSH 5GGQL 4NQEA 1XGPA 3MRHB 2APVA 1U3HB 2WBJB 1E27B 3UXFA 2OMBA 3BH8B 3BHBB 3MV8D 4UINH 5IW6B 5HDQH 1HK6A 1D6EA 2IQ9L 1IAIH 5TE4L 1A3LL 3REVA 1A3RL 3Q0HA 4N8CL 4ZMAT 3WNKA 1RUML 4KUCF 4KXZH 4ZUTA 2WSKA 3ARVA 4M5ZL 3GSQA 5HI3D 1DFBL 1UZ6E 5SV4A 5ADPH 3AREC 1ZEAL 1P2CA 1T0MB 3TBSA 3IDIB 1XR8A 1OAZL 5KSAA 1M05A 3DIFB 1JF6A 5CBAA 2BSRB 2RJMA 3EGSA 3U1SL 3F6LA 1CE1H 3MUJA 3ULUD 3S3SA 4CJ1A 2J6EA 3K7UA 2OX5A 5EO1B 3THML 5C9JB 5CLTA 2C3VA 3HPLB 2HTLD 3OGOE 3OR6A 4OCXH 3RWJA 3ULUE 4OLXH 4PLKC 4RGNE 1JPTL 5TDNB 2FBOJ 4M5YH 2I5YH 5FGCB 1RZGB 3CH1A 2IWGA 4RCAA 4EQ2A 1A6PA 3VXRA 1RZJL 5IVZB 4U05A 5K9QI 2PTTA 4PBVC 2FGWL 4ORGA 5GRJH 2LFGA 1P84K 3SKOB 3QEHB 1RIUH 3L3JA 5C6PB 3GB7A 1JZ6A 3D0LB 2Z93B 3L5HA 3BZFA 1MHPH 4BFIB 5DR5H 2NLJB 2VXUH 2X9YA 4U6HB 4KVCH 3UJIH 4PRIB 2Y36H 2VJXA 3ZKQD 4NWUL 2CK0L 3C6LC 1XGYH 4LGRB 5CCKL 2HMIC 4GKSA 3RGVD 3LKSB 2PYEA 1C5CL 5TH2A 3DV6A 4Y5XC 4PBXA 1I8LC 1DBJL 3L3HB 3ZDYF 2CDEA 4JCMA 4JHBA 3ILPB 1EEUA 2OTUB 4HJJH 5EU6B 5E99H 2OP4L 3JV5A 3IS1X 4MQTB 5ITFA 5JW4Q 1A7OH 1CXEA 1WFNA 4OLWH 3DSFL 3D5OF 1TENA 1KNOB 5C0RL 2FIRT 5AWNL 3TFKC 5GZOC 5JLZA 4DGVL 1SJXA 4LLUA 2GTWB 3ZSTA 3CFEA 4KKCD 1U91B 2IF7A 1HEZB 2PW2B 5F7KC 1OWWA 1D5BB 2KL6A 4RWHA 5FHAL 3OR7A 1YEKL 2DDQH 1KG0B 1CICB 2OI9B 3FO1A 4JRYD 2ICEB 2YUVA 1MFEL 4JRYE 1W0WB 3RKPA 5IIEA 2GTZB 3MJ6A 2F54B 1IAMA 2R23B 4HKJB 1OSPH 4CADA 2ERJC 5LGKA 4J1UA 1FLTX 4E41A 1I1YA 1NDGB 1H5BA 2NTFA 2EDJA 4RFOL 1CN4A 3WLBA 4F7TB 3ULVC 3MV11 2X10A 2FB4L 2BRQA 1CDHA 3C87A 4HCRA 1O7VA 2MCPL 4D9RD 3VRLE 4DZ8B 3F62A 5C0CD 4Z7WA 3KR3L 3QI9D 4X7TA 4PR5B 1YEGL 3MJ8A 1QLFB 3S35X 1FV1B 2D4DA 5C0CE 1TVBB 2AJSH 4ODWB 3HI6L 3IRZA 2XNAB 3ARBA 1NFIA 1ZVSA 2R0WH 3BEVA 3ZO0A 4OSUL 4KKBC 4P23D 3WL9A 5C8JA 1KTDB 1M71B 4HQQL 1OD7A 1FZMB 2NW3A 5DRNA 3IAQA 1K4DB 3EYFA 1F11B 1QBMH 4I3GA 3HA0A 4AM0B 1XAUA 5D5MA 2VQTA 1NGYA 5D1QA 1YUHA 5J89A 5I18H 5IHLB 4XXDA 3HNTH 5IROC 3OGCB 3CFIC 2ZWLT 4P2OB 4BFBD 4ZAKA 4XNYH 2UY6A 1ETZB 1KUMA 3QDJD 3TESA 2RCSH 4CU6A 1MJ8L 4MB5A 5H2BA 4WDIA 3QHTC 3GNMH 3U9UA 2O5YH 3K46A 4UILH 1FNFA 5KW9H 2PR4L 4JKKA 3GMPB 4APQD 1I7ZA 4NDMA 4XAKD 1K2DB 2BVQB 2F74A 1G7PB 1H9VA 2ZG1A 5E1AA 1CF8H 1MFCL 1YQVL 3QXDB 1DN0A 1D5ZB 4OLEA 5DUPL 1LMKA 2W0PA 3GIVB 3B9VA 3RI5F 3BFOA 3LB6D 1HXMB 2VQUA 2DQTH 3KNBB 3BI9X 1TVDA 3C60D 4O9HH 4NRXB 4NQCB 1JV5B 4YZFE 3QUXB 1MI5A 7FABH 2X09A 1RUAH 4IS6B 1YJDL 2C5DC 1JZ2A 4HZAA 1A6VL 5IWLA 4M43H 3QQ9C 3QFJA 1FH5H 4YUEH 1OGAA 3EZJB 3CFJA 3ARFA 4BELD 3IS0X 1FLRL 5AUMA 4HS6B 3GHEH 4LHUA 1P7KA 4N5ED 2UV3A 1KJ2B 5F89B 4NOFA 1MOEA 3NIDF 3QG6A 3PUCA 1TZIB 5J12C 5IFJA 2DRUA 3KXFD 4FN0A 3K8KA 4S2SB 3SCMD 3WFBH 2ED7A 2L4OA 4HK0A 1P5VA 1MH5B 3V5HA 3WIFB 5D2NB 3KXFE 1JPST 3UBXI 1EFQA 1K5NA 1QZ1A 1T1ZA 4IIQC 1VKXA 1KPVB 1UWGL 3T2PA 5KZCB 1G7JA 3UZQA 1VSCA 2EECA 1BFSA 1IEAB 4CJ0A 4GG6E 1J8HE 3KDMB 3WO4B 4DOHE 5E9DB 5D72L 4P2RA 5MEOB 4G9DB 4YHML 4KDTC 1HI6B 2CIIA 3EBAA 4XVSH 3V5KB 4GSDH 2LAGB 5KN5A 4ODUA 5L6YH 4U6VL 1SJHB 4R6UA 5DK3A 3BMWA 5C7XH 3QO0B 2PUQT 4HC1H 4CMMA 4P4KC 3GJEA 4HEME 5LVEA 3FONB 4H1LB 1A02N 1CLCA 4DKFL 2R0ZL 5HHQB 4L8SB 4MDIA 2I60L 3WN5B 1BLNA 2YZ1A 4PJ8C 1QKZL 3FFDA 1YEFL 4HGMA 1U41A 5KOVC 5FFLA 3KYOA 8FABB 2DM3A 1IBGL 5E8OB 2ZCHH 4ETYA 4ZD3H 5AG8A 4YWGH 5E2JA 3JXAA 3GMMA 2HFFA 2W9EL 2PYFB 2J8UB 3WXWL 1JF1A 5HI5C 3BZEA 5C2UB 3N06B 4N0UA 1C08B 2AJXH 5EBMB 5DJ0A 4HK3N 3FT4B 2EE3A 5C2BH 3VU2A 5A2LH 1JTPA 4K9EL 1B3JA 4JN2A 1OTUC 2X70B 1BD2D 4TUKH 2ZG3A 4PY7A 5T1KD 4KI5D 4Z0XA 4HEPG 5B38A 4LCCC 3STLB 4Z78A 1HSBB 2HLFD 2VDQL 4DKEL 1P4LB 4KI5E 5KSVB 4JY4B 4J3XA 2EDHA 4LDOB 1J05A 4PJCB 4TVSa 2VOTA 4P57A 3TO2A 1FVCA 2C3WA 5IHBA 3ET9F 3T4AA 1OAQL 5HPOA 3BH9A 2HVJA 3MRJB 1EHXA 4QEGA 3ABZA 3G5ZB 1CXHA 1AIFB 4S1DC 3WSQL 5DRWA 3ELAT 1FCGA 1Q1JL 3RU8H 2AJZB 1AJ7L 5J6HA 5GS0D 5ID1B 4M00A 1GH7A 5IKCA 4B50A 1B9ZA 3QDGD 5GGVL 1DQQB 5KSBA 1CLOH 2IFFH 3MGTA 3BPCA 1JNNL 4AQOA 3QDGE 3TZVD 5KVEL 4HXBH 4HCRL 3VE0B 1UB6A 1FCCA 4XCNB 4KKAD 4UDUA 2SEBB 3H0TB 4KAQH 5DJ2A 5BO1L 1HSAB 1ZTXH 5TDOA 5DMGD 1X5LA 4HIEA 2Y5EA 3O8XA 3FRUA 3H9ZA 1J5OH 2I24N 4HIXL 2IG2H 3MV8B 4M7LH 4EIZC 4UNUA 4TQEH 4Y0GA 3HC4L 1Q9WA 1QA9A 4TULH 5E8DH 3T3MF 1Y18B 1L6ZA 1JHTB 2HKHH 1RZIA 3RDTC 1A6UH 4UV4H 5AD0B 1X6NA 4AG4L 2DQUH 3CXDL 2XXMB 4UINL 4QCIB 2JJWA 5HDQL 1FNHA 1WSST 1YN6B 1GOHA 4K3DL 1MCRA 4AENA 2N4IA 2O5ZH 2RFXA 4XCFH 4PJEA 4MZ3A 1TITA 4FFWD 5HHXH 1GOGA 5ADPL 2H2SD 5T33L 5I8KH 3IAPA 2HT2D 2H3NA 5EZJB 3T0EA 3BP5B 5GGRA 2DTSA 2W65A 3V9FA 3BQUD 2QR0B 3MJ9A 4MMZC 3NA9H 3KWWB 5J57B 3DUUA 4BSJA 5D1XC 3QNYA 5D7JD 3IGAA 4OLXL 1PY4A 2IANA 2W9DL 4Y16C 1ORQA 4Y7MA 2HN7B 3NIFF 3EDEA 5CHNB 1JMZA 3MMEB 4M5YL 2I5YL 3OHXB 4JFEA 4XI5D 5HVGB 3O4LD 2WNGA 2CKBH 4NC2B 1KJVB 5GZNC 4Q74A 4Z0BH 2NXYC 5T1LD 4PJGA 1PG7X 4JJ5A 2ZPKH 3O4LE 5CIPH 5EORH 3MRCB 1KXQE 4IRSD 3QQ4B 1RJZB 25C8L 2CMRH 3EZ8A 1RIUL 3S4SG 5HYJD 4LVNC 4YBQC 1T66D 3RGVB 3RGHA 5IQ9B 5HYJE 2VXUL 1ES0A 4Y4FD 2ITDB 5DD1L 4KVCL 3UJIL 4RGMC 2Y36L 3BO8A 1NBYB 3GJFH 2D9CA 5I16A 5ESVA 4I2XA 3IU3B 1AXTL 1KCSH 1XGYL 1W0VB 3AMKA 4JG0H 2NY2C 3SHSA 4TPRH 2ZUXA 4X0KA 3VXTB 1CU4L 3QPXH 4WRLA 5FF6A 1I7RB 3TH3T 1XGTB 1FJ1B 3O0RH 1VGKA 1BAFH 5E99L 2IBZX 5EUOF 3ARSA 4OLWL 3QHFH 3DMMD 2PTUA 3A6BH 5FK9A 5JHDD 3ARWA 1TJHL 3GMRB 3T77A 4YBLB 5JHDE 1T20A 3T65A 1HYSD 1DEDA 4PJAE 1K8IB 4DK6A 2I9LB 4JRYB 1TETH 2VIRB 4G8IB 1P84J 43CAB 1XIWC 5GGTA 5E2VH 3IDMB 4XP5H 4AIZA 1M1SA 4L9LC 4LLMA 2D0HA 5DJXA 5ERWA 4QHNB 3MGOA 2DDQL 3GSOB 3IFLH 2R0LH 3T0VA 2MNUA 2VLRA 4GOSA 3KPTA 5E56A 3QAZC 5DJZA 4OTXH 4JB9L 5HYQB 1EV2E 4A6YH 5CKAA 4PJ7F 1VEMA 2DLHA 2PXYC 2V9TA 1Q9OA 4LLQA 3SDXF 2YPKA 4LVHC 5C0CB 1BVKA 1FL6A 3QI9B 4EDXA 2YRPA 4FP8H 2PTVA 1G7IA 1OTSD 5IHZA 1NGZB 4S11A 2NZ9D 4S1SH 4P23B 5D7IE 4C58B 4BQ8A 3VDAA 1K4CA 2R2HA 1CFQA 1DVFA 2P8MA 2AJSL 5BV7H 1S8DA 2EC9U 3GBNH 2XYCA 5F9OL 3V5DB 1AE6H 4NQVA 1WT5C 2VXVL 3MSPA 4L8BA 4QF1A 4F15C 3INUH 3MRRA 3STZA 4MNQD 4M1DH 1TFHA 2P4AB 4UI2A 5F93C 4M93C 5C0BD 3QDAA 3GMOA 3QDJB 1QBML 1HE7A 2A9MH 5C0BE 1NLBH 2BMKA 4HUVB 3P9LA 1I1AD 5D6DC 1IM9D 3HNTL 4TVPD 1S78D 1TTUA 4APQB 4XNYL 4LHJB 4IJ3B 4GW4A 4TVPE 3U2SB 4EUPA 3LCYA 4AH2B 1ZGLP 4FS0A 4UILL 1RSFA 5KW9L 4WHDA 5EBLB 1H3VA 4PB9H 4XNQA 3EKCA 4GUPB 2H32H 3FOLA 4XPFL 1ZHKA 5FHBH 5KVMC 2JCCA 3LRSB 3C60B 4XHJD 5ACZB 4RWYH 3KPSD 4LQFH 3UZEA 1MCQA 4RDQG 5BW7C 1WAAF 3KPSE 1L0YA 1K8DB 5C71A 1C8PA 2WWMC 2DQTL 4V2BA 1MIMH 4O9HL 4LP4A 7FABL 3P4MB 3JZ7A 4EI5C 1N6UA 5CIPA 4KZDH 3MLVL 4M43L 1G7HA 1FH5L 4YUEL 3FT2A 4QHMB 3CC5A 3P9MA 4MD5A 1A7QH 5D4QA 4PJFF 1FZKA 2ZCKL 3KXFB 3GHEL 1HH6A 3SCMB 3VFNA 3HI1A 1FZJA 2G75A 4LDEB 1F2QA 4YO0B 4P5TC 5DEGB 5IVXF 4JPIB 4XAWL 3FJTA 3RWEA 4DOHB 4JFXA 4KKLC 3WFZA 3PQYA 1QR1A 1IZJA 2WINB 3NPSC 1YEIH 1FYTA 3WUWA 4PGDA 5KBNC 1N6VA 4GS7B 2ESVD 1MLCA 1LO5A 1X5YA 2ESVE 2E3VA 4JLRA 1AKJD 1J1XH 2FBJH 3BPNC 3V4PH 1XR9A 4KK8D 4LBEB 3DUSA 2AQ3A 4HAFA 4ZPVB 1MQ8A 4XVSL 5ILTL 4GSDL 3D48R 5L6YL 4B0MM 3HNVH 1OGTA 5DJCA 3S88L 3P40A 2HLAA 5C7XL 3QIBD 1X7QA 3HMWL 5LG1A 4HC1L 1NCUA 2GJZB 4OT1L 2ICES 2X42A 2YK1H 3DGCR 2FO4A 1D9KD 2GK2A 3REWA 3I6KA 2O93L 3G5YB 3QXWA 1AQDA 3RKDC 4ORZC 3QNXB 5F9WC 3DRTB 1ZLWH 5IW1B 4ZD3L 4YWGL 1AR1D 3MA7A 2XN9E 4XTRD 4LEOB 5EU4B 2JIXD 4CU8A 1BD2B 1C1EL 2R29H 2BHYA 5T1KB 3D69A 3G9VA 1HHHA 2AQ2A 4GRLC 3BDXA 1UWXH 2AJXL 5C2BL 4HUMB 2A83A 1R5WA 2J5LB 4QOKD 4HGWA 4X83A 3RZCD 3HG1A 3BISA 4ZODA 4KJQC 3O2VH 1VENA 4X9IA 1BIIB 4JFZL 5GGTL 3ZTJG 1CLYH 4NNXB 1ZLSL 1OF2A 5I8EB 2WLYA 5L88H 4OGAC 2W92A 4G6AD 4LFHG 4F7EA 1MHCA 4OGXL 3SE8H 3NBNA 1WWWX 2O61B 4X4XA 5T5FH 4AIXA 3LIZL 2WAHA 2EO9A 4AT6B 3QUYC 1OW0A 2FHFA 3QDGB 2CDFB 1UZ8A 5DMIH 5DD0L 2YRZA 1I1FB 2YA1A 3RU8L 4JQVA 3JWOH 1A6WH 3T1FB 2YD1A 1Q8MA 4TSBH 3TZVB 5C0FA 5AYUH 2XQYK 2VZUA 1ZV5A 4AY0A 4MVBC 3IJYA 1J12A 4WUUD 4ZDHA 1XZ0A 4K7PX 4Y19A 3U79A 2IFFL 4WUUE 4LFHD 1CE6B 1RUPH 2WIIB 5ESQB 1RK1A 4HXBL 1NFDE 3ZTJH 4C59B 4F37K 4LCWA 1S9YB 1AY1H 4KAQL 3P77A 1IC4L 1ZTXL 3B2VH 3AU1A 2Y5TA 1S7UB 4GRWH 3GO1H 3VXSE 1J5OL 1E6OH 3NIGF 1J1PH 5CZXC 1KLUB 3MRHA 1YC7A 3JV4A 4FTVE 1U3HA 2QADC 3NCJL 1EK3A 1E27A 3BH8A 3BHBA 2ZNWA 4TULL 5E8DL 2XTJD 4FFYL 4Q97A 4O2CA 3TBVB 4OIBA 5B8CC 3QXAA 2HKHL 3UX9B 4UV4L 4JY5H 1MREL 2MPAH 3VG0L 3BJ91 3PWJB 4WO4D 3TA3A 1MVUB 5KS9E 1T0MA 4Q6IB 5HVHB 5FM5M 4IRJC 2R69H 4XCFL 4I0PC 3IDIA 1JN6A 4BA8A 1LK2B 2D7QA 3BQUB 3DGGB 3DIFA 2BSRA 3RIFF 5C70A 5HHXL 1FSKB 2ILLA 4GAJH 1UADC 4ODTL 2G9HB 5I8KL 4CVXA 5D7JB 2NYYD 3ALXA 4ZUSB 1F42A 5C9JA 2Y06L 3DO3A 3HPLA 4JFQA 5I1KL 1NGPL 2NY5H 1XF2B 3VXOB 3NA9L 3EFDL 1GIGH 3CVHA 1WGOA 3O4LB 1KC5H 4U1JA 4JRXA 4OM0H 3PWVB 5T1LB 1GHFH 4P59H 4Q9RH 5DQJA 1GGIH 1RZGA 1S9KC 1I85C 5CILH 3WJLA 1QHPA 3S9DB 4NBYB 4IRSB 1PZ5B 3QEQD 4NRZB 4CN1A 4Z7OF 5LJYH 2CKBL 5ANMB 1OAKH 4WEBL 1TQCB 3PL6C 3QEQE 3SKOA 3V52H 3QEHA 5HYJB 4U6YB 2ZPKL 4OQTH 1G9MH 3D0LA 5FCUH 3EYQC 3MXWH 4WCYH 4Y4FB 4BFIA 2PO6C 1I9RH 2CMRL 5DHVB 5FYLL 4ZO7A 4ZO8A 4I8DA 4U6HA 5EZOH 3S36X 2QJDA 4GAYA 4PRPD 5CZKA 4PRIA 2DF3A 1NEZB 3CSPA 5FA4B 1FE8H 4ONHB 1UKQA 4RMWA 1VFMA 3ARPA 4XP4L 2VDNL 5KAQG 5I0ZA 4HBCH 4Z7NE 1RJYB 2WMPA 3LKSA 4FZEH 5ID0B 1B0RB 1N3NB 2FR4B 5FKPA 5DC9B 2CLRB 1KCSL 5HYSB 1ZOXA 4IMKA 3DMMB 3OAUH 4OKDA 4R4NC 4TPRL 3MA9L 5JHDB 1KNOA 3B3IA 5F3HB 3LMJH 4RMRA 1I1RA 3O0RL 1BAFL 1IGTB 4JKLA 8CGTA 4K94H 3A6BL 4R4BB 5L0QB 1U91A 1ERNA 1HEZA 1UM5H 2PW2A 2PNDA 3QWOB 3ZE0E 2W0FB 1D5BA 3L3GB 3NPZB 2CH8A 4JPKH 3B9KD 2G2RA 1QSVA 1CICA 2M8XA 4QRSB 3RVTD 5A2KH 5DRXA 2ICEA 2BNRA 1NUFA 2CKNA 2CRIA 5F7FA 4XHQA 1CTNA 1G9NC 1ZGLM 2R0LL 2GTZA 1DBMH 5E08L 1FZOB 4HKJA 1PQZB 2DM4A 1WVZA 1QHOA 1OTTC 5J1TC 2EIEA 4OTXL 4OKVB 4U4BA 3AM8A 4Y4KC 5DVKA 4OIAA 5D7IB 4I9WD 3IDYB 4JM2F 2N7BA 3AC0A 1I3UA 4GBXC 4PJHB 5D93B 4FP8L 1GZPB 3LHPH 4H88H 3PF2A 4PR5A 4R90H 5GRYA 4RMUA 1QLFA 1FV1A 5C07A 1OP5H 2Z92B 2H41A 2OSLB 2VLJE 2AEPH 3RBSA 4ODWA 1Q0YL 4R0LA 3ESUF 4MJID 2XNAA 1PX4A 2EDKA 1WBYA 3NN8B 4J12A 4MJIE 3WO3B 3SDAC 2WK2A 2BVTA 1M71A 4MNQB 4POUB 5GS3A 5IMLB 5C0BB 3GBNL 1QUNA 3IKKA 1XH3B 3CCHB 4G3YL 3D0VB 2V5SA 1AE6L 1F11A 2Z91B 1VB9A 4MXQC 3RL2A 5FYJL 4AM0A 3F6IA 3LDBC 1BBDL 3DTXA 1I1AB 3INUL 3P4LA 1HQ4A 1IM9B 4GW5B 3OGCA 5B22A 1YMME 4P2OA 4ZG1A 2A9ML 1ETZA 3MCLH 1NLBL 4UTBH 2Q86A 5J9PB 5CEZD 2YN5A 3U9PL 1OCWH 1RHHB 3UTTD 5F7DA 3U7AA 5GRWA 4X4YA 1Y0LB 5CEZE 4WU7B 3GMPA 3QEGL 5F88B 1JVKA 3CPLB 5MERB 5JZ7C 4C56D 3UTTE 1ZGLB 4G6ML 2F5BL 3NFPB 1IFHL 3MNZA 1TDQA 3PJSB 4JDVB 4OCLC 2NZIA 3KPSB 2MMXA 1NAKH 3GMLA 4PB9L 4CW1B 1JTTA 3PGDB 4BKLB 3GIVA 2W9LA 5FHBL 1HXMA 3RWHB 3KNBA 3QPQD 4Y2DC 2YD5A 3IXTB 3GRWH 4KTDL 4LQFL 4NQCA 1JV5A 1QFWH 3U82B 3LPWA 3RVVD 4IS6A 1EZVX 1JPFB 3PP3H 1LVEA 3Q5YA 5C09E 3V6FB 2E7HA 1IKFL 3V7MA 3TWCH 3EW3B 3F8UB 2YMXH 4JZOB 1KJ2A 5F89A 3K4ZA 5F1KC 1H3TA 1A7QL 3NZ8B 1TZIA 4PD4K 2UVFA 4DVRL 1YYML 4KU1A 3RTQC 1M7IB 4LASH 4WW2C 4S2SA 2DQFB 4PGJA 2VQ1B 5FOJA 3CVIL 2UUDH 3P4NB 5D2NA 4UIKH 5JW5B 3VI4E 1CDCA 2LVEA 1KPVA 1AGEB 4QY8A 2EO1A 2ESVB 5E03A 1Z6JT 1ZT1B 1L7TH 2YOCA 3CVHL 1AKJB 5CKGA 3N50A 2Z4QB 1R3IH 4DJMA 5E9DA 1I9JH 3GKZA 1GYAA 2DYPD 4G9DA 3V5KA 1HI6A 3GM0A 1ZHLA 2A6KB 3NTCL 1DBAL 1J1XL 2FBJL 3QIBB 1CDJA 4NFCA 1KEML 3ORJA 3QO0A 5LWYH 3X12A 2FGZA 4HF5L 3FONA 4H1LA 3T4YB 3HNVL 5D96C 5IG7A 5I1IH 4GQPH 2FWOB 1D9KB 1KN2H 2UWEF 5HHQA 3AB0C 3ZYZA 1G1CA 3ULVH 5K59E 2Z8RA 3D25B 4TYUA 2E9JA 8FABA 2X7LB 2YK1L 4KKBD 3DRQB 1SYVA 4K55A 2IC2A 2JIXB 2GJ6A 2XY1A 2BC4B 5MEPB 1E28B 2PYFA 2P5WA 2VZTA 4OZGB 3ZDXF 4JGUA 4R97C 1KCRL 2X4OB 4Z77B 2DQDH 2X1QA 1C08A 1FN4B 4KUCD 4UAOB 1U3ZA 3ARDC 4X6DF 1M7XA 3G6JE 2EDFA 3LH2H 4QOKB 5B4MD 3RJDA 2VERN 5EPMA 3RZCB 3BRGC 2R29L 4MNGB 5GGUB 3EO1B 1FNEB 3PHOB 2EE9A 4AJ0A 5IVNA 1FFOA 1SJEB 1IL1B 1U8OB 1BJ8A 3JV6B 3QDMB 2F53D 5GS1C 1P4LA 4YHPB 5L8JB 1MLBB 2F53E 4JY4A 3GSXA 1ZKAA 2EYRB 1JZ5A 3O2VL 4PJCA 1ZAGA 3AREA 5IF0B 4LSRH 1ZE3C 1EO8L 5EUKA 1QFPA 3RI5K 2K7QA 1ZANH 1ED3B 2DI9A 2DN7A 1AIFA 3IFOB 5DC0A 1LWRA 2FD6H 3SE8L 2AJZA 4KVNH 3U0WH 2D7MA 5T5FL 5FO9B 3OBAA 4WUUB 3VWKC 5SX5H 5DMIL 2DQGL 3S34H 4F9PA 1A6WL 2NXZD 2OBGA 3LQZB 4TSBL 3SGDH 1AI1L 4QHKJ 3MCKB 4MXVE 5HGBB 4CDHA 4Z95H 1NLDH 2H45A 4XCNA 4XBPA 2XQBH 4LRNH 4YGVB 1HSAA 5IB3B 3WXVH 3MV9D 1G9EA 3ZKXC 2E8ZA 3BPLC 1I8MB 3MV9E 1T83C 3PWNB 1AY1L 5SX4H 1MCLA 2QL1A 2XTJB 5M95B 2ARJQ 2V5YA 3B2VL 2HJLB 3MNVA 3WCYA 1Y18A 3GO1L 3QO1B 1U93B 1E6OL 1HKLL 2DKUA 5AD0A 4YHNA 3MACH 4G7YH 4WO4B 5FYKU 2NCMA 3N85L 4I18C 4EN3C 4QCIA 4PJDE 1YN6A 4YHLH 5BVPH 2NY6D 2MQCA 4X6BB 1DLHA 4M7JH 4JY5L 1CQYA 4CAGA 1KYOK 5BZDB 1K3ZA 2I9TB 2D7PA 2YD4A 3T0AA 1KGCD 4PTTA 3RX5A 1MQKL 5EZJA 3BP5A 5HPMB 3BP7B 3FQWB 5K9QG 5ICXB 2HKFL 2MQ0A 3EAKA 4P4KD 4NQXA 4GAJL 2QR0A 5L9DH 2EXYD 1NEUA 2JB5H 4GH7B 4YJZL 1EEYA 2VC2H 2XPGB 5IV2B 4NNPH 2DQEL 5CFHA 3UYOD 2AXGB 5T1DH 3BPOB 2FJHA 3QWRD 1T5WB 4YXLH 2HN7A 4YDJA 3L7EA 5GSRB 3QEQB 1S7SB 1HILB 3QUMB 5LGJB 3MMEA 3RY6A 5C0EA 4OM0L 1S7XA 3MRIA 1LE5B 1GGIL 2VZ1A 1KJVA 1A7PH 4JY6B 4WW1B 4X5XB 5DMYA 1XCQB 4MX7A 4F8QA 5HI5D 4IBLT 4CN6A 3MRCA 3BGAA 3VA6A 5I30H 3GFUA 3QQ4A 1RJZA 4MJ5B 4PRPB 1OAKL 2YZ8A 1CFVL 1T80A 3O6MH 5HHPB 1QP1A 5EO0B 3CIQA 2BDNH 1TNMA 3HAEB 5GGSB 3TH4T 3MXWL 1IGIH 4HUUB 4D0BB 4LSUL 4XNMA 2IGFL 1V05A 2ITDA 4PGZA 2WBKA 3VWJD 1NBYA 3K74B 4G80B 1FE8L 4NZJA 4GLRH 3IU3A 1P9MA 4HBCL 4JQXA 4LLVA 4G5ZH 1HXYB 1W0VA 5KVDH 4FZEL 3EJYC 1MIEH 5JPMA 1NL0H 1C12A 4LPXA 1I7RA 1XGTA 1FJ1A 3QRGL 3X14B 2HVKB 3CFBB 2JELH 1CGUA 2Y9RT 1OARH 3BIKB 1CZ8H 3LMJL 3WD5H 1FIGH 5ICYB 2A2QT 2YUZA 4OF0A 3B9KB 5H94A 1W0YT 4FXLA 3PP4H 2I9LA 4JRYA 4K94L 2VIRA 4K71C 3M45A 2C1OB 1UM5L 3IDMA 1A7RH 3A67H 4WNQB 2Q76B 5HDBF 1RULL 4JPKL 3TM6A 4NRYB 2BHZA 2EIZB 4NUJB 1OPGH 1CDUA 4YX2H 4NCC1 3VA2C 3DX7A 4P99A 5DLML 1Q94B 3SO3B 1A1NA 1MEXL 3VW3L 3VRJA 5FDWB 5E8EB 1R3JA 5C0CA 2O5XH 1EBPA 3AS2A 3K4AA 1TTFA 3TYGH 4I0CC 4HFUL 2K9UA 1NGZA 4MJIB 3DUHA 4JG1H 3VCLB 3FQXB 5EOTB 2JTDA 4P23A 3LHPL 4HS8H 5HSFA 4DQOH 4YE4H 1FBIL 5D2LE 2V2TB 3D3VB 1T7ZA 2AEPL 3HCVB 1PG7H 3VFWB 1OWRM 4PV9A 5A2JH 4Y2OA 1WZMA 4O2FB 3I3DA 4HHAA 1U8PB 2CDGB 5LXGH 4JREC 3WFEH 1N59B 2OR9L 4L5FH 4UU9B 3DVIA 3OXSA 4KROC 4LNVA 1ZA6B 4TSCH 3SY0B 4HUVA 3UTTB 4PJ5D 4IOSD 4Z7WF 3O3DB 4APQA 4C56B 1F6FB 3BN9C 4PJ5E 3WNNA 1HHIB 3MCLL 3U2SA 3KYNB 4U7KA 5CBEB 1FDLH 3P0GB 3DROB 3K2UL 3G5XB 1U6AH 3D39D 3MRPB 1OCWL 3VD5A 3EO0B 3MODH 3D39E 4LSTH 4WWID 4TNWF 4CVWA 4NP4H 1CD1B 3QCUL 3DXAD 1YJDC 4DN3L 3C60A 1NAKL 5ACZA 4JQIH 5FO7A 3GMQB 3DXAE 3BGFC 5D5MF 2Q7YB 1K8DA 4MD0B 1UCTA 1TCRA 4AIOA 4RX4D 4UV7H 1QFWL 3UBXG 4PV8B 2L7JA 5KSAC 3VGHA 1LD9B 4Y89A 1T7VA 5E2TH 1WWAX 5F97E 5IBTH 5HYIA 5EN2B 4WTXA 15C8H 2W0KA 1VGEH 4QHMA 4M7LT 5I17A 3TWCL 1Z5LA 3KXFA 3SCMA 1QPXA 4KMQA 4WEMB 5C0NC 5L2KD 2BXYA 1REIA 4YO0A 2B0SL 3FAWA 4UB0H 1NCWL 5L2KE 1CGWA 5FYKH 4LASL 4NSKB 2NY1C 4GG6A 1J8HA 1ACZA 5MP6H 4UIKL 1FO0H 2AEQH 4LU5H 3TH2T 2A74B 2WINA 4R9HA 4HZLB 2DYPB 5BJTB 4JVUA 4WWKC 1A6TA 2EEAA 1L7TL 2ZUWA 3PV7A 3C2AH 1UM6H 1R3IL 4WI3A 1I9JL 1KFAH 4LBEA 2P43B 3MRKB 4ZPVA 5SWQA 3F12B 4PP1D 4YK4C 1E4JA 2R2EA 3UTQB 4DTGH 1U95B 4FQQB 5SWSD 1R3HB 3QDHA 5LWYL 1YY9C 3RZWA 5SWSE 4O2EB 4YR6A 5ALBH 2XG4A 3L5XH 3G5VA 5D70H 5I1IL 3GUTB 3QZWA 1KN2L 3ARGD 3C09B 3ULVL 1Z0NA 3QNXA 2D7TH 2IBBA 3DRTA 4BSWB 5KG9A 3P11H 4ESKA 4D3CH 2G5BB 3UYRH 3CLFH 3MQIA 5IW1A 5GRVK 2ZOLA 4URTB 5EU4A 1O5DT 4NHUB 1IGCH 2EDQA 1A4KA 5IJVA 1GC1L 2AJ3B 3ZYOA 1TQBB 5T1KA 5HI4C 2W1NA 4GMTH 2F53B 3MBXL 4U6XA 4QO1A 3LH2L 4H0IA 1I9IH 3QXTA 1RFDL 1FL5B 1QLEH 2VLMD 3OJDB 4FFZH 4ZQKB 1L9NA 2VLME 5E5RB 1LNUB 4KY1H 1BJMA 1BIIA 1A4JB 3M8OH 3W11C 1DJSA 1AXSB 1G7QA 4NNXA 4PJBE 4FQPA 2EDYA 1I3RA 1QACA 3WBDA 4IOFD 2IADB 5D8JL 1DQLH 1H5BC 1T6WA 1FQ9C 1U0QA 3L6FB 4LSRL 1S9WA 2O61A 3WKNA 1U2HA 1ZANL 3ZT5A 2NY7H 4LSPH 4JAMA 4AT6A 3MLTB 3QDGA 3UJTH 2CDFA 2FD6L 2NXZB 1JZ4A 2HH0H 1I1FA 1LP9E 4ZO6A 3U0WL 3TZVA 1F8TH 4M03A 5TQ0H 1ORSB 3OAYH 4M1GH 3BXNB 5I1CH 1VACB 3ARBC 2CRYA 3DETC 2NTSP 3S34L 1VA9A 4V2CB 1LILA 3MV9B 4O02H 3VGDA 4H20H 3TEUA 1CE6A 2WIIA 3H7BB 4Z95L 4J4PA 4M9PA 1RMFH 2QTEA 2APXA 1S5HB 5E8PA 4H26B 1S9YA 4YDLC 3OSKA 2GW5A 4LRNL 2XKSA 1VPOH 2HJFB 4IIQB 3WXVL 1HQRA 1S7UA 3P4OB 1JGVH 4ZOEA 4CNIA 3SJVE 5ACLA 4P5KA 1P7QA 4RMVA 4X7EC 5E5MB 1HYRC 1A2YB 1KLUA 4PJDB 4PGEA 4K3HA 1CXKA 1MELA 1MY5A 4LIQE 4XC3L 2VXQH 3WFHB 2VE6A 5EOQH 2NY6B 3TBVA 4ZUWB 5TF0A 4TOYH 5A43C 5EO9B 3F65A 4OCSH 4EBQH 3MACL 5KSBF 2R1WA 3OZ9L 3WJJC 4RISH 1P4BH 4Q6IA 3DVGB 2DMCA 4YXKH 5C0AD 1WC7B 4U1LB 4JGJA 4P4KB 2AI0L 1LK2A 4M7JL 4QT5A 5JORB 3BQUA 3DGGA 4XWOD 1J18A 5HJ3A 5C0AE 2BXZA 4Z76A 2DQIH 3TIDB 5FM8A 4FXKB 1G6VK 4RQQB 4ODHH 4ZUSA 1NPUA 3IF1B 1X5GA 3VXOA 2C3GA 1FO0A 2HT4C 5BRZD 1ADQH 3O4LA 5IWLC 4NNPL 4QWWC 4S1QH 1ONQB 1QBAA 5T1DL 4Z9KB 3ARFC 3O3EB 4YXLL 1XIWA 4KJPD 2UZIH 4L8DB 3I85A 4IRSA 1T3FB 43C9B 3DHMA 4PJ7E 5KANI 4PJEF 3FB7B 4D0DB 3ROLB 3MOBH 1U8JA 1A7PL 1H3WM 4AK1A 1YA5A 5HYJA 1QLRB 4U6YA 2XRAH 5DJYB 5DO2D 4EDWL 3MRMA 3MRFB 2B5IC 4Y4FA 5HHVH 3VWJB 4RZCB 3VFUA 2XKNB 4JHWH 5T3XH 3TLRA 4X9FA 1IGIL 1NGWA 1PEWA 3MRQB 1BOYA 1RJYA 1W72B 3FFCD 2AEIT 4MA1B 4HUXB 3VFSB 1T1YB 3BWAB 3BYTA 4K7PH 1B0RA 3F7VB 1N3NA 1G0DA 1F6AB 3FB8B 3FFCE 2CLRA 1AGBA 1NBVL 1MPAH 5HYSA 4G5ZL 4J6RH 3RL1B 5KVDL 3HUJE 3DMMA 3IU4H 3H42L 3CX5K 4PJGF 3MRDB 5JHDA 4PJAA 5F3HA 4M7ZC 3QUYD 4DFIA 3TV3H 3N0PB 1GGUA 3L3OA 2JELL 4KI1A 1WT5A 1LK3H 1OARL 1WICA 2YEZB 4AYFA 4R4BA 1BECA 2VR5A 2LTQC 1ITCA 2CIKB 1YEJL 2YD8A 3WFCH 3EOAB 4MVBD 3S96B 3C5JA 4JZJB 3GSVB 4RFNB 4JJHA 3L3GA 1T5XB 3BKYL 3PP4L 1LQSR 4M8QA 4ODVH 5GSVB 1GCFA 4QRSA 4U2ZA 5B3NA 1A7RL 3CFCH 2OS7A 4RGOH 1EHLH 1NAMB 2D03H 3VI3F 4K8RD 2YWZA 1JGUH 4QXTB 4P48A 3UAJC 2YPLD 1OPGL 3CXHJ 2E5EA 1PQZA 5DS8A 4QKXB 4KQ4H 2YPLE 4OZHF 1MAMH 1WAAE 4OKVA 3FOMB 4F9LA 4KTYA 5D7IA 4YFDB 1MCFA 3LY6A 3AFLA 2AK4E 2C7UB 32C2B 3ZKNC 1CL7L 2ZUVA 2NY4D 4KC3B 4OZFB 1PY9A 2O5XL 4HWBH 1GZPA 1PKQE 5E2UL 2ARJB 3BKCL 2RAMA 3WE6B 3TYGL 3K3QA 3WIIL 2ICCA 1RVFH 2Z92A 3IETA 5D1ZD 5BMFH 1CGSH 4E0RB 2C4FU 3GI8H 5GXBB 3U4AA 4AEIH 3SKJH 2Y6SD 1UC6A 4HS8L 4YE4L 2HFEB 1SQ2N 5IBUB 3OWEA 3TPUB 1WBXA 3EYVB 3QUZD 4LVEA 3MLYL 5F6IB 1BQLL 5IVXE 5C0BA 4X98A 4MAYD 1N0XH 3D0VA 4PS4L 4G6KL 5FUOH 4WTWA 4ZXBD 5LXGL 4GG8A 4JFYB 4KQ3H 1N64H 4MQ7B 5HGAB 3MROB 4PJ5B 3WFEL 2F8XC 4R26L 4I3RL 3T3PF 2X89A 4P9MH 3ZT6A 2CLZA 1HWHB 1KTRL 3U4BH 2ZUUA 4TUJB 5J9PA 5D9SA 2GAZA 3D39B 3R8BB 4UMGA 4U31A 1QFUH 1MRCH 3O8XC 1RHHA 1K85A 4WU7A 2OJZH 3D9AH 4OQ1A 4GAGH 5MERA 3DXAB 2A9NH 5IMMA 2ZUSA 1A6ZB 5K9KA 1SVZA 4NN6C 1ZGLA 1FDLL 5B39G 5E70A 3SE4C 3LOWA 1RK0B 3NFPA 3BUYB 4JDVA 3KPSA 3Q1SH 2DMKA 4RGMB 4WFED 3OKYA 1UWEH 3MODL 5J1AA 3PGDA 5DFVC 2EXWC 4NP4L 4WFEE 2LQRA 4LARH 3BEWB 3RWHA 3TJHC 4JQIL 1CT8B 3HE7A 4PLNC 2GCYB 3EYUH 4NHCH 3RWGB 3TBWA 3U7YH 2JB6B 1U58B 2XV6B 5CLWA 3BZDA 4UV7L 3GZKA 2XZQH 4MA7H 3V6FA 4LHQB 4X80L 1PBYA 3T0EC 1ZS8B 5L2KB 1E6JH 4HIJA 3RWIB 4PGBB 15C8L 1VGEL 4FQIL 2AJUH 2DWDB 3NZ8A 2A6IA 1M4KA 1M7IA 2IPKB 1IGJA 2DQFA 2FH8A 2VN4A 2VQ1A 4X4ZA 2JCCF 3ISWA 4L9LB 4UB0L 2WM0A 3P4NA 1PYWB 1RIHL 4OD3L 5JW5A 2E9WA 3VGEA 4I1NB 1J86A 4OLYH 3VJ6A 3EFFA 2EC9T 1AGEA 2F15A 2CD0A 1LO4L 3FO0H 2ESVA 4XWGH 3WYRA 1ZT1A 3FQNA 3QQNA 4KK5C 2ZCLL 1FO0L 1DLFH 4LU5L 1UH2A 5CSBA 2HTKD 2Z4QA 1ZHNB 1NJ9B 1MFDH 3HMXH 3ZKMD 2OK0H 5TDPB 4KRPC 1BVLA 1T1XA 2E9IA 3O2WH 2A6KA 1JP5A 5SWSB 4NN7B 3C2AL 2AK1H 3D1MC 1NCCH 3QIBA 5AG9A 1G9NH 3CDYA 4LMQI 5F8QC 4Y4HC 5JMOC 2E9BA 4P3DB 5CSZB 3RRQA 4MJ6B 1CS6A 3V6ZA 2DLEA 4LNRB 3ARGB 4G9FD 2ED9A 1OP3H 2FWOA 1D9KA 4IEFB 1EVUA 4G9FE 4R2GD 5I1HH 4GXVH 3QG7H 5ALBL 3VD9A 3MNWB 2XN9A 4MZ2A 4UT6H 4U1HA 1BOGB 3TCLA 3DRQA 1II4E 3C8KB 4BZ1H 4N8VB 2JIXA 5HHNB 1D6VH 3NIGE 2D7TL 3TO4C 1E28A 3P11L 1MHEA 2V9QA 2X4OA 3DURA 2QKIB 4KWUA 4ZNEE 4OZIF 1OP9A 1IGMH 4GMSH 1K6QH 4YDVB 2QQNH 1SY6H 1IGCL 5IB2B 3RZCA 2P5ED 3EO1A 4P49A 4Z6AT 1FNEA 2P5EE 3PHOA 5A40E 3I6LD 3QIUD 1SJEA 2LAAA 2ZSVB 3F5WB 1B0GB 1RD6A 1U9KA 1FAKT 3I6LE 4XVJH 3V8OA 1QSFE 4YHPA 2VN7A 4LSSL 2IH3B 3O9WA 1MLBA 2YUXA 4FFZL 4XXCC 4FNLH 3V0VB 1UM4H 2EYRA 1A1MB 1DTUA 4MHHI 1IKNA 3N1MC 3TNMA 5JZ7D 1CVRA 4KY1L 3M8OL 2EDNA 3PWLB 1EA9C 4XPAH 3GIZH 3IFOA 4DUVA 1DQLL 4I3SH 1I9EA 2BSED 5FO9A 3UO1H 5AZ2L 3VFPB 2GJJA 4LSPL 5DDHA 4N68A 2RBLA 5T3ZH 4EIGB 1KB5B 4WUUA 5INCA 3UJTL 4XH2B 1NFDA 1T04B 2GK0B 2HH0L 5I74B 4EXPX 4BZ2H 3LQZA 1F8TL 5TQ0L 4M6ML 4Z7OE 1DVFC 3SPVB 2R8SH 3MCKA 5HGBA 4Y1AB 4LOUD 2D31B 5I1CL 1N26A 2FATL 2R4SH 2APFA 1KTKE 4F7MB 3VXSA 1INEH 2Y7QA 4O02L 4FTVA 3BJLA 2KKQA 3OKKB 4YBHA 4H20L 2P8PB 4M1CD 2P48B 1MCKA 2BNQE 5J3HD 4QTIL 1RMFL 1QG3A 1TZGL 2P42B 3PWNA 5FXCH 2PETA 3V4UH 2UVEA 1VPOL 1EFXA 3DBXA 3GK8H 4GKOA 1JGVL 2PO6A 2OXHA 5GISH 3QO1A 1U93A 1Q9LA 3UTSE 2V6HA 5KS9A 4OD1H 1SBSH 4JFPB 4WO4A 4Q9CA 2FECL 3RVUC 4TVPL 5EOQL 5C0AB 1GGBH 4KJYB 4TOYL 4X6BA 3KPOA 4OCSL 4UDTB 2HJKA 3WNPA 3W9DB 3OTTA 2I9TA 2UYLB 3FMGL 3V7AE 4RISL 1P4BL 1RJLB 4KGLA 1LO2H 2M2DA 1NH6A 3BP7A 1VEPA 5HPMA 4NUGL 3FQWA 1HCVA 5ICXA 5CEYB 1LO0H 2EDXA 4JFOB 3DARA 4ZUVB 4DCQB 4WI7A 3RNKB 4NN5C 5BRZB 1I3GH 4JFDD 4PJ9D 3LKRB 3MO1B 4Q6YA 5AZEH 4QHUA 5IV2A 2JE8A 4RAHA 3ALPA 3RWCB 1FL3A 1CD9B 2AXGA 4PJ7B 5E00B 4EI6B 4NO3B 5C9KA 5IEKB 5GSRA 3QEQA 4LQ1A 1EPFA 1HILA 2ZKHL 3C08L 3QUMA 5MEQB 1T2JA 4JFFD 5F72S 1LE5A 1YYLL 5KSUB 4JY6A 1EVTC 4JFFE 4OCRH 4X5XA 4L3EE 1NBZA 4I5BB 4MSWA 2UZIL 3P73A 4WY7H 4UQ2A 4JM2D 1F4XH 5L2JB 4MJ5A 5GIRB 3QB7C 3BDYH 3MOBL 1U8NB 3ARDD 1CGVA 1IEBB 5BS0E 2FJFB 3HAEA 2V2XA 4TRPH 4YQXL 1FC1A 5HHVL 3BVNA 5JPNB 3FFCB 1F13A 4HWEH 4MS8C 4JHWL 5DUMH 5T3XL 4RDQF 4KH2A 4AQ1B 2VUYA 4RIRB 2VAAB 1HXYA 4TSAH 4M48H 3ZHDA 1TTGA 1IC1A 4MWFB 1Z9SA 4ZS6D 3GSNH 3QUYB 4GW1A 5DEFB 1EH9A 4J6RL 5FM5O 2HVKA 1HDMB 3X14A 3CFBA 3E2HB 3IU4L 2P7TB 3SDAA 4XBEH 4Q0XH 3BIKA 3MFFB 2NY0C 4RA0C 1YY8A 1NCBH 1KT2A 3TV3L 1DEEB 4ONGH 3MYJA 4OF7A 4L3CB 1YNKH 1RURL 1T03H 3B9KA 1CIDA 3AGVA 3E8UH 1ITBB 1LK3L 4A2MA 5DJAA 3TCXA 4LGPB 1BEYL 3QUKB 3KPMB 3UTZB 3WFCL 5CJXC 2C1OA 4WNQA 4WHYH 4N0FA 3FN3A 2QV2A 2Q76A 2AS5M 2YD2A 2YPLB 4N9GA 2WANA 4ODVL 1FRGH 2QADB 2J7LA 3CFCL 3MRLB 2D03L 5T5NG 1Q94A 1IC7H 2VITA 3QIWD 5CP3H 1JGUL 3MUGA 1DCLA 2NY4B 1PKQB 3NCYS 4XRCB 2MKLC 1J0ZA 3VH8G 5JO5A 2R1XA 4KQ4L 5TE4H 1GPOH 2VLJA 1MCBA 4PJFB 3OJ2C 1A3RH 1YNLL 1MAML 1AGDB 4N8CH 4DEPC 5DMKB 4OZ4B 5D1ZB 1J10A 4J3SA 5EU5B 1CGXA 3CX5J 4LSVL 6CGTA 2DIJA 2V9RA 4MJIA 2D4FA 2BZDA 3VCLA 4Y2DA 2J1KA 4RNRB 3X11B 3FQXA 1RUKL 5EOTA 5IVXB 3E3QE 4F7PB 4GRMB 4PREA 4DZBB 3QUZB 2I27N 5LCVL 1RVFL 3HCVA 3TN0A 5BMFL 3VFWA 1CGSL 1U8LB 3EDDA 4MAYB 4AEIL 4ENEC 3THMH 4F7CA 3SGEI 4K3JL 4ZXBB 1OW0C 4RAVB 1U8PA 2CDGA 1WLHA 3NH7L 4OUUB 1YMMA 1JPTH 3TIEA 5D6CB 5F7WC 3K81A 1NGXA 4N90D 5DJ8A 3RTQA 4UU9A 2FIKB 2R1YA 5FUOL 1ZA6A 3JV0A 5FUCE 1N64L 2DQJH 1F4WH 4RAUA 3UTTA 3VFTB 4P9ML 4IHOA 1CQKA 2Y07L 2GUOB 3O3DA 4I4WA 2V7NB 2OQJB 4Y8AA 3U4BL 3JUYA 4WI2A 1NFKA 3KYNA 1MFNA 1S7VA 3DROA 4FQ2H 1MRCL 3G5XA 3NACL 4QGTA 4QRTB 2OJZL 3EO0A 1P1ZB 1U3HC 2WBJC 4GAGL 3S7GA 1CD1A 4PY8I 2FEDC 4NKDB 2QHRH 5GS2H 5B3JE 2CK0H 3BESR 3ARXA 3Q1SL 4FQ1H 3UPCA 3GMQA 5C09A 4LARL 3B5TA 1DE4B 1DBJH 4ETQB 4MD0A 2ATKB 5A3IC 2WWKO 3N9GH 3EJYD 2OP4H 2GSGB 4C4KO 4POZD 1CFBA 4NZRH 2Q6WA 4X99A 3EYUL 1LD9A 3DSFH 4NKOB 4DW2H 1QEWB 5EN2A 2P47B 1Q38A 2XZQL 3O3BB 4MA7L 1CDIA 4X6DE 2OM5A 3EDKA 3RNQA 1NCDL 1U8HA 5EU6E 1WIPA 1OY3B 4U49A 3T2OA 4G43B 5FEBA 4HFWA 4M6AA 1BX2A 1UACL 5EWIH 2F8VA 2WP3T 5BXFA 4HBQA 3FB6A 5JDJA 4YLQT 2LU3A 4OF5A 3BZ4B 1F3DJ 3WJLC 4XPBL 2BFVH 4HJGA 2A74A 3TBYA 1GAFH 2VDKL 4OLYL 3HZMA 3W9EB 2DYPA 1TPXB 5BJTA 1AFVH 1G6RB 3MFGB 1X3DA 4ZTPH 1WEJL 1MJJA 3PDOB 5I73B 4JPWL 3U4EB 1DLFL 3UPRB 1AC0A 4HWZB 4DAGH 1MFDL 1O7SA 1V7ML 3MRKA 4MCZB 3F12A 3X13B 4G9FB 3NOIA 4B5EA 1N7MH 2A0LC 3DX8A 3LKOB 1TLKA 2AK1L 1NCCL 1G9NL 2F54E 1R3HA 4XCCL 4R2GB 3IFNH 1LEGB 3MLZH 3FZUD 4P4RB 4O2EA 4BH8B 3VWKA 3O41A 1X6LA 1Q72H 4RRPA 3VXUD 3EIFA 3IJSA 2EKSA 4IMKC 3VXUE 4BK5A 4MLIA 2R2CA 4LAQL 3G6JA 1RZ8B 2X1WL 3LDBB 3SQOL 1T89A 1YN7B 5C08D 2BHUA 5CP3A 4HV8B 2P5EB 1NCTA 4X6EA 4UIMB 4NHUA 1KCVL 1NC2D 1NC4D 2AJ3A 2C1PA 3QBTB 3QIUB 4HIHB 2H26B 3WIHH 2F53A 3IKCB 1IGML 2QQNL 3H3PL 1MFAL 1A5FH 1MJ8H 1SY6L 1CICC 2OI9C 5CS7A 3OPZL 1K3IA 2OYPA 4WU5B 4Z7QF 1T7WA 4Q2ZB 1WFUA 1FFNB 5KAQF 5BZWB 1IGFL 5JXEC 4ZSOB 1XGRB 4NT6B 1LNUA 4TNWK 1LDPL 1AGCB 4GKZB 1AXSA 3EJZD 5FGBA 4FRWA 2JJTC 1N0LA 3CX2A 1MFCH 4FNLL 1UM4L 2IADA 3AM8C 3L6FA 3F7QA 1F2XK 3KPNB 4XPAL 3GIZL 1PX3A 3MLTA 2ID5A 3MBEA 1JZ3A 1S9XB 3S5LG 4WI8A 4X9HA 5I1JL 4I3SL 1YJDH 1A6VH 4L4VD 3ZE2F 3DLQR 5T3ZL 4XNUL 1ORSA 2EH8H 4L4VE 3RX7A 1FLRH 2VISB 5E95B 1WTLA 2J8HA 5I8CB 4BZ2L 3DO7B 5IGXL 3MV9A 4H25B 2R8SL 4MDJB 1KJMB 4ZS7L 2Z35B 1EBAA 3DWTA 4PJCF 4XNZB 5I2IB 4H26A 1INEL 5C0ND 5C86A 1CYGA 1WTGT 4N1CA 5F9JB 2J6EH 3U7WL 2H8PB 4PJDA 1ZT4A 3PE9A 4P2OC 3V4UL 3GK8L 3IDGA 5F1NB 4XPGH 3VXRD 1J1OL 4ZUWA 1SBSL 3V2AR 3KYKH 3MRGA 4YHMH 4BUGA 1GGBL 3BMVA 5DVOA 4U6VH 5LBSL 1WC7A 1INQB 3EUUA 5HY9B 5JORA 1A47A 5FECA 2MHAB 2E7LA 4JFDB 4PJ9B 3TIDA 4OV5A 1CCZA 4FXKA 1KB9K 1Z9LA 4RQQA 3L3KB 1ZHBB 2XACC 3QWRA 1DDHB 2I60H 2Q3ZA 4DFHA 1GJIA 3IF1A 1QKZH 1FNGA 1YEFH 3FN0H 2EZ0C 1I3GL 2DJ4A 1FC2D 4JFFB 4LKXB 2PF6A 3O3EA 4YDIH 1MWAB 4JM2B 4MLSA 4OFKA 5CJ5A 2ZUQC 3PG2A 43C9A 5DTFA 4OAWB 1JE6A 1VADB 3GSRB 1XGQB 3UEZA 3FB7A 3ARDB 3IFPB 5CD5C 3IB4A 5DVMA 1RPQA 1U8QB 1KTLB 2A6DB 4OCRL 1LEIB 2ICWB 5IB4B 1KJ3H 4JZNA 4QRQB 3ULSB 3MRFA 3ALWA 5D2NC 3BDYL 3VWJA 4RZCA 1IAKB 4JN1H 3PHQB 1GVIA 4HH9B 2J8UE 2XKNA 1EUUA 4KJWC 1JJUA 4DUXA 5CGYC 1M6OB 5JUEH 3LKNB 4HWEL 4I13B 5E6YA 2F19H 1W72A 4WI6A 4HUXA 4JFHD 3VFSA 3F7VA 4L3AA 1AHWA 3FCTB 1F6AA 1IT9H 2VXSH 5I9QB 4JFHE 3MCG1 4XBGA 3DSNA 5DRZB 4TSAL 4M48L 4HX1A 1PGRB 5DD6A 1EHNA 1FGVH 1Q1JH 2AV7B 3GSNL 3MRDA 3HB3D 1FNAA 1QOKA 1JWUB 3N1QC 3SGDI 2X4QB 1U2CA 1NANI 4ELMF 1JYWA 5JNYB 1WWCA 1BVZA 1JPGB 3WIHA 4ELKB 4L8SC 1NCBL 2CIKA 2FZ3A 3EOAA 4HCRH 1A8JH 4XGZB 1YNKL 3MUZ1 3CSGA 4JDZB 3S96A 5CD3B 4JZJA 1T03L 3GSVA 2XZCL 3DETD 3ULVF 4RMTA 1RZKC 3E8UL 1T5XA 3JWDL 3VRIA 1H8OA 1U36A 4D9QD 1I8KA 3CGTA 3QIWB 2XY2A 1NAMA 4M61B 1S7RB 3RIAF 1YC8A 4QXTA 3HC4H 4OUOA 2B8OT 3BYYA 5D1QD 5GRXG 2DM7A 1CG9B 4PP2B 2YSSB 1IC7L 4ZAKD 2HG5B 3VG9B 1QYGH 3KLHC 1U8KA 1A9BB 2ZG2A 4JO1H 3B9AA 4AG4H 3CXDH 32C2A 5D2LA 5FDYA 4K3DH 3MV8E 4PRBA 1GPOL 4E42B 4OZFA 4TTDC 2XWJB 3AAZB 2YKLL 3B2UD 2Y23A 4MAUH 3WE6A 2V7HB 1D5IH 1UVQB 1I7UB 2DQHL 5T33H 4F3FB 4LHUG 5JW4N 1MCIA 4E0RA 3CU7A 3O45B 4CBPA 5EC2B 1X4ZA 2HFEA 3TPUA 3EYVA 3VGAC 3PGCB 3T04D 4OV6F 4QTHB 1KPRB 2WZPD 1UEYA 4N0CC 4XVUD 1UYWH 3VRLF 1MI5D 1Z0MA 2W9DH 1Y6KR 4F9PC 1LGVA 3S5LA 5HGAA 3RQ3A 4PBWD 3MROA 4PJ5A 4EJ1C 3TVMD 5I1GH 1I4FB 4MNHB 5DK2B 2YBRB 2DQJL 4TUJA 1F4WL 3D39A 2W59A 1IC5H 2UWEB 25C8H 3C5SB 5IESL 4WWKA 1X5XA 3DXAA 1A6ZA 3IAGC 1ZVYA 3E6HB 4FQ2L 4HUWB 4LLYB 3BUYA 3RHWK 4GLRI 3O3UN 2WW8A 5DD1H 1S5IH 4M3JA 2BVPB 4J7RA 1AGFB 3BEWA 4RX4A 1TJGL 1KXTB 2QHRL 2VNCA 5F1OB 4KMLB 1AXTH 5EB9A 3O3AB 3HC3H 4FQ1L 1CT8A 1JYVA 3BP4B 4U3CA 4AEEA 1CXLA 1HHJA 1HHGB 3GDBA 4OFDA 4X6DB 2GCYA 3RWGA 1U58A 1CU4H 3U6RB 3TF7C 4FQCH 3ULUC 4NZTH 1NUDA 2IBGA 1WCBB 3FT3B 3N9GL 2DQCH 4RGNC 3ZZ1A 2HTLC 5E94A 3M17A 4NZRL 1ZS8A 3BGMB 4NFBA 5L2KA 3LQAC 2B20A 4U1NB 4DW2L 3LKPA 4MJ4A 4PGBA 5E4IA 3QH3B 3I02B 3I50L 1TJHH 1VFBB 2DWDA 1BZ7B 5ESAA 5D7LD 2H1PH 2IPKA 4LPCA 3L3DB 4O4YL 5H8DA 2QLVB 1ZLUK 2MSPA 1WFTA 3O6KH 4NJ9H 5D7LE 1PYWA 5B38G 1HNGA 5F7LB 3RY6C 5EWIL 2I26N 4X5WB 3SBWC 3G04B 4NOBA 1F4AA 3T0DA 1U92B 2VMFA 2BFVL 1CL7I 1UA6L 3FQRA 1GAFL 1EHAA 4JB9H 1E4KA 1ZHNA 1AFVL 2FHCA 4ZTPL 2I07B 4UUJB 3R1GH 4BK4A 5JA8B 3PV6B 1EGJA 3P9WB 4F33B 5SWSA 3RGVC 4DAGL 3G08B 3VFMB 3B5HA 4P3DA 3ZKND 3ILQD 1DN2A 5CSZA 1N7ML 4MJ6A 3TT1H</