3V6BR

Vegfr-2/vegf-e complex structure
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
199
structure length
187
Chain Sequence
HQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPHKKLVNRSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/signaling protein
molecule keywords VEGF-E
publication title Thermodynamic and structural description of allosterically regulated VEGFR-2 dimerization.
pubmed doi rcsb
source organism Orf virus
total genus 30
structure length 187
sequence length 199
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v6bR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v6bR01
1MNUL 2E9IA 1FIGH 3QIBB 4U0RB 2VSCA 5C6PB 1OGAE 1XH3B 3MOQA 1ZHNB 1G7JB 1MLCB 1HKFA 3GSRA 4DAGH 4LIQE 5FA3A 4DWHA 4J4PD 2BNRB 3V2AR 4HDIB 4JM2C 3PHSA 4PJDA 3SE3C 1LEKB 5IHZA 1C8PA 4XRCB 3DSFL 4WFGE 4ZO6A 5E08L 4MA3B 5E6IB 5DFWH 5GRZA 3CK0L 5EWIL 1HSBB 4Z77A 1IFHH 3VFTB 4FQLL 1LO5B 3QH3A 1T80A 1SYSB 2EH8L 4PJ9C 4V1DA 2VMFA 4BH8B 1MCQA 2VKXA 4NJ9L 1IGJB 3F58H 2B5IB 3CFEA 3MGAA 1F4WH 4LSQH 5D6DA 4U7MA 3ARRA 4P2OA 1XFPA 3HZYA 5F72S 5EC2B 3D5OF 2GAZB 1OP5K 4ZO7A 4MXVF 4OBRA 4AL8L 1BEYL 1A4JA 3EIFA 1DBJH 4W68A 4GRLC 5DD3H 4HV8A 3V8OA 1QFOA 4P0DA 5D2LA 1KLGA 5HVFB 1JZ7A 4Q6IA 2P5EE 4ODVL 2VDLL 2HA1A 1NFDB 4XPBH 2V9RA 4G42B 1BQSA 4H1LA 2ZOLB 1ZE3C 5C2BL 1Z9MA 5F3HB 5IB5B 2XNAB 3IS1X 1BWWA 3W9EB 3VE0A 1OW0A 1N59B 1FNLA 4QXUL 1YPZF 3T2QA 4G6JH 4J3UA 4P59L 1UG9A 4R4ND 4A2MA 1NGPL 4JGMA 1CXFA 2WQRA 4DKFH 1CFVH 3BP4B 1BX2A 5CCKL 2BHZA 4LGSB 5HGDA 3ZYJA 2FATH 3V9FA 5J1AB 4Z76A 3FQRA 3WO4B 2F74B 4OI9A 3IU3A 3S4SA 3NCEB 2EYRB 1RK1A 1OGAA 3BUYB 2DQJH 1RJZB 5B38G 2CDGB 3SE8H 4JHAH 3M45A 3ORJA 1J10A 4L3CA 3DGGB 2A73B 4P4KC 4NBXB 5IQ7L 1I85A 3EOTL 3KDMB 4PG2C 3BVNB 3T0EE 4HBCH 3OSKA 4JM2B 3O2DH 1ZSDB 1QLFA 4DGIL 1L7IL 1ZA6A 5C2BH 1X9QA 2UZXB 3ULUE 3JWOC 3NPSC 4NWTL 1S9VB 3HCVA 1RI8A 4J8RA 4X9IA 4U1MA 1VPOH 4QXUH 1XIWA 3TN0A 3FO1B 1S9WB 4BQBA 4PJ9B 3THML 4R7NB 4DUXA 1YDPB 1G7MA 2OQJB 3MSPA 3UTQB 4ZPTB 5IEHB 1PGRB 3EJYC 3MV11 4FQHB 4IOFD 4YEFA 2FX7L 3ES6A 4XGZB 3SQBA 3CUPA 4RSVA 3ILPB 4PB9H 2ADGB 1ZWIA 2P5EA 4M9OA 4MYWB 4JRWA 4RFOL 4I0PA 5DVNA 1EMTL 4JN2B 4GRLB 2EDWA 1CI5A 4OLUL 2R23B 3U6RA 4KRMB 5T3ZL 4B50A 2DQIH 4RQQB 4LLYA 4H8WH 5DMGC 5FCUH 5TE6H 3UO1H 4PV8A 3VCLA 3QDGB 3ARBC 3MA7A 3MQIA 4EDXB 3VFGL 3G5ZB 1FVDB 4OJFL 3FZUC 1MVUA 4I0KA 5I1AA 4LLVA 1X4YA 2GJZB 5FO7A 2M2DA 3NH7H 5FHBH 3WFDL 4S1SL 4NQCD 4JFFD 1I9JH 4NFCA 4XPTL 3G04A 5IHUL 1BJ1J 1IAMA 4K07A 4YR6B 3MOAH 5AYUL 2BDNH 3V6BR 4YFEA 4ODUB 3X3FH 5GSVA 2YHGA 2GSIA 2KDGA 3W81A 2Z35A 2LABA 4LHJB 1JZ4A 5D2NE 4YFDB 5IWLA 4WJ5B 3JVGC 5GS3A 4MLIA 1ONQA 3EYUL 4ODXB 5C0JB 5CZKA 4JLRB 5HYQB 4EN3C 1CLOH 1S5HB 3D0LA 1YN7A 4MXWL 1JGDB 3T0EA 4HH8A 2VLME 4FFWD 5GGRA 3LCYA 2PUQT 4M6MH 3L5XL 3QIUA 1KCVH 1S3KH 4P4KB 4LKXA 2VISB 4UDTA 3QYCA 4KKCD 4GQPH 4Q9CA 5C2UB 3RQ3A 3UTPE 1BVLA 3BKCL 3MRKA 3QXWA 4GFTB 5T3XE 2JKXA 1U3HD 5KS9A 3IDIA 1CICD 5GRVK 3NPSB 1IGML 4NGHL 2AK1L 2EIEA 4C56E 3P77B 4P5TD 3S36L 3HC0A 4MNGB 1XGTA 2Q87A 1DUYA 1AI1L 2DQHH 4XCNA 3RPIA 5HGBB 5E9DB 4U1IA 3CFDA 1F90H 1IQWL 4F2MA 4CKVX 4HFWB 3BH8A 3QUZA 5AYUH 4HUUA 2WM0A 1RZ8A 3A6CL 1RIHL 2HLFD 3RTQA 5A3ID 1T4KA 2VZ1A 1AGCB 1AGFB 1KJ3L 3FOLA 1PEZA 5MEQA 1XCQB 4WI3A 2IANB 3VG9C 3LKQB 2IAMA 4WW2C 5A2JH 1AQDB 4RNRB 3RIAK 4YH6A 1YQVL 1IBGH 1GRWA 1JMZA 1NFIB 4PGJA 1E4WH 8FABB 4GG6E 4K3DH 1KG0A 2O5ZL 3BEVB 2QKIA 4XXCC 4Y4HD 5IMKA 3RVUD 1DQJB 1JPSH 3QUYD 1MFDL 1R0AL 3QDJD 4XHQA 3FO9A 4KTYA 4CU8A 2E3VA 2V7NA 3ARBB 4P23A 1KLFA 5I2IA 3QXVA 1PJ9A 4WUUD 3TIEB 3LRSA 5LGKA 4FZ8H 1WBXA 3RHWK 1QP1A 3HE6A 2H9GB 3T1FA 2BRRL 3ESVF 1U42A 5KSVA 4QF1A 5I30H 4BK4A 5D2NA 4JQIH 4OT1H 4AEHL 1OCWL 5T1DH 3WFHB 5D5MF 2AP2A 4AIXA 1F3JB 3B43A 4DW2H 3PGCB 1T66C 5HGAB 3BUTA 3BN9D 2FGWL 3D85A 3X3GL 2CDFA 2LV4A 1S5IL 3GHBH 3UP1A 3W0WD 5HHMD 1F4HA 1LNUA 4G3YL 4EN3B 4LLDA 2ZNXA 2BP3A 5EO1A 5EO0A 4G7YL 4U1SB 3KG5A 2F9BT 3PWPE 1IC1A 1Z6JT 3OR7B 3LQAL 2VQ1B 1T3FA 2P24B 3GJFA 1ZV5A 3O2WH 4X6BA 4GAYA 3TH4T 4RZCB 2P44B 5TDNB 1YQVH 4DGVH 1U8PA 3M17B 2R4RL 1OTTC 5JR1H 1W0VB 5D96C 2NY6C 5GGTL 4C56A 1A9BA 4U1LB 5ESAB 2CK0L 2VERN 1XR8B 1EAPA 1FPTL 3VXQB 3TNMA 4YBQC 1MI5D 2Y5TB 3KJ6H 4JO1H 1I7UA 1RUKL 1HZHH 1J0YA 4P46D 5F6IC 4G6MH 4BELD 1P5VA 3CDGA 5L6YH 5J3HC 3JV6A 1FNEA 5C09B 1CDBA 3OKNB 4JY5H 4PJ8C 2VXUH 2C3XA 1D5BB 1OCWH 2ESVE 1KIQA 1JTPA 4HKJB 4GG6A 4XPHH 2R0KL 1NGXA 3QFDB 5KSUB 3VG9B 4WW2B 4W4OC 5DO2D 3TZVA 3ZT7A 1PSKH 2DJSA 4LSTH 3JUZA 3U48A 3X14A 2Q7NA 4S1RL 2RFXB 1GGYA 3CFCH 3PHQA 4OCYL 1YY9C 4PP2A 5CBAB 3IDMB 1S9YB 4LSPL 3FQTA 1LK3L 4WUKL 1QRKA 4MJ4A 1JJUA 5J8OA 2VABA 2R29H 1I1AD 1BMGA 4P2QB 4PJBF 5E24E 4S0TD 1ZEAL 1INEH 2R8SL 3HG1D 1VFBB 4YX2H 3U2SA 5DMIL 3P4NB 2XYCA 1PYWA 3WMSA 2I9LB 1QLEH 1JZ3A 4XNXH 4P57A 4Y5XC 2ENSA 4FZEL 3VFOB 2Z92A 3NPZB 1G7HB 5LQBH 2XZAL 1KCSH 3C60D 5FUZH 5GRVL 5BRZE 3BD3A 2K9UA 3PWPA 1BZQK 3RWGB 5EU4A 3L3JB 3EO9L 4DZ8A 2DMBA 2J8UE 1SHMA 2VAAB 1JGEA 4ODSH 4FQXC 3UCRA 4QHLA 1NAML 2J8HA 2R0KH 4LVHC 1LO2H 3MRQB 5SWQA 1A9EB 1K8IA 2XXMB 2X9XA 3SCMC 5T33L 5IROA 4BQ8A 1BLNA 4DCQA 1NUFA 5D96B 2NY6B 2BCKA 2VXQL 2CRZA 3BDXA 3CSYB 3ARVA 4LU5H 1WJ3A 4UTAL 3NA9H 4XVTH 3HZVA 4ZS7H 5F1KC 1T03H 1NGQL 1O7SA 5GGUB 2HYMA 2FX8L 3ZHKA 1ZEAH 1P84K 1LEIA 4PJIF 2R8SH 5F6IB 2ESVA 4JVPA 3G6AB 3OF6A 3HTLX 2VXTH 5D1XC 2I9TA 3F62A 4PJ8B 1U8MB 3RWFA 2QEJA 4N0CD 2CRIA 4XNUH 1HE7A 4NO2A 5L88H 1AGBB 1IQDB 4TULH 4XP9H 3RAJH 3KLHC 1WIPA 4NRZA 2UZIH 1M6OA 2EXWC 1X3DA 4X6DB 3BKYH 1XF5A 4RIRB 1R3HB 1TIUA 2NY4D 1KC5L 2CH8A 3QDGE 2IADB 2DQEH 4LVNC 5HHQA 1A7OH 2QADC 4EEEA 3HUJB 3HR5B 3DVGA 4KHTL 4MSWA 1B2WL 1JF1B 4R4BB 1HSAB 3I6LD 4O00A 3TH3T 4LOUC 3D0VA 4QYOA 1T0NA 3S9DB 1X5ZA 1I7RA 5CJ5A 4QTHA 1NL0H 3S3PA 5DQDH 1IAKB 4Y2DC 3QFJB 4WI2A 3RY6A 4U33A 5BRZA 2RQ8A 5HHVL 1ZS8A 3AFLA 4Y5XB 1U58A 1Z9SA 2NPLX 4XTRD 5MENB 4KKNA 3VW3L 2AXJA 2J8UA 1F02I 4XC3L 3KGRA 1F58L 3C87A 5BV7C 5JXEA 4FS0A 4K9EL 3VXSA 5JDSB 2X7LB 12E8L 2NR6C 4F7TA 4PTTB 1YYMH 1YMMB 4FQXB 2AJXH 4XPAH 1H15A 4LVHB 3CDYA 3QIWC 1FZJB 1G0DA 3SCMB 1QYGL 2FWOB 1PG7X 2IPTH 4Z7VF 3TO4A 3ISWA 3CZFB 3U79A 2Y9RT 1FH5L 1H3TA 1C5DB 3QDME 3F5WA 2QHRL 4JFHE 1WC7B 2L0DA 1I8MB 1YEEH 4YHOH 5ETUA 1DUZB 1WT5C 2UYLA 3VGGA 1KJVA 4FP8L 3IYLW 4Q9QL 4UZGA 5F7NC 3IDGB 1LE9A 4IBLT 3SJVE 2P7TB 3LHPL 4E5XA 3T0WA 4NNYB 4M1CD 4JZNA 2D0GA 4HH9B 4KK8C 4N9OB 3VFUB 1T1YA 3W39B 2LU4A 5D1XB 1WBYA 4EBQL 3MNWA 3DX9B 3GIZH 3REVB 5F1NB 2C4XA 2EXYC 3D18B 3NOIA 1BZ7B 3T2PA 2LTQC 2WWMC 1TITA 4B5EA 4MB3A 5E5UB 4OZIF 5SV3A 3ZE0F 3V0WH 4NJAH 3IAGC 4XBEH 3CFJB 5I18L 1BBDL 4JO3H 4XH2A 5J13C 5FK9A 1V7NL 4K8RC 5H37H 1OAYL 1SEBA 1MQ8A 4OZHE 2DM2A 4NO0D 4JRXE 3EOYG 3HMWH 4LVNB 3RA7L 3O8XA 3GMNA 3BZFB 2EIZB 3WJJA 2QADB 4OLEA 3WD5L 1QYGH 3H9ZA 4FA8A 4F7CB 2H26B 3BKJH 3U0TA 3O2DA 5M95B 1N0LA 5CJQL 1FH5H 3EO0B 4MLSA 2I07B 5IBLD 5J56B 4XBGA 5EUKA 2QHRH 2DTMH 1EVTC 5EC1B 3RY5A 2WUBL 3LKNB 4HHAA 4LLMB 4YXHL 3WKMH 2O5YL 5CJBA 4KJYB 1EEUA 4Y2DB 3C5SA 1NCBH 3L3IB 2CKBH 5GGQL 5IMLB 4TNWK 5JUEH 5C0BB 1XEDA 1OAZL 3KAAA 2EDOA 2QLVB 4XBPB 3KYNB 3ULVD 5ESQB 1QR1B 3JWDC 4E41A 4GW5A 2FJGB 2R69H 2VDQH 3EOBB 5GGVH 2LAAA 4LNVA 1PLGL 5BV7B 1G7PA 4CU6A 5JIHA 1WFOA 2M8XA 4Y4FA 4OCNC 1A6TB 1G0YR 2BOBA 4OCLC 2DQTL 1FO0B 5D7KD 5F96L 3GMRB 5BOZG 3DX7B 4ZSOE 3QIWB 4LRIA 3VGEA 4LCCC 3VGFA 3QDMA 4UV7L 3L3GB 1OM3L 3VWJC 3UZQA 4X8JB 1CGSL 3NCJL 4NDMA 2FJHB 2XQBL 3R0MA 2BVOA 3C6LD 5KVGL 4FABH 2PR4L 5FGRA 5EA0L 1VFAB 4H88L 4NFDA 5CBEB 4P9HC 1NKRA 3SJVA 2XTJD 3R06A 2BRQA 4YGVA 1EGJL 5DMJB 4PRPE 4FQCH 5DYOB 3L3DB 3SKJL 2Q7YB 3S88H 4D9QD 4Z0XB 3T04D 1MOEA 1NBVL 3SGDI 5IUSA 4NZTL 5CJXA 1KB5L 4TTDD 1DFBH 3L5HA 2O5YH 1D5MA 3B9KC 5EFIA 3HC3H 1FNSL 4BFIA 1DBKH 4MCYA 1JI2A 3IRZA 4XCEA 4CN1A 3V0VA 5FDWB 3ARGD 4I3GA 4HS8L 3BP5A 1U91B 1MPAL 1D9KC 4N9GB 5IJVA 4OLVL 4Z7WE 4LSUL 5ERWB 4M7LH 3SQOL 2LTQB 4EOWL 2EEAA 4JY4A 5DJDA 4OZHA 4F33B 4JRXA 1YYLH 1A7QL 1RZJH 2B0SL 5E2UL 5JZ7C 3DVFA 3KR3H 5J13B 4HZLB 1J05A 4LFHD 4GAJH 1P9MC 1LK2A 5L2KE 1I9RH 3MRFB 4QRTB 5HYJB 1RU9H 1MFAH 5ICZB 1FL3B 2YWZA 3UTTD 4MAYD 4PD4K 4X7SL 3OR6A 5IBTH 3WSQL 5FF6A 1DE4B 2X4RA 5IIEB 1TJHH 3FONA 4LEOA 5IVOA 4H88H 3JTTB 1HI6B 3BDYL 1Q9KB 4OQ1A 4HFUL 3CZJA 2XKNA 1MRFL 5FGCB 3HPLB 2Q8BH 4GW4B 4L4JA 2IMMA 2VDKL 5GS0H 2ERJC 1QBLL 4GRWB 3RVTC 1OAXH 4GMTL 5DLML 4N8CL 5FO9B 4ZSOA 2HFFA 3HRZB 5DJ2A 3STZA 2IEPA 3V4UH 4OLWL 2K7QA 4PD4J 2YWYA 3GMQA 3MTRA 4G6KH 2FD6L 2JTDA 4PG9A 1A7QH 1EEYA 4LCCB 4TVSa 1DLFH 2IPKB 3VWJB 3MCG1 1IAIL 1AGDA 2JJUA 4OM0H 4PJ5D 4PRPA 2HT3C 2OX5A 4MJIE 4XCCL 4NRYB 1EA9C 4L5FH 4WI8A 2ZZUT 2FH6A 1T21B 5D7JA 5IK3A 3IXTB 3QHFH 5DEZA 3QEQB 4DN3H 5K93A 3G08B 3U82B 4WGVB 5E8OB 1FJ1A 5GS1A 4O02H 4NKMB 1VADA 5ID0B 3FN3A 2XA3A 3FTGA 1K5NB 1ZLVK 4NUJA 3MRMA 3VXOB 4F37F 2C9AA 3B9KB 5D6CA 2JJVA 5E2JA 4QGTA 4L29A 4XP5H 5LAXA 2OL3B 1T6WA 1GH7A 4LSSL 2ZUSA 1ZT1B 1D9KB 1IC7H 4DN4H 5I8KH 3OAYK 4WFHE 2GT9B 1QBLH 1X5FA 5L2KA 5HHOD 3T4AB 4NNXB 3MROB 3HN3A 1JZ2A 2VXVL 2PW1B 3FN0L 4JFDD 2DQCH 3EDFA 2FD6H 5ADPH 2ILLA 5CHNB 4PGEA 1MWAH 4HKXB 3UJJL 4OUUB 5AZ2H 3UTZB 1PVHA 4MA7H 1BD2D 4L4VD 1LMKA 4NKOA 3BP6A 1U6AL 2OJZH 2R2CA 3SDDA 4K3JH 3UYOD 4FXGA 1DVFC 4IMKA 1H5BC 3Q5YA 3LDBC 3PWJB 5CLTA 3INUL 3O81A 4JPVL 1J0JA 4JFEB 2AQ2A 5I1EL 1FN4A 5AG9A 1M1SA 1X5XA 1CG9A 4L4TB 3PABA 3EYQC 1S78C 2HKFH 3A6OA 5H8DA 4N1EA 4OQTH 4OFPA 3RWEB 3O3UN 5T1LD 3EJJX 2ERJB 2VB5A 1U95A 1F8TH 1YMME 1CDUA 2AXGA 1NCWL 1RUPL 3FT2B 3R1GH 4R0LC 4QY8B 5I76A 4UV4H 3PL6C 4LSSH 5DEGA 3SDAA 2VXSL 1S7UA 4PJEF 1D7FA 5CGMA 4UNUA 5ALBL 4MJIA 1MEXH 1TETH 4NO3B 2G2RA 5D70L 4GAGH 1N7MH 1QEWB 2ZUTA 1F6AB 1FZMA 3G6DH 3RVVD 3OJMB 2K1MA 3PP3K 4R4FH 4Y0GA 5SWZE 3UDWA 1QNZL 1CFQA 3TVMA 3UBXB 4EUPH 4PJCE 5GIRB 2I24N 3AMLA 3CCHB 1RHHA 5E8PB 1MIML 2IBZX 5E1HB 5JLZA 4XHJC 3UZVB 1I8LA 5DJ0B 4PJHF 1BQLL 3WEXA 5EUOF 1AR1C 1OPGL 3O3AA 4J12A 4G6AC 1NUNB 5D72L 2NW3A 3VGAC 1NKOA 4WNQA 1J1PL 5HDQL 1QD0A 1YEGL 1G9NC 2DQDL 3LEXB 1G7LB 5JPNA 4ZYKB 4P2OD 3FRPA 1NCWH 3UJTH 1VFMA 5DJ6A 1QSFE 3HRPA 5CP7B 3HI1B 1ZHBA 3MGTA 1N5YH 4PRIE 4HAFA 4XNYH 2FX9L 4PY7A 2R0LL 3GSVA 1V3KA 1S7WA 2IBGA 1R5WB 4O2EA 1KEGL 1U8NA 1BOGB 5DTFB 1ORQB 2F54B 3QEUA 4FHBD 5EZIL 2JJSC 1IL1B 5GS2H 4IRZL 4J23A 3KWWA 3H9HB 1DVFB 1EFXB 2B4CL 2GJ6B 3S35X 4X6CF 4WWKC 1H5BB 1BM3L 4ZDHA 1N8ZB 3LDBB 5A2FA 1SY6L 3ZDXE 2BERA 4M7ZC 1WBZA 4HUXB 1OARL 2BSSA 1CD9B 5C0CD 5D7SH 3UPRA 1NC2A 2YC1B 3QDAA 1JGUH 1YEIL 1HH9A 1S8DB 3P0VL 3MJ7B 3D1MC 4D0DA 3H9SE 4HJ0D 4R0LB 1I7ZA 4OIIL 3P0YH 3T3ME 5FGBA 5I1GH 3ARYA 3PL6B 3OB8A 1AIFA 2VUOA 1BVKB 1PBYA 5GISH 5C0ND 3ARDD 5F89A 4OCWH 1J8HA 3QWQB 4U4BA 1OGAD 1OF2B 4MNQB 5JW5A 3U4AA 1KN4H 5KVDH 5DSCB 1U8LB 4LP4A 2Y6SC 4ZUUB 4B7IA 1D5ZB 5KZCB 3QI9A 3U7AA 3WNKA 4CVZB 4MD5B 5SWZA 4JDVB 2VR5A 5JHDE 1CTOA 5I19L 2ICCA 4HK0A 1JYXA 5HYIA 5DJYB 4UU9B 4WFFD 4PJCA 5D7IB 3TGXA 1RZKH 3WS6A 1QFPA 4X99A 4J6RL 2O26U 1YEKH 4WFGD 4NKDA 4X80H 5EULV 2V5RA 4LARL 1RUQL 3DUSA 4KDWA 2K7PA 1Y18A 4KXZH 4YHPB 2R1WA 4GBXA 3CVIH 5DJXB 1CLYL 3QJHA 1W72B 1FL6B 3CXHK 5EU6E 3QEGH 2DWDA 3F7VB 3NABH 2EDDA 2ZKHL 5FYKL 3VGAB 1XIWD 2Q76B 3TN0D 4XP6H 2WIIB 3S5LB 2ZCKL 3DPBA 1YC7A 3TO2A 3RL2A 3ZE1E 5CEXA 1AD0B 1JGLH 3ZKMC 4PRIA 1EERB 1U41A 5ACZA 2NNAB 4MQXD 1IGFH 3G5XA 1KTLB 3UAJD 2JB5H 3TBVA 1AH1A 4PTUB 1F3DH 2BK8A 1KV3A 4IS6A 2BVPB 3DOSA 3V6FB 4OLYL 3T65A 5DD6B 5B39A 3PWVA 3MBXL 4HGKC 4NQEB 3D39E 3LN4B 1DQLH 4NC2B 5AZEL 4KRPC 1TVHB 1L0YA 1UCBH 2H32A 2ADIB 1D6VL 1EEQA 4YDLC 1NEZA 4Q74A 4QRRE 1QACA 4R97C 2CR6A 5CGYC 4OF0A 3CXHJ 3WFBL 1UCTA 2UUDK 5BZWA 3EYOA 5I19H 4CW1B 3IDYC 1QSZA 2AQ3A 4WWKB 4R3SB 1SBBA 1L0QA 2VC2H 5I1KL 3IJHA 4M7ZB 2HKHL 5FKAB 3NIFF 3KS0H 3D25A 3KYKL 1MLBA 3CX5K 4MQTB 4XAKE 1QRNE 3H9SA 3MREB 4HUKB 4YAQA 2Y5EA 3D2UB 4HIIA 2F53A 3O41A 3CJJA 3HI6H 3KPOA 1GGCL 4X5XA 3MLRH 43CAB 5HPMB 4QHKI 1LHZA 3S37L 3JWOL 3MRBB 1RZGA 4QHMB 5C9JA 3FO2B 2NY5C 4XWGL 1CBVL 4A6YH 2D7TH 5GRJH 5CKGA 5JHDA 1QSEA 4ZD3L 2FHFA 4O4YL 3SGEH 4N0UE 3VWKD 1DQQA 1FV1B 2FDBP 3V52L 1MHPL 1U0QA 4J4PC 2VDML 1RJLB 2Y1VA 4GAFB 3WNOA 2OLDA 1SJEB 3QIUD 3EFFB 3VXPB 5AZEH 2BOCB 3GMPB 3TBTA 3SE9L 2Q3AA 3LKSA 4KROD 3ZT6A 4GLRH 4HJGB 5I0DA 1N2RA 1N0XH 3ULUD 3GUTB 1BJMA 4DTGL 4QHKJ 4PUBL 1NJ9A 2Z31A 1X5KA 5EU6A 3MRLA 2EYSB 4LLUA 2F8VA 1FL5B 4FQJH 3V5KB 1MHCB 5DRXB 1BF8A 1YQ2A 1OP3K 1U93A 3T2NL 2CKBA 1YA5A 2X41A 4WV1A 3GSNH 3WHE1 5CEZL 1NSNH 3PGDB 3QNXA 4LCWB 3QUZD 1CD1B 5JNYB 1AC6A 3D39A 2IGFL 4U1JA 3SE4A 1CFNA 3RTQD 1DSFH 4TSCL 3KPSA 5IW6B 1I3RB 4WY7L 4JKPL 4QRRA 1B88A 1PZ5A 4XWGH 3NN8A 4OI7A 2YMXL 3HPJB 4PRDA 2IAMD 4KRPB 3MV7B 5AD0B 1JRHH 3D69B 2DQFA 3EW3B 1LEGB 3N1FC 3ULSA 3WIFA 4YDLB 2JJTA 5TFSL 3K1DA 4PJAB 1JWSA 1IT9L 4KVNL 3BWAA 4R97B 5BQ7B 4IRSD 1E6JH 4JFEE 1UA6H 3WUWB 2X40A 4OZGF 5FXCH 3T0VA 1E27B 3IDYB 1IGTB 1XCTA 2AEQH 4D94A 5KW9H 1FORL 1P7QA 3QQ9D 4XAWL 1QRNA 1NCNA 4R4NC 4E0RA 4N8PA 2FIKA 3S98A 15C8L 4P23D 4HBQA 4KUZL 2DM4A 3B8SA 3KPQB 2OP4L 1J11A 1TMCB 1SYVB 2JCCE 3FB7A 1NC4A 1FG2A 1UXSA 3RFZC 3RI5K 3QXAB 1J1OL 1OTUC 2FBOJ 2AXFB 2OTUA 4JFOB 4J3SA 1E28B 4AQOA 1UJTA 1VEMA 1A21A 2YA2A 5DC9B 1KENH 3QPQD 4N0UA 4G7VL 4DK3A 2EDFA 1PQZA 3EBAA 4LAQL 2VLMD 3C6SB 1PY4A 2PF6A 1HHIB 1XZ0A 2IGFH 4KAQH 4PRHD 3FFDB 3IFOB 5HHXL 4M6AA 4MDJB 2CDEA 4QXGH 4WY7H 1HHGA 4UT7L 4WHYH 3UTPD 1KBGL 5C70A 5JQHC 2DMKA 2MMXA 5T3XD 3T77A 4RAUA 4PLJD 4NQVA 3W11D 3ILQC 1CCZA 2GTZB 2JJWA 3PHOA 4LRNH 4YK4C 3SOBH 4C56D 3ECBB 4YFLI 1A14H 5JQ6L 4LNRB 2ADJB 4G8EA 5TE4L 4HIJA 4M00A 2AQ1A 4P9ML 2VYRE 5MHSE 3VG0H 2X1PA 3QQ3B 5KS9F 4IOFC 2FO4B 3V4VL 1HXMA 3O3EB 4QRQB 4FMKA 4TOYH 3VFRB 1BFSA 5IFHH 2FL5A 3V0AC 1I1RA 1RD6A 1RIVL 4JG1L 1T0MA 2H1PH 2FB4L 4ZUSB 1LP9A 5ACMA 4W4NA 1YECH 3QQNA 1QFUH 5SWSE 5M7QA 1GJIA 2PETA 3FHQA 1J1XH 4M02A 1P5UA 4Q2ZA 3IVKB 2DYPA 1S9XA 4HK3J 4Y16A 4Z6AT 4ERSH 1BF2A 1ULVA 5HI3C 3X12A 4JFZH 4CL7A 5GGSY 2D31A 3CSGA 3HE7D 3I6KB 1XF3B 2CLVA 2HJLB 3KPMB 3ZYIA 2VDPL 1H9VA 2E6QA 4UT7H 1IAIM 4LPYA 3REWA 3FFCA 1X4XA 4P2YA 3RUGE 3CLEL 1KJMA 3K2UH 1AP2A 2JCCA 1AFVH 3H9YA 2EKSA 3HAEB 1ITCA 1MCRA 4CDGC 2F5AL 5K9QG 4KI1A 4OD2A 1T20A 5D9SA 2DWEA 2FGZA 4TUOA 1H3UA 3FAXA 4JGJA 2IBZY 3H3KA 4PJXB 2FHBA 2BHUA 2RAMA 4MS8D 3W2DL 5DDHB 4HUWA 3KPPA 2H6PA 5KG9A 2EECA 2AKRA 5BJTB 3I50H 5FUOL 3JTSB 5I66A 3PWPD 1CWVA 4UIMA 5EZLA 4I48A 1Q9WA 4NO5A 5IHLB 2VR9A 4KKCC 3VGDA 2DM7A 2YPKA 4D0BA 1QBML 1YEJL 3QNZB 2YBRB 1P53A 5CJOH 4A2LA 1FAKT 2YOCA 5DUBA 1K4DB 4JR9H 3T09A 3SDXF 1U3HC 2ZJSL 1FFOA 1CICC 4X5WB 3IF1B 2YSSA 1MWAA 2BFVH 4I1NB 1AHWA 4YO0B 3F7YB 4YK4B 5HDBF 3QCVL 4XPFL 4P5TC 2DLFL 3A6BH 3DXAB 5JPMA 3GRWH 3WHXA 1YEDA 1M7DA 1P2CB 2ZSVA 3IJSB 1UVQB 3L7FB 4NM8L 4Z7UB 5TF1H 4JY6B 1NCDL 1Q1JL 2AEWA 5DHYA 4QHNB 2IH3B 5A3IC 4OQTA 2NY1D 1MJ8H 3OF6D 4NCC2 1U8HB 1IKFH 3QT2A 1IC4L 4OFKA 3OV6A 4R8WH 5SWSA 5IB4A 3BXNA 3MRGA 4XNMA 4S2SA 3TNNA 3MUGA 2EDRA 1I3VA 4P3DA 1BOYA 1I7TB 4E42A 3G6JB 3LB6D 3WIHL 4Y4HC 1UZ8A 1IAOA 3WIIL 3MFFB 3IU4H 4BZ1H 3QUYC 1I75A 1RIUL 4PS4L 5T5FL 1JMXA 1ZANL 1WFUA 4LEXL 4LL9A 3RUGA 5IVXB 4K7FB 3NCBB 2W9EH 4LDLB 5IOPA 3AUVA 1V7ML 2AABL 1JHLL 2X9YA 3U7YL 4M8QB 3MNVB 3AXLB 4XB8A 5F1IA 4JFFB 5IM7A 3NFNA 3QRGL 4AMKL 1S7SB 4EUPA 4XPFH 4PGBB 4V2BA 2XWBB 1A3LH 4LQ1A 5B39G 2YN5A 3U4EA 1RUML 1P4LB 2APXA 5EIIA 3TLRA 4YE4H 1NEZG 4HK3N 5BRZD 4OTXL 2EEDA 2D7QA 3OKKA 4B41A 4JFYA 2V9QA 2IALA 1VA9A 2IG2H 5A2LH 3NBNA 4NUGH 4YIQA 2ICEB 2QQNL 5FM4A 5BVJA 3AMKA 4NQSA 3VXSD 2E6JA 2A38A 1ZGLB 5KJRH 4LBEB 2XN9E 3OXSA 4ONGL 3PNWB 3IRPX 4AENA 1U3HB 1CICB 4TVPE 4OZ4A 3IAQA 4LSVL 3TO4D 4XP1L 1ZT4A 4P5TB 5EOTB 1K4CB 1Z3GH 5D8JL 2HTLD 5H94B 1IEBA 5TE7L 1EPFA 2R1XB 1A2YB 1QKZL 4MXVE 4ALAL 4AMKH 4C55A 1JWUA 5IFJA 4AG4L 1VERA 3HB3D 4ONHA 1XF1A 1HINH 1JYVA 5H37G 4F9LA 3OAUL 4HWNA 2A77L 1IGIL 3EYVB 1JGVH 4LLQB 1T1ZB 3O4LD 3CXDL 4P2RE 3BRGC 4DKEL 2HAZA 4ZQKB 4JFPB 5DUPH 3S34L 3VDBA 3LS4L 2BVQB 4HKZB 4Y4HB 3CFBA 1YPZE 1YEFL 2EDLA 3QUYB 3QDJB 3QUMB 2GSGA 1I1AC 1CTNA 4G9FB 1GHFH 3MCKB 1MFCH 3P73A 5BV7L 4WUUB 3FQNB 2BC4B 1HH6B 5J1AA 3O8XD 4OSUH 3DX8B 3LSOA 2XPGA 1KCUL 4U0QB 1LDPL 2GFBA 4LSVH 4M6NL 3GIVB 1FO0L 4IDJL 2EDYA 4JM4H 1Q9LA 4LSRH 1EJ6A 5L9DL 4QEGA 1RZFH 1M7IA 2DKMA 1R5VB 4UUJB 1NGZA 3GMLA 4RISL 2FSEB 1DDHB 4GW1B 1QKZH 3TYFA 3C60C 3O45B 1I8KB 2OJEB 4N1CA 3NACH 4IMLB 2QQKL 3W0WB 5HHMB 4GKZA 1P1ZA 1K6QL 4RDQG 5K59F 2E8YA 2GITA 4X6FA 4E41D 1I1YB 4R96B 2XN9A 3DIFB 2HJFB 4HXBL 4OCMC 1FGVH 4KKLD 5C0FB 4X7TA 3ZKSD 5AEAA 1QR4A 1NLDL 3V5DA 4GXVL 3MLVH 5DHVH 1PKQB 5IV2B 5HGGS 3MRJB 5ICYB 1RK0B 4OGXL 1X5JA 5FYJL 1AO7E 1QLRB 2NLJA 3BZ4A 3FO1A 1S9WA 1EK3A 4KY1L 1MHHA 4K94H 1KJ2B 4JFHD 4JFQA 4R6UA 7FABH 2ED8A 1O7VA 1ZTXH 4B0MM 5L8LB 4KHXL 1JFQH 1A3RH 4Z18A 1TCRA 4M7KL 2X4OB 5DJ8B 3TPKA 3PWUA 1J86A 3GNML 3BAEL 1NDGA 4K8RL 2Q6WA 3SJVD 1E6OL 5JHLH 4PB0L 3VD7A 1FO0H 4P2RA 4HPYH 2CUMA 2XG5A 2F8OA 4N0CC 4NQXA 5MEOB 4KJWD 5FCSH 2CUHA 4RQQA 3LN9A 2A6DA 1MJ7H 2I27N 1UM5L 4Y1AE 2QL1A 5I1CH 1JHTB 1YPZA 4P3CL 4RAVB 1WGOA 4IIQC 4QOKE 5K9OA 4I5BB 5DK0A 3E0GA 2NY4C 1U3JA 1UYWL 1WZLA 2NY3D 5CWSA 2I60H 2QTEA 5JO5A 2NX5D 4U1KB 4A6YA 1NGWB 3JWDL 4HUMB 2G5BA 1B6UA 2OMNA 2NXZC 1R3KB 4OCSH 1I1AB 2Y36L 3RNKB 3G5VB 1RVFL 4ODTL 4GQ9L 4ZUTB 5DD5L 4U1NA 4XCFL 1B3JA 4BZ2H 1FVCB 3IXAA 3RJQB 4M3JA 5DVOA 2QR0A 2XRAL 3KNBB 4PIRF 4NM4L 4ODXA 5C0JA 4NYLB 3DROB 1T04B 3QWOB 1DL7L 5DQ9B 5F88A 5GSRA 4XTRC 3F6LA 4M5ZH 4JQXA 1Q72H 3C60B 4P99A 4Z78B 3MYJA 5IGXH 2A9NL 3H2WA 3GSNA 1HHKB 3OGCB 4P9HL 2D03L 1T2XA 2Q1EA 3A67H 4PYHA 2MHAA 3ROLB 4WW1B 3CMOH 2D2OA 4WEBL 1OGTB 3NFPA 3NVQA 2V7HA 4Y8AA 4KRLB 4YHLL 2P8PA 5JW4M 1YJDH 1A6AB 4LPWA 4XMLH 3ZKND 3L1OH 1AO7A 3NZ8A 4RBPK 3ARFA 2ZUUA 1OT2A 4FFVD 1A64A 2LVEA 3EYFA 2Q86A 1CGXA 1AE6L 4PLNC 2OL3L 3WE6B 4KJQD 3P11H 1A1NA 4UQ3B 1HHJA 1NCAL 1NMAL 4HLZH 1G7IA 3LKOB 1OVZA 4U3XA 5C3TA 2V5MA 3HHRB 3ZO0A 4PRPD 1YY8A 3N1QC 4YQXH 4D9RD 1HOCA 3QISA 4KI5D 4Q58C 4CJ0A 2EZ0D 1G6VK 2X10A 3O3BB 5KAQG 5DJCB 5D7JD 3DURA 5E00A 1IGYB 4XMPL 3MR9B 2J6EL 1AR2A 1P7HL 5C0RH 3BSZH 1B0GA 5MERB 4Y1AA 1FE8L 3AU1A 2EYTA 1T83C 1MQKH 4ODWA 2BZDA 4UINL 4OZIB 4QOKA 3NZHH 2JELL 2HMID 3MNZB 4N8VA 3QPXL 4K7PH 5T5NF 4IIQB 3DTXA 5E1AB 4JZOA 2NY4B 3WS3A 2FBJL 1IKNA 5L2KD 5EH1A 3GSWB 1MY7A 1G7QB 1L6XA 2NXZB 1H0DA 2X42A 2MCPH 4M62L 3T4YA 4NQCE 4GKSA 5E5RB 5D5ME 3U0PA 2FR4B 5HYSB 2DIBA 3OJ2C 1T7WA 3QZWB 1TZHB 1ED3A 1AE6H 3GBNH 1Z9LA 5DHXB 2OL3H 4JB9L 5E2VH 4ZTOH 3JVGA 1R3JB 1N3NA 5INDB 4XWOD 4YHZH 5DRZB 2VDNL 1JF6A 3ULVC 1ZAGA 1CE1L 5J6GB 1INQB 3GHEL 3U36B 4HG4K 3PV6B 5F9OH 4BQ9A 1OQOA 5HYFA 2CGRL 3L3OA 4KFZC 4CN4A 2R56L 3ARED 1NGYA 4FFZL 2HH0L 4UDUB 4UTBH 5JXAH 3AAZB 4LCUA 3QUKB 3MLUH 1QFWH 1Q8MA 4J1UB 5IB3B 1BGXH 4AEIH 1FLRH 2AJYL 4TPRL 2VO5A 3K1KC 1JZ5A 4KXZI 4X98B 4M48L 3E6FB 4KDTC 1UWXH 3SDAD 1MAJA 4UT6L 3LMJH 3C6LC 2JIXB 1C12A 2ORBH 4MJID 4YDJB 3Q48A 1CT8B 1RUAH 1CF8L 4HG4J 1MCBA 2XTJC 1LO3L 2ADFH 4WFEE 3I02A 3QQ4B 1UWEH 4L9LC 4X4XB 1MY5A 5DS8B 3FT4B 1QPXA 4TTDC 3ALWA 2WIMA 5FYKU 1B4JL 3TVMD 4OAWA 4JJ5B 4KI5F 4J3WA 5KSUA 2WP3O 1XGRA 1OWRM 4G9DB 2D4FA 2QQLL 3QG7L 3B6SB 2VDNH 4XXDA 3ARGC 3P9MA 3JV4B 5GRUH 1DEDA 1KN2H 1W0WB 4XXCA 4F8QA 1J9CT 5F6HI 1ND0A 4WFHD 4UOJA 3BGMA 5IB1B 4PJBE 2Z8VC 1KT2A 2VITA 4HT1L 3QA3B 3AB0C 3SKMB 1H3PH 4NO0B 4NQCA 3CVHH 2AGJH 5IMOA 3IKCB 1F3DJ 5D5MA 4LHUG 3MUHL 3I75B 3MRCA 1J18A 4ZFOB 1A6ZA 5GZOD 3VA6A 1VGEH 5BMFH 1SJXA 4MAYC 2VWEC 4WCYL 2V17H 5CSBA 3SGJA 5HYEA 4M03A 4HJJL 1HYRC 3FN9A 3OKEA 3BO8B 5TQ0L 4FMFA 4WHCA 4XCYA 4ONFL 4UQ2B 5B38B 4NHUB 5F6HJ 4ODBD 2A83B 1BIIA 1S7QB 5TDOA 2HJKA 4GKNB 3UC0H 4XNZC 3GRWA 1OSPL 3A0OA 3GKWH 4AT6A 3ZZ1A 5JOPE 3RGVA 4GT7A 1KYOK 3OBAA 3GMOB 4QT5B 5KBNC 5ANME 5H35A 3BW9B 1FRGH 5DRNA 1TZGL 5E8DL 4U2ZA 1NC2D 2XA8H 5DI8B 2VZ3A 5EBLA 4GLRI 4Z5RA 1U8QB 4TN9A 1R24B 1HKLL 4X4ME 2R0ZH 4TQEL 1N5AA 2C5DC 4QXWA 1WEJH 4KTDH 2X4QA 2V6HA 1L9NA 1XT5A 5F9JB 1MI5E 3C6LB 4PJIE 3WFCH 3ZMRA 1J8HD 3C2SA 5DUML 1VKXA 5IF0B 3RNQB 2OR9H 3E6HA 3QI9D 2XTJB 2A9MH 4M43L 5SWZD 4ACPA 2Y7QA 3TIDB 1NEUA 3TBYA 4L9LB 5B21A 3NIDF 1RJYA 4QWWC 2VLLB 3B2UC 4G80B 4Y88A 2Y06L 2RBLA 4GBXD 4OF6A 3MZGB 4D3CH 3FO0H 5C7XH 1OSPH 1WZKA 3ZKQD 1RPQA 3L9RA 3ARGB 4YWGL 4MWFB 4NZDA 2DMCA 5IG7A 4PJBA 2IADA 1NBQA 3IDXH 1JWMB 1BQHA 4U1GB 2W0FB 1C08A 2EH7H 2ITCB 4HF5L 3K4DA 3S96A 5FM5O 1HSAA 4OGAD 5LGJB 1U8OB 2ICWA 1AY1H 4PRID 4O2FB 1TDQA 4G8GB 3AB0B 4KV5F 4U1HB 2NW2B 5IT2L 3O9WA 3QULB 4NP4H 1W72H 4ZAKA 3HG1E 2J7LA 3QFJA 3O3DA 4MAYB 1MVFA 5IW3A 3TPUA 3UTTB 1VESA 1AJ7L 3C8KB 2BHYA 3EZ8A 2EE9A 4ELMA 1G9NH 4RCAA 1JNJA 3V5HB 4PREB 1MCNA 5IVNA 4I2XA 3H3PL 2ARJQ 3BJ91 4KZDH 4D9LL 4MJ6B 4K71B 1YNLH 4XNZB 2WUCL 1QFHA 4PTTA 1J5OL 1FFPB 4Z8FL 2VLKB 4X7DC 3SEPA 2P5WE 4X4MA 3HI5L 4K3EH 3V6OC 2X2YA 4I77L 1Z5LB 4ZTPL 4MCZA 1DLHB 4Z7VE 3TCLB 3B9AA 4HS6A 1DBML 1A7NL 3EYSL 2F53D 5HDLA 4LMQE 3C9NB 4TVPL 4S1QH 5E99H 3WL9A 1C5DA 4CVWA 1MI5A 4ETQB 4PJIA 3MYZA 2R2HA 5C0AD 3CX2A 1FNGA 2XI9A 3C08L 3RVVC 3ZTNH 2XWTA 3S3SA 4L8CA 5JHDD 1QSED 3P4MA 2OBGA 5IT2H 4KK6D 4LCYB 3TYGH 1KULA 3EFDL 1VGKA 3O6FD 5IMMB 2IQ9L 3VFUA 1CK0H 1OAUH 3R8QA 2G9HA 1OB1A 4OI8A 2D7NA 1WWCA 4HGWB 1VB9A 5DA4A 1A6UH 1R3IH 2C4FT 4H26B 1MUJB 4G43B 5EZJB 4OZIE 3BIKB 3ZE0E 4CMMA 2Z31D 3GK8L 5AAWA 5EU6D 1TVBB 2VLRE 3BISA 1FGNH 2DD8H 4U6VL 4GUPA 3TT1H 1AQKH 3OPZH 1IM3B 1TJGH 4NT6B 2MTPA 2A6IA 2AJUL 1AXTL 3DBXB 4NSKA 1KSRA 4AY0A 2Z9TA 5D6DC 1W2KT 4PR5B 4QRPE 4P2OC 4F9PA 1IEAB 3MLTA 5HHOB 3P30L 1RFDL 3KLAA 4JN1H 5ILTL 5FFLA 4KVCL 3RIAF 3TJEL 4CJ1A 2H26A 4P2CG 3HG1A 3O4OC 2NZ9D 1HIMH 4J3XA 4CNIA 4JFDB 1FCGA 3D39D 4FXKB 3QCUL 4HIXL 2A1WL 3EJZD 3KPSD 5JIIA 4R7DA 1ZLSH 4Q6IC 4GMSH 4YHIB 3OAZK 3GSXB 5DHVA 1BD2B 4L4VB 1LWRA 5IMLA 2HWZH 1CVRA 4TUKL 3KYNA 4GS7C 1QR1A 3KJ4C 4U6XB 3RHWF 2AJVL 1KB9K 3J8F7 4N8VG 2NY5L 4ZOEA 5JORB 2IQ9H 2OMBA 3PWNB 1HCFX 1OW0C 4PYGA 2D7PA 2P5WA 2Z93B 4JFXA 4PGDA 5JA9A 4WO4D 4OCXH 1P7QD 1QRND 5B3JF 4Z7VA 3ARPA 2WAHA 5AWNL 5L7XL 4HWEH 3LIZL 5C8JA 3KYOB 5IB2B 3NCYS 4CAGA 1ERNA 3QIWA 3DX6B 4HJ0C 1KELH 4H25A 4F57L 1NC4D 2VN4A 1F4XH 2K3TA 4WHYG 5C0NC 2XFXB 2VTFA 1HQRB 5ISZD 1F11A 3L3HA 4O2CB 2JK5A 2HTKC 3DVNA 5I16A 5CINH 3O0RH 1Q94B 4KVCH 5I8OH 3L3DA 5TJWK 5BVPL 5C0GB 2DKSA 4YXKL 4D8PA 4X6EA 2CLZA 1I85C 5I1DA 2UVFA 3GSRB 1F4YL 4JO4H 5FA3B 1FP5A 4HWBL 2XT1B 4FQQA 3HNVL 2CKNA 4PJDB 4RAHA 5IHZB 4TTGA 1BIHA 1GYAA 2VLRA 3MRHA 2EDNA 1BREA 5EU5A 4P5KA 2H8PA 2I26N 2E9JA 1IVLA 5IBUG 3VXME 3DLQR 4LCIH 5GGSA 4OLZH 4QRPA 4TSBH 1XIWC 3TN0C 4V1DB 4EQ2A 3WXWH 2OZ4L 5FUCE 3CFEB 4ENED 4IOIA 4MQXC 3RKPA 2W9LA 3MPCA 4P2OB 3UAJC 3MRNA 5K9KB 1CFSA 3K3QA 3PG2A 3VI3F 6FABH 5GS0D 1CXHA 3O4OB 4TRPL 5BCAA 4WU7A 2DTSA 4I0PC 1SMAA 4MMZC 1A4JB 3CFKA 1I1FA 1FLTX 4HV8B 4H0HB 5D2LB 1KLGB 3MV8E 5I0ZA 4Q6IB 3OG4B 2ARWA 4Y16D 2AERT 4YXKH 3SDYH 4GS7B 4JRYE 3WLBA 3KJ4B 2GUOA 4QHUB 2GKIA 4WRLA 3FRUA 1WICA 3IS0X 3U46A 1Z2KA 1P4BL 3NTCH 3P40A 2F58L 2ICWI 3Q6GL 5F9DC 3WNPA 4L8BA 3VE0B 5CD3A 3FFCD 3WN5A 3CDFA 2Y07L 4F7PA 3RVXD 3BYTA 2J1KA 2HRPL 3DI3B 4WI9A 1DQTA 1SBSH 5DMKA 1HCVA 5EU7E 5HGDB 5KSBF 5CIPH 4UOW1 1GPOH 4OM1L 4Z76B 4WDIA 2B2XH 4MDIB 2OZ4H 1EHXA 1MRCH 3IU3B 4JANB 4Y2OA 4JDTH 1FFNA 3LN5A 4NRYA 5EDXA 1RK1B 1OGAB 3D9AH 1UM6L 3FB5A 2ICWJ 3SPVA 5A43C 3HZMA 2YD8A 3T0EC 3QEQA 1NBZA 4L3CB 3QIUC 4FG6D 4I3RL 2YD2A 3RBSA 2G60H 4KROC 5LBSH 2LVCA 5FM5M 1H8NA 5GHWL 4DOHE 3ULUC 2KZ1B 4C57C 4DVRL 4RGOL 3MFGB 3U7WL 5EIVA 5ICXA 4X9FA 1QLFB 3VXMA 1ZA6B 5I15H 1UKTA 5EOQH 3HCVB 1JPTL 1NFKA 1W0YT 1BECA 3VFPA 2F58H 3Q6GH 1PG7L 4XVSL 1TZIA 4M1DL 1KFAH 2EE6A 5MHSD 3T4AA 4J8RB 1DP0A 2Q8AH 4U1MB 5C71A 5EZOH 3O6KH 1XIWB 1BVZA 3TN0B 1A6WL 2Y72A 1G7MB 1K2DA 5EOCJ 1CGVA 3OHXA 3LH2L 3QUZC 4O5LL 2AV1A 1WTLA 3CUPB 3RTQC 4HLJA 3MJ9A 4WHTA 2JLLA 1Q94A 3MV8A 4NHCL 4F58L 1ZWIB 2P5EB 4ZUVA 3C2AL 4IRJA 1YZZA 2IAMC 4I0PB 3RJDA 3TWCL 1BZ9A 3TA3A 4XB7A 4YDVA 4YLQT 4JRYA 4ZXBC 3MLPA 5FYLH 5GJSL 3U6RB 1LP9F 2WLYA 4LLYB 3D6GA 3GSOA 1E4JA 3ELAT 4PV8B 5F7YC 4U2YA 2LAGB 3VCLB 1NANI 1BQHG 3MA7B 4DJMA 3K8LA 2PYEE 4P23C 3RY4A 3HKFA 5CILL 1MVUB 1C16A 4LLVB 1QPPA 2WBJA 5FO7B 3RIFF 3HE6C 2DI8A 2UY7A 3LS5L 4AM0A 4PJEE 4MNHA 1OAQH 4NQDD 5D2NC 3OKLA 4M5YL 4M1DH 5BXFA 5LWYH 2WV3A 5GSVB 5LVEA 3V79C 2GSIB 3QPQC 2XZCH 2Z35B 1F6AA 4NZUH 3MRDA 2C1OA 1MFEH 1N6QH 1LO4L 1SVCP 3C5ZA 4PJ5E 1ONQB 1IC5L 4WGWB 3P0GB 1MSPA 3D0LB 5CKAA 1YN7B 4WU5A 3T0EB 3WLWD 1I3GL 5GIRA 5GGRB 4NHCH 1CGYA 4DZBA 4KDVA 3CCHA 1LE5A 3CVHA 1CLZL 3QIUB 1QOKA 5TQ2H 2OXGA 4LKXB 2ID5A 4HUVA 4UDTB 1XGQA 3Q1SL 4PJHE 4KROB 2X1QA 4I0CC 3QR2A 5KVMC 3W11C 5E6ID 2EC9T 1DBBH 5EUOE 3ZKXC 2QHLA 1BVLB 1JNHA 3MRKB 4HC1L 5KS9B 3IDIB 5KN5A 1B6DA 3SHSA 2VRAA 3LEYH 1U2CA 5I6XC 1T89A 2KQMA 3VXRE 5GS2D 5F1SA 1WZMA 3HC0B 4WTZA 3EO1A 3QUML 4UILH 1XGTB 1L7TL 5ADOL 4HD9A 4XCNB 3WXVH 5E2TH 5HHOE 4LSDA 3RPIB 4U1IB 3CFDB 5E6ZA 4YHKL 4F2MB 5F8QC 1LDSA 1UACH 4OKVA 5F1OB 2CMRH 3BH8B 3QUZB 3D3VE 4HUUB 1RZ8B 5TH2A 1WFNA 2WWKO 5F7EL 3RTQB 1T4KB 4M9PA 2A0LD 3I2CL 3FOLB 5FEBA 5INCA 1EEZA 2ZUYA 4XPGL 4X6CE 3K8KA 2IAMB 3TZVC 1LO4H 2BXYA 3IGAA 3P4OA 4ZXBB 4M6OL 2DQUL 5AAMA 3DV4A 1KG0B 4P49A 1N64L 4FQ1L 2UWEE 2QKIB 3LQZA 5C0DA 1Q0YH 5IMKB 2PYEA 3X11A 5HGHA 2CD0A 5DQJA 3HC4H 3FO9B 5DD0H 1KCLA 4OZFH 5E2WH 2V7NB 4YXLL 3U9PL 3E8UL 4P23B 1UC6A 3WJLA 4PJEA 5I2IB 1Q0XL 3VJ6A 3HMXL 3LRSB 4JPWH 4UT9L 5EOCL 3V4PH 1WBXB 4KUCD 3HE6B 1TJIL 3VFVA 3T1FB 1A7PL 4RRPA 4I4WB 5KSVB 4QF1B 2ZUXA 3LY6A 5D2NB 4MNQA 1NBYA 1KJ2L 1L7TH 5DSCA 4DUWA 4FQ2L 5TGBA 5DJZA 4YHKH 3D85B 1MJUL 4O9HL 2CDFB 2PNDA 4J3TA 4YHML 2QSCH 1LNUB 3PE9A 5IR1A 4LLDB 1JPFA 5EO0B 3TBSA 4PJHA 3GO1H 3VFWA 2XN9D 5EUOA 1T3FB 1WF5A 2CIIA 1ZVHA 3GJFB 2DQGH 5F93C 5C07E 3DRQB 4X6BB 5E8NA 4GAYB 3RPKA 3BRDA 1W72A 5IFAL 1U8PB 4M6OH 5IROC 3P9LA 3ZKXB 4C56B 4OGYH 4HSQA 3VXRA 3WCYA 5LXGH 5D71L 1LO0L 4P48A 5MP6L 1RULH 4PJ9D 1AKJA 1EAPB 1VFUA 3TNMB 4PRBA 1EDQA 3DYOA 1OQXA 1UH3A 3WNLA 5I6XB 1I7UB 2X05A 4DQOL 1ZMYA 1X7QA 2ZCLH 3PP4L 4HKBA 4MA8H 4UT9H 2FH8A 3D3VA 1G9MH 4NZRH 1BBJA 3CDGB 2FO1A 1CQKA 2R9HC 3JV6B 3JWNC 1FNEB 3LN4A 2EC8A 4P2RD 4GRLD 3DVIA 3NFSL 4X6CA 4RMVA 1KIQB 2RCSL 4W70A 3LB6C 2FEEL 2ZSWA 4GG6B 3MODL 1NGXB 3X17A 3T0XA 2UWEA 4RWYL 1GZPA 4CW1A 2CLRA 1ADQH 3TZVB 5E03A 1NFDF 3BE1H 3X14B 3GMMA 4AIZA 3KPRE 3PHQB 3NIFE 4PP2B 5DWUH 3FQTB 5FHAH 2XOTA 5T1LA 3RU8H 3SO3C 3O2VL 2V2XA 3IFLL 1G6RH 2VABB 5L8JB 4ZG1A 5IFAH 1QFWI 5C0CE 1FNFA 1A7RL 25C8L 5EORL 3RVWD 5HPMA 5ITFA 4YHNA 4KZEL 1FFQA 3VXUE 2EICA 2MWCA 3MLXL 4OB5L 5JOFA 4ZFZA 4OKDA 4QO1A 4KUCF 4NC0B 4ZO9A 1NAKL 1PYWB 3RY6C 3BT2L 4P57B 2APFA 4OD3L 4HCRH 4PGZA 4GSDH 1EO8L 2Z92B 3BGFC 3UYRL 1ZT7A 5ITBL 4YGAB 4IDLA 4MQ7A 3PWPB 4F3FA 2IWGA 1BP3B 5JXEC 5MEPB 4HLZG 1CXEA 5EU4B 4DZ8B 3CH8A 5C07A 5A2IH 4JKKA 4WFFE 4AH2A 1DQDL 1JGEB 3MXWL 2UV3A 4QHLB 1Y0LA 3WFEL 1X5HA 5EU3A 5SWQB 1K8IB 4JM2F 1KF9B 3LEVH 1AO7D 3HA0A 5FV1L 4OV5A 3ARFD 1EJOL 1W8NA 3MA9L 3MLWH 1BLNB 2X1OA 4DCQB 1ZOXA 4DEPC 2NQCA 4KPHH 2BCKB 2WK2A 1UJ3C 3PJSA 2QQQA 2R4SL 3N1GC 1ZVYA 1CU4H 2X44D 4HS3A 4LF3A 4DGYL 5IVZA 4ZFFA 3HZVB 1NCCL 1NDMA 3OJDA 4PRAA 3HB3C 1PKOA 2WBKA 2ESVB 5CZVL 5IW6A 1BFTA 1KXTB 4PRNA 3BZEA 2V2WA 4JQVA 2EO1A 4S11A 2I9TB 4JPKH 3MUZ1 5AYQA 3RWFB 1MNUH 3G9AB 4YBLC 4Y1AD 4P5MA 4OF7A 4QOKD 2LQRA 5DMGD 1U8KA 2MNUA 3VA2C 3KPRA 4NKIL 1QQDA 4OZGE 4NRZB 1E4XI 1M6OB 1TNMA 4PJFE 3WO3B 1XF5B 4H5SA 4RGMC 4YZFF 1DQDH 4W6YB 2VQTA 4POYA 3DSFH 5C0CA 4ELKA 5HHQB 2EDTA 3SO3B 4EI6A 1CL7L 5E08H 2DRUA 3WJJC 3VXUA 1DN2A 2XG4A 3CK0H 5EWIH 3DVGB 4MSWB 3GSUA 4FQLH 5A2KH 3D0VB 3N9GL 2IH1A 1T0NB 2EH8H 1I7RB 3IFPA 1C7TA 3H6JA 4QTHB 4NJ9H 3ARDA 1CVSC 1U92A 2R4SH 3MLYL 4ODHL 2X4SA 1URLA 2BXZA 2F19L 5BRZB 1ZS8B 5J57B 1U58B 5KANI 1HXYA 5CZVH 3S35L 2O61A 3BGFB 3QJFB 2XZQL 4AL8H 1BEYH 2J8UB 1G0XA 2X4PA 2ZPKL 2IC2A 4C83A 3UJIL 1MCOL 5ABDE 4KKLC 4C4KO 4S1DC 4WENB 1SJHA 4ODVH 5C1MB 1KEML 2VDLH 4Y4FC 1KIRA 4M1GL 3TT3L 2VDOL 2V9TA 4KTEL 2PCPA 2A6JA 2ADJA 1H15B 4I9WE 2YUWA 4LRIC 2AI0L 3QEHA 1OSZB 2RJMA 4R26L 1A22B 1A1OA 2HLAA 1ORSA 1QHOA 5KS9E 3TO4B 1YEHL 2FO4A 4H8WC 1OD7A 4P59H 4X7EC 4DEPB 3F5WB 1UJ3B 1NGPH 1B90A 5FYLE 3VXTB 5ETUB 2UYLB 5CCKH 3FT3A 1BAFL 1KJVB 1REIA 1JYNA 4NWUL 1LE9B 4ZFOL 1DZBA 1E4KA 5CJXC 3OX8A 4KJWC 4NNPL 4E5XB 3L7EA 3EDEA 2RB8A 3MJ9L 5KTEL 1V3JA 1T1YB 3R8BB 5EBWA 1WBYB 3VFMA 3MNWB 4OZGA 2C3GA 5CIPA 4YBLB 3GI9L 3V7AE 2YA1A 1F45A 4PJFA 1P69B 3PIQA 2A2QT 5CSGA 1WQVT 3ZSSA 5IQ7H 2NY3C 3DMMC 3EOTH 1T22A 3ULVL 3FAWA 4XH2B 4OBSA 4P2QD 1EBAA 5FK9B 4WTZG 1MIEL 1RURL 1MREL 4DGIH 2VDOH 1L7IH 4RGMB 1SEBB 4LFHG 2SEBA 4NWTH 3GMNB 2L7UA 2FZ3A 2HRLA 4CVUA 3LKRA 3QCTL 2PKDA 3B4NA 3FB8A 2X09A 3U0TB 3VD9A 3THMH 2A6KB 3RWHA 3U0WL 4XBGB 5EUKB 1J87A 2HT4D 4LVOC 4HHAB 5J12C 1T7YA 2J4WL 2FX7H 2YUXA 4X4ZA 5JW4R 3C5SB 2BJML 3T8XA 3SO5A 3VWKA 2DICA 4KRNA 5J0BA 4CN6A 4X0KA 3RGVD 2FJFB 2PYFA 3MX0A 4RFOH 4PRHE 3MRIA 1EMTH 1NMBL 4GW5B 5B8CA 3SDXE 5KTEH 5KANG 3NA4A 4GXUN 3ARWA 4LVEA 4OLUH 3IF1A 2VLJA 3OKDA 1G7PB 1JCKA 3DO3A 3ZKNC 5T3ZH 2ZUWA 5HDBE 4Y4FB 5KVEL 4FFVC 5BOPA 2BOBB 4KMTL 3DXAA 3B9VA 1XGPA 4RA3A 1NLBL 2BSTA 1ZXQA 1HHHA 4RRPG 3QDMB 5EB9A 3VFGH 1PY9A 3BEWA 3BH9A 4OJFH 3IAPA 2VH5L 5CSZA 1F4AA 1MREH 4NDMB 5DT1L 2BVOB 3WFDH 4S1SH 2M26A 4WFED 4I3SL 4LHQB 1E4XL 3VFNA 4KI5C 4XPTH 2E6PA 4L8SA 5H2BA 5IHUH 4ZNEE 1S7XB 1SJVA 5D7JC 4GH7B 3SJVB 3R06B 4YGVB 3MV9E 3SKOA 4DUVA 1T1WA 3OQ3B 1ZGLM 2GK0B 1D5MB 2HMIC 3EYUH 5EFIB 4MZ2A 2BSRA 4UBDD 2Z4QA 4BFIB 3CFIC 4MXWH 3ALPA 4MCYB 4IRSA 3FOMA 5CP3H 4XCEB 2GJJA 3V0VB 3HLAA 2BMKA 3MMEA 3L5XH 4WW2F 2VIRA 1XGUA 5IJVB 2NY3B 3DMMB 1NUDA 4JY4B 5DJDB 4DKDC 4OZHB 1UGNA 4M8QA 4JRXB 1A3QA 4FTVE 4OLXL 3V8CA 3BKCH 1J05B 4X4YA 3O6ML 2BX5A 5GGVY 1LK2B 2VN7A 4HQQL 3CU7A 1I9IL 3O9WD 1ACYL 1IGMH 2AK1H 4NGHH 3EOAA 4ZAKD 3S36H 2NY2D 3QFJD 2KL6A 4G8FA 2V5YA 4XWOC 3OR6B 1AI1H 5EN2A 3SDDC 5FF6B 4I3SH 2X4RB 1IQWH 4IMKC 3FONB 4LEOB 2XACC 4LVOB 4BSVA 1KTKE 5J12B 5JOPD 1T5XA 2W65A 1XF2A 3A6CH 1RIHH 4PRHA 4XNQA 3RX8A 2XKNB 3SDXA 1KJ3H 1MJJA 3SDCA 2WP3T 4FQXD 4ZO8A 2MQ3A 2AVGA 4HXAL 2HVJA 3FQWA 2O5ZH 4ZSOB 1HN1A 2HFFB 1DR9A 5DJ2B 3STZB 3DGCR 1NMCC 3MXVL 1P7KA 2W0KA 1R0AH 1MFDH 2C7UA 3RRQA 5IESL 1SEQL 1N4XL 2H2SD 3GMQB 1DBAL 4PG9B 5I1LA 1EEYB 2FECI 3LD8C 4KC3B 4ZNEA 5HVWA 4LGPB 3IDNA 1AGDB 4PRPB 2VDRL 2BRRH 1B0WA 2R39A 3MV9A 1I9IH 3FQXA 1EHLL 5I8CA 3VI4F 4OZFA 5D7JB 5IK3B 4AEHH 3UDWC 2IBBA 3TVMC 4JHZA 3H0TA 5DA0B 1FJ1B 3GJEA 1J8KA 2FGWH 2X4NA 5J6HA 4XVJL 3X3GH 3TV3L 3FTGB 3BP7B 1I8LC 1S5IH 4NUJB 3MRMB 5GJTL 1QBAA 1BFVL 4U7KA 1CDCA 4PGCA 4XP4L 4Z7QF 5DR5L 4Z7WB 4G3YH 2EXWD 3HE7A 5D6CB 4MB4A 1P6FA 4G7YH 1NQBA 3ZL4L 3SY0A 2X4TA 1WSST 4L29B 2MPAL 5LAXB 3LQAH 2I5YL 4GKOA 4G9FA 4FTVA 4X6DF 3MCKA 1KPVA 5IW1A 1MF2L 2P1YA 5L2KB 2QADD 2R4RH 3AVEA 5GGTH 5I1JL 1P4IL 4NRXA 2CK0H 3HUJF 1FPTH 2W60A 4UUJA 3DUUA 4PGEB 3TESA 4WEMB 1RUKH 5LGHL 4NKOB 3BP6B 5F9WC 4IMLA 4PP1D 1BQUA 3SDDB 4FXGB 5K59E 2YPVL 3MUY1 3RWJA 2ATPA 4H1LG 2F8XC 3M8OL 1GOHA 2AV7A 5C08E 2P8MA 3RI5F 1FN4B 2WINA 5EPMA 1HILA 2H41A 4H20L 4ELMF 1CG9B 2PTTA 4GRMA 2CO7B 3PF2A 2P5WD 3PABB 1GGIL 4FNLL 3I84A 3L95A 2L4OA 4XVJH 2JB6A 3VXSE 4PBVC 1VEPA 4TSAL 1MAML 4N68A 1U95B 2AXGB 3QIWD 5GRWA 4S1RH 4OCYH 5FGBC 4LSPH 5I76B 4APQA 4NKQB 5KOVC 1KTRL 5DEGB 1NMCB 1LK3H 4WUKH 1S7UB 2YXMA 4Z95L 3ME0A 1ADQA 1ZK9A 1M71A 3S4SG 5HDOA 4MJIB 2G2RB 1P6AB 4XMKL 3LD8B 3QI9C 2H3NA 1FZMB 4KQ3L 2HVKA 4RMRA 3DHJA 4CVXA 2AEPL 3RWCA 4LASL 3MZTA 3WS6C 5DMIH 1G6RA 4QTIL 3AY4A 2VZUA 3DJ9A 4QRSA 3IDJA 1CFQB 3TVMB 4FZEH 5E5MA 5CEYA 4GBXC 3O4LE 2EXYD 1RHHB 2XZAH 2VLRD 4PV9A 5HVGB 2JE8A 5JLZB 4UAOC 4OD1L 1CR9L 2WWMD 3WEXB 3EO9H 3QXUA 3O3AB 2Z0BA 2NW3B 4QRPD 1OAKL 4HCRA 4WNQB 2NXYC 1NAMH 4OGAC 1XMWA 4QRUA 4K8RD 3RP1A 3QRFM 1C7SA 4BH7A 4QCIA 2G5RA 4ZUTA 5JPNB 2F5BL 1EO5A 2KPNA 5T33H 5DJ6B 5ECJE 2C1PA 3G9VA 1ZHBB 3MGTB 4NN6C 2VXQH 4PY7B 3SKNB 1ZVSA 3MRRA 1ZHKA 5FECA 2YN3A 3GSVB 4UTAH 1S7WB 2D7MA 4O2EB 1U8NB 4N5EC 5I8EA 1NGQH 1PEWA 2IPUG 3E2HC 2FX8H 2PW2A 3KPLA 3Q6FA 3QEUB 4BSJA 5DD1L 5C08A 3P4LA 5F9WB 2X4UA 3QHZL 4LASH 4ZDHB 2ZCHL 1CS6A 1IE5A 1I1CA 2IJ0C 4LIQL 4QTIH 4HPOL 5F3BA 4WW1A 3O6LL 4E41E 1WBZB 4FFYL 1UKQA 2BSSB 5JTWA 3UPRB 1I4FA 4KGJA 1NC2B 4JG0L 2YPLE 3WDHA 1AGEA 1HH9B 4D0DB 2WQ8A 1I7ZB 4UB0L 1KC5H 1JNLL 3DV6A 3ETBF 4P3WA 1SM3L 5DEFA 5F7DA 1AIFB 5F89B 1FDLL 2DM3A 3GB7A 4KHTH 1B2WH 4KK6C 4MVBD 3GJFK 4AEFA 5JW5B 4PJGA 1FAIL 3QI9B 3QEQD 2CXGA 5SWZB 3PGFL 5DJAA 4HK0B 2CRYA 4PJCB 2R1YA 2YUVA 3O4LA 4YNYA 1QSVA 4X99B 3CC5A 3FB6A 1F13A 1G1CA 4NKDB 4G6FB 5HHVH 1GL4B 3DUSB 5DD1H 2FIRT 1Y18B 4MA1C 3VXMD 5BS0E 2LU3A 4Y5YA 2R1WB 4GBXB 2V5SA 4IIQA 3VW3H 1RZ7L 2X89A 5E6YA 3U9UA 5E1AA 3QJHB 4UAOB 4XC3H 1F58H 3GBML 4YBHA 3O6LH 2DWDB 2YA0A 4K9EH 4XZUA 4WV1C 12E8H 3RWIB 3RL1A 5I1IL 2FYYA 2CIKB 2NX5E 1INDL 2PTUA 5JDJA 5C6TL 1GIGL 1X44A 2NXYB 4WTXA 2FLRT 1QSFB 4R90L 4XC1L 3TO2B 3PXJA 3RL2B 5EBMA 3LOWA 4PRIB 5HYSA 2NZ9C 5ACZB 2H2PC 1V8HA 3G5XB 3NIGF 1FZOA 1CLCA 4RFEA 5LKNA 3SE4C 3J7HA 3EJZC 2P45B 4IS6B 4Q6YA 4C54A 3T65B 3MV8D 5B39B 5A1AA 2ITDA 1D6EA 2B1AL 4KGLA 4NN6B 4YJZL 2DBLL 4J2XA 5ALCL 5FA4A 5IQ9A 3ZDYF 4IRJD 1B0RA 3TF7C 3KVQA 1GOFA 1LD9A 1YUHA 3V7AG 2H32B 4LKCA 3TA3D 2JJTC 2BY0A 1NEZB 4JRYD 3OL2A 3K80A 4FP8H 3S8WA 4Q9QH 1FAIH 3E2HB 5K9JL 3OKMA 3HFML 4L4TD 3LHPH 5BZWB 4DFIA 1YN6A 3EYOB 3LKPA 1CD0A 3ZLQC 2GTWA 4KK5D 2GCYB 4EBQH 4HEME 2YPLA 2OYPA 1ZA3A 2WBJD 3D25B 5I75C 1VACA 1MLBB 2R2BA 3WHE0 3H9SB 3LQMA 4YAQB 4GRWF 3ULUL 1Y6KR 4HIIB 4HGMA 3VD5A 2F53B 3O41B 4HULB 1JYWA 3KPOB 3W82A 1HDMA 1HWGB 4X5XB 1BBDH 5I18H 2DLGA 4L8DA 3RDTC 4MAUL 1V7NH 1INDH 1OAYH 5C9JB 3LPFA 3T3PF 3I9GL 3Q2CA 3N85L 4PLKD 3RA7H 4M61A 2IF7A 3IFNL 3FT4A 3L5WA 4EDWL 4WVRA 1QSEB 3C5ZD 2AK4E 3WD5H 4D9RE 5JHDB 1II4E 1RZJC 1DQQB 4Z0BL 2DJUA 2N7AA 2P43B 4IOSD 3ZT5A 5IKCA 1S7TA 4KI5E 5CJQH 3MOBL 3GFUA 3HNSL 2AJSL 1GOGA 3PQYE 1H3WM 2WUBH 4YXHH 5C0IA 5C86A 5BS0A 3TBTB 2DLTA 3JV4A 3LKSB 5GGQH 1W0WA 1N2RB 4AYFA 5HJ3A 5JIPA 5K9JH 1OAZH 4O58L 1A0QL 1NJ9B 3F12A 2Z31B 5EU6B 3MRLB 4MA1B 3CH1A 3CSBA 4LLUB 2NX5A 1PLGH 3HNTL 4PFEA 1U93B 2CKBB 4EZMA 5DGQA 4WV1B 4JDZA 1Q38A 2XQYK 4KKBC 1J88A 2DQTH 4G8IA 5F96H 2OK0L 1U9KA 3JBG7 2OSLA 4F7EA 3QNXB 2YZ8A 1MAKA 3NCYP 1Z9OA 4UV7H 1X4ZA 1OM3H 4ZPVA 4JGUA 3D39B 3RKDD 4U1JB 4N0YL 1CFNB 1CGSH 3NCJH 3KPSB 2XQBH 1DEEA 5KVGH 4JHWL 5ENWA 2PR4H 5EA0H 4LQFL 2ARJB 1PZ5B 4QRRB 3NN8B 4Y16C 2XV6B 4PRDB 5DRWA 5ELIA 3LPWA 1KIPA 2DQFB 3WIFB 3ULSB 1EGJH 2WMPA 2AAVA 2HFGL 3W9DA 3SKJH 1JWSB 2CQVA 3BWAB 1NBVH 3ROOA 4NZTH 2PYED 1KB5H 1XR9A 1S78D 3OXRA 1XCTB 1RAMA 4K3HA 1P7QB 1QRNB 3PV7A 3RVXC 1ZKAA 2FIKB 1FNSH 2X1WL 3BMVA 2VL5A 5T3XL 5I75B 1QZ1A 2EDJA 1C1EL 4HS8H 1MPAH 3FB7B 4OLVH 1NC4B 4LSUH 4R9HA 3SQOH 1FG2B 3PL6D 4EOWH 2NY0D 3DRTA 1YNKL 2OTUB 4Y19A 3SBWA 5I74C 4L3EE 4MNQD 2B0SH 5E2UH 4OIAA 35C8L 3RDTB 5CP3A 5IJKA 2AK4A 4N0UB 4HIHA 3CLFL 1GGUA 5JMOC 3QXDA 1JNNL 1PQZB 5I71C 3NIDE 4FG6C 1D5XB 1T1XA 5JW3L 2VQUA 1IM9A 3PQYA 1MFBL 1XZ0B 4BQCA 2VLLA 3T0BA 4X7SH 1OY3B 2OS7A 4RWHA 3WSQH 2CDEB 2OCFD 1HHGB 1PD6A 3SKUD 3BDYH 3T77B 4RAUB 4HFUH 4NQVB 3FMGL 3PHOB 1JWMA 1MRFH 4WWID 1CZ8L 4FQIL 1VCAA 3MBEA 2YRZA 1RZIA 5BO1L 3VXRD 4G8EB 2DDQL 2Z91A 4WI7A 4HIJB 2VDKH 2P48B 1AKJD 1LILA 1UQSA 4HWUA 1YNTA 2DKUA 1JHKL 3H42L 3V6ZA 2O5XL 4KV5E 4G8GA 4GMTH 4RGNE 5DLMH 4N8CH 1K8DA 5HHNA 1HXMB 1BFOA 3BPCA 3D3VD 4I18A 4OLWH 2LE9A 2GW5A 2FL5B 1T2QL 3SGKA 2EDQA 3E1F1 3BIAX 5HHPA 5HY9A 1T0MB 2XQYG 4LLWB 1LP9B 2Z8RA 1IAIH 2IFFL 3U4BL 4U6HA 2J8OA 3EDKA 4M7JL 3DO7A 3BQUA 4XCCH 4Q2ZB 3FHAA 2DYPB 4Y16B 5KVFL 4XI5D 5JOEA 1AXIB 1MELA 1CQYA 3U83A 2ATKA 3X12B 4Q9RL 2D31B 3AREA 2DL2A 3STLA 2R0WL 4I8DA 3REWB 3MO1A 2XY2A 5A16A 1KJMB 1AP2B 2JCCB 1VHPA 3FQUA 5CUSL 2EKSB 3AM8A 4M4RA 3C9NA 4N0FB 3BKML 4M4PA 3VRJA 2YR3A 4ONOA 2GEEA 2VJXA 2HT2D 4L3EA 4OD2B 1T20B 3QXTA 2W9DL 5FB8A 1V3LA 2DWEB 3QO0A 4TUOB 1EXUA 3QUXA 2UY6A 3ZHDA 1EFQA 4U49A 5I74B 3MACL 2CO6B 4YUEL 2VXVH 1J8HE 5J9PA 4TUJA 3UYPA 2H6PB 3FN0H 5KG9B 3KYMB 2AKRB 2WWKT 5FIEA 3WLWC 4UIKL 3M1BA 4OCRL 5I71B 5I66B 4JPIA 4UIMB 3AS3A 1MCIA 1Q9WB 4I48B 4NO5B 5EZLB 3UJJH 3C8DA 1J7VR 5C07D 4NPYA 5GGTA 1U6AH 2YPKB 5FAAA 4D0BB 5D7IF 2GQHA 5F97E 5DUBB 4F15C 1AXSA 1UKSA 3QO1A 2X70A 2WANA 3INUH 4JPVH 4O51A 1FFOB 1IM3A 5I1EH 2YSSB 4ZOAA 3DBXA 3OZ9L 1CFTA 4JO2L 4NIKB 4K2UL 5JPMB 1ZHLA 4JZJA 2KBGA 1A6VL 3WHXB 1BHGA 1YEDB 1FIGL 1M7DB 2ZSVB 1RUPH 3ZKMD 4BA8A 3BKMH 3SGDH 1ES0A 3LVEA 1JF5A 4DAGL 5DHYB 3TH2T 2M1KA 5F7MC 2VXSH 4F9LC 5E4EC 3MJ8A 1T0PB 5ALBH 3CPLA 5SWSB 5IB4B 3BXNB 2B39A 5D70H 3MRGB 4XNMB 4S2SB 3TNNB 3MUGB 4MQSB 4D0CA 4P3DB 4K7PX 1DN0A 4E42B 3CNKA 1IFHL 3X13A 4HUNB 4UIKH 1T5WA 3KPRD 1UZ8B 1IAOB 3QWRA 2W91A 1MCPL 5B3JE 4YPGA 2BNUA 2D4DA 1K9TA 3JSSA 1QNZH 1UB6A 2E7MA 3RUGB 3F58L 2UWEF 1TQCC 4LSQL 1F4WL 2DAVA 5IOPB 1MIMH 1RZKC 5T1KA 1BQLH 3VXUD 3EGSA 3WV0A 3HZKA 5F1IB 5IM7B 1OPGH 3KHOA 3NFNB 2D3VA 5B4MD 4I13B 5D72H 2V2TA 1DBJL 2F53E 3BPOC 5DD3L 9CGTA 1FHGA 1J1PH 2PO6A 5HDQH 1A6VH 1YEGH 2DQDH 3QG6B 2MJWA 2YD4A 5C0AE 3U4EB 5D1QA 1FC2D 4U6YA 5C0GA 4XPBL 5EIIB 2HFEA 1CE6A 3OKKB 4JFYB 2ZWLT 2FX9H 1NAMA 1QSEE 2KKQA 2IALB 2R0LH 1KEGH 3VD4A 3SN6N 4YIQB 5E95B 1HQ4A 4G6JL 5BVJB 5ID1A 4NQSB 2VZTA 5EZIH 4IRZH 3MRPA 4DKFL 2EKJA 1CFVL 5J1TC 3OXSB 2B4CH 2BNQE 1BM3H 2FATL 4F15B 4AENB 1MCPH 5E0QA 1SY6H 3F7QA 4OZ4B 4MD4A 3Q3GA 1OARH 1ZT4B 5K9KA 4FXLA 4BSWA 2DQJL 2YRLA 1IEBB 3VI3E 1MCLA 2NTFA 3SE8L 4JHAL 3H8NA 1YEIH 4LHUB 3GEWB 3P0VH 4NZJA 1JWUB 5IFJB 1NCUA 4GG8A 4OIIH 5D7LA 5CMAA 4EI5A 4ONHB 4EXKA 3S3JA 4PJ7E 4HBCL 5TPWL 3E3QE 5E4EB 1ZLVH 3O2DL 3KPSE 2XWJA 5L8KB 3ESUF 1MCHA 1ETZA 5T5NG 2A74A 4HIEA 4Z7NF 4QHUA 5ESVA 2YD6A 1IILE 1JTOA 3K4ZA 5D93C 3CFBB 4J6RH 1ZLWH 4KK9D 1VPOL 4PJAF 3OAYH 5I1HL 4ORGA 1I3UA 4LARH 4B53A 1RUQH 2GSGB 1GC1C 1TQCB 3TBWA 5C0EA 3RVWC 4YEEA 5KSBE 3P73B 1CLYH 3H7BA 4AQ1B 2ZUVA 2DBJA 5CZXD 3LSOB 4PB9L 2XPGB 4D2NA 5EO9A 1OTUD 4MDIA 1GSMA 2GFBB 3VFSA 5C0AA 2ZKHH 4JANA 1JVKA 1Q9LB 5FYKH 4CU7A 1M7IB 3BPOB 5ISZE 2ZCKH 2P8LA 1NGZB 3GMLB 2DQIL 3TYFB 4H8WL 3OKYA 4JQXC 4Z9KB 1ODAA 5FCUL 2E9BA 2BY2A 5TE6L 2APTA 3UO1L 3O6FA 4LPVA 2XY1A 4OLYH 8CGTA 4GKZB 1P1ZB 3B3IA 2GITB 4X6FB 3MBXH 5E70A 5TPWH 3KXFE 4BFBD 2XN9B 1D6VH 5T1MA 1KPRA 3NH7L 3DECA 5FHBL 2VLJD 2BNQA 5SV4A 4I9WD 1I9JL 4X7TB 3WFBH 1I8IA 3ILQD 3ARFC 3V5DB 3MOAL 2BDNL 3DXAD 2RIKA 1PZUB 3BPNC 1DANT 4L3AA 3X3FL 3IJYA 3GSQA 2NLJB 3BZ4B 4N5UA 5I1HH 5I1KH 2FHCA 1MHHB 1QVOA 2HKHH 4ISVA 4JFQB 3LV3A 2AJ3A 3KYKH 5FYLD 3FCTA 1K85A 1HWHB 3UX9B 1CLOL 1FYHB 1TCRB 3IETA 1XF4A 3PWUB 1NDGB 2Q6WB 1GGCH 3PP3H 4M6ML 2CUIA 3BDBA 4PJ7A 3S37H 1KCVL 1S3KL 4EXPX 1FYTE 3JWOH 1R3LA 4HX1A 4P2RB 2QSTA 4HWZA 4NQXB 1CBVH 2J3SA 1LP9E 1QA9A 3UEZA 3MUJA 5IEKA 4LP5A 2A6DB 4O4YH 2XXCB 4ZD3H 5DK2B 5HI3D 3V52H 1MHPH 1UXWA 2VDMH 1YPZB 2C3WA 4JAMA 4PPTA 1UB5A 1KPUA 5K9OB 5FKPA 3BOVA 5DK0B 4C4KT 5CWSB 3VDCA 5K9QI 4WO4A 3O11A 5JO5B 3SE9H 5D93B 1IKNC 3CD4A 4XVUD 4A6YB 1Q9OA 3RZCA 2DQHL 4PJFF 3K2MC 5KSBA 5GQBA 1T7ZA 3VGBA 3VH8A 3FFCE 1F90L 2G5BB 4DTGH 1FVEA 1GZQA 4PUBH 1R5IA 4Q7DA 4EJ1C 4FRWA 2VE6A 4U1NB 5TDPA 5ISZA 3ZTJH 3T2NH 1JZ8A 3IXAB 1U8IA 1TLKA 3MLZL 2QR0B 1U8JA 3QP3A 4MHHI 5CEZH 4EIGB 1IBGL 4PJXF 2ED7A 1CXIA 1E4WL 5F88B 1M4KA 4K3DL 5GSRB 3HS0A 4LPXA 3W5MA 2NYYD 1JPSL 3MYJB 3KXFA 4TSCH 1UM4L 3GSNB 1HEZA 1JK8A 3SDCD 5DK3A 4JKPH 5E94A 4ZFGL 1W8OA 2YMXH 1EIBA 2MHAB 1G84A 5JIKA 2ZOKA 5AUMA 5LJYH 4FZ8L 3NFPB 5TFSH 2V7HB 2P8PB 1IT9H 4KVNH 4HW6A 1AO7B 3NZ8B 4DVBA 1AD9A 3ARFB 5I30L 2XTLA 4JQIL 4OT1L 5DZOA 3UTSE 2PXYA 5T1DL 3RWDA 3BPNB 3EYFB 4N1HB 1FORH 4XAWH 1JUFA 2Q86B 4DW2L 1EGJA 15C8H 1A1NB 1HHJB 4KUZH 2BVUA 2OP4H 1G7IB 2R2EA 3GHBL 1U36A 1KB5A 1YY8B 1A4KA 1JPGA 5I17B 3L6FA 1FYTA 3FL7A 4CADA 1HOCB 3MV9D 2FRGP 1J1OH 4Z7UF 2OTWB 2E7CA 3DURB 5E00B 3MLZH 2OR8A 5L2JA 3R0NA 3O2WL 2QV2A 1WCBA 5FO8A 1B0GB 1KNOA 4Y4KA 4DGVL 2IFGA 4Y1AB 4ZXBA 3AU1B 4G7VH 2EYTB 1OTSD 4Y5VA 4ODWB 4LAQH 2HN7B 5JR1L 3H7LA 3GGWB 4QOKB 3VRIA 4N8VB 3G6JF 5HHXH 1UM4H 4MJ5A 1IRAY 3DTXB 3KJ6L 3VXNA 4JO1L 3NCCB 5F70A 1KBGH 4G9FD 4ZFGH 4FTVD 4JZOB 3WS3B 1HZHL 5IVXF 2DLIA 1IZKA 2J2ZA 1FZKA 4G6ML 2YEZA 43C9A 5L6YL 2FEDD 3FRPG 1WWBX 1H0DB 4I4WA 5C9KA 3T4YB 5JQ6H 4JY5L 5TE4H 3SGJC 2VXUL 4GKSB 1NPUA 3U0PB 3OJVC 4P4RA 4WHDA 4P9MH 2HG5A 4NQDE 2HT4C 1ED3B 1S7VA 1UH2A 4R2GD 3V4VH 4XPHL 4MD0A 3Q5TA 1N3NB 1OD9A 3GM0A 1PSKL 2UUDH 5IP4A 4LSTL 3EDDA 4FFWC 3CFCL 1RIVH 4JG1H 3RGVC 4HMEA 3EHBD 4MHHG 2NMSA 2FB4H 1QO3A 5D1ZA 2BNRE 2VNCA 4ZUWA 3L3OB 3DRQA 1NGYB 2R29L 2IQAA 4IJ3C 3GM8A 4EVNA 32C2A 1S7RA 4LCUB 5HD8D 3L3KA 4XX1E 1INEL 1FIEA 3QNYA 3UTSA 4YX2L 5IBUB 4F7MA 3KPNA 3T0DA 3BHBA 2VDPH 4AJ0A 4APQD 2UZYB 1KXQE 4NC1E 4K7PY 4IHOA 5E8EA 1QLEL 1M7XA 4XNXL 3CLEH 2J12B 3AS2A 1S9KC 1C12B 1H3GA 5LQBL 1KCSL 2F5AH 1MH5A 5FUZL 3PDOA 2CPCA 3ABZA 3G5YA 4KMLB 2HLFC 3I02B 2G75A 3B9DA 1KLUA 1MHEA 4ODSL 5KSAA 4HZAA 1LO2L 4OAWB 4MX7A 3W2DH 1XGRB 4UBDC 4BKLA 1NFDE 3PWLA 1M05A 2B8OT 3RGHA 2BVYA 4XXDB 1JV5B 5FUOH 3P9MB 3RVUC 3C09C 1KTDA 1OP3H 1EX0A 2BY1A 3C5JA 3QHTC 1ND0B 2IMNA 1TCMA 4LU5L 1QBMH 1YEJH 3BGMB 4MGXA 4MXQD 3NA9L 4XVTL 5HVHC 4ZS7L 1T03L 1KT2B 2ZJSH 3JV5A 2VITB 4ZS6D 4NQCB 5IMOB 5D5MB 5FOBA 2DIJA 3O9WC 3I6GA 3MRCB