3V6BR

Vegfr-2/vegf-e complex structure
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
199
structure length
187
Chain Sequence
HQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPHKKLVNRSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VEGF-E
publication title Thermodynamic and structural description of allosterically regulated VEGFR-2 dimerization.
pubmed doi rcsb
source organism Orf virus
molecule tags Hormone/signaling protein
total genus 30
structure length 187
sequence length 199
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v6bR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v6bR01
2QADC 1BVKB 4A6YH 1DLHA 5CUSL 4J8RB 4P2QA 1U9KA 2DQFB 5ESAB 3U7WH 2HTLC 3WDIA 4RMUA 3FFCE 2WLYA 3T65A 4IOSD 2VLKB 3O2VL 4GKZA 3QDJD 4JN1L 4MZ3A 1KC5L 2QQLH 2LE9A 5F7YC 2DM4A 4JR9H 4FQXB 5A2FA 4PJXF 4P23B 1OSZA 2C1PA 2QSCL 4PPTA 3U30C 5IMLB 1F4XH 3SKJH 3MR9B 4MDJB 1JPTH 2VZUA 3QZWA 2X4RB 3DRTA 3DHMA 4LLQA 1Z5LB 5HI3C 1LO0H 3K4DA 3WFHB 2ATPB 3U0WH 2BP3A 1XF3A 3J7HA 3QI9C 3H0TB 3BX7C 2BSTA 3WIFA 4F37F 5TDOB 1XIWD 1FL5B 1RZ8B 2ERJC 4R97B 2XA8L 2LABA 1OGAE 4YWGH 1BD2E 1X5HA 3D2UD 4LMQE 3B9EA 4IOIA 1MAKA 5JXAH 3VXNB 3V6OA 2JELH 4Y4KA 2NX5B 3O4LE 4Z78A 2ZCLL 4OUUB 3ETBF 3LKSB 2BDNH 3EYVA 5JPNB 4FXGA 3FQXB 3WKMH 4YPGA 1NCDL 4JVUA 5DO2C 3QO1B 5I8EB 4OZIE 3DX9B 1RUKH 4P57A 1QBBA 4F9PA 5FK9B 1HQRA 1CU4H 2D9CA 5E8DL 2F58H 4GUPB 3O9WC 1A3LL 4PJAE 2DLHA 1UT9A 1I7RA 2OTPA 2GT9A 5HYJA 1T66C 4X4ME 5E03A 2RFXB 1J05B 3JBG7 1AR2A 4GXUN 3RZCA 1S9VA 4N8PA 3SDDB 3MCG1 4GT7A 4TOYH 5IKCB 4U0RB 1VFAA 2BRQA 1ADQA 4WUUB 1QKZH 1NAMH 4UQ2A 2V7HB 3O0RL 1TJGL 4PJDB 4KPHL 3GMMA 3ULVF 4XNYL 2DIAA 3UYOD 4LCWA 1S7SB 3MMEB 1NCBH 5FGSA 3WSQH 1LDSA 4ZUWB 3FO0H 3OKDB 1R5VB 4ZXBB 2PR4L 3NBNA 2GJ6B 2OL3A 3KYAA 3A0OA 3VXOB 4XPBH 5C6PB 4L4TD 3T4YA 1QSFA 3L3OA 2P7TB 1CE6A 3E3QE 4JY5L 4NN7B 1B2WL 3OKNA 2R2HB 4L8SB 2G75B 4AEIH 1YEIL 2FD6H 1YEHH 1BZ9A 4H0IA 1LO3L 3T0EE 4WW1B 3MJ7A 1HSBA 1N2RB 1VFBB 5C0DB 1R0AL 1RIUL 1KIRB 3OGOE 5CZKA 4HFUL 3BKMH 2ARJA 4KQ3H 4JRXE 4A2MA 3BHBA 3WDHA 5D2LA 3IXTA 4E5XA 1HI6A 2HG5A 5I9QC 4GAGL 5T33L 1JTTA 3HZVA 5CJBA 4UZGA 4G6AC 4P5TB 4X4XB 1MJJA 4QNPF 3VGBA 3BT2H 9CGTA 2EEAA 3DUSA 2X1XR 3T8XA 3TNMA 5B39A 3TFKD 3ULUE 1F02I 2HJFB 5IWLC 5F89A 4CN4A 4JO3L 3MBEA 1FG2B 2F19L 3SGJA 1E4JA 3C6LA 4P5MB 4KRPB 2EDWA 1I75A 5F9OL 2ADJA 4LNRA 1G7IB 1OAXL 3BD4A 4PRPD 4CW1A 1CLZH 4LASH 1QPPA 5D7KD 3MBXH 2AJZB 3RY6A 4H26A 2HT3D 3GSXB 4Y16D 2Z8WC 4YDVB 3VXRE 2DQGL 3CUPA 1CD1A 2ESVB 4NRZA 5LAXA 1ORQB 4JLRA 2QADD 2JIXB 4PP2A 5B8CA 1XGUA 5L9DH 2OTWA 3TCXA 3JV4A 2VXQH 3EAKA 2AEQL 1JZ8A 5F21B 3QEQE 4N0YH 5EBLB 3L7FA 4WFGD 4EOWH 1ZAGA 5EZLB 1HHGA 3JZ7A 1YECL 2P24B 4GKSA 5LQBL 3PP3H 1NFDB 3KPRE 5ICXA 3UJJH 3TZVC 4RBPK 4QXWA 1TFHA 2WWKO 2QR0A 4QRSB 1PFCA 3KJ4B 4YIQB 4F33A 2CJUH 3V5KB 5EU3A 3RWHA 1C16A 4LP4A 4U6HB 1DBBL 3QUZA 4FQ1H 3QHZH 4GKNB 4ODHL 4MCZA 3HUJA 3ZE1E 1N6VA 2YD2A 3P0YH 4LGRB 4W6YB 3QI9D 4LP5A 5CWSB 1RSFA 5EBGA 5F9JA 3SBWC 4QTIL 5I75B 4NKIH 4JRYB 1FNGB 3WXVH 1T5XB 5GSVB 3VXSA 3HNVH 3UCRA 4LSSL 5D5MB 3R8BB 5HYIA 4JPWH 4N0UB 3D0LB 5HGGS 3H9YA 3KWWB 2YRZA 4OZFB 4JDZB 1WV7T 3MRNB 4P3WA 1N0XL 4PTUA 4QY8A 3OR7B 4XMPL 1MRDL 4PR5B 4LVNB 3RGVB 4FQCL 4K3JL 4QRRE 3TBYA 4U6YA 4DKFL 4JQXC 2V5TA 4KMTH 4R4FL 4OV5A 3GSNB 2VDKL 3SDYH 2ZSWA 4XNZB 3QG6B 3P77B 2ZSVB 2FYYB 1UWEH 5HI5D 3L3HB 2DM3A 3QISA 3QPXL 4DTGH 3O9WD 1ZA6A 2UUDK 4L4VA 3RWEB 3WHE0 5MP6L 4XRCA 1T66D 2JKXA 2ADIB 4ZSOE 5LBSL 5IT2L 3VGGA 1D5IL 1UB6B 3DXAB 3QB7C 3OR6B 1FBIL 3W39B 1DVFB 1VACA 2KZWA 1UH3A 1JTOA 1OT2A 1GPOH 3WLWC 5EB9A 1X5KA 3M1BA 3ULUL 2OR8A 1URLA 2ID5A 5DJDA 3SCMB 2VDRL 4KJWD 5M7QA 4LHUB 1F3JA 4W68A 2DLGA 3PL6B 5JOFB 2OJZH 3FB7B 5E5MA 1T1XA 5J57B 1J18A 4FNLH 4MXVE 5IHUH 2H45A 4YQXL 3LPWA 1QR1A 4D3CH 1UENA 4LSTH 1ZLWK 2ADFH 3VD7A 3T3PF 5CEXA 1L0QA 2IBZX 1MHHB 1HXMB 4FTVB 1LEGA 2FHFA 5I71B 4NUGL 4QT5A 3VXUD 3VRJB 1QYGL 4UTBH 1TCRA 3H3BC 1UWXH 1ZHLA 3FQUB 3G08B 3O8XB 4YHOH 5IESL 4OD3H 5HGBB 3WO3B 1AO7B 4LNVA 5HHOD 1HYSC 1PVHA 5JW5B 3GK8L 1ETZB 2QHRL 4KKAC 2ITCB 3HNSL 4TSBL 3S37L 4KJYB 1CE1L 2AKRA 1PQZB 5EOCL 2VZ3A 3DV6A 3W9DA 4YK4C 5IOPA 4JZOA 2R29L 1CLYH 2V7NB 1EUTA 2F53E 3H9HA 1DQQB 2OTUA 5C0JA 4FQQA 4F7TB 2H32A 4G6AD 4YHNA 4ZFFB 1XFPA 4P4KA 3EZJB 3ARTA 2FDBP 3JWDL 1GCFA 1SVCP 2BXZA 1EA9C 1KB5L 3TA3C 1S7XA 4OLVH 1MCSA 4M00A 2PXYA 4ZUUB 4JHWH 4WHTB 3WFZA 4JJ5B 3QNZB 3BVNA 2VQUA 1NEZA 4Y4HB 4LLDB 4Z7UE 2MCPL 1RJYA 2G5RA 4NKMB 1IGCL 3TH2T 5C07E 4ZNEE 1ZHKB 5B22A 4IMKC 4UUJA 1OAYH 3EYUH 3QNYA 8FABB 5DJAA 1S7RB 3S96A 1GXEA 2P8LA 5IVXE 2GHWB 4GAYB 3TBVA 1UJ3B 2GSIA 2F5AL 4JO4H 1UXWA 1T3FB 1AXSA 1MNUH 2XZCH 5ACZA 5L2KE 3ARVA 4AQ1B 4OCYL 3WFEL 3WD5H 4WI9A 3RRQA 5CJ5A 1UGNA 5CSBA 5KSBB 3P4MA 3RBSA 2VLMD 3O6LH 3IVKB 1T7ZA 3GIZH 1I1FB 4HUVB 1OAZH 3I9GH 2APFA 4LSPL 3BEVB 3RHWK 4ZAKC 3BQUA 4HUWB 4H0HB 5JO5A 3BXNB 1NQBA 1G9NH 5IFJA 4P9HH 1BP3B 1S7VB 1CQYA 5DD0L 4RFNB 3RDTC 3B5HA 2AQ1A 1AQDB 3D39D 4UQ3A 2C3XA 2E7MA 3QUXC 4Y1AB 3AY4C 1S7QB 4OD2B 5GGQH 4R96A 1L7TH 4R90L 1FSKC 2GQHA 4GMSL 4V2BA 5JQ6H 4U1KB 3MV8E 3WN5B 1TNMA 4TYUA 3IFOB 2IFFL 3MROA 3IDGA 1FRGL 1GZPA 1DLHB 3KPSA 3OG6B 5HVGB 5E4EC 2NR6D 4P2QB 3BZFB 4X6BA 4EI5A 5KAQF 2G5BA 4OV6F 3T65B 3QDHA 2NY5H 3HA0A 5DWUH 2ED7A 2LFGA 1SEQH 1BVZA 3G5VA 2X5PA 3OAZK 1KENH 4FQXC 2C1PB 5HVHC 3MOAL 4K8RH 4HC1L 2K3TA 15C8L 5L88H 1Q0YL 4R0LC 5A2JH 3QZWB 4NO3B 4F3FA 3UPRA 4HMEA 1HINL 1MWAL 3TVMD 4Z7VA 1L0XA 3SKMA 2R56H 5LG1A 1DBAL 4CMHB 1ONQA 4LSVH 1R3KA 3RVWD 3KHQA 4M93C 4JPIB 4XPHL 3WJLC 1BOGA 1XF3B 1F13A 2YWYA 2CUMA 4NT6A 5EH1A 1YEEL 1NMCB 4QTHA 4R4ND 4ISVB 5GZNC 3L1OH 2GAZA 1I3UA 4NJAH 2HJLB 3MJGX 5C9KA 3WLWD 2V9RA 5D5MF 2XFXB 3G6JF 3DWTA 4IOIB 4POUB 1R3LB 1AIFB 2IANE 3U36B 3VGAC 3ZT7A 4XAKD 5ETUA 2K7QA 2BSSA 1CDYA 4C4KO 1N7MH 3EGSB 1DZBA 5DFTA 3LH2H 3HI1A 4Q0XH 2VQTA 4OLYL 1U36A 3PV7A 5EN2B 1CZ8H 5F7EL 4P57B 4QHKJ 4QGTA 1HQRB 1A6ZB 5H2BA 1U8PA 2WWMC 3WL9B 1KV3A 4OIBA 4JZJC 5HYJB 3NIGF 1D5MA 3B5GA 1S9VB 2ED9A 4JFEE 1WEJH 1F4WH 4YXLL 2N4IA 4UQ2B 1MRFL 5L0QB 4BUGA 2I60L 4PY7A 2F74B 4K7PX 1EFXA 2PCPA 5IFAL 5FB8B 5GS0H 4ODSH 3RGHA 1CFBA 4MCYB 3RVVC 4XHJC 3U7YH 2QQKH 1MY5A 1XCQA 5HPMB 3BJ91 4S1SH 3DSNA 2YK1L 5I0DA 3TA3D 4G43B 5LGJA 4NHCL 3T4YB 5FHBH 1QSFB 1O0VA 5DK3A 1N64L 4NZRH 5HDBE 4ENED 5EBMA 1BZ9B 3ZMRA 2EIDA 1BPVA 4X7FC 2EZ0C 4ZFOL 1RURL 3LPFA 3DTXA 4N90D 1QLRB 2X40A 4POZC 3UDWA 1LO4L 3I85A 3UTPE 1PEWA 4P59H 1ZVSA 2VAAB 1AFVL 1BM3H 2X4SB 1E6JH 3MRLA 5IJKC 2ARJB 4P46C 4TQEL 5GRVK 3L5WB 4O4YL 5D2LB 3WUZA 2XYCA 1HI6B 5AEAA 3MUJA 2I9TB 2HG5B 3QCTL 4PJBE 1HILA 3HZVB 5LBSH 4XNUL 3T8XB 3DUSB 3RBGA 3TNMB 3MV7E 5B39B 4Q9RH 3RVTC 1N8ZB 4OZIF 1TVHA 4ZFGH 1Y18A 3ARBA 4XWGH 5F89B 3MBEB 1PKQB 4YAQA 4PJAF 2EIZA 3C6LB 3RDTD 2ADJB 4CW1B 3OZ9H 5F93C 2HKFH 4MMZC 1KCVL 4H26B 3JWOH 1MRCL 4WCYH 4GQPH 1JIBA 1EJ6A 2DB8A 3S4SA 1ZXQA 4PGJA 3C5ZA 4NRZB 5JZ7C 1TVDA 4I9WD 4JLRB 4AIXA 4PP2B 2MHAA 4OTXL 5B8CB 1JGUL 1XGUB 4JPKL 4X8JB 4U49A 3IJYA 3JV4B 3WIHL 1CF8H 3IS0X 3OKMA 4TNVF 1QVOA 1YJDL 1E27B 1ZGLP 3QDMA 2OSLA 1B4JL 3L7FB 5D6CA 5KSBF 4XCCH 2HVKB 4MJID 1JGVL 1HHGB 1IAMA 3U7AA 3KS0H 4GKSB 2VL4A 3QQ4A 4XMLH 5FYJE 4WTZG 3K3QA 2OJEA 2Y06H 4AYFA 5C0CA 4M9PA 4TSBH 1CBVL 2GCYB 2XNAA 2Y7QB 3EYOB 4M61B 1IEBB 2QR0B 1XF2B 2Z0BA 3QEUA 5BV7L 4GRMB 1JRHH 3RWHB 1F6LL 1C16B 5I1DA 1GZQA 2E7LC 1D5ZA 3QUZB 4NFCA 1HKFA 3BPLC 3QFDA 3QA3A 1F6AA 1RIHL 3HR6A 3RVXC 4XWOC 5EU5B 1WFTA 4ZFZA 2A1WL 4S1DC 4D2NA 2KKQA 1G84A 2AW2A 5IBTL 3K81A 4XCNB 3VXSB 2MCPH 4KMQA 3A6CL 3DSFL 4IOFC 2Y36L 3CX5K 4Y19B 3T0VA 1WSST 3IDJB 4OZ4B 1DQDL 4RQQB 4QY8B 3L95A 5FM5M 5E5UB 3ULUF 3NIDE 3VFOB 3CFEA 3GSOA 3IDXH 5DS8A 4PJIE 3VFPA 3D87B 4WW2C 2EH8H 4PFEA 2X9WA 1WWAX 4OCWL 3NTCH 3EFFA 1EGJL 3BUYA 3FO9A 4OI8A 3S36X 1TZGL 5FECA 3F7RA 2NLJA 2NNAA 4RMSA 4XPTH 4AG4L 3WDJA 1AXIB 1UB5A 3K0WA 5TJWK 4XGZA 4L4VB 3CFKB 5BZWB 4LGPB 2NY4B 4RISL 1FNLA 4WUKH 1ZGLM 1NCNA 1PKOA 1I8KA 1S5HA 1U8LA 4B41A 1VACB 3MJ6A 4WEBL 5TPWH 1DR9A 2VWEC 1KTRL 5K9QG 4HW6A 1CT8A 3M1BB 2C3VA 3OGCB 1SBSL 2XPGB 1VB9A 1F3JB 3FT4B 3RVVD 1IGIL 1RU9H 1JPFA 1FYHB 4XHJD 1VSCA 2H1PH 3S5LG 5E5MB 1L9MA 1T1XB 4GW4B 4WTXA 1CI5A 3ZO0A 1QR1B 4G7YH 2P5EA 3OXSA 4Y2DB 1AJ7H 1QHPA 2ARWA 1BEYH 5AUMA 3GJFK 4JFFA 4BSWA 2FBJL 3ZE1F 3RWFA 5BW7A 1CD0A 5IFHH 4KUCF 1UZ8A 2CGRL 4GQ9L 1J10A 3BOVA 4MX7A 1QO3A 4I0PD 2EZ0D 4R2GB 2X70A 4G8FB 3UC0H 4MGXA 4POZD 1Q0YH 5FYJL 5DFWH 2B5IB 5FA4A 4JHAH 2RAMA 1QFWL 5D2NA 1HWHB 1R5WA 2AKRB 2W60A 4QCIA 4YDIL 4P46D 2DQDL 1A4JA 3DV6B 2JF1A 3W9DB 5IOPB 2OXGA 5DD5H 4Z0BL 1F2QA 1FJ1A 2KBGA 5C0JB 4FQQB 4FN0A 4TUJB 3K2MC 5E94A 4C56D 4KTDL 1IGFL 2H32B 5C7XL 1YNTA 3VXMA 3T3ME 4P4KB 2YPLA 1CXFA 3KR3L 2EEBA 2YPVH 1S7XB 4XNXH 3A6BL 4L8DA 1KCRL 4XPGH 1MIML 2VZTA 1KEMH 3RWIA 5HHME 4YHZH 3RWJB 1KN4L 1KB9K 1AR1D 5EO0A 4BK4A 1IC4H 1NEZB 3BVNB 1M4KA 4DGVL 4OLXL 3VRIA 5FO8A 1MHCB 4XCYB 3C5JB 4ZQKA 2FHCA 3PWPA 5C09A 2XICA 4FQHA 5ISZA 5JZ7D 2P8LB 2VKXA 3D3VD 3TBVB 2AGJL 3SGEI 4OLYH 4L4TE 1UJ3C 1AXSB 2APWA 3L3JB 4KHXH 3Q6GL 2UZIL 4LLMB 5J6HA 35C8H 4JO1L 3UO1H 5HHNB 1H3PH 3P4MB 3K8KA 4MXVF 1P7HL 2OXHA 1DQLH 4PUBL 4XC1L 4NKOA 2WNGA 4NPYA 1I8IB 1INEL 3HCVB 3O6FB 1E4WH 1OWWA 5KSAA 4JG0L 4X9BA 1G6RL 1KJ2B 5IIEA 4NZUL 4UQ3B 2DMBA 3FB5B 3SDAB 1UQSB 4OFYA 2V2WA 3RVXD 4XWOD 4KJQC 3S4SG 1FE8H 1ZLUK 1VCAA 5E8EB 4S1DD 4IRZL 3NH7L 3KPSB 5LJYH 3F7VB 4X6BB 4EI5B 3JUYA 2VC2L 1RUQL 1W0WB 4G9FB 2G5BB 1NCAH 4PRPE 2FL5B 4IOFD 3UJTL 5D7KE 2H2SD 5MENA 1BLNB 4HUNB 1U8KA 5DK2A 4OFIA 1KUMA 2I9LB 3MOQA 4CDHA 4DVBA 3KAAA 4X4ZA 4DFIA 1WISA 5C08D 4A6YB 5ERWA 2CMRH 4M8QB 3V5DA 3RTQD 3C5SA 4PS4L 4APQB 4O4YH 4F8TA 1HSAA 3UPRB 3FFCA 4OM0L 4Z7VB 1KEGL 3SKMB 1PX3A 2BMKB 3HS0B 3QEHB 1KPVB 1R3KB 4OLEA 4WO4C 5IVXF 1UACH 2SEBB 1QBLL 5FM4A 1BOGB 3BI9X 2Y07L 2YSSA 5LXGH 3NA9H 1G9ML 4NT6B 4JG1L 3H9SE 1TQBB 1GOGA 3EOAA 3MNWA 2GAZB 1JYXA 1AHWA 3SHSA 4PLKC 4HAGA 1P4BL 3ZDYE 2HJKA 5L6YH 4X4YA 4X7SH 4LAJH 5DRWA 4XMKL 3CXHK 2BSSB 4Y4KC 1UCBL 3VFRB 5GZOC 3ZDXE 3PABA 3TBTA 1ORSA 1OGAA 2A9ML 2F54D 3VD5A 2CO6B 3EOTH 1I9EA 2Z8SA 3SDCA 4I4WA 3IU4H 4F9PC 1KULA 3D85B 5ILTL 2R2EA 2FBOJ 3TLRA 3T0BA 1INDH 3PIQA 3MGOA 3VFTA 1D5MB 5EIQA 3SGDI 3O4LA 2AEPH 3OB0K 2CKNA 3NN8A 3RZCC 1X5GA 2YBRB 3H3PL 2A9NH 1U8HA 2APTA 1I9RH 2FJFA 1S7WB 5EZOH 4PY7B 1QSEB 1XGYH 4YR6A 3ISWA 2BOCB 2B8OT 5AYQA 5IM7A 5FAAA 1A14L 1LEKA 4PJAA 4NQDB 2O5YH 3K2UH 1T6WA 4NC2B 1XCQB 1AXTL 4NQEB 5EOQL 3S88H 1LK2A 2MWCA 3DSFH 4TVPE 4UNVA 4P2CG 1ACZA 3UBXB 5EBMB 1FFNB 2DAVA 4JY4A 1UM6L 4IDJH 1CICA 5ICZB 4K3HA 3VWJB 3VG0H 4I18A 4PJCE 3CNKA 5C8JB 1QSVA 8CGTA 5F1NB 5FIEA 1ZVSB 4X5LA 3MRLB 4HIIB 2F9BT 2PYFA 1WAAE 1YN6B 1DEEB 4ZD3H 4EZMA 1QLEL 3EOBA 3VXUE 2P45B 5ESQA 2OZ4L 2IPUG 1CQKA 4LKCA 3T0EA 3BIKA 1G7HA 3FONA 1OP5K 4MB3A 1JGDB 4BM7A 5HHOE 1I3RB 1MF2H 1UM4L 2ENSA 1U91A 3GSQA 5F88B 3TO2B 5IEHA 5FOBB 3WXWH 1Y18B 1V05A 1P2CB 5F7DA 3EO0A 4YAQB 2EIZB 4UNTA 4X9IA 4HX1A 3B5TA 5JA9A 4ACPA 4BZYA 4HGWA 3WJJA 5KAQG 2DOCA 1JNNL 4BH7B 4G6JH 3OKKA 4JGJA 5JIHA 5JOEA 3RY6C 2A6IA 3GBNL 1CN4A 5CBEB 4PRIB 5DJ0A 5JMRA 2O5XH 2H41A 1T83C 2UZYB 3IJYB 1RVFL 4O5LH 1NANH 4F15C 1UWGH 4PJ7E 1HH9B 1QVOB 3UTSD 1U58A 1WT5A 3VI3E 5D6CB 3CK0H 4XP9L 3VXRA 3BH9A 3AREA 1W0VA 3ARXA 4NO0D 4RRPA 3QUKA 4TRPH 1N4XL 4X0KA 5E6IA 3TIEA 1FORH 4Z77A 5CGMA 2XNAB 2QKIA 3OPZH 3QWRA 4KKCC 4PIRF 1SM3H 5HDBF 1H9VA 2WLZA 1CDJA 5EOTA 3TH4T 4U6VH 5FM5O 4NO5B 3TPKA 1GZQB 4AY0A 5C86A 5JNYB 2HA1A 1MCRA 3QA3B 1IFHL 3N9GL 1E4XI 2Z93A 4WO4D 3KPRA 1ULVA 1YN7A 2EE6A 4NHUA 3BKYH 4XXCA 3BPCA 1UKQA 4LU5H 4G9DA 4PLJC 3AVEA 3MXWH 3DNKA 1XGQA 4WNQB 3SJVE 2ORBL 3I6LE 3F8UB 4ODXA 4PJBF 5A3IC 4TVPL 5E70A 1N5YL 1XF1A 2Z4QB 4OQ1A 1KB5A 3CFEB 1EEYA 3MRFB 4EDWL 1NC4B 1MHPH 3IJSA 4Y4KD 4XXDB 2ZG1A 3CSYA 2E6QA 3ZE2E 1ZE3C 5GZOD 3DROB 3QXDA 1OPGL 1JGLH 2DMCA 2XN9D 1GRWA 1F58L 1A22B 1A1NA 5C6WH 4XAWH 5FECB 2CIKB 2NNAB 1H8OA 4G5ZL 5DVLA 3Q5TA 4L3ED 3LS5L 3F12B 1U8LB 3B3IA 1J88A 2VIRB 4QRTA 3C8DA 1E6OL 4KK9C 4WI8A 1JZ2A 1OAQL 1F90L 2X2YA 5C0AD 1BFVL 5KZCB 2XWBA 1CT8B 2WUBL 1D5BA 2UV3A 1CGSH 2YD1A 4HCRL 3LQAH 1D6EA 2C3VB 1WIPA 4LCWD 4NQVA 5MI0B 5EO9A 4MD0A 2OX5A 4MVBC 5CGYC 5DHVH 4DAGL 3FO1A 2ZCKL 1B0GB 3GI9L 1AGFB 3CX5J 3S34H 4I2XE 5E2VL 3OXSB 1BX2B 5C2BH 1NJ9A 3U1SL 4RNRA 2Y5TA 2PYEE 5DJZA 1PY4A 5AUMB 2Q6WA 4JFFB 4YE4H 1IAKB 1KIUA 4F37K 5DR5L 3PHQB 4HS6B 1ZHNB 3GRWH 3HZYA 4LARH 1IKFH 1I1AB 4MX7B 1T7XA 1U8QB 4XAKE 2J12B 2DYPA 4Z7QE 4P3CL 4YEEA 2X70B 4MD4A 3EHBC 4HG4K 2B5IC 3MRMB 5E00B 3HZMA 2Q86A 3DUUB 3DVIA 1R5WB 4Z7NE 4QCIB 1C12A 5H35B 2J4WH 4LFHG 2ATKA 2QL1A 4HQQL 4KFZC 4PJIF 5HY9A 4KZDH 3IRZA 1FZOA 3G5ZB 3HB3C 3KGRA 1J1OH 1FJ1B 4LRNH 3PQYE 2NCMA 4HC1A 5E94B 4DEPC 3Q2CA 5FEBA 2E3VA 5I1GL 1YNTB 3LKNA 1DUZA 3VXMB 3F5WB 2YPLB 4GOSA 1MWAA 5T1LD 2EXYC 1FN4A 4K9EL 4MAYB 2PXYC 4NJ9H 4NQCD 5HHXL 1KCUH 4S11A 1PDKA 1MFAH 2FIRT 4LEXH 3DV4A 1X7QA 2F53A 1MCBA 4ZQKB 3CSGA 4OCRH 3RIAF 1DSFH 3CU7A 4P2OD 1J8HD 3PWPB 1GOHA 1I8LA 4LDLB 3AXLB 1QFPA 4FQHB 5ISZB 2P5WB 4J3SA 4HWZA 1H3WM 4AT6B 3OJMB 3T1FA 1BGXH 2P1YA 5A16A 3LRSA 3PXHA 2CRZA 5CILH 3O3AB 4Q7DA 4Z7UA 4P48A 5DC4B 5C2UB 4ZNEA 5C07A 2BRRH 5F9AC 1CG9A 1MFDH 4OGXH 2CPCA 3O6KL 1W72H 3Q6FA 1AC6A 2BHZA 3KXFE 4HPOH 2J8HA 3UTTE 3BWAA 3LN5A 4NKOB 2MQ3A 4YO0A 3BQUC 4DN4L 4NPYB 4KKCD 4QYOB 2MQCA 5L2KA 4AENB 5DUPL 5F96L 2CKBL 2MOVA 1IZKA 3ILPB 5ALCH 4RGNE 2G60L 1ZLSL 2EE9A 1HNFA 1HZHH 4O02L 1X5LA 3LZFH 3RKDC 1YDPA 3K8MA 2VERN 5SX5K 4J6RL 1NMBL 4LRIC 1S5IL 4PLJD 1RFDH 5K9JH 3CDCA 5EA0H 2ZUYA 4M7LH 2R0KH 1NBZA 5FHAH 4EI6A 2XWJB 1HH6A 3T4AA 5KTEH 1IM9D 2XTJC 3QUML 2KL6A 2L4OA 5A3ID 3T3MF 3CFJA 5MENB 1U8KB 2FATH 3B2UC 5MHSD 4YC2B 3MV8A 1T4KA 1SY6L 4RRPG 3FQNB 1T1WB 5J11B 3BP7A 2PTVA 1I1YB 5ERWB 4DW2H 1DTUA 3TIDB 3C5SB 1P84K 4ZUTA 4UILL 4KWUA 1MUJA 1HSAB 3ILQD 2HVJA 1GAFH 3W82A 3GKWL 2H2PD 3M8OH 2W07A 4ZFOA 3G5XB 5DHXB 1HCVA 4S2SB 2DQUH 2ENYA 2XI9A 3LKRA 1FVCA 3SPVA 4ZOEA 3UYRH 3MA7B 5IMMB 1HHHA 3ULVC 3MLYL 4XP4L 5BZDA 2A74A 4JKPH 1QP1A 4KK9D 2BVUA 5EUOB 1PLGH 3EOAB 1J5OH 1P6AB 2DBLL 5DHYB 1TQBC 1AHWB 5DLMH 4CKVX 2HJKB 1DDHA 5C0BD 3WNKA 4KGJA 2DI8A 4MVBD 4OZGE 3R1GL 5CGYD 4CADB 3MOBH 5DRWB 3KPMA 5CAYB 1MI5A 3O4OC 5D1XB 5F6IB 1U95B 5E6YA 2EDDA 1UH2A 3MGTA 4O2CB 3SDCB 2VZVA 1JPSL 3TN0A 3ARZA 4B53A 2YRLA 5FYKD 3MRKA 1MJ7L 1JFQL 3PIQB 2IANA 1YMME 1ODAA 3VFTB 1J0YA 3WIHA 4NP4H 1NL0L 5DZNA 3ZKNC 1P69B 1YEKL 2A73A 4GG8A 4OIIL 3MLVL 5LWYH 4LQFL 2FJFB 1BMGA 5T1MB 3V7MA 4YBHA 3FRUA 2L7JA 1LE5A 5I74B 5IM7B 1LEKB 1OTUC 4PJ5B 3VG9C 2V17H 2FEEL 3BDBA 3IF1B 2MPAH 4JFEA 3FT2A 2EDYA 4NDMA 1G7JA 4R3SB 5J89A 3WYRA 1LK2B 3FMGL 2PXYD 1FH5H 4E42A 1VFMA 5I2IA 3CXHJ 3V7AE 3MGAA 4S1QL 2AJUL 3VD3A 1J0IA 3P9LA 1CICB 3D9AH 1TPXB 3MCKB 3OKLA 1CFSA 1NCUA 3IAPA 2NY3C 3UDWC 5GGTL 4QEGA 3H3KA 2PYFB 3X3GH 4ZTOH 1NC2D 4LLVA 5T1KB 4KVCH 4HZAA 3KPQB 4LKCB 1TNNA 3T0EB 3V4VL 2D31A 3ARDD 2PW2A 3ZDXF 3ABZA 4JKKA 3GSQB 1F2XK 2BY1A 2W0FA 5C3LD 2DQEH 3V0WL 3GHEL 3QXVA 4MDIB 5IMOA 4KHTH 1IQWL 4OLUH 1NFIB 2GYSA 2WUBH 2ZPKL 4RGOH 3VDAA 4M6NH 4ZG1A 3EO0B 4HCRH 3ARBC 5JDJA 3K74B 4H1LH 5D72H 1OM3L 1JHLH 3EDDA 2UZXB 5C0GA 5FUCE 4PJBA 4C56E 5E8NB 2IAMC 4Z5RA 1A3QA 2Z31B 4GG6E 3MV7A 5DJ0B 3QNXA 1YPZB 3AGVA 1RI8A 3C5ZC 1MREL 3C8KA 5EU6D 2XKNA 4HXAH 2ILLA 5SWSB 3V0AC 1AY1H 1U58B 3Q1SL 1IT9L 4N5EC 1QTYT 4PRHE 4Z95H 3GSWB 5D9SA 4OCNC 2GK2A 3T0DA 2IBZY 4LSQH 1UZ6E 2DLFH 3B2UD 1W0VB 2QEJA 4K71C 1CLCA 4X0KB 3QUKB 5E6IB 2RIKA 3D3VE 4I0CC 4WENB 4AMKL 2C4FU 4Z77B 4ZDHA 1QNZH 4ONFH 2FZ3A 3LMJH 3SDXB 2ED8A 2XZQH 1G7LB 1N3NA 3QSKB 3WNNA 3KPOB 4WHYG 2HTKC 4PJCF 3IT8D 5I73C 4MNQD 5JOPD 1AC0A 3NA4A 4M7JH 1A7NH 3ULVD 3L5XL 1WAAF 4JB9L 3MACL 5DT1L 4G9DB 4PBXA 4KI5E 4LSDA 5L7XL 1MCPH 3NMEA 4ODXB 1MCDA 3GMPA 3REVA 43C9A 3AMKA 3P30H 3P9MA 4LCIH 5IVZB 4CN1A 3P40A 4NWUL 1RUMH 2IPUK 1IGJA 1VEOA 2R1WB 5HGHA 4QOKB 2VDML 2J6EL 4HWNA 1S7UB 3TT1H 1FGVH 4L3CB 4DGIL 3C60C 3QXDB 5C0EA 3O2WH 1U8NB 3UTQB 4UB0L 1U6AH 5E2WH 2Y23A 4NN5C 1I9IH 2VB5A 1AE6H 4K3EH 1PZ5A 5KG9A 1BBJB 3P2TA 1P1ZA 5C08E 4PJIA 2B2XH 1ES0B 3EO9H 4XVSH 3LS4L 2FWOA 3B3IB 1RULH 3ZKND 4QRTB 3MCLH 2HLAA 4WWKA 4LPUA 3VI3F 4R26H 1QBMH 2AABL 1LO2H 3KPNA 1UXSA 4YDLC 1I7UA 3CLEH 4HS3B 5TE4L 2XWBB 3BRGC 1J0JA 4KK6D 3BDYH 5D6DA 3ARWA 4D9LL 5ENWB 4MXQD 4FZEL 2B1AH 4XB8A 4NQVB 4MD0B 4PJ8C 3L9RB 2C4FT 1OTUD 4XVTL 1CLOH 4DOHB 5MI0C 2VLRB 1NMBH 2A6JB 2O26U 4Z0XA 5GJSL 1OCWL 3HE7A 1G6RA 2WUCL 3HG1D 4KKLC 4FG6D 4L4JA 1MQKH 2Y5TB 2VWEE 5H8DA 5J13C 2Q6WB 2BC4B 4XVUC 4G7VL 3NCBB 1CR9H 4OQTH 3HZYB 5BW7C 1WF5A 1IC1A 4UINH 4NM8L 4MD4B 3HAEH 1K8IA 1XIWA 3OAUL 1NGQH 2NY3D 3LAFA 1U93B 3KYKL 1CXKA 2HRPL 4UIKH 3HZMB 4RBPH 3MJ9L 2F54E 5DRZA 5D2NC 3EO1B 1IBGH 4LDEB 1F45A 4PJFB 3D2UA 4LSUL 5HY9B 4GXVL 1XF4A 2RQ8A 4CDGC 2ITDA 4P9MH 2DJSA 3G6DL 1FZOB 1AP2A 4M6OH 3CPLA 1NDMB 1C7SA 1JGEA 3LKNB 1DUZB 1OWRM 5H37H 5I16A 3HPJA 3RUGB 3ZHLA 4CRPA 2VXUH 2JK5B 5LGKA 3Q48A 1PYWA 1EAPB 2NY6C 4D9RE 2EDKA 3RIFF 1UYWH 1YYML 4EUPH 2DRUA 4UAOC 3BPNB 3ARBD 3CVHH 4F58H 4UTAL 2Y5EA 4OAWA 2RCSH 1N5AB 3DV4B 1X7QB 4YBLB 12E8L 5TH2A 2IAMD 1T03L 1MAJA 1YQVH 3FB8A 2ZUQB 4GAJL 1MFBH 5FUZH 2EYRA 4HWZB 4RFEB 1CFVH 1HHIA 3C5ZD 1FC1A 5CD5C 1EHLL 4MA3A 3NPSC 4YGAB 4IHOA 4M43L 4P23D 5DJ8A 4N5ED 25C8L 4Z7UB 5I19H 3SE9H 2R9HC 5AD0A 4Z7WE 3EYFA 1NFKA 1KPRA 1X9QA 2XQBH 1CG9B 1NUFA 3PHOA 4HG4J 1T0NB 1A7PL 3Q6FB 2WIIA 4HKXA 4NFBA 1NL0H 1QRND 1R5IA 1UCTA 4I5BA 2UUDH 3LN5B 4L3AA 2NXYB 4JVWA 5JHLH 3ECBB 5C0CD 2FH8A 4CVXA 4L4TA 5BRZE 3MX0A 4OFDA 1ERNA 2R0LL 5L2KB 4D0DB 3TH3T 5KSAC 5T3ZE 2X42A 4K23H 1ZANH 4K7PY 3QFJB 3PGDB 4BZ1H 4WY7H 3KPTA 1VADA 4Z7NF 1WZMA 4ZTPH 3RPKA 3U46A 1YPZF 3BP5A 4YBQC 1NBZB 4EI6B 4XTRD 3X3FH 5DD1H 3T4AB 1LDPH 1MLBA 4QRPD 4AJ0A 1JPGA 3CFJB 3ZKXC 3AM8C 4Y0GA 1E4XL 5HYFA 5D70H 2AV1B 1EJOH 4WGVB 3PWVB 1NGWB 1T4KB 2B0SH 3S37X 4Y5XA 4JN2A 3LQZA 2X4PA 5SWZD 2YD6A 3C60D 4G8EB 1BZQK 3QIWB 4HV8A 1MUJB 1TITA 4JFQB 3UTSE 2D9QB 5IROC 3ARQA 1W2KT 4PRPA 1X4XA 3SDDD 4Y16A 4WUUD 2P8MB 4TNVK 3LKRB 2NY7L 5D1ZB 3RVUC 3KYMA 3SPVB 1MJ8L 1N59A 1HHHB 3LCYA 1UM5H 3BPOC 3S8WA 5E4IA 1J1XL 3HE6B 5BZDB 1GGCH 5CD3A 3TBWB 3H6JA 2XG4A 1G7QA 1I1CA 4HK0B 2OZ4A 4P5KA 2AP2A 4YXKL 3LRHA 1FIGL 5ITBH 4R9HA 4PJ8D 3B6SB 5DRNA 4NKDA 3VMNA 4FQLH 4WU5A 4GW1B 1A1MB 2NTFA 3BYTA 2KQNA 3KPMB 3VD4A 3I50H 1MI5B 3T0WA 2ADGB 1J8KA 2NY0C 2W1NA 4L29B 3MV11 1F00I 2P5ED 2VXVL 1RPQA 1C5BL 2V2TA 4AZ8A 3JWNC 3BAEL 4QXGL 4WJ5A 5T5NF 3DMMB 1JBJA 2HN7A 3QEGH 2W9LA 1CXIA 3WFCL 4I77L 1P84J 4X6DE 5TQ0H 4OB5H 5KOVC 1N6QH 4GG8B 1OARL 3EZ8A 3DIFA 5C0IA 2BNRE 2XN9E 4CU6A 5FFLA 1JWMA 3O2DH 3IDYC 1HKLH 1WIOA 3FRUB 1U3HB 1LE5B 1RZ7L 3WE6A 4L3EE 3W0WD 2BZDA 3U6RA 3K80A 5I74C 5T3ZL 1JE6A 3DETC 1YEDA 1KELH 4KTEH 5ADOL 5D1QB 1RD6A 5BV7B 3ARGB 5J4MA 1KACB 4NDMB 2NY6D 1G0YR 1G7JB 5D93B 5DVMA 4G6KL 4P99A 1QFUL 4YHIA 1R24B 1NBVL 4E42B 2E6PA 4QHLB 5I2IB 1LILA 4L8BB 1MLCB 1PSKH 3GB7B 1MJUH 1R3HB 4ONGL 3P9LB 1NAKH 4E41E 2CDGA 4DGIH 1QPXA 5A40E 4K3DH 5CJ8A 3OAZH 5C09D 1HWGB 4NGHL 1CFSB 3OKLB 4IJ3B 1LGVA 3DRQA 3WS3A 4I18C 1K9TA 3SY0A 1FYTB 2CDFB 1FFRA 3HMXH 3NCEB 1MEXH 1BJ1J 1ZSDA 4OZGF 3E3QC 2XRAH 1KIQB 1YNLH 2R9HD 3DGCR 3TPUB 3HNTL 2VDQH 1BQLH 3P4NA 5J6GA 5KVGL 2NY1B 3T0EC 2PW2B 4KVNL 1Q0XH 1OGTA 1U8IA 4PJCA 2W0FB 1JWUB 3V6FA 2ZKHL 4WI4A 4OZHE 2JJUA 4X6CE 4K94L 4JANA 4PJHE 3JSSA 4QGYA 4U1GB 3VXUA 4PGEA 4JQIL 2RB8A 1I3VA 3FCTA 4JRYD 3MRPB 1BFOA 1D7FA 1DQML 1JCKA 5DMYA 7FABL 3IETA 5HHOA 3MV7B 4MYWB 3VFWA 4W4NA 1I7ZA 3OJ2C 3I3EA 5AWNH 3I75A 5F7WC 3C8KB 4HCRA 2XKNB 3ZKSD 4LK4A 3ULUC 4YBQD 1HDMA 4LLWB 4NQCE 5D7LD 5FKPB 5DMKA 1WT5C 1B88A 3WNMA 2LTQC 1BBDL 2HKHL 3S35L 4HH8A 2M2DA 3IJHA 4KI1A 1IMHC 2YN3A 5I1JH 2X6MA 1TVBB 4I3SH 3AREC 3U4BL 3MPCA 1JI2A 2IH1B 2BSED 4NUJA 2IBBA 1GGBH 1Z3GL 2VDPH 1OSPH 4PJ7A 2VLJB 1ZT1B 3FFCD 3OSKA 1DQJA 4LLUA 1DVFD 2LV4A 3OF6D 4M1GL 4NN6B 5HYSG 2VL5B 1LP9E 4N0FA 5AZEH 4G8GE 4JFDB 1GIGL 2V2XA 1NKRA 3CJJA 1OL0A 3CDYA 3SE8L 4UTAH 5F1KC 3MRQA 3REWB 5A1AA 3P9MB 2FGZA 5KVFH 5KN5A 2E5EA 2PO6D 5HGHB 1YEJL 1U92B 2DQCL 2KPNA 1IC7L 3JWDC 3UPAA 4W70A 3K46A 2W92A 4YFEA 4BZ2L 5JDSA 1NH6A 2NY0D 1OB1A 3HLAA 3SJVA 4UV7L 3MUY1 3O8XD 25C8H 3GJEB 2AK1L 2NXZB 5DMIL 3D39A 1T20A 1S9KC 1M71A 2ZCHL 3SOBH 4GG6F 1OGAD 3OL2A 1YUHA 5BS0E 3LD8B 1CL7H 3N85L 1OT1A 5MHSE 3PV6A 4OF7A 4UI2A 2P49B 5KG9B 1BD2D 5JPMA 4H25A 3GSUA 1P1ZB 1UA6H 4HS8H 3BD3A 3SBWA 4HXBH 1RIVL 2GFBA 5F6HJ 1LO5B 3PHSA 3O4LD 2HLAB 5ESVA 3CXDL 3FOMA 1I7UB 4PJGB 3QBTB 4JDVA 4HZLA 2JCCF 3C87A 3QDJB 2VH5H 2P8PA 4JFOA 2YUXA 4BFEA 3GUTA 1U3JA 3LN9A 1B0WA 4LFHD 5IK3A 2UWEF 5HYEA 5I6XB 5IGXL 3VE0B 4GRLC 2WBKA 3PG2A 3GBML 1LEIA 5GHWH 4HKZA 2F5BH 4JQXA 3DO7A 3U83A 3BSZH 3TVMA 2DDQH 4Y8DC 1JNHA 1VEPA 3GZKA 1FO0L 2BJMH 4XNQB 1GHFH 2UYLA 4FFZL 5DMGC 2EKSB 4HIXL 5C0BE 5DHVB 2OK0L 1KCSL 4KI5F 5EORL 5FGBA 1WZ1L 3MC0A 4F2MB 4H88H 5IR1A 2FSEA 2QQNH 4I2XA 4R8WL 3GIVA 3GO1L 3QUMA 4KROD 3O3EB 5DRZB 5I1CH 4RZCA 1XGTB 3TCLA 1UADC 1FZKA 2MNUA 3CDGA 1SY6A 2YWZA 5FYKE 2ITDB 4KK8D 3OXRA 3N1GC 3CPLB 2HFFB 2J5LC 2YD7A 4WEMB 3UTZA 1JGEB 3FO2A 1S3KH 4PD4K 5I16B 4J7RA 4HWEH 3A6OA 2O5ZL 5D7IE 2FGWL 4IRJC 3KYNB 3E1F1 4UDTA 2B4CL 3B4NA 3IFNL 3INUH 2BSRA 1A9EA 1QQDA 2IPTH 4U31A 4JRXD 5ACMA 2IPKB 5H94B 4DZBB 1ZGLB 2EXWC 1XR9A 5C6TH 5I8KH 1QFOA 1T1YA 4E0RA 1RZFH 1FNAA 3KLHC 4L5FL 3C08L 2AXFA 1JN6A 1NLBL 1I8LC 4G42B 1A7OH 4EUPA 2EYRB 3BP6A 3T0XA 1U8MA 4OSUH 2X7LA 4MA1C 5I18L 1BQHA 4NNXA 3MO1A 5DJ8B 1DUYA 5AD0B 4JCLA 5IF0A 1AKJB 1KCKA 4XCFL 1KPRB 4P4RA 4LCCB 3LPGA 3LN4B 3E2HC 5IW1A 2CIIB 3ARED 1ZMYA 1M6OA 5IHBA 4UT6H 2NZ9D 3GDBA 4L4TB 1BFTA 4PV8A 1GOFA 3QWRD 3U2SA 4FXKA 4N1CA 3G04A 3QEQD 4U0QB 1W72B 3BP4A 5DQ9A 2VDOH 4IMKA 3T2NL 5CBAA 3LEYL 2RBLA 3KXFA 4NIKB 3U46B 1HEZA 4OCXL 1RJCA 4TNWF 3BP5B 1PD6A 2XG5A 1EEZA 4PY8I 3SO3C 2XZAL 1TJIH 1TQCB 3MZGB 1CK0H 3GJFH 1MFEH 5IW6A 1X5JA 3GMNB 2R69H 4RFOL 2AI0L 2IGFH 4HBCH 4FQIH 5F1IA 1Q9WA 3L3KB 4NQTA 3LQZB 1YEFH 2W65A 5LCVL 4GRWH 1WGOA 2X4PB 1JHTB 1RMFL 1UKTA 2Q7YA 3B9VA 3DX8B 2VDLH 3WUWA 3RDTA 4N1EA 2X4UB 3ZSSA 4TSCH 3HNTH 3VH8A 3AY4A 4WWID 2EDJA 1J86A 5I8OL 4X98B 1U8JA 1A6WL 5FYKL 2D7PA 5GGTA 1NCCL 3SE4C 2QADB 2R23A 5CD3B 5IB5A 3QQNA 3OKEA 5DF0A 1P5VA 4QRRD 1G7QB 3GHBH 4ELME 4Z7WF 3MRBA 1VFUA 1OTTC 4DN3H 3OKOA 4K7FA 4P5KB 4QF1B 3MZTA 1QHOA 4MJIA 4RAVA 5E99H 1YC7A 3DVNA 4MNQE 4X5XA 2BFVH 1F4YL 2EO9A 2E6JA 2UVFA 4GRLD 5GS1A 5DQJA 4WU5B 2GW5A 2ICWA 3U30B 5DUMH 2HFGH 2HWZH 5T1DL 1CGWA 3I2CL 3Q5YA 2OQJB 4F8QA 2V2TB 4WJ5B 2HN7B 4J1UA 4G8IA 4HSQA 5DMGD 3O6MH 3TN0C 4OZGA 4P2RD 4PREB 4KDWA 3QI9B 4YHKL 2F8OA 1TTGA 2G9HB 4GLRH 4HT1H 1EPFA 2NMSA 3DIFB 1YJDC 2ERJB 1IEAA 3FAXA 1JWMB 4OLWL 1X5IA 1RUPH 3MYJB 1OAUL 2GSGA 3SQOH 2GK0A 4KAQH 3QHFH 1CD9B 2H9GA 5DTFA 2A2QT 2J88L 4R4BA 1YEDB 4XH2A 3PP4L 2FR4A 5IBUG 1ZLUH 2VSDA 4OLZL 3CMGA 4BJLA 4IRJD 5BV7C 2ZUTA 3D69A 1A3RH 3MV9B 1ADQH 1CDIA 5MEPA 4G6ML 3GNMH 4YHIB 1T2QH 1IAIM 5EPMB 1JYNA 3L6FA 3O9WB 2DLEA 1GC1L 5CGTA 1PG7L 4JZJA 4Q9QL 2BVOA 2CDGB 3KLHD 1EAJA 1EHNA 2I27N 5D7JD 5HGAA 3HG1E 1SEBB 1KLFA 1ZEAL 1ACYH 4IJ3C 3I02A 2OL3H 1EK3A 4JDTL 4HLZG 4JM4H 2D03L 3BIBX 4GMTH 3MRRA 3LKOA 1H0DB 4JFZL 4U1IB 3VW3L 2AEIT 2DQHH 2J6EA 3P4NB 5J6GB 5C07D 3QG7L 1PGRB 4U7SA 4M62L 4OGZA 1U0QA 4H5SB 3IFLH 3V6FB 4UOJA 1MIEH 2YN5A 5DGQA 4OCMC 1JZ5A 4QXUL 4NRYA 4ALAL 3BKCL 3TYGL 5CCKL 3EJZC 5JW4Q 4HHAB 2FX7L 1BOYA 3D25A 4M1DL 3RL2A 2X9XA 2ARJQ 5HHVH 3FCTB 1A6VH 4FFYH 2HYMA 1BFOB 3HI5H 4I0PA 1HN1A 3NACL 2HFTA 5KW9H 3C2SA 3IETB 5HHOB 3HN3A 4Y19D 3VFWB 5CKGA 5GJTL 2H6PA 2GEEA 4YNYB 1KBGL 3I75B 5SV3A 3WBDA 4Z9KB 1HDMB 3V4UL 1P4IH 1FL3A 1P7QB 4H1LB 4U1NB 5E9DB 4LCYB 4RGMC 4L9LA 5I9QB 5SX4H 5HHQB 2YD5A 3QWQB 1KCSH 1MVUA 1K3ZA 4C56A 1D5XA 1H15B 2VLKE 1F3RB 2IQ9H 3L3IA 2OMNA 4R6UA 3RIAK 5I1IH 2GUOB 2FECL 2BNUB 3OB0H 1CFTA 4NUJB 2XWTA 3M17A 4D9QE 1I1RA 1J1PL 1NGXA 3TESA 4PRNB 1DQJB 1L7IH 5F1SA 4QLRA 1ZV5A 4HDIA 1IQDA 4N0FB 3MJ9A 3VGFA 3MLPA 3D3VA 2A0LC 2V2XB 4DJMA 1L6ZA 4M6ML 4TPRL 4FA8A 4RX4D 3ZTNH 3DVFA 1OTTD 1Q9KA 1RZIB 3HC4L 3PJSA 4MB4A 5EZIL 5KN5B 4KZEH 1BIIA 1A7RH 3C08H 5T5NG 4OZHF 1F3DH 3KNBA 4S0SD 4X6CF 1RJLB 3MLRL 3BGFC 5DVNA 5DJ6A 2UVEA 4PJHF 3QIBC 4YLQT 5CEZE 3L3DA 5F9WC 4Q58C 1OB1B 3HLAB 4XPAH 2ZG3A 3A67L 4OKDA 4D8PB 2NX5E 5IHLB 1NPUA 3D39B 1T20B 4UT7H 5GGVL 3UPCA 3VFVA 3FQWB 4QRPE 2E7LA 2NXZC 3BO8A 4EBQL 1LWRA 1J7VR 1M05B 2BNQB 4L9DA 4X80H 5J1TC 3PV6B 1UH4A 1F8TH 1SBBA 5DEFB 4H25B 5E8OB 4LHQB 4TUKH 2IAND 3VRLE 3MREB 1OP5H 5SX4I 5SWZE 3GI8H 3HPLB 3QUYC 5ESVB 4E9LA 5K9OA 1EH9A 5KVEL 2YR3A 1QD0A 4WWKC 4YFDB 4RMWA 4JDVB 1HOCB 4KXZI 4MMXC 3WLBA 1PZUB 3U9PL 3RPIA 3LKPA 4WUUE 4M7KL 5E8PA 3W5NA 1FV1B 3IFPA 3NFNA 3JV6B 4PJDE 5BO1L 5C08A 4HJJL 4LBEA 3BW9B 3RTQA 2VABA 5DA0B 1OAKL 4HKJB 4OF3A 5HHPB 3W2DL 5I1KL 1LEIB 3HE7C 1S9YB 1SJVA 4JFED 1L9NA 4KQ4L 4Y7MA 4DQOL 3DO7B 5HYQB 4N8VB 4UT9L 2YUWA 4F7MA 4G6FB 4LHJB 2JJTA 1LP9F 3FJTA 2GJ6E 2I24N 2UYLB 4PRBA 1KFAL 3MLUL 2EDRA 2OLDA 4Y4FA 3D18B 1XGRA 4NQSA 3DHJA 2VSCA 1YA5A 4GBXA 4MZ2A 3MODH 4JVPA 4ORGA 3VJ6A 4KTYA 1G7PA 4MA7L 3GIVB 1I3GH 3FQRB 5C9JA 3RFZC 1J0ZA 1OTSC 1R3JB 1XIWC 2RR3A 1A6AA 4BFIA 4RZCB 5TFSL 3UYPA 1TETH 5FDWB 4Y5VA 4XVJH 4AEEA 3CDGB 2DJUA 5E2TL 5A2KH 2DLTA 5IVOA 4FQJH 4ZS7H 2VUYA 1CXHA 2H3NA 3UTZB 3FO2B 3WHXA 5J0BA 3HAEB 4PJ9C 1A1OA 2P42B 1FAIH 3QCVL 5J1AB 1IM3B 4UDTB 1U8OB 4HIJB 4JRWA 1EO8H 2F54A 3HFMH 3EJZD 2BSRB 1A9EB 1QQDB 1TJHL 4GSDH 4MQ7B 3VGEA 3NGBC 2WW8A 2J8UF 2MKLC 1XR9B 5KJRL 1KLGA 2IALA 4KC3B 1M7XA 4M48H 1O5DT 3W0WE 1DBMH 4HWBL 2BOBA 5EUKB 1T1YB 1Q8MA 4RAUA 5F7UA 3DGGA 4BSJA 1G9MC 1JN6B 2CXGA 5IEKA 2DQIL 1EXUB 3I2CH 4EUPB 1DL7L 1MAML 4NZTL 4O2EB 2FX9L 4DUXA 5CEZL 5I30L 1BQHB 4NNXB 1KTDB 3QRGL 3NCJL 4YK4B 5HDOA 1JUFB 5CLTA 3RP1A 3V7AG 4GH7B 1K85A 3P0VL 1Z2KA 5IW1B 5KOMC 1EFQA 2K1MA 3TA3B 3P4OA 1NFDE 5DJCA 5DA4A 5DD3H 5ALBH 4PV8B 4WDIA 1Z9MA 4F7CA 2D7NA 1M1SA 1MCOL 5L8KB 2IC2A 4N0CC 4PD4J 4Z7WA 5DSCA 3RX7A 1A0QH 1IGMH 1V7NL 1HCFX 1RK1B 1T80A 4YHPA 4BSVA 5I1EH 5DQ9B 5CBAB 2D7TL 5FYJD 3MLTA 4MJ4A 2ZOLA 1H3TA 2NPLX 3IGAA 1QA9A 3KLAB 2C26A 5BRZA 4G6MH 2XTLA 1PBYA 1EEZB 4M02A 1ZT4A 3O3BA 2XKUA 4JRYE 1NMAL 4DUWA 4JFHE 5D7IF 2HRLA 1FGNH 4KY1L 1YYLL 5D5ME 3CLFL 4ZAKB 5JHDD 1V5JA 5F1IB 1Q9WB 4YDKL 2W65B 3LQMA 1LK3H 2W9EH 3G6JE 1M7DB 3QIBD 4FZ8L 4Y5XC 5DVKA 2Q7YB 5DXWA 1U2HA 3WUWB 5DI8A 3RDTB 1O7VA 5ANMB 1MOEA 2WQRA 4L8CB 4PB0H 2B1HH 1NLDH 3QUXB 1SJXA 1OQOA 3KPLB 3H2WA 1FSKB 2YC1A 2HT3C 4Y16C 5L8LB 1JPST 2FB4H 3X14A 4YUEL 5CJOH 3NZHH 3ZL4H 3T0AA 1JF1A 3OKEB 5E4EB 2Y1VA 3QUYD 4K2UL 4EDXB 1TLKA 4WWKD 3NIGE 4M1DH 3UTSA 3MRIA 1REIA 4NYLA 5IB2B 4TULL 3DXAE 4YHLH 3V8CA 1NKOA 4MJIB 4RAVB 5E7FA 4OCSH 2AJ3A 5DQDH 3PWLB 2R4SL 4X5XB 4LPVA 2FHBA 4NO0A 5KVDH 5DQJB 5HVHB 3ULVH 1WFUA 3I6GB 3HE7D 4R0LB 5DUBA 5D96C 3H42H 4ZUVB 1FLRL 2R0ZL 5KS9B 3VWJD 3EUUA 4HFWB 4J1UB 4WO4A 4M93B 2D2OA 4GJTB 4FTVE 3THML 3VFSA 3Q3GB 3E6HA 4H20L 3F58L 4AL8H 4XBGA 4M5YL 3TO4A 5GRUH 4PBVC 1P6FA 2CUHA 5DMJB 5GRWA 3TWCL 4L1HA 5LVEA 3LHPH 1GGIH 4CNIB 1OTSD 3NCMA 1IEAB 5J12C 5C0RH 3RNKA 1AO7E 1KJ3L 2R8SH 2APXA 5FCUH 2XY1A 2VYRE 5JUEL 3ZKMC 2GSGB 2EH7H 3TT3L 2GK0B 5J7CC 2H9GB 5DTFB 2YUZA 3VGAB 2DTMH 4R4BB 4XH2B 4X6DA 2MFNA 3V5HA 2NYYD 2VRAA 4TPRH 4AEHL 4PJ9D 4HF5L 4JHBA 5SX5H 3BKJL 4YHMH 4TSAL 3P73A 2XN9A 4O58H 3FN0H 4YGVA 3HI6H 3MRHA 5EZIH 2VTFA 4PRID 5HI5C 2XACC 1U41A 1DFBH 2DTSA 5A2LH 5TE6L 1EMTH 4F7PA 5EBWA 3LEVL 4L3EA 1ZT7A 4JZJB 2VDNL 2GI7A 2GTZA 1LE9A 2BVOB 4ELMF 2BCKB 3U0TA 2KZ1B 5T3XH 5C0AA 2PETA 3NVQA 4QHNA 3QCUH 1KGCD 5GGUA 3QT2A 3V4PH 5CFHA 3RU8H 5HHMD 2YPKA 5HDQL 3RY5A 4MA8H 1Q1JL 3MRRB 2EYTA 2AJXL 3LKOB 4ZUSA 4HPYH 4MSWA 5HJ3B 3SN6N 4KJWC 3U4EB 3QQ3B 4GS7C 2FLBT 3TJEL 2DI9A 5F3BA 5KSBE 3GSNL 5FYLE 5I17A 1DBJL 2RHEA 1ZA3B 4OF5A 4JPVH 4EXPX 1B9ZA 3PNWA 4NRYB 2F8VA 3GSRA 4N0CD 3RAJL 1T0MA 1FNEA 3TF7C 4TVSa 2DMKA 2VR5A 4B50A 2JB6A 5GSRA 1IL1B 4U1JB 5F8RC 3EJJX 3RA7H 2NQCA 3UJIH 4Y1AE 5FXCH 3E8UL 3H9ZA 4UT9H 5FA3A 2WK2A 4OZHA 4D0CA 4K55A 5K9KA 1IAIH 4P46B 1OHQA 1M7IB 4GKOA 4PJHA 3ZT5A 1NC4D 2GY5A 3G5YA 1KFAH 3RIFK 4R7DA 1AGDB 7CGTA 3BZDA 1OP3H 4C56B 1P7KA 1D5XB 4TTGA 4PTTA 1IC5H 1X44A 4JM2F 1FL6A 4FP8L 1AQKH 4HUXA 4QHUA 5T1LA 1WLHA 1BJ1H 1HQ4A 1A6UH 1T22B 1F42A 3JV0A 1C08A 1FO0A 4K7PL 4M5ZH 4AM0B 4XPFH 2V6HA 2WINA 1ED3B 4NQCA 1XH3A 1HHJA 3WFBL 4XBEH 3L5JA 3BN9C 2BY3A 4F7EA 1E28A 1YEGH 5BVPL 1NGXB 4OJFL 3LDBC 4PJEB 32C2A 4P2OA 1J8HA 1S7TB 4KRNA 3GBLA 5TE7L 5GISL 1IAOA 1T83A 2ZJSH 5SWQA 1DLFH 3E0GA 3EDFA 3QIUD 4Q2ZA 1EV2E 4XC3H 4QXTA 4IDLA 4LAQH 3UBXI 3AU1B 2AJYL 2LU3A 4AIOA 4ODTH 4HJGA 3QXUA 1V7MH 1LP9A 3EYSL 3F62A 3CX2A 4G8GA 4X7TA 1HIML 1D9KA 4K9EC 1JVKA 4KUZL 3N1PC 4MNHB 5F3HB 3QHTC 1DBKL 2X4OB 1I1AD 2DBJA 4U6XA 3NCJH 3H9SD 5GGRY 4JO2L 1VDGA 4O2FB 4R7NA 1JNLH 3BPLB 2PW1A 1ITBB 1OY3B 4LPTA 3TBSA 1FDLH 1IAII 1Z6JT 2OR9L 1G1YA 5D71H 3FQTA 3TV3L 3CFCH 3GEWB 4PV9A 3NIFE 2XY2A 5TF1L 4CMMA 4S1RL 4U33A 4DGYL 5K9OB 2NR6C 5HYJE 3WNPA 5FYLL 5CJQH 1VESA 1IM9A 2W0LA 4EN3C 3F65A 3PGFL 5TDPA 3MLZL 3LKPB 3RPIB 5LGHL 4Y5YA 4QO1A 2AAVA 3ZKMD 1QFHA 3IFPB 5F97E 1MFCH 4MAYD 1D6VH 5C08B 5IQ7L 4WW2B 1FNSL 2RGSA 4YXHH 1H5BA 2QSQA 3WFDL 3TVMC 2VQ1A 2IJ0C 5KS9F 3BZEA 4PRBB 3SKOA 4OT1H 3RVWC 1QSFE 3LKQA 4WI7A 3FFDB 1XGRB 3MLSH 3W9EA 4ORGB 5FGBC 3MNVA 3V95A 5J8OA 3TNNA 1G7PB 2OP4L 1RHHB 3WIIL 4R4NC 4BFIB 3OHXB 3F7QA 1QEWA 3I6KA 2VLLB 1KJVA 4TVPD 3V52L 2C1OB 2Z35A 3VDBA 1ND0A 1ZVHA 4DFHA 4MXWL 4UV4L 5C0BA 1NGPL 4P2RE 1F6FB 4XP5L 5D2LE 5IMKA 1LD9B 5EO1A 4QHMA 1JWSB 5CUSH 2AK4D 2J1KA 1AD0A 1I9JL 5F7KC 4N8CL 4ELKA 2F54B 3O2VH 2DWEA 2GTWB 3AB0C 4JN1H 1KC5H 4M1CD 2FX8L 4S10A 1KLGB 3VRLF 3I84A 1OQXA 5J3HD 1PKQE 4KK5C 1I7TA 2BOBB 4RAUB 3U9UA 2QSCH 3IXAB 5D7IA 3JWOC 1MVFA 1K5NA 1L0YA 4URTB 3S36L 5I8CA 1FLRH 4X6FA 2EYSB 3F6LA 1KN2L 4PJDF 4OM1L 5FM8A 1CFQB 5ACLA 1V3MA 1XF5A 3LY6A 4JHZA 4PGZA 5E2UL 2CK0L 3HR5A 1JHKL 5JTWA 4BFBD 1ZTXL 3P4OB 2QLVB 3DBXA 2XA8H 3O45A 1WBZA 4ODVL 4PG2A 2X4TB 4WDIB 4F7CB 1CS6A 1RZJL 2BVTA 3BN9D 3GMRA 4OUOA 4FQ2L 4YDJA 2FNBA 4ENEC 4YHPB 2EO1A 4AEHH 3NOIA 2ZCLH 4ZPTA 4HKBB 2ZOLB 2UY6A 1QA9B 2Z92A 1NCDH 3HC0A 2BHYA 4FRWA 4Z8FL 2NZIA 1P4LA 3NZ8B 4PJXA 1NC2A 2Q76A 1HHKA 1ZT4B 3O3BB 5E2JA 2LQRA 3EYQC 5E8DH 1PAMA 5EWIL 4ERSL 3X17A 2D7MA 4YJZL 1A3LH 5D1XD 3ARDA 4RGNC 3QH3A 1YNKL 4PB9L 1JK8A 3SE3A 2CLVB 4WTZA 4Y19E 1DQTA 4Q6IC 4DZ8A 3U0PA 1VKXA 4EJ1C 1AH1A 1EX0A 3O0RH 4LSRL 4DUVA 2DQTL 1TJGH 1EZVX 4WVRA 4KPHH 3SJVD 2YD8A 4U1MA 2Q8AL 1SYSA 4XNYH 3I6LD 2WBJD 3UX9B 2VE6A 3GJFB 4ZOAA 3VFGL 2VNCA 4F57L 4CUCA 3QP3A 2YC1B 5GGSA 3PF2A 5CINL 2CLRA 2PR4H 4GRWB 4LRIA 1AGCA 2DQJL 5EU6A 2EDBA 2R0WL 2Q8BL 4YHYB 4PJ5D 4U1LA 4JY5H 1B2WH 2R4RL 3MRIB 4NYLB 4EN3D 1HE7A 1YEIH 4O9HL 4GKZB 1H8SA 2AJ3B 5BOPA 1LO3H 2DM7A 3MRCA 4NO0B 2YKLL 1NFDF 2K9UA 5GS0D 2IH3A 4MJ2A 1R0AH 5GS1C 1RIUH 1OSZB 2IEPA 4HFUH 2CQVA 4ELMA 4JFYA 3DRTB 3QULA 1TDQA 2AXGA 4LLQB 1BAFL 4GAGH 4K07A 5DDHA 5ID1A 5T33H 4WO4B 4MNQA 4WHCA 4AEFA 3LV3A 1PW3A 1NGYA 3SKNA 3E6HB 4H8WL 4XBGB 1XR8A 5T1KD 3EFDL 3IDUA 4PGDA 2APVA 4JO3H 2F19H 3RNQA 3STZA 2BSTB 4YZFE 3WIFB 1G0DA 5F9OH 2PYED 1OAXH 2CDEA 3RNKB 3ZDZE 1MCFA 3CMOL 1VFOA 2Z8RA 5HD8C 2YXFA 2DQGH 2C4XA 4KMLB 3C09B 4JZNA 4Y4KB 3BWUC 4X6DB 3S5LA 3V5HB 3ME0A 1KXVC 3JXAA 2VUOA 4Z78B 2EC8A 4WV1A 3EYVB 1FCCA 3P73B 4FXGB 2XN9B 5J06A 4LVOC 2AEQH 4WI6A 2Z31D 4YPGB 5EIIA 3MRHB 1YMHA 1KXQE 3OV6A 3ARFC 2CRYA 1YECH 5LQBH 3ROOA 5MEQA 4F7PB 5EBWB 4L3EB 4KKBC 1S8DA 4KK5D 5SWSD 2HFEA 1I7RB 2GT9B 1I4FA 3PQYD 3RZCB 5KSUA 4YEFA 4Q9CA 4LIQE 4MD5A 5C0AB 1VFAB 3LIZL 2DS4A 4QHNB 5AZ2L 3P11L 1VGEL 1DBBH 1AD9A 2A6DA 1BFSA 2HH0L 2JB5L 3GMMB 5D7SL 1C5CL 4LCWB 3NFSL 4ODHH 5ITFA 4NBZB 3IKKA 5JR1L 4C57C 5F3BB 4QTIH 4Y8AA 2VXTL 3HG1A 3CH1A 2OL3B 2IFGA 5L2JA 3X13A 4LSSH 2HAZA 3GSRB 3L3OB 1CE6B 2J7LA 3OKNB 4M4PA 4EKXA 1RUAL 1X3DA 1N0XH 2XXMB 4XMPH 2NY2C 1FNEB 3PWJA 1AI1L 1MRDH 4DK6A 5GSRB 1XGPA 1KXTB 1U2CA 4I0PC 3MJ7B 1HSBB 4FQCH 4K3JH 3DX7A 2FJGA 3KXFD 2XKSA 2J3SA 1S78D 3UTTD 4DKFH 1B90A 4R4FH 1QFWM 2HT2C 4P3DA 2VDKH 5D8JL 4QOKD 1ZKAA 5DRXA 3AAZA 3BHBB 5BVJA 5CZVL 2Q20A 5E08L 3IXTB 3EYQD 2C7UA 3QPXH 3GGWA 4J4PD 2ZP0T 4R7DB 4E5XB 4I8DA 4L9LC 5MP6H 5FUCC 3M45A 4G9FE 1VPOL 3QJHA 4LCUA 3HMWL 4RGND 5BOZG 5IT2H 1D5IH 5GRJL 1MJJB 4HUXB 1FBIH 4QHUB 5T1LB 5GQBA 1C08B 3PDDA 1FO0B 5CSGA 4I3RL 4IMLA 2WINB 3V52H 3ULUH 1HHJB 1AR1C 2CUIA 4FABL 1BVKA 4F7EB 4IRSC 2YHGA 4LNRB 2VDRH 1Q72L 2DQFA 32C2B 2IAMA 3H7BA 4P2OB 3R8QA 1EBAA 1J8HB 1C1EL 3EKCA 4NM4L 4Z7VE 1DCLA 2VLKA 4YQXH 3CUPB 3UAJD 1CD1B 5SWQB 5LAXB 1WUNT 4X9HA 4OI7A 2CD0A 4X83A 3DYPA 2OTWB 1EEQA 4F15B 2EEDA 4P23A 1MCEA 4NUGH 5J1SC 2AS5M 2DF3A 4J23A 5J9PA 5IMLA 4KRMB 1QYGH 3MR9A 5HGDA 2AXJA 1K6QL 5IESH 1F97A 1QRNA 3KJ6L 3VFNA 5ICXB 3TYFA 4M7LT 1Z5LA 3GK8H 2QHRH 4BQ6A 2E9JA 3HNSH 3U82B 3S37H 1CE1H 2ATPA 3O81A 2FEDC 5EOCH 2MMXA 4KI5C 1G0XA 2ZWLT 4HWBA 4LIQL 4F33B 3H0TA 5EU3B 4R7NB 2R29H 5C71A 2PW1B 1FL5A 1VHPA 2W9DL 4MCZB 3HUJB 5JHDE 4YX2L 3JWDH 4PV9B 5TDNA 3H8NA 1KB5H 5F9JB 4CMMB 3WKNA 1GGTA 3VXNA 1UEMA 2NX5A 5T5FL 1FPTL 2AJSL 4OUUA 2IG2L 3LKSA 1E4KA 4QRPA 1IGCH 5TDPB 5ABDE 4N8VG 2H2SC 1MCWW 4PTUB 3AMLA 5HD8D 1QSEE 3DX9A 5ADPL 3PE9A 5KVMC 1YMMD 4QRQA 2BY0A 2EC9U 5AYUL 2F5AH 5SWZA 1K3IA 2C3WA 3C60A 3RTQC 4NQDE 1KJ2L 3TBYB 4U6YB 4OV5B 2DD8L 4OCYH 3WFEH 3SDDA 4DVRL 1RZKL 2ZSWB 3WO4C 2JJTC 3NAAL 4NQEE 4WUUA 3ARFD 1MPAL 2V7HA 4LKXA 3SKOB 3IAGC 4XP1L 2KH2B 1YZZA 1ZA6B 3HC3L 4KKBD 4PJDA 4LSPH 1A7QL 4Y4FC 1S7SA 3MMEA 1X6NA 4XRCB 3W9EB 4GBXC 2DQTH 1WBYA 1MHEA 5DD0H 5BMFL 1IE5A 1R5VA 3I6KB 4F57H 5FO9A 5I15L 2GJ6A 3BE1L 2NXYD 4Y5VC 4R90H 4PJ8A 5C0BB 4A6YL 5DJDB 4AQOA 4GMSH 2P7TA 2KUTA 3OQ3B 2M1KA 3EDJA 3U7WL 4F80A 5EO1B 2IFFH 4QHMB 2G75A 1FRGH 1JRHI 1GJIA 4WW1A 2QQLL 4ELKB 5B38G 3QFJD 3ES6A 5CEXB 2CRIA 1RZGA 3BISA 1BECA 4OIAA 4JR9L 5C0DA 2DWEB 5DURD 1LEGB 4WFHE 1C8PA 1KIRA 3NIFF 1ZWIA 4QT5B 2NY2D 1F4XL 1TCRB 1JPTL 1SMOA 1ZHLB 3MOAH 4HC1H 1SJHA 15C8H 2DL9A 1Z9OA 2HLFD 1LO0L 2HT2D 1HINH 1MWAH 1LQSR 5I8CB 1BAFH 2PKDA 4PRIE 4LOUC 1DBAH 4NBXB 2YD4A 2C3GA 3W81A 4JZOB 3W0WA 4XPHH 4DEPB 3H9HB 2OTUB 3HR5B 1A8JH 4YHNB 3AUVA 2AJZA 3BD5A 1YEEH 4CVWA 4YWGL 4YDVA 3D48R 1KGCE 3DBXB 5JQHC 2X10A 5D1ZD 3O45B 5JXAL 1WBZB 1KYOK 2PXYB 4XI5D 2JELL 1ORQA 5JORA 2JIXA 4MLSA 4IRSD 2JJWA 1WJ3A 4YDJB 1RJYB 3D0VA 4PRHD 2BDNL 2D3VA 4CU7A 3IDIA 5F71A 3WKML 1S9XA 5EBLA 4ZPTB 4UUJB 3QNYB 1RUKL 3BESR 5DJAB 2P24A 1CU4L 3S96B 1Z9LA 1NFDA 2F58L 2GSIB 1UXWB 1P4LB 4PJXB 5F7EH 5ACZB 1NC2B 1HHKB 2J8OA 5D2LF 2EDLA 3LVEA 4TOYL 4QRSA 4YIQA 1QKZL 1NAML 3QH3B 4RDQF 3K1KC 1JK8B 3KLDA 1EBPA 4DZ8B 3DMMD 3U0PB 3BQUB 3QAZC 4GKNA 4YXLH 3FTGA 5TQ2L 1NCBL 5JO5B 1MRFH 3IS1X 3WSQL 2WANA 2I60H 1UFUA 5IFJB 2FEDD 4KI5D 5CWSA 5IFAH 3PWUA 2WQ8A 3FO0L 4JRYA 1FNGA 4I13B 2ICWJ 5C0NC 2XV6B 5GGSB 5GSVA 4R96B 4XPBL 5D5MA 5EFIA 2YK1H 4V1DD 5CP3A 4OZFA 4JDZA 3MRNA 3TM6A 3G6JA 3MROB 1SMAA 1U3HD 5EU6B 3IDGB 2E8ZA 4AEIL 4NHCH 1GZPB 2FD6L 5FGCE 4PR5A 5B3NA 1YEHL 5D7LA 4YHYC 2XTJB 4PYGA 1N64H 3AM8A 3GSNA 4N5UA 2CK2A 3QG6A 1RURH 3MRCB 3MSPA 2ZSVA 3P77A 3BKML 2FYYA 3G5VB 4KQ3L 4NNPL 4Q6YA 1LO4H 5EU4A 5D8JH 1AFVH 1NCTA 1NSNL 3RWEA 3OJDA 4K94C 4TQEH 1MCCA 2VAJA 4HUUA 2YZ8A 3J8F7 5IROA 4F3FB 2VZ1A 3BT2L 3DXAA 1B6UA 3W39A 3QCTH 1DVFA 5ID1B 3OF6A 1VA9A 4MNQB 1ONQB 4XNUH 3LV3B 5KSVA 4JFFE 3SKNB 4Y4FD 3CU1A 1XR8B 4GBXD 3TO4C 1CLZL 4LASL 4X9FA 3MBXL 3PL6A 3RNQB 4QTHB 4BH8A 5JOFA 2CDEB 5B4MD 1KCVH 2PO6A 1MRCH 5L9DL 3MTRA 1CDHA 4JZNB 3EW3B 2VXQL 1A2YA 3C09C 3S5LB 5ETUB 3VRJA 4N0YL 4OTXH 1JGUH 3O4OB 1BWMA 4JPKH 3ALXA 4EOWL 3FQUA 3O8XA 3WIHH 3HI1B 5HGBA 1YJDH 2BERA 1AO7A 1B4JH 2YPLE 5EIIB 3UJJL 1JGVH 2ITCA 2R1YA 1BD2A 5H2BB 4ZOCA 5MEQB 1U8PB 5FKAA 2XA3A 2HFEB 3BMWA 2XZZA 1I4FB 2CJUL 1CBVH 2V7NA 5KANI 4DKEL 4FQ1L 1KNOA 3QHZL 5BV7H 5EU7E 2Y6SC 4D9RD 1AD9B 3ARPA 3P0YL 4LOUD 4OZIA 2P5WE 1EFXB 2PCPB 4Q9BA 5ITFB 1RIHH 2X1QA 4NKIL 3WS6C 4YX2H 1KG0A 1XT5A 3VG9B 2A1WH 4JJ5A 5E1AA 1TTFA 1Q38A 3WXVL 4Y4HA 4X4MA 4LLDA 4EVNA 3HNVL 4JPWL 3HG1B 3VGDA 5IBTH 1ZHKA 2C3HA 3O41A 4WU7A 4OF8A 3FRPA 2PF6A 2AJSH 3P3YA 2XOTA 3A6CH 5LGJB 3X13B 8FABA 2Y36H 4MWFA 5HSFA 1JJUA 4JFDD 4GAYA 3CFBA 4NC0B 1DQDH 1T3FA 4OFKA 2DWDA 5C92A 1I85A 4KMTL 3SDYL 5KSBA 4YZFF 2AK4E 3DTXB 3DX7B 1UWEL 4UMGA 3ZDZF 2NY3B 1AGBA 1I1FA 4OCWH 4DTGL 4HUVA 5IG7A 4P3DB 2LVCA 3BEVA 4ZO6A 3NAAH 1EGJH 5BRZD 1TZGH 5BVJB 3BXNA 4AG4H 1EO7A 1KTKE 4XP1H 4PRDA 5T3ZD 1FIEA 4RISH 3QJHB 1HILB 3BGAA 2EE2A 4DWHA 1AQDA 4I3GA 3S98A 1GPOL 1S7QA 4NWTL 1TVHB 3DYOA 4WEBH 5GGRA 4U1KA 4N9GA 4IMLB 4Q74A 3ARBB 1CDCA 4BELD 2Q3AA 3IFOA 4JRXA 1IARB 2OJZL 4KDTC 5BJTA 3NPZB 1SBSH 1WZLA 2VZSA 4FNLL 2BVEA 3WCYA 3BZFA 2EIEA 5IHUL 4M7ZC 4D3CL 4LSTL 5C0ND 1IGIH 2IAMB 4FHBD 3H7BB 1DP0A 2ADFL 5JW3L 1TTUA 4P2OC 3S4SB 3B9KC 4JFXA 3C5ZB 4O51A 2MHAB 4UTBL 4CL7A 1PG7X 4YHOL 2FBJH 1X5ZA 4OD3L 3OKMB 5AG9A 2VMFA 4LPWA 3QDMB 5J9PB 1Q9LA 1QOKA 2OSLB 5HGDB 2CGRH 5EUOE 3QQ9C 4GQ9H 4QKXB 4NO3A 2EKJA 1K4CA 3AS0A 1QRNB 3QQ4B 4K71B 3QDGD 2V9TA 3VFNB 3TYFB 3VA2C 5FYJH 1QFWH 2OJEB 1UVQA 2B4CC 2YXMA 1D9KC 5C0CB 4NC1E 4JPIA 1CLYL 4YDIH 3EIFA 2X1WL 2DQDH 1IKNC 3QEUB 1WFNA 3QEQA 5I1DB 4Z0BH 1D5ZB 4ISVA 3B8YA 5I73B 4OLVL 2HJLA 3QFDB 1IGFH 4KTDH 5C7XH 1F6AB 2VITA 4JHWL 1ZK9A 3KR3H 4ZFZB 5TDNB 3FZUC 4OZFG 2XFXA 2OMBA 4BFGA 3A6BH 1KCRH 3WNLA 1R3LA 1MIMH 1AIFA 4WFEE 3BYYA 3TO4D 3BEWA 1KN4H 3U36A 2OCFD 3EGSA 4DGVH 1OAYL 4QRPB 3EYUL 4OLXH 2OI9C 1XEDA 4JO4L 4Y5YC 3L95B 5EN2A 4IIQC 3MUHL 4M3JA 1MNUL 2XZCL 3GSOB 2VR4A 1A6ZA 5CZXD 5DS8B 4QRQB 3WD5L 3VFPB 2AGJH 3WL9A 5SWZB 3C60B 1CFNA 3O6LL 4PJ5E 3GIZL 3Q6GH 2UZIH 3ILQC 1H5BC 1OAZL 4JO1H 2BNRD 3I9GL 4EQ2A 5IHZA 4Z7VF 4M9OA 3EFFB 4NN5B 3BUYB 3FO9B 2H2PC 4LKXB 2NLJB 3T2QA 1G9NL 1FNHA 4PUBH 4XC1H 1UB5B 4P9HL 2F74A 4XGZB 1NANI 5TQ2H 5FB8A 1L6XA 4MCYA 1AKJD 1I8KB 1S5HB 1INEH 4LHUG 4QRRA 1WBYB 1DJSA 5GGQL 5GRYA 4YDLB 4JG0H 4Z7OE 1L7TL 1MHEB 2Y6SD 1G6RH 5HPMA 5JQ6L 4NZUH 2FRGP 5IB4A 5FO9B 2Q7NA 4MNGE 2JJSA 1QFWI 4N68A 4G43A 4PJ8B 4GRLA 4IRZH 1JPFB 5FUOL 3NH7H 4ZSOA 4E41D 2NY5L 5DWUL 1J11A 2P5EB 2VC2H 1SEQL 1RUQH 3CIQA 3ES6B 5J13B 1RZGB 1QLRA 3UJTH 1QZ1A 5E1HB 4JJHA 1KENL 4BSWB 2VAAA 3RWFB 1QACA 2X4SA 1ZWIB 4K8RL 4ZO8A 1A9BA 4NNPH 4P2RA 5L88L 1UZ8B 3L5WA 5CMAA 1JZ4A 1QO3B 1NSNH 2IQAA 2I9TA 1SJHB 2R56L 4PS4H 5FA4B 4LSVL 3VWKC 4OM0H 5D2NB 1KEGH 3C6SA 2W60B 3G9VA 4LVHC 3FL7A 4XX1E 1N8ZA 1CTNA 1YPZE 1A4JB 2OM5A 1UJTA 3W0WB 1PKQA 1QBLH 5SWSE 1YC8A 4XT1C 3L1OL 2Y07H 4NJAL 1G9MH 3MLXL 4JG1H 4IRJA 2NY6B 2EDXA 3FRPG 1A02N 1WITA 4L8DB 4UAOB 1B3JA 2CSPA 3RWIB 4BQ9A 1P4BH 3BFOA 4PG2C 5CEYA 5JORB 5EO0B 1CVRA 3ZYOA 4X8JA 1N7ML 3SDXE 3D0VB 3LH2L 1LMKA 2HTLD 3VRIB 3IDIB 5FO8B 4Q0XL 1E27A 1S9XB 4XMKH 5D7JA 4POYA 5C09B 1CZ8L 2HVKA 1UCBH 5I1LA 3B9KD 1PJ9A 4WRLA 5IP4A 1RHFA 3UP1A 2A9MH 5INCA 3NPSB 3BRFA 2H26A 1J0KA 4JGMA 2GCYA 5J6HB 2Y7QA 3EYOA 3V2AR 5ILTH 4M61A 1IEBA 3QQ9D 1XF2A 1WEJL 1F4WL 4GRMA 5DZOA 3ARDC 4YFLI 3SE3C 4DKEH 3H3PH 5HI3D 4G8GD 1MCWM 1D9KD 3FTGB 5IVXA 5GS0L 4ODSL 4QOKE 5EU5A 2Y25A 3X11A 3R0MA 4KDVA 5KSAB 3L3GA 1WICA 3PWUB 2QQKL 3U7YL 1GC1C 1FVEA 5IIEB 4S1SL 1A14H 5A43C 4XCNA 1H3VA 2V2WB 1CIDA 4Y19A 5EFIB 1CTOA 5FHBL 1KYOJ 1AXTH 3IDJA 1SVZA 3FZUD 4OZ4A 5EOQH 4RQQA 1RK0A 1KB9J 3G6JB 4LLYA 4NZRL 3VFOA 5D7LB 3G9AB 3BN3B 1EVTC 1KLUA 2QQQA 5KBNC 3ZKXB 5CHNA 3QZWG 4P59L 5BS0D 1UM6H 2P48B 1BM3L 3MV9D 1E6JL 5DK2B 5DO2D 4DVBB 1P53A 4J3UA 1BF2A 5EU4B 3V5DB 3OJDB 4DOHE 3CFKA 5BZWA 2VLRE 4HUUB 2WSKA 1QLEH 3FFCB 2OZ4H 3MFGB 4Q9RL 3DLQR 2D0HA 5IQ9A 1WWWX 4ZFGL 5JIIA 4XWGL 5KSVB 3B9DA 3SE4A 1GL4B 1UM4H 4NWTH 3OGCA 3BPOB 2XPGA 2YSSB 2ZNWA 3FT4A 3OZ9L 5FO7A 2HKFL 3ARUA 4RX4A 3JWOL 4BH8B 4NQXA 4GW4A 3MNWB 4RWHA 4WCYL 4Y2DA 1JNNH 5F72S 5SV4A 2PO6B 5JW3H 1W8NA 4CGTA 1T1ZA 4MQSB 3GBNH 1GVIA 4PYHA 1CF8L 4PJFE 4X4YB 3BH8A 1A2YB 2NY0B 4XCCL 1RVFH 4HWUA 3V6ZA 4P0DA 4WV1C 4XMLL 1QG3A 3PABB 5IBLC 3TBTB 3RUGE 1ORSB 3OG4B 4G8FA 1OGAB 2MTPA 1NCWL 2Y06L 1OP3K 4XP9H 3ELAT 2R1YB 1BD2B 4I4WB 5FKAB 2ZUWA 4EIGB 2R2EB 1P7QD 1N4XH 5E9DD 4ZPVA 3FN9A 4XNMA 4YH6A 3MGOB 4MAUL 1JRHL 3RI5F 3O4LB 3NN8B 1KNOB 4TUJA 1P5UA 4WFFE 1U8HB 3VWKD 4JM2C 4MQTB 3GMQA 3IDYB 4YR6B 4KK6C 4OZIB 3S3SA 4MXQC 1IFHH 3N9GH 3RWJA 1KG0B 4PJAB 3F7YA 5E1AB 4EVNB 1MHCA 1NUNB 4XCYA 3C5JA 5F8QC 3MQIA 2F15A 2ORBH 3O41B 4WU7B 4FG6C 3DO3A 4KRLB 4MWFB 3IDXL 3NCCB 4TVPH 5IB3A 3DOSA 2DI7A 3CFBB 3UZVB 3DI3B 1N5YH 2DWDB 2EH8L 3L3JA 4EDWH 4LLMA 4JY4B 4IS6A 5HHNA 3NTCL 3QJFA 4KROB 4RDQG 1MCNA 4I18B 3UMTA 1AGBB 1OPGH 4XPTL 3QFJE 5IG7B 2WMPA 5JXEC 1F58H 5B39G 1G1CA 4WUKL 4G5ZH 3TZVD 1I8IA 3EOBB 3HCVA 3O6FA 4PRDB 5ESQB 2OS7A 3LS5H 3VD9A 3BIKB 5TPWL 1KJ2A 1G7HB 3FONB 5HXMA 3D6GA 3FB5A 5J56B 3SDAA 1UQSA 1E6OH 1OAQH 1U91B 1F90H 2BNQD 4WHDA 5IEHB 1HYRC 5GGRB 1EGJA 4N9GB 1BFVH 4DK3A 4CVZA 5E8EA 1RU9L 4JRXB 4M8VA 5F7DB 4C54A 2H1PL 5BJTB 4HX1B 3F7VA 3M07A 1BQUA 4HGWB 4G7YL 4DAGH 1W0WA 1AJ7L 4G9FA 3OKKB 1ZVYA 2ZCKH 5FUOH 2FL5A 1BEYL 1WTLA 2A6IB 3GI9H 4BQBA 1BLNA 2HT4C 5AAWA 5E2VH 1OOAA 4JFXB 3U1SH 3NCYS 2I9LA 4O51B 5IFHL 4I48A 2WIMA 1F3DJ 4A6YA 1G9EA 4M8QA 5DR5H 4P23C 4APQA 1Q9LB 3UC0L 2LTQB 4JHAL 1V8HA 2D0GA 1D3CA