4UT9L

Crystal structure of dengue 2 virus envelope glycoprotein dimer in complex with the scfv fragment of the broadly neutralizing human antibody ede1 c10
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
110
structure length
110
Chain Sequence
QSALTQPASVSGSPGQSITISCTGTSSDVGGFNYVSWFQQHPGKAPKLMLYDVTSRPSGVSSRFSGSKSGNTASLTISGLQAEDEADYYCSSHTSRGTWVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords ENVELOPE GLYCOPROTEIN E
publication title Recognition Determinants of Broadly Neutralizing Human Antibodies Against Dengue Viruses.
pubmed doi rcsb
source organism Dengue virus 2
total genus 17
structure length 110
sequence length 110
chains with identical sequence M, N, O
ec nomenclature
pdb deposition date 2014-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ut9L00
3TJHC 5CINH 1I1AA 3ZE1E 5IG7A 1RJZA 4D9LL 1YY8B 5JIHA 4QHLA 3KG5A 4S2SB 5HYQB 2A77H 3WLBA 4MWFB 1BWWA 5HHQB 4A6YA 5C7XL 4I8DA 1CFVH 3ZDYF 5E9DD 3X14A 1IAII 1P7QA 3VFPA 1YEJH 3WE6A 4NO0B 1HZHH 5E6ZA 4Z7UA 3OB0K 2GAZA 4NO2A 2I07A 2G60L 1U8JB 3FQTA 4DJMA 3HR5B 3QIUB 4FXGB 4NRXA 5CJXC 1ZMYA 4IIQC 4HJJH 3TPUB 1DANT 1DBBH 3R1GL 3SGEI 3WIIL 1ZVSA 2JCCF 4Y4FC 4MA7L 2DF3A 4XCYB 4HQQL 1B4RA 3QEQB 3MV7D 2Y07L 1YEHH 1WF5A 2ZSWA 3D18B 1D9KD 1P2CB 2QHRL 4AEFA 4D9RD 3OL2A 4Z77B 2CUIA 3MJ7B 5C3LD 4EJ1C 4WFED 5E70A 1CU4L 5FOJA 4X9FA 2EO9A 4LF3A 4JEGB 5DR5H 3EFFA 1S7TB 5ICYA 5IKCA 2VC2L 1NL0L 1F4YH 3VXSB 1SMAA 4JFED 4I4WB 4ZUWB 3BPLC 4N0RA 5DGRA 4KDWA 4F9LA 1GGIH 1ZAGA 4U1IA 1T04B 5F3HA 3WFHB 5GGVL 3MCLH 3ZSSA 4UB0H 5FB8B 2H2PC 1MQKH 4PGDA 3RHWF 4JQXA 4XBGA 4OLEA 4TULH 1MFAH 1T21B 1JGDB 1GHFL 1RSFA 2W9DH 5BXFB 1MNUH 1A6TB 2CUMA 3CNKA 4XPFL 5GGVY 3RIAK 5KZCB 1HI6A 1MJJB 3C5ZC 1S78D 2IANB 1UVQB 3C6SA 5AG8A 4V1DB 1C8PA 2GJJA 1JN6B 2AK4A 1KPUB 3P9MA 1DDHB 5C2BH 3MJ8A 1TITA 4LAJH 3LRGA 3MRMA 3GBMH 2PYFB 1KCSL 4X5XA 3EOAA 4APQD 3QIWC 3QQ4A 4P57A 4WDIB 4GRLA 3WXVH 3TF7C 4LCIL 4HWUA 3W11D 3MLYH 1A3RH 4MNGE 3WEXB 5CEZH 4GBXC 4J3UA 2OCFD 2V5RA 5B8CC 3H9HA 4JG1L 3MLUH 2R2CA 5GSVB 2HFEA 1M71A 4MLIA 5L7XL 3RL1A 2FEDD 1K8DB 1OTUC 2XWBA 4OUUB 5TQ2L 3DX6A 1J05B 1NGQL 3QWOB 1SBSL 3RTQD 2QQNL 3UTTE 3LSOA 1UB6A 5IWLC 5JW3L 5SWSE 2N7AA 1A6VH 3UTOA 5KSAC 2Z92B 3KDMA 4PTTB 5TF1L 1XR9B 1H3XA 4J3VA 4RDQF 5ADPH 5SX5H 1MFDH 3VE0B 5D2NB 5DMGD 1HEZA 1VENA 3BUYB 3TO4D 4D8PA 1JPFA 5C0EB 3RWFB 3HI1B 5CGYD 4OD3H 2EDTA 6CGTA 4JO3L 4QF1B 43CAB 3BGMA 3BD5A 5DMJB 1A6ZA 4P4RB 1AD0B 4JFDA 1G0DA 2XQBH 3QUXB 5DZNA 2W0FA 1HN1A 4WHTB 4OJFL 3ZKND 4GRWH 5JXEC 3LDBC 3PNWB 5I6XB 5F7FA 3FONB 3MRBA 3CMOL 2IJ0C 3E3QE 3LPGA 3MBED 5LXGL 1A7RH 5HI3D 4G80B 1LWRA 4NQVA 3BHBB 4EN3A 3E3QC 4O4YH 2XIDA 2NLJB 1A14L 1Y6KR 3T4YA 1QSFD 3ELAT 4GAGL 1KXVC 3NIFF 4JPKL 4MJ4A 1KTLA 4FQ2H 3AXLA 3VGAB 4GG8A 3TN0B 3CUPB 1AKJA 1MIML 2BNQA 3D87B 2CDGA 2F53A 5D6DC 4OQ1A 1C16A 4KV5E 3NCJL 1OD7A 5FO9B 5CGTA 3BKCL 5SWZA 3OPZH 5DWUL 4QY8B 1WT5A 2W1NA 2BRRL 1K3IA 1KEML 2Q7YA 4KJPD 4XRCB 1NLDH 3VXTA 1N5YL 5E8NB 5IB1A 1KPRA 4AIOA 4LNRA 1L7IL 1G0YR 2VDQH 2E7BA 5F1OB 1FNHA 5DD0H 4DKAA 3OAYH 5ID1A 5KBNC 4U6HB 1FH5L 4LPWA 3C6LA 3GMOA 4J4PD 4FZEL 4LSUH 4ODSL 2D0FA 1HKFA 2IQAA 1XR8B 4I18B 1TJGL 2X4TA 5DFWH 4LCCB 5I66A 4FP8L 4H20H 1NCWH 1UB5B 3ALPA 4KMTL 3VMPA 2AEPL 5IQ7L 3ARED 4PB0H 4PBXA 2VXTH 3NCMA 1XGTA 4Y4KC 2ATPB 4LGPB 2FSEB 2YD6A 3JTTA 2ERJB 3PIQB 2PNDA 4I0PD 3LKOA 5ESAA 1YEKH 2AJUH 3WIHL 4M43L 3MUY1 5K33A 4GUPB 4Q0XL 1NH6A 1F4WH 5T33H 4CDHA 1IC5L 3F8UB 2Z31C 5C0BA 1SJEB 1JZ3A 1I8IB 5D1ZC 4Y16A 2VZVA 3LQZA 1XGYH 2YK1L 1S7VB 3VFWB 4K8RH 1R5VB 3AU1A 2HVJA 1BECA 3QQ9D 1X5FA 3UAJC 3CH8A 4JKPL 1YYLH 4JM2F 4KHXH 5CD3B 2AK1L 5HDOA 1EZVX 4KK6C 3BZFB 4Z7VF 4D3CL 3X13A 5GRJL 4WU5A 1KG0B 5DRNA 1T3FB 4NCC2 3S88H 1JK8A 2EIBA 4OGAD 4X0KA 4EDXB 4GAJL 4Y4HB 5C07B 3QCVH 4AL8H 4XMKH 3RL2B 1IVLA 5DC9B 3V6OA 2GYSA 4QRPD 3HE6C 5F7DB 1I3UA 1K2DA 2B1AL 4BFEA 4J3TA 3CFBA 4Z7WA 3Q6FB 3BT2L 4DZBA 4OZGF 1WZLA 2EZ0C 3MLWH 3P0YH 4QHNB 5IW6B 3D85A 3MV8B 4KKCD 1U8MA 4R6UA 1YEEL 3VWJA 2WBJD 2RB8A 3B2VH 3IRPX 4NWTL 2ARJA 4LSQH 4JO2L 2GK0A 3ILPB 35C8H 1J1XL 32C2B 3MXVL 4G8GA 2VLRB 3BN3B 4MS8C 4GS7B 4QXTA 5BRZD 4PJBA 2NX5D 1MVUB 4NQEB 2BNRD 5E7FA 4O9HH 1CWVA 4QRRD 4QTIH 5I1JL 4YHML 1OAQL 1QKZL 2ICEA 5E4EC 3ROOB 2YUWA 5HDBF 5F3BB 1ZHBA 4BUGA 4LEXH 3MRCB 5FGBC 3ULUF 1AGEB 3FQNA 5D7KD 4OKDA 3FQUA 4ODVH 1I1RA 1TPXB 1SYSA 3HRZB 5J1SC 5E8PB 3IJHA 4CU8A 4Z7UF 4ODUA 4UIMA 4UDTA 1JGEA 3SO5A 4C54A 1GPOL 4UQ3A 4M48H 1B0GA 4FXKA 5TPWH 4YFLI 1S8DA 3LAFA 3VFOA 2MFNA 1GZQA 4UILL 5FGCE 1UCBH 1MPAH 3QFDA 4LRNL 4YWGH 1HH6A 4RGOL 2P5EA 2Y6SC 5I1AB 3P73A 5D9SB 5EZLA 2APXA 3O6FA 3MRRB 2WUBH 3BWAB 1QLEL 3BDXA 3CZFA 5IHBA 3KXFB 4GSDH 4QRQB 2F8OA 5BVJA 3OKKA 3HMXH 3U4EB 2HN7A 1I3VA 2ZCHH 3GB7A 3K46A 2E9WA 5JW4Q 3MLRH 5E08H 4JLRA 2ARJQ 3BAEH 3MLXL 3WL9B 1HHHA 5MHSD 2R1XB 2YPVH 4JHBA 1LQSR 5DD5H 3O3AB 5ETUB 3DRQB 4JPIB 1FFPA 1A0QH 4ELMB 4KDTC 3MGOB 1CE1H 5MP6H 5C0IB 1H15B 4P46A 2FD6L 1U3YA 3L3HB 3QG7L 1ZLUH 1GAFH 2FZ3A 1TIUA 5ISZA 3WYRA 4ZSOE 1QOKA 2KBGA 3A6BH 2FWOA 4FN0A 3RZCA 4HUMB 5DD3H 2I9TA 2HG5A 3S98A 4ZUSB 3S6CA 3HZMA 4CBPA 1RHHA 4DEPC 2P24B 3V8OA 1RURH 5GS0H 4W81A 3NAAH 1BPVA 1BQLL 3V4UL 4LFHD 1T5XA 3IRZA 3U0TA 1IARB 1DL7L 3QNZA 4PJHE 3DXAD 5DMYA 4XBEL 1N64L 1RUML 4KTDL 4OFPA 1BIIB 4QWWC 1UXSA 3S4SA 3U2SA 3PP4H 5C6PB 1HSBA 1AXSB 3KR3H 2Q3ZA 4QRTA 3OKOB 4DVBB 5I8OL 2OI9C 1B0RB 2HRPH 2XTJE 3TPKA 2B0SH 5I71C 3UROR 5IBTL 5EOCJ 1T2QL 4HT1H 1A9EA 2XTJC 5J8OA 2PO6D 1RU9H 4YBLC 5HHOB 4PJAE 4E0RA 4WUUE 1J0YA 6FABH 2BOCA 2R2EA 4I9WD 1F97A 4S1DD 1LEKA 4U0RC 3LKRB 5IOPA 5D1QB 4NM8L 1CIUA 3AFLA 3C5JB 3GMQB 1WWBX 3HFMH 4OCWL 3VFTA 3MV9E 1AGFB 4K71B 3RWHA 4FMFA 5DZLA 4IRZH 1MCNA 4EIZC 5AUMA 4NFBA 1UZ8A 4F7PB 4G7VL 4QOKA 5FHAH 1INQB 3EJZD 3MJ9A 4OLWL 2OL3H 3FO2B 1CT8B 3H42L 1AI1L 4I77L 4JG0L 4HUUA 1JHLH 4OZHE 3T0XA 2FIKB 4L8SC 3PL6B 3TWCL 1A4KA 3FFCD 2FJGA 3GNMH 2VN4A 2XNAA 4YDJB 4AMKH 4G43B 2XN9E 4HUXA 1GJIA 4N5UA 3OKLB 3HPJB 2P43B 2DOCA 2AXFB 4KJQD 2CIKB 2NW3B 4XPGH 3LD8C 1IGJB 5E1AB 1CR9L 4LSRH 3CDCA 1E4XI 1RHFA 3EYQD 3U83A 3RVXD 4NO5B 4LCWE 4JRWA 5CZVH 2YPLE 5FYLH 4LHUA 1RUKL 4U6VL 4XWGH 3TBWA 4PJ5A 4PY8J 1KB9J 4P49A 1AIFB 4WEUD 4P5TC 1DVFC 3MYZA 3QQ3A 3REWB 4XC1L 4DKFL 5IV2B 4L3ED 3TNNA 4FQQB 3IDXL 1AGDB 1M7IA 2N1KA 3RWGB 5ITBH 2J7LA 3GHEL 4ZFOL 4R4BA 4Y5XB 5A1AA 1U92B 2BVQA 3GGWA 3D1MC 4IMLA 4FFVC 5EUOF 3LN4B 4KUCD 5IVNA 5BVPL 3OAUL 3MX0A 3QDJE 1NCNA 1S5HA 3EOTL 2Z8WC 5E5RB 1SHMA 4QRSA 3WN5C 3R1GH 1FVDB 3WIIH 4WI7A 4WV1A 2HKHL 1MCOL 4MA7H 2CSPA 4HQQH 4ETQB 4E42B 1T22A 2Y07H 4WFGD 3QUKA 2XA3A 3BGAA 1OF2A 2XY1A 3MBXL 4IIQB 2QHRH 4MJIB 1RULL 3DSFL 1JPTL 5GRUH 3BX7C 5KN5A 2DQIL 1CU4H 1G7IB 1FC1A 3I2CL 4Y4FB 4QRUA 1BAFL 1RZKL 5F9JB 4CVZA 1BEYL 2EDJA 3IYLW 3QCUH 4XT1C 2VC2H 3FCTA 3HR6A 5IFJB 1T20A 1BFOA 4ENED 4JY4A 5IIEA 1FNLA 1FL5B 3LZFL 2GITA 3AROA 5GGVH 1FZJB 1UWGL 2R0LH 3P11L 3FT2B 4P23B 4OZGB 3TNMB 5J9PB 4JGMA 4E41B 1J0IA 3MODL 2AXGB 3LVEA 5B3JE 3BPLB 1GHFH 5JQ6L 4L8CB 5KS9E 1UACH 1S9WA 3BKJL 4XPFH 5HYSB 2AVGA 3IXTA 4NRYB 2YWZA 1BIHA 4Z7WF 5SWQA 3DGGB 4IRJA 4PYGA 4ZXBD 5HGHB 3G6DL 1ORQB 2W65B 3GDBA 1GH7A 2XKUA 1ZT4B 1W0VB 4NKQB 1A5FL 3S35L 2DTML 1ZKAA 4X7SL 2IG2L 3MFFA 1RJZB 2ADJA 5GGRB 5E24E 3WD5H 1VGKA 4LCIH 3X14B 1WVZA 1P7QB 1TVHA 3WE6B 4YHYB 2AV1A 3OKDB 4R4ND 4JG1H 4YC2C 1G0XA 1INDH 3MRKA 4X4MA 2I07B 4HGKC 1X5HA 5L7XH 4MQTB 4WY7L 4MA8L 4CKVX 5TDOB 4MNQA 3DUHA 2C26A 3V4VH 3V9FA 5DHVA 4XVSL 5D7IA 1ZHNB 1Z9OA 2QQNH 4HXBL 1QSZA 5EIQA 3KAAA 5JW3H 4K94L 4ZOAA 1BF2A 1XEDA 2C4FU 2W59A 1FORL 3BP4A 4JVUA 5TF1H 4MNGB 4TVPD 3ULVF 1HIML 3IF1A 2FRGP 1JTTA 2JK5A 1EA9C 4I0KA 1D5XA 2VOTA 5K59F 3OJVC 4JO3H 3ZDXE 3EJJX 2CO6B 4U1MB 5KSAB 5E8EB 2H2SC 4ZOBA 4GQPH 4RMVA 1UQSB 5HDQH 4XXDB 3INUL 5SWSB 2HRLA 5ICYB 4OJFH 4ZO7A 3IVKA 5GGTA 3BD4A 4PJDA 5JXAH 5SV4A 3T3PE 2FYYB 5LXGH 1F3RB 2Q6WA 1IEHA 2XV6B 4R9HA 1CGTA 1A14H 3R4DA 4TUJA 3EYUL 3T65B 4JPKH 4PGDB 3M07A 4OF8A 1YQ2A 3BKYL 3RA7L 2OR9H 2DLGA 5LVEA 5DJCB 1MIMH 1E4WL 3H0TB 4FHBD 5AG9A 1KENL 2PW2A 1T0NB 3ZTJG 3NCEB 3SDDD 5LAXA 4C57C 1DEDA 2OTPA 3BKCH 5FYJH 2OP4L 2AK4B 1OP9A 2BRRH 3P9MB 1KEMH 5CP7A 5EOTA 3MJ8B 3RBGA 4UIKL 5KVDL 5T3ZL 1QBBA 4KK5D 1L7IH 4P99A 5ACZA 3X3GH 3IU3B 3QQ4B 4P57B 5GJSL 1F6FB 1MCCA 2R9HD 3VFRB 3Q5TA 3AAZA 1FZOA 4FQ1L 4PJ8C 4FZEH 1SBBA 1G1YA 5K9QI 2BJML 1TJGH 4Y2DC 3MR9B 3VXUA 2HFEB 1M71B 2APBA 3RL1B 1OAXH 5IVZA 4GT7A 4PV8A 2AEPH 2XWBB 5C1MB 5IQ7H 3PGDA 4PB9L 5E9DE 3SKNA 1A6WL 2VISA 2QL1A 2HTKD 2IFGA 5KOMC 3SKOB 4JHWH 1MLBB 3P9WB 1M7XA 1CD1A 1RIVL 2IPUG 1U58A 3UJJH 5C08A 4M43H 3KDMB 1D3CA 3W0WA 2RCSL 4FFYH 4APQA 1MWAL 4IDJL 4BSWB 3U7AA 3V79C 2ZG3A 1JPFB 3TV3L 1N0XL 4UNTA 4ZD3L 3BGMB 3VXPB 4XAKE 1A6ZB 1LP9E 2YK1H 3MV7E 4P2QD 2JJUA 4F7TA 3EGSA 4BH8A 4JKPH 1IGCL 4HK0A 2X1PA 5HPMA 4D3CH 1D9KC 3D3VD 1P4BL 2UWEE 5GRJH 4EQ2A 3ZLQC 2DYPA 2QHLA 4EIGB 1PG7W 5I8KL 1VFAA 5FYJU 1KTLB 4M4RA 1AJ7L 1NMCB 3AXLB 4GG8B 2AGJL 4JFEE 1MQ8A 5A40E 1AKJB 2QLVB 2AJYL 2B1AH 4DZ8A 4KI1A 5J13C 4QT5B 4WTZG 3TP4A 5JO5A 3BT2H 5E7BA 3ZE2F 3O9WC 2R4SH 5KAQF 4JY6A 4F2MA 1L0YA 4JRXE 4P59H 5IMKA 5SWZB 1YEEH 2XOTA 3ARBC 3P3YA 4FXLA 2WWMC 1R5WB 2Q7YB 4JO2H 5EDXA 4MLSA 3G5XB 1J1XH 5IB1B 2COQA 4U6XA 4LNRB 1LE5B 1QSFA 5IEKA 3RGHA 5ID1B 4TOYL 1S78C 5CS7A 4RNRB 2OJZH 5IBLD 5I1JH 4YHMH 1QKZH 3AUVA 3GMOB 1OSZB 4MAYA 2IQAB 3MRIB 4PRPA 4Q6IA 1ACYH 1MRCL 4NUJB 2ZUYA 4FG6D 2W07A 4KAQL 4GKZA 2V2WA 2IQ9L 2FECL 3FN9A 4HX1B 2JJTA 1FVCA 1I3GL 1KJ2L 2BVOB 2XWTB 3U1SL 3NGBC 4CDGC 5E4EB 2H41A 2C4FT 4K3DL 3V0VA 1QBML 3LKOB 2X4UA 5ESAB 4LLDA 1CDJA 1I1CA 5AYQA 4CADB 1ZSDA 1GPOH 1KCLA 1LK2B 4X4ZA 2IPKB 4L4TD 1KGCD 2YSSA 3SJVA 2FEDC 5FM5M 2UZIL 1D6EA 1MI5A 4XX1E 4M6AA 3IS1X 1IEAA 3RTQC 3BGFC 3C8HA 1XCQA 3LQZB 4KKBD 3FQWB 2L7JA 3KHOA 3VDBA 3NACL 4M5YL 4U1KA 1Y0LA 5HJ3A 5DJZA 2OTUA 5DK2A 1Q94A 3X13B 4NT6B 5CBAB 2EDWA 3CDGA 4XPAL 3TO4C 2HT3D 3FOLA 2QADB 1XF1A 2I26N 3BPCA 2CK0L 5FYJD 5CGYC 5DHYB 3T0WA 4U1JA 5GZOD 1F6AA 2HJLA 3LKQB 5IVOA 1NGYA 3B43A 5DFVD 3ARXA 1A02N 3ZKNC 1QNZH 5AD0B 5GS3A 1BREA 2YRLA 1K2DB 4FOMA 3CFBB 4X5WB 1QA9B 3MBEC 5AAMA 4PGEA 5C3TA 5HI3C 4DZBB 5K9QG 3RY5A 3HG1D 1BVKB 3GHBL 3OG4B 4U3HA 2DTSA 4H0GA 3U6RB 3VI3E 4PRHD 5E2UL 3VWJB 4IRSC 2DD8L 2QKIB 3IDGA 5C70A 4YEFA 3HHRB 1PY4A 3EO9L 1JHKL 2FD6H 3QG7H 1YECL 4G8GB 3LKSA 3RWJB 1WFNA 4QXTB 1LO2L 4JJ5A 4PJBB 1DCLA 5BV7B 5JTWA 1DLHA 4DFIA 4LASL 4U6YB 2X4RA 2APVA 2ICEB 2BSRA 4QRPA 1UYWL 5ICZA 5CILL 5IHZA 4KJPC 4M9OA 1ZHBB 1BQLH 3A67L 4JZNA 3V4UH 1CN4A 2Q3AA 3ZYOA 4R7NB 4PGZA 2IH3A 3B9AA 1DL7H 4P48A 2R1WA 1LNUA 3STBA 2ITCA 3OKYA 4ZSOB 1WGOA 3HC4L 1IT9L 3IJHB 4HS3A 4G5ZL 4KTDH 4B7IA 5H8DA 1BJ1J 5CWSA 3O41A 4J4PC 1TETH 3AMLA 5HHNB 4YDVB 1WFTA 2XFXA 5EU7E 5GISL 1OWWA 5I8OH 1ZLWK 4UDTB 4EUPB 4DUVA 4UQ3B 5D7IF 2ZUQC 1RQ5A 2A38A 3T09A 4FXKB 5EU7C 1S8DB 3MZGB 1EBPA 2YRZA 3AREC 1GZQB 1MCWW 1D7FA 1PQZB 1KNOA 3SDCD 5MEQB 3FB8B 2AJ3A 5IT2H 3BVNA 1MFBH 3QDMD 1IM9D 4I0PC 1HH6B 2NY6D 2Y4SA 2OI9B 5EPMA 2EDKA 1H3PL 1NCBL 5I71B 1T7ZA 4NM8H 5EZLB 3SHSA 2IBGA 4GG6A 3UTQA 4JZJA 3O6FB 1A6UL 2PN5A 4JFXA 4U2ZA 5FV2A 1LILA 5GRVL 4G7VH 2Q86B 2VB5A 4OLWH 2AABH 4PJAB 4PJDF 3ZKXC 2VXVL 1AI1H 1MF2L 3H42H 4JG0H 5MERB 5JORA 3QQ9C 1PKQE 5BVJB 3Q1SL 3OKKB 1L9MA 2IAMA 2HN7B 2VDML 5F1SA 2XI9A 4V2CB 2CR3A 1AR1D 4DW2L 2D7MA 2EE2A 3QWRD 4WO4C 2LV4A 4W4OA 4NYLA 2JELH 4L8SB 4WWKC 4BH7A 1REIA 2DI8A 5EBLA 4WW2C 2UZXB 4JCLA 3CLFL 4KRPD 5DVOA 3SOBH 4M7ZC 1RZKC 2VITB 3AMKA 4GAYA 2P44B 4DOHB 2JLLA 4CVXA 3QHFH 4U6VH 1N59A 4KI5D 1S7UB 2FWOB 4L3CA 2AKRB 4P2OD 3RZCB 5I1GL 1HH9A 2ZCKL 2BVUA 3H7LA 2DIBA 3HZMB 4XC1H 3NMEA 3GJEA 4DKFH 1QSEA 2X10A 2WBJC 5BZDB 3HE7C 1YQVL 4YK4C 3IDXH 3V6ZA 3GHEH 4X7EC 1S5IL 1RK0A 4S11A 4O5LH 2NX5E 3QJHB 4YQXL 5LGHL 3D0LB 4FFWD 3OTTA 4M00A 3SO3B 4QRRE 4Y5VA 4WEBL 1IGML 5INDB 5I1CH 1DVFB 3ES6A 5J1AA 3CX5J 3S4SB 1HSBB 3OAUH 3MO1A 1U2HA 1D5BA 3EOTH 3SDAD 2APWA 2CXGA 5D96B 1P7HL 5AZEH 5IQ9A 1J0JA 4QRTB 1DBKH 3RDTA 3MYJA 1MCOH 2A1WH 1VGEL 2A9ML 3HAEG 1VFUA 3MBXH 5EU6D 1RULH 1I7RB 3DSFH 1JPTH 3QI9C 4BA8A 4E0RB 1XF4A 2BOCB 4H1LH 3WN5B 2DQIH 4J6RH 1JHTA 2YZ1A 1EUUA 3I2CH 2DMKA 2R2EB 4OAWB 1BAFH 1RZKH 5LWYL 4J8RA 5IOPB 1BEYH 1F11A 3DXAA 3PDOB 1IILE 4JDZA 3RWHB 1U3ZA 3NA9L 1IAIL 1N26A 3HZYB 3T1WA 5GS2H 3N50A 4R97C 1TVBA 2VDNL 5AUMB 2FJHB 4EEEA 3U9PH 5CHNB 4H8WC 4ERSL 1ZOXA 1KB9K 3WCYA 3QSKB 1MY5A 4ZAKD 3AGVA 4HUUB 3QB7C 2GJ6A 3CPLB 2EDNA 5I75C 1IL1B 4YR6A 4K94C 1HHGA 2FJGB 4OCYL 2IBZX 4R90L 2XNAB 3O2DL 2Z8SA 5JQ6H 2PO6A 5C0RL 2XRAL 4TUKL 3LEVL 2P8LB 2CD0A 3IAQA 1WEJH 1GZPA 2IH1A 1ED3A 1KLFA 1MHHA 5EOQL 5L2KA 5DC0A 4KK9D 1U2CA 5T1DL 3D25B 3U79A 3CFCL 1X5ZA 3G6DH 1HNFA 4TNVK 4DGVL 5HVFB 4NHCL 3QZWG 2DQGH 4O2FB 3WIFB 2OR8A 5MHSE 3NIGF 4LHUB 1A5FH 3S35H 2E7LC 4FTVA 1TQCB 3TBWB 4Z7OE 4X7SH 1CTNA 1EFXB 2IG2H 1FLTX 5KS9B 1F42A 2RGSA 3BKML 1RV6X 3VW3L 3QQ3B 4PG9B 2VLJD 1MRFL 2APTA 3FFCA 2OZ4H 1M7IB 1BBDL 1U8OB 4L9LC 1MLCB 4R4BB 1EEZA 3DVFA 3VGHA 2EXWD 3GGWB 2CMRL 4IMLB 1CICA 4MA8H 5F72S 5F1NB 4XVSH 5D8JL 3N1PC 4HXBH 1S5HB 1NC4B 1L9NA 2MWCA 1IGIL 4BQ8A 4D9QD 4ZUUA 3PGFH 2VDLL 4HWEH 4X6EA 4HKJA 1FORH 1NUDA 3B9VA 2VZ3A 5T3ZE 1O0VA 2GQHA 1FYTD 5JA9A 1HIMH 5DT1L 3QUKB 1F4XL 4RGND 5IHUL 3KPOA 5H37H 1G9EA 4KUZH 4L3EA 3SCMD 4P4KD 1PW3A 1PJ9A 3WO3B 3QNYB 4YZFE 4QRUB 1JI2A 4PRIA 2Q1EA 4CVZB 3INUH 2AXJA 5HYSG 4ZUVB 4KTYA 2VL5A 4L4VD 3FCTB 1SEQL 2O61B 1WC7B 2M1KA 1BFOB 1BVLB 4JY4B 5IIEB 1DQDL 3D39E 5ITFA 4LARL 5EO0A 3V4PH 3GMRA 1UGNA 1ZLSL 5JPMA 3BKYH 5JA8B 1TCRA 2YR3A 3DARA 1IKNC 1E4WH 1NMAL 2WBKA 5FA3A 3HMXA 3E8UL 5JOFA 3EJZC 3IXTB 4WTXA 1KFAH 5I8EB 1AHWA 5SWQB 4IRJB 2HT4D 2OP4H 3HNVL 2EE6A 3RBSA 1ZA3A 1E6JL 1DZBA 1VADB 2H9GA 1VFOA 4I3RL 4QYOA 3G5VA 3I50L 5H94A 5T3ZH 5KVDH 3T0EA 4Z8FL 1T1XA 4LPVA 3IFPB 2BX5A 4NQDD 4K3JL 4NZDA 5KVEH 3O8XD 2GSGB 3MA9L 1JYNA 1EFQA 2ADJB 3MRQA 4MA3B 1M05B 1SEBA 4FQ1H 4MQ7A 1HHJB 3EYQC 5T3XD 1U3HC 4DCQB 4HIJB 4M1GL 1JVKA 2QSVA 2BJMH 3AB0B 2ZWLT 2YUZA 4LBEA 5DJDA 1CLCA 1BGXL 4MNQB 3AS1A 3TIEA 2VDRL 4PB9H 5DHVB 3SGDI 2VNCA 4JFFA 4OZ4A 1A6WH 4OI7A 2L0DA 3MZTA 5J89A 4Y2DB 3CVHB 1ZLVK 2V2XB 3BP4B 1ZHLA 2KKQA 4XGZA 4PJ9C 1XGUA 5DMIL 1MIEL 1MCWM 4X6CE 3JWNC 2C3XA 1MWAH 4IDJH 4RIRA 4Q74A 4TN9A 2JK5B 1R3LB 1D5XB 3OJ2C 3PWUA 3TV3H 1N0XH 1N2RB 4PJCA 2VR4A 5D5MA 3SE4A 2W9LA 3WFEL 4WCYL 5E9DB 3DUSA 3F12A 1P7KB 1CE6B 4NC2B 5JIIA 1IGYB 4WFGE 4YAQA 1RZ8A 1T03L 1IGCH 2BMKA 5KZCD 1XIWD 3CC5A 3LRSA 5FGRA 1KJ3L 2E27L 1YEDB 1P4BH 3WFZA 5DSCB 1EMTL 4K55A 1FL3A 1P53A 3QNXA 2Q6WB 3BH8A 4NSKB 5A3IC 4GG6F 3IKCB 4TUJB 2HKFL 1LP9B 2O26U 5I8KH 4LVNC 3WNLA 3T08A 1N3NB 2AGJH 1T1WA 4OCLC 1D9KB 2AJYH 3OZ9L 2Z35A 4X6DE 2FL5B 2A74A 1HKLL 3M45A 3GMPA 2PW2B 4ENEC 3K8KA 2UWEB 2P5WD 1FQ9C 1TTGA 2Q7NA 4Y1AA 3CMGA 3BP7A 5B39A 2P8PB 2C3HA 4H0HB 3EYSH 1JPSL 1IEBA 5J13B 5CP7B 5EOTB 2CJUL 3MROB 4BFGA 3EO0B 3U36A 4QXUL 5D70L 5F93C 3GSNL 1UXWA 4JFOA 1FE8L 3UX9B 5HYJD 1JUFB 5EA0L 5ACZB 4XP5L 1MCPH 3FQXA 3AAZB 4MX7A 4ZXBC 5FDYA 3MRGA 5HGAA 3GI8L 3S7GA 4HAFA 1G7LA 1X9QA 3VXUB 5LCVL 3UO1H 1HE7A 1QRND 2DJSA 5I74C 3FL7A 2NY3D 4KAQH 3PV6A 4R2GD 2ESVA 3SKNB 1I3GH 1KJ2H 3M1BA 3U1SH 2VISB 4XH2A 1QBMH 2MHAB 1CD1B 1U58B 4AK1A 4MSWA 5C08B 5GGUB 3OR6A 1HILB 1LO4L 3HI6L 4R4NC 3C9NA 1MCQA 3W0WB 4FMKA 2PXYA 4APQB 2UUDH 4UTAL 1W72A 5C8JB 1MHCA 3K2MC 2UZIH 2UYLB 4N0YH 3U0WL 3LQAH 1JTOA 4EI6B 3O3BA 4F7MA 1LEGB 4R96A 3WNNA 4XCFL 4TVPE 4G42B 3EGSB 2FX8L 5E2WL 4OB5L 1CXEA 3NACH 2Y23A 5DD1L 4IS6A 2XG4A 2Q87A 4G6ML 2YD1A 4FFZH 1E4KC 3L3JA 4CVUA 4XPAH 3CDFA 5D7JA 3RTQB 2DYPB 2CK0H 1RZIA 4U1GB 4KV5F 5IVXA 3RX7A 4LCWA 3JV5A 2IFFL 1RUQL 2G9HA 3BI9X 1VFAB 1OP3H 5E2VL 1VA9A 1Y18B 1CL7H 4P9HL 3MLVL 2RQ8A 1YMMD 3TO4B 3IETA 3FOMA 3NCCB 5JO5B 3VDAA 5LBSL 2AJVL 1EX0A 1X5GA 4JY6B 4F2MB 1EV2E 4Q9QH 1NKRA 2J6EL 5E2UH 5IMKB 4GW1B 5D72H 3EZ8A 4PJFA 5BJTA 5IESH 2DD8H 3ESVF 5ELIA 4XPTL 3BD3A 1MJUL 2J8UE 4M8VA 1F4HA 3MBEB 3ALWA 4PD4J 3TVMC 3UDWC 1I1FB 1WQVT 4HXAH 4U6XB 5IBUB 1YECH 1T83C 3C09C 4HHAA 1QSFB 1O5DT 2O5ZL 3D2UD 4TYUA 4HAGA 4LASH 4OLXL 3SDDC 1Z9MA 2BY3A 5IMOA 1HXMA 1KCRH 2J4WH 5DHXB 1UYWH 1DBJL 5CILH 4Q6IB 5J11C 5JLZA 1Q0YL 3I6KA 3A67H 3ARVA 1EPFA 3G5ZA 4GKZB 3TA3A 4G8EB 4Y7MA 1DUZA 4I48A 3P30H 3HC4H 4G5ZH 1HHKA 3V0VB 5T1LD 2R15A 3MLPA 2VUYA 3WXWL 4OLUL 4LLDB 5D93C 2OXHA 5GISH 4RISL 4NN5C 3SJVB 2X05A 3EHBD 1PG7X 1CFQB 4LMQI 5E2TL 1AO7A 1BD2D 1KUMA 1XCQB 2IEPA 5F96L 5C07D 2HTKC 2Q8AL 3H7BB 1NFIB 1EAJA 5JW4N 1NFDE 3QXDA 1H3PH 4L3AA 1S7RA 2ZUQB 1NCBH 4RWHA 5I76A 1Y0LB 1LK3H 4D2NA 1RJYA 5HJ3B 5DJZB 1XFPA 5DK2B 1Q94B 3P4MA 4TRPL 3MV8D 1I9JH 1A6UH 2IALA 5DEGB 3UTSE 3FOLB 4LKCA 3BPCB 1ZGLB 5ILTL 4TTDD 2NY5H 4P2QE 3RWDA 2Q76A 1YJDL 5I1EH 1NKOA 1F6AB 3BQUD 2HJLB 3BXNA 3N0PB 1MF2H 1NGYB 4NO3A 3VXME 1FIGH 5J3HD 5IJKA 1H8OA 3D3VE 4HKXB 3Q1SH 3T2OA 4ZFOB 3PDDA 3MUGA 5CLTA 5HXMA 2VLRD 2VDMH 3I3EA 1Q72H 4PGEB 1EEQA 3SE3A 4CMMB 1WWAX 2B1HL 3KPLA 3QULA 2A6JA 2VLMD 1XCTB 4X4XA 2I9LA 4HDIB 2YN3A 1MCJA 1R3HA 3KYKH 2JTDA 3IDGB 1PKQB 1XF5B 3M17A 2NTSP 3ULSB 1FRGL 3T2PA 3LKSB 3EDJA 5I1GH 5DD6A 3K4ZA 2DQUH 2ZCKH 4GRMB 4WW2B 5EH1A 1M6OB 4QRPB 3V0WL 4M7ZB 5ICZB 1KPVB 1KLGA 4F37F 5IHZB 2JB6A 1SJHB 3QDGE 4XAWL 4YQXH 3ZDZF 4JKMA 3RNQA 3KPMA 1LNUB 4WEBH 2ZUWA 1WFUA 4MNHA 4HS3B 2WBJB 5CWSB 3O41B 3DI3B 2V9RA 5KSVB 2HA1A 4WRLA 2XFXB 3UBXA 5FA4B 3V2AR 2W9EL 1VGEH 4FG6C 4ZG1A 5HHPA 5GIRB 5BRZB 1KXQE 2GJZA 2A9MH 2QQKL 2BNRB 2V7NB 2WANA 4O2CA 4PV9A 3CXDL 5IJVB 5DUPL 3D0VA 5I1LA 3ZKQD 1KNOB 1DR9A 4JVPA 3QUZD 3LN5B 1EUTA 1I4FB 5E00B 4L4TE 3BP5A 1OVZA 2ZNWA 1KGCE 4PJCF 4MCYB 2E9IA 3PQYD 2YC1A 1OAKL 2DQEL 4JZJB 1ND0B 4YNYA 4PJIE 3K8MA 3NA9H 1IAIH 4MAUL 2J8HA 5BQ7A 4K7PY 2VDNH 4HIEA 5FECA 4GRWB 1U8LB 4JQVA 3BO8B 4X98A 1MCHA 4KKBC 2DM7A 2HMID 3HZKB 5L8JB 3L5HA 4L8DA 5JORB 3LKPB 5FFLA 4PRDB 1BVZA 1A47A 2NY0B 5D1XC 5HYEA 3IFOA 3O2DH 4HKZA 3MFGB 1T2JA 2XRAH 2EH8L 3CSBA 3LEVH 4TUKH 4Z78B 5J57B 4Y8AA 4F3FA 4MA1C 3MACL 1N6VA 1I3RA 2RAMA 5EOQH 3W39A 1A7PL 2GSIB 5EORL 5GZOC 4NYLB 1W8OA 1YEGL 5T1DH 1EGJL 3CX5K 5I75B 3CIQA 3CFCH 3G08A 4KHTL 1BLNA 1JE6A 4M7KH 5FF6A 4JGJA 1Z0NA 2DQTL 3HG1E 4NHCH 3VCLA 5L88H 1F2XK 5DA4A 4GMTH 1MRDL 3S4SG 4PRHE 4NUGL 4PJHF 1LGVA 4MGXA 4L3CB 1HH9B 4U6TA 2AXHA 3T8XA 4OCNC 1DBML 2F54D 4P2YA 2C7UB 1QSEB 2B4CL 5D71L 1CZ8L 1OAUL 5I2IA 4I2XA 5LGJA 3ULUH 1ZT7A 4XHJD 1GOFA 1NJ9A 1PFCA 5EIVA 3F6LA 3EFDL 3OR7A 2B8OT 4Y19E 4ZS6D 2VYRE 3LEXA 2X70B 1HOCA 1UM5L 4BKLA 4Y5VB 3HZVB 3FKUS 4MXQD 5TE6L 4ONFL 1A9BB 5EIIB 8FABA 2OMNA 3W9DA 1T5WA 3IDIA 5D8JH 5I1HL 3MO1B 5F6IB 4IOIA 3JBG7 2FDBP 4L9LB 1IGIH 5MENA 3IDJA 2Y7QA 3KPSD 2VDLH 3MYJB 4JRYD 3SDXE 3VI4F 5DT1H 4AZ8A 2EO1A 3J7HA 1F4XH 4RFNC 3Q3GB 5IHUH 1FL6B 2PW1A 4JFQB 1XF4B 3MPCA 4FQXA 4K2UH 3H6JA 1NCCL 3M8OL 2X41A 1YN7B 4NQCD 1WITA 4NHUA 3EAKA 1QFWL 5GQBA 3MUHL 4LSDA 4KJYA 3DXAB 2FJFB 4JDZB 4NJAL 3VFUB 3FZUD 4UDUA 1U42A 1OCWL 1GC1L 3WO4B 1TVBB 3QDME 2EIEA 3OKNA 3SDCC 3SDAA 5IB5A 4HUWA 4LARH 5I15L 3HNTL 2NY6C 4GO6B 4JFPA 1AC6A 3ZYZA 4LHUG 4YR6B 1TTUA 1ZLSH 1HHGB 3EYVB 2O5XL 4YDLB 2VL4A 2PO6B 1RVFL 3QUYD 3TH4T 1NMAH 3B83A 3O4LD 1BZ7B 2E9JA 2UVEA 3E8UH 1ED3B 1MHHB 3DVNA 3LV3A 1GIGH 4FQLL 1S9YB 4CAGA 3MGAA 7CGTA 3T1FB 1A1MA 3MRDB 3JVGC 3HNVH 1RMFL 4LU5L 5IW1A 1VCAA 5K9OA 1K6QL 4I3RH 2YPKB 4PJFF 3I50H 3I6LD 1AR1C 2FX9H 3MA9H 3IU4H 5FM4A 4HH9B 3AS3A 4OZIE 1XGQB 3VJ6A 4Q9BA 5HD8C 2X4QA 3FFCB 4OFYA 4XVUD 4L1DA 3EOYG 4M1GH 3T3ME 3OWEA 5HI4C 3OGOE 5GJTH 1EEZB 4KI5E 5IUSA 1ETZB 3CFEA 3CFDB 4JM2D 4KI5C 4XB7A 2DB8A 1BGXH 4P2OC 1EEYA 4PJEB 2VDRH 4EOWL 1V3LA 4ZO9A 5L0QB 4Y5YA 2J12B 1JGUH 3L5WA 5I1KL 1Q9OA 3V5DA 1CLZH 4DGYL 4G9FA 3QIBD 4KJWD 3FO1A 4FFWC 1NANH 3QEUA 3MMEA 3KPOB 3UJTH 3MLZL 2RIKA 2D0GA 2VLJA 4L3EB 4NC0B 1X5KA 2BHZA 3BIAX 4WCYH 2DWEA 3WFEH 1G7MA 3IJSA 2DQDH 3AS2A 4PRIB 4JHZA 1XH3A 3NN8A 3SY0B 5CJOH 2OSLA 4ZFFB 5ENWA 3VD5A 5B3JF 1SQ2N 2R29H 4J3XA 1OARL 1A4JA 1KJ3H 2E27H 4X6CB 4XNMA 1EMTH 2V5YA 4LGSB 4MDJA 4TQEL 2FHCA 5JDSA 3RWIA 2Z8VC 5EO0B 4G9DA 4WGWB 1NFKA 3GMRB 4PIRF 3I02B 2NY1D 5JPMB 1K8IA 3BESR 1WTLA 1QLFA 1YA5A 5ACMA 3OZ9H 2WIIA 1I1AD 4K7FA 4FRWA 4P3CL 3LOWA 3QCTL 2ZJSL 2CKBB 4OGXH 3VRLF 3P0GB 3F5WB 3QT2A 1AHWB 1BFVH 3QH3A 4AIXA 4P5MA 1FFNB 2BZDA 1OGAA 5EUKA 2DAVA 4ORGB 1JPSH 3GO1L 2PTVA 4P3DA 2CJUH 5I30H 2VLKA 2H9GB 5D70H 3HI5L 3G5VB 2QSQA 1T1XB 4X6DB 2EXYD 5JW4M 5BZWA 1ZEAL 5C0JA 2EYSB 5FYKD 1RFDL 2WINA 1CLOL 1NAKL 4KK9C 4PLKD 1SM3L 1NBZA 4L5FL 3FRUA 3ECBA 4X8JB 3TLRA 3UZQA 4FQHB 1RJLA 3GI8H 2VXQL 4DTGL 5CEXA 4P9HC 5DJDB 1SY6A 1VPOL 4YX2H 4ZXBB 4JFFB 1AGBB 3ZDXF 1YY9D 3TT1L 3DV6A 4HZLA 4WI2A 1QFPA 4YUEL 3K7UA 3HI6H 4J12A 1ZHLB 4HJGA 1IGTA 4XGZB 4B53A 1JNLL 1XGUB 1M4KA 2EXWC 4OZFA 5HHMD 4CNIA 3GSWA 3O8XA 2XPGA 5EZOL 4RIRB 4H26B 3T3PF 1CFSB 1X5JA 3U0WH 3PWUB 5D5MB 4D9QE 3MLTB 3F12B 4XCFH 4HH8A 3SBWA 1FYTE 1SJXA 3WDIA 1JV5A 2FX8H 5E2WH 4YAQB 5DD1H 2ED7A 4NFDA 4H1LA 1W0WB 5DUBA 4UUJA 3CC5B 3LRSB 4HD9A 5E6IA 3X11A 1XF2A 2FLRT 1H3UA 3FB6A 5E2JA 2DDQL 1FO0H 2XQYG 1DBAL 2P47B 4P4KC 5GS1C 1D5MB 1TZHA 2EDHA 3SCMC 3G6AA 5JOEA 2IFFH 1NDGB 2FBJL 5TDNA 3GMNA 2G75B 5EN2A 4ZTOL 5EU4A 2ICES 4LLVB 2Z35B 3HE7A 2A74B 3QAZC 5HI5D 4GRLD 1UT9A 3QR2A 4QXGL 4OF0A 3UC0L 5LBSH 2AJVH 4OT1L 4MD0A 4U1SA 2J6EH 5I1DA 5J6GA 5C2UB 4N9OB 5B39B 2LU3A 1KB5H 4XP9L 2FH6A 4XHQA 4XPTH 3HTLX 1MJUH 1QUNA 2BSED 1KCVL 3X12B 1EBAA 4XXCC 2ZUTA 1UXWB 4JFOB 2IMMA 5FKPA 1RZGA 2O5ZH 3FQXB 4OLXH 4MX7B 3NZ8B 2OTWA 2HT4C 4PP2B 3ZKMD 5ID0B 2X5PA 3MRGB 5HGAB 5K9JH 1DBJH 1G7LB 3S5LA 3WFBL 2J8UB 1UJ3A 3B9EA 4L29A 1RZJL 2OZ4A 3ARSA 3GM8A 4YHPA 4DKEL 3SDDB 4JFDD 3ARUA 3M1BB 5BCAA 2A6KA 4QKXB 4XP1L 2R8SL 4OM1H 5J11B 5I1IL 1N7MH 1F2QA 4MSWB 5TH2A 3VH8A 1HXYA 5IMLA 3C9NB 2VDOL 3DROB 3R06B 2VDPL 3NCYP 2GIYA 3QRGL 1W72B 3KNBA 5DJ6B 4EN3D 4XX1G 5IB4B 1MHCB 2KZ1B 3BPOB 1JGVL 4K23L 3NFSL 3PWLA 4YHIA 1U91A 5A43C 4OBRA 1L0QA 1HCFX 2Q8AH 5F96H 1BQHA 4R96B 4M3JA 4GLRH 4PJXA 3VXSE 1AKJD 2X9WA 2EE3A 2BNQD 3OJDA 4NN5B 2F53D 5DQ9A 3TCLA 3L3JB 5A2LH 5HY9B 4TRPH 3DMMA 4ODTL 5GGSB 1ZV5A 4PD4K 5ABDE 4ZNCD 5ILTH 1RZIB 1RZFH 5SWZD 3MQIA 1YJDH 1P6FA 2NY2D 5IVXB 4OTXH 3L3KA 5JW5B 3S8WA 1CDGA 1MJ7H 4QO1A 2DLIA 5IBUG 3ZTNH 1N6UA 2VSDA 3B5TA 1XIWC 2IANE 3IETB 4V1DE 3FOMB 2MCPL 4DN3H 1A7NL 5ANMB 5JHDD 2B1HH 3C6LD 3N85L 4P2QB 5HHVH 1KOAA 3B9KA 5H35B 4O58L 2GUOA 1L6ZA 4PJFB 4Z76A 1I8MB 1NUFA 2GTWA 2QTEA 4JPWH 3O6KL 4OIAA 2PYED 2YUXA 1GGBL 3D3VB 1MEXL 2WBWB 4JN1L 2NR6D 4MJ2A 5E99L 5C09D 1LO3L 4RAHA 1H3GA 1YPZA 4YE4H 5I17A 1JNNL 3VXRA 2ZOLB 4LRIA 4HF5L 4GJTB 3FO0H 5IB3B 3V0WH 1AP2B 4R8WL 3FFDA 3BPNB 1YMMA 3CXHJ 5HYJE 3BRFA 1DQTA 3I6KB 5MEOA 5C0BD 3WUWA 4XAWH 1S3KH 2HT2C 4MJ5A 4ZO6A 3G5ZB 4F7CB 4Y16D 3W5NA 4ZQKA 4M7LT 2DLTA 2HJKB 1T1ZA 3CD4A 4I48B 3FO9A 1EJ6A 2Y5TA 4G7YH 4OLYH 1CGSH 5D2NE 3OB8A 5B22A 3GRWL 5KSBE 1EIBA 2MJWA 2VRAA 2C1OA 3T0AA 2V6HA 5D2NC 2W9EH 2XXCB 4Z6AT 1YMHA 4F8TA 3TBVB 3D2UA 2QQKH 1QO3B 4JPVL 2WK2A 3WS6C 3E0GA 2GT9B 3CXDH 4R2GC 3ARGA 5DUPH 3WS3B 1AO7B 1CQKA 3QUXC 3GSUA 1Q9KA 2SEBA 4K7PH 1PZ5A 2EC8A 5I6XC 4N68A 2JIXA 3L5XL 1X3DA 1S7RB 2B4CC 5I76B 4J23A 1UH3A 1RJYB 5K9KA 1FSKC 1JZ7A 1F58L 4ISVB 1OAKH 2DQEH 3D85D 3P4MB 4N8CL 1FIEA 1F45A 4MAUH 4J2XA 1J8KA 1I8LA 4A6YL 3KGRA 1CDIA 2PTUA 4ZMAT 4ODWA 5GRXG 2DRUA 1VEMA 3GIZL 3VI3F 1KIQA 4NNPH 1I1YB 3VGAC 5DJ8B 3ARFD 1JPST 5GGRY 5C0CD 1FGNL 3V5KB 1P1ZB 3B5HA 2A73A 3PGCA 4G8GD 1M7DA 2R0WL 2Z91B 5FYKL 2EH8H 3FB5A 2A6JB 3MACH 3SPVA 1A7PH 5EORH 4X4XB 2FEEI 2N7BA 1YEGH 3KYOB 1JPGB 1EGJH 1R3HB 3MREA 2LU4A 1JWUA 2DQTH 1A6AB 2N4IA 4DWHA 4MA1B 2LABA 1IAKA 4YDKL 3QO0B 3B8YA 3ULVD 1GC1C 3BQUA 1VACA 2OJEB 5DD6B 4I18C 5CKGA 1DBMH 3NFPA 4PUBH 2B4CH 5D71H 4C83A 4WUKL 5L8KB 4KZDL 1KLGB 1CI5A 5FO7B 3E1F1 4MQXD 5M7QA 3EFDH 1KTDA 3HG1B 1CD9B 3CSYB 3RWEB 3SGKC 3RNQB 1UM5H 2X4OB 3WHE0 1NLBH 1EAPA 2YA2A 4ONFH 3KS0J 2HFGL 2EIZB 1I7TA 2P5ED 3LMJL 4N0UA 2F58H 3G04A 3WHE1 2DQHL 3JUYA 3S37H 2VH5L 5HPOA 1ORSA 3UBXB 3VGDA 2X1OA 3G6JA 3CH1A 3O6FD 3GSRA 3KWWA 3BSZH 1P4LA 3FQRA 4JKLA 3MRLA 4HEPG 4O2CB 2LTQC 4PV9B 3EJYC 1NGWA 4X5LA 4XVJL 2EKSA 5DURD 4JY5L 4TPRH 4NPYA 4JKKA 1NCCH 5IM7A 3GSVB 3HRPA 2VAJA 5INCA 4MZ3A 2BOBA 3L3GA 3B5GA 5B21A 4YGVA 1QFWH 2YC1B 4NJAH 3RI5F 4RFNB 2Z0BA 1BD2E 3EHBC 4UQ2B 3SDXB 1OCWH 2DI7A 5C07E 5BQ7B 1GC1H 1T80A 4BFIB 1JBJA 4Y4HC 5DJ0A 4N1HB 4X98B 4Q2ZA 3V6FA 5ADOH 4EI5A 5I15H 3B6SB 2HLAA 3HNTH 5MI0B 4QNPE 4L8DB 3TM6A 4J1UA 4P46D 3MV8E 4QCIA 4HEME 1GSMA 1I85A 5ISZD 2VIRA 2X9YA 2O5XH 4HKZB 4DUWA 2J8OA 3VFMA 4NGHL 5D2LA 3RZCD 3RP1A 2F15A 3W2DL 3PHOB 3MRHA 3PJSA 4TTDC 1CXFA 4F3FB 3DETD 4J3SA 3QDMB 1IM9B 1QQDA 3W39B 1FDLL 2IPTL 1VFBA 4HIHB 5JR1H 1LE9B 5GZND 1CLYL 2VLRE 3G08B 2A2QT 2R4RL 2HJFA 5J3HC 3PQYA 4NQEE 5FF6B 1RMFH 5D7LA 5IGXL 1K6QH 2VLME 3DOSA 1AD9A 2A9NL 4H88L 3UPRA 3EW3B 5TF0A 3MLSL 5EU5A 4X80L 1D5ZA 3T8XB 5F9OL 3LCYA 5IK3A 2VAAB 5I2IB 2DIAA 5KVFL 1OTTD 3MRFA 4I2XB 2JCCE 1ZT7B 2LAAA 9CGTA 3HKFA 1NJ9B 3U7WL 3OR7B 3ZO0A 1KJVA 1RUAL 2HH0H 5ICXB 1AE6L 8FABB 1ITCA 1T5WB 2B2XL 2Q20A 2ZG1A 3IDIB 4M1DL 4R7DB 4EOWH 3DIFB 4OZIB 4KRPB 5MENB 3IDJB 4DGYH 3QXAA 3L3OA 2WP3T 2ZP0T 4QOKD 3VFNA 4P2OB 4BQ6A 4A2LA 4M6NL 2EDEA 5FCSH 2F54A 3MLZH 2CRIA 1U3JA 3KYNB 2EEAA 1GGYA 3PABB 2QV2A 1HQRA 4NHUB 1X5XA 4KRLB 1OW0C 4KJYB 4NP4L 2IGFL 3GSNB 4PJXF 4YXKL 1MCEA 2A6IB 4OV5A 2XZQL 3C60A 4LVHB 3VGGA 4NZTH 1BX2A 2E7HA 3OKNB 4XBPA 5IF0A 2OX5A 5C9KA 4JFHD 2CR6A 1MFEL 3SDAB 4TQEH 4HFWA 5IB5B 3QUZC 5JUEL 3BE1L 4HUWB 4JFPB 3W5MA 1ZXQA 2XACC 2YD7A 4PJGB 3TBTB 3K1KC 3RY4A 4JRYA 4LHUD 5D4QA 4JO4L 3RUGA 1G9MH 3MC0A 5EU6B 4PJ5D 2XYCA 1EJOL 4R0LA 2ZCLL 5GRWA 4ELME 2ZJSH 3DVNB 3LV3B 4I5BB 5I18L 3NVQA 3L3DA 4W4NA 3T4AB 3K4AA 1A1MB 1U8QA 4FQCL 2YEZA 3ARRA 4AEIL 5K9OB 4KQ3L 3HCVB 4O02L 1E6OL 1KN4L 3MNVB 1RFDH 4WU7B 4ZAKB 1OB1B 1YNLL 1NAKH 1SM3H 43C9A 4L5FH 3VJ6B 1NQBA 4QLRA 3BMVA 2X4QB 3ROLA 2H1PH 5DO2D 4PRAA 1YPZF 3DHJA 5C6TH 3QUYA 2VXQH 3ZE0F 4DTGH 4HGWB 5BS0A 1O7VA 5M94B 3CFEB 4Z7NE 1IJ9A 1VPOH 4AQOA 4OF7A 3VXOA 1ZLWH 2Y72A 1NBYB 3ZHLA 3NCFB 1R24A 4WHYH 2GY5A 3HUJA 4XHJC 4YZFF 3UTSA 1OGTA 4YUEH 4Q58C 1V3MA 4GH7B 4CGTA 4YDIL 4JJHA 1A1OB 4ZS6C 1IE5A 1ZTXL 3QEUB 4LLYA 4HFUL 4HLZH 5TE7L 2EYRA 1H8SA 2VLJB 4H25A 4MCZA 1CGYA 1Z2KA 3L1OL 4RZCA 1G7MB 3BWUC 4JO1L 4OD1L 5D1QC 3DX8A 3IJSB 5J6HA 3OGCA 1FAIL 3KPQB 5C9JB 3S34L 1XH3B 4K71C 1AQDA 2Y25A 2OSLB 5BV7L 1OOAA 1YC8A 1UM4H 2UUDK 3C5SA 4IHOB 5JDJA 1A4JB 1CIDA 4AH2B 1U9KA 4XWOD 4XNMB 5TGBA 1RZJC 4X4YB 4QHUB 4MJ6B 4MDJB 4IRJD 4ONGL 4AIZA 2D9QB 3RWIB 3ARPA 3PL6C 3JV0A 3QIBA 4G9DB 2FBJH 2NTFB 1FYTB 1EHLH 4WFHD 5IEHA 1WBZA 4ZTOH 5CFHA 5FIEA 4RGNB 1NMBH 1T89A 3OAZH 3SCMB 4ODHL 5EFIB 4NQXA 3UC0H 2WWKT 3O2DA 3QDGA 1BZ9B 4M4PA 4RX4D 12E8L 5HHXH 1LD9A 1OP3K 1OGAB 5JNYA 5EUKB 4L4VB 4WJ5A 5EOCH 4XP9H 2H32H 5DS8B 2R69L 4N1CA 4JM4H 3QAZB 1RD6A 1PVHA 4PR5A 5C0FB 1WIPA 3S36X 3OG6B 5BZWB 1EHXA 3VXQA 4ELKA 4ZPVB 4OGYL 1NBZB 4RAVB 1UKSA 4HIIA 3SKMB 5DTFA 4Y5XC 3ECBB 1FV1B 4ONHB 5F88A 3I6LE 2X89D 3OKMA 5FO8B 3UYRH 2R2BA 2BDNH 1FN4A 2FATL 4JQIL 3B3IB 2BRQA 4IJ3B 3VWKD 4QHKI 3PWPA 4DKEH 3RNKA 1B2WL 1NGXB 4Q7DA 4O2EA 4UT7L 4ODXA 1K4DA 3BDYL 5E5MA 4X6FA 3TBYA 1U8PB 1Z0MA 3DV6B 4XP1H 2YBRA 4P2RA 4MJIE 4TUOB 3MNWB 4XVUC 4HZLB 3UEZA 5I1IH 5L2JA 5D6CA 4NBYB 4ZNEA 2VDOH 1IGTB 3V5HB 3R8BB 2VDPH 4OZFB 4JDVB 4NQDB 4Z7VE 3GSWB 1IC7L 4ALAL 3O8XB 1ONQB 4OCSL 3GIVA 3I85A 4PGCB 1JGVH 4K23H 3NFSH 3G6JF 1X7QA 1CS6A 2K7PA 1H3VA 4LLMB 1F3JA 4W68A 4P2CG 4DQOL 2C3GA 4XMLH 4LVOC 5EBWA 2D0HA 3JWDL 1AXTL 3C2SA 4KJWC 1R3KB 4UUJB 5DJYA 5I0ZA 1WSST 2H8PB 1JF1A 1XF2B 4ODTH 3PWNA 4OZGE 3GSQA 2P45B 1WBXA 4HLJA 4NDMB 4XCEA 4E41E 1WK0A 5B39G 2XKSA 4RFEB 3QUMB 1PBYA 1P5VA 3G6AB 4P23C 3DGCR 2GY7B 3IGAB 3GMNB 3KJ4B 3ARWA 3L9RB 4WGVB 5EN2B 3DV4A 5EU4B 1JF5A 2MCPH 3K81A 1OAYL 2C1PB 5GRVK 3F7PC 1S9XA 2HVKA 3CAFA 3X3FL 1NCDL 4ZUTA 5DXWA 5I1DB 5J6GB 4HWBH 5D2LF 4Z18A 4O58H 4Y19A 2XA8L 3VXUD 2EECA 1XIWB 3O6KH 5HDBE 1MEXH 1VESA 4MXWL 4G3YH 3JZ7A 1U95A 3GZKA 2D2OA 4JN1H 1I1AC 3TEUA 1RZGB 1E4JA 3SQOL 3DRTA 1JNNH 3LS4L 4Z7UE 4RMTA 3RAJH 2Z93B 5C08D 1JI1A 2OTWB 4YHYC 4HF5H 5IFAL 1T66D 5DEFA 2V7HA 3H9YA 3W0WD 2DQFA 5JIPA 1FPTL 1J8HD 3ILQD 1DLFL 3S5LB 5ESQB 3L6FA 1UJ3B 4N0FB 3MJ9L 5FYKE 2P5WB 2EXYC 4UNUA 1MFCH 4YHPB 1KIPB 3KPPB 1OM3L 1P6AB 1Q9WB 4PLKC 4MHHI 4YIQA 4E5XB 1FVEA 2A6KB 1X6LA 5E95B 4CN6A 3GRWH 1YNTB 1U8KA 5TH2B 3VH8B 1HXYB 4NWUL 5IMLB 5I16A 5HYJB 1A6PA 1G6RB 4YO0B 2R23B 2V9TA 2E9BA 5DRXA 3UBXI 1QG3A 2DYPD 3KNBB 4J3OC 4YXHH 2R1YA 4JPVH 3PWLB 3JTSA 3MGTA 3O2VH 3S96A 3F7YB 1BQHB 2VDKL 2VERN 5F9AC 1ITBB 4G6KH 3WMSA 2R2HA 2JF1A 2AQ3A 2FGWL 5KSBB 1QRNB 3OJDB 2CDEA 1KJMA 2NY3B 3O81A 4F9LC 3DMMB 1RK1A 1UA6L 4N8CH 4R2GB 4D0DA 3GFUA 2VMFA 1DQML 3HC3L 3STZA 1IMHC 4CN4A 2FHBA 3RVUC 4OCXL 2YXFA 4XCCL 4JQXC 1K3ZA 2CGRL 3QHZL 3UTZA 5BW7A 2NYYD 1FSKB 1FGNH 3GMMA 5ERWA 3LB6C 3CXHK 1AGCA 5DK0A 3RGVA 5E94B 2R0WH 4JFYA 1NGZB 2I60L 3CSPA 1CBVH 2AK4E 4OCRL 1NCAH 3RUGF 4MAYD 2D7NA 4PRPD 3B9KB 4XCNA 1CDUA 2LE9A 2GUOB 4UT9H 2WW8A 3RIAF 3KVQA 5F1IA 3NH7L 2AJZA 3TZVA 3IB4A 4PY7B 2H6PB 1K5NB 7FABL 5HI5C 4GRLC 4PBVC 3QA3B 1VHPA 1YDPA 1YPZB 1WCBB 3VXRB 4EDWH 1QFUL 3L95B 2QR0A 4WNQA 3FT4B 1CDBA 1Q9LB 2ATKA 2JE8A 4WUKH 4KZDH 3PE9A 1YMMB 2IWGA 2B5IC 3SJVD 5MEOB 3VGEA 4X99A 3WUWB 5JHDA 1MI5D 4FS0A 2V5MA 1ZS8A 5EUOA 1YUHA 3WJJA 4ZQKB 4RFOL 1ZLVH 5CIPB 3TJEL 4KVCL 4NZUH 3THMH 3LMJH 3ZKMC 1XZ0A 2PYEA 4KXZH 3V52L 2VH5H 1NFDF 4DN4H 4C56A 4PJ7A 1URLA 5C09A 4JFDE 2JB5L 4FA8A 3D2UB 3HUJF 4NNXA 4G8FA 5FOBA 3KHQA 3BH9B 4XVJH 4NZRL 3GSUB 4OD2B 5C0AA 1D6VL 2ICCA 4YPGA 1FNFA 1PZ5B 2EYTB 3TYFA 5FHBL 3RQ3A 4XI5D 4Z0BL 4EN3C 2LTQB 4F9PC 4OLVH 1JRHH 1B6DA 3K74B 3MV01 5JOPD 2HFFB 1CVSC 5T1LB 1X5LA 1C5BL 1JFQL 3N9GL 5TDPB 3QFJA 3S97C 1NMCC 2BNQE 4KROD 4OF3A 1NGPL 2F53E 1TFHA 4E9LA 3C08H 1FO0A 5KJRH 5E6YA 1N5AB 3RVWD 3LEYH 1AY1H 4U4BA 4HJ0D 5SWZE 5EC2B 4NGHH 1B88A 1BD2B 3W2DH 1T6WA 3FB5B 4OM0L 4D0CA 1G9NL 4ZPTA 3CVHL 3W81A 4HUKB 2IPTH 4HIXL 1CLYH 1WT5C 4I3SL 3LHPH 1D5IL 3MCG1 2R4RH 3MREB 1JWUB 3DBXA 2FH8A 4MHHG 2J6EA 2VXSH 5IGXH 5CEZD 1V7ML 1INEL 1IAKB 2A9NH 1KB5A 3PWVA 4H88H 4R3SB 1J0HA 2FR4B 4DAGH 3BQUB 3UXFA 3C6LC 1VACB 3MLSH 4UT6H 4EBQL 3ARFA 3UBXG 1AH1A 1EVUA 4AENA 5C0CA 2FO4B 4WI9A 1FNAA 2D7QA 5F9OH 5GGTL 1F13A 3D48R 1T0MA 2WLZA 5KVFH 3NBNA 3EO1B 2W60A 1A2YA 1AQKH 5BMFL 4U2YA 1J1OH 3OXSA 4NKIL 2QQLL 2QSCL 3P4NA 2PTTA 3QO1A 1MAML 1RUAH 4RA0C 5D7SH 1EAPB 4XP6H 3CFJA 1AE6H 1PYWA 2ZSVA 1IC1A 4YHLL 4RMUA 3C5ZD 4N0UB 3G04B 1GGCH 1ORSB 1V05A 3CH1B 2JCCB 3TIDA 2ICWA 2IBBA 3FQRB 1PGRB 4XNZC 4JN2A 3QP3A 3MRLB 4Y16C 4PJIF 1UENA 1NGWB 3IJYA 4M6NH 1G7PA 2EKSB 1OHQA 3OXRB 4S1QL 1TMCB 3RU8L 2CRYA 4NPYB 5IM7B 3DURA 2IAMD 1HCVA 2BOBB 2NY0D 2XWJA 4U1LB 3P4OA 3IXAA 3H9SA 5DJ2A 2VXUH 2QADC 1OQOA 4NP4H 5IROA 5EO1A 3O4OB 2XZQH 3ISWA 2YMXL 3AM8A 1OTSC 3V6OE 2KH2B 5DJ0B 4FQIH 5CJQL 3IFNL 4Q9RH 4Z7WE 3GJFK 1WLHA 4JR9L 4S2SA 4BSVA 3BE1H 3V6OC 2HLAB 5HYQA 4MWFA 1CXHA 2AP2A 4QCIB 1QR1B 3UTTD 3PDGA 2BFVL 1OPGL 4NO0A 3F7VB 2DIJA 1IC4H 2ADIB 5B38B 3PJSB 3MRHB 1U8JA 2NQCA 2P8MB 1EJOH 3DO3A 3HR5A 3QIUA 3VWJC 5I19H 2ZCLH 3QUZB 1QQDB 4XPBL 4ZS7L 1QSED 4IOSD 1MHEB 4G8GE 4O00A 4FQCH 4PJBE 4ETYA 3PQYB 3UPCA 5D7LB 5HYIA 2FBOJ 5E8DL 3QEQA 4O02H 4IEFB 5BV7C 1E6OH 3MRJB 2BY1A 3UPRB 3D18A 3WNPA 2GI7A 1P2CA 4Z77A 5DRZA 5EU5B 5DRWB 3BZEA 1D5ZB 4Q6YA 3MJ7A 1UWXK 5IK3B 3RDTD 1H5BA 4Z5RA 1E27A 2R0KL 3MRFB 3CLEL 4IBLT 3TT3H 4TSAL 2IC2A 2D31A 5T5FH 2DKMA 1S7TA 1TCMA 4MB4A 5F89B 3EYOB 4LKXA 3BW9B 1KJVB 4C59B 3VXSA 3U46B 3CK0H 4ZUWA 5K59E 4YXLL 2NXYB 4KY1L 5JZ7D 2CIIB 5EO9B 2OQJB 1T04A 5KOVC 5FB8A 1B90A 4LCYA 2X1QA 3L3OB 3O6ML 4K8RD 3HC0A 4PGBA 4YDIH 5DJXB 1T21A 1JGDA 3BJ91 5F44A 3SGJA 3VFNB 1ZTXH 2P5EE 1EZVY 5BXFA 1A6TA 1J10A 4HFUH 2F54B 5TE7H 2GJ6D 4POYA 1DEEB 1ADQA 4KZEL 3TYGL 2IANA 4JO1H 4KRMB 2W91A 1FAIH 1JN6A 4OSUH 3S34H 1EEUA 1VERA 3O6FC 5F7UA 1KPUA 2DQCH 5BV7H 1I8KB 1YN6B 4AM0B 5JMRA 4OV5B 5L2KD 3C60B 5I73B 3EYFB 4POUB 1KIRB 3FB7A 4ONGH 4WDIA 1V8HA 3KPSB 2WMPA 5E8OB 1CFVL 4ZYKB 5IB2B 4JRYB 1B4JH 1YEJL 1E28A 3WEXA 5A2IH 1HZHL 1A3LH 3RUGB 1NAMA 5C6WH 4FTVD 1K4CB 3QHTC 3HAEB 2DJ4A 2OLDA 3ZZ1A 1BJ1H 5DDHB 3DTXA 4GQ9H 2Z31D 3PP3K 4OUUA 2O93L 1J05A 1JNJA 1ACZA 2VTFA 4EUPH 3L3DB 4HJJL 4NC1E 4NQCB 5ISZE 4DOHE 1QEWA 1DBBL 1U8QB 4XPHL 4P46C 4XP4H 2JJSA 5JIKA 4NC1C 1CQYA 4ESKA 3T3MF 2Z92A 5DQJB 3UAJD 3JWDC 2R69H 4MMZC 1CICD 1KLUA 3UZEA 3LH2L 3NZHL 1YEHL 3KYAA 4I0CC 3RZCC 1KBGH 3WBDA 1H0DB 3VE0A 5D2NA 3BUYA 3DUUB 3DETC 1HHIA 1Q1JL 2ZNXA 5C0GA 3RWFA 3HI1A 2K1MA 4OGYH 1RUPL 43CAA 4IMKA 4P4RA 1J1PL 2BCKA 2XY2A 3PHQB 1FP5A 5DR5L 2A0LD 4PRAB 3VFVA 1CGXA 4K3HA 3SO3C 4WHTA 3QUYB 3D69B 4PRNB 3E6HA 2FATH 3PNWA 3O4LB 3HE6D 4D9LH 5BS0B 2E3VA 4JQIH 2GEEA 3GM0A 5C7XH 2EZ0D 1X5IA 1B2WH 3BHBA 3VXOB 1GGIL 1WICA 1FFOA 3QG6B 5D96C 2CRZA 1OT1A 2FCBA 3BDYH 4PRID 4LMQE 2MKWA 3P9LA 3MCLL 2C3WA 3BZ4B 1XF3A 3HUJB 2W0LA 2G60H 2VZOA 3QZWB 3UYOD 3V6BR 2DLHA 3TN0A 5J56B 4TULL 2W9DL 3E2HB 2W92A 5CSZB 1IC7H 4ALAH 3DX9B 4NKDA 5CSGA 3HLAA 1CFBA 4I13B 2EYRB 4HK3J 4PJ7F 1UKQA 4H25B 1WBYB 4LDEB 3HB3C 1ERNA 4RZCB 4HS8L 4DQOH 5T1KD 5J6HB 4WI5A 3GUTA 4WI6A 3JWDH 1AQDB 4QOKE 1AXTH 2D03L 4XRCA 1FYHB 3DJ9A 2BVEA 4JM2B 3C5SB 3GBML 5E8NA 4G8IA 4YFEA 2CO7B 4Z7VB 5TGBB 1WIOA 2BVYA 4NN6B 4AIZB 1HQ4B 4WTZA 4LVOB 4OKVA 2VJXA 3QIBB 4U6HA 5FUZL 1NL0H 3A6CL 1VKXB 1CG9A 3MLYL 1JMZA 5CEZL 3T0ED 4LCCA 2H26B 4BK5A 3U0PA 1OD9A 2EEDA 3MLUL 2NW2A 4JFHE 4OFVA 2A6DA 2OXGA 1NCDH 2CLVB 1JTPA 2ATPA 2FSEA 5SX4H 3VRJA 1LD9B 3PUCA 5KW9L 1S7QA 4HS6A 1LO0L 2XA8H 4PJ5E 4WJ5B 2Y6SD 3EDDA 5GS0D 1TQCC 2K7QA 3VD7A 4PR5B 3BP6B 1CGUA 4JFFD 3VXQB 1SJEA 1ZT1B 4ELKB 5IMMA 1PX3A 3SQOH 2KDGA 4OD3L 3LS4H 3JV6A 1S7VA 4HIIB 5IFAH 2NY1B 1KCSH 4OZFG 5F88B 1FPTH 1I1AB 2R2BB 5IG7B 5CD3A 5KVMC 2X4PA 4QHLB 3BZFA 5DVLA 3WLBB 1EHAA 3CU1A 3DI2B 1A7RL 2BVTA 4A6YB 4RX4A 3RNKB 3FAXA 4ODXB 1QHPA 3VFPB 3DNKA 4WV1C 4X6FB 3TBYB 3W9EA 4Z7UB 1TENA 2GAZB 5AAWA 4EDXA 4H1LG 4NO2B 3QJFA 5DO2C 1L4IA 3FQTB 4H8WL 1RIHL 4NRXB 4NBXB 4NWUH 5TQ2H 1NGQH 5F7DA 4M93C 1SBSH 2B7DT 3KJ6L 5HGGS 2DLEA 5IW6A 1ZVSB 3FN3A 1C1EL 1F3JB 5LG1A 4UZGA 2VDKH 2X89A 2ZSWB 2P48B 5L9DL 4MDIA 3VWKA 2J88L 1UA6H 4UOJA 4Y1AD 5KANI 4LF3B 4QXWA 4XCEB 3BIKA 1EO5A 4U05A 3EFFB 5IKCB 4QWWD 3CMOH 2CGRH 1MH5A 3QHZH 1G7QA 4MXVE 5HHMB 3U4BL 2F9BT 4U1IB 1T7YA 5F3HB 1CDYA 4XWOC 3IAGC 4X9HA 2I60H 2CDFA 1R6VA 4GAGH 5FYLD 4IRJC 4PB0L 2VXTL 3HRZA 4XBGB 4ZUTB 3S5LG 2J5LC 3ZHKA 2ORBL 3C87A 1HI6B 5J0BA 3BRGC 3NCJH 3C6SB 2EDLA 7FABH 1MFNA 2ESVD 5DWUH 1JYXA 5JQHC 1QFUH 3VH8G 1N5YH 3EDEA 3MRMB 2VZTA 5DEFB 2V7HB 3AB0C 4K9EL 4MNQE 2DQFB 2PXYD 3MUJA 4X5XB 1HWGB 3EOAB 4AT6A 5I1AA 5D7IE 1T2XA 1O7SA 4GRLB 1NDMA 1OLZA 1BQHG 1FH5H 4G6JL 4ODSH 4RFOH 2Z9TA 3S88L 1BBJA 2XN9D 1G9NC 3H9HB 4YIQB 4FP8H 3TJEH 4KVCH 3KXFA 2IPUK 2B5IB 3QCVL 3V52H 1S7SA 4KMTH 2FEEL 3DX6B 5I16B 2DBJA 2FECI 5D7JD 1BOGA 2JB5H 3LSOB 1UB6B 1I9RL 3JTSB 3MGTB 1XGRA 4LCWD 3WIHH 4NZRH 4PJDE 1T4KA 3DX7A 1D6VH 4Q0XH 1J8HA 3DRQA 1HEZB 5FHBH 1W2KT 5FUOL 1IC5H 2WP3O 4D8PB 1JWMA 2CDEB 4LSQL 4PG2A 3MGOA 35C8L 1H15A 3RJDA 3MXWL 5C0ND 3MNZA 4JFDB 4F33A 2C5DC 3AY4A 2W0FB 1KIUA 1KN2L 1C5BH 1JFQH 4D9RE 3PXHA 2AK1H 3MRBB 1NGPH 4PGJA 2WZPD 3P77A 3UTZB 4WFEE 3GMMB 5ERWB 4NQVB 4EN3B 5B3NA 5DK0B 1UG9A 4LEXL 3T4YB 3DPBA 4JFYB 4AEEA 4M6ML 4GAJH 3CSGA 2BXZA 4YPJA 4ODVL 2ED8A 4F57L 1T1YA 3CVHH 3RPIA 2HLFD 4HIXH 1BIIA 1CL7I 4HMEA 3PXJA 4Z0XA 2BNQB 1UCTA 2CDGB 2F53B 3WUWG 4DFHA 2FB4L 1AXSA 3KPTA 2AJZB 3TZVB 1C16B 5ALBL 3TA3D 4OFIA 3LPWA 4N9GA 5C71A 5CZXD 3T04D 3VD9A 2Y06L 2EIDA 5TPWL 1AC0A 1INEH 5BOZG 4HC1A 2F5AL 2NY2B 4OQTA 2H32A 1KXTB 5ALCL 4NWTH 5HHOA 4EBQH 1UCBL 3VXUE 3VXTB 4C55A 1J0ZA 1PY9A 2QR0B 1MPAL 4WNQB 3O6LL 3SN6N 1KPRB 4YWGL 1LVEA 3H2WA 3MXVH 2D7TL 3LKRA 3JWOL 2NY4B 3O3UN 3P0VL 1OP5K 3C5JA 3GMQA 4AYFA 2UZYB 4X99B 5JHDB 4AJ0A 2QSCH 5E56A 1AGFA 2KUTA 1MAMH 1OAQH 1AO7D 3C6LB 2WUBL 5EUOB 5C08E 1FNEA 2V2TA 1ZHKA 3W0WE 1FCCA 2X4TB 1INQA 5I66B 3KPRA 4GOSA 3ARDA 3FO2A 3CCHA 1CT8A 2PYEB 4GSDL 3TH2T 4APQC 3ILQC 2FIKA 3HMXL 3PL6A 3WJLA 4PJ7B 2CKBL 5C09B 1XGTB 4KKAD 2ZCHL 4YDJA 3JTTB 2DKUA 4G8FB 1DFBL 5FOBB 3W11C 3BAEL 3HPJA 3O0RL 2YPVL 4S1QH 5DD5L 4PREA 3BRDA 4JB9L 5C0BB 4KVNL 2L4OA 4XNZB 2D4DA 1CE1L 4HV8A 5MP6L 4UILH 4Y16B 4U1GC 4LRNH 3AU1B 4RGOH 2HVJB 3A6BL 2P46B 3E6FA 1AIFA 5DD3L 4JR9H 3REWA 5DMGC 5IV2A 4WU5B 4FQQA 1RURL 5GS0L 5DRNB 3DECA 2BFVH 1JK8B 1XGPA 5DI8A 4X0KB 1FFQA 1QLEH 1U92A 4NKMA 3QISA 5GRYA 4D0CB 4ZPTB 4XPBH 4ZS7H 5HBBA 3PP4L 1DN2A 4LPCA 4Z7WB 2EDRA 2NYYC 1QSFE 3D85B 2HRPL 3MLXH 1U8MB 5MEPA 4HWBA 1S7WA 1MCIA 5E8DH 4ETQA 2D4FA 5CJXA 1KB5B 3PWVB 4PRPE 3FHQA 4HT1L 3WNOA 4GXVL 4IIQA 4RGMC 3TH3T 4BK4A 2WWKO 2ARJB 3ARFB 2GK0B 4MAYC 4AENB 3MRNA 1NCUA 1UC6A 4Q6IC 5C0CB 6FABL 4YH6A 1G7IA 4Y4FA 3CLEH 5EU3A 5TE4L 5F9JA 1A2YB 4NN7B 2Y36L 3OXSB 1ES0A 4M7JL 4W6XB 2JJTC 4C4KT 4IRZL 1UEMA 5IFJA 4ZOEA 1II4E 4TVPL 1PYWB 2WAHA 4YXLH 2ZSVB 4KY1H 2VZ1A 3SJVE 1FZJA 1MI5E 3FQNB 3FT2A 3FQUB 3GK8L 4CRPA 3TNMA 1SYSB 4XBEH 1N64H 3GNML 1RUMH 2AXGA 1CXKA 2VSCA 4KH2A 4L8CA 1YZZA 3IJYB 4ODUB 4UIMB 1JGEB 4KZEH 4KC3B 1B0GB 4XPGL 3TFKD 3DURB 4PJ8D 5IBTH 4LSRL 5HGHA 1T2QH 3VFOB 3IXAB 1ORQA 5B38G 3H9SB 3VG9C 5DJ2B 3T2NL 1ZT4A 2OK0L 3QFDB 1X6NA 1W0VA 3VMNA 2P5EB 4XWGL 3Q5OA 1BHGA 3C5ZA 3P73B 4PS4L 5GGRA 4OCWH 4BSVB 3MOAL 4X7FC 2MQ0A 2YD2A 5ITBL 1IQDA 4XI5C 5CMAA 5JOPE 3OKDA 2DICA 2VE6A 4QHMA 3TGXA 2F74A 3CZFB 3QIWA 4I77H 2BXYA 1U41A 1ZGLP 5DURB 5TDOA 1KULA 2EDXA 3BUTA 3LIZL 3TWCH 4D94A 4KROC 1ZHNA 3GB7B 1W72L 4XPHH 4GBXA 4RRPA 5B8CA 5EG6C 3RVWC 4JLRB 4XAKD 2WLYA 1HHHB 4OGAC 5EBGA 4MNGA 4HJ0C 4WTWA 3NPSB 3LH2H 3NZHH 1BF8A 2EDYA 1TNMA 2NPLX 4QRPE 3OAZK 1CR9H 1FFPB 1M1SA 1Q1JH 5DRZB 5GRUL 3BZEB 5MEND 1RUPH 4KKLD 4KGJA 4P46B 3ZYIA 5IWLA 1H5BB 4U1MA 1J1PH 3UTTA 4Z5RB 1E27B 2FZ3B 5KSAA 5ISZB 5CEZE 5E8EA 1CK0L 1RUKH 4RDQG 3U7YL 2D31B 1UQSA 4KKCC 4XXDA 3O45A 5SWSA 2EDBA 3TCXA 2R56L 1Q0XL 3QCUL 2I9TB 2XG5A 2HG5B 2X1XR 4LKXB 4OFDA 2FYYA 1RHHB 2M8XA 3UCRA 1ZE3C 1DTUA 4FQXD 4BQBA 4GKSA 5GGSY 3O9WD 1BJMA 5BRZE 1T5XB 4KQ4L 1KYOK 2BNRE 3U0TB 3QNZB 3T65A 1P4IL 2R0LL 3ARBD 4LCYB 2HAZA 2WWMD 5JXEA 4BQ9A 4JRXD 3HC0B 4PGBB 3U2SB 1UXSB 5DJCA 3H0TA 5BVPH 1UACL 1GYAA 3N1FC 1T0NA 1GCFA 1FGVL 1L7TL 3QDHA 4OFKA 1JJUA 2HKHH 5D7KE 4GG6E 4HS8H 1J11A 1DQJA 2AI0L 4GRWE 1A9EB 4JZJC 1TZIA 2D03H 1MJ8L 5GRZA 5D6DA 1LEKB 1SYVA 4ELMF 3FB7B 1TJHL 3CDYA 3IU3A 3WD5L 3VFTB 2EKJA 2DQJL 3VFRA 1WZKA 1EO8L 5FUZH 2IAMC 2NY0C 3A6CH 4M61A 1UZ8B 5IHLB 1E28B 1WV7T 5I9QC 4QOKB 3L7FA 1NAMB 3MR9A 1INDL 3LZFH 4RAUA 1YYML 1U93A 4W4OC 1UWEL 3DTXB 1UWGH 3P11H 5HVHB 2DL2A 3V4VL 1A4KB 3MODH 1TQBC 4OFYD 4HULB 2YRPA 1QEWB 3SKOA 1MLBA 3WNKA 1CVRA 4HUXB 5KW9H 1LO0H 3BKJH 3ORJA 4YLQT 1KLUB 2EEBA 5DK3A 4OI9A 1QSEE 1Q8MA 4BSWA 1HHIB 4Z7NF 4Y4KA 5C0GB 4CJ0A 5CLWA 1OT2A 5CEYA 3VXPA 4G9FD 1F6LL 4UINL 2BCKB 3TO2A 1HSAA 3VFVB 2DTMH 5HDQL 1C12A 4PJ5B 1BWMA 4Y5VC 1A21A 3E6HB 1BQSA 5JXAL 3ESUF 2Z31A 1GRWA 3TNNB 5D1ZA 1ZA6A 5F6IC 2Q8BL 4UV7L 1FFOB 4F9PA 3RDTC 2JKXA 2BVQB 3P9LB 4LSSL 2X4SA 5F7WC 1XF3B 4EVNA 4IRSD 4H8WH 4WY7H 4DVRL 1RIHH 2FHFA 1BQUA 2OR9L 4MD5A 1X4ZA 3KJ6H 4QT5A 2VLLA 4QRSB 4BZ1L 3CX2A 4NKDB 4PLOB 3HLAB 5JZ7C 4HW6A 4K94H 4WV1B 1C1EH 3GSXA 1H8NA 3DXAE 1T22B 3GUTB 4KPHL 1SVZA 2NXZD 5FYJL 1NANI 1WAAE 4FQPA 4K8RC 5L9DH 1OF2B 3HE6A 1R5WA 4M93B 4K9EC 3WO4C 5KG9A 1U0QA 4LDOB 3G5XA 5KN5B 4G8IB 2GJ6E 2J88H 2XT1B 1LE5A 1UFUA 3MOBL 4KFZC 3X3GL 3DLQR 1OGAD 4OKVB 4RNRA 3I9GL 2X4NA 1IAOA 4YDLC 1OSZA 1T20B 1CG9B 3Q48A 3MRIA 2VLKD 2PO6C 5L2KE 5CBEA 4AEHL 4XZUA 4NUJA 4I9WE 3U4BH 4HWZA 3U0PB 4CN1A 2GITB 2NW2B 1WISA 1OAXL 3EDFA 1XAUA 2C3VA 3RX5A 3EYUH 2A6DB 3ARYA 4S1DC 4HX1A 4QTHA 5A16A 5T1KA 4U33A 1CYGA 3RA7H 2BVOA 2XWTA 3VRJB 1IQWL 4JHWL 5DLML 2X1WL 4FTVE 1S7QB 4HS6B 1S9WB 3UJJL 1KENH 1S9KC 2ORBH 5EZIL 5FGBA 4CADA 3ZE1F 1LK2A 3H8NA 4FFYL 2IPKA 4ZO8A 3FFCE 3IFLL 1NBVL 5A2KH 4TNVF 5EWIL 1V3KA 5IMMB 1U8HA 4Y0GA 1NUNB 2J5LB 2X42A 1FZKA 3JV6B 4UIKH 1AR2A 3FQWA 4K9EH 3U82B 2F8XC 2YA1A 4PJEE 1CICC 3MFFB 1JMXA 2X4PB 4KJQC 1VGKB 5GJSH 1CGVA 1MUJA 2XICA 3ME0A 1BMGA 4NT6A 5CBAA 2DN7A 3QPXL 5L0QC 4G6JH 5F7NC 3RVXC 1TVHB 5DHYA 2AV1B 4WO4D 3W9EB 3MRKB 3LKQA 2L7UA 3QJFB 4LQ1A 4KTEL 2A0LC 4WWKD 2D9CA 5GSRA 4GW4A 2IADA 4L3EE 2DKSA 2OBGA 5E6ID 5AD0A 5ACLA 4OI8A 1C5DA 5D7IB 5FUCE 4X5WA 1QA9A 4BQCA 1I9RH 4PRIE 3LKNA 1RIVH 1BVKA 5GS2D 4GW5A 2R4SL 5FUCC 4MYWB 2N56A 4AQ1B 1L0XA 3U6RA 4P59L 2RCSH 3EOBA 3IF1B 4BYHA 5F7YC 2V5TA 5CUSL 5FUOH 2QKIA 4U49A 3HE7D 4MDIB 2MMXA 4P3WA 4PTUA 3VWKB 3JWOC 1CCZA 4ZD3H 2P7TA 2IBZY 3MXWH 4DK6A 3RWJA 3BIKB 1KN2H 4UAOB 4EZMA 4Z7QE 4U6YA 3IVKB 2OJZL 1K9TA 4PJDB 4KU1A 1MH5B 4KDTA 1G7QB 4FNLL 1CDCA 1ACYL 3CFKA 4JFZL 2KQMA 4R7NA 1DE4A 4M6MH 1AHWC 2CDFB 4NRZA 4F57H 1AJ7H 4ZSOA 2OL3A 3QI9D 3T0EE 1EVTC 2G5RA 4PLNC 5HHNA 2FB4H 5CJBA 4YDVA 3OHXA 3T0EC 5SV3A 4EUPA 5ALBH 3ZDZE 5LAXB 2Y06H 1KELL 4RQQA 3EZJB 2F5AH 4N8VA 1WWWX 4PJHA 5ALCH 3K2UL 1PQZA 2CRMA 4GKOA 5MEQA 3FB8A 3O6LH 2XZCL 2D7TH 1BP3B 4AT6B 1P84J 1NC2A 3JWOH 5GS0C 4JFFE 3P0VH 3GI9L 1NDMB 4HWNA 4TOYH 1FZOB 4L8BA 3DWTA 3VG0L 1HK6A 1BBJB 1MRCH 2Q86A 1R3IL 4XTRD 3J8F7 4PJAA 4WUUA 4IOFD 5F70A 5MERA 4B5EA 15C8L 1S7SB 5IVZB 4PV8B 4PJCE 5D5ME 1QNZL 2IQ9H 1KC5L 3DMMD 3PGDB 2CKBH 3GMLA 4BZ2L 1BOGB 4LEOA