5FYJD

Crystal structure at 3.4 a resolution of fully glycosylated hiv-1 clade g x1193.c1 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122, 35o22 and vrc01
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
242
structure length
242
Chain Sequence
QGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41 ENV ECTODOMAIN
publication title Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B and G
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 36
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fyjD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fyjD01
1KPUA 5CGYD 1K4DA 3QYCA 4S10A 4C55A 3MODH 2JJSA 1E4XH 1DQLH 2WWMC 4JFQA 3O8XD 4U6VH 3UO1H 3CFEA 4JANA 1XGQB 3LVEA 1AD0A 1UCTA 4JVWA 3VGBA 5IVXF 1HXMB 3HPJB 2XFXA 3P2TA 5JXAH 1CN4A 1MRDL 1JPSH 5DQ9A 5EUOB 2VB5A 4PJFE 3AFLA 3P4MA 1E4KA 3AGVA 2IBBA 2N4IA 4RSVA 5EPMB 3NGBC 2YWYA 3QRGL 1SYSA 1SQ2N 4JQVC 3WFEH 3WCYA 1RULL 4IOIB 5ITBL 4ZUVA 4LLAA 4P4RA 4HT1H 3TBVA 1A8JH 3FMGL 2HWZH 4JO3L 1T5WA 3DIFB 3CVHA 4HS8L 2WWKO 5E08H 1CFVL 3EOAB 2V5RA 3JUZA 3DJ9A 3H6JA 2FDBP 1FHGA 4OIIH 3FTGB 4A6YL 3PQYB 3RNKB 2XRAL 4Z7WE 1QLFB 1CDCA 3O45B 4JHAL 1BGXL 5HHOA 3WEXA 5BRZD 2D7QA 3H3PH 3RWEA 3AS2A 1D5IL 4RMVA 1NGXA 4MJ2A 5DZNA 1AHWB 3V6FA 2ZNWA 5FUZL 2FZ3A 4DN4L 3RL2B 2CLRA 4JR9L 1NCTA 4JDVB 3OF6D 4OLVH 2W65B 1CFNB 1P84K 4HF5H 3W2DL 3UBXA 1FFQA 3C8KB 2OTUB 4JFPA 4OI8A 3HMWH 2NR6D 4I9WE 5I2IB 4TTGA 4LSQL 2XPGA 3L3HA 3UPRB 1ZT1A 5ID0A 3QDMD 5F7KC 1MIMH 4LCIH 5FCSH 32C2A 1WCQA 4P2OA 4PRIA 3D2UD 3NCYP 3H9ZA 4DKFL 3MCLH 1J1XH 2X1QA 4DQOL 2CK2A 2VDQL 4YDVB 3VMPA 4QTIH 3OJVC 1Y6NR 1ADQA 3IDUA 3B3IA 2A6JB 4G6FD 2FH8A 5AYUL 2BSSB 4QT5B 1ZWIA 3GNMH 1FFNA 1CE6A 1FIGL 4QO1A 2PXYB 3SKNA 3MRCB 1YY8B 2PTTB 4MA3B 1F2QA 3PV6B 4JJHA 1YMHA 2EH7L 4MYWB 4DW2L 2MSPA 2CKBH 1P69B 1GIGL 3BVNA 1JYWA 1SJHA 1XIWB 1KEMH 2ZZUT 4MNGB 3VD9A 5CEXA 4S1QL 5ANMB 1IGFH 4NC1C 5DWUL 4QTHB 4MJ6A 2BVPB 3KWWB 3MV7B 3W0WD 1WBYB 1R3LA 1S9YA 4FTVA 3T04D 2W59A 1TTGA 1WQVT 4NKIL 2H2PC 2VZOA 1D9KB 2JLLA 4J8RA 4LNRB 5E2UL 3BDYH 1C08A 2VR4A 4YNYA 3QIWA 3FQNB 1MJJB 3P77A 4R4NC 2CDFA 3KYMB 3RWFB 1OAQH 2QR0B 3I3DA 1EUUA 2VAAB 2HJKB 1PAMA 3VWJD 3ALXA 1NCAH 4YH6A 1P9MA 2JCCE 1C5DB 3C5ZC 1LVEA 4NN7B 1M1SA 5I6XB 3C6LA 3U1SL 4ELMF 3IJYB 3BWAB 4R2GB 3WUZA 1TPXB 4PRNB 5BVPL 3V6OA 1BJMA 4WW1A 5JW3L 1F4YL 2GSGB 1CVSC 2WLYA 3BP4A 3GSRB 4TUJA 4CNIA 1BAFH 1FPTL 4KY1H 4M1CD 5GS1B 5IHZB 3X3GL 4P23C 1CS6A 5HI4C 4JKWA 3O3AA 5EU5A 4PJEA 4K3JH 4NQCE 1T5XB 4HIJB 3HUJA 4YE4L 3VFNA 4FFWD 3VXNB 1SEBB 5ICYB 1J18A 3L3KB 4R7NB 2C5DC 1AGBA 4H5SA 3MUZ1 2XA3A 4EI5A 5KN5B 2Y6SD 4EDXA 2ADGB 5CWSB 1FVDA 5DJ8A 2EO1A 2ZUSA 3VXPB 1MOEA 3O2WH 1T4KB 2EKSB 4Y5XA 4DKEH 4GQPH 3I6GB 1JGUH 1QBAA 3MXWL 5FOJA 2IBZY 3HNSH 3MGOA 3T0ED 4NKMB 2RFXA 4HUNB 3C09B 2WWKT 3A6BH 5E2JA 2YXFA 5HVWA 3SGKA 3VFUB 4L9LA 1KGCE 4YQXL 3OJMB 4OSUH 3NIGF 1GH7A 3BISA 2R29H 1C8PA 1LEKB 1CDIA 2JIXD 1HHKA 1D5XB 1WZ1H 1VFAB 1T21B 3O11B 2E9WA 4FQ2L 2YPLB 1J1PH 3TT3L 2Q7YA 2VTFA 5C0GB 3EOTL 2AI0L 1GL4B 1ZT7B 2YBRA 1RU9L 4LLMA 4HPYL 1T89A 3D39D 1JWUA 2UY7A 2HN7B 3ZKSD 3RU8H 3DX8A 2VZ1A 3QFJD 1K8IB 5CINL 5B39A 3BZFA 3QZWG 1S9VA 2W0FA 5D72L 1FNGA 5HHVH 5DD1L 5E8DL 4QRRB 3KHOA 1TQBC 1CFSB 4WI8A 1OTSD 1UADC 3N1FC 3ARBC 3RVWD 3F62A 2P5EA 1CXIA 4F33B 4JG0L 3DX7B 5FYJU 2E27H 1U95A 2A77H 2NY6B 1HQRB 1UJ3C 3LMJL 1MJ8L 3WE6B 1Q72H 3MGTA 1P4BL 1FE8L 2Q20A 3ZDZE 4XMKL 5DVNA 1UWGL 4X6CF 4OT1H 4WU7A 3QDAA 4NP4H 3RVXC 5FO7A 2H32A 2YD4A 4P5TD 3MRHA 1NCCL 3HZYB 1FO0L 4Y2DD 2AEQL 3VCLB 4UBDD 1TENA 2BXYA 3MC0A 2R2CA 3V4PH 2ITCA 2DF3A 2PO6A 3BT2L 3QPQC 4KKAD 4HGKC 2R1WB 1NMAH 2YA1A 1CGTA 5CJ8A 1M7DA 1I9EA 1JFQL 4V1DD 5D7LB 4I8DA 1HINL 3ULUD 4I3SH 1MLCA 1Q1JL 1PG7W 3CFIC 2FWOA 4YDKL 2UVFA 2KZWA 3FB7A 3OKDA 3TH2T 1CFBA 2EZ0D 3V5KB 1IMHC 4WI7A 2FRGP 1CGVA 2DLTA 3PWPE 3UJJL 4L4TD 1UB5B 5EUKB 1XR8B 5HHPA 4PJIE 3IXTB 4XH2B 3C60B 4H25A 4KPHH 4MCYB 2A9ML 3VDAA 1LNUB 1JYNA 3O6FB 3PIQA 1NDMB 1SHMA 4ALAH 1G6VK 4NO0B 4X4XB 3E6HA 5ENWA 1CZ8H 4QXWA 2AJYH 2JJTC 2Q6WA 1OAZL 5DHXB 3U0WH 4FZ8L 4PJ7B 2Q8AH 5GRJH 5IROC 1H3XA 4LPTA 4L4VE 4L8SB 3S6CA 4XVTL 3SE8H 3P73B 4XPAH 5B21A 5CJBA 3EKCA 4AIXA 1V5JA 4NO5A 4ZDHA 4RMTA 3S35X 2I9TB 3F5WB 4OLUH 4BKLB 5EIQA 4UUJB 4Z7QF 1DEEB 4AENB 1WF5A 1X5IA 5EZLA 5T1LA 3VXUB 4XP9H 5EWIH 1R5WB 2VDRH 2FBJH 4R9HA 2DQIH 4LPWA 1PKOA 1F90H 1UA6H 3FQUA 1NFIA 4XWGL 3G5XA 4HWBH 1DQMH 3Q1SL 1NJ9A 3UTSB 1S5IH 5BZWB 3N9GL 5EU6E 3CH1B 4TUKH 3GMNB 2YRPA 3OAUH 4PR5B 4DAGL 1QTYT 2ZSVB 2NX5B 3TP4A 4TVPE 1IARB 4N1HB 1BIIB 1BZQK 1PZ5A 1HI6A 3BN9C 4GSDH 1CT8B 1GGBH 1GHFL 1MCCA 4Y16C 5GGRB 4ODTH 4P3DA 4M7KH 4G6KH 3KHQA 1G7IA 4OFVA 1KULA 3LKNA 2BSRA 4F7MA 2HVJB 1Z5LB 4ZD3H 3O6KL 5FK9A 4J3VA 3RJDA 5C1MB 3D69A 4I9WD 2PXYC 1OPGH 5MERB 2BNRA 4XX1G 1MWAL 5IK3A 5F88A 4PP2B 1DQQA 5BV7L 1Y18A 3HNTH 5DQDL 5DUBB 3ETBF 4GMTH 1EJOH 2BSTA 4HBCL 3TV3H 5HXMA 2H41A 2NY7L 4MA1B 3SKOB 4BZ1H 2DRUA 2BVTA 1FAIH 3HFML 3TBWA 1YEFL 4EXKA 1QR1A 1KYOJ 4XBPA 1D9KC 4LSUL 4PJ9B 1CLZH 3KPRB 4G7VH 5F9WB 4D0BA 2GJ6A 3DVGB 2EIDA 4ZS7L 4XVUD 4AG4H 3LD8C 2VNCA 4NSKA 4OCLC 5C08B 1J0IA 2EXYC 2GK2A 2OP4L 3TVMD 4PUBH 4P46B 4WHDA 4O2EB 2NYYC 4LP4A 3LQMA 3VXTA 25C8L 3SGEH 4PTTA 2ADFL 4NN7C 5ISZE 5I6XC 4C4KT 4CVZB 1UC6A 2J6EH 3CZFB 4LF3A 3L5HA 4FABH 4R2GC 1TPXC 3T65A 5ERWB 1UWEL 4Q0XH 3HAEA 5DT1L 4HUVA 2ARJA 2PCPA 3T4AA 2EYRB 2DN7A 4YHZL 1MCWM 4GW5B 4IRZH 5ID1A 1UXSB 4CMMA 2EXWC 4M6OH 4Y19E 5GS1C 4NQDE 4J7RA 4ODUA 4MJ5A 2DMCA 2OZ4A 3D0LA 1C5BL 4GRLA 1ZMYA 3LZFL 5CHNA 4ZOEA 1I8IA 2YMXL 2AJZA 3G6JF 2OL3L 5KTEH 3ZE0F 2VABB 3HRZA 1MH5B 4K55A 4LKCB 2HMID 5GGSA 3S88H 4OD2A 4D3CL 2NY5L 3QJFB 3MV11 1AKJD 5ECJE 3QXDB 3QIBB 4YGAB 1FBIL 1K3IA 1RZJC 4HHAA 3VRJB 3RIFF 4M8QB 2D9CA 2XI9A 1KB5L 5C07E 4LARH 5SWSA 1UVQA 3QWRA 4F15B 9CGTA 5DMKB 5JHDE 3C09C 1INQB 1AY1H 4NQCD 3BWUC 1RZ8B 4HJGB 4J3UA 5DJDB 1KENL 5CLWA 4HQQL 1PJ9A 4YZFE 5M94B 5TQ0L 5E8EB 4YX2L 4H26B 4R97C 3T0AA 4Y5VA 4OGXH 1FQ9C 1X6NA 5LGJB 1ZS8B 4GRMB 1K4CB 5IV2B 2PETA 2L7JA 1MLBB 1HYSC 3DVFA 1Q9WB 2ICEB 3NACH 5L2JA 4Z0BL 2DQGL 1UM6L 2LFGA 2ZJSH 5I17B 5FHBH 1KGCD 1C12B 3OQ3B 3OL2A 4I4WA 1KSRA 1KPUB 4NNPH 4XX1E 5AZEH 4YWGH 1K4DB 4JRYE 2AGJH 4WFHE 5DD3L 3O2VL 4JFQB 4U1IA 4QXGL 3CFEB 4JANB 1NAML 1AD0B 2BY3A 2V5TA 4OJFL 2O5ZL 1NQBA 4Y1AE 4U2ZA 2XFXB 2VAJA 3UTPE 4Y5YA 2J8OA 2NY6C 2ESVE 3NFPA 3HE6A 3EFDH 5DQ9B 4W4NA 2QL1A 1MEXL 3P4MB 4JFDE 2DJ4A 1A1OB 5FGRA 4YXLL 5ADOH 3MNVA 1OM3H 1SYSB 4UU9A 3TBVB 5T33H 2X40A 2ZP0T 3SQBA 2MQ0A 4IRSA 2FSEA 4HMEA 1T5WB 1UB6A 3CVHB 4A6YA 4RRPG 1A7NL 5GGVH 1D5ZA 1FDLL 3JTSA 3PXJA 2DAVA 5IT2L 1GYAA 1RVFH 2W9DH 5HHOB 3WEXB 3VGDA 3QNXA 3QXWA 5A3IC 3RWEB 3SGDI 4TRPH 1BFTA 2DQUH 1FSKC 2ZCKL 1NGXB 3V6FB 4E0RA 5KAQG 4PIRF 5KSAA 1YEJL 4Z7UA 2FZ3B 2ZUUA 2CLRB 4LVHB 1U0QA 2J88L 3IKKA 5JR1L 3QQNA 1PKQE 1JV5A 3SKUD 3C60C 3KPSE 3UBXB 2NY4D 1A9EA 4JFPB 2M1KA 4IMKC 4UDTA 3O6FC 3D3VE 4PJHE 2XPGB 3L3HB 1ZT1B 2OM5A 1CIUA 5ID0B 3QUML 1IQDA 32C2B 4P2OB 2VUOA 4PRIB 4ZYKA 4S11A 2J7LA 1T22A 3LRSA 2OMBA 1NAKL 3PWPD 4IMLA 1BM3H 4LRIA 4OLXL 1TFHA 1HNGA 5GZND 1ZOXA 5EA0L 1JPGA 4RX4D 3B3IB 1BD2E 4M61A 2CJUL 1KC5L 1ZANH 4Y4FA 1ZWIB 3AC0A 4M4PA 4X7DC 1FFNB 1CE6B 1FG2A 2OYPA 3SKNB 1K3ZA 1LDPL 1YMHB 2VDMH 3ESUF 4O58H 3F58L 1CDUA 3BKCH 4YHKL 3DMMD 5FUCE 3BVNB 1SJHB 4JKPH 4Q74A 1RZ7H 3ZKMD 4LIQE 4Z77A 5CEXB 1ZE3C 3O8XA 1MUJA 4MJ6B 4L4VD 5KJRL 1R3LB 1S9YB 4FTVB 1R0AH 1PFCA 4URTB 3NCCB 1CD1A 5I30H 1JHLL 2ZUXA 2GW5A 2L7UA 3FO0L 4J8RB 1V05A 3JZ7A 4GW1A 4OF7A 4MB5A 1C08B 4YNYB 5FHAL 3QIWB 4ODXA 5DC4B 5E6YA 3P77B 3DRTA 2CDFB 3OR6A 1OSPL 2B0SL 3TZVD 5KANG 5IQ7L 1JMXA 3PGDA 1T66D 4OCNC 1LE5A 2WBWB 5FDYA 5HD8C 4C54A 4YXKL 3UJIH 4NZUH 3UAJC 3NCJL 3BW9A 4TSCH 1H15A 1WFUA 3DSFH 3WUWA 3JV0A 2RR3A 2YK1H 2CRYA 2ZG3A 5EU6D 1B88A 1YMMA 1QOKA 3UYRH 1OL0A 3C6LB 2C26A 4OGAC 2P5WA 4WEBH 5JHLH 1PX4A 4TVPD 3QPXL 3IDMA 5C86A 1QACA 4WW1B 2A38A 2R0WH 2HKHL 5GRYA 3BP4B 4TSAH 4MA1C 4TUJB 1U8JA 3W81A 4CNIB 2F58H 5EH1A 4PRDA 5JW5A 1PZUB 3S35L 3OXRA 2PW2A 2EDOA 2OLDA 2KPNA 4FQLL 1H3UA 3O3AB 5EU5B 4PJEB 3T2PA 3VE0A 4PJ9C 4BSVA 15C8L 1CGSH 1JGVL 1NGPH 3HUJB 3VFNB 4LSTH 4HG4J 4LU5H 4B7IA 3PNWA 3P3YA 1AGBB 3CK0L 4H5SB 3VW3L 4XNYL 1OAXH 4EI5B 1BQHG 2E7CA 4EDXB 3D2UA 5LCVL 4P46C 1FVDB 1LP9A 5DJ8B 4EEEA 2R2HA 4Y5XB 3NZ8A 4NT6A 1LQSR 1NMCB 5DC9B 4LCCC 1B2WH 5DJAA 4P9HL 1YJDH 4XNUL 3MGOB 3VMOA 2JELL 4XP1H 3DYPA 2OZ4H 2RFXB 4UAOB 2HYMA 1V7NH 4FHBD 3MCKA 3WBDA 4PP1C 4L9LB 1MJ7L 2FX9L 2GI7A 2HTLD 4OTXL 2B1HL 1H0DA 1MCLA 1HHKB 3CMOL 4H0IA 1RIVH 4L3EE 4O5LH 5IMLA 3OKLA 1P7KA 1SEQH 4LVNB 2Q7YB 3WN5A 2R0LL 5ISZD 2YBRB 4JHZA 5J1AA 4LLMB 4EDWL 2EKJA 5F7UA 1JWUB 4NZRH 3T0XA 3DX8B 1BX2A 1W0YT 5B39B 4ELKA 3BZFB 1CDYA 5H94A 1S9VB 2W0FB 4UIKL 1FNGB 3LQAL 3MLSL 4F7CA 5C0DA 3BHBA 3H3BC 2XWBA 1CYGA 2K7QA 3QIBC 3BD5A 5DTFA 4IIQA 2HT3D 4Y19D 1MVFA 4LRNH 4NQDD 4OLWH 3P4LA 4TUOA 3DOSA 3PHSA 3WJJA 5AD0A 4YR6A 2XZQH 4F15C 2IMMA 2ED8A 2P5EB 4KVNL 5DDHA 1U95B 5JZ7C 5A2FA 4Y8DC 3MGTB 3MV01 4WTXA 5D2LF 3EO9H 2Y72A 1QFUL 3GI9L 3VXRE 5F93C 1FO0A 4OCRH 4WU7B 4RCAA 3T3PF 2AEPH 5FO7B 2H32B 3S98A 3MRHB 3VFGH 5IEKA 4OIAA 3BZDA 4TPRL 3H42H 3AVEA 3SN6N 2HFFA 1ZHKA 1CGUA 3CH8A 4K23H 3GB7A 1A3QA 2ITCB 2PO6B 1E6JL 1T83C 4JM2D 1M7DB 1CLYL 1YN7A 5L88H 1B6UA 3VDCA 1H8SA 4XCCL 1MLCB 2FWOB 3I2CH 3UXFA 3FB7B 3OKDB 4R4FL 1HDMA 4R0LA 3VFVA 4MX7A 2JJSC 3JXAA 3P40A 3WFDH 4HKZA 2XN9E 1RFDL 1Z9OA 4RAHA 3D9AH 4K9EH 4LCWA 4I77H 5D6DA 3GHEL 5HHPB 1GCFA 1CFVH 1A7OH 5D7IE 2Y23A 4H25B 4D8PA 1F11A 5GHWH 3T0EA 1LO5A 1B0RA 2JB5H 3SDCA 5I1KL 4HLZH 4U3HA 4LHUG 4KRNA 1KB9K 3GFUA 3GZKA 3PIQB 5CKAA 3QUKA 3MTRA 5CJXA 4UNTA 5ALCL 5IBUB 5IGXL 2WP3O 4PRBA 4JRYD 5ENWB 3E6HB 4KZDH 4WFHD 2EEAA 2Q6WB 2JIXA 1CQKA 4FXLA 4DN4H 1FFPA 1FNLA 1A6VH 5EZOL 1U8IA 3B9KC 4Y1AD 1S9XA 1L7TL 3UTPD 2NY3B 3PL6A 2ESVD 5GRWA 4U0QB 4XPGH 1T7XA 5I75B 2MTPA 1A4JA 4NO5B 4ZDHB 4JFDD 3KGRA 4ONOA 4GKOA 3RNQA 3R06A 4LSQH 3TA3D 2D03L 2EDRA 3ESVF 5EZLB 4JAMA 5T1LB 4AY0A 4LVHC 2HKFL 4RMSA 3RX7A 4DOHE 1FNEA 3FQUB 1P53A 1NFIB 2DTSA 3G5XB 5DR5H 1F3DH 1L7IL 1NJ9B 3BE1L 4XCYA 5D71L 5IOPA 3O9WD 4X83A 1MRCL 4C59B 1I1RA 3ZDYF 4K8RD 4MXVE 2YN5A 4WHYG 5DUPH 1RZIA 3MNWA 4P2OC 4WWID 1PZ5B 1HI6B 4XVJL 4UQ3A 2XQYK 1X9QA 4P3DB 4PJXF 3SQOL 1MF2H 3OJ2C 3GMQA 1WEJL 3TFKD 1G7IB 4Y2DA 5CEZE 3T0WA 4BQBA 4LHQB 3LKNB 2NY2D 2VXUL 5D2NA 2BSRB 4F7MB 5D7JA 5CP3A 1H8NA 4HIXH 5FK9B 5K9QG 2EDBA 3D69B 1MWAA 1MCEA 3BXNA 3O3EA 4QHNA 3D3VD 4XP6H 3S3PA 4V1DA 3C5JA 2BNRB 4NKIH 5IK3B 3ALPA 5F88B 4ZFZA 1DQQB 4GRWE 1Y18B 3HC3L 5GJTH 2GITA 1KBGH 1K8DA 2XQBL 1ORQA 2VLJA 1BVLA 1FCCA 3KPLA 5LXGL 2IALA 2GIYA 2BSTB 5TDPA 4L4TA 3S3JA 3TBWB 2Y9RT 2APFA 1BD2D 1SY6A 1QR1B 2R2EA 5E5UB 5F9OH 4XBPB 1E0OB 2Z92A 1W0VA 3WO4B 2GJ6B 2C7UA 3REWA 5BVPH 3H0TA 2Q8BL 3MQIA 5JW3H 3HMXL 2P44B 4U6XA 4N8PA 3IDNA 4NSKB 1AFVL 3T3ME 5HGDA 2VN7A 1P9MC 4JDZA 4QRPE 2G5RA 3VXTB 1NH6A 5TF1H 4PTTB 1Z3GH 4Q2ZA 3C6LC 4RFNB 2MQCA 4LF3B 4TNVK 5CCKL 5B8CA 3T65B 2XV6B 2VL4A 4P0DA 3EYSL 4KDTA 3HAEB 3V6OC 4HUVB 4PJFA 2ARJB 2PCPB 3T4AB 5IHBA 4YE4H 1E6OH 5T5FH 1DBKH 4YHLH 2AQ3A 3INUH 5ID1B 4CMMB 5DYOA 1I9JH 4GQ9H 1CBVH 1XAUA 5GQBA 3M8OL 4ODUB 3S3SA 4MJ5B 1T04A 3ZKQD 2X4NA 3D0LB 1NANH 3MV8E 3E1F1 4GRLB 4AM0A 4ZO6A 1BEYL 3QHFL 4M6ML 4CU8A 5LWYL 5CHNB 4QXTA 2OL3A 1I8IB 2J1KA 4U1MA 4Z7WA 1UKTA 2AJZB 4ZNEE 4F57L 4YIQA 3HRZB 4JKMA 5GGSB 4OD2B 4G6JL 4EI5C 2R8SL 1EBPA 4OCWL 1KB5A 1X3DA 4M6NL 4Y5XC 4HHAB 1DBBL 1NMCC 4HAGA 1CDGA 1IEBA 2GFBA 2IPTL 1UVQB 4R90L 1U41A 4KV5E 3IT8D 3EOTH 2QADD 4JCLA 4KKBC 5F7FA 2AI0H 4QRTA 2WQRA 5DI8A 3WD5H 3SGKC 4L9LC 4KKLD 1TJHL 1DP0A 5I8OL 1EGJL 5CZKA 3MUY1 1IGJA 2VWEC 3MCG1 1GZPA 3A67L 2YZ8A 5DJ6A 4JPKH 5I1HH 3K2UH 4NN6B 4Y5VB 1XCTA 4LCUA 3TN0C 1IKFL 1YY9D 4KI5E 4LVNC 2HLFD 4RGNB 1VFBA 4GJTB 3RPIA 5AAWA 1EHAA 1BQLL 1T89C 5HHXH 3PP4L 4M5ZL 3U46A 5L2JB 1MFCL 2R4RH 3RKPA 4S1RH 2DLGA 2JJVA 3U6RA 2GCYA 2E6QA 4RNRA 3WS6A 3BYTA 1JRHH 1VPOH 1QFPA 4XMKH 3NOIA 4I4WB 4WW2F 3ARWA 1XEDA 2ITDA 4JB9L 3VI4F 1RIHH 4NJAL 4L3ED 2XQYG 2YKLL 2FJGA 4U1IB 1OHQA 3U9PH 5D9SA 5IFAH 2Y07H 1CIDA 5FYLE 4Y5YB 3SJVB 3S36H 2UZYB 4LIQL 4I0KA 4OZGE 1GC1L 3NFPB 3HE6B 2VLKB 3U7YL 4XAKE 1JFQH 3HR6A 5IBTH 5CGMA 3V7AE 4LL9A 1SJXA 2GSIA 3ARQA 5DEFA 5LKNA 5DGQA 1DN0A 2CUIA 3MNVB 3ARED 2BVQA 3QIUD 1A21A 2VIRA 4UU9B 5HY9A 2NZ9C 1KJ2L 3FHQA 1NCBL 4RBPH 1IEAA 4IRSB 2FSEB 4JQXA 4PJXA 2PO6C 4ODWA 1UB6B 3TJEL 4N9GA 1A5FL 1FYHB 1TETL 3UJJH 4A6YB 4G6ML 4P3WA 3MLRH 2DI8A 5CLTA 5I0DA 5IM7A 1I1AA 2JCCA 1JPFA 5SWZA 1D5ZB 2UZXB 2EE3A 3JTSB 4Z7VE 5TFSL 5JW4N 4FQXC 4UNUA 4G80A 3EDEA 3QNXB 3BGFC 3D0VA 4Y2OA 5IF0A 2LU7A 4HWEL 1WT5A 1IT9H 4E0RB 4OB5H 1UEMA 5JXED 5KSAB 1AKJA 4Z7UB 1VGEH 2UUDH 1G6RL 1EZVY 5F7EH 2X1OA 4JG1L 4JDTL 1N2RA 1T7ZA 4OZIE 3QHTC 4PV8A 5GISL 5IB3A 5FGBA 1VGKA 1J86A 3RTQA 4M4RA 4FZ8H 1JV5B 1A9EB 5FDWA 3SDXE 2VDOH 3QUMA 4UDTB 3RHWK 1CF8L 4PREA 4NQCA 3LS5L 4L1DA 4WTWA 3I3BA 1IQDB 4IHOA 4ZYKB 1EEQA 2O5XL 2CR3A 1T22B 3LRSB 3WIFA 1G7PA 4IMLB 2XN9D 4KVCL 3CAFA 5E9DA 2HT2D 2NY3C 4AEIH 1JPGB 4Q6IA 5K93A 4XWGH 2NXYB 4R8WL 4M61B 1C16A 5I75C 1VACA 2ZOKA 4Y4FB 4ZFOL 2A74A 1FG2B 3M1BA 4OBSA 2X9WA 4IJ3B 3KPOA 4Q9RH 5F8RC 3FQRA 5C6WH 1VERA 3ES6A 1HIML 2GKIA 2H1PH 5FEBA 4Z77B 3U30C 4OF5A 5JQ6L 3O8XB 1X5LA 1ITBB 3M07A 1MUJB 3MXVL 1MI5E 1P4IL 4O02L 1V8HA 4ZUSA 5D1QC 1CD1B 3EFFA 5HDBF 5JW4R 2F53E 3V9FA 3KYKL 4WUKH 1NEUA 2VLME 4GW1B 3FN9A 2VXVL 3TYFA 1GOGA 4ODXB 5GRZA 4J4PD 1J88A 3DRTB 3OR6B 1FZKA 4HIIA 1VFOA 3ULUH 1BOYA 4S1SL 4YUEL 3PGDB 1ZLWH 2G75A 1LE5B 3RWCA 4HCRH 5FB8A 3QEUA 3GHBH 4WUUE 1DQDL 3BW9B 1H15B 2X7LA 3WUWB 5IFHH 5HYSG 3IKCA 1BVKA 1S78C 1F4WL 3GIVA 1WIPA 4X7SL 1YMMB 2R9HC 1UACH 3G5YA 4N8CL 3TH4T 2P5WB 1HZHL 3IDMB 1SY6H 2HFTA 1WWAX 5D1XD 5AAMA 3CZJA 5DD0L 4HWZA 4P3CH 5HDLA 5DZOA 1U8JB 3UJTL 5CEZD 4PRDB 1C1EL 5JW5B 4X80H 3OXRB 2PW2B 4JFHE 1F58L 25C8H 1IJ9A 2NW3A 1VEOA 4BSVB 3VE0B 2BNQE 1PVHA 2ADFH 2PR4H 4D0DA 3RDTC 3NZHH 1UWEH 2JF1A 4X9GA 2VDKH 4Q7DA 2V17L 3LS4L 4MNQE 4JLRA 2APBA 3TYGH 3PNWB 4LSRH 1S9WA 5MEPA 5DLML 2J8UE 4GAGH 3BH9A 3D2UB 2FEEL 5F7DA 1LP9B 3ZT7A 1HQ4A 2R2HB 5IB5A 3HNVH 2WMPA 1BIHA 2AKRA 4BFBD 3NZ8B 1CXFA 3PWPA 4NT6B 4POZD 3BZEA 3DX9A 1J5OL 1I7UA 5DJAB 4RFNC 5JMOC 4HC1H 5E2VH 4PJIA 4RX4A 4OZFH 3PHOB 1MY5A 4G6FB 1T03H 1I9RH 4XPHL 3MCKB 5BOPA 5BS0D 4TNWK 1S7VA 2J2ZA 7FABL 5CD5D 2O61A 4QGYA 1MRFH 3ARPA 4K2UL 1H0DB 1MAJA 1YJDC 1EJ6A 2PUQT 4U7SA 3DMMA 4D2NA 3OKEA 4QRPD 5IMLB 3OKLB 5SX4H 1P7KB 1PQZA 4GRLC 3WN5B 2HTKC 5L8JB 5J1AB 4M62L 3VWKD 1IE5A 3IGAA 4OLYL 3C08H 4KUCF 3G6AA 4B5EA 3T4YA 1BX2B 2X1XR 3ILQD 3TBSA 4ELKB 5H94B 2P24A 3MREA 5F9AC 4F7CB 4H8WL 3KJ6L 5EU4A 3BHBB 4KK6C 5C0DB 2XWBB 5DTFB 4IIQB 3U79A 5BO1H 3TZVA 4TUOB 1NGZA 5AD0B 4YR6B 1CE1L 1L0YA 1DDHA 3MV8D 4JO1L 5GRVK 1EO7A 3TEUA 4DZBB 5DDHB 2DIAA 3QDGE 2A9NH 2I9LA 1QLEH 4KK9C 5FYJE 3FQWA 4CGTA 5EU6A 5TQ2H 4XPFH 4OCSH 4ETYA 4Z76A 4P9ML 4NN6C 4Y5VC 1FO0B 4UZGA 4B0MM 1X5XA 3FFCE 3QZWA 4H20H 4IOFC 5IEKB 2MFNA 2W9LA 4RGNC 1TZGH 3T2NL 3P11H 2HFFB 1ZHKB 5I9QB 1H3VA 4S0TD 3GB7B 4RGOL 3WSQH 5DFVD 3OWEA 1INDH 4PJ5E 3LN4A 4EQ2A 5I15L 1J1OL 2IGFH 2KBGA 4TOYH 1YN7B 3MZGB 5CS7A 1I3GL 2XA8H 2A2QT 2V2XA 3ZTJH 4APQD 1HDMB 3NABL 4JPVL 4Z8FH 5EIVA 4R0LB 1OCWL 3VFVB 4LSVH 4MX7B 1QSFE 2V5MA 4YXLH 2LV4A 2Y5TA 4Z18A 4HKZB 4LSDA 4KI5D 4P57A 5FO9A 1YEKL 3GSNL 3T08A 4LCWB 2PTVA 1K6QH 4Y5YC 3E0GA 4M48H 5C0BE 5K59E 3HE6C 3R8BB 3W9DA 2XIDA 2XOTA 1FH5H 3HN3A 4D8PB 1F11B 3NA9H 3T0EB 1LO5B 1B0RB 1XH3A 3SDCB 5IT2H 1WFTA 1NUDA 5ETUA 3UTOA 3QUKB 4NQTA 4K9EC 3K0WA 4Y4KA 4Y88A 5ILTL 4PRBB 5L9DH 4DKAA 2ZCKH 3LQZA 2LABA 2JIXB 2IQ9L 1FFPB 2VH5L 5TE7L 1U8IB 2P47B 1MREH 3BJ91 4FFYL 5FYLD 1S9XB 4TVSa 1MAMH 3AS1A 4JN2A 4G9DA 1F02I 3PL6B 5ISZA 3EO1A 1NL0L 4XAKD 1IBGL 3MJGX 5C0IA 2HA1A 1A4JB 4P4KC 3FB8A 1OP5H 5DC0A 5INDA 3RNQB 3R06B 4U2YA 1A22B 1SVZA 5KSAC 4JAMB 4PJBF 1KTKE 4ZXBD 4Y19A 1FNEB 3B8SA 4NQDA 4XXCA 3MLTA 4MJ4A 43CAA 5I0ZA 1N7MH 4YHML 3EHBC 1QLRA 4UT7H 4XCYB 5IOPB 1CXLA 1OB1A 3C2AL 4MJIE 2KQMA 2J4WH 4LGSB 4XPBH 1RZIB 3MNWB 4KK8C 1BZ7A 4M1GL 3SE4A 1UCBL 4UQ3B 2FNBA 1R6VA 1LDPH 2IPKA 4PLJC 2D7TL 4LLWA 1M6OA 3GMQB 4XP4L 2FB4L 3ARDD 4Y2DB 3R1GH 5I8EA 3QXAA 5C07A 5D2NB 3MJ9L 5D7JB 2NXYC 4G43A 4KH2A 3WKML 2X44D 4I0PD 3RWHA 4JM2A 3EAKA 5KJRH 1G9EA 3BXNB 5JHDA 3O3EB 4QHNB 5BV7B 4V1DB 3C5JB 4IJ3C 2AXHA 3QISA 1OT1A 4R26H 4X7CC 3FO0H 3U4BH 3U9UA 4ZFZB 1BJ8A 1W2KT 2ICWI 3AY4A 5B4MD 4NOFA 5CGYC 3NPZB 2GITB 1K8DB 1ORQB 2VLJB 1BVLB 3OKMA 3KPLB 4TSBH 2IALB 5FCUL 5TDPB 3RWGA 3O8XC 2ZPKL 3MUGA 1BWWA 4FQQA 3OKKA 4L4TB 5EC1A 4Z7OF 4O51A 2EC8A 2F5BL 1T7VA 3PWLA 3CDYA 4PJDF 2R2EB 2XZCL 2UWEF 4DGVL 1T2QL 2Z92B 1XF4A 1W0VB 2VJXA 3HMXA 4MDIA 1FYTE 3BEWA 2C7UB 4NN5B 3REWB 1CR9L 3RGHA 3H0TB 2EE6A 1TJGH 4U6XB 1EH9A 2VRAA 3IDNB 5HGDB 4JRYA 1U91A 1WAAF 1KELH 3GI8L 4BFIA 2IH1A 4X0KA 4JDZB 4HEME 1BOGA 2LVEA 1MI5D 3ZMRA 3CLEH 4Y1AA 4Q2ZB 4FQLH 5B8CB 5C09E 2ESVA 2F53D 4OZHF 3LN5A 4PJFB 2VLMD 2EH8H 1NBZA 1SYVA 3HKFA 3MBED 2EEBA 3GO1L 5DYOB 3L3GA 3IFLL 5EBLA 4PGEA 5DMGD 1R3KA 4JFEE 2HH0H 1T04B 4WUUD 3CIQA 3IVKA 5E5RB 4YAQA 2X4NB 1YQVH 3Q3GA 2BX5A 4B41A 4AM0B 4KROD 1YEDA 3ZDXE 4CN4A 2OL3B 3MLWH 2NR6C 4U1MB 4Z7WB 3TF7C 1CXHA 1AI1L 5TDNA 3B2VL 4YIQB 4KZEL 2G60L 1MJ7H 3WIHL 1QRKA 3MLVL 1QNZL 1I3VA 1KB5B 4KXZI 2YC1A 3QXTA 4BUHA 2DYPD 3EYQD 1QSEA 5FGCE 3O6MH 1IEBB 4H1LH 3DPBA 2R0KH 2GFBB 3PG2A 4U7KA 5DHVA 3O2DL 4MA8L 1QRNE 5DMJB 1MHPH 1ES0A 1PKQA 1OOAA 4TYUA 2BNQD 5FYKE 3E2HC 3KPSA 4QRTB 1ZHLA 5JUEL 5DI8B 5L2KE 3CXDL 4QHKI 1A02N 3DO7A 3D3VA 4PJHA 4MNQD 1IGJB 1AXTH 2ICWA 2BDNH 1GZPB 2IANE 4JY6A 4GBXD 2LE9A 4QRSB 4UIKH 5DJ6B 1A6AA 3GK8H 1J0KA 1XCTB 4LCUB 2CO6B 3MODL 4GLRI 1E4XL 5J12B 1DQLL 4U6VL 4JQVA 3UO1L 3WN5C 1ZEAH 3QP3A 1VFBB 3RPIB 4POUB 3TT1H 4WV1A 3PF2A 3U46B 3VJ6A 1JPSL 3SO3B 5GGVY 1BD2A 2VZVA 4OFPA 3VI3F 4KVNH 2D9QB 2OXGA 4MZ2A 3U6RB 3X13A 2GCYB 4RNRB 3VFSA 1YEEH 3DURA 4IIQC 3AUVA 3GI9H 4WU5A 3WFEL 2ITDB 2BY0A 4HT1L 4FQIH 3WJJC 3FOLA 4PJBA 2H45A 2HWZL 4TVPH 3VWJC 2FJGB 2ICWJ 3CVIH 5D9SB 3OR7A 5E08L 3IU4H 4OIIL 3BIKA 2P46B 2WINA 1E6JH 5T3ZH 3LN9A 5B22A 1CLYH 1T7YA 1YEGH 2BFVH 2R0ZL 3H3PL 2GSIB 4AL8H 5DEFB 3I6KA 1DN0B 3FFDA 1KJ2A 1AP2A 4PLOB 4GMSH 3ZHKA 2BVQB 2VIRB 4XNZC 5HY9B 4OCMC 4B53A 5I9QC 5MEOA 1YECH 1IEAB 4MVBD 4CJ1A 4ODWB 4OLVL 4N9GB 4HF5L 5IM7B 1I1AB 4KHTL 2JCCB 1JPFB 5SWZB 2I5YH 3QDGD 3IDXH 3HMWL 5FYJD 1OWWA 5TE4H 3K2MC 1U58A 1FL3A 4G80B 1ONQA 1JWSA 4B50A 1OW0A 4R0LC 3IJHA 3D0VB 1MIML 5IF0B 4LCIL 1P1ZA 3FFCD 4ODSH 3CSGA 1AKJB 2Y6SC 1J1XL 1G9NH 3FAWA 3MCLL 4QY8A 3WFZA 3H9SD 2FX8H 3P9WB 1N2RB 2DQCL 4PV8B 5D6DC 5IB3B 1VGKB 3MA9H 1U8PA 4Q58C 4QTIL 3RTQB 2VISA 4NWUH 1TQCB 4PJ5D 3BRDA 5KANI 3BPCA 3T0EC 1U8QA 5FDWB 5EUOF 3SDCC 4K07A 1FN4A 4QOKE 3QUMB 4PJDA 4RRPA 2UZIL 3GNML 4PREB 3MOQA 4NQCB 4J3OC 2UWEA 5A2IH 5EC2A 4ZS6D 2X09A 5CJXC 2H26A 1WTGT 2GK0A 2Y25A 5HGHA 4IHOB 1QSFD 4YBQC 2CKBL 2DM7A 1EFXD 2FEEI 3CCHA 5C6TH 3WIFB 1G7PB 3HPLA 1KEML 3DGGA 4G6AD 5E1HB 4GG6E 4Y8AA 5E9DB 1IGFL 1DSFH 4WFFD 3ARXA 3PL6C 4Q6IB 1IKNA 4ZFOA 4OV5A 4RZCA 4PRAA 1KF9B 1C16B 3TM6A 1VACB 4KRPB 4KRMB 2ZOKB 1MRCH 2A74B 4GKNA 1U8HA 2Q1EA 2Z9TA 3M1BB 4L1HA 4OZHA 1OAYH 1LGVA 2H3NA 3BDYL 3T0VA 4GKZA 3KPOB 1CFQA 3MLZH 4WVRA 4LNVA 3B9EA 4QHKJ 4XVJH 3TH3T 3FQRB 1OAQL 1OTSC 2FO4A 3ES6B 4NKQB 2FJHA 2BMKA 4X8XA 3W11D 2Z8RA 3FN0H 3RVWC 2MPAH 4L3EA 1WEJH 1NCAL 1RHHA 3BYYA 4F7EA 4ZUSB 4MWFA 5FIEA 3HZKB 3DXAE 3RI5K 3EFFB 4ZODA 1X5AA 1NBQA 3IDYB 3FZUD 4NQXA 3TYFB 3MSPA 4ZSOE 4AQ1B 2FYYA 1P5UA 4YBLB 1FZKB 4HIIB 4P5TC 3T3MF 4OM0H 2H6PA 4Y2DC 1BAFL 2G75B 4UBDC 4KY1L 3RWCB 5FB8B 1M71A 3QEUB 5D2NC 3QDJA 3KS0H 3SDDD 1Q9KA 1KCRL 2X7LB 1EAJA 4QXUL 1JE6A 1G0XA 5AUMA 1CL7H 4KKAC 3IKCB 1BVKB 3RWJA 3GIVB 3OZ9H 3BUYA 3O4LE 4K3JL 4ZQKA 4MJID 3G5YB 3ULUC 1QD0A 1A7QH 1ZK9A 5C0CA 5GS3A 4GKSA 4NYLA 5DHYA 2E8YA 4ONFH 5B3NA 3VXRA 2VITA 4JQIL 4HWZB 1EAPA 5JXEA 4QEGA 3O2WL 2VQTA 5HPMA 1MNUH 1MQKL 3FT3A 5GGSY 1BBDL 2C1PA 3VXME 3HNSL 2NW3B 1RUQL 1LWRA 2NY4B 4D0DB 1SJEA 4NN5C 2VC2H 3A6BL 5KG9A 1NGQL 2FHFA 2ZUWA 4WWKD 2VERN 3GSQA 4JLRB 3CFDA 4OSUL 2R29L 1S9WB 1IGTA 5MEPB 1DVFD 3BH9B 1WZ1L 5F7DB 1HQ4B 5IB5B 3UP1A 2AKRB 3FQTA 1J1PL 3PWPB 4G8GE 2XN9A 5AWNH 3BZEB 4MAYD 3DX9B 3M8OH 2XXMB 1I7UB 1GGCH 3BEVA 1J05A 2AXFA 4XNXH 4J1UA 1T0MA 2GJJA 4LOUD 3PHQA 4U1NA 4PJIB 5I66A 5LWYH 1BEYH 3QHFH 4ONGH 3RU8L 1LO4H 5D7IA 2CRZA 1FYTD 4M5YH 2G5BA 4W6WB 1B6DA 1S7VB 1W8NA 2O61B 3QO0A 3EBAA 1EO5A 1AR1D 4K8RH 4HKBA 2YN3A 5D7SH 3MA7A 3DMMB 1NSNH 3HI5H 3OKEB 1XGTA 4DGIH 4NO2A 1URLA 1PQZB 1BQHA 1JN6A 4BZYA 4OM1H 1O5DT 2E27L 3IGAB 1WZLA 2A77L 4JRXD 1FZJA 1KN2H 5C09D 1M05B 1CDJA 3G6AB 3L5WA 3T4YB 3TBSB 4RA0C 2CLZA 2P24B 2VYRE 4NC2B 4NZDA 2I25N 4BQ9A 3MREB 4POYA 1L0XA 3N1QC 4OT1L 5EU4B 2O93L 4NP4L 1U8MA 4J4PA 4X5XA 1JYVA 5JMRA 3TZVB 4JFED 1NGZB 3VMNA 3WNMA 3V4PL 1DDHB 5C3TA 1KXVC 4RWYH 3V8CA 5D93B 1NMAL 1BQLH 2LAGB 5LG1A 3PP4H 5JORA 2I9LB 1RMFH 3FQWB 3PQYE 4BA8A 5EU6B 4I3SL 4R6UA 3V5HA 2DI9A 4Z76B 1X5KA 1ZT4A 3EJJX 3RUGE 3WMSA 4UNVA 4X8JA 1ETZA 1NEZG 5D1XA 3QZWB 4I1NB 5J12C 3U83A 1JZ8A 3CC5A 1OY3B 4KTYA 4JB9H 4KJWC 5GRUL 3RIAK 2R23A 2JJTA 1QRND 1J87A 4JGUA 4EI6A 2D2OA 5DK0A 2DBLH 3QUYD 3LN4B 5FYKD 2F8XC 1MHCA 5EOQH 4KPHL 5L2KD 2XZZA 3LKOA 1LE9A 1GC1H 3FCTA 3P30H 3J7HA 3WS6C 2WQ8A 3U7YH 2V2XB 1Y6MR 2BVOA 2IAND 4IDLA 4XVUC 2QBWA 3CX5J 3L1OH 3GSNA 2Y5TB 4ZUWA 2Q7NA 1CZ8L 2AJYL 2AP2A 3TVMC 4PJGF 2ZUYA 4P57B 5FO9B 4Q97A 1KLGA 2X4RA 4XB8A 4U33A 1KJ2H 3TWCH 3U0WL 4F9LC 1N0XL 4S0SD 3B6SA 2Q8AL 5GRJL 4WENB 3W9DB 3SDXF 3SE8L 3BQUA 3UEZA 3AS3A 4XPAL 1ZLVH 1VCAA 1XH3B 3Q0HA 1S7QA 5ETUB 4OLUL 1EBAA 3BFOA 2CO7B 3BP6A 4Y4KB 2CR6A 3TJHD 2XZAH 1EERB 2E7BA 5K9QI 5C0ND 3LQZB 4JQXC 4XP9L 5EWIL 1J12A 4ZNCD 4YO0A 3P0YH 2VDRL 2FBJL 4Y16A 2DQIL 1F90L 5GJSH 3VFRA 4MNGE 4QRPA 4OFYA 4HWBL 4KAQL 1DQML 1CK0H 3QEQD 4RBPK 3VFOA 4JN2B 3BMVA 4G9DB 5ISZB 3EO1B 5C0IB 2YUZA 3OAUL 5IMKA 3FB8B 4GS7B 5EFIA 3VGEA 2NTFA 3CSYA 5INDB 1YNLH 1JHKH 2HMIC 4GSDL 1GGBL 4NRXA 1BP3B 3S5LG 4ODTL 2VZ3A 4M7KL 4LHUA 4G6KL 5FGBC 1TVBA 3FT4A 4Y19B 4GLRH 4NQDB 1TQCC 3MLTB 43CAB 3OJDA 4KVCH 2UUDK 3L3IA 2AW2A 1QLRB 1WGOA 4BQ8A 4ZD3L 2ED9A 1OB1B 1RUPH 1IAOA 2MCPH 2WBJD 1OPGL 5HYFA 4X7FC 1IL1A 4PBWD 1KCUH 1G7QA 1BZ7B 4ZNEA 4Q9CA 4GMTL 2IPKB 1KXQE 1WCBA 1EJOL 4EIZC 3MV9E 4LLWB 3TLRA 1M6OB 1UZ8A 4BZ1L 4NCC1 5I8EB 3QXAB 5C07B 2DWEA 1LDSA 4G43B 4D9QE 4KRPC 7CGTA 3RWHB 4JM2B 2X4SA 1P4IH 4QOKD 2QKIA 5JHDB 4HIEA 4XHQA 2DLHA 1ZVHA 1CLZL 2QQQA 5BXFA 2PYEE 5FYKL 3U9UB 4APQA 5A16A 4AG4L 4YXHL 3OKMB 3KLHD 1E4XI 12E8H 3GMPA 3RWGB 2PW1A 2FCBA 3MUGB 1KTLA 1CLOL 4FQQB 3OKKB 5EC1B 1OAKH 4O51B 4G8EA 3PWLB 2J6EL 4ODBD 4YBHA 4FABL 3UZVB 1Z9SA 3IDYC 1XF4B 4FZEH 1S9KC 4MDIB 3BEWB 5E6ID 3BIBX 4YBLC 4FMFA 5F7MC 4IRZL 3CFKA 1ACYH 1K85A 4M6OL 1JTOA 4JRYB 1U91B 4E41E 2Y1VA 4BFIB 5T3XD 2IH1B 4X0KB 1BOGB 3EZJB 1ZLWK 1MIEH 4UOW0 5LAXA 4Y1AB 3O6LH 1IGMH 1N4XH 4OZGA 3THML 2ESVB 1S5HA 2DS4A 4KMTH 3S97C 3LN5B 3W39A 1JZ6A 1P7QA 3NCMA 5KTEL 4Q9QL 4WTZG 1NBZB 2UVEA 1SYVB 1VFMA 3S88L 2V17H 3LS4H 4TNVF 2RAMA 4N9OB 4LSPH 1ITCA 5L8LB 3CDGA 3O41A 5ESVA 3L3GB 1JYXA 5D5ME 5EBLB 4PGEB 4ZXBA 5KS9E 1R3KB 1SBSH 4BQ6A 5GRVL 4LARL 4YAQB 3Q3GB 1FLTX 3ARFD 3QJHA 3IF1A 1YEDB 3WFBH 2NY4C 3O4LD 4PG9A 5F7HA 3RPKA 1DUZA 1JNNH 1AY1L 2NW2A 4U49A 4Z7VA 2V2WA 3KJ4B 5TDNB 1FFRA 3GSXA 4F7TA 3KLDA 4HKXA 1HSAA 4OGXL 1FVEA 4P9HC 2YC1B 3O2DA 4MGXA 3BRFA 1QSEB 1AXSA 2MJWA 4PJGA 4Z95H 4OZIA 3ARDA 1XF1A 5GZNC 5DHVB 5C0AD 3F8UB 3VXMD 5JA9A 3MLXH 1ES0B 1PKQB 1OSZA 3QG7H 3UX9B 1UKQA 3NACL 3KPSB 1FG9C 3OXSA 1ZHLB 1ZLSH 4I0PA 3SDXA 2ZJSL 3D1MC 5D7LE 3KYOA 5FHBL 3ZE2E 2BJML 4YFLF 3DO7B 3RQ3A 3D3VB 4PJHB 2ICWB 1T2JA 2B7DT 3H3KA 4JY6B 4XGZA 2I27N 1VA9A 4FXGA 1A6AB 3MYJA 3DMMC 2C1OA 3NGBB 3ZKMC 5GPRA 3CDFA 3OG4B 4WV1B 2WIIA 3EO0A 3C9NA 3VJ6B 1BD2B 3EFDL 5HTSA 1IC5H 5HJ3A 3RL1A 5E6ZA 4HGWA 2X9XA 3X13B 1RZGA 1AQDA 3B5GA 3VFSB 1FNHA 5ADOL 2VQ1A 3DURB 1WC7A 1A3RH 3AM8C 3QDME 1TCRA 4WU5B 3TZVC 1HEZA 5T33L 1T66C 3BJLA 3FOLB 4PJBB 1Q38A 2FBOJ 5JOFA 5K9KA 2A0LD 3OR7B 3N1GC 3WHE1 5D93C 1AGEA 4PJ7E 5GGVL 2MMXA 2HT4D 3BIKB 2WINB 5EIIB 1NCDL 1T6WA 1RVFL 2W9DL 2OR8A 5CEZH 1P7HL 1Q0YH 1KB9J 1LNUA 1KIRA 3I6KB 4IMKA 4MDJA 4TRPL 2DQUL 3FFDB 1KJ2B 5E99H 1AP2B 3MRRA 1OQOA 3MBEA 3VXSE 3OX8A 3JWDH 5IB4A 5MEOB 1RZKH 2NCMA 4S1DD 4XCEA 4KQ3H 4EUPG 3AMLA 4L8BA 1P2CA 3PQYD 5GS2H 4NFDA 1W72H 4YHOH 1U58B 3CGTA 1FL3B 5DS8A 1ONQB 1JWSB 3K8LA 3IJHB 3SDYH 2AABL 4PS4H 2NX5E 1P1ZB 3RVTD 3TIDA 2YUWA 4YFLI 2WNGA 5IB2A 4QY8B 3TESA 5F70A 5KOMC 3BESR 2HG5A 1BM3L 2DYPA 5CJQL 1U8PB 2ILLA 2IQ9H 2VISB 2CDGA 5TE7H 5DVKA 4NHCH 5I74C 3SKJH 1EMTH 3BPCB 1U8QB 2AJUH 1FN4B 1ZANL 2BNQA 1G9NC 4PJDB 5C0JB 5KVDH 2PF6A 2UWEB 1HHIA 3K4ZA 3LHPH 5EC2B 2CKBA 4FN0A 2DIJA 1GZQA 2H26B 2HTLC 1EO8H 2GK0B 3ARRA 4MNQA 2EDTA 5HGHB 2VDML 4O58L 5ALBH 4KQ4H 3CCHB 3BKCL 2FD6H 3RHWF 2J8UA 3HPLB 1RZ7L 4BFGA 3DGGB 3HTLX 2IJ0C 1JPTH 2AV1A 4ZFOB 3JUYA 4BH8A 4OV5B 1R0AL 4RZCB 4PRAB 3NIDE 4G5ZH 5TPWH 3Q6GH 4KMLB 1QFOA 4GS7C 1T0NA 5I30L 3R0MA 3DBXA 1S8DA 4GKNB 1U8HB 4OZHB 2F8OA 2H3NB 4OQ1A 2PXYD 4DVBA 2F74A 4GKZB 2B2XH 1CFQB 1F45A 5I8KH 1OP5K 3QUZD 5DUBA 5B3JF 2XTLA 2FO4B 2HT3C 2FJHB 2BMKB 2MQ3A 1DCLA 4N1CA 4XXCC 5F3BA 4GOSA 4NZUL 1XIWD 4L3EB 4CRPA 4HXAH 1RHHB 4TSCL 5IMMA 3MLPA 3OAZH 3D87B 3DSFL 5CILL 3PWNA 2YK1L 3AB0B 4F7EB 4MWFB 3P9MA 3F6IA 5JHLL 3SE4C 2DBJA 1ND0B 4NQXB 2FYYB 2R0WL 4FFVD 3M45A 4OZFG 4TSAL 2ENYA 2H6PB 2F58L 2ZOLA 5FCUH 1M71B 2HLAA 3QDJB 2C4XA 2QSVA 1Q9KB 1WIOA 5AUMB 2WSKA 4X99A 3RWJB 1DLHA 2EIBA 3ULVE 3RY4A 2NPLX 4JM2C 4F7PA 3BUYB 4LCCA 4ZQKB 1CGSL 3QDGA 5I1CH 1NGPL 4LASH 5DO2C 3D39E 1T2QH 3EYVA 4LSTL 4M3JA 4R2GD 5C0CB 4LU5L 4GKSB 4NYLB 3AY4C 5DHYB 3S36X 3VXRB 2XT1B 4U1SA 2VITB 1OAXL 4BELD 1EAPB 3FFCA 3MV9D 4I5BA 1A7PH 3GSOA 3ZSSA 5HPMB 2EXWD 1B0WA 3FT3B 1B2WL 6CGTA 2C1PB 1DJSA 4D9QD 3ZDXF 3JBG7 1YJDL 4PRPA 5BQ7A 4PJ5A 1P6AB 4XP1L 2Y06H 2R4SH 3QI9D 1SJEB 1V7NL 5HYSA 5KG9B 4TULH 4Y0GA 3AXLA 2PYED 5FYLH 3GSQB 3E3QE 3CFDB 5CEYA 1KFAH 4CN6A 1IGTB 3LAFA 4GXUM 4WY7H 3MFFA 2ED7A 3SE3C 1EFXA 1RIVL 4O5LL 1TQBB 3RZCD 1TTUA 3FQTB 3D85A 3RWIA 2XN9B 3IFLH 1JZ5A 1SEQL 2FGWH 3BEVB 1J05B 2AXFB 1BFVH 4J1UB 1T0MB 4U1NB 3PHQB 1HILA 2W60A 5C0BA 5I66B 4NZRL 1RUAH 4QHUB 5D7IB 1FGNH 1A1NA 4Q6YA 4FQJL 2G5BB 1TVDA 1UYWH 1H9VA 3QO0B 1ZVYA 5GS0D 1S7TA 3MLVH 5H8DA 1QNZH 1WITA 4HKBB 4LRNL 3MA7B 1R3IH 2OCFD 4OLWL 4U1LA 1XT5A 3O0RH 4NKDA 3TO2A 3QEHA 4N1EA 5CFHA 4TNWF 1XGTB 4PJAF 4NO2B 1IGYA 2D4FA 1BQHB 4FMKA 1JN6B 3EDJA 1MHHA 5L0QB 4PJEF 3O9WC 2GHWB 5DVOA 2B8OT 3KJ4C 1FZJB 4MA7H 3L5WB 1NFDF 3HUJF 3IAQA 5MP6H 3EO9L 2CLZB 4GW4A 4KDWA 5C9JA 4OCRL 1FVCA 4LDLB 2AEPL 1U8MB 5DJZA 5T1KD 1IM3A 4X5XB 3ZSTA 1Y6KR 1RJZA 3VFGL 1TMCB 3H42L 3TFKC 4K23L 4DOHB 1PYWA 2NY2C 5FA4A 4DEPB 3FO1A 1WBZA 3SDDA 3X14A 1F4XH 5JORB 5L88L 4XWOD 3OPZH 2G9HA 4MJIA 3AS0A 1MPAH 2NY6D 3V5HB 3VG9B 3I2CL 1KTDA 2IPUG 5CD3A 1ZT4B 4X6DE 3JWOH 3WS3A 4X8JB 3EIFA 1A1OA 1ETZB 3NIFF 1L6ZA 4JFFE 2BHYA 4PGJA 5D1XB 3CC5B 3WFDL 2ARWA 4MD4A 1S3KH 2FIRT 1LD9A 2COQA 3BP7A 3V5DA 3U36A 1MVUA 1I1CA 4WV1C 3D9AL 4K9EL 1XR9A 2R23B 4I77L 5KVMC 4EI6B 5F9DC 5DK0B 1BJ1H 1FCGA 1HKLH 3EYUH 2NY1D 3T2QA 1MHCB 3CXHJ 4NNYA 1A7OL 3B9KA 4NZTL 1UXWA 5GHWL 5HDOA 2JB5L 1LK3L 1X4ZA 3LKOB 3MFGB 1A3LH 5D7LD 1LE9B 3FCTB 5H35A 1WTLA 2BVOB 4LQFL 1CG9A 3WNLA 1JNJA 2R0ZH 5LJYH 3ARTA 4GRWB 3VGAB 5HI5D 3QBTB 2Z4QA 3GSNB 1V3KA 4ZUWB 5FUCC 5HHNA 4PRIE 4KZDL 1IQWH 5EU7E 1KLGB 2X4RB 1A6VL 1GC1C 3B6SB 4YC2B 3FB5A 3SGEI 4MAYA 4UILH 2VKXA 5L6YH 3BQUB 4KHTH 4XPGL 1CTOA 1G9MH 4FOMA 3VGHA 2ZUVA 1S7QB 1A7BA 5J6GA 1NKOA 1FYTA 3BP6B 1FIEA 3BSZH 3EOYG 5KSBF 5DSCA 2APVA 4PPTA 5HYJE 4YO0B 4HWBA 4Y16B 1JZ4A 2IEPA 2W0KA 5D6CA 5DK2A 3VFRB 5I76A 5DR5L 4QRPB 2DQCH 5GS0L 3NAAH 4LSSL 4N0YL 5FOBA 3OMZA 3VFOB 2QTEA 1UM4H 4PRHA 4XI5D 1ROWA 1FL6A 1OW0C 1DLFH 5IMKB 3VD3A 1BFOA 5DUPL 1WWBX 2VUYA 5EFIB 2NTFB 2UZIH 3CSYB 1YN6A 4NRXB 1HKFA 3MBXH 1HH6A 3VXSD 2VZUA 4LHUB 1MF2L 5HHME 1I8KA 4DWHA 3FO2A 3FT4B 1TVBB 1F8TH 4FRWA 2OI9C 2DOCA 4NKOA 4XXDA 1RUMH 3OJDB 4ORGA 3WHXA 4BSWA 3L3IB 2X9YA 3QUXD 4DUVA 4HIXL 2QADC 2HRPH 1MFBH 4NJ9H 1IAOB 1JI2A 4XP6L 4KKLC 5F6IB 4XC1H 1IL1B 4J3XA 1G7QB 2FLBT 1XMWA 2NX5D 2DQFA 5GJTL 2X89D 1S7RA 1KBGL 1WCBB 3HI6H 3QXVA 5FV2A 2YWZA 3ZE1E 1YY9C 3JVGA 1KCSL 1UZ8B 3RZWA 3LD8B 3VRLF 2HLFC 2GUOA 3K81A 3L6FA 1IKNC 2DWEB 1RK1A 1C7SA 3VG0H 2W1NA 4BZ2H 2KDGA 5F9OL 2X4SB 3GBNH 3GMMA 2QKIB 3BMWA 4HIEB 2CXGA 2AK4A 3K1DA 5EBWA 5E00A 3L5JA 5BXFB 4R4BA 2BY1A 2F15A 5D4QA 4XB7A 5F1SA 5A16B 4APQB 4AEHH 2VXTH 2CK0L 3NH7H 2X4QA 3GMPB 4FQHA 4KJYA 2PW1B 1KTLB 3RY5A 2J6EA 4DZ8A 3AB0C 4KUZH 5TF1L 3AROA 4PJAA 4G8EB 1FGVH 1KCRH 1Z3GL 4H88H 4QXUH 1DL7L 1TLKA 4HXBH 2VL5A 5IVXE 4H1LG 1OD7A 1M7XA 5EG6C 5JNYA 1NFDA 3ARGA 3SO5A 1E6OL 5T5FL 1DBKL 4YHLL 3CFKB 3INUL 3QIUC 1I9JL 5FYJH 4JQIH 4GQ9L 2ZG1A 1CBVL 3SCMD 4I3RH 1UKSA 2CUHA 4ORZC 4P46D 1MQKH 5F3HA 2OX5A 5LAXB 4JJ5A 1AO7E 1BBDH 4EXPX 1QPXA 4OZGB 4KTEH 1S5HB 1RUQH 2NY0B 3W39B 1P7QB 3QWOA 4OF0A 5JIKA 1NGQH 1MCDA 1FLRH 3DUHA 1NGWA 1CVRA 2N1KA 5JXEC 5EOTA 2DL2A 3QG6A 3CDGB 3O41B 3DI2B 4JPIA 5ESVB 3GUTA 4R97B 4ZXBB 1LO0H 1BZ9A 3TN0A 1B4JH 2BNUA 2D0HA 3ULVD 3QJHB 3IF1B 2P5EE 4OQTH 4PG9B 4QF1A 1DUZB 2DL9A 1DUYA 2NW2B 2R1YA 3MLYH 2A6IA 4RQQA 4Z7VB 3WD5L 2V2WB 4JZJC 3V2AR 2WBJA 4P2RE 3EJYD 1K5NA 3TPKA 5EO0A 2YD1A 3LEXA 3GSXB 4NQSA 4JPKL 2X4TA 4F7TB 2JKXA 4HKXB 2DQDH 5I1HL 1TNNA 3K2UL 1HSAB 2HAZA 1FVEB 4HUWA 1AXSB 4ZFFA 4GG8A 4PJGB 2VXQH 4OZIB 3ARDB 2HT2C 4HLJA 5K33A 5LQBH 3L3JA 2CH8A 2YD3A 4N5ED 5HHXL 3V8OA 1OSZB 2R4RL 2YPKA 3OXSB 4S1RL 4PB9H 4WI6A 1OP3H 4I0PB 4P49A 3SDXB 5E7BA 4QOKA 3KYOB 5JZ7D 1OWRM 3ZHLA 4D94A 1JRHL 1VPOL 2ADJA 4XGZB 1Q8MA 4FXGB 3MYJB 3BZ4A 2C1OB 1RIHL 5KSBA 3P0VH 4HZAA 3U9PL 3ROOA 5L0QC 1F5WA 3QA3A 5IFAL 2Y07L 2EYTA 5K9JH 2EDKA 2WIIB 2HVKA 2C4FT 3EO0B 1FAKT 3C9NB 4PY8I 3VA6A 3S36L 2VN4A 1OTTD 2QJDA 4H8WC 3F7VA 4XTRD 5HJ3B 3RL1B 4HGWB 5IBTL 1FC1A 1RZGB 5FUOL 1AQDB 2X4UA 4FQXA 4HMCA 5E70A 2Z35A 5BCAA 4J4PC 4XAWH 2VQ1B 1WC7B 1TCRB 4WFGD 1HEZB 5IWLA 3SE9H 3ZTNH 1FSKB 4DEPC 4JE4B 3MRLA 5JOFB 5K9KB 3DHMA 5J06A 4G3YH 5GRUH 1AGEB 3MLRL 4OD1H 1JMZA 3MRGA 3WFHA 5CMAA 2EDFA 3VG9C 3L7FA 2AERT 1A6WL 3DXAA 4HWNA 5CSZA 1KIRB 2V9TA 4MDJB 5E24E 2C3GA 4ELME 5D1XC 3MRRB 1IT9L 4OB5L 3MBEB 2FECL 4IS6A 1VGEL 3OX8B 1H3GA 5F7EL 5IB4B 3SDAD 2GT9A 5E56A 4XCEB 1N0XH 2F54A 4X5WA 2CPCA 4G8IA 5H2BA 3ARUA 3ARFA 1UM5H 4L8BB 1P2CB 4KROB 3GDBA 2VDOL 2E7HA 3O4LA 4N0UA 5E8PA 3UTQA 3JWDC 2YXMA 4JN1H 5DS8B 5DVLA 3PV7A 3VGAC 1RZKC 2FJFA 3WO3B 1MCNA 3TIDB 4JFFD 1U42A 1WUNT 2RQ8A 5DUMH 1CI5A 3ABZA 5IB2B 4HX1A 3E6FA 3T0BA 4YC2C 3SKMA 2HG5B 2DYPB 5J6HA 3QCVH 4AEIL 2CDGB 4E5XA 4D0CA 3BQUC 4MSWA 4KAQH 3VXMA 2OR9H 4RA3A 2EDYA 4FA8A 2BNQB 1WJ3A 2E5EA 3LRHA 1HHIB 2G2RA 5D1QA 3U48A 1UZ6F 2CKBB 2AXGA 1BBJA 3OGOE 4TTDD 2BNRE 1GZQB 4MNQB 3DVIA 1ZLVK 5CD5C 3WNNA 4GAYA 5FKAA 4Q9RL 2ZUQB 3EZ8A 4M00A 4P2OD 4PRID 2J8UB 1A1MA 3NIGE 1G7JA 2H1PL 5D7KE 2VO5A 5T3ZE 4G8GA 2RJMA 2AV1B 4QHMA 4BH8B 3HE7D 1U3YA 3M17A 1T0NB 1ZKAA 4HMDA 3DBXB 1S8DB 2W9EH 3ILQC 4JFZH 3RA7L 4WUKL 1LEGA 4DVBB 2F74B 1JF1A 1AD9A 5ELIA 2OJZL 1DBMH 3V0WH 4Z7UF 3OKOA 3ULUL 3GKWH 5HYJD 2C4FU 4HCRL 5F3BB 3ME0A 3GHBL 1MCRA 5IMMB 4QYOA 4OCYH 1F42A 3QULA 3PWVA 5IFHL 3WJLA 3PWNB 4KJPD 1ZAGA 3WIIH 1UACL 5F6IC 4JY4A 4HPOH 3V6BR 2D7NA 3P9MB 4PY8J 4X9FA 1SY6L 5E5MA 3RDTA 5FYKH 1AR2A 3QIWD 1LEIA 5LGHL 1KACB 4MNHA 4P3CL 4X6CE 5HHMD 1F6AA 3I85A 4YXHH 2VOTA 4OCXH 1GSMA 3IXAA 2ZOLB 2LVCA 2HLAB 2L0DA 5DFVC 1OVZA 1DFBH 4X80L 1CLOH 1K2DA 2ZKHH 4X99B 1DLHB 4O9HH 5IW6A 4F7PB 1MCJA 4LCCB 2PR4L 3QDGB 5IVNA 4N5UA 4U1HA 3NZHL 3HZVA 1HYRC 1N5AA 3EYVB 2VDKL 4APQC 1YPZF 1ZVSA 3TYGL 4TN9A 3S7GA 4LSRL 1TITA 4JGMA 3RUGA 4KC3B 4U1SB 1LO3H 4GAGL 5KVEL 3FFCB 4I5BB 1X7QA 4KI5C 3GSOB 4PB0H 3HNVL 4CDHA 1H8OA 3JV5A 2X5PA 1N59A 3NCYS 5SWSE 1OT2A 3CFJA 5BQ7B 4PRPB 1HCVA 4HC1L 5F7NC 4PJ5B 5E2VL 4HUXA 4IRJD 4JCMA 1QA9A 1MCOH 5HYSB 3THMH 1T03L 1A2YA 1I9RL 3AXLB 5J7CC 4M7ZB 1L6XA 5CEYB 4Q9QH 2WUCL 1MRFL 5EN2A 1EX0A 4X5LA 1O0VA 3MFFB 1EFXB 2IQAA 3RWIB 3D85B 2BXZA 3QH3A 4KKCD 4F3FA 2AJ3A 1EEZA 4UIMA 3RVUD 1HILB 4IDJH 3DNKA 2W60B 5C0BB 3C08L 2NY0C 2IH3A 2F5AH 4KKBD 4G8FA 1A1NB 5F7YC 5JTWA 5F96H 2XWTA 1I7TA 1KG0A 1S7TB 4YHIA 5BO1L 4ZXBC 2D7PA 3QUZA 2PNDA 3TO2B 4U1LB 4Z7QE 4NKDB 5KSVA 3KR3H 3K8MA 3QEHB 4HDIA 1QHPA 3MJ8A 1Y0LA 1IGYB 4LAQH 5HVFB 1MHHB 1AO7D 4PLNC 2DICA 2CMRH 2RHEA 3CLFH 2A9NL 1QLEL 2ATKA 5TQ2L 4XPFL 4OCSL 2NZIA 2AEIT 1RJYA 3OAYH 4GW4B 2BJMH 3BD4A 5C9JB 5EOCH 5JQHC 1FVCB 5DJZB 5BOZG 1IM3B 4U6YA 4H20L 1RJZB 3Q5OA 1LP9F 1TZGL 4DN3H 4WIQA 3ARDC 3P11L 4CU6A 1TVHA 2IFFH 1PYWB 3WSQL 5FA4B 3FO1B 1WBZB 2EEDA 1INDL 3SDDB 3PGFH 1MQ8A 3X14B 2P5ED 4XVSH 1G0DA 4I0PC 1XGUA 2IGFL 3V79C 4TOYL 3SJVA 1U92A 3HG1E 2G9HB 4MJIB 2XA8L 3WLWD 4P2RD 2VLKA 1KTDB 3WNPA 5CD3B 4Z8FL 3WS3B 3AU1A 4FP8H 3BX7C 4LSVL 5B4MC 3KPTA 4R7DA 2ADIA 4MD4B 3GSVA 3OKYA 2NQCA 1REIA 1LD9B 2R15A 3L5IA 3MV9A 5J13B 3BP7B 3V5DB 3U36B 1MVUB 3G9VA 5GGQL 1XR9B 1K6QL 2ZSWA 3I84A 3JWOC 4M48L 5DA4A 1J0JA 3GKZA 3QT2A 1FH5L 4NNYB 1JNHA 3B9KB 1UXWB 3NA9L 5T3XH 1NCDH 3QI9A 3DECA 4YHNA 5H35B 5DZLA 1CG9B 1CLCA 2PYEA 3EOBA 4P4KA 1N5YL 2Z4QB 5L9DL 3OBAA 5GGTH 3MRQA 4W6XB 5HHNB 1CFTA 2DI7A 1R5IA 3CX5K 4RFEA 2WW8A 4E9LA 4NBZB 2CSPA 5SWQA 1MREL 3FB5B 3RZCA 1NEZA 5B38G 1IGIH 4MAYB 1MAML 3EJZD 43C9A 3VH8G 5DEGA 1YNTA 1L4IA 1F13A 1EA9C 3DGCR 5J6GB 1FYTB 1PX3A 3MBEC 2AABH 2VDNH 5DSCB 1NC2A 5DFTA 4YFEA 1QVOA 2MHAA 5CIPA 5D70H 5FM4A 3BN3B 5DMGC 3CDCA 3WFCH 2A1WH 4E41A 1G9MC 5D6CB 5DK2B 2YD8A 3RBGA 1NANI 5I76B 2VXSL 1N7ML 4DFIA 1R3HA 5CJQH 5FOBB 4UT7L 4AZ8A 1Q9OA 1S7UA 3DRQA 1VEPA 4KROC 1NBVH 4PRHB 2EDHA 3RKDD 1IAIM 4OZ4A 1FL6B 8FABA 3VFTA 2J4WL 1BFOB 4XPBL 5C09B 2AJSH 4WI5A 1YN6B 1YPZA 2CRIA 3G6JE 1HH6B 1V3JA 3ZE0E 3S4SG 5HYEA 5T1KA 5HI3D 1I8KB 3EYQC 2A6DA 3FO2B 3R1GL 5D5MA 4NKOB 3ARVA 5KS9A 4XXDB 2IAMD 3WHXB 4ORGB 4BSWB 1YNKH 4U05A 2UY6A 4NUGH 5HSFA 1XF2A 4JZOA 2DLEA 1F3DJ 5I8CA 1NLBL 1YMME 4ZTOL 4R26L 3U4BL 2ZUQC 4GBXC 1A6PA 2DQFB 3KLAA 3HC4H 1S7RB 5ADPH 2YPVL 1A0QH 2R2BA 4TSBL 2P42B 3LH2H 5JDJA 2EIEA 4DGYH 2DKUA 2AJXH 1GPOH 1OLLA 1Z2KA 3MRFA 4WFEE 4K94H 2GUOB 3S5LA 1U2CA 5FGCB 2HFGL 3L6FB 4LLQA 1RK1B 5CILH 5IVZA 3GMMB 1ZHBA 4HWUA 4OUUA 2AK4B 5EBWB 1NLDH 5L2KB 5E00B 2HFEA 2R9HD 4I13B 4CAGA 4R4BB 2BNRD 1JRHI 4JRWA 4RDQG 1IC7L 5BRZA 1H5BA 1TJGL 2X4QB 4YLQT 5J1TC 5D7KD 1KJMA 1G7LA 1KELL 4FQHB 1G7HA 4KJYB 5FA3A 4F8TA 1YDPA 5T3ZD 3QQ9D 4DZ8B 1JBJA 5GZOC 4PJAB 3CLEL 3OF6A 3C6SA 3OAZK 4UOJA 1MFEH 2VL5B 4NM4H 5TH2A 4M1DH 2AXJA 2WANA 2EH8L 5T1MA 5JNYB 1NFDB 3ARGB 1RPQA 3QCTH 2DB8A 1CGYA 1LILA 3HLAA 1KV3A 5L7XH 3QDMA 2H8PA 4FG6D 4MVBC 3SY0A 2HH0L 1N6UA 1T1XA 1EHNA 1YQVL 4HGMA 5F3HB 5GIRA 1QR4A 3GIZH 4JJ5B 4F2MA 3MLWL 5M95B 3PHOA 3R4DA 3ULUF 3QWOB 2IFGA 4FXKA 4NWTL 4MB4A 1NGWB 2FECI 5EOTB 1Z6JT 2P48B 3CU7A 1OTUD 3QG6B 5HGAA 4X7TA 4JPIB 3VXSA 5C7XL 3GUTB 4LHJB 3O6ML 1BZ9B 3TN0B 2R0KL 2BNUB 1EUTA 5J9PA 1MHPL 4LFHD 4ODHH 4DVRH 3QUXA 1UEYA 4QF1B 1DUYB 2R1YB 3KPMA 1GJIA 2A6IB 4RQQB 1MCHA 3W0WA 2I24N 2WBJB 4W70A 4M7ZC 4RFOH 2JJUA 4HFWA 1AXTL 1K5NB 4ZS6C 5EO0B 2BDNL 3LEXB 4NQSB 5SV4A 4G9FE 2X4TB 4FQJH 1CU4H 1GRWA 1YZZA 3GK8L 1YA5A 1AIFA 4WTZA 4HUWB 4G6AC 2XNAA 4ZFFB 1ZEAL 4GG8B 2EE9A 2ZUTA 5SWSD 3TT1L 2Y5EA 3L3JB 3VWJA 5J11B 1YYMH 1G7MA 4J12A 4GH7B 3KYAA 1YYLL 4ACPA 2YPKB 4HULB 1U3JA 4DZBA 4EBQH 3F7PC 3UDWA 1DBAH 3MPCA 4PJFF 4QOKB 2X6MA 1MFAH 4MS8D 4AYFA 5IKCA 3QHZH 4Y4HD 1YEEL 2ADJB 4P99A 1EEYA 1Z9MA 4L3CA 5KVFH 5EORL 1U8KA 3QO1A 3TGXA 3BZ4B 1BPVA 3VXOA 4FQIL 3QEGH 5KSBB 3W11C 5IIEA 5FECA 4PLKD 4TVPL 2O5YH 2AAVA 3CVIL 3ROOB 3QA3B 4CJ0A 2EYTB 1FJ1A 4OI7A 4LCWE 2HVKB 3MRIA 3IU4L 2C3WA 1JTPA 4FQ1H 5T3ZL 3MZTA 3F7VB 4GAFB 4KK5C 4Z7WF 1YEGL 4RISH 2VLRE 3IAPA 4C57C 4W4OA 2BFVL 4AL8L 1KEGH 2X4UB 3FZUC 4FQXB 3LEYH 2Z35B 4GMSL 1I3RA 3BGFB 5DEZA 4RAUA 5F1IA 1VHPA 4YHPA 1RIUH 5T5NG 3B2UD 1ZA6A 5IVOA 1MCWW 2ZCHH 1YECL 4BQCA 1VADA 1HNFA 3SCMA 3MRLB 3SDDC 4JHBA 4YDIH 5F7LB 1G1CA 3MRGB 1JIBA 4X6EA 3TCXA 3UYPA 2I5YL 2BRQA 3WFHB 5CMAB 3IDXL 3FKUS 3L7FB 1TDQA 5TE4L 3HE6D 3DXAB 4NZTH 2DD8H 2YD7A 5DK3A 1LK3H 5I1AA 5CSZB 5HPOA 3KNBA 1HOCA 3I50L 1U8OA 3RFZC 4LQFH 4X9BA 2DM3A 4G7YL 4ODSL 1G9NL 4IS6B 4MHHG 5J13C 4MQXD 2FX8L 3FQXA 1F3JB 2DTMH 2GT9B 1IAMA 3H9HA 4QWWD 4IRSD 3MA9L 2F19H 4NWUL 4X5WB 2F54B 2IADA 4O2FA 2QQKH 4G8IB 5H2BB 2DJSA 2GTWA 1I85A 3ARFB 3HG1D 2MKLC 3O4LB 4N0UB 5E8PB 3UTQB 4XC3H 4DTGL 3LB6D 3D39A 3HB3D 4WWKC 3QFJA 2FJFB 5DA0B 4K71B 1E27A 4XCNA 5CJ5A 1DVFC 2NXZB 4HX1B 5C6TL 3E6FB 4XP5H 3MOBH 5DD5H 3DV6A 2H2SC 3SKMB 4ERSH 1D6VL 5J6HB 4MAYC 4J3SA 1DSFL 1HHJA 1TCMA 4E5XB 4D0CB 3K4AA 5GS0H 3RGVD 5CIPH 4MSWB 3U30B 2H9GA 4LSSH 4N0YH 3VXMB 4CADA 5I1DA 1O7SA 1N8ZA 3EHBD 5TE6H 1JPST 1DZBA 5HGBA 4EUPA 3TBTA 2G2RB 1OAYL 4NFCA 5D1QB 4KU1A 2AXGB 1BBJB 1TIUA 4PFEA 1X5JA 3MLZL 4GAYB 5FKAB 3K1KC 1AR1C 1EVTC 4JY5H 1AC6A 3U7WH 1A1MB 4OI9A 3FN0L 1G7JB 5SX4I 4P5TA 4MAUH 2MPAL 4G8GB 1MAKA 2DDQL 4KHXH 2JCCF 4QHMB 2VR5A 4YEFA 1XF3A 4HK3J 3F6LA 3RX5A 3M17B 4HZLA 4JO2H 4K3HA 2JK5A 4Y4FD 1LEGB 1JF1B 1AD9B 4BK4A 1A6UH 4JHWL 1YUHA 4HCRA 3OKOB 5CJOH 4OM0L 1C5CH 1KCSH 2NNAA 4QYOB 1GGIH 1J10A 1GGUA 3QULB 3PWVB 4FNLL 1CL7L 4CKVX 4FS0A 3OZ9L 3DV4A 5IBLD 2YA2A 3UROR 3V7AG 4JY4B 4QCIA 4TQEL 1A7QL 1D5BA 5MENE 3LDBB 5E5MB 3LSOA 3NFNA 4ONFL 3RDTB 4PGZA 3I02A 5BS0E 1VFUA 5D2LE 1LEIB 4MNHB 3JVGC 3LY6A 2CK0H 1F6AB 5ITFA 3T3PE 1MNUL 3IXAB 1MFNA 3SDAA 2APTA 1EXUA 1U2HA 3EW3B 5F21B 1K2DB 5IW6B 3QUYC 3V6ZA 4EVNA 3P0GB 2XTJE 4ISVA 4K7PX 4NQEE 2OJEA 1DL7H 3N50A 1YMMD 3MX0A 5C8JA 4DJMA 2VC2L 2VDPH 4U1HB 4HIHA 3HZVB 1N5AB 2P5WD 1ZVSB 2WLZA 3L3OA 3PGCA 4X6DA 3RUGB 1NC4D 4JFFA 1X7QB 4M9OA 3CSBA 5DFWH 4K3GA 4WFED 5AWNL 3NFSH 4HC1A 1N59B 3MACH 4OZFA 3IRZA 4NGHH 1GGCL 3CFJB 4XNXL 4PG2A 4HUXB 2WAHA 4ONGL 3RX8A 1QA9B 2P45B 1LO4L 3ARGC 2D0GA 4PYHA 1A2YB 3MRBA 4M5YL 3V95A 3TJHC 5EN2B 1UGNA 3DSNA 5C0NC 4K8RL 2R39A 5F8QC 4P5MA 5D7SL 1LK2A 2J3SA 2QQLH 1NSNL 3HI5L 2IQAB 2DLIA 2VQUA 3PWJA 5JPNA 4DGIL 1AQKL 2VLLA 3QH3B 4F3FB 2AJ3B 4OM1L 1EEZB 3RAJH 2Q86A 4RIRA 2QSQA 4UIMB 2WP3T 1JCKA 1PG7X 1KN2L 1U93A 1UG9A 2IH3B 4GAJH 3HE7A 4G8FB 4WI2A 5I16A 3ZDZF 2XWTB 1F97A 1PLGH 1LMKA 1I1YA 4QRSA 5I1LA 1I7TB 1KG0B 4YHIB 3QUZB 1FL5A 3BUTA 5HYJA 5KSVB 4HDIB 3GBMH 3MJ8B 1Y0LB 1JVKA 4PD4K 4UQ2A 1JNLH 5ICZA 4RWYL 2LU4A 5JPMA 4UV7H 4ETQA 3WKNA 4IOSD 1RMFL 2ATKB 2WBJC 4M43L 2XKSA 1RJYB 3BAEL 4GO6B 4NBYB 3NVQA 3ZDYE 4U6YB 5HHQA 5DMIH 4WCYH 5MI0B 4F8QA 1TVHB 1RUKL 1QO3A 2WIMA 5TGBA 4PJXE 3UYOD 3D48R 3TVMA 1J11A 5J11C 5LBSH 4F9LA 4ESKA 2DBLL 4PJIF 5EOQL 1XGUB 5A2LH 4LPXA 1U92B 5SWZE 1W0WA 1BQSA 3P30L 4QNPE 3CU1A 4UT9L 2XY1A 1OP3K 4G9FD 4L29A 5FUOH 2OSLA 3AU1B 3L1OL 2ZNXA 4R7DB 5C2UB 3FONA 3MLUH 2ADIB 3KLHC 3GSVB 3MV9B 5IW3A 3TWCL 3E8UH 3T0DA 2R56H 1GGYA 5LVEA 3BPOC 2ZSWB 1FORH 5HVGB 3ZYOA 1JNHB 2VDLH 3CXHK 4IRJA 3MROA 1U6AH 3QI9B 4YHNB 2BCKA 4L5FH 1A6WH 5E6IC 5C70A 1KCLA 1SVCP 2PYEB 3EOBB 4W6YB 2D31A 4P4KB 2XZAL 2Y36H 3L3DA 4HJ0D 5IWLC 1TJIH 3MRQB 1CFTB 3BGAA 1R5IB 4Q9BA 3CD4A 4RFEB 3P0YL 5IP4A 5EZJA 3UTTE 1PW3A 5GJSL 3WLBA 5SWQB 4HFUH 3RZCB 1NEZB 3F12A 4LCWD 1CK0L 5E9DE 3I6LE 43C9B 4PY7A 5DEGB 4L8CA 3GRWH 1XGRA 2VLRD 1I9IH 1YNTB 2YSSA 5IVXA 3SDCD 1YNLL 1JHKL 5F89A 3QWQB 3ULVH 3DVNA 1NC2B 4XHJC 1QVOB 4C56E 2MHAB 3Q48A 5CIPB 4YBQD 1HN1A 4E41B 3MR9A 3H2WA 1CD8A 5F44A 4MQ7A 1R3HB 1QZ1A 3ARFC 2SEBA 1Q9OB 1S7UB 3DRQB 1VB9A 4HKJA 1AO7A 1RUPL 4OZ4B 1T1WA 3PL6D 3EGSA 2MCPL 8FABB 3L9RA 3VFTB 4NIKB 1MCPH 4UT6H 1KCUL 3EYOA 4K71C 3DYMA 1JGDA 1J7VR 2B1AH 2NXZC 1IAIL 1ERNA 1YPZB 4EUPH 1TZHA 4OIBA 5T1KB 2A6DB 2LU3A 5D5MB 4I18C 1R24A 1U36A 5KS9B 4LEXH 2K7PA 4PJ8D 5FO8A 1XF2B 4JZOB 5JIIA 5F1NA 1RAMA 3U2SA 5I8CB 1IZKA 3HZKA 3RJQB 3T09A 3RA7H 4P2RA 4BJLA 4GXVH 5AEAA 3KLAB 4I48A 1QBMH 2OJZH 2R2BB 4ZO9A 12E8L 2EDNA 3DYOA 3PABA 1NCWH 5DRNA 3BKYH 5CZVH 3MRFB 5C2BH 1FZOA 2KZ1B 4C4KO 5E0QA 3S5LB 1OAKL 4LLQB 5D7JD 5IVZB 1YEIH 2Z8SA 2NY1B 1ZHBB 2I60H 4OUUB 4RWHA 3OHXA 1NKRA 4FZEL 2HFEB 1WBXA 2WZPD 2E9JA 4K94C 5BRZB 2Z93A 1U8NA 1ACYL 1H5BB 2HP4A 1MJUH 4OF6A 5LGHH 3UMTA 1GXEA 2VLJD 1G7LB 1KJMB 4NDMA 1G7HB 5FA3B 3S34H 1B4RA 1YDPB 2AK1H 2E6JA 3WJLC 2FX7H 2A0LC 3VI4E 1MIEL 3U0TA 2HT4C 3O6LL 3D25A 1A7RH 1IGML 1N4XL 3C6SB 3IFNL 1E28A 4OFDA 5TH2B 4KMTL 3LDBC 3PDOA 2FEDD 2ZWLT 1RURH 1RJCA 5T1MB 1CGWA 4FQCL 3CVHH 4EIGB 1ORSA 4NNXA 5IESH 2JTDA 4PTUA 5I1IH 3HLAB 4ZOAA 4BUGA 4LSPL 1KJ3L 3QDMB 1XGPA 2H8PB 5KVEH 2FH6A 3NCEB 5CZXD 3SY0B 1NMBH 1SBSL 5FM5O 4JZNA 1T1XB 4S1DC 1P5VA 1QFWH 5GS2D 3X17A 5GIRB 2Z0BA 1RQ5A 3QQ3A 3WFBL 4JM2F 4A2LA 4F2MB 5DJCA 1JNNL 1LO2H 2QV2A 5MEND 2X41A 3E2HB 4J6RH 2KUTA 4YZFF 2XY2A 3FRUA 4FXKB 3RVTC 2D4DA 4ELMA 2Q76A 4MD0A 1AHWC 2WUCH 4H1LA 4Z9KB 5AZ2H 5HGAB 4UB0L 4X7TB 4MLIA 3VXSB 4OD3H 5ESQA 3B9DA 4D9LH 4Z95L 2W92A 1QYGH 5J9PB 2GJZA 2IAMA 5IUSA 3MLXL 3JSSA 3QG7L 4YEEA 4NPYA 2XTJD 3QUXB 4NQED 2B4CL 4Z0XA 4L4VA 1ZLSL 3KPMB 3UPAA 3W0WB 4PYGA 1CXEA 1JGLH 1M05A 2P4AB