5FYJD

Crystal structure at 3.4 a resolution of fully glycosylated hiv-1 clade g x1193.c1 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122, 35o22 and vrc01
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
242
structure length
242
Chain Sequence
QGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B and G
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords GP41 ENV ECTODOMAIN
total genus 36
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fyjD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fyjD01
1ONQB 1KB5B 3ZT6A 1WZMA 3AM8A 3L1OH 4V1DE 3HR5A 4XPAH 5B39B 5CCKL 4G6AC 1HZHH 1L0XA 4ODVH 1QVOA 5IMLB 1UYWL 2XTJD 4YPJA 5J6HB 2D7QA 5C0DB 5GQBA 4XZUA 4Y19D 1N3NA 1BFTA 1JWMB 3WXWH 4ELKB 4LVNC 4FXKA 2FIRT 1F4YH 1G6VK 4NZRH 3FONA 3O41B 4X6FB 1AXTL 3MZTA 3MRNA 1XGRA 3K7UA 3WO4C 1BX2B 5D1QA 1YNTB 3BGFB 2I9LA 4KFZC 4LKXB 4UOJA 1MCPH 4JE4B 4UU9A 4BUHA 3ARGC 4ZUVA 4JFHE 1HHKA 4GAGL 3D69B 4KVCH 1LNUB 5CEYB 5FGCE 3QAZB 4O2EA 2CO7B 1FYTB 5HDBF 3H9SA 3FN0H 5IQ9B 2MTPA 4NKIL 5GRVL 2HJLA 4JRYE 4HUXA 4L4TB 1HINH 3CUPA 1E28A 4FFWC 4MA3B 2HN7A 1P84K 3O45B 3Q2CA 3K8KA 5L2KD 3LEVH 2CRMA 4BFBD 4D9RD 3WFHA 3WNPA 5LGHL 4OF3A 3H9HA 2XWBB 3O4OB 4WGWB 3RWGA 1T4KB 3GMPA 5CLTA 3WS6C 4QCIA 4KDTA 4Z7WB 2ZP0T 5EIIB 2XTJE 4P4KC 2DLIA 4XNUL 1NMAL 5GGUB 1RZJC 1O0VA 2FD6H 5AWNL 1G7LB 2CGRL 5GISL 1MAJA 1E27A 4KVNH 5C7XH 4LASH 3P4OB 4Z8FH 4JN2A 3P73B 43C9A 5C0GB 1J8HB 1ZT1B 3Q0HA 4RX4A 1EEQA 4NOFA 4X5WB 3VGBA 1EJOH 4AM0B 3VMNA 2K7QA 2COQA 4HKZB 3TJHD 4YR6B 3NIGF 5EZOH 4YIQA 1BZ7B 5E2TH 3KYKH 2D7PA 1IM3B 1AGBA 2DI7A 3HA0A 3IB4A 1YDPB 1I7UB 1N4XH 2F54A 4Y5YB 4RMRA 2QQLH 5EOCJ 5CEXB 5I1KL 3GK8H 3EYFA 3HE6C 5A2KH 5JA8B 3JTSB 4XWGH 3U2SA 4YFLF 1LP9A 4YLQT 4LGPB 4I0PA 1KENL 2BY3A 3EDJA 1XCTA 3VE0A 1HQ4B 4OSUH 5M94B 2FO4A 5B39G 2O5XL 1FVDB 2AV7B 5JW5B 1LK2A 3VXPB 3ZE0E 5L2KB 4M9PA 2A73B 5FCSH 2AV1A 4WO4D 1UENA 4EJ1C 1TETL 1MCQA 4X6FA 4QRRB 3ARSA 1QFPA 4XP6L 1OPGH 2EECA 3NFNA 2IFFH 4XZUB 3VXRE 4RX4D 1EUTA 2MKLC 5DJ0B 1ZHKA 2V7NB 2Y25A 1DQJA 4LVOC 5JOPD 4U1IB 2VZTA 1NC4D 3MODL 3IU4L 1UGNA 3G6JF 3SE4A 1MHEA 1QFWI 3HR5B 2KZWA 1YPZF 1KB5A 5B4MD 4UMGA 5T5NF 5TE4H 5EU7C 5D6DA 5C0EB 2V2TB 2WK2A 1KLGB 2CJUH 4NCC2 1OHQA 5J9PA 1IEAA 1ZAGA 3SKOB 1FL6B 1CFSA 2PTTB 2Q8AL 1FFQA 4TSCH 6FABL 3I6GA 4W70A 1GOGA 4ONGH 4ZAKB 3I50H 5J89A 3O3BA 5INCA 3OKOA 3SKNA 5DEFB 3BP7B 1D6VL 1DBAH 5HVHB 1GIGH 5IHUH 1SYSA 4M5ZL 3ULSB 3DX6A 3U0TB 1OLZA 2Z8WC 3W81A 1BFSA 3I50L 3SKNB 5IMKA 4TSCL 1OAXH 1K8DA 5TQ0L 1YY8A 1KJ2H 2X4NB 3GGWA 4MD5B 3CSPA 1R3LA 1JGUH 5D7KD 3I75A 5DLML 1NFDF 3TCLA 1XIWD 4L5FL 1DBJH 5LAXA 5DQJB 4PR5A 5FV1L 3TGXA 3DGCR 3CFIC 1CDIA 2QHRL 4MD0A 3JWOH 5IB1B 3MJ9H 4RISL 1X5LA 1S7WA 4XCNB 5JDSA 5L8LB 4GAYB 4HLZH 4ZO9A 4JKWA 4WHDA 3W5NA 4KU1A 3K46A 1RZGA 5CMAB 2N56A 1QSEE 1A1OA 4JZNB 1DQJB 4MAYD 2DYPA 5E2WH 1EEUA 1LD9B 2VITA 3KLSA 4CMMB 1BEYH 4GG6A 2VLRA 4XP5H 3S37X 4NQDB 3SDAA 4ODSH 1CR9L 2DQTL 1YUHA 3U46B 2QKIB 2AQ1A 2IPTL 3CU7A 3VXTA 2R39A 3I6LE 4LSUH 4PRPB 5DQ9A 1HEZB 5BO1L 2DQIH 1XF4A 2R23A 4LMQE 5SWSB 4IIQB 3CVHH 1P9MC 1KJ3L 1JV5B 1K4DA 2CUIA 3U9PH 5KN5A 5MEOA 2X4TB 5J3HC 1VACA 2UWEF 1CFNA 1NBZB 1LDPH 4KJQC 2GY5A 3TZVA 1KTRL 4ZSOB 5LXGH 1F6FB 1U93B 2P8MB 2LV4A 1V7NL 3W9DA 1BWWA 1SMAA 1UG9A 4JLRA 4GJTB 4F15C 4ZMAT 4NNXA 1ZA6A 5HHPB 4E0RB 3KJ6L 1II4E 1EJOL 1EHAA 1CICB 1EVTC 4AM0A 4M8QA 2PO6B 1VACB 4QF1A 3DI3B 4LASL 3MV9D 4HWUA 5I18H 2A6JB 3OSKA 1YEFH 4FS0A 3QO1B 4MNQB 3GJFH 1GVIA 4OB5L 2YC1A 1HEZA 4XNUH 3U7WL 2IANB 2QADB 3ULVF 5D7JC 5JZ7D 1ZWIA 2ITDA 3L7EB 4LMQI 5DK3A 1D6EB 4JFDD 1UACH 2WWMC 4OLXH 4X7FC 5KOVC 3MROB 2OYPA 3SO3B 4I48B 5LGHH 4MD4A 1T1WA 5CWSA 4ONOA 1GL4B 1F4WL 3D0LB 2Y1VA 1RZKC 4KK9C 5I1DB 3E6FB 5JMOC 2D9CA 1PBYA 3MA9L 3CX2A 4HGWB 4G6FB 5JHDA 1FIGH 4L4VB 3HB3D 1U58B 4WUUE 2NZ9C 4YXHH 1I8MB 3BPLB 1OAQL 3S96B 3SDDD 5CCKH 2JJTA 3OKKA 3STLA 1J87A 4AT6A 1VGKB 3A67H 3W11C 5HVHC 1AJ7H 1HHKB 4MD0B 5IUSA 1ZA3B 1EMTH 1HI6B 3ABZA 3MOBH 1JPSL 3QUMH 5F96L 3QPQC 2I9LB 4XNZB 1J10A 1AXTH 1JTTA 3ARDC 1F4YL 1AR2A 1CTNA 1C7SA 3DXAE 3PHSA 4QRSA 4Y2DC 2XRAL 2DBJA 2X4NA 1JWMA 2AGJL 3MXVH 1JZ2A 3PWUB 4M3JA 1MFCL 5CGYD 1TTUA 3FRUB 4HX1B 4FABL 5L7XL 4JFDE 3QFJA 1SYSB 1BVKA 4OGYH 1T04A 2A77L 1L7TH 3MRBB 3VDCA 4MNQD 3T65A 4K3EL 4Y19B 1U8MB 4ESKA 1N6QL 4F9LA 1KPUB 3LN9A 4MDJA 3RVUC 4XHJD 1TVHB 2JB6B 2Q87A 5IB2A 5GS2H 2ARWA 3VI3F 5L9DH 3WIIL 3WIHL 1P7QD 4I3RH 2XTJC 3NA9H 1YEDA 3G04A 3F7VA 5I8EB 4MZ2A 3PUCA 1KSRA 5T3ZE 5JNYA 5C0RH 3U1SL 4AK1A 3IU3A 4YNYA 2AJXH 3AROA 1CGXA 2XZAL 3S3PA 4WW2F 1CGVA 5D5ME 3N9GH 3PV6A 5FEBA 5CD3B 3PG2A 3QT2A 2DAVA 4JFOB 1S5HB 3QHTC 4F80A 2AJXL 4JFPB 2IPKB 4JCLA 5C0IB 4H8WH 3TIEB 3GMMA 3VD7A 1I8IA 4K23H 3L3JB 3QCTH 4NT6A 3ROOB 2AI0H 4NSKA 4XBGB 4KV5E 3AVEA 4FQXB 1AO7A 5CZVL 1FBIH 4B7LA 3M8OL 4NHUA 5DRNA 2X40A 3GI9H 5JW5A 3H7BB 2X1QA 1MH5A 4JPKL 4MNQE 4J3TA 2FIKB 2Y4SA 3K0WA 5DRZB 3C87A 1R3HA 2V7HA 5F9OL 4K3EH 1R5VB 2X70B 3U83A 1IGCL 1ZT7B 1ZHNA 4BQBA 2X89D 2DI8A 1BOGA 4BJLA 1ZGLA 1I3RB 3CMOH 4XBEL 1RURH 2UWEB 4ONFH 4P99A 4R2GB 5CBAB 1GGUA 2B39A 1UWXH 3X11A 1CXIA 2NNAB 2NTSP 1J1PL 3EYVA 2EXYD 4LIQE 4ACPA 3TWCL 2ZUVA 5KZCD 4TRPH 4OFDA 1QBAA 3MACH 3UBXB 3EO0A 4HKZA 4LCCA 4WVRA 1CGWA 1PW3A 4P3DA 5C6PB 3LKPB 3A67L 1ZT1A 3GI9L 3MNZA 5BVJB 3P73A 3VJ6A 2FATH 4N0YH 2VISB 1MCWM 4LCUA 4NBZB 3F62A 1MOEA 3O8XD 4HXAH 1E27B 4QTHB 2YUWA 1B2WL 3F65A 5FUCC 5C07A 4X9HA 1Y18B 4KY1H 3U0WL 1U3HA 3S9DB 2XXMB 5HTSA 1GZPA 5I30L 4B7IA 2C3XA 3QXAA 4PJXE 2NW2B 1W0VA 3HC4L 5I1IL 3LN5A 4CW1B 1BBDL 1Z9MA 5JPMA 4JREC 2C7UA 1TJIL 4QXTB 1FH5L 3SKJH 2OJEB 3VFPA 3EBAA 4PG9A 3RU8H 2ZUTA 2AJUH 3BKYH 3FOLA 4OQTL 4LSTL 2VC2L 4R4FL 5MI0B 5DSCA 3CSBA 5CEZH 4LLWA 1QSFD 2NMSA 3EFFA 2C3HA 3GSVB 2BY1A 1DQDH 4IM8A 4LAQH 5CZXC 2SEBA 3RWJA 3VFVA 1NUDA 2YWZA 3VXOA 4I3GA 4UU9B 4WRLA 3VG0L 5L2JB 3AAZB 3BUYB 4OGYL 2GK0A 5CJOL 5IF0A 4R2GC 1JK8A 3QJFB 7FABL 1BX2A 5D1QB 4FABH 3TO4B 1FPTH 3PP4H 2IQAB 4ELKA 1UXWB 3ARBB 4JQIH 4APQA 4NNYB 3U9PL 3QUML 5FYJL 3IKCB 1IGYA 1E4WH 2DL9A 1SJVA 1QO3B 4KI1A 3DO3A 3NPSB 4KGJA 3PP3H 4EQ3A 4A2MA 5DMGD 2EDKA 2DQTH 3Q6GL 4RRPG 2A2QT 4NBXB 1DBML 2EDDA 2VTFA 5HGBA 4POYA 2FECL 2HAZA 3BIKB 5DI8A 3FB8B 4YHPB 4R7NB 3K80A 1I9IL 3VGHA 3HCVA 1AI1L 2FX8L 2DRUA 2HTKC 4LU5L 3BIKA 5DI8B 2WANA 1JWUA 1QEWB 2FBOJ 2OMNA 4HJ0C 2J5LB 4OLXL 3CCHB 3LN4A 2ED9A 4OZFA 3PDDA 5GZNC 4ETYA 4PRHE 1OD7A 4M6ML 3E3QE 3MRCB 1MEXH 2CDEA 5HYIA 2QHRH 1S9WA 4Q0XH 2GCYB 4L29B 3BQUB 5IVNA 5EU4B 5HGHB 1DBJL 3AXLA 5D93B 1RULL 2HVKA 1QSFA 1YEIL 2EE3A 3E8UH 4FQPA 1A6UH 3SJVD 2ED8A 1N8ZA 3ARBA 3TA3C 5C09A 1JGEA 2IQAA 3U82B 5EB9A 1W0YT 5ESVB 2Q76B 3KG5A 2HJFA 5B21A 3OKDB 1FNSH 4GKOA 2XN9E 1G7PB 4LVOB 5E6IB 3OV6A 5KSAB 5LXGL 1G9ML 3CC5B 1WT5A 1U41A 1G7IA 1S9YB 2DLGA 3OG6B 2NY4B 4KMQA 5BQ7A 2EDNA 4P2QE 3QQNA 4HIJB 1KEML 1CDJA 3QIUB 4PRID 4JFEB 1OVZA 4IDLA 3BSZL 2JB5H 1F97A 4PRNA 3I3DA 2R2HA 1QLEL 1YECH 2DQIL 4Y4KB 1MCFA 5I74C 1RAMA 2GEEA 3GBML 4HEPG 4UDTA 5TE4L 2C7UB 2J8OA 3QUXB 4PYHA 3P0YL 5GS0L 1SBBA 3E3QC 2CIIA 5B22A 4IJ3B 3H7LA 3QXAB 3RFZC 5EC2A 4KHTH 3ARED 4H1LB 1FGNL 2XTJB 2HLAA 3MLUH 1EBPA 1XF2B 2AK1H 2NY4C 1J9CT 4BH7B 4E5XB 5IB4B 5E2WL 2EH7H 2WBJD 3F7YA 4N0UB 1Y18A 2PYEE 3NCJL 2E7CA 5FYLH 2VXUH 2ZUUA 5CSZB 3M45A 4PLKC 5HHOE 1I7ZB 1FGNH 3OKYA 5J57B 4U1SA 1YEJH 3T1FA 3OG4B 4G3YH 3T0EA 1JZ6A 2IEPA 5H8DA 3LSOB 4M7ZB 3KPRE 4MWFA 2UZYB 3QWRD 1NUFA 5SV4A 4JO4H 3GMOB 4KK8D 1LO3L 1HHIA 1YYLH 2MNUA 4XC3H 3T4YA 3U4BH 1MPAL 3R1GH 4OUUA 3QPXH 4KHXL 1JUFA 1XMWA 4OZGB 2MKWA 2XPGB 3TBTB 1GGBL 3TJHC 1AGEB 4U4BA 3KYKL 2CXGA 1QR1A 3OHXA 4D8PB 1BFOA 1WBXB 4M48H 5AZ2H 1SBSH 1ZHBB 3IS0X 1DLFL 3IDGA 4KPHL 1J0JA 3RHWF 5IHBA 4QHUA 2R69L 1MF2H 4NWTH 2VDPL 4HUVB 3HE7B 3PNWA 3NGBB 4AIZB 3IDIB 1AO7B 4YZFE 4ZXBA 1BJ1H 3T2NH 2BNQE 4XBGA 4KJWD 4GG8B 3WS3A 1J0YA 4N8VG 2VMFA 4QTIH 2IAMD 5GISH 4RAVB 4L3CA 1QPPA 3LZFL 1XT5A 2FD6L 3ARDD 4JANA 4MSWA 3N50A 5C3LD 1D5MA 3LV3B 2DWEB 5GRUL 4JRYD 2MMXA 4OLVH 3OXRA 1WSST 4DEPB 5CD3A 1JHLL 4WWKB 3PL6B 1TCMA 3SGKA 2F5AH 4GW1B 3R4DA 2IGFL 1XR9A 5ISZB 1I3UA 4UINH 3GMNB 4XP9L 5ICZA 1A7NL 2HT3D 3TO4C 3MA7A 5DR5H 4MJID 3VXMD 1YPZE 4P3CH 5CJQL 5T5FL 4R0LA 5IB2B 1YNKL 4PJ8D 5F7NC 5H2BA 3B2UC 2FYYB 3MXWH 4NUGH 4WI8A 4ODWA 1UXSA 3GHEH 4OFKA 4H0IA 4GAGH 1U8MA 1FJ1A 2PETA 1GAFH 4OIBA 1NAMB 5TJWK 4J1UA 5T3ZL 2X41A 1EEYA 5AYQA 1VADB 2DJUA 5DJ8B 1Z5LB 4JDVB 4NOBA 3GK8L 3BHBA 3MFGB 2IF7A 1FG9C 4KC3B 2WWKO 1PAMA 4NQEB 1QTYT 3UTTE 3U0PB 3QUKA 3C08H 4MA8L 1KJVA 1UB5A 3PIQA 4PV9B 1N5AB 3RNKB 5I1GH 1H5BA 2CDGA 4NQVB 3WJLC 2X4UB 4L8SC 1SM3L 5EZOL 5E9DB 5F70A 5IFHL 4HZLA 1RJYB 3GJFA 3QUXC 3ARFD 3SGJA 5D9SA 2NXYD 4GRLD 1DQLL 1CD1A 5K9OA 3QRFM 3U6RA 1T89C 4NQEE 1D5IH 2QLVB 1Q72L 4WUKL 5C08E 2VC2H 4R4FH 5AWNH 4GKNB 3BKYL 2NY3B 1B6DA 2R4SL 4PJBE 3FB7B 2YKLH 3DMMC 3WFEL 4QNPE 4M61B 4JPVH 2WP3O 2FB4L 4NCC1 5MP6H 2AW2A 3MRFB 4I48A 3B9KA 4MJIB 2R9HC 3LKRB 3HS0B 5I30H 2DQFB 4RIRA 4OCWL 3A6CL 1MRFH 5ITFB 1CQYA 1R3JA 3O6KH 4YHYB 2GAZA 4PJ5A 1KB9J 4RFNB 4QHMB 1GGTA 3C8KA 5D2NB 3O2DA 4LP5A 1A7OL 3KXFA 4U6XA 3TF7C 4X5XB 2AJSH 1PEWA 3RDTA 4M8QB 3RY6C 5ADPH 4H1LH 3UZQA 3MRIA 1I1FB 3HR6A 3MV7B 4MNHA 1JNLH 3RJDA 4LRIC 2DQUL 4MQSB 1P2CB 3TIDB 1OT2A 3IFLL 3K1DA 4K8RC 4PD4K 2OLDA 5EDXA 4HKBB 5GGVL 4PRBB 2AXFB 2EE2A 4MQ7B 4P49A 1IGJA 5HHMD 4ONFL 1CFNB 4AL8L 1G7MB 1RURL 1MFAH 2HKFH 1WAAF 3K74B 3TVMA 5KN5B 4YHNA 5E94B 1L9MA 3DGGA 2Y5EA 4ODVL 3V0VB 3RJQB 5JQ6L 4N9GB 2ICEA 3OKEB 4HS3B 1ZSDB 3GJFK 2C3VA 4XPAL 1A2YB 5IKCA 4PRPA 3BDXA 5DQ9B 1P1ZB 2EDBA 3KNBB 4LSRL 1E4XL 3O81A 4HPOH 3N0PB 4LRNH 3QEHA 1SQ2N 4EVNA 2ZCKL 3HTLX 1KCKA 1P4BL 5LGJB 5HYEA 3ARFA 4YXKH 3KYNB 3HC3H 4FFZH 3BN3B 5IVXA 3ARZA 4DUVA 3O6FC 1TENA 4R4BB 1NGPH 4U3XA 1BIIB 4NNPL 2BVTA 1TIUA 1RZFL 3DRQB 1TZHA 2RAMA 1CL7L 4G6KH 4K94L 5DJ2B 3QEQB 4OGXL 1XFPA 4MZ3A 1WLHA 1C5CL 1BF2A 1R3KA 2PR4L 3ZKQD 3U1SH 3MJGX 4BQ8A 4TUOA 5F8QC 2DBLH 2DJSA 3BD3A 4XNZC 2BXYA 3ZT5A 3WIFB 5LAXB 5I76B 4UQ3A 4XNMA 3CVIH 4P46C 3I75B 2ZNWA 2CKBH 2LU4A 4OZHF 4GBXA 1H3WM 2FJHB 4O58L 5I1CH 2RFXB 1HXMA 2VXQH 2ZSWA 5IBLD 4WTWA 4XPBH 1DVFA 1ZOXA 4PJFA 5IMKB 4X6CE 2ZNXA 1UZ8B 2MPAL 2NLJA 3KYAA 3SCMB 3MYZA 5K9QG 2B4CH 4DVBB 4PGBA 3KPNB 4OIIL 4UT9H 4H26B 4BZ2L 3K2MC 1UH4A 1MFCH 3SO5A 3MXVL 3V95A 2PTTA 4G43B 3EFDL 3FO0L 1I1YA 2VZSA 4MJ6B 1U3HC 3ARBD 4PJIF 2ARJB 2VXQL 3D6GA 3GKWH 3MUHL 3TT3H 4X8JB 2BRQA 5F88B 1X5JA 3U4EB 3ARFB 5GSRA 3FFDB 5TQ2H 5IMOB 4PYGA 3TA3A 1ZT4B 5DURD 3CU1A 1OSPL 2DBLL 2X1XR 4NP4L 4F7EA 3CVHA 4HFUH 5HHNA 4H20L 3U9UA 3WDHA 4DOHE 3FO1B 2AK4A 5GJTL 5EZJB 5A1AA 3LKQA 1NC4A 3CPLB 3HAEA 2JELH 4NIKB 3ZTJG 3VH8A 4K9EH 3MV11 3HG1B 1A3LH 3CFJB 3NFNB 5I2IA 3HZYB 3SY0B 1F4WH 1RUPH 4TTDD 5KSBE 4DN4L 2IFGA 5ID1A 4C56B 3DECA 4GRLB 3VXQA 1MCEA 1MRCH 4KV5F 4YDIL 1UM5L 35C8H 4HSQA 5IROC 5EA0H 1A1NA 1QFUH 5BXFB 3T3ME 4OB5H 3B5HA 4X6DE 1Z3GH 3EYFB 2WV3A 4NKDB 4NWUH 1A6ZA 2ADJA 3BH9B 4X80L 3C8KB 2B8OT 1PYWB 3UX9B 4PJAE 1ZVSA 2R2EA 1NMCB 4UUJB 3BDYH 1ADQA 2HKFL 5DEGB 1AGBB 3P77B 3R0NA 5HPMB 4Q9RL 1O5DT 3MJ7B 4QRUA 2DMCA 5I1LB 2FZ3A 4KROC 4CADA 1JTOA 1FLRH 1GXEA 4G9FB 3MLSL 4PGZA 4YDJB 3TLRA 1Z0MA 5I1LA 4X6DB 3MJ7A 4Z18A 3QA3B 4LPXA 3G5VA 1RUAL 2DQUH 4DCQB 1W72A 1FZJA 1J88A 3EO1A 4PGDB 4F3FB 2A74A 4WHTA 1QR4A 1J1OL 2Y36L 2H9GB 2GQHA 1NDMB 2EKJA 1KJ3H 4PY8J 2FECI 3P0GB 1IT9H 2EYRB 4XPHL 2EC9T 3CLEH 4PV8B 4TSAL 3S36L 4OCXH 3VWJC 1HHJA 3V52L 2H1PL 3TPKA 1LEIA 4RAUA 1VFAA 2CUHA 4MNGB 5HDOA 2YD1A 4OF5A 2GYSA 3WHXA 3F58H 1D5XB 1FN4B 2YPKA 3GMLB 1JNHA 5FGCB 4RDQF 4GRLA 3QWQB 1M7IB 4NJAH 3S8WA 4QWWD 3QI9B 4XNQB 1V5JA 1CE6A 1OAYL 2CRIA 3CUPB 4S1DC 5SX5H 2FEDC 4FHBD 1IGTA 5E2JA 3WHE0 1FNGA 4QHKJ 2ZZUT 3D39A 4HKJA 5EWIL 5FYKL 3VGFA 2X44D 2E27H 5I1HH 5DJYB 4HUWB 3H9SD 2M8XA 1X6NA 1NKRA 3NZHL 4KUCD 1UT9A 3MBXH 4Y5YC 4RISH 3O9WA 5HHNB 1GGIH 4G5ZH 4ZS6C 1NMBL 4GKSB 2NXZD 2HFEB 4WU5B 4HH9A 1F3DJ 4HV8B 4OLUL 1VFOA 2FYYA 3SGEH 3QSKB 1S7SA 3ECBB 3GI8L 1EO8L 4I4WA 1IQWH 3PWPD 2AVGA 4M03A 2YD6A 4MB5A 5LGKA 3BESR 1R3IH 5IHLB 1HKFA 5ACMA 3NGBC 2C4XA 2QSCH 5ICZB 4MJ6A 5KSUB 1K8IA 1XR9B 3S97C 5CIPH 4NQCB 3JV6A 4M5ZH 2DMKA 2IBZX 2G9HA 5DD1H 1OAUL 5ICXA 5B39A 3PL6A 1Q9OB 4LIQH 2G9HB 6FABH 4WV1A 4NQCA 2Q8BH 1OTTC 2NW3B 2HRPL 4ERSL 3UCRA 2PYFB 1N64H 1UZ8A 4M7KH 4X6CA 1CF8L 4O4YH 4QY8B 1DVFB 4MXWL 2AJ3A 3GHEL 4L3CB 5HHOA 2I9TB 1S7RA 4GG8A 3WS3B 5GZOD 1XR8B 3TZVC 5EBWB 2P8LA 3OX8B 1S7SB 3ECBA 1RZKL 1EAPB 1MFBL 4WDIA 2NPLX 1RJCA 3WIFA 3TJEL 3P9WB 4ZFGL 4QXGL 1T21B 4FXGA 4U1GC 3ZKXB 1NAMH 4D8PA 4O02H 4ODXA 5CINL 2ESVE 2F5AL 4U31A 4EXPX 3PWVB 4ZOBA 1Q1JL 2VO5A 4WW1B 2LAGB 2C5DC 4ETQB 3MJ8A 2NXYC 4FZEH 4PLOB 4XNQA 5F9JA 3UPRA 2IALB 3ULUL 2NY5H 5MEPB 3T3MF 4R7DB 2Z4QA 5C70A 4F57H 1IAKA 5CEZE 1X44A 4LPCA 1MLBB 4IIQC 2BMKB 5IVXB 5IVXE 3D25B 3P30L 1XGYH 4P9MH 5E56A 1HYRC 1KCSH 2ATKA 1B4JL 5BJTB 2CK2A 4UNTA 2ZG3A 5BZDB 2R69H 4EVNB 2XN9A 4RWHA 1CI5A 1P1ZA 3KNBA 3QUYC 5E03A 1MCIA 3BZDA 5EIVA 1HH6A 3OAUH 2R9HD 4YHKL 2OSLB 4M48L 1X5XA 2ZKHL 1WWAX 3TPUA 1KBGL 3O4LB 4PJ9B 5AYUH 4PGDA 1WV7T 4OCYH 1W72B 1P7KB 3MRJA 2H32A 3H3KA 1IGJB 1LO2H 1DN0A 1CLYH 3UXFA 5HYSB 5C0BA 1YYLL 4HKBA 1LO3H 5F21B 3P77A 4JO4L 4KTYA 2NR6D 3I84A 4NZDA 5CIPB 3MV7A 1NMBH 4MNHB 1G1YA 3KAAA 1GGIL 3EOAB 1HN1A 2WLYA 1NLDL 1LDSA 5CP7A 3BGMB 3DROB 1U8NA 4QT5B 1LK3L 5EWIH 4UB0H 5LQBL 4JB9L 4AG4L 4QLRA 4KZDH 4QGYA 1CDCA 5T1DH 1TJGL 1R0AL 5GGSB 4Q97A 4L9DA 1A1NB 4NO3A 4PG2A 5C86A 4FQXC 2J8UE 3CC5A 3QB7C 3WV0A 2YA0A 3VXQB 1NCCH 1ZEAL 4IOIB 2GY7B 4KJWC 5GRJH 3LKRA 1JWSB 4MJIA 1BQHG 1ORSA 4XCEA 1QLFA 4OCNC 2JJSC 3FFCB 5HHQA 4X6EA 2YEZA 1T03L 4NRXA 1DQML 4Y5XB 3C5ZD 1UA6H 1CLOL 4K7PH 2UZIH 4PJCB 3V5KA 2UZXB 4ENED 4ORZC 3MCLL 2GJ6E 4PRAB 15C8H 1KJ2A 4WJ5A 5C08A 4XMKH 1LILA 2GCYA 4L29A 1U8IB 4KJYB 3BSZH 1FCCA 4OZGE 5FK9B 4KRPC 1DUYB 1J1OH 4J6RH 4P5TB 4F7EB 4P5MA 1KTDA 4L3EB 3ZLQC 2WMPA 2HT3C 4OT1H 1MWAA 1CIUA 5DEZA 4M7JH 4ELME 3EO9L 3IJHB 1JWUB 3QIBC 3MR9B 4AQ1B 4E42A 1S7VB 3B2UD 3QDME 1BGXH 3EOYG 4RBPK 1KELH 1MWAH 3VXRB 1K4CA 4XB7A 2IAMC 1UB5B 3QEUB 3RZWA 3T09A 2R8SH 4R7NA 1UYWH 4P2RE 3QQ3A 3WFZA 3FQRA 4G7VH 1F3DH 4A6YL 1RZ7H 4IMLA 4KTEL 4Z9KB 5I6XB 2HMIC 2IANE 4OKVB 1G1CA 1CVRA 3MNWA 3UROR 3DURB 1BFVL 5EZLA 2MCG1 4M93B 1XGQB 1B9ZA 5TDNA 2DIBA 4LKCB 4WI6A 1TPXC 4XMKL 3JSSA 5E5UB 5HD8D 3U4AA 1KCVL 4F7TB 5F6IB 1AE6H 3F5WA 4R2GD 4P2RB 4DGYL 1P4LA 5ILTL 5KSAC 1YPZA 5E4EB 1REIA 3MLVH 4XMLL 1J05A 4RGND 1YPZB 3O2WH 5F8RC 4P2RA 2HG5A 5F1KC 1WICA 3JWOC 2HFFB 1NCCL 3KPSA 1ZEAH 2MHAA 5T3XH 4U1KB 2Y07H 2ZJSH 2WBKA 4UAOB 3Q3GB 3FT2A 3QEQA 2VDLH 3WNLA 5T1DL 3MYJB 3BQUC 4OKVA 2X4PB 3P11L 4WI7A 1F4XH 3BP4A 4L8BB 1DEEA 4KXZH 2OL3B 4RFOH 3TT3L 4XXCA 3WFDH 3VFPB 4S1QH 4MXVE 2F19L 3NIGE 1VGEL 2G60L 4BQCA 4FQQA 4PGJA 4JPWL 3HC0A 4GLRH 4UTBH 4CW1A 4EI5B 5GS0D 5DO2D 2H2PC 3ARFC 3VFNB 4F7PA 4RWYH 3S5LG 4R6UA 3UO1L 1V7MH 4A6YA 5C0JA 1C5DB 2MPAH 4MB4A 2W65A 1I1AD 4OCSL 2EDTA 5C08B 3HHRB 4FTVD 1GHFH 1RMFL 2MQ3A 4LAQL 2P5WD 3MSPA 4EXKA 2CKBL 1ZTXH 2FX7H 4WEBH 3SGDI 2WIMA 2L7UA 1FO0B 4J4PD 1U2CA 2EIZA 3DX7B 1U6AL 4HWZA 1Q0YH 3GMOA 3FFCA 2R2BB 2WBJA 2W9DL 3O0RL 2WWKT 3K4AA 3SQOL 3S7GA 3O9WD 1A6WL 4WFGD 1EPFA 2FNBA 3NVQA 4OLYL 3DVFA 1OGAD 4YXLL 2ZCLH 1T0NB 3EYVB 3IFOA 4KI5F 3OBAA 2E5EA 3KXFB 4U6XB 3Q5TA 4WTZG 5F6IC 5F97E 2Z0BA 4PRIE 4OZIF 3RVXC 3ES6A 3LKOB 2F5BL 1BWMA 5IG7A 1NGPL 4JDTH 4L1HA 2CH8A 3QRGH 3IF1A 4PJ9D 3WE6A 3T0EC 2V7HB 3PGFH 4YHOL 5KW9L 2R4RL 4P9HH 3S34L 4JKLA 1I3GH 3ALPA 5DS8B 5F89A 4LLAA 1IVLA 1ZS8A 3BGAA 3VD4A 4JQVA 3HPJB 1NCWH 1Q0XH 4YDKL 2V5RA 5GS1A 4PJDF 4ZPTA 1EXUA 3L5WB 3RBSA 4LRIA 1UCBL 2R2HB 2FJFB 3V2AR 4O9HH 2PYED 1CD1B 5KSBB 5DJZB 2IPKA 5C0IA 3T04D 1MAMH 3TPUB 4UIKL 1CS6A 4HIJA 2Q8BL 3L7FB 2V17L 4I0PD 4ZTPL 5IT2L 4KTDL 4HWBH 4JGMA 2O5ZH 4WCYH 3BUTA 5CJXA 1MY5A 3B9DA 1QYGL 4Y5VB 3KPLB 1U3ZA 3FB5A 4PRPE 3JUZA 4NQEA 4P23A 1MJ7H 3SE9L 2VXTH 4V2BA 2WNGA 5ADPL 4M7LL 3AY4C 1G0YR 2AJSL 4WHCA 2JJUA 1NBQA 1VADA 4XVSL 3IJSA 1EEYB 4G6AD 4TNWK 3FT2B 3JWDC 4PTTB 3O6KL 4OGAD 2FL5A 3MRCA 5DHXB 1Z2KA 2HVJA 3VWKD 2AABL 1T04B 3MRBA 3NABL 2CLRA 2MHAB 2BJML 3KPSB 3GFUA 3PXHA 4RZCB 1RU9L 2IADA 1JFQH 3DYPA 4PB0L 1NUGA 3MRHB 4U2YA 3GSOB 4XPTH 3FOMA 4G80B 4TQEL 1G6RH 3WFEH 1LE9B 3H8NA 3V0AC 3BOVA 4QRPB 1JIBA 1QBBA 2BNQB 1NLBH 4FQ2H 4Y4HD 5AG9A 5KVGH 2J7LA 4LPVA 4OM0L 1H8NA 3QUZB 3H2WA 3BD5A 2BRRL 4H88H 5TDNB 1CDGA 4LLYA 3FO9B 3HI6L 3OXRB 1TJHH 3EOBB 5D2LB 3V52H 1RIHH 3MNWB 4N1EA 2BVUA 4XVSH 4IDJL 3QO0A 1X3DA 5GRWA 3GSNA 4OQ1A 1FRGH 2YK1H 4IJ3C 4JANB 3ZDZF 1I8MA 2P47B 3L6FB 4S1RH 4ZDHA 1F11B 1K8IB 1ED3B 3VCLB 2VDRH 1GJIA 2XWJB 1QYGH 5IR1B 2EH8H 1GC1H 3MRHA 4PLJC 5ADOH 3RVWC 4LBEB 1U95A 3OZ9L 2YD9A 5J12C 4H1LG 4Z7WF 1MHHB 5HY9A 5IFJA 3ARWA 3BPNC 2E7HA 3TNMB 3BRDA 4XX1G 4ZTPH 1PG7W 1TZGL 2CLRB 5EU6B 3MOBL 5D72L 4IMKA 4L3EA 5EOTB 4M62L 1NQBA 5JA9A 2Z9TA 2GT9B 5IQ7L 1IC5L 1U3HD 4NC1E 1U8IA 4LDOB 5EORH 1D9KB 1X5YA 4WGVB 3QISA 4OM1L 4NWUL 5DFTA 5F9WB 3RWJB 4RNRA 3DV6A 1UKQA 1RFDL 2KH2B 4NRXB 3SKUD 3D2UA 2PXYB 1QLRA 1FIGL 25C8L 5JOFB 4I5BB 4X4ZA 4MAYB 5J13B 4R26H 5HHPA 1WWBX 3HMWH 5JPMB 3GMLA 2VZ1A 4X83A 1RY7B 3QQ4A 1W0VB 2OXHA 2V2WA 1I9JH 4NZUL 3IDYB 2NW2A 4UTAL 2Y9RT 5L2KE 4M8VA 4G9FD 4D9RE 4PJ5D 5CSZA 1AIFB 2J3SA 2NYYD 5JIHA 4ODBD 3GUTA 5DFVD 5EU3B 3EOTL 3LDBC 4K3HA 1V3KA 1OSZA 4JKMA 4UQ2B 3G6DL 3WYRA 4JM4H 1LHZA 1UJ3A 3BYYA 3IAQA 5C0AD 2XG5A 2DLTA 4IS6A 5IB5B 1IC7L 3OMZA 4X9FA 3HNVL 4QRTB 4JDZB 3PWNB 4ZOAA 5DMKB 3TBYB 4HMCA 1GGBH 4CGTA 3O4LA 4BKLA 3TVMD 1B0RA 2VLJA 2C26A 4S2SA 1M71B 3W39A 5E7FA 1JN6A 2EICA 1A4KB 4YBLB 3TNNB 1LEGA 3CFKB 3FTGB 4DW2H 4JPWH 2B4CL 5F9WC 3U4BL 1L7IH 5DF0A 2FWOB 1R5VA 2X70A 2MFNA 4NFCA 2HJFB 5JHLH 4RGMB 4R97B 3T77B 5DRZA 2QQNH 4LSUL 2CPCA 3ZHKA 3FFCD 1FCGA 1F90L 1F4XL 1CR9H 1AC6A 2FEDD 3ZT7A 3BPNB 5B38A 2IALA 3P4NA 3AXLB 4XBPA 3ET9F 5HHME 4K8RD 4F15B 1IEBB 2IG2H 5T1MB 3VWJD 5DUPH 3MV8D 3GGWB 5GGVY 4W6XB 2JCCB 1DE4B 5F7FA 3OAZK 1T1ZA 1LO4L 1P53A 2EH7L 5IP4A 4LCYB 1U8PB 2QQKH 3S35L 1C5CH 4R90L 3DX6B 5GS0C 2NXZC 4ODXB 1OF2A 1J7VR 4FG6D 1I9RH 1T21A 4FXGB 2EDOA 4ZAKA 1CGYA 3FT3B 1DZBA 3MGOB 1CL7H 4NFBA 5JOPE 3KLAB 1DQTA 1G9NL 3HRZA 4AJ0A 4WI2A 2OR7A 1TQBB 1X5IA 1EAPA 3KVQA 4HCRL 2P8LB 3SKOA 2YPLA 1DEEB 2FGZA 3BD4A 4CU6A 2C1PB 4K3DL 1FFRA 5CD5C 3WN5A 4X8JA 3ZE1E 1NEZG 4DZ8A 4HFWB 2ARJA 4QY8A 1YC8A 3HZVA 3CX5J 3GO1L 4Z7NF 1DR9A 4YHIB 1JGUL 1TVHA 5EOQH 3ULVD 5F72S 4JGUA 1KG0B 5BW7A 4ZTOL 3UJJH 5E08H 4XGZA 5FDWB 4PJXB 3KPNA 3MV9E 4B53A 4DAGL 1HWHB 2DLEA 4HLZG 5LVEA 2Z8RA 3D48R 1XF5A 1FNEB 2JK5A 4NO0B 2CSPA 3PWUA 3JV4B 4NQTA 1JNNL 1I1AB 3NACH 3RA7H 3F7PC 2F53E 3SDDA 2VL4A 5H35B 4I2XB 5K93A 3E8UL 1RULH 4XPGH 3KJ4B 5FKAB 3MRLB 4LF3B 3AM8C 2YUZA 4HK3J 3QHFH 5ALBL 4LCIH 4K71C 12E8H 1OB1B 3GSNL 1A3RL 3HMXH 2SEBB 1IEHA 1B0GB 4KJQD 4IRJB 1JMXA 5DUBB 1CLOH 4EDWH 4JFZL 1MREL 1R6VA 2XIDA 2VE6B 4Q9CA 2D0HA 5E00A 5D7LE 3IS1X 3WSQH 3E6HA 4L9LC 4HWEH 3I2CL 2J8HA 1JGLH 4ODUA 3E6FA 1MJJB 2ADFH 4FFWD 1M05A 2Q20A 3GM8A 3RKDD 3IXTA 3UBXI 2OTWB 1MWAB 1UB6B 2D9QB 4HIXH 4ZOEA 2AEWA 3GHBL 4POZC 4FQLH 4P5MB 4JVWA 4DTGL 1U3HB 1MCDA 4OI9A 3C6LD 2BX5A 1F42A 1BZ9B 1KJ2B 4ISVA 4MNQA 1CICC 1IFHH 2ICEB 3RL2A 2H9GA 5DT1L 1D5BA 4JRXA 4XWGL 3BE1L 2WWMD 2E6JA 4M1GH 1WFOA 1FVCA 5DMIL 3TVMB 1FZJB 4RDQG 5HHQB 1FZOA 2IQ9H 4G9FA 3GMPB 3U7YL 3WNNA 2F58L 3HZKA 4MQ7A 4QHKI 3T4AB 4ENEC 3PWLA 1DDHA 1CU4H 4Q2ZA 4TTDC 4JLRB 4Y4HA 4ZD3H 1U93A 2P8MA 3O45A 4HJGA 4NO3B 2NNAA 5CJOH 2W60A 5AYUL 3U7YH 2BOCB 5C07E 4FQCL 1BM3H 1DQQA 3CXDL 5DMIH 2Y6SD 5ABDE 5HYQB 2G75A 4M1GL 4PJDB 2ZCHL 3FZUD 3OF6A 3QIBD 5F3HB 5BZWB 5KS9E 4PJ5B 4QRQB 2W38A 4LVEA 3W2DH 1W2KT 4UNVA 3FQTB 3MV9A 4WI9A 3TESA 1MIML 3P30H 3DYMA 2D31A 5F7EH 4L3ED 2VXVL 5EUOE 3RWHB 4XXDA 5DK2B 1P4IL 4Y16B 1IM9D 5ESAA 5EZIH 4FQXA 1LVEA 2QR0B 3FN3A 2XZCH 3LEVL 3DI2B 4O2CA 5IESH 2BDNH 4MVBC 5DXWA 3S3SA 1Q1JH 1DFBH 4FZ8L 2JJSA 1ES0B 2IGFH 3UYRH 2DYPB 3CDGA 1NC4B 5TDPB 2X4OB 4X4XB 3G5XB 2VXSL 1SJXA 1S9XA 1Y6KR 5J8OA 4OD2B 4TNWF 5D1XB 4HMDA 4OZGF 4TVSa 5KSVB 5ALBH 4TSBL 4W68A 1RUMH 3IAPA 4LARL 3GSWA 2VYRE 5M95B 1CLCA 4XPGL 3C2AH 4NPYB 4NZRL 1MF2L 3QIBA 3U0PA 4YQXH 3TZVD 1FZMB 1P9MA 4U3CA 4KPHH 1TVDA 4H26A 5AG8A 5E0QA 4JY5H 4QNPF 1U92A 3H9SE 1HXYA 3UTQA 1AP2A 1DN2A 3QFJB 3IETB 1HOCA 1MFEL 2NY1C 4H25A 1OTSD 3OKOB 4HC1A 4ZOCA 4PJFE 4PJFB 4XWOD 5F9OH 5FXCH 4TUJB 2IPUG 5C71A 2JJTC 4HCRA 3T08A 1CXEA 3QPXL 5HHXH 1NFDE 3VFGH 1I8LA 2DQGH 1EV2E 3UTZB 3ARGB 5EBWA 4UAOC 1G6RB 5MHSE 4DZBA 3EJJX 3GSWB 3KR3L 3WKMH 3V6ZA 5FCUH 5IBUG 3S37L 4ZO8A 4TN9A 4FNLH 2P46B 3KDMA 4HHAA 4HF5L 1VGKA 2OR9H 5D1XA 3RPKA 1IILE 3RWFA 1AO7D 4MLSA 4R96A 5I1HL 5T3ZD 4GW1A 3DNKA 2RCSH 3BO8B 1A64A 3KPSE 5FYKH 1KCRH 1WZKA 3KXFD 5C0FA 3PQYD 1RHHA 2VOTA 3DUHA 4E9LA 2VDNL 4KXZI 4U1IA 1XGTB 1PEZA 3BZFA 3ARUA 4KKCC 1JPGB 1LO4H 2CRYA 2W0FA 2YRZA 4E41E 4HGMA 4KRPB 1NSNL 1OTTD 5F1NA 3MLUL 1WK0A 4R4BA 5J12B 1NEZA 5E8EA 1KYOJ 1YMMD 2Y72A 2X1PA 2J8UB 5IEKB 5I9QC 3IDIA 3CFDA 3FQUB 2P5WB 5L9DL 4JY4A 4Y16A 1G7QB 4M3KB 5JW4N 2ITDB 3L7EA 5D2LE 4IRSC 3GBMH 2E7LA 3VWJB 4G8FB 2IANA 1MLCB 3QIWB 4YBQD 3CK0H 4TSAH 2FO4B 4G6FD 2YC1B 1YECL 4ZG1A 4MXVF 1RJLB 4X4YB 4Q6IC 3BN9D 3OKEA 3OPZL 4I0PB 3QO1A 3T8XB 2FH8A 4EIGB 4GRMA 1SEQL 4HKJB 2A6JA 3M1BB 2XWTA 2P43B 3T1WA 3HB3C 5HYQA 4XAWH 1CE6B 3BMWA 1JNJA 1EO5A 1ZA6B 3HLAB 4HJGB 1ZLUH 3ZDYF 5FO9A 2Y7QB 3HI1B 2F8XC 3TIDA 4JQXC 4Q2ZB 1M7DA 1DDHB 5A16B 4JHWL 5DHYB 3AGVA 2EDQA 4YHMH 3HAEG 4N90D 5EBMB 1I1AC 3RZCC 5D70L 1LEIB 3KPMA 3LSOA 4PV8A 3MLWH 1OCWL 4U1SB 4YXHL 3T1FB 4QHMA 1U8JA 4YX2L 4RRPA 1BVLA 3O4OC 2RIKA 4P5KB 3GBNH 2VB5A 5AAMA 3MRGB 1ITBB 1OGAB 5CILH 4OD3L 2NZ9D 3UZEA 4U1MA 3BZ4B 4K8RL 1LGVA 5A3IC 3RUGB 4QRUB 5FO7A 4HUUB 2ZOLA 3UAJD 1FYHB 2R1YB 3L5XH 3I85A 3QCUH 4LU5H 4M61A 3LB6C 3QUXA 5DEGA 3GZKA 3LMJH 1KEGH 1ZVSB 2R2EB 2HN7B 4IOFD 1EGJL 4BA8A 4ZUSA 5BVPL 2XN9D 3QDGA 4YX2H 1A1OB 2AQ3A 1I7TB 2YA1A 5GRYA 1KPVB 5IQ9A 1QFWL 1OCWH 3DBXB 4NC2B 1NCTA 4JHBA 2BFVL 4G6ML 4ONHB 1FE8L 4XNYH 3IDXH 3F12B 2JIXB 2VQ1A 4M62H 4GG6E 3BKJL 3MMEB 1PKOA 2I5YH 5E6IA 4AMKL 5DQJA 1IAIL 4NGHL 3RGVC 3NIDE 4HPYL 2IJ0C 3GKWL 4U1GB 1HHGA 5CP3H 2RGSA 4U1HA 1WFTA 4PV9A 3RNKA 4P4KD 2NY1B 3TN0B 1NBVH 4RGNB 5HD8C 2EC9U 3BAEH 1TCRB 4NRZB 1A14H 2EH8L 3BHBB 4OFIA 2CR6A 4TVPE 1G9NC 3GSXA 4OIIH 4UT9L 4BFIB 2GKIA 3FB6B 1S5IL 4NM8L 5IMLA 1J18A 3DO7B 3OPZH 3SCMC 3BEVB 2X9YA 1JF5A 4PJXA 4X98B 5INDB 3LRSA 4IDJH 1BVZA 2P5WE 1CQKA 2P4AB 4ODWB 1HILB 3O6FB 4OLEA 2AEQL 1OP3K 1U8HB 1CFTB 2BRRH 4H88L 4QRRE 5EIQA 4KJPD 3K81A 4LSTH 2ZSVA 4HFWA 3BKCL 4YFLI 2V5SA 1CG9A 3KPRD 2DDQH 1ORQB 5E1AA 2BZDA 3C60B 3LKSA 1YJDH 1KEGL 4P2RD 3VWKC 4B5EA 4UIMA 5E99H 2F54E 2UY6A 3MGOA 3L3IB 1GH7A 1OTUD 2B4CC 4G6KL 1OF2B 2J88H 4Z5RA 3ZTNL 4J23A 1IM9A 3LV3A 2G2RB 1T1ZB 3VRIA 4MSWB 5KJRL 3JWOL 2FEEI 4NNPH 3IKCA 5K9JH 4HXAL 4G8GB 1OOAA 3LKNB 4PLJD 4HUNB 4YXKL 3SKMA 3MLWL 2IBGA 2KQMA 3HE7A 3VI4E 4LK4A 3JV5A 1FVDA 3RZCB 1FORL 4JHZA 1MI5A 5HHXL 3PWJB 4NZTH 5LBSL 1HQ4A 5TQ0H 1NGXA 4LEOB 2A6KB 1YYML 4HBCL 3NCMA 3TWCH 2VDQL 4OCLC 4G9DA 4OTXH 3LEXA 4QRRD 4TPRL 1JN6B 5EUKB 1QSEB 32C2A 1JGVH 1UKSA 1NGWA 3MGAA 4XBEH 5ANMB 1PZ5B 1YDPA 4O9HL 1U8KB 1BIIA 4M7LT 1J8KA 1SEQH 4W6YB 5GGVH 1IGCH 2AEPH 4WW2C 3ME0A 4BSVB 4IS6B 2CQVA 1UCBH 4PJ8B 4X5LA 3FOLB 5HYFA 4XMPL 3GMRB 1AR1C 3CFBB 4GSDL 4OBRA 4QXUL 1IKNC 4LARH 4V1DD 2NY7H 5D5MA 5I8OL 3KPRB 1KPRA 4Z7UF 5JXED 4ODTL 1INQB 2Q1EA 3QEHB 4MWFB 1AD9B 3V6OA 5E95B 2O26U 4AZ8A 2IAMA 3MC0A 4MS8D 1J0HA 4Y5VC 5D1ZA 3RDTC 1YEGH 5FKPB 2M2DA 1IMHC 1HSBA 4HS3A 5CZKA 4JZJB 2B2XH 4JCMA 5DO2C 3UYRL 3DGGB 4GQ9L 5IGXH 1YEHL 3REVA 4HK0A 1A9BA 1CTOA 1G7MA 2WLZA 3BISA 4PJXF 5I71C 4QCIB 5I1AA 3RVVC 2NX5D 1FFNB 4HXBL 5HHOD 3TV3H 3QXWA 4GO6B 2NY1D 3TN0D 3H9ZA 3O3DB 3OGCB 4Z76A 1CCZA 2W9DH 4WFGE 5D5MB 1I1FA 4KKAD 4MAYA 5HHVL 1XF3A 3MJ6A 3D3VA 4BSVA 2VH5L 1VFBA 3D2UB 5JORB 3IFNL 3RDTB 5D7LB 1ZTXL 3O9WC 2CLZA 4U1LA 2DQGL 4RNRB 1K3IA 3VFGL 5ANMA 3O3AB 1URLA 3CLFL 2OP4L 4HT1H 4OZHA 32C2B 3V6FA 5KANG 1BM3L 2DQCL 3QUMB 3VH8G 4MXQD 3VD5A 3BZEA 1VEMA 1NBYA 3D1MC 1HK6A 3LS4L 4P57A 5CJ5A 4Z7OF 1SM3H 4PFEA 3NPZB 2B1HL 3HS0A 4RWYL 5FHBL 3IGAA 5IVZA 3TBSA 4JY5L 5CHNB 3FONB 3O41A 4UTBL 4MA8H 5C3TA 4NO2A 1MI5B 4PJ8C 3RUGF 4EOWL 1DANU 1U0QA 3EJYC 2Z92A 4PGEB 1N3NB 2PUQT 1C12A 2EDRA 3EHBC 5C0DA 3VCLA 3HPLA 4OAWA 1QA9B 5FHAL 4L4JA 2GSGB 3L6FA 1E6OL 3B43A 5LWYL 4JRWA 1KIPB 5DYOB 4NM4H 2EDFA 1F8TH 3QO0B 5C6TH 4DTGH 2VN7A 3LN4B 1OARH 5IVXF 4YGVB 4ZQKA 4FTVA 3ARRA 5CJQH 1JJUA 2D7NA 3H0TA 1EK3A 2L7JA 3ZKMD 2BNUB 4Y2DD 1AD0A 1UM4H 2Q3AA 2BNQA 1N5AA 2BERA 3E1F1 1OD9A 2BDNL 3L3KB 3DRTB 5E70A 3G04B 3H0TB 2BSED 4HKXA 4PJ5E 5EZIL 5HGAB 5FYJE 4HIHA 1C8PA 2VAJA 3G6JA 3IRZA 1U3JA 1HILA 1OARL 3QP3A 1KPUA 4V1DB 5EO0B 1INDL 1A3RH 1KXVC 3ELAT 3W2DL 5F44A 1NAMA 3U36B 1FZKB 2WINA 3PGCB 1ZGLP 1F58H 3MREB 2NY4D 5AAWA 4NKQB 5CJXC 5CD5D 4OAWB 4KK9D 4R0LB 3STZA 4S1SH 4QKXB 1RZ7L 3VDBA 1E4XI 4LCWB 4F8QA 2BVQB 3MA7B 5C0AE 2NY5C 3KJ6H 1NGQL 4YHLH 1BIHA 5IB3B 4LOUC 5CHNA 3EZJB 4YHZL 3C09C 4JZOA 2F58H 2IH3B 4R0LC 2V2XA 2A1WH 1ACZA 2ICES 4EEEA 5EO1B 5E08L 5C6TL 4YWGH 4PP2A 3BE1H 3LOWA 1CZ8L 3GJEB 1U58A 1BD2E 4PJHF 5LCVL 3EAKA 4ZUSB 4ZXBB 5FYJD 1A6PA 3QDGD 1H3GA 2WQRA 1MCJA 2BVEA 3QI9D 5DJCB 1G7HA 4J8RB 4HUUA 3MFFB 3PL6C 1YEJL 2IWGA 4HXBH 3RVWD 1GZPB 2EIEA 3AS1A 4R90H 4L8SA 5IG7B 1JGLL 1FFOB 1ZWIB 5I8KH 3REVB 1QRND 2O93L 3R06A 5DJ6A 2A83B 5C07B 1H8OA 2GIYA 5ECJE 4U7MA 4JFZH 1T0NA 3IFOB 2VISA 3IFNH 2VH5H 1W0WB 1RIVH 3KPMB 5BVJA 1XAUA 3BJLA 4FQIL 3KPOA 1U8LA 4LGRB 4MVBD 2R2BA 5JHLL 4X4ME 4GBXD 4PJGB 5E4EC 4YJZL 5T1LB 3CJJA 4EI6B 5J1AB 3ARDB 1U8KA 4KK8C 2UWEE 1H3XA 1LO2L 2FBJH 3FAWA 2A83A 1ERNA 3IDUA 5IHZA 5EUKA 3NFSL 5HDQL 2W65B 2A38A 2XWTB 1ZHNB 5E2VH 4ZFOL 4QHNA 2HLAB 1XF2A 4HIIB 5KVDL 5E5MA 2ZG1A 3F6IA 4NN7C 4DAGH 1RJLA 4X4YA 1XF4B 2W92A 1A4JB 1OQXA 2EEBA 4LL9A 1PZUB 5GGQL 4G8FA 4FQQB 3UDWA 5JQHC 5EOQL 3GO1H 1YEIH 4MDIA 5HYJE 1T83A 3OAYK 4XMPH 5IK3B 1IE5A 3H9YA 1S7XA 3ALXA 4UT7L 1WGOA 3DUUA 4FQ1L 5LJYH 4NDMA 4PTUB 1WBZA 4XWOC 4U05A 4U0RC 3QEQD 3HE7D 5JW3L 1WZ1H 4Y2DA 3MYJA 1CT8A 3ZTNH 2D7TH 1KYOK 2EXWD 3GSUA 3TVMC 2YPLD 4OTXL 3ARBC 4FFVD 3V9FA 5E99L 3FRPG 1NAML 4CAGA 4P3WA 1WIOA 3X13A 1ORQA 4XP6H 4Y5XC 3TH3T 3V7AE 3VFOB 4OV5A 2B20A 4P2QB 1N8ZB 1QD0A 2FSEA 3I6KA 4I0CC 1U8HA 5K9JL 4MDJB 3MREA 1NL0H 4GMTL 4ZUUA 4MXWH 2OS7A 5DMGC 1HWGB 3LRSB 4Y19A 2ZOKA 3MLRH 3MLXH 5LG1A 4C57C 4M4RA 3RTQD 3IETA 1F02I 5MENB 1L0YA 3C09B 1Q38A 3ULSA 3LS5H 3UTQB 4ALAH 1TZIA 3VFRA 4P5TC 5EFIA 1QEWA 1V3MA 4WY7H 4PUBH 4DKAA 3QNYB 5E6ZA 3OZ9H 3DRTA 5I1EL 4XHQA 3HUJA 3TN0A 3RPIA 1K3ZA 4ZS7H 1FPTL 4XB8A 3RAJL 2DDQL 4NN6C 4U1HB 4YHPA 1MHCA 5E2TL 3RVVD 1IQDB 1UM6L 1KIRA 3FCTA 5HDBE 1FC2D 4E42B 3BN9C 4O5LH 1BREA 1XGUB 4K3GA 2Z8SA 3GI8H 1CVSC 5CGTA 3L3OA 2EIBA 3I3BA 1LEKB 1PJ9A 3B9AA 1DUYA 4KJYA 4PJAA 2X4OA 4X4XA 4NNYA 1EA9C 3HPLB 4JO2L 1X7QB 3QH3B 3ZO0A 5I1JL 1A6TA 2NY2C 3MV01 1EFQA 2BNRE 3BDBA 4QRRA 3SDXE 2ICWJ 4LPWA 4YBQC 4U6YB 1V3JA 3QJFA 3JBG7 4AMKH 2BJMH 2HLFD 3EYSH 3BPCB 3F58L 3OKNB 3IDXL 4LSDA 3QEGL 4HJJH 3X12B 1E4KC 4K94C 4Y4FC 2WUBL 3SJVB 1KC5L 1X4YA 1M6OB 2G75B 4JO1L 3RWEB 3BKML 3VDAA 1EGJH 2I27N 5D70H 1MJ7L 2Y36H 2MQCA 3LB6D 3GRWL 2W60B 2EYTA 5CIPA 2EDEA 4Z76B 3L5XL 3MACL 1FNAA 4DGVH 4S1DD 3W9DB 3T4AA 1FLRL 2A6DA 2R56L 1FFNA 4NKMB 5I1AB 1UVQB 1WC7A 2DJ4A 1FZOB 4XAWL 2ZUWA 1KN4H 3OKMB 2EDLA 3V6BR 3BT2L 4HK0B 4JFFD 3DWTA 3NFPB 1A0QH 4JZJA 3RL2B 2GK2A 5C0AA 3VWKA 1ADQL 3WL9B 4GMSH 4QTHA 1WJ3A 5FKPA 2E7MA 5D1ZB 2Q86B 4LNRA 5D1QD 3B8YA 5CJBA 1A7QH 3CK0L 2BSSA 1NCWL 3LKPA 1S9VA 4JREB 5BZDA 2Y06L 1G7QA 2YD2A 3KPRA 5SX4H 3SDAB 1N7ML 2ATKB 1T4KA 1FYTD 3M8OH 4P59L 3VFWB 3CFBA 3GKZA 4WNQA 1OM3H 4GG6B 1M05B 3QRGL 5ISZD 4FQ2L 3G6JE 4HZAA 4MCZA 4DN4H 1NAKL 5E8NB 3X11B 4TQEH 3NFSH 5BV7H 4XPTL 5B3JE 43CAB 1JPGA 1XZ0B 3PQYE 2VLJD 2VE6A 4L4VE 4BUGA 4U6VL 3MRPA 1OT1A 1A3LL 5C0FB 5HYJA 3FO2A 3HI5L 4E41D 1PKQB 5FUZH 2XXCB 3FMGL 2RCSL 1NCDH 2VSCA 4ZXBD 2MWCA 4YE4L 3ZE2F 4OLYH 5GJTH 4EN3A 5C0RL 5CGMA 1OB1A 1A6WH 4NP4H 2AJZA 1CDUA 3PWJA 2FX9H 4IOFC 3TH4T 3UYOD 3WNKA 2BC4B 1QPXA 1NCAL 3BI9X 3C60D 3WIHH 3WIIH 1W72H 2L4OA 1QKZH 5H94A 3SDXA 1XR8A 4NSKB 4M1DL 4ZO6A 4FMKA 3ROOA 1RMFH 2BNRA 1Q9KA 1LP9F 4KKBD 2AJ3B 3NIDF 3KWWA 1K8DB 1CGTA 3VRIB 2FGWL 4JFPA 5J6HA 1IM9B 4FQJL 5HGDB 5I17A 1CL7I 3N1QC 1PX3A 1UADC 2ENYA 4HWBL 1FYTE 1HXYB 3BP7A 4LP4A 3PL6D 1SJEA 1XIWA 1M1SA 4XGZB 5FDWA 1W8NA 4GAJH 5KZCB 4JRYB 1H3PH 1YEEH 4KJPC 4FNLL 3QIBB 4O51B 4MCYA 4TULL 2F19H 3Q1SH 4PD4J 2JF1A 3KR3H 3WKML 4IRSB 1DTUA 4N90E 4Y8DC 2X10A 2FHCA 1K6QH 3L3GA 3CVIL 5EBLA 4E41A 2J5LC 3D85A 3F6LA 1AJ7L 3QUYD 3MRKB 4Q9QH 2VWEC 3GMQA 2RR3A 1I3GL 4X98A 3PGFL 5KW9H 5C0ND 5D7IB 1UZ6E 5DHVA 2GTWB 4R3SA 5DRWA 5E8PA 1ZHKB 2V7NA 5I0ZA 5T3XL 4KWUA 1JHTA 4LCYA 4S0TD 2F5BH 3MA9H 4KKNA 3HAEH 1IRAY 1Q9KB 3EYQD 1BOYA 4WTZA 5BS0B 3H42L 5ESAB 1GPOH 5B38B 1LK2B 3VXPA 4C56E 1ZV5A 1FN4A 3FQNA 1HI6A 4UDUA 4DKEL 1D5XA 1QOKA 4P46B 1RPQA 1OGTB 3ZE1F 1AKJD 2Z93A 1XCTB 1TQCB 5IMMB 1U6AH 1T1XB 4MNGA 3OKKB 5A40E 1UH3A 1XCQA 4PJDA 1J12A 3JTSA 1YEFL 3U2SB 1EDQA 2HT2D 4OLZH 3TNNA 5C0BD 3D9AH 4I3SH 1GHFL 4PJBA 2J4WH 2B0SL 4AEHH 3DMMD 4D9LL 4NO0D 4K7FA 5JQ6H 1RI8A 4BKLB 2A74B 4WHTB 4F3FA 2R0LH 1RUKL 2J6EH 1IM3A 3WD5L 3VU2A 3QG7L 2XZCL 1P6FA 4Y4HB 3D0LA 4OQTA 5SV3A 5BCAA 3PWLB 3B5TA 3L3HA 4NQXA 1F3JB 5FO7B 5DUML 5E9DE 3MRRA 3HZKB 1QSZA 5FUCE 3V5DA 1EFXA 1D6EA 4NQXB 4KI5C 4N8CH 4CVXA 1HIML 1SHMA 4RFOL 2A9ML 1PYWA 3VWKB 1AGFB 3S4SG 2DQJH 3CMGA 3WUZA 5HI3C 4AIXA 1AIFA 1OP5H 5EIIA 3GHBH 4HGKC 1N0XH 4DN3H 1X5GA 5IMMA 1DJSA 4N1HB 5B8CB 1M7DB 4CNIA 1MJJA 1YMMA 1I75A 3CGTA 2Y7QA 1G0DA 1JGDA 2DN7A 4YDVB 4RAHA 3ULVL 3MBEA 3O2WL 1QFOA 5FYLD 1UWXK 1VCAA 2O61A 4JKPH 2LVEA 1FVEB 4O00A 3RWEA 2X4TA 2C3WA 3SJVA 1FAIL 4AEFA 5C0CE 4AEIL 1B0GA 4R4ND 1EERB 3LKQB 2R23B 4ZUVB 2C1OA 4HWNA 3RVTD 2DQDL 2EYSB 1L6ZA 3NCFB 2VLMD 4LKXA 2QKIA 3MRKA 1H3UA 2P5WA 4KTEH 5ACLA 4PJHB 3TV3L 1PDKA 1X4XA 3BPOC 3JWDL 4WFHE 1KN2L 3U4EA 5H35A 3SDDB 2EE6A 2ADFL 1U95B 1I1AA 4CMMA 3MV8B 2QQQA 2R8SL 4UZGA 1FNEA 2XWJA 1OAXL 4U49A 3D5OF 4KK6D 2H2SC 2CR3A 5CJ8A 3K2UL 4GQ9H 4Y16C 4MCYB 1F11A 3TBWA 1KBGH 1A21A 2ZKHH 5F7DB 4HH8A 4LQFL 4I9WD 2FHFA 4F8TA 3BO8A 3V4UH 3HMXL 5AZEH 4KMTH 3KYOA 2P45B 4LCIL 5T3ZH 3SCMA 2OR8A 1OTUC 3IDJA 3HZVB 4J6RL 4X0KB 5FYLE 2VLKE 5FM8A 1XGUA 2IAND 2DIJA 3V6ZB 1XGYL 4KKLC 2AJYL 3RNQA 1YNKH 5MEQB 5EUOF 1PGRB 1EH9A 1LE9A 5DTFB 4WU7B 4UQ3B 3OAYH 3AB0C 2E9WA 1F6AA 1JNNH 5GZOC 2ADIA 5EBGA 1HYSC 2P8PB 1YY8B 4TVPD 3QNYA 4IRZH 4ZPVB 2H8PB 4MB3A 1FIEA 1BAFH 1AGDB 4UINL 1NCUA 3QNZB 2AKRA 2FCBA 4MAUL 1J1XL 1WTGT 1RVFH 4GS7C 5HYJB 2YD5A 1ZLWK 4PTTA 3K3QA 1QRNB 4MQXC 3DV4A 1VKXB 1R5IB 4JN1H 4NO5B 3X14B 1T3FB 3ZKNC 1MUJB 4J4PC 1KLUA 4EI5D 1KACB 1UJTA 2PYEA 4QOKE 5BMFL 2JKXA 3LIZL 5DC9B 3ZZ1A 2V2TA 2CKBA 1A6VL 4WHYG 4WNQB 5JUEH 1MQKL 1KTLA 4Y88A 5KJRH 2OI9B 3AMKA 4Z77B 4HQQL 4PRPD 1ULVA 4L8CB 2F54D 1D7FA 1T7YA 4NQSA 2VLKD 3ARPA 1S9XB 4NRYA 4KAQL 4JEGB 1G84A 4P4KB 3HUJF 2RBLA 4MS8C 5IFAH 3MLZL 5E94A 4YHNB 2APBA 3TBYA 2JLLA 1YJDL 4O2CB 5EU5A 2X2YA 3DUUB 2YUVA 4BELD 1PY9A 3MRMA 1FO0L 1WC7B 2A73A 1T80A 3VD9A 5KOMC 2WZPD 3W9EA 4PRBA 2AV7A 1WCBA 2IPUK 5CSBA 5KSBF 4OLUH 5L0QC 4TTGA 4TYUA 3HE6A 3QUYA 4QRQA 5IBTL 5JUEL 3IKKA 1TQBC 1DUZA 3QPQD 4BFGA 2RJMA 1YN6A 3DX8B 3EOTH 1NJ9A 4DW2L 1M6OA 4PJDE 1NFKA 4XT1C 1R5WA 1EHLH 1QFWM 4OCRL 5CEXA 5DVNA 5I71B 1IAMA 2NZIA 3NCJH 2BOCA 3NA4A 5J06A 3BPOB 3CSGA 2WW8A 3O8XB 3VXSE 2CUMA 4NJAL 3P9MA 4F37K 3D3VE 1BZ7A 1BAFL 4MXQC 5CKGA 4DUWA 3T3PE 4HG4J 4N8VB 4XP1H 4YR6A 2UVEA 4QXGH 1CXFA 3VW3L 4RMUA 3R8BB 3RVUD 1QLRB 4K3JL 1A6TB 1I9EA 3T0VA 4LPYA 2VDML 1KF9B 3RWDB 1QLEH 2AJYH 3GIVB 3LY6A 5GGSY 4WW2B 4LHQB 5DHVH 5B4MC 1N64L 1MCPL 2CD0A 5C0JB 1RUAH 2CIKB 1DBKH 3BGFC 3BVNB 1U2HA 4GXVL 3RWGB 3TNMA 1TZGH 3DOSA 1G9MH 4HBQA 3HC0B 1LO0L 4LBEA 2YR3A 4PJCF 5DJCA 5SX5K 4Z7WE 4Q9RH 1WAAE 4JHAL 5IR1A 3K2UH 1GC1L 3O3EB 1N5YH 1PLGL 1AQDA 1E28B 3RPIB 4RCAA 4ZDHB 3RIFK 4YK4C 1AKJA 3ZKMC 5L0QB 4ODHH 1PVHA 2HJLB 5ESQA 4RQQB 5D1ZD 5CBEA 4FQHB 3EW3B 1U8QB 5IJVB 1KV3A 1FYTA 1OW0A 3B4NA 5E4IA 2ICCA 3D69A 5MENA 1QFHA 2QSVA 4XI5C 4YHML 3OJDB 3QUZA 1LO5B 4LSSL 1SY6L 4CRPA 4CDGC 4I2XA 1V05A 4KQ3L 5TE7H 3UC0L 5ADOL 4JKPL 5CUSH 2HT4C 3EDEA 1X4ZA 2AS5M 4U1NB 1F6LL 1VPOH 3EJYD 4P23C 1MNUH 5D2NC 3HMXA 1W8OA 2JELL 3LQZA 4JFHD 4G8EA 4LKCA 4NUJA 5EO0A 2OZ4H 4KH2A 4OKDA 4YHIA 2D2OA 4XNXL 4C83B 5EU7E 3VRJB 4EUPA 5HGAA 4OFYD 4PJ7A 4OM0H 4LLVB 4RAVA 3ILPA 5D7IF 4BZYA 2XA3A 4ZFZB 1S7XB 2GJZA 1SYVB 3TT1H 4M6NH 4MDIB 4QHLB 5FF6B 1CE1H 3GSRA 3AMLA 3OJVC 3ULUE 4WCYL 1DP0A 3MR9A 5KS9B 4QHUB 1B90A 3PP4L 4Z7VF 2CDFB 5DD6A 1VHPA 3QYCA 3QI9C 5IW1B 1KCRL 4M6OH 3G08A 3L7FA 3P2TA 1EEZB 4KRNA 2AABH 1TITA 1U8PA 4HIIA 2OR9L 1NCBH 5DYOA 4CVWA 1QQDB 2OL3H 5FK9A 3PWPA 4M6AA 2Z91A 3I3EA 2N4IA 4WJ5B 4LDLB 4PRAA 5FO8A 5KVFL 1EXUB 3L5WA 3MX0A 5GS1B 1Q9WB 2PO6D 5ETUA 5HJ3A 5T1LA 3BP6A 3OAZH 5B38G 1HH9A 4P2OA 1RK0A 5DJAA 1UCTA 4D3CL 1MFEH 5E24E 4N8VA 1JWSA 3V8OA 2ESVB 4OIAA 1U42A 5FUOL 1T0MA 3T0ED 4KTDH 1XF1A 2X9XA 4OZIA 2YD4A 3LKOA 3CH1B 5D1QC 4GBXC 2XZZA 4X6CF 3ZYZA 4MYWB 2DD8H 3PJSB 5GRVK 3T3PF 4X7CC 1B0RB 1HKLL 1T6WA 3LQMA 5TDOA 4N0FA 3S98A 2ADGA 1JF1B 1BD2D 4QRTA 3JXAA 1U8NB 1M4KA 1YN6B 3IXAA 4JFXA 3QDGE 1XF3B 4PBWD 1ZVHA 4MJ5B 3GRWA 4BQ6A 4V2CB 4TSBH 1F5WA 3MFFA 3VMOA 1MRDL 2FATL 1P5UA 3O0RH 3QFDB 2EIZB 3DX7A 2X9WA 4Q9QL 2YBRA 4KGLA 5FA3A 2ZCKH 2CKNA 3IDNB 5GXBB 2OMBA 2FX7L 4WFED 4WEBL 4QXWA 1T5WA 2B1AL 1KOAA 1K6QL 1DN0B 5KVFH 2GW5A 1S3KL 3K8LA 2H32B 3LH2L 3VXRD 1DFBL 4FZ8H 4K71B 4OCSH 1HKLH 2EO1A 3FO0H 3QIUA 4X9BA 4C55A 4AL8H 2P42B 4ZFOB 2P5EE 3VFNA 4DKFH 2V2XB 2VLKB 2H26A 5SWSD 3JVGC 1LE5B 4XP4H 1FNLA 2J8UF 4D3CH 1VGEH 1JYWA 2OL3A 5IV2B 4I5BA 1U91B 2PTVA 1RV6X 2Z31A 3BP4B 1QHOA 4LCWA 4Z0XA 4LFHG 5MEPA 2HVKB 2X4PA 4X7SL 4PB9H 5EU4A 4GLRI 1A6AA 4NO5A 5DZNA 3S5LA 3X14A 3BQUA 4O2FA 4K23L 2YPVL 3PGCA 4FQCH 2OZ4L 1QQDA 5EOTA 1T2JA 2D3VA 1V7ML 4G8IA 5I66B 1ZKAA 5ERWA 2VDKH 5GGRA 3VFTA 5B3JF 3QCVH 3TM6A 4WFEE 3GSQA 4U0QB 5M7QA 3PGDB 2HG5B 2H8PA 3SE8L 5TE6H 4YEEA 5IOPB 3B5GA 4HS6B 1ROWA 3RZCA 1PY4A 5EPMA 5FOBB 4M43H 3TH2T 2FB4H 5F7UA 4OF7A 2XKSA 5ILTH 3SKMB 4JJ5B 2X6MA 5T33L 5TE7L 3OX8A 4IBLT 2BHZA 1Q9LA 4H5SB 4G8GA 5FAAA 5FDYA 4UV7L 5HI4D 2VIRB 3QNXA 4Z7QF 3Q48A 1PQZA 3VXNB 4EUPB 1FL3B 1DQLH 2PYFA 5C07D 3DURA 4PJ7F 3G9AB 3PABA 4CN4A 5SWQA 1A7QL 3V4PL 4LLYB 2HYMA 1KIPA 1P7QB 3PP3K 3HE7C 2VIRA 1OP5K 3H3BC 2QJDA 2V9RA 4Q6IA 4H5SA 1I4FA 2NYYC 4QRPA 2WBJC 4RGNC 3V5HB 1K4CB 4MQXD 1YQVH 4PLKD 3PHOB 3SEPA 4CU7A 1DBBL 2Z92B 3SQBA 4NN5B 3U7AA 5C9KA 2ZSVB 1RJZA 4I8DA 4KQ3H 4EDWL 3PGDA 1TFHA 3Q6FB 1YQ2A 4RZCA 1PG7H 1GSMA 2X1OA 2FRGP 4DGVL 2DQEL 3MRQA 1KUMA 4WU5A 2ZG2A 3WIHA 3G5YB 3NH7L 2DLHA 2A0LD 2AXGA 3VXOB 4OZHB 2VQTA 3S5LB 3OF6D 4YPGA 4JO1H 4BQ9A 4PJCA 1OAQH 4HLJA 5F6HJ 4L1DA 5C0CA 2GITA 3QJHB 4G7VL 1A7OH 5D7LA 2Z31B 4Y5XA 1AQKL 4NRZA 1N59B 5DSCB 1T03H 1QBLH 1ORSB 4PG9B 3AFLA 3NTCL 4BSJA 1IBGL 3G6AB 3MNVA 4JHAH 4XTRC 2CRZA 2XI9A 1N6VA 3A6CH 4YDVA 3VFMA 4QXTA 4XP9H 1M7IA 1EAJA 8FABB 4IOIA 5E5RB 1YMMB 2GHWB 4UT6L 5IJKA 4L4VD 3B3IB 3N06B 4HW6A 3AREA 1DBKL 3WHXB 5GGSA 2YMXH 3VXUA 3ROLB 3OB0H 4RMQA 3FZUC 3RP1A 3S88H 4OLVL 1SJHA 3C6SA 4U33A 2JJVA 5GRUH 1U8OB 2BY0A 1EHLL 1VB9A 1A9BB 3AS0A 1WBYB 2PCPB 1I8KB 2R1WB 5DWUH 2KPNA 4QTIL 4Q7DA 4DKDC 1H15A 4PGCB 4FRWA 4YGAB 2GJ6B 4MAYC 1KJMA 1E6JH 1F4AA 1QNZL 2R0WL 3QA3A 3QFDA 5TFSH 5DS8A 5JR1H 4ELMA 3VXMA 4XP1L 4LCCB 2FZ3B 4U1MB 3HRPA 2RB8A 5AZ2L 1TVBA 5KBNC 1BD2A 4MGXA 1PFCA 5SWZD 1P7KA 3LQAC 1R0AH 2X1WL 1YY9D 1PZ5A 4U6HA 5IFAL 5CBAA 4N0CC 4I77H 3SDCC 4RFEA 4UB0L 4OZIB 2NY0C 5FB8A 4KAQH 2D03L 2NXZB 2H32H 3DX8A 5D8JL 4MNGE 3UDWC 2EKSA 4Y4FD 3UJTL 1H8SA 5BXFA 2OX5A 1CDHA 1R3HB 5BOZG 5ITBL 5DJAB 3WEXA 5E2UL 4LHUA 5EC1A 3X3FL 3W11D 1IAKB 1TXKA 2FIKA 3UJTH 2X4QA 5FO9B 3BP5A 1K2DA 1WCBB 4P4RB 2OTPA 4ODSL 5T5FH 5A2FA 1A22B 3ZDXE 1NMCC 3AUVA 4P3CL 5L6YH 5L88L 1ACYL 3L9RB 5BS0A 3TEUA 4I77L 3SDCA 5D1XD 3PWPB 3DX9B 3MLZH 5ANME 3M1BA 4JRXE 3T8XA 1Z9SA 2AK1L 4Z5RB 3D0VA 4JFOA 2G5BA 4L9LA 3UYPA 4YBLC 5K59E 2D7TL 2PN5A 1BF8A 4R8WL 1C08A 2OBGA 3IU3B 4YNYB 3TA3B 5GS0H 4PS4L 2OK0H 5GSRB 3LZFH 3C60A 3LKSB 4FQ1H 4F57L 3BRGC 1YEDB 5I8EA 4L8BA 3F8UB 5HHOB 2I9TA 1IJ9A 3KGRA 3T2NL 3ULUH 3L5HA 4N0UE 2OK0L 4PS4H 5DLMH 2F53B 3VRJA 1H3VA 4ZUWB 4JFQA 1KEMH 3S88L 2NY2B 1NFDA 4HDIB 5GGQH 4LAJH 4NUJB 4G7YL 1DLFH 4FA8A 5JW4R 4PJ9C 4EI5C 1I9JL 1XIWB 4PJIE 4U1KA 4BSWA 3LDBB 4O02L 3S4SB 5GS2D 1DBAL 5HGDA 3V6OE 5I17B 1QHPA 3RY4A 4IRZL 3TBVB 4CVZB 2Q3ZA 3TJEH 2H2SD 5I75B 1HXMB 2ZSWB 5K33A 3SPVA 2R1XB 2BNRB 2X5PA 4Y4HC 3CXHJ 1OWRM 4QRSB 1RFDH 3UTSE 3EDDA 2A6IA 2VABB 4JRXD 3EYQC 4X7TA 3MOAL 1JVKA 4U6TA 1H0DA 3FQWA 3QUZD 3QG6B 4HS8L 2D7MA 2W91A 1G9EA 1IC5H 2AXJA 4TUJA 5EORL 2DQDH 3MRDB 2OJZH 2HRPH 1BQHB 1SEBA 4CJ1A 4HK3N 5E7BA 1RIVL 1FG2A 3STLB 3TN0C 3V4UL 2QADC 1KPVA 5JTWA 5JO5B 5DD1L 1I7TA 4LGSB 2X09A 5IW3A 4AEIH 2K3TA 1NC2D 5DJ2A 3T0WA 3FQRB 2XTLA 3C5ZA 2DF3A 5DJXA 4ZUTB 4F7CB 4L4VA 3KPSD 1MI5E 5FYLL 2QSCL 2ZUQC 2VDRL 3B9KC 2IFFL 4RBPH 5IW6A 3ULVH 4PJEF 4RMWA 5I1DA 1S7VA 5BV7B 1B88A 1WISA 3JWDH 4MD4B 4G6JL 3KS0J 3WXVH 3ETBF 3BZ4A 3O6LL 1C5BH 1WFUA 5MENE 1KTDB 3MRGA 4GRWH 3MCKB 4PJAF 1X5FA 4PRHD 3QDJA 5T1LD 2EYRA 1KENH 4L4TE 2E27L 1ZSDA 3O6ML 3N1FC 3O2DL 3V5KB 1FAIH 2A9MH 1HCFX 1CDBA 3HG1D 4YWGL 2E6PA 3LRHA 5C92A 2YSSA 4JQIL 5D71H 4YDJA 4PB0H 4Z7UA 5JIIA 4E0RA 4NKMA 2XKNA 3DYOA 1JFQL 5F7HA 4UT6H 4P9HC 4PBVC 1FL5A 2IC2A 1P2CA 3NTCH 4GQPH 1RZIB 1QBLL 1RUKH 4PREB 4CKVX 4BH8B 4MX7B 1D5ZB 3BH8B 2KZ1B 2VZOA 1IC4L 1X9QA 4OCXL 4U2ZA 3ILQC 4KVNL 4NN7B 1NJ9B 2YN3A 1GC1C 3KLHC 4FN0A 1Z3GL 4P2OC 1D5ZA 3BH8A 4OQTH 5SWSA 3NH7H 2NY6D 1RZIA 3QXVA 4JG0H 3DIFB 4X6BA 3JWNC 1BBJA 1MRCL 3LAFA 5A43C 4XP4L 3QULA 4TOYH 3D39D 3V5DB 4U6YA 2H3NA 3CSYA 4Y8AA 1WT5C 3H42H 1RUPL 1AY1L 1UWGL 2H41A 2Z8VC 1JF6A 3T2OA 3A0OA 4UIKH 4IOSD 5IEHB 5F1NB 2FX8H 2VITB 4U1JB 4PJ9A 3HG1A 2HH0L 4W81A 4GKNA 3CPLA 5DC4B 1B2WH 4PJAB 4LSVL 1HH6B 1VFMA 5KG9A 3V4PH 1RZGB 5CMAA 3DVGA 2XN9B 1Q0XL 3QDMD 3MO1B 1UB6A 4GAYA 3ZL4L 3I9GH 1ZT4A 5JDSB 4LCWD 3C2SA 2DKUA 3IXTB 4M1CD 3NPSC 5IB1A 2Z93B 3D25A 2R4RH 3DARA 4P9HL 4UDUB 5TPWH 5F88A 2VLRD 2X4UA 3AS3A 4ODUB 2WIIA 3A6OA 5T33H 1IKFH 2CDGB 4NQVA 3UPRB 1HDMB 3E6HB 3UTZA 2VL5B 1Q94B 1BZQK 4G43A 3MJ8B 1T5XB 4ZUTA 2E9BA 5FM4A 3ZE0F 1T22A 2E8ZA 3W0WD 2YA2A 4YXLH 1JHTB 4PGBB 2DMBA 5FUOH 4FXLA 4R3SB 3MCG1 3KPQA 3SQOH 3IVKA 3DLQR 2FGWH 4Q58C 1DCLA 1OSPH 3L1OL 1Q0YL 5GRXG 5MERB 1XGPB 4ZUUB 3MRLA 1F6AB 1FZMA 4LF3A 5BV7C 2I07A 4JPKH 4M1DH 4WTXA 3D85B 2VABA 2NCMA 4XNMB 2XFXA 2HTLD 3ZKND 4G42B 2P5EB 3QXTA 5IM7B 3RU8L 3Q1SL 5KAQF 3IDJB 4X0KA 1FH5H 2GJJA 1L0QA 2LU3A 5D7JD 3S4SA 5JZ7C 1R3KB 2XA8H 3C9NA 4BZ2H 4OF8A 4OD2A 3HI5H 2AQ2A 4GW4A 1NFDB 4HDIA 4ZO7A 4ELMF 1JRHH 3WDJA 3D3VD 3TFKD 1A5FH 4S1QL 3LH2H 4J3WA 1NDGB 4LLDA 4EDXB 5BS0D 1IKFL 3SDCD 4NHCL 1X5ZA 3LD8C 3WUWA 2C1PA 1KTKE 3OJMB 4Y1AE 1OM3L 1A7BA 4XCFL 5CKAA 3QWOA 2GTZA 3V8CA 4HUVA 4XNXH 4C4KO 3KLAA 5A3ID 2EYSA 4D0CA 1BQSA 4N8PA 3OL2A 5C6WH 1WBXA 2Y07L 1HYSD 4EN3B 5F3HA 1ZVYA 4Z0BH 2A77H 3DVNB 3V0VA 5B8CC 3D39B 2ILLA 3FO2B 1J1PH 1LMKA 4YUEH 2Z35B 3AREC 4K94H 5C2UB 3TBTA 3RTQA 1FVEA 5GZND 5T1MA 1UWGH 1XZ0A 2F54B 4Y5YA 3J7HA 4NN6B 4XBPB 1AE6L 4TOYL 3VI3E 2YPKB 4FFZL 4CNIB 3OJ2C 1WUNT 1OGAE 3IFLH 1T0PB 3B2VL 1SY6H 4HBCH 1U8LB 1N7MH 3T77A 5JLZB 3VFWA 4F7MA 2FWOA 1S9VB 1E4XH 4HPOL 3CFKA 3FTGA 3BKMH 2IBZY 5D96B 1RK1A 3P4OA 4N5EC 1KC5H 1M71A 3WLWC 3SDAD 1I7ZA 1IC4H 4NQED 4C58B 4KUZL 2EO9A 1L9NA 5ITFA 3QEGH 4M93C 1DL7H 1EGJA 1WF5A 4FP8L 1JI1A 2NY0D 1EHXA 2R56H 5FA4A 3EO9H 1F3JA 4LLUB 5F1IB 1UACL 1JZ7A 2MCPH 3BWUC 4OF6A 4OT1L 4UDTB 3F7QA 3TT1L 5DQDL 4TNVK 3THMH 3RIAK 5I1JH 1RD6A 5E00B 4K7FB 2VJXA 3RGVD 1I8KA 2R1WA 4ORGA 5DK0A 1D5IL 3QZWA 1U8OA 4NKOB 3KPPB 5CEYA 4HJJL 4IMKC 3LCYA 4P46A 3QQ4B 3BPCA 3CDFA 5HSFA 4NM8H 1VPOL 8FABA 3ULUD 1V7NH 3OKDA 3MRNB 1MCBA 2KKQA 3FJTA 5HPOA 5JOFA 3SY0A 1IL1A 1N59A 3VGAB 3H3PH 3CFJA 4CDHA 2VSDA 3QH3A 4WY7L 1X7QA 3STZB 4YPGB 4HPYH 4WV1C 4WUKH 1Q72H 1IAIH 1QVOB 4JKKA 2HFTA 5FGBC 4F33A 1D9KA 2AK4B 1NLDH 4MJ2A 3MLXL 1FZKA 4LVHB 1MIEL 1FGVL 1DLHB 1GAFL 1QRNE 4HS8H 5ID0A 5EU6A 3SCMD 5IMOA 5BW7C 3FFDA 3MXWL 3RWCB 1A47A 1IKNA 1NFIA 5J1TC 2C3GA 1CLYL 3L3GB 4GW5B 3UTTD 2MSPA 3GB7A 1IQDA 3WN5B 5ENWA 1AGCA 1PLGH 3WFCL 1BPVA 4YEFA 1WVZA 1ED3A 5I1EH 3HZMA 4O51A 2BNUA 2BVPA 3BRFA 4RSVA 5ICYB 1AXSB 1YA5A 4ALAL 2BOBA 4GXVH 3OAUL 4YHKH 4BK4A 3GSNB 3LS5L 1TZIB 5GIRA 3UPAA 3PABB 4OD3H 2E8YA 4XVTL 5CILL 4Z7QE 3U7WH 3PDOB 1KCSL 1X5AA 3KWWB 5D4QA 4XH2A 1C1EH 5JPNA 1K9TA 4XTRD 4NUGL 3QXDB 5H94B 3MV8E 4GAFB 5I18L 2YUXA 1C12B 1JZ4A 5DR5L 4P2OD 4NWTL 3RY5A 4R8WH 2ITCB 1FV1B 3RQ3A 4GOSA 4JHWH 1J1XH 3TO4A 2A0LC 3CD4A 4PJIB 1OAZH 1AR1D 1PKQA 4I0KA 4K7PY 4N0RA 1VEPA 3C5JA 1B4RA 5E2VL 3AAZA 2OQJB 2E6QA 4ONGL 1CWVA 1JPFB 4OD1H 1CK0L 1NC2A 2Q8AH 1NCNA 3VRLE 43CAA 3RIFF 3BWAA 1MFBH 2EDWA