5FYJD

Crystal structure at 3.4 a resolution of fully glycosylated hiv-1 clade g x1193.c1 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122, 35o22 and vrc01
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
242
structure length
242
Chain Sequence
QGQLVQSGAELKKPGASVKISCKTSGYRFNFYHINWIRQTAGRGPEWMGWISPYSGDKNLAPAFQDRVIMTTDTEVPVTSFTSTGAAYMEIRNLKFDDTGTYFCAKGLLRDGSSTWLPYLWGQGTLLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKGLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GP41 ENV ECTODOMAIN
publication title Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B and G
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 36
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fyjD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fyjD01
1NSNL 3NIDE 4MJIE 3GMRA 2W38A 4NGHL 4YHZL 4D8PB 5KSBB 3QCVL 4C56D 4H0GA 2BDNH 3ILPA 5DRXB 2APWA 1KF9B 3W11D 1QRKA 4HUVA 2EKJA 1FRGH 2HN7A 4GRMA 3CMGA 1N3NB 2VLJB 4QHLB 4P46C 1OLZA 4K3DL 2W60A 1L6ZA 4ZDHB 5EU6D 3STZB 2MPAH 2FL5B 3W39A 4Z7OE 2NY2D 4PGCB 5T3ZE 5GSRA 1RSFA 1M7IB 4LSRL 4S0TD 3TLRA 4I0PC 1XR9B 4JN1L 1DVFA 4HKJA 5DJ0A 5CEZE 2YKLL 1D6EA 3IKCA 3MXVH 3QXWA 2BNQA 1KJ3L 1IAII 1UWEH 2E8YA 2EDOA 4OM0H 5F88B 3MJ9L 2UWEF 1CDHA 1KIQA 2OL3H 3MNVB 3U7WH 3P11H 1S9VA 1WAAE 1F4HA 2AV7B 2IANA 5GHWH 1U36A 4FS0A 3RY4A 4JFEA 3KJ4B 3VXPB 2VWEE 4F33A 4YLQT 4P46A 1IM3B 3ORJA 4GSDH 4ZOBA 5IOPB 3NACH 4HEPG 1A6ZB 2FB4H 2AJVH 3S36H 1M7DB 3CSPA 4U1LA 1ZSDB 3E0GA 4LVOC 4LCYA 4J1UA 1II4E 3BAEH 3DXAB 1CK0H 4I0PA 2R69H 5JQHC 5DD1L 3W5MA 1OGAA 3VXSD 4HGWA 5LCVH 5CFHA 1K2DA 1OP3K 2CD0A 4U6XB 4KKBD 1RPQA 2E9BA 1FAIL 3BDXA 2DMCA 5IB3B 5I8KH 1JYWA 3TNNB 4QHMB 1A64A 2Z91B 2G75A 3HI1B 3VI3E 1U92B 5CGYD 1CICB 2YD5A 4XNUH 1FNHA 2AK1L 2ID5A 3BGMA 3E8UH 2H9GA 3KPPB 1ZAGA 3N9GH 4JPWH 2H2PC 4KV5E 2J6EL 3G5ZA 1JZ6A 4ZD3L 3CAFA 3B9EA 4JQIH 2CKBH 4PRIE 5ETUA 4CVXA 3UPRB 3GDBA 1JZ8A 1K6QH 2BJML 4JFPB 5D93B 2R56L 4G80A 1QSZA 1NEUA 4PRHA 4YGVA 3ARDB 1AC6A 2AXFB 5LJYH 1J1XH 12E8H 4KZEL 4KDWA 1YNKL 2C3VB 4Q0XL 4LOUD 3TWCL 1YNTA 2R2BA 3ARGC 4X9FA 2AK4E 2Y6SC 4BUHA 5B8CC 1QUNA 1YN7B 1KLFA 5SWZE 5JHDD 3BPNC 1Y0LA 2OJEA 3O2DA 2NZIA 1G7HB 1N8ZB 3HMWL 1BQLH 2NW2B 2EYTA 1HXYB 1X5FA 4HCRA 3MACL 3AM8C 5CGMA 5IWLC 2D0GA 2AXJA 2W92A 4X6FB 4CU7A 3WFBL 1M1SA 4IMLB 1BVKB 3TEUA 6FABL 4MB3A 2VDKL 1FNSH 2HFGH 1F90L 1ZT1A 1E0OB 4XNXH 3EYSH 5HI5C 1MFBL 1QTYT 1FNEB 5I73C 4GRWF 3BRDA 4RQQB 3QDMB 3GSUB 3MFGB 3O4OC 3PWLA 1RJYA 4PJAF 3ARGA 4PJBA 2P47B 5B8CA 1YEGH 1G9MH 4GS7B 2NPLX 5CILH 2CSPA 3UTZB 5I6XC 1V3LA 4QWWD 2DLIA 4F3FB 5CP7B 3V5HA 1FCGA 1K8IB 4GKZA 2FIKA 1B4JH 5FB8A 3BZEB 1OAZH 1UENA 3NCCB 2AEQL 3T65A 4M7ZB 4NQDA 3AM8A 2ZG1A 1YMMD 5CEXA 5IWLA 1TVDA 4KQ4L 5CBEA 2F54D 4JFHE 2HH0L 2W9EL 3TV3H 1TJGH 1TETL 3V0VB 2DQUL 4OUUA 1JK8B 2XQBL 4HUXB 4Y19A 1NAMB 1HIMH 4PJXA 4HIIA 2EDXA 3OKLB 1FFOB 2A2QT 4YHKL 2KZ1B 3SJVE 4QNPF 4Y4FD 3OR7B 5CS7A 1DLFL 1RZ7H 2BNRB 4Z7VE 1YEHL 3REVA 3QEQA 3L95B 1YEEL 43CAA 4CMHB 1SYSA 3VD7A 1FVEB 2V5SA 5H94A 1AXSA 1FIGL 1LEKB 2YD8A 5F9WC 3RQ3A 5EBMB 1EUTA 3X3FL 3F7RA 2WUCH 5EOQL 2HFEA 1JF6A 4X4MA 1BJMA 1CF8L 3V95A 2G5RA 4H1LG 3VXQB 1OM3H 3U4BL 3S3PA 5DMJB 3RNQB 1GZPA 3DV4B 2BVPA 2ADGA 2XFXA 2WUBH 1SMAA 4OUOA 2Q7YB 3QXDB 1UH4A 3VGDA 3QH3B 3O6FB 2CR6A 4WUUB 2H32H 3DSFL 1FG2A 4AYFA 1P6FA 4JFFE 2XY2A 3TJEH 2YA2A 1MAMH 2O61A 1JF1B 3MNWB 4O51A 3WNNA 3VWJB 4EDWL 5HGAB 1A1OB 3D9AL 4PJAA 4R90L 4OLXH 2O26U 1KIUA 2FSEA 4PJEE 4FXKB 1JFQH 3EGSA 3PQYE 4LDLB 2CJUL 3RL2B 3MX0A 4U49A 1X5GA 1JMZA 5TF1H 4HV8A 5IMKA 4LCCC 3ALPA 1T20A 1X44A 5DO2D 5HYIA 1NGYA 2VR9A 3LPWA 3C60C 2DQIH 4NBZB 4D9RD 2Y7QA 1HCFX 5CBAA 3L3OA 5T5FH 4JREB 3O2WL 3VWKD 4M7KL 2DJ4A 4LP4A 4GW1B 1I7TB 4JRYE 4Z78A 1AC0A 1OD9A 1GHFL 4QTHB 3EFDH 4GAGH 4NHUB 2EECA 2ZSVB 5D6CB 1YY8B 3O6LH 5E9DB 1BJ1J 3QPQC 5D7IA 2PYEE 1P7QA 2FJFB 2PCPA 5ITFB 3ESVF 3CU1A 1WWCA 4X5WB 1VGKB 5FDWB 3G5VA 2XIDA 2CGRH 4LCCA 2C26A 4NO5A 4XRCB 3QJHB 1N6QH 3N1PC 5LAXA 1FNFA 3C60A 4J12A 3I85A 4H8WL 1SQ2N 5T3XE 5EG6C 3LN5A 2B1AL 3QNYB 2NY5C 3GSNH 1F4XL 1N2RB 2V5RA 2ZNXA 5CWSA 3F6LA 1I1FA 1F13A 2CO6B 3BP4B 1H8NA 4NN6C 4RCAA 1K8DB 5TDOA 3DX6A 2OZ4H 3ULUF 1OCWH 1T0NA 3QUZB 1X3DA 5HDLA 1X4YA 3TH2T 4M43L 3VG9B 2CUIA 5FKPA 5I75B 1P6AB 1ZHKB 3T3MF 1VSCA 1FL6A 3IDXH 3VH8G 2VTFA 4P49A 3F5WB 3NOIA 2WW8A 3X13A 1CL7L 4LSQH 5TQ2H 4P5TC 4XBPA 3MLSL 5GGQL 1I1RA 2NY1D 5GS0D 1ZXQA 2XG4A 3BEWB 1GCFA 1JNNL 4BH7A 3BKML 2LU4A 4UAOB 3NFNB 3C5SA 4MNHB 1S5IL 2GK0A 5K93A 2QSCL 1B88A 2Y06L 5ESQB 1EZVX 5E7BA 1K3IA 1DQQA 4OF7A 2IBBA 3BHBA 2J8UB 2VDQL 5C09D 5D5ME 3HPJA 2EICA 3OAYH 3ZL4H 3ISWA 5CZVH 4XP5L 4LIQE 4TYUA 5C0BE 2KBGA 1RUPL 5ICZB 1EFXB 1ZA3B 5ADPH 4YPGA 5KVEL 4P4KB 4KZDL 5MENA 1S9KC 3QA3A 3UBXA 1IFHH 5GGUA 3ULUC 4P99A 4WENB 2AABH 5D1QC 3AROA 5DFWH 4KH2A 3HC4L 1RJZB 3V79C 4P5TA 1RUAL 3VJ6A 4P5KB 2ZUVA 2OR7A 2VISB 4YIQB 3CCHB 5IIEA 1PG7H 2D4FA 3FHQA 1P84J 1CL7I 4L4TB 4JFXB 1PQZA 1OF2B 1LE9B 3SDDB 3IXAB 4PJGB 1FO0H 4LVHB 3NAAL 4U1GB 3R8BB 3KPLA 5D7KE 4OSUL 1TNNA 1IGFL 4J3TA 5D2LB 5JQ6L 5HSFA 3TBWB 3LPFA 5GS0L 4XNYH 3GMMB 2YPLD 1MQKL 1FYHB 2Z8SA 4G6JL 1ZLWH 1KTRL 3HZVA 4RFOH 4CNIA 2EDNA 3IFNH 3PDOB 5D1QA 1R24A 2DYPB 3O6MH 3C6SB 2DI7A 2VL4A 4OI8A 4XCNA 4QRRD 1ND0B 4RGNB 2ITDB 3MV11 4GMTL 5LWYL 4RIRA 3ULSB 2F5BL 5KN5B 3GMQA 2Z92A 1U8HA 2YD3A 4L3EB 4PY8I 1CLZH 1R5VA 1I1YA 4KHTH 2GT9A 2YRLA 3VD5A 3D18A 3BD4A 1UZ6E 4LARH 4DN4L 2YXFA 4PGBA 4ZOEA 4QF1A 5FA3A 5BVJA 1IE5A 3U36A 1T04A 3KS0H 2MFNA 5F7FA 3BE1L 3BDYH 5MEPA 1BFSA 1LO0L 1FFNA 1HHGB 2YK1H 1CLCA 3MRKA 4WIQA 1QFUL 4LGPB 5KVGL 1B0GA 2W0KA 3DGGA 4QOKA 4C54A 4U1IB 1C8PA 1BZ7A 1UA6H 5EOTB 2QKIB 4YXLH 4BZ1L 4ERSL 5I9QC 1KXVC 3BX7C 4PRPE 1T03L 2AJXH 5I8CB 1DQJA 4ZTOH 4WV1B 1BM3L 4OZHB 3IFLH 2C5DC 5GISL 3U2SA 3AC0A 4HH9A 2MKWA 5FUZH 3MRQA 4CVUA 1BIHA 4ZUWA 2JELL 4KJQD 3QFJA 3TVMB 4NM8L 4JR9L 4UIMA 3RVUC 1LNUA 3FN0H 5BJTA 3ARYA 4F37K 4KUZL 2PXYC 3BVNB 2QADB 1VEPA 4LLWA 1FFRA 2J8OA 3LB6C 4PB9H 4WI7A 1Z0MA 4KQ3L 4PJIA 4PRBA 4PGDA 1Q94A 1TDQA 5TE7L 3ZE1E 1NEZG 4L29B 3QUYC 4AEHL 3LV3B 4H20L 4JY4B 3GMLA 1A4KB 1A2YA 1T4KA 3G6AA 2I9LA 4Y4FC 1BD2E 2D2OA 4L9LC 1FZKB 4XPBH 2YR3A 1MREL 2CO7B 4BKLB 5D1ZD 1W72L 4N5ED 5ACLA 5C2BL 3ARBB 4XPGL 1D5XB 4UOW1 1GPOH 5ID1B 3G5YB 1N0XH 3CDFA 5HGBB 3DHJA 3G6DH 5DVLA 3GJEA 2OP4H 2PXYA 3RDTD 3KXFA 5EU5B 1INQA 3L5XH 2Q8BL 1RIUL 3OKDA 1BFOB 2YN5A 2R29H 3SKUD 3U30B 2FLRT 5CJXA 2BY1A 3CX2A 2DQFB 4J3VA 4OV6F 3D85B 2P45B 1MJUH 4TPRL 1KELL 5IQ7H 3C9NB 3LH2L 3QUYA 1Z9OA 4PREA 3RJDA 1ZOXA 2NY6C 4F7TB 2K7PA 5DZLA 5A3ID 1QQDA 1I3GL 4O58H 3FB5A 4Y4FA 3U1SL 3WS6C 1FJ1B 4BZYA 2VLKE 4HJGA 2VB5A 1QSEB 4L9LA 1HE7A 1UB6A 4OZIF 5ANME 2G2RB 3GRWH 3FFCD 1RIHL 3O4LB 4F58L 1J88A 2QQLH 3HI6L 3TC9A 3FB6B 3TT3L 1UQSA 3QIUC 5C08D 3IDJB 1P7HL 1QSFB 5BZDB 5IGXH 1F58L 4PJ7F 2CQVA 4NYLA 1I8LC 4ZO7A 2YEZB 4E41D 1NFDE 5C0DB 1F4AA 3H3KA 3VFWB 5LXGL 1N5AA 2EYSA 2XTJC 1C5BH 1VERA 4JO3H 1T22B 1F8TL 1IKFL 5GJSL 4FQ2L 3JVGC 5DK0B 3WS6A 3QXAB 3LQZB 5DK3A 1CBVL 1CZ8L 3TH4T 4FN0A 4XBEH 3QHFL 4NNPH 4Z9KB 4R6UA 3ROLB 3TZVB 2IPKB 2VDPL 1KNOB 4KROB 5KZCD 3QIUA 2ZOLB 4G8IB 5E6IB 1RK0A 2WIIA 4DFIA 1QRNE 1I8LA 1I3VA 2RFXA 3N85H 1XCTA 3RWDA 2V2WA 1N5YL 4GG6A 3GZKA 5I1LA 4AG4H 1IAOB 3KPMB 3ZKND 4XMPL 2BMKB 1LWRA 3TCLA 4KKNA 4HQQL 3MXWH 4C83A 4FQHA 1FPTL 3A6CH 5A2IH 4PD4J 2VR5A 4GBXB 1MFCL 4WEBL 5DD6A 1FV1A 3PP4L 1MHCA 3O11B 4P2OB 4JDTL 3JVGA 4LLMB 1S7UB 4KTEH 2FBOJ 4NQCB 2VN7A 1F4WH 2GTWA 1OSZA 2V7HA 4YR6A 3W0WA 4NCDA 4ODUA 3RWFA 4HJJH 2AJZA 5L8JB 3GB7A 4Z95H 3N0PB 5SWSB 1AO7D 2NR6C 4F7CA 3MBXH 3HB3C 2OJZL 1D5BB 5E03A 1UCBL 2X4NB 2PTTB 4ELMB 2AV1A 4MNQB 2A77H 5I17B 2XZQL 3LKPA 3L6FA 3VFSB 1HILA 1MAJA 4O2CA 2Y9RT 4Y2DD 4EQ2A 2CIIA 1FGNL 3GSRA 3PHQA 3O8XD 2UUDH 4GKNB 4JJ5A 4ZPTA 5MP6H 1OQOA 4M62L 4XHJD 4PJDB 1DSFH 1LDPL 1EZVY 1RIVL 2VE6B 1V7NH 1PW3A 1QKZL 2DQDH 3WFEH 5GZOC 1LP9A 3T0ED 3KR3H 4HAFA 2ARJB 4KC3B 4HHAA 1EIBA 1Q9LA 2ARWA 4YK4B 4ONFH 4TSBL 5CJOL 3TBTB 3EDDA 1SY6L 1F00I 4LF3B 2APFA 5F9OL 4OQTA 1OTSC 2EDRA 5I8OH 3E2HC 1PSKL 1PKOA 4IOFC 1AIFA 4PUBL 5I30L 3DETD 2D03L 3GI9L 5F70A 4KGLA 2ATKB 3DI2B 1VGEH 5DRWB 5CSZA 1KPUA 2X4QB 2N4IA 5SX4H 4FQQA 2VQTA 3CVHL 4ODTL 4NWUH 3WHE0 3WIHH 1GGCH 4WGWB 4Y4HD 5F3HA 1VADB 1ORSA 4F8TA 3DMMC 2G5BA 1Q9WA 3MRMA 2NW3A 2OK0H 1V3JA 3DYPA 5C7XL 4CADA 1T1WB 3OXSA 5TGBA 4NZRH 4MZ3A 3BPLB 2BFVH 4LSSL 4N68A 3RIFK 5BV7B 4HWBH 5E56A 4ZUSA 5BO1L 3ZDXE 5I1JL 5ABDE 2QQKL 4KMQA 3VH8B 2W0FA 3GSWB 3HMXL 1CGSL 1I3UA 1FC2D 3ZDYF 5MEQB 3KAAA 5JZ7D 4N8VG 4I48A 2E6PA 4X5XA 2GSIA 2Z31D 5JLZA 3S4SB 3WFDH 1D9KB 1A6UH 3BT2H 1BAFH 4DEPC 1O7VA 4DVBA 4Z7QE 1HOCB 4RA3A 1IGTB 5BQ7A 5ALCH 4CJ1A 3PGFH 3DMMA 1CFSA 2KZWA 2Y36L 3GI8H 4ORGA 2VXUH 5GSVB 4CU6A 4U1KB 3BW9A 4ZYKA 1G7MB 1RJLA 4XP9L 3HG1D 1HH9B 1F3DH 1VHPA 1IMHC 3HE6B 2HT4D 3GBMH 5DJ6A 2YHGA 3GK8H 5C0FB 32C2B 3MZTA 3ZSTA 4OCYH 4CW1A 3EYQD 3D5OF 4HPOH 1NC2B 4PJ5B 5TDNB 4OLUH 3AU1A 4ZFOB 2CDGB 1NLBH 4OLVL 4X83A 1U8IB 5IP4A 1A7NH 3SDAD 1OLLA 3OL2A 1YUHB 3OJDB 3UROR 3NBNA 4FFVC 4EUPA 1OD7A 3L3GB 4BSWA 4KTDH 3PWUB 1A7PL 5EUOE 1ED3A 2NCMA 4KJQC 4AM0B 3JUZA 5FYJH 3CFBB 3JWDL 5HHNA 3WIFA 1A3LL 1H5BB 1YNLH 3ARVA 4H25B 1KJ2L 5CZXC 5EO9B 5I71B 3UZQA 4V1DE 3MLRH 1TIUA 4FP8L 5BRZB 3CPLA 5L8LB 1KEGL 4LHUB 5EU3B 1A5FH 5HGDB 4H88L 2IC2A 3LEVH 5KSBA 3BOVA 4D8PA 5DK2B 4NO0B 5DRXA 1DLHB 4FFZH 3B4NA 1A4JB 2YD6A 2HVJB 4AT6B 1N3NA 2VLJA 4QHLA 1RUMH 5CIPH 1IGCH 3BN3B 5DHVB 3RA7H 3STZA 2FL5A 1UWXH 5DMIH 5D1ZC 5JXAH 3SE9L 5F1NB 4ZFGH 2BK8A 1A3RL 1CU4L 1GGBL 1M7IA 1A6AB 1XR9A 4M61B 3UTTD 4F7MB 2RCSL 3SDYL 1FGVL 2BCKB 5IK3B 1CTNA 1QBMH 4S11A 4GMSL 4JQXC 5F88A 3WDIA 4D94A 4M5YL 5EZIH 3UC0H 4TOYL 3D69A 3MNVA 3LKRB 4YDKL 2AV7A 1CICC 2F74B 2XKNB 5CEZH 4P5MB 4PV8B 3ULVC 3VXPA 4KRNA 4LCUB 4C58B 1YZZA 1IM9B 4M1DH 1IM3A 1CFNB 2JJUA 1ZHNB 2DS4A 4MA8H 5FCUL 5IOPA 4W6XB 1A6ZA 5D1ZA 3FRUB 1MNUH 5KVFL 1M7DA 4JZOB 1MWAA 1ZSDA 3L3IB 3DXAA 5D93C 1GGIH 3ARDC 1L9NA 2EIBA 2IG2H 1ACYL 1KEML 3OKOB 4NZUL 5FGRA 3BN9D 4NOBA 4WFGD 4U6XA 5C0CB 5E5RB 4X8JB 4JQXA 4LPWA 5IB3A 3IFPB 1UT9A 4YUEL 2GAZB 3CU7A 3MREB 3TNNA 4QHMA 5F7EH 2Z91A 4OGYH 3MGAA 5DQDH 1RURH 3HI1A 5HDQH 3D39B 3OMZA 5IBLC 1U92A 1FC1A 1CICA 3C08H 4ENED 5CEYB 3KPPA 1CT8A 3BH8B 4EEEA 2DMBA 4YGAB 4KFZC 3I50H 5IVXE 4QKXB 4KI5D 4Z7UB 5CUSH 1BREA 1YYML 3X17A 3BDBA 4AQ1B 3V5DB 2DQCH 3OPZL 1MFEH 3HZMB 3EYVB 3G5XB 3MLUL 1AGCB 3UPRA 4L8CB 4DKEL 1RHHB 4POZD 4JFPA 5IVNA 4X4XB 1PX3A 3B2VL 3ARDA 2AXFA 3BGAA 1RJCA 1DBJH 1H3PL 3F65A 2IGFH 2KQNA 3FQWB 5LVEA 4E41A 3LSOB 3K46A 4JVWA 1PY4A 2YA0A 1YN7A 5L2KB 4X6CE 4MXWH 4GS7C 4UDTB 3M1BB 1MQ8A 5IB2B 1G7HA 5KVDL 1N8ZA 3MLVH 2NW2A 3MBED 4MQ7B 4XCFH 4GLRH 1HXYA 4M7ZC 5FYKU 4M9PA 4LP5A 3H9ZA 1RUQH 1IC4L 4NSKB 4IMLA 1BVKA 1NBVL 3NN8B 1OB1B 3HC0B 4OJFL 1ERNA 1M05B 2WV3A 3CXDL 3V52L 3DRTB 1AE6L 5AG9A 2H8PA 3CH8A 2ORBL 4NKDB 4JAMB 4DGVL 1A1NB 3VGHA 2X9WA 4RQQA 3QDMA 3GSUA 2JKXA 5A2FA 3S96B 3MFFB 2AAVA 1NH6A 2GQHA 1MI5D 3RTQB 3UTZA 4P2QE 4WW2B 5GS1B 4F3FA 5CP7A 1K8IA 5ACMA 4D3CH 3BZEA 3RGVB 3PP3K 5C07D 3QUMB 5JO5B 3CFCL 4XNZB 4QXWA 2FHBA 4URTB 5HYSG 1WGOA 2GJ6B 4ODVH 1QO3B 3CVIL 4PS4L 3MV9D 4XVUD 4OB5H 4YBHA 3V0VA 3JTSB 4EZMA 4NQTA 1NCCL 4HUXA 1NAMA 3QWRA 1DUZB 2VQ1B 3O6FC 2YSSB 3OKLA 5FFLA 1FFOA 1FG9C 1KTLB 1IT9L 4IOIB 1WCBB 4WDIA 2P8PB 3OR7A 2ED7A 2BNRA 3BSZL 2DQEL 2UYLB 1DBKH 5HHVL 2H6PA 2F19H 3L95A 3WE6B 3VWJC 1HSBB 4PB0H 1FVEA 5ERWB 4ZS6C 2WLZA 1LEKA 3KJ6H 3NFPB 2R0KL 1XGUB 5EBMA 4LCWD 2DDQH 4PP1D 3QIWB 1EGJA 4ZAKB 5INCB 3UZEA 1LK3L 2RIKA 3VXQA 3KPRE 3DVFA 4CGTA 3DV4A 3QDJB 3EZ8A 5EIQA 2Q7YA 1WVZA 2EE6A 3QXDA 4PLOB 2VR4A 3O6FA 7FABH 3LQAL 4WUUA 4WEUD 4ETQB 2V9QA 2AEIT 4TN9A 3ECBB 1CLOL 5DLML 2DICA 3IFOB 4D9QE 3IRZA 1QFWL 4JREC 3NA9H 1D5ZB 3EYOB 1JF1A 3MNWA 5IFJB 3VDBA 3VWJA 4AIXA 4JO2H 5KS9B 3QG7H 5HGAA 1A1OA 2IFFL 3DV6A 3K1KC 3TGXA 4XP4L 4M6NL 4HWEH 4FXKA 4RWYL 2XNAB 3VXUE 2X1XR 3RL2A 1ADQH 4X80L 3TBYB 3W5NA 1RMFH 1G6RL 1CXEA 2KDGA 2FCBA 2FEEI 4YO0B 4HC1L 4NHCL 1OAQL 4MLSA 5FKAB 4DOHE 1JZ2A 4OD1H 4ONOA 2HT4C 1U3HB 1QYGH 2BDNL 1RAMA 4G9FD 5K9OB 3NGBB 1FN4A 1FRGL 2VDOH 4XVTH 5I1GH 1D5MB 4G8GE 2J8UF 4N0RA 3HAEH 3TNMB 1E6JH 3TFKD 4GW1A 1I7TA 2MPAL 3PJSB 4UOW0 1H3VA 5D9SB 4KJPC 1XGTB 5H2BB 4QTHA 4U3CA 5FUCE 5DFVD 1QFWI 3FT2B 4NHUA 2DLHA 2ZSVA 5D6CA 5DJ8B 1YY8A 1P4LB 5E9DA 3QUZC 3AMLA 1F3RB 1C08B 1HHJB 1E4WH 2FJFA 2X44D 3VG9C 3MXVL 5I75C 1TITA 5ITFA 3V6OC 2J3SA 4X5WA 4BQ8A 1UWEL 1VGKA 4AEIH 5FDWA 5E08H 3S36X 2X42A 1T0MB 5JIKA 5J11B 3D3VD 4GRLD 4XRCA 2OL3L 1N0LA 4KHXH 3QJHA 3U7WL 3P11L 4W4OC 3PF2A 4EQ3A 5GHWL 3VMOA 4NQSB 3RKDC 4PJGF 4I13B 2IH1B 4M4RA 2OTUA 5D2LF 1NAKH 4EXKA 1LO3H 4N8VB 2DWDB 3QNYA 4KK5D 1N2RA 4GSDL 3NACL 3BIAX 1JGUH 2FB4L 5SX5K 2AJVL 3S36L 2IMNA 1K8DA 3T2OA 25C8H 1MHEA 2XPGB 3BAEL 4OD3H 1QP1A 1W0WB 1CK0L 3B8YA 4KMLB 2R69L 3QUZA 4O2FB 5IBUG 5LCVL 3VXME 3AVEA 2I9TB 4R0LB 4FNLH 1ZHKA 4P4KC 2P5WD 3V6OA 3T4YA 1M6OB 4NN5B 3LKNB 5I8KL 5B3JF 2LU7A 1G7LB 3F5WA 4ZO9A 4MXVE 4W4OA 5EC2A 3O3BB 5D7JD 5J13B 4XNUL 1Z5LB 3E8UL 4FRWA 4PPTA 1DZBA 3JV5A 4FA8A 1JPSH 3QQ9D 5F89B 3MLZH 3N9GL 4JPWL 3BEWA 3LMJH 4JQIL 1AJ7H 3NFNA 4MNHA 2CKBL 2VUOA 5ESQA 2NX5E 4ZUUA 4LVHC 2YN3A 5CKAA 4KI5F 4U1GC 1K6QL 3CVHB 1KYOJ 2J8UA 1WWWX 3FQRB 1J1XL 12E8L 4LGRB 5ICZA 1EFXA 1ZA3A 1MRDH 4P4KA 2CIKB 1QLRB 5HTSA 1DE4B 1RFDH 1RJZA 1KOAA 4P5KA 5I1KH 1HDMB 2WWMC 4RGNC 2DM3A 2VISA 4YIQA 4OZHF 5MERA 4G43B 3CCHA 4HAGA 2D0HA 1BQLL 4KVCH 5F7YC 2VIRB 4L4TA 4JFXA 4CUCA 1OF2A 1MPAH 4ODHH 1LE9A 4QXGL 3IXAA 4PJGA 2E9WA 3NABH 1FNSL 2W65B 4CMMB 2F58H 5BXFB 2HFGL 5D2LA 1L0QA 1MCWM 4XNXL 3OG4B 3EYSL 3TBWA 3VG0H 4HT1H 4S2SB 3GMMA 2Y5EA 2XYCA 3FO2B 1J10A 2CUHA 2J5LB 3PDOA 2AP2A 2DYPA 1YEGL 3C6SA 5K33A 1G9ML 5CILL 3CJJA 4EI6B 3QIBB 4R4BA 4AL8H 2VXSH 3NCBB 1ND0A 2ITDA 1DBBH 4JZNB 4NP4H 3MUZ1 5DMGC 3ULSA 1B4JL 1H15B 4OKDA 1OAZL 2MCPH 5KN5A 4L3EA 2MTPA 5INDB 4I18B 4FQJH 2HLFD 1S5HB 4WV1C 4OI7A 2ZUSA 1I8KB 3O2DH 3TV3L 1TJGL 3ZKMD 3LPGA 4LAQH 4U6HB 1RV6X 3TVMC 1HIML 4HCRH 4QRUB 3VW3H 2NY4B 1HHGA 2QADC 3TP4A 5IBTH 5JPNB 1RZ7L 4GG8B 3OAUL 4U1IA 2V17H 5EOTA 5HHQB 2QKIA 5ICYB 3T2QA 4RNRB 2XA8H 2DBLL 3U7AA 2RB8A 4OCNC 2WUCL 1MFNA 3PWPD 5I8CA 4WV1A 5KVMC 2MKLC 3P0VH 4N1HB 4OZHA 1OM3L 2UZYB 2ESVB 4EBQH 4I0CC 4YZFE 3WD5H 2EKSA 3ARBC 3REWB 2WUBL 3TVMA 1O0VA 3HN3A 3ZLQC 2A83B 4WI9A 1AKJD 2XN9B 1FHGA 3BVNA 3MRLB 1S78D 2NY0B 3R8QA 1ZHBB 1L4IA 2BVOB 3TJEL 3U30C 3VGAC 1MAML 2EDFA 1I9JH 1GGYA 1Q72H 4UT7H 5DEZA 2WLYA 1RD6A 4P3DB 2N1KA 1C12B 5EBWB 1KB9K 4L29A 4OCMC 3UTSD 4WFFD 3RPIB 3LV3A 3TN0B 1ULVA 4JY4A 4GFTB 4OLXL 1A4KA 3QBTB 4KRPD 4ZQKB 5LKNA 2ZUXA 5D2NE 5DJ2B 3O3UN 1FZKA 5TF1L 3VRJB 3MJ8B 2ZOKB 4BKLA 4HIEB 5DF0A 2JB5H 4P2RD 3ARBA 1D5XA 3GMNB 5ID1A 3FOLB 4N0UE 4YHNB 3G5YA 4OZGE 1PKQB 1J0JA 2ADJB 4RMWA 2DQIL 4TUOB 4G6KH 5HGBA 3O41B 1GOFA 1RZIB 2WBWB 5EU5A 3QZWB 2VLRE 3MLWH 4LSPH 3RVXD 2YOCA 1H0DB 1BFOA 1PVHA 5T5FL 2DQFA 3D85A 5D4QA 1MCNA 3C9NA 3EO9H 4GAGL 1PEWA 1KT2B 3H9SB 3O6LL 1G9NC 1XIWD 5CSGA 4F7TA 2AQ3A 4XC1H 2FX8H 5DQJB 1FJ1A 1A6VH 1QSEA 4RAHA 1EK3A 4GRWH 2LVCA 2CGRL 2G2RA 4MJ6B 3MYJB 3TZVC 3O4LA 3HI5H 1N6QL 3FB6A 5HYSB 2C4FT 5AG8A 5E6IC 3IDJA 1QSFA 5BZDA 3BUYB 1F4YL 1CE6B 3K4ZA 3MJGX 3S6CA 5IFHH 5JW4M 3Q6FB 4ZNEA 4RAVB 2YEZA 1SMOA 4Z0BH 3VA2C 5C6WH 2UY7A 2VXTH 4HF5H 5BS0B 5C0DA 3GSNL 4JRXD 3JV4B 5DZOA 4MCYB 2C9AA 4D0BB 3VFWA 1AD0B 1KFAH 4PJDF 4PY8J 3VD3A 5FHAH 3LZFH 1E4KC 1T22A 2OZ4L 4MJIB 3LKOB 4IIQB 5E9DE 4GBXC 1J8HD 1OCWL 4JGMA 4P2OC 5IQ9B 5DK0A 3RX8A 3QXAA 3LQZA 3QSKB 4JM2B 4OQ1A 4HGMA 5FOJA 4JVPA 2PYFB 4NM4H 3IDXL 5EO0B 3DIFB 3ROLA 2UWEE 3TZVA 1KNOA 3OBAA 3AXLB 3P77B 4LSQL 5TQ2L 2ZOLA 5J12B 4G8IA 5E6IA 1F6LL 1BQUA 4RMRA 4H1LA 1U8OB 5GGSB 2BRRH 3CZJA 1IAOA 3KPMA 2MSPA 1NGPH 3NCMA 1MIMH 2BMKA 1UH2A 3BKCH 2MQ3A 2EO9A 1U3YA 5E95B 1E4KA 4DZBA 3VXRE 4DAGH 4GBXA 3VDAA 5EA0H 1PG7X 4ZO8A 3O9WB 3ZL4L 3O11A 4P2OA 5CZVL 5F93C 4LLMA 1S7UA 2D7TH 4NQCA 4UNUA 5ADPL 4KMTH 4LASH 1C16B 3ZKQD 2OTWB 4JFDD 1IFHL 2LABA 2GJ6D 1A7OL 2AEWA 5SWSA 5FAAA 1AQDB 1IAKB 5ISZB 5IMMB 4L4VE 3ILQC 3GMPB 1SJHB 1UB5B 4JQVC 1P69B 2PTTA 2X4NA 5DZNA 4ELMA 4RZCB 5I17A 1O5DT 4KJWD 4DJMA 3MV8E 3EJZD 2NY3D 4YK4C 1PG7L 1BF2A 3VFSA 2EEBA 4WEMB 1TFHA 5DEFB 3EJYD 1J8KA 1FO0L 1UWGH 1NKRA 3UTQB 4GKNA 1KLGB 4XNYL 2NY5H 4PJDA 1HSAB 4RFOL 4F37F 2VE6A 3IFNL 4LBEB 5HXMA 3G9VA 3O6ML 4M5ZH 4PRIB 3MRIB 2HLAB 5ICXB 1JN6B 1IBGH 2O5ZH 4JQVA 2ARJA 5KW9H 3BPLC 3L9RB 4WI5A 5BV7C 1OTTC 3SE8H 3WXVH 3TBTA 1I4FB 2GYSA 5H35B 4LF3A 2KL6A 2P5WA 5DXWA 2Y07H 3TBSB 1CLZL 3EYFB 1VENA 4KHTL 4TSAH 2AK4B 2ATKA 3MRFB 5DRWA 4LARL 5SWZB 3SQOH 2FHCA 3RU8H 1FL5B 3SDXE 2X4QA 1BQHB 1D9KC 1U2HA 5DR5H 5CJQH 3BDYL 1MCWW 5E8OB 3VXNB 1L7TH 1WIUA 3RUGF 1VADA 3LKQA 2PNDA 1D6VH 2YK1L 4P2CG 1JGDB 2JK5B 2DTSA 4HKXB 4F8QA 1T1WA 1ZA6B 4JFZH 1UA6L 4RBPK 4M3JA 4YXLL 4F7PB 3HE6C 3QYCA 3OSKA 2LTQB 4J3SA 2D7QA 5GGTL 2AJXL 5HHPB 1KXQE 3VH8A 3C6LD 2P44B 4DVRH 3ULUH 3GSWA 4ZTOL 1CIDA 3VFRB 4KKCC 3IFLL 4XGZB 5MEQA 3BJ91 1C7SA 1U0QA 5F9JB 4WFED 5C0AE 5FUZL 3S4SA 1D9KA 2R0WH 2F53D 4LSUH 3VA6A 1S8DB 2G60H 5EFIB 3UMTA 1HOCA 4WU7B 1IGTA 2LAAA 4XVSH 3FN0L 1Z6JT 5IF0B 2HTLC 2HT3D 4QNPE 2NYYC 4KDTC 5GSVA 4U1KA 1G7MA 3DARA 1HH9A 3RZCD 1DQMH 3HE6A 1Q0YH 5FYLH 3PHSA 1WEJH 3BD3A 4C4KO 2GTZA 5C0FA 32C2A 3SJVB 5SV3A 3LEYH 5I71C 4Z7VB 3ET9F 3NIFE 1AR1C 1NC2A 1B6UA 3RBSA 4B0MM 4PJ5A 1KTKE 5TDNA 1GPOL 4ZFOA 2CDGA 1N0XL 4LLQB 1VCAA 3DROB 4NC1E 1U8IA 1WTLA 3G6DL 2OP4L 3L5XL 3PGDB 5DC9B 3U0PB 4Q9CA 1YUHA 3OJDA 3LOWA 4JKKA 4W70A 5TE4H 2R29L 4KDTA 3L3GA 5IEHB 4OZFG 2W9EH 1NDMB 2C3WA 3OB0K 1MJUL 5JOPD 3PWUA 3RUGA 4X8XA 1BJ8A 4UV4H 3RWGB 4AM0A 3C8KB 1CG9B 4TULH 2XWTB 3W81A 3EDKA 3KWWA 3CFBA 4O58L 3FZUC 4CDHA 4JFFB 3VGEA 4H25A 4DKAA 3BP6B 5C0RH 5EO9A 3UO1H 3NIGE 2EXYD 1U3JA 2EZ0D 3GRWL 4CVZA 4LHUA 5EU3A 2QQLL 2P46B 2BP3A 5HGDA 3TO4D 1E28B 4QYOB 3MUY1 5DK2A 4NO0A 2VH5H 5IGXL 1DLHA 3DI3B 2H1PH 4KWUA 3Q48A 4PJEB 1A4JA 4BK4A 2HVJA 1Y18B 4AT6A 4PLJD 3PQYB 3FB8B 35C8H 4CN4A 5EDXA 5DHVA 3U4BH 4C56E 3QPXH 1QFOA 1IVLA 1MLBB 4OBSA 4WHYH 5GGRY 4TTDC 2VSCA 5F1NA 1QNZH 4WI3A 1C5BL 2V2XB 1OP5K 4JO3L 1NMCB 4M61A 4F7MA 5EU6E 3U0TB 1N7MH 5J06A 2C3HA 3U48A 2BCKA 5IK3A 4NFDA 3RWHB 3ZSSA 4KKLD 4XBEL 2VQUA 1K4CB 4NNPL 4JRYB 4OIAA 2VZOA 3LKRA 1QVOB 2F74A 2XKNA 5EU7E 4P5MA 4PV8A 2PYEB 1DP0A 4LCUA 4ZNEE 3N85L 1ODAA 1IM9A 4WWKD 2VZTA 1TTGA 4N9OB 2VABB 4AG4L 1CFNA 4PJHF 1ZHNA 1UKSA 3FRUA 4EI5B 3MXWL 3VRIB 4JZOA 5GQBA 3A6CL 3L3IA 4M9OA 4H26B 1YN6A 1QLFB 1KCKA 2CPCA 3OKOA 4KTEL 4WW2F 5C0CA 5K9QG 4X8JA 1F4WL 2D9QB 2BVTA 5GRYA 3IFPA 2GAZA 4HJJL 4ZPVB 3MREA 1ZS8A 3VXSE 3MBXL 5FV1L 3D39A 5JIPA 4BSJA 1TPXB 5J7CC 5CEYA 2A77L 2Q76B 3BH8A 2EDDA 3WUWG 4GKSB 2XXMB 4Z7UA 4BYHA 4ZFZB 4R4FH 4UT9H 3ZKSD 1KULA 1QBBA 1RUKH 3RIAK 3V5DA 3JV0A 3TA3B 3HZMA 3EYVA 3G5XA 1AGCA 4L8CA 4X4XA 3LAFA 4X7TB 2YD4A 3VGGA 3QP3A 1UM5H 3LN9A 2PW1B 4M6MH 5MP6L 3FQWA 1KGCD 3FT3B 2B1AH 3LSOA 1SBSH 1V7NL 4JPKH 5GGVH 2DQDL 3WFEL 5L2KA 4UDTA 2BZDA 3M1BA 4JGUA 3RTQC 4WW2C 3RY6C 5IB2A 1LD9A 5GS1C 4YHIB 3KR3L 4MNQE 3DURB 5D5MB 3RGVC 4ONFL 4PYHA 4MQ7A 1GC1C 5C0BB 3TPUB 4XNZC 5JHDE 1WBXB 1P2CB 4NSKA 5A1AA 1A6TB 2Z93B 2MMXA 1ZHLB 5I8OL 1ZWIB 4PJ9B 1OAUL 4Y16B 1AH1A 2MHAB 3NN8A 1OB1A 1VGEL 3HC0A 4HPYH 3GHEH 5C0EB 1M05A 3FO1B 3DRTA 3H6JA 3KDMB 4J3XA 4NKDA 4JAMA 2NXZB 1TNMA 1A1NA 4NUGH 4NWUL 3WIHL 1GGCL 5CD5C 2JE8A 1OWRM 3BKMH 3S96A 1QR1B 4MNGE 3MFFA 4J6RH 4TVPH 2OK0L 1XGQB 3RTQA 1NC4B 4WW2A 1MHHB 3RY6A 5GS1A 3OKMB 1A6PA 4NZRL 5GZND 5HD8C 2GUOB 2BFVL 3SHSA 4HWBL 3RGVA 3KPSD 3RJQB 4HUUB 3DO3A 3QUMA 5JO5A 1A6WH 4GAYB 3QIWC 5AUMA 1U9KA 4ZAKC 4J4PD 1EEQA 3WSQH 3WL9B 4RFNC 2GJ6A 4X7CC 1QO3A 3PIQB 4ZFFB 1FVCB 3JTSA 3V4UH 4ZXBB 3R1GH 3VFNB 1YMME 1UACL 2HMIC 1YPZF 3WFDL 5IW6B 1A6UL 3BT2L 1S7SB 1BAFL 2F54E 3H9SD 2VQ1A 2YSSA 1YDPB 1PDKA 5ALCL 4G7YH 4OQTH 3PGFL 1KTLA 1WCBA 5SX4I 3GI8L 2X6MA 5FYJD 5IW1B 2UYLA 4UDUB 5KSUB 2DD8H 2VXUL 2W9DH 3WE6A 3LKSB 1HSBA 3C5JB 5ERWA 3OF6D 2ICEB 3NFPA 4P3CH 1ACZA 4YHYB 1XGUA 3GBML 1VA9A 5JXED 4WY7H 6CGTA 3QIWA 4R3SB 1B3JA 4ZAKA 5INCA 5DA0B 5GGTA 1U8LB 3GK8L 4OCYL 4D0CB 1IC1A 4O2EB 5F7DB 3RWIB 3QDJA 4J3UA 3MTRA 1RY7B 3HLAB 4OLUL 1U3HC 1P53A 4GW5B 1NLBL 4JPIB 4ETQA 4PRPB 3KPQB 1IZKA 4X6DF 3NGBC 1A7NL 3I9GH 3ECBA 2YWYA 3IFOA 5BZWB 4MD0A 1D5ZA 2FD6H 3EYOA 4OGAC 4U3XA 5IFJA 4O9HH 1U8KB 4KTDL 5KS9A 5F1OB 3TPKA 4Q9QH 3DX9B 1HWHB 5CEZD 2XNAA 1OGTB 4HJ0C 5FYJL 1H3GA 2X10A 2EIZB 2HT3C 4P23B 3TBYA 3C5ZD 1Q9OB 5JMOC 4XX1E 5B38B 5DUBB 3MLRL 4YO0A 5J11C 4Y8AA 2AQ1A 3HZKB 5CP3A 1UCTA 5FKAA 1A5FL 4BZ1H 1AD9B 5F3BB 5TJWK 3LEVL 4YHPB 4LRNH 1U3HA 4IHOB 1Z3GH 1AGEB 3O9WD 1G0YR 1B2WH 3FO9B 5K9OA 4FFZL 4NC2B 1U91B 4LRIC 1D5MA 4X7SH 3R4DA 4LAJH 1BD2B 1RUML 4R4NC 1IGYB 1IGCL 3TNMA 4MAYD 3VMNA 2AJ3B 2D9CA 2UZIH 5GISH 3RA7L 3PJSA 1EFQA 2ICWB 3I6GB 5ITBH 5DMIL 5JXAL 4D9RE 1CTOA 1XGTA 5HVGB 5H2BA 3FT2A 4APQD 3TYFB 5DJ8A 1P4LA 3HS0B 2FNBA 4KUCD 1C08A 1HHJA 4KUZH 4IBLT 5T33H 4EUPH 4R0LC 1QBML 2YD1A 5B4MC 3ARZA 3RVVD 1JWSA 1BOYA 4E5XB 5BRZE 1T0MA 4B41A 5EZIL 3UC0L 4N0CD 2XZZA 1AI1H 2X1OA 4FQ1H 4NQSA 5J13C 5CEZL 1T5XB 1KPVB 2IH1A 4HMCA 4JHAH 1UH3A 1NDGB 4PJ7E 4U0RB 4LRIA 4N8VA 2DWDA 4M1DL 4HH8A 2VLKB 4PJCE 3MA7B 4MA8L 1MNUL 4WCYH 4AZ8A 5C2BH 5ANMB 3TO4C 4XAWL 1DJSA 2VRAA 2PKDA 1GGIL 3MLTB 4O2FA 4Y4KB 4Y1AD 2IG2L 1U93B 2VNCA 4N8CH 2I9TA 4R0LA 4WTWA 2WQ8A 5T5NG 1M6OA 1NFDB 3LKNA 4P9HC 1G7LA 5F7EL 2X4RB 1NCWH 1F3JB 4OGYL 5DQDL 5BMFH 5HDQL 4O02H 3BZ4B 2EDJA 3O3BA 2OI9B 3C08L 1Z5LA 4WVRA 3BESR 5F89A 1JZ3A 3P0YH 1T2XA 3I50L 4FFWD 5IJVB 2G9HB 5CUSL 2XZCH 3B3IB 3WLWC 2OX5A 2DQCL 1TTFA 1MFEL 2BY3A 3CFEB 4K9EL 5AEAA 5FO8B 3TO4A 2Z4QB 4U7MA 4JHZA 2D7NA 3KYKH 3FQRA 3ZKXB 1DBJL 1QRNB 1EAJA 2DKUA 4OZFB 3SN6N 2FYYB 2IGFL 3BP7B 2OXHA 5C09E 1U58B 2J5LC 2P5ED 4YE4H 1DE4A 1MWAH 5J6GB 1T7XA 2V5TA 3F6IA 2ITCB 3QIBC 5F9DC 4UI2A 1HDMA 5D7LD 4M4PA 4UILL 4G43A 4Z8FH 1UM4H 3MLVL 5DMKB 4XCFL 4Z7UE 2VIRA 1LDSA 4I18C 1JWUB 2B1HH 1CZ8H 1RUQL 3WO4B 3SGDH 2W65A 3NCFB 4CMMA 5BXFA 4KRLB 3PG2A 1WWBX 2Q3AA 1F42A 4JHWH 5KSAB 5T1KB 3ULVH 3BPCB 5DWUH 3K80A 4S2SA 3RRQA 2NY4C 4S1DD 3FO2A 2R4SH 3FN9A 5EC1B 4AMKH 4XAKD 2YPLE 4WI8A 3QIBA 4EI6A 5LGJA 1PJ9A 4Z7WF 4JZNA 1KUMA 1MFCH 1H15A 4D3CL 3QUKB 1XGRB 1XF1A 1K4DA 3UAJD 5INDA 4I18A 1HCVA 4QRRE 1I1AB 1S5HA 1LEIB 4MQTB 2WINB 4ODVL 5DJZB 1I8KA 4PLKD 4N0YL 1JHLH 3T1FB 4U6HA 3I3BA 5IHBA 3DYMA 2FO4B 4QRUA 1FLTX 4OCRH 2JJSC 1G1YA 1JWMB 2NY0C 5M95B 1P84K 3ROOB 2X05A 4TNVF 4HG4J 2J2ZA 4FMKA 3S3SA 4GG8A 1DBKL 2F19L 3VFPB 5HHQA 4PB0L 5ICYA 1H3WM 4EUPG 3PV7A 4RNRA 1PX4A 1TCRB 3KJ6L 1QACA 3HC3H 1R5WB 1LHZA 3TN0C 5D1XD 2DDQL 3RAJH 4ZMAT 5DS8B 5JORB 2IWGA 3GBLA 2FLBT 5DHXB 2ESVA 4B7IA 3ZDYE 2X70B 2DWEB 3WUWB 3REWA 1T66C 3MV7D 5IB5B 3KPTA 1IQWH 2A83A 7FABL 4ELKB 2JJSA 2XN9A 2GJZB 3GHBH 1ZHBA 2BVOA 3NA9L 4HIJB 2NXYD 4P3DA 3IVKB 1C12A 4FMFA 3CGTA 3QG7L 1NAMH 5EBWA 2HVKB 4BFGA 4JJHA 3K4DA 5HPOA 3RPIA 3TN0A 4AH2B 1WZMA 3QFDB 1TVHB 5F7NC 4ZQKA 1ADQL 3Q5OA 5F8QC 2Q20A 1RMFL 3VRJA 1KB5A 2ZOKA 3MJ8A 3SKJH 4HIEA 1T2JA 3ZTJH 3GMNA 5I66B 5E2UH 3FOLA 4YHNA 2ATPB 1PKQA 2ADJA 4OD1L 3NPZB 1NCNA 4TUOA 1YEKH 3O41A 1EGJH 1QYGL 1RZIA 3IAPA 3EOYG 3QZWA 1QBAA 1H0DA 2VDOL 4XVTL 5I1GL 1WAAF 3QO1B 3HTLX 4XTRC 1KLUB 1E6JL 5E6YA 4AENB 1CGXA 4XI5C 1MCOH 2APVA 4V2BA 1KT2A 3H9SA 2MCG1 4WW1B 4IIQC 3EHBD 3I75B 1DVFD 4U6VH 4Z5RB 2D7OA 4RAUA 4YNYB 1E4WL 3QB7C 5DJCB 2QR0B 1TQCB 4JM2C 3RKPA 3P4MB 5C9JB 2BNQD 5D72H 1SM3H 5E08L 2CK2A 4AEIL 4KUCF 5JPMB 4MJ6A 3MYJA 4HSQA 4MS8D 4KHXL 5EUOB 3QDAA 5HYSA 1CCZA 2IAND 1CDCA 3DX7B 1TCMA 4YWGH 4UMGA 3BUYA 4NWTH 1CE6A 5I0DA 2PTUA 3Q6FA 1FDLH 4JFED 4RAVA 4CBPA 1OL0A 3FFCE 1NAKL 1LO3L 5BS0A 4P46D 5HHOB 5E1AB 3JV4A 3VD9A 4MCYA 4G6FB 5C08E 4D0BA 1AD0A 4V1DB 3BXNB 1JGUL 3GM0A 3DWTA 3SEPA 4PIRF 25C8L 4IRSB 3U9UB 4MJIA 4OD3L 3LKOA 4IIQA 2WNGA 3BPOB 4YFDB 4I0PD 3O9WC 3F7VB 1OGAD 5IQ9A 3I6KB 5C0BD 2VWEC 4FNLL 4JM2A 2HP4A 2PYFA 2WWKO 2Y72A 5GRJH 5EO0A 3H9HA 2EDYA 3AXLA 3P77A 5TQ0H 4E9LA 4O5LH 1JPSL 3WEXB 2H2SC 1U8OA 5GGSA 3MLZL 3T0VA 4I4WB 3LMJL 2VMFA 1BZ9B 2V7NB 1AJ7L 4EJ1C 3FAXA 2E7HA 1REIA 2OR9H 4WHCA 3MGTB 4MA3B 4QGTA 1WAAA 4K9EC 4D9LH 1X7QB 3O9WA 4OFPA 3OQ3B 5JIHA 5HVWA 1NGZB 2DM7A 1MRDL 1YECH 3UTPD 1S9XB 1C16A 5J8OA 2GY5A 2OTWA 1GAFH 1JTTA 1HYRC 4QEGA 4ZOCA 1RFDL 1AQDA 1IAKA 1VPOH 5ISZA 5IMMA 3GMPA 1SJHA 1UB5A 2BX5A 5I1KL 4RZCA 4NRZB 2AEPH 3E3QE 1WBZB 1HYSD 1AO7E 3L5IA 2H2PD 5DSCB 4KVCL 4JKPH 3ZE0F 1D3CA 4RMTA 4NT6B 1MPAL 4ODHL 5AZ2H 3NABL 1OHQA 1DFBH 2F58L 2YC1B 1OP3H 3UTQA 5LGHH 3ZZ1A 3VG0L 4YBQC 2A74B 1BVLB 1KLGA 5IVXB 1HSAA 3VFTB 1X9QA 4NNYB 4PGEB 3HA0A 4LBEA 2I60H 3ARGD 3S34H 4X5LA 2Y6SD 4PRIA 3MRIA 2HLAA 4DCQB 5ICXA 3VRLF 3PHOB 1JN6A 4TQEH 4QRSB 4AL8L 4RMQA 2VXSL 5HDBE 3L9RA 1DBBL 2MQ0A 4NP4L 2CRMA 4HLZG 4PD4K 4OKVB 2MCPL 2LFGA 4DTGH 1I4FA 2LTQC 5H35A 3IJSB 4NQDD 3TBSA 3T0EE 3EYFA 4M7JH 2MQCA 4NN7B 3GGWB 4K7FB 1XF2B 5HYFA 2AK4A 5JA9A 3MRFA 3O2DL 5HI3C 1I1CA 4X6CB 1INDH 3SCMB 5SWZA 2E7LA 1OY3B 3IDUA 5E4EC 1FL5A 4LAQL 5ID0B 1BQHA 2JB6B 4Y19D 4YQXL 3K8LA 4HCRL 3VXNA 3RFZC 4NJ9H 1S9YB 3VW3L 4LKXB 3IYLW 1CDGA 4HUMB 3QCUH 5LQBH 5IBTL 3L3HB 4TSCH 3OJ2C 1H3XA 4X7DC 1JGDA 2IF7A 5FK9B 3WNPA 3C09B 3QEQD 4HKXA 1ZA6A 2V17L 4HDIA 1KIRB 4JGJA 4P57B 1MCLA 1OTUC 2JF1A 4F7PA 1FYTB 1ZKAA 1SYVB 3O3EB 1M71B 2XA8L 4PG9B 5HHPA 1E6OH 3VFRA 3P0VL 4UOJA 5AYQA 4XGZA 5F9JA 4EBQL 3WD5L 3HUJE 4NZJA 4P2QB 4U6YB 1S8DA 4OLYH 1RHFA 5EFIA 4WU7A 1G7PB 1CLYH 3DUSB 3UAJC 1DEDA 4YDJB 4ONHB 5IF0A 1AP2B 4U1SB 2Q1EA 3GJFK 4NQEB 1I9JL 1Q72L 4UT7L 4R2GB 1AGFB 5DT1H 1T1ZA 5CSBA 1J7VR 2GFBA 1CVRA 2BOBB 1TZHB 3V52H 5L0QB 3C2AH 4PY7B 4ZG1A 1S3KL 3JZ7A 1P4BH 3HG1E 3SJVA 43C9B 1T6VN 2DQTH 4Z7VA 1SHMA 4Y7MA 1GYAA 3MCG1 2JB5L 4ODXB 4NO2B 1NUFA 5EIIB 3CD4A 1Y6KR 3MRBB 1FZMB 3B9KB 4LLQA 3HE7B 3DROA 2VZSA 4G6KL 4O00A 4Z76B 2EDQA 4M48H 3PGDA 2N7AA 3CFDB 4JE4B 3MLWL 4LSPL 3U0PA 5IVZB 1WIPA 3WS3A 5IEHA 1BFTA 1NDMA 3GO1H 3KPRB 3UEZA 3T0DA 4JB9H 2ZJSH 2ZUUA 2VDRH 4K55A 3EO9L 3RWGA 2DL9A 3C8KA 1CG9A 4G6AC 1DBAH 1NMCC 2I07B 2XWTA 3MMEB 2P48B 3P4LA 4XC1L 1P7QD 1C1EH 3S5LG 2FX8L 2BRQA 4JFFA 3FRPG 1A6VL 1XGPB 3BP6A 3H0TB 1CIUA 2EYRB 2DLGA 4OF5A 4M6OH 2Q8AH 3HI5L 4UB0H 1E28A 3OX8B 4QYOA 1PKQE 3C60D 2B20A 3EW3B 5IFHL 4PJEA 5IHZB 3BISA 5KANI 5HYJB 5C6PB 1Y18A 4TTGA 3MLXH 1MFAH 3PQYA 5C0GB 1TMCB 2XRAH 3QQ4B 4H5SB 4Z0BL 3VXUB 2ED8A 5LBSH 2VXTL 4HF5L 3U0WH 1BF8A 1T3FB 5J6HB 1MLBA 4MDIB 3LRHA 4EI5C 1KFAL 4BA8A 5FHAL 2V2XA 2YUVA 2ADIB 2CKNA 3LZFL 5DEGB 4QLRA 5T1LB 1UXSB 3QPQD 1YJDL 3U0TA 4LQFH 1LE5B 3QNXB 2AKRB 1TQBB 3RWHA 2YUXA 3T0BA 5GS2H 2EH7H 3CSYB 2XACC 3LEXB 3UTTE 1K4CA 1FE8H 4JRYA 3T3PF 3GSVB 4ODSH 3KGRA 1QVOA 1TPXC 2CH8A 4XP4H 1TLKA 5TH2B 2PYEA 2JIXB 4FXGB 4YPJA 2WP3T 4RWYH 5I1DB 3LRSB 2BRRL 2VABA 5BS0E 1NGPL 4BQ9A 1MIML 3TA3C 3D0LB 3BKCL 4EI5A 4IMKC 3OZ9H 3VRIA 3BWUC 4MS8C 2XV6B 2HG5B 4DAGL 2EC9U 2FWOB 4H26A 5EA0L 1QLFA 4M7LH 4U1HB 4RISH 2D7TL 4NBYB 3VFGH 1HI6B 3UJIH 2IMMA 4KMTL 2NY7H 4LASL 5MEND 4ZPVA 5FF6B 4MHHI 4WFGE 1G9NH 1MJ8H 4P5TD 3K2MC 3KS0J 1ZLVH 2M8XA 2Q76A 3F58H 4X0KB 5ADOH 1R3IH 3VXMB 5HGGS 4ZFZA 4MB4A 1S7RA 3WNMA 2EDBA 3TA3A 3WHXB 4IMKA 4PJ9C 4JFOB 1UWGL 4Y16C 4KI5E 2QJDA 4X7TA 2C4XA 4H1LH 2ZUTA 5FA4B 2NXZC 2M26A 4YDVB 1UZ6F 2PW1A 2NY5L 1S7VB 2QV2A 1MIEH 3EOBB 3FT3A 3IGAA 4KI1A 3L1OH 2R39A 3ULUD 5IKCB 5D1QD 4M5ZL 5DD3H 5ISZE 2NX5B 4Y88A 1IBGL 2O5ZL 4YHIA 3MLPA 3DHMA 4X9GA 3DURA 5KW9L 3OR6B 5D5MA 4PJBF 3SE8L 3WXVL 1RZJC 1S7WB 2EIDA 1EHLH 5C0BA 3TPUA 4I3GA 1WBXA 3MRPB 4LPXA 1P2CA 5DJYB 2Y07L 1A6TA 3GIVB 2Z93A 1A7RH 1ZHLA 4FTVB 4TSAL 1ZWIA 4PJ9A 4KRMB 4Y16A 4L8SB 2MHAA 1X4XA 5C0EA 3SQOL 3FO1A 4FZ8H 3RU8L 3KDMA 5GRUH 5DR5L 5CJQL 15C8H 3AMKA 3K81A 2P43B 1HYSC 1L7TL 3S3JA 4LLYB 5FYLD 3HKFA 1Q38A 1DQDH 3ARFB 3MV01 1I7RB 1QR1A 5DUMH 1D6VL 4PJXF 5ILTH 1XGQA 2FO1A 5J57B 1OSPH 1ROWA 1NC4A 4RMUA 1MHHA 4S0SD 4MD5B 4QOKD 4JFZL 3V6ZB 3OKMA 4MVBC 2GUOA 1FLRH 4YHYC 4UU9B 1MCFA 4HUUA 5EBLA 2BOCB 5I1HH 1MI5E 4MZ2A 4GAYA 2OQJB 1Y6NR 2HTKD 3WN5B 4LFHG 4DVRL 2AERT 3ULUL 3BRFA 3NTCH 3WL9A 2GCYB 3ZE1F 3PIQA 3U82B 4ZFFA 3V8OA 3UBXI 3VFNA 3N1FC 3SDCB 3DX8B 4W6YB 4MLIA 5D71H 3QFJD 5IW6A 4X9HA 2R0WL 5C86A 3P4OB 1S7SA 4LSUL 5TF0A 2G60L 3VDCA 3MV9E 1YDPA 4XVSL 4CAGA 4ODBD 4MDJB 4PJFB 1GRWA 4QXGH 4Y8DC 4UDUA 1YA5A 5DI8B 5KSUA 2XKSA 1NLDH 3LKSA 3C5JA 1ONQB 4NUJB 3QXUA 2ICEA 1DQML 1JV5B 1Q0YL 5FYLL 5J0BA 3GJFB 1WEJL 2J8HA 4R3SA 5JDSB 1CDIA 4IDJL 1U8LA 2AJYH 4D0CA 3DTXB 3LEYL 4O2EA 1G84A 5F7DA 4LCWE 1NL0H 5JR1H 4DQOH 3RWIA 4V1DD 4Y5YB 4A6YB 5GRVL 2J12B 5BV7H 3QEHB 2DTML 5I0ZA 4U0QB 1V05A 5EWIH 3HLAA 2DIJA 1IGMH 3CFIC 4GW5A 3RVUD 4JPIA 4G42B 4PRPA 2NZ9D 1J1OH 3KPQA 2PXYD 3KXFD 4RGOH 5E8DH 4XT1C 4YC2B 3V4PH 3BQUB 5TE4L 1U8KA 5EZLB 3LB6D 2GY7B 5FOBB 3Q5YA 2HFFB 4PRAB 1CXHA 3ABZA 4TVSa 4UV4L 2Z8RA 1JMXA 3QUYD 4FXLA 4TULL 1BP3B 3DX9A 4Q7DA 2E8ZA 1U8NB 3PDGA 5A2KH 1LO5B 4LPTA 1OGTA 4RFEB 3O3AB 2EIZA 3CLFH 5FO7B 1IEBB 1Q9OA 1RZFH 2P7TB 5C0RL 3UO1L 5DUBA 1B6DA 2B5IB 3OAUH 4FQCH 3FB7B 5D7IF 5B38A 5JHLH 1JYNA 3HR6A 4RSVA 3HZKA 3H2WA 1DBMH 2PR4H 3G04B 1VFOA 4LNRB 1DN2A 1AD9A 5F3BA 4YHPA 2DBLH 4IHOA 3RVWC 2VH5L 1AGEA 1OAYH 5TDPB 2H1PL 5JNYB 4LQ1A 1MRCH 2GK2A 4U0RC 4IRJB 1U91A 2HJFB 35C8L 2EC9T 3RL1B 1BD2A 1IGYA 2X40A 5D2NB 1MSPA 2AJ3A 3QPXL 4G8FB 3RIAF 3V4VH 1L9MA 2ICWA 3FN3A 3I6GA 4G9FE 3CSBA 3SO3B 2X7LB 4HBCH 3DLQR 2K3TA 5DVNA 4FFYH 1QNZL 4F15B 4KPHH 3HS0A 4N0UB 4OZGB 4EIZC 1RZKC 2NY6D 4UQ3B 4Y4KC 1N7ML 4U2YA 4RRPG 2JJWA 1YJDC 2VLRB 4U1LB 1Z9SA 4YHMH 4Y5VB 2APXA 2RR3A 3WCYA 4E5XA 3FQUB 4MA1B 3D0VB 1MELA 4F9LC 1TZIB 5HHMD 1CVSC 3SGEH 3KG5A 1RULH 2OI9C 1T83C 3QIUD 1WSST 1T5XA 1KPVA 1B0RB 4I1NB 1FIEA 1NDGA 3AREB 3D3VE 3WXWL 1E4XH 2VLKA 2YXMA 3MA7A 4ORZC 4YHLH 3BGMB 2PO6B 3HNSH 2XTJD 3BYTA 2DMKA 5ANMA 1ITBB 5K9KB 3L3KB 1IAMA 3MLTA 2X1PA 4Y4KA 1KN2L 3ZKXC 1U93A 1ZE3C 3P2TA 5DHVH 5GIRB 3WIIH 3W0WD 1GGUA 3FT4A 3L5JA 1NFDA 1BBDL 2A9ML 4DK6A 4PRHB 1YEDB 2X4RA 1F3JA 4F9LA 2DN7A 3BZ4A 5B39B 5KOMC 1T83A 4GJTB 4QXTB 3T0WA 3OKEB 4OT1H 3RWEB 4EVNB 1JPST 5IJVA 3D87B 4WNQB 4HWUA 1QR4A 4HS6B 3B3IA 4R4FL 4UT9L 3FMGH 4NKQB 3MSPA 1BVZA 1RUKL 2DF3A 3WO4C 3CK0H 4XCYB 4TVPD 2UWEB 5FO8A 2Z4QA 4XNQB 4AEFA 5KSAC 1UM5L 1F4YH 1QRNA 1VFAB 5E2TH 4OZFA 4HZAA 4JFQB 1IAIM 2BERA 4M6ML 2CR3A 4HUKB 3BP7A 2KH2B 1WLHA 2P8LB 1U58A 2L0DA 1SBSL 1ZLVK 4JPKL 5GGVL 4EN3B 1F11B 5J6GA 1ZGLM 2NR6D 1R3LB 3HB3D 4JY6B 2ITCA 1Y6MR 1CD1B 3IJHB 3S5LB 3PWLB 3PXHA 3VXRB 5DMKA 4K8RC 5I16A 2WBJB 1I1AC 1V7MH 2LV4A 5KAQG 3V7AG 4I3SH 3FONB 3ZDXF 3V5KB 3OG6B 1J1PH 4K94C 4HPYL 3GHEL 4L4VB 1F3DJ 2P42B 2V2TA 3D2UB 5KSAA 5T1KA 3BPCA 5CMAB 1YY9C 1OVZA 2DIBA 3MV8B 4BSVA 4NUGL 1OWWA 5EC1A 4YXKH 3S4SG 4X99B 1IARB 2DQGH 4J6RL 4TVPL 3CXHJ 3F62A 5GZOD 3DO7B 3KLAB 4L3AA 3C8DA 2MOVA 3FOMB 4YFEA 1LVEA 2B0SH 3ARUA 3QUKA 1KYOK 1XGRA 3ESUF 1LGVA 2YZ1A 2PF6A 1A6WL 4X4YB 1I1AA 4FQXB 3WSQL 1OAXH 1LEIA 1OTSD 2WINA 5DJZA 4CKVX 1A7OH 4IOFD 2Z8VC 3PE9A 4M93B 3V4UL 5E1HB 4S1QH 3T1FA 3R1GL 4QRTB 2UVFA 4XX1G 2FO4A 5AAWA 4G7YL 5BCAA 4OQTL 1JWMA 3DMMD 3ROOA 2FJGB 2VZ1A 4D9QD 5HPMB 4IS6B 2DD8L 3VFPA 2W9DL 2FH6A 1EEUA 3EDJA 4N1CA 2EO1A 2P4AB 3SDXB 4NZDA 1TCRA 4OGXH 4P3CL 3BP5B 1JPTH 4X6BB 2X4SB 5J3HC 1R5WA 3AS2A 1L0XA 4WY7L 3DGCR 3IU4H 3PWVB 4WO4B 4MJ5A 4PJIF 5JORA 3D25B 5ESVB 1ORQB 3Q6GL 4JO4H 2FIRT 2X70A 2DWEA 3WUWA 3RZWA 3PWPE 2VDLH 1I85C 5IB5A 4NQVB 3QUMH 1GC1H 1N64H 4ELKA 4LHUG 2GJZA 1SJEB 5E5MB 2HTKC 3I9GL 2CLRB 2BSTB 3IDGB 3M17B 4OV5B 4G8GD 2FD6L 4HIJA 4L9DA 4LEXH 4O9HL 1BIIB 2FGWH 3QUXB 3IVKA 3MPCA 5C0AB 2HVKA 3S9DB 3WFHA 3MQIA 2B4CC 1U95B 4Q9QL 3R0MA 1HWGB 4LLVB 2QSVA 1EVUA 4AH2A 4EIGB 3QFDA 1TVHA 4JM4H 4KK6D 2WSKA 3DVIA 1TQCC 3WFCH 3SE3C 3UTSE 1KCRL 4WFFE 5E70A 3QXVA 3QDGB 3S98A 4JG1H 1I85A 5I66A 3UJTH 2ATPA 3STBA 4LRNL 2X4TB 3NCYP 1Z3GL 4Y89A 1B2WL 1HKFA 5GGTH 1ZGLB 4P2RE 4X7SL 1FNGB 3G08B 4BQCA 2VLJD 4FFVD 4G9DB 4KK9C 1KLUA 5HI4C 5LAXB 4MQXC 3B9VA 2DI9A 2FBJH 2UZIL 5AAMA 4AENA 4Q9RH 5ITBL 1JHTB 5HHXL 4KVNH 1J05B 5HBBA 5JTWA 3UTOA 3SKNB 2J4WH 4IRSC 4NKMB 4WW1A 3BPOC 1PEZA 3I75A 3MODH 2NZ9C 4MXQD 1CE1H 3F12B 4Z5RA 4YNYA 2BVQB 5DJCA 2QR0A 5T33L 3RVTC 5C9JA 3P4MA 2FZ3B 3MRJB 3SE3A 1QZ1A 5DURB 2EEDA 5CZXD 5TDOB 4IJ3B 5CJXC 5JPMA 4YXHL 4OIBA 4E0RB 2EDWA 4G6MH 5J9PB 5EUOA 1AI1L 4OCXH 2FHFA 4FQ1L 1C5DB 4O4YH 3SQBA 5FYKH 4EKXA 1CFVH 1LO2H 4JHAL 3MO1B 2E7BA 1S9WB 1YYLH 1DR9A 2JCCE 2IAMB 3QI9B 4V1DA 1MH5B 3BXNA 5CP3H 1UKTA 1IGJB 4WCYL 4GG6F 2JJVA 4PJ8B 1G0DA 5GPRA 4IRSA 3U9UA 3DXAD 4Z77B 4JRXE 2PTVA 3F7VA 4OZ4B 4R97B 3I6KA 5HY9B 4N8CL 4ESKA 4FG6C 2E7MA 3DRQB 5FIEA 3CX5J 1J8HE 4C56B 1NCWL 5BMFL 4O02L 1TZGH 1JHKH 2QQNH 4Z7NF 1CICD 1HQRB 3E6FB 3WEXA 1A22B 1DCLA 3P0YL 5EU6B 4DUVA 3ULVD 1ZT4B 4I4WA 5FCSH 2R9HC 1BZ9A 2NY2B 2XZCL 2V7NA 4JVUA 3ZE2E 3MGTA 3MOQA 3NZHL 5ESAB 4JDZB 1BZQK 4MA3A 4TNWK 4UBDD 1WFUA 4WHDA 1X7QA 3KYKL 3ARDD 3FQTB 3CNKA 2HA1A 1EPFA 1NGZA 4Z18A 3OWEA 1GIGH 1S9XA 3U4EB 1IKNC 5DQ9B 3GIZL 5T5NF 4YE4L 5L2JB 3O45B 1MWAL 4IOSD 4AIOA 5IBLD 4NRZA 4LVNB 4JFDE 4MJ2A 1WBZA 4Z8FL 4PLNC 1UM4L 5CGTA 5DSCA 3E1F1 1LP9F 4I3RH 2ICES 4LGSB 4NT6A 1OW0C 2B1HL 1N26A 4NN7C 3BUTA 5EO1B 2YS4A 4WHTB 3QRGH 3VXSB 1PBYA 2YC1A 5C0IB 2ZSWB 4JHWL 4DW2H 3ULVL 2A74A 1K5NB 5DWUL 1BVLA 1G7JB 4LSVH 5IVXA 3QDMD 2R4SL 3VFTA 1IKNA 4NZTH 1P9MC 4NNYA 2HRPL 4PGEA 5GXBB 4AMKL 2R1YB 4DCQA 3TIDB 1MJ7H 3C09C 3PHOA 3S37H 4QRSA 3PABB 3ZT7A 3CSGA 1KCUH 4AQOA 4OKVA 3V9FA 3QNZB 4NQUA 4P9HH 1OW0A 4N9GB 1EBAA 5FUOH 3GGWA 4K7FA 1ZVSB 5F1SA 1XF2A 2X2YA 4X6CA 1JHLL 3CIQA 2XQYK 2IALB 4FQPA 5ID0A 4QHKI 4XNMB 2JB6A 3B2UC 3SGDI 1S9YA 3QWRD 4LKXA 5HDOA 4OCRL 2VERN 1P9MA 5JHDB 3L3HA 2BNRD 2R1XB 5FK9A 2K7QA 4R2GC 3FFDB 3D48R 1KIRA 5L0QC 3EOTH 1SYVA 3O3EA 1M71A 4H0HB 2QHLA 3F7PC 3K74B 3HC3L 3LS4L 4LSDA 4PG9A 3P9WB 3IXTB 4DK3A 3RAJL 5EZJB 5M94B 3BKYH 1KACB 4FQLH 4MNGB 2QLVB 4P59L 3NH7H 4OM1H 3V6FB 4C59B 3GMLB 4P2QA 1HZHH 3T09A 4U6YA 5K9JH 4QXUH 3V8CA 1XF5B 1IQWL 3B9KC 5E0QA 1G7PA 3O6FD 3HE7C 4WUUD 3TBVB 3WFZA 3DUSA 2LAGB 3T77B 3O6KH 4ONHA 3GHBL 1Z9LA 1AP2A 4YDJA 4U1SA 1SEBB 1OAUH 3PP3H 1MCBA 5B3NA 5F6IB 3VWJD 2BOBA 1TZHA 1NAML 4ZS6D 1YMMB 4PY7A 2E5EA 3TJHC 2F54B 4X9IA 5T1MB 1TJIH 4R7DB 2OXGA 4U7SA 43C9A 3SKJL 3MA9H 2PO6D 4ODXA 4NO2A 5FM8A 5E2UL 4JRWA 5EIIA 4HK3J 3GSXB 3MRBA 4Y4FB 1FZMA 3B9KA 3HE7A 1YEKL 4Z76A 1EGJL 4M3KB 5E2JA 2XT1B 5BW7C 3CFDA 4X6DE 5IVZA 2YMXH 1C5CH 2X4OB 4ALAH 5KSBF 2YA1A 1I9IH 3KPRA 4MX7B 5BOPA 3V0AC 1MCOL 1UACH 4XC3H 4R26H 1VACB 2I07A 3WNKA 3MMEA 4WU5B 5E9DD 4LPYA 2VXQH 3HNVH 4U6VL 1ZK9A 1TQBC 5JOPE 1I7ZA 4FQIH 3U7YH 2N56A 1XGPA 5D72L 3H0TA 1SM3L 2EYRA 5DGQA 1X5YA 1P7KB 3MOBH 3VFVB 3CDGB 1UVQB 1YEIH 2VKXA 3P30H 3OX8A 2VLMD 5FUCC 4I2XE 4YWGL 1HQ4B 4NWTL 5BW7A 5IHZA 1FDLL 5HYJA 5C0GA 4MXVF 4KK6C 3QQ4A 4H5SA 3VXUA 5ENWA 1KB5H 3B6SB 3GBNH 3NPSC 5DRNB 1T3FA 5J6HA 1RK0B 1W8NA 4MDIA 4KK8C 4KJPD 3BD5A 2QTEA 2ADIA 5DEGA 4POYA 1UZ8B 1F6AB 4S1RH 5T1LA 1LE5A 4U3HA 2DAVA 3QNXA 2AKRA 3QUZD 4FOMA 3CUPB 4FQHB 2BXZA 4G8GA 3LEXA 2VLLB 4K2UH 2VSDA 5GRJL 3WLBB 5FGCE 3GSVA 1FV1B 4NC0B 5TQ0L 1U8QB 4GKOA 3RKDD 5KTEH 2GTWB 4O5LL 4LL9A 3OGCB 2OM5A 3VWKB 4YHOH 1XH3B 3RWFB 5TH2A 2JIXA 4FXGA 4MXQC 5I1DA 3LRSA 5HYQB 1IZJA 1MCSA 5HHOE 2ZCKH 3D0LA 3TIEB 2OR9L 3ULVF 4M1CD 5IB4B 2OSLB 4OZIB 3QAZB 1CGTA 1EERB 2HG5A 2WZPD 2FWOA 4HIHB 4S10A 4D9LL 1TVBB 1NBYB 4U1HA 1IGIH 2R0LH 5F1KC 2C1PB 2FEDC 1HI6A 3KJ4C 1EFXD 4PJ7B 3RBGA 1YECL 5FV2A 4P4KD 1JNHB 2YPKB 3F7YB 3X3GL 3ZYIA 4QRPE 4MAUL 3VU2A 2ENYA 1GAFL 4PJCB 4V2CB 4ZDHA 5FF6A 2XZAH 5IMLB 1VPOL 2HKHH 3INUH 4PGCA 3BGFB 3CC5B 1JTPA 1WT5C 1ZLUK 2AEPL 4X0KA 5SX5H 3VXMA 4JKPL 1HEZB 1IC7H 4L4TD 1LK2B 3S8WA 3EUUA 3WHXA 4KAQH 5AZ2L 3SDDD 5IFAH 1P5VA 4JFOA 4L8SC 4QTIH 1DFBL 5T3ZH 1NGQH 3B9AA 5LGHL 4P4RB 3NA4A 5FA4A 1JCKA 4YDVA 1S7VA 3EOBA 1K85A 3ARFC 3KYNB 3JXAA 4I0KA 5HYEA 5IKCA 2I60L 1FSKB 2DYPD 3S34L 2NX5A 4K3GA 2NY1B 4TQEL 5DRZB 2DLTA 1KGCE 1WT5A 4UBDC 1CXFA 2WWMD 3OR6A 4NKIH 4KTYA 4RGND 4XAWH 2XKUA 7CGTA 1E27B 3ALWA 1S7WA 4DTGL 2IQAB 3MRPA 3WN5C 4L3ED 5DJYA 2RHEA 3GIVA 3KYOB 4M7JL 1BWMA 5C09B 1EBPA 1FAKT 4L8SA 4K7PH 5TFSH 1INDL 4WI4A 3SDCC 3MROB 5C0NC 2XOTA 4NJ9L 4LLYA 3N1QC 2VC2H 3ARFA 3QCUL 1I7RA 3ZDZF 5LQBL 2I25N 4TSCL 3CFKB 4DGYH 3MRRB 4K9EH 4MD5A 3V6ZA 4NO3B 4U31A 1MVFA 4HK3N 2DJUA 5DMGD 4UU9A 4OIIH 2YUWA 4GXUN 2OQJA 5DJXB 3WN5A 2C3VA 1E6OL 5DD5H 3EO1B 2C3GA 2GCYA 1OPGH 1EVTC 2WAHA 4DKFH 2VO5A 3KPSE 3H7BB 4Y5YC 2CRYA 2YPLB 4NJAH 5IV2B 3SDCA 3DX8A 1EUUA 5F7KC 3TVMD 4UILH 3P4OA 3DBXB 2RAMA 1WBYB 4OLYL 1CLYL 1MCPH 4MDJA 1GGTA 2QADD 3I2CH 1NCUA 4QRRB 4KGJA 5KOVC 4YC2C 4X6FA 1V3MA 3BQUC 2F8OA 3K3QA 1V8HA 3QZWG 2DJSA 4NFBA 4HD9A 5DT1L 4NQXB 1ONQA 4NUJA 3IJYB 1FYTE 4LFHD 1JV5A 2H3NB 3C2AL 5FYJE 3GJFA 1FNEA 2B2XL 5JDSA 5T1DL 1CFBA 1P4BL 4B7LA 3G6JE 1X5KA 1E4JA 3DTXA 1EMTH 2DLFH 1CD9B 2DQTL 3MUHL 4ZSOE 5I19H 2B5IC 4Y5YA 4A6YA 1F45A 5TPWH 3QEHA 4CMHC 3ARBD 2QHRH 3WIFB 3CLEH 5L7XH 4G42A 2IFGA 4M48L 4AK1A 4IRJC 1NKOA 4NQEE 3BQUA 5A2LH 1W72B 1VEOA 1VKXB 1UXWB 5D2NC 5EZLA 5GS2D 4N0YH 3GO1L 3D85D 5FOBA 4PRAA 2HFFA 4JB9L 2ZJSL 3IKKA 3ZHKA 3SO3C 5C92A 2VDRL 5AD0B 1JK8A 1IQDB 4F15C 1YC7A 2I5YH 3GKZA 4XBGB 1DBAL 1U8NA 4OCSH 5CINH 5TE6H 1LO5A 3OHXB 1DL7H 4RFEA 2EDHA 1C1EL 3O3AA 4NOFA 2KQMA 5FO7A 1IEBA 2P7TA 2J88L 4Y5VC 1QSED 4PR5B 3FB7A 4MA1C 1A47A 3EOAB 3U6RB 3G04A 4M6OL 1KJMB 3O4LD 2Q8AL 4LNRA 4UB0L 4XB8A 1DN0B 3GNMH 3F8UB 5ALBH 4UTBH 3AB0B 5HJ3B 1QSFD 5TDPA 5JNYA 3AREC 4IRJA 2HJFA 3MLXL 1MFAL 5I1IH 2DQHL 2XRAL 3D69B 3RL1A 5IHLB 3M45A 3VD4A 5LBSL 5D2NA 3U0WL 4G8FA 1J18A 3RNQA 2PO6C 2X7LA 5C6TH 3JWNC 4N0UA 3SGJC 4OZGA 2FJHB 4UQ3A 3QH3A 3CFJB 4LNVA 1J87A 4LQFL 5D1ZB 2UVEA 2VLRA 2EH7L 1MWAB 4Y5VA 3FQUA 3O3DB 3D0VA 2CDFB 4HK0B 1FE8L 2KPNA 3TZVD 1TZIA 4ODSL 3RDTB 4KROD 2BNUB 5E6ID 4X4ZA 2A0LC 1FNLA 1V3KA 1B0RA 3AREA 5HYJE 5L9DH 1NCTA 1RVFH 2EIEA 3T4AB 3FKUS 4RX4A 3IT8D 1SBBA 3QO0B 1CT8B 2PO6A 3OZ9L 4PTTB 1DANU 1NCAH 5K9KA 1W2KT 3SGJA 1MHPH 4PGZA 3L3KA 4JN2B 4KDVA 2ZCLH 2GHWB 4GBXD 4M7LL 4P2OD 4RISL 1T6WA 3VFGL 1X4ZA 1H8OA 4NQCD 3UJIL 5GIRA 1JZ4A 3FFCB 2NY7L 5BOZG 4R8WH 4YDIH 5I8EB 3A6BH 4EN3C 5C08B 5IG7B 1YEDA 5SWSD 4Y1AE 3HRZB 1WV7T 5B39A 1G9NL 1MJ8L 2OTPA 4QXTA 4MNQD 4E41B 3OKEA 4JO1H 3F58L 1CFTB 3E6HB 5ECJE 4UUJB 1KJVB 3RWEA 4EVNA 5ADOL 4NNXB 3AGVA 4WNQA 1R3IL 3RI5K 1U6AH 4HS6A 2WBJC 1MCHA 3DECA 2BHZA 3ZYJA 4XCYA 2CXGA 3T2NH 2UWEA 4HS8H 4XNQA 5FO9B 1NQBA 3WHE1 5EPMB 3KLSA 1UGNA 1VFAA 1JF5A 4JFQA 3BKJH 4N90D 1BQHG 1MIEL 3SDXF 5ELIA 2P8LA 4U1MB 3L1OL 5KZCB 4UAOC 4EN3A 1F11A 1UYWH 2H8PB 3V2AR 5DD3L 1R3LA 1KPRB 4M1CC 2A6JB 4A2MA 1TJHH 1HHHB 4JY6A 3BP4A 3ILQD 3DYOA 1CD1A 3KHQA 3IJHA 3S5LA 3VXRA 5D96B 2IH3B 2P5EE 3FRPA 3EDFA 5T3XH 1MUJB 4X98B 1EHLL 3ZE0E 2WBJA 5DTFB 3PV6B 4FQXC 1A7RL 5D7LE 1NCDH 2QSQA 3FONA 4I9WD 3DUHA 3N50A 2HWZH 4M93C 3V5KA 3DNKA 2X1QA 1Q1JH 4OF6A 4L4VA 4FZ8L 1A7QH 3D2UA 1T89C 5CMAA 5GRUL 2LE9A 2DLEA 3MV8A 15C8L 5ACZB 1AO7B 2V9TA 1A9BB 1DQDL 4FZEH 3M8OH 4X99A 5DUML 4QGYA 5EOCH 4AJ0A 3SDDC 2C4FU 5ILTL 2W07A 1VESA 3DO7A 1OSPL 3KLAA 3FOMA 3VRLE 3FO0H 4LLDB 1JI2A 1FLRL 1OTTD 4WDIB 4OLZH 4XAKE 5I1HL 4X4YA 4Y2DB 4LHJB 2H6PB 3FAWA 4WO4C 5EORH 2Q87A 4HUNB 4FQXA 3NTCL 2BVEA 4FTVE 1M4KA 3O8XB 2WMPA 3MNZB 5F71A 3JSSA 3PWNB 4QRTA 1T89A 1MY5A 2Y4SA 4ONGL 4NPYB 2XXCB 5D71L 1D9KD 1NGXB 4LIQH 4UNVA 3NIFF 4P48A 1ES0B 3T0EB 2FJGA 3SDDA 5HPMA 4IS6A 1NLDL 3QUXC 1JGEB 2EXWC 3RPKA 3SDXA 2BVYA 1T0PB 3BP5A 4X6BA 2X4SA 2R4RL 3HE6D 3JUYA 4RA0C 4PBXA 3PWVA 4WO4A 5IESH 1FCCA 3SKOB 4M8QB 3D25A 5ESVA 1ORQA 2AJYL 4KKCD 3DV6B 1KTDB 1NJ9B 1HKLH 2XWBB 5J1AB 1NL0L 5JR1L 4DQOL 3WKMH 5BV7L 1NC2D 4DZ8B 4Y4HB 2RJMA 1RZJH 4IRZH 4NQVA 4PJ5D 5EWIL 3DVGB 3UDWC 4IM8A 1IGML 3NIGF 3OKKB 4OF8A 1J1OL 1SJEA 5E5MA 3ZT5A 4BFEA 4RBPH 3IDGA 2CLRA 2BSTA 3M17A 4PJFE 4RGOL 5E8DL 2HTLD 3J7HA 4OV5A 3MV7E 3V4PL 2NYYD 4K3EH 1QOKA 4TUKL 1BIIA 3QUXA 2CUMA 3VCLB 3HUJB 5C0AA 1R0AH 1FN4B 1U95A 4WFHD 4YQXH 3ME0A 4LLVA 3LRGA 4NC1C 1MY7A 1LILA 2H26B 3CLFL 1RZFL 4Q6IB 2FX7H 2Z31B 3LS5H 3QDGA 4IJ3C 5JHLL 4FQCL 1A9EB 3H7LA 4HG4K 5IHUH 1R3JB 5BRZD 1AR1D 5E24E 3EBAA 1DBML 2PR4L 4LHUD 4OFYA 3UDWA 4OLWH 5E99H 3O2VH 2X4TA 4NO0D 4HZLB 1OAYL 1ZGLA 1JGLH 1DANT 1I7UB 1IC5H 1MRCL 4EDXB 1KJ2B 3HG1B 1FNGA 3G08A 4G9DA 3H42H 1MCKA 4GQ9H 5E2VH 2IAMC 3P4NB 3QI9C 3V4VL 1JHTA 1J05A 4HBCL 4PJ8C 4FFYL 3SKNA 4PYGA 2OTUB 2VITB 4ZFOL 4KPHL 4NKMA 3QDHA 4XVJH 3KLDA 4PG2C 5IM7B 2ZUYA 3F12A 4R97C 2BVQA 5A16B 3FZUD 2FZ3A 3MRJA 2ZKHH 5J56B 4YHML 2X4UB 5DVOA 1MHEB 5CJ5A 1AFVH 4E0RA 3W11C 5J9PA 2COQA 3AS3A 3SDAB 1RULL 2R0ZH 2AJSH 1C5DA 2BNQE 2R8SH 1S3KH 1P4IH 3T4YB 2EE2A 3CH1B 3OB0H 1KXTB 1JIBA 3DUUB 3MO1A 3MJ9A 1E4XL 3VFMB 1IM9D 5CJBA 4XMLH 1S9WA 2NY2C 2YZ8A 5EC2B 3HFMH 2IANE 1A3QA 1BHGA 2KKQA 4YHLL 2IAMA 3QI9A 1MH5A 2W9LA 1IGJA 3HNSL 4TTDD 4JFEE 4PJ8A 2BSRB 4LU5H 3K8KA 4Z77A 3GM8A 4PG2A 1QBLH 4OZ4A 5EU7C 2Z0BA 5HY9A 1CQYA 4ZUUB 5GRXG 3BFOA 5C0CD 3WIIL 3DRQA 5CCKH 2AVGA 4C56A 2CK0H 1OGAE 3IS0X 2DIAA 3IU3B 3MLYH 3T3PE 3D39D 5EZOH 1HQRA 3E6FA 4LVNC 4NKOB 4LK4A 2BVUA 4OT1L 5EU6A 1G1CA 1JYXA 1ZT4A 3SGEI 1WTGT 4ELMF 5MHSE 1OP5H 2YWZA 3FMGL 4JZJB 1CGVA 3JWOL 3CK0L 3WDHA 4BH8B 1QFWM 5ESAA 1H3TA 4JDZA 3UTTB 1BMGA 5MERB 5EULV 1CXLA 2Q7NA 1E4XI 4XPFH 4KROC 5I1CH