4M6NH

Crystal structure of anti-il-23 antibody cnto1959 at ph 6.5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
213
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFSNYWIGWVRQMPGKGLEWMGIIDPSNSYTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARWYYKPFDVWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CNTO1959 light chain
publication title crystal structure of anti-IL-23 antibody CNTO1959 at pH 6.5
rcsb
source organism Homo sapiens
total genus 46
structure length 213
sequence length 218
ec nomenclature
pdb deposition date 2013-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m6nH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m6nH01
2XTLA 1OAYH 4IRZH 1G1YA 3KJ6L 1U8OA 3AY4A 4I9WE 4JKLA 1T2JA 3GRWH 4Z8FL 3SKUD 1AQDA 3MNVA 3WL9A 3PWVB 3RPIB 4FQQA 2BHYA 3OBAA 3UTSA 3SDAA 1IGMH 4NNXB 1S78D 3WN5C 15C8H 1TQBB 3E2HC 5ESVB 4PGJA 5FYJL 4WHTA 3BT2H 4FZEH 5HYQB 2VXQL 5ICZB 4U7KA 4C59B 4MCZB 1I1AA 4I3GA 4YLQT 1KN2L 4E5XA 3PL6C 4Y5VB 4PLOB 1TFHA 3CZFA 2OCFD 4ELMF 2DF3A 5I71B 5BS0D 1NBVH 4MCYA 2FGWH 2R56H 1K4DB 3Q5TA 1QLFB 5TFSL 4RRPA 1LO3L 1NLDL 4OLZL 4ODSH 3V6ZA 4H20L 4HDIA 1W0VA 2GAZB 1LE9B 3AFLA 5AYQA 2F74B 4JFHD 3BP4B 2YD8A 5GS0C 5I1GL 1AQKL 3OXSB 5C0RL 2OK0H 4K8RL 1JWUA 1UKQA 4QRQB 5HHXL 5HHVH 3UTSE 2BOBB 4MNHA 3U1SL 2IMMA 2G5BB 4LHQB 1DQTA 3T0ED 4DVRH 1HYSD 2HRLA 1Y0LA 2OXHA 2HAZA 2IBZX 4I0CC 1Z9SA 3VD7A 4M1CC 3OKNA 3MREB 3IFPA 1G7QA 1YMHA 4M7JL 3P4NA 3ECBB 4ZYKB 1IEBA 3AUVA 5LJYH 3G08A 1KJ2L 1HQRA 2X4PA 5T5NG 2DQDL 5C0FB 1CE6A 2DLGA 4W68A 3ZT6A 2A0LC 5E4IA 2X9XA 4BA8A 3ET9F 4GMTH 4P23C 2QHRL 1EAJA 1J0HA 3MV9B 4KI5F 2NY2C 4X0KB 4OI8A 3PWVA 1DBBH 4PJCF 3D9AL 3RPIA 5JA8B 4NNXA 3JV0A 1BFOB 2EO9A 4P4KD 1T20B 5ESVA 2YHGA 4P99A 5HYQA 5ICZA 2VDOL 2HWZL 3UTQB 2CLRB 4LQ1A 4OV6F 4MCZA 5D1ZB 2ED8A 2P4AB 4WO4C 2RR3A 2X1QA 4N8VG 4Y5VA 4M7ZB 1PAMA 2GYSA 4EJ1C 4K7PH 3QI9C 5B39G 3B2VH 4PYGA 1K4DA 4YNYB 1QLFA 3ZL4H 2AGJL 3TYGH 3O6LL 5JHLL 5J13B 2F15A 4XXCC 3TJEH 2YD2A 2F53D 2GAZA 4U0QB 5MEND 2DQIH 1LE9A 2F74A 3IAGC 3BP4A 4OFVA 1ERNA 1KCLA 3QG6B 3D5OF 1JZ8A 3OXSA 3RWIB 4OGZA 2JIXB 3VFSB 4M6NL 2WIMA 1LK3L 5I75B 4IRSC 1VSCA 1MHPL 4EN3D 4PS4L 1MVUB 1JYVA 3K8KA 2G5BA 1E6OH 3AB0B 4JFFB 4TNWF 3ARGD 1A47A 3MJ6A 1EO8L 3BSZH 1CN4A 3MREA 4Y4HB 3DO7B 3ECBA 4ZYKA 3T09A 2VZTA 2BVTA 4LRIC 2J7LA 5DR5H 4MLIA 4F7PB 1T1WB 1MCBA 1RIVL 1XIWD 2DQJH 3ZTNH 5JW3H 3SE9H 2DIJA 5J11C 5C0FA 3G5XB 3RIAF 5I9QB 1YMMB 4DGIL 2MHAA 3DSFL 3FOLB 4OIAA 3HUJF 3TT3L 2PW1B 2OI9B 4JPVH 3MV9A 1KEGL 4X0KA 5FHBL 3V4VL 4IRZL 3RKPA 4MXWH 4KAQH 3W5MA 3ZT7A 4MA7H 1BFOA 1ZOXA 1T20A 3M45A 2DBLL 3EYUH 3KJ4B 1AGBB 3ZE2E 3UTQA 2CLRA 3I50L 1JZ3A 2DQCH 4QGYA 4BH8B 5IMLB 1U3JA 5IROC 4HJ0D 1YDPB 4H1LB 1UXSB 5D2LF 2ZPKL 5HHOB 1E28B 1N59B 2EDTA 5GGRB 4YNYA 5D2NB 4D2NA 2BCKB 3MLUH 1KB5H 2M2DA 4JZOB 3TWCH 1DFBL 1Z9MA 2APBA 1L0YA 2R56L 3MV9E 3QG6A 4YZFF 3T0DA 1B4JL 1FDLL 5C8JB 3U9PH 1GCFA 3VFSA 3STZB 2PUQT 3AU1B 4KJWD 4TVPH 4QRSB 1MVUA 4DK3A 5I1AB 3QIWC 4P3CH 4TVPD 3WIIH 4JFFA 3ILPB 3PWPD 3JWDC 3K8LA 2OK0L 3TVMD 1MIMH 1OF2B 2NYYD 4JM2C 4DUVA 4EDXB 2KL6A 2AEQL 4Y4HA 3DO7A 5DFVC 1MI5E 4TNVK 3WKML 5I1IH 4YDKH 4F7PA 1T1WA 5T3XD 3S36L 3NIGF 4IBLT 1C7TA 3G5XA 1NCDL 3AXLB 1YMMA 2CMRH 1JYXA 1NBQA 3QDGA 4AMKL 4PRIB 2PW1A 5HY9B 3JUYA 3ZKND 2D03L 1J8HD 4G6MH 3H42L 4ZOCA 1WBXA 3FAWA 3NZHH 2UZYB 3WO4C 3O6FB 2DIAA 3C6LB 1QSFB 3X3FH 4JFFE 1FFOB 3MV7D 4P2RD 1AGBA 2GEEA 5CJ8A 1ZANL 3UPAA 4ZNEA 5MP6L 4MXVE 4N90D 1T04B 3STLB 4PRDB 4BH8A 5F3HB 2HJLB 5IMLA 4QTHB 3RKDC 1YDPA 1FLTX 1FRGL 4F58H 4H1LA 5DGQA 5HHOA 1B4RA 1E28A 4Y4FD 4NUJB 1OTTC 3UYRH 4JE4B 2YPKB 5GGRA 5D2NA 2C9AA 2QSCH 4Y88A 2BCKA 4J7RA 3NPSC 4JZOA 3VXPB 1YMME 3HAEB 4XPBH 3LB6D 2R0WH 1JPTH 1UCBL 5EU6B 2BHZA 3QDGE 1UGNA 4WI5A 3VW3H 2VDKL 3VFTA 1MCSA 3TYGL 2Y9RT 5C8JA 2WIIB 3STZA 4DTGL 3DUSB 3BGAA 3AU1A 3GM0A 4QRSA 4MDIB 4NO3B 4GS7C 5I1AA 3L7FB 4IS6B 4LARH 4F3FB 3BQUD 4LAQH 1AE6H 1NDMB 1ES0B 3IU3B 1RIUH 3RU8H 4HCRH 5E6ZA 5EOTB 2NY4B 3A6BH 1OF2A 4ZNEE 1HDMB 2NY7L 4C83B 4PFEA 1CE1L 3QFJD 3FN3A 3R0NA 4EDXA 2ITDB 4QY8B 1KOAA 3QAZB 1JF5A 1FPTL 2XY2A 3HMXL 5HHOE 3NACH 2AJYH 1SYVB 3BSZL 1GVIA 4U1MB 5D2NE 3FKUS 4NCC1 4YXLH 3AXLA 3QPXH 1A3QA 3DRQB 3VGGA 1AO7D 5GHWH 1HSBB 3BPNB 5JW3L 5LWYH 4PRIA 1A1NA 1WZLA 3MFFB 5HY9A 5TPWH 1KCRH 5DQ9B 2VXVL 3EYQC 4TSBH 1WT5C 1IC5L 4P5TD 1YN7B 1U8JB 3O6FA 5DMYA 1S9VB 3C6LA 5JMOC 3NA9H 1F97A 4HPYH 3M8OH 5FCUL 3ZDXE 5FV1L 4M62L 4ALAL 3BN3B 4MA7L 1T04A 3STLA 4PRDA 5F3HA 3MNZB 2HJLA 3DV6B 4XWOD 4XB7A 1ZT1B 3KPTA 5CKGA 4KY1H 3BD3A 3WIHH 3MPCA 4NUJA 2DQCL 2YPKA 5FECB 3IT8D 3RNQB 2R8SH 3VXPA 1KIPB 5GRUL 3HAEA 2YKLL 1CFSB 2QLVB 4QOKD 3QDJB 5EU6A 4Z7VF 4IRJD 4PRIE 3ZHKA 3W81A 1UM5H 4Q2ZB 2VDQH 2WIIA 4NJAH 5T5FL 3D3VD 4WTXA 5BMFH 4HKXB 4MDIA 4NO3A 3L7FA 4IS6A 4F3FA 4GLRH 1NDMA 4P9MH 1ES0A 1NGQH 5EOTA 3S3SA 5FYKU 1HDMA 4C83A 5F96H 4JKKA 2ITDA 4ODHH 4QY8A 3RUGB 5K9KB 2VZVA 3NFSL 3QYCA 4JJHA 3FQWB 1JHTB 1QPXA 4MX7B 1LE5A 4URTB 2XZCH 3V7MA 5EZOH 1JE6A 1NAML 1SYVA 1JPGB 3CDYA 4U1MA 3BKCH 4PJCB 3P9LB 3DRQA 3VA2C 5F7LB 2A6JB 4KK6D 4PLKD 5I1JH 1HSBA 5EU6E 2BNQD 3P0VL 3MFFA 3K1DA 4JDTH 1YJDC 3LY6A 3S37H 1RHHB 5DQ9A 5C3TA 3W11D 4BQ6A 5IHUL 1R3IL 3RIFF 2KZWA 2D0GA 1MRDL 3NOIA 1YN7A 3GJFB 4RIRB 1U8JA 2BXZA 3HI1A 3MXVL 4X9BA 4LFHG 1S9VA 3IDMB 1E4XI 3OR6B 3UTZB 4W6YB 3VXOB 3K2UL 1J11A 3GHBL 3BHBB 3NZHL 4YDJB 1F45A 2WWKO 1VFUA 3E6FB 3DYMA 3MNZA 3DV6A 1MCKA 1ZT1A 3VWJB 4ZFGL 1PEZA 4NZRH 4CVXB 5FECA 1J1OL 2XN9B 3RNQA 1E4KC 2Z0BA 1A6VL 1CDJA 1KIPA 3NH7L 4ZAKD 4J3OC 4XNYH 2BY2A 3EJYC 1CFSA 2Z9TA 3QDJA 3UYRL 1LVEA 1HIMH 2G75B 4Q2ZA 3DO3A 1GAFH 3GK8H 1J87A 2DLHA 5IMKB 2DQGH 4HKXA 3PGDB 5J7CC 1DBKL 2EDRA 2QADB 3RZCB 3SKJH 1GYAA 1C12B 1P6FA 4XX1E 5D6CB 1FFPB 2WM0A 3BE1H 2J4WL 3RUGA 5K9KA 1FGNH 4LARL 5DMIL 4O4YL 5T3ZL 5I8OL 3FQWA 1JHTA 3HUJB 4FQJL 3RU8L 4MX7A 3A6BL 2FBJH 1JPGA 5KANI 4QEGA 4E41B 5LKNA 1J05B 3EW3B 3VGAB 3P9LA 1LWRA 4EN3C 4LCUB 1BF8A 3MJ9A 4LK4A 2AI0H 5EUOF 3S7GA 5DD6A 1AKJD 4LF3B 3V6BR 3JXAA 3AC0A 3QDJE 2EO1A 4ELKB 2DQHH 4JO4H 4KKBD 4YHOH 5JHDD 1RHHA 4P2OD 4OD1H 3GJFA 3QCUL 4RIRA 4KJQD 2V6HA 2E27H 3IDMA 3OR6A 5D2LB 3VXOA 4M43L 5EOQH 5F7DB 5KVDH 2MCPL 2J8OA 3BHBA 3IDXL 4YDJA 3RFZC 3E6FA 3UJJL 2EDLA 2LV4A 3RUGE 5A2JH 4YHKH 3VWJA 1JWMB 1NC2B 5AWNH 4LDOB 4RMUA 3UTOA 1MWAB 4LCWD 4CVXA 3U4AA 1NCBL 4KI5E 5A16B 2XN9A 5KN5B 3LEVH 4IDJH 4OCXH 4NNPL 4X7SL 4OF5A 3G5YB 4M4RA 4U2ZA 4OCNC 4HFUH 5JXEA 4LLQB 5GRVL 3TPUB 5D70L 3OPZH 1B90A 1B0GB 1MHEB 2G75A 4PR5A 3MRDB 5TE4L 3SDCD 3BWUC 2IWGA 2P43B 3ARBD 3QZWG 3PGDA 2BX5A 5LBSH 3DMMB 2D0FA 3RZCA 1KELH 2VDQL 1C12A 4WFHE 3EDDA 5D6CA 2IPTL 4OFPA 1FFPA 2MSPA 4LIQE 4PJFF 4HG4K 2ICEB 3GSVB 4HLZG 4LSRH 1QFUH 4DGYH 1KIQB 3SDDC 1GC1H 5C08D 1NGQL 4HJJH 5TGBB 2VSCA 3HUJA 5FF6B 1RY7B 5FUCC 5EOCL 2X2YA 4E41A 2XN9E 3PDOB 3AROA 5D1XD 5EZLB 3O3BB 2IC2A 3ELAT 4KJWC 4LCUA 5IF0B 4S2SB 4LF3A 3MODH 1RZJH 4ELKA 4QXGH 4GAGL 2X4OB 3BKCL 4N8CH 3RL2B 5AZ2L 3TVMC 3BN9D 3VFNA 1XGYH 2Y4SA 5CAYB 4WI7A 3MRLA 4PD4J 1L7TH 4BZ1H 3DRTB 4ZOBA 2Y7QB 5DEFA 3RHWK 1NCUA 2X05A 4ESKA 4K71B 1BJ1J 4U1GB 5D2LA 2B39A 3SQBA 2ZG3A 5F7DA 4PJBF 3BGFB 5C0AB 5I15H 4I18B 5F21B 4KKCC 3BMWA 3O45B 1JWMA 3EZ8A 1NC2A 1S7QB 1PX3A 3HUJE 1MWAA 2YWYA 2MOVA 1NFKA 4NKOB 4LSPL 4Y5YC 4E41E 5A16A 3U48A 3MACH 5KN5A 3QJHB 2CKBL 1FFNB 1OQXA 1QFWM 1CD0A 5DUBB 5EO1B 3CVIH 4YO0B 4K9EH 3G5YA 3RP1A 4OFYA 2JJUA 4LLQA 5C9KA 2WUBH 3TPUA 2E7LA 3S34H 2VISA 1B0GA 3TN0B 2ARWA 3RVVD 3MRDA 3IFLL 3I3BA 4MNQD 3EYSH 5FUOH 4NKIL 2VAJA 1CLZH 4WWKB 1ZHNB 3VD5A 3W9DA 3THML 3DMMA 2FX9H 5D2LE 5E4EC 4Z7WF 2W92A 2VDPH 4G9FD 1CDIA 1QR4A 1GAFL 2Z31C 3DBXA 5GGUA 3HI5H 3P40A 5GGSB 2ICEA 2ZSVB 3GSVA 4F7CA 4HG4J 3O9WC 1KIQA 5D7KD 5TGBA 4I5BB 5FF6A 3LOWA 3NAAL 1QLEL 1S7VB 4XWGH 3UJTL 4RMVA 1K5NB 3PDOA 5D1ZD 2W0LA 1P9MC 1LO0H 2B7DT 5JIPA 5EZLA 3AGVA 3O3BA 5IF0A 5CS7A 4S2SA 1LGVA 2X4OA 2FBJL 3CX5K 1ZLVH 3RL2A 3GHEL 1E0OB 3P0YH 3IDNB 2EE6A 3UTPE 3GSNH 1JPFB 4D3CH 2YK1L 4TSAH 1CYGA 2BVEA 3DRTA 1YEHH 2NTFB 5JOPE 2DM3A 4Q9CA 3VFUB 5IM7B 2HFFB 1BPVA 1A7PL 3F58L 5AZEH 2JIXD 5KZCD 4KC3B 5KVEL 1DBAH 4PG2A 1DL7H 4PJ9D 5C0AA 1KBGH 1FE8H 1YEJL 1F4HA 5FGRA 1Q72H 1XGQB 3O45A 3C60B 1S7QA 5K9JL 3B5GA 5KVDL 5GGSY 5EO0B 4NKOA 4HUNB 3QJHA 1FFNA 4P5TC 5DUBA 4PJAB 5EO1A 5C0BD 4YO0A 4Z7UF 5HDOA 5INDB 2RBLA 4H0HB 5D7LB 1BFVL 2IQ9L 3TN0A 1H3PH 4HF5H 2VDRH 2AK4B 4WFGD 2VWEE 1CDCA 1YYMH 4LVNC 1U8NB 4WWKA 4XNUL 1ZHNA 2ITCB 3L6FB 3OPZL 4GXVL 1KIRB 4EUPG 4KRPB 2EDBA 5AD0B 3V6OA 1MVFA 5C0AE 5GGSA 1KTDB 2ZSVA 1A8JH 1ZWIB 1AXSB 5DURB 1TCMA 4IRJC 1AGFB 1HILB 1S7VA 3BUTA 5MEQB 1CICB 3UEZA 4X6EB 3IGAB 1K5NA 3MOBH 4OTXH 1HKLH 3SOBL 2MCG1 1QFUL 3QIUD 4WFFE 1HSAA 4HJJL 2XTJB 2Q76B 1R3JB 1W2KT 3U7YL 5L7XH 3X17A 1KCVL 5JIIA 1TJHL 3IDNA 5ACZB 1JPFA 4KKAC 1WIOA 3MODL 3GNMH 1U58B 1RZIB 2NTFA 5I17A 3GKWL 5IB1B 3VFUA 5IM7A 2E9IA 2EIEA 2HFFA 1S7TB 3BYTA 3ULVE 2V5TA 3V6OE 4DKFH 4NM8H 2WBJD 3U4BL 3TO4C 3C2SA 4KGLA 1XGQA 3V4PH 1F4WH 4L4TD 3C60A 2PN5A 1JTPA 3QQNA 5EO0A 3W11C 1Y6KR 3ZYOA 5C9JB 5J1TC 1WEJH 4UUJB 1I4FB 1EGJH 1A3RL 1BVLB 25C8H 5IMMB 4PJAA 5INDA 5CSZB 4HWBA 5FB8B 5HGDB 4M6ML 4XCNB 4QNPF 2EXWD 2V7HB 5D7LA 5DFWH 3EO0B 4HK0B 1RZKH 4MD4B 5B38G 4EI5A 3WNMA 2AK4A 4PJHF 3F7PC 1DBJH 1U8NA 4OLEA 2ICWI 2WUBL 1F90L 2ITCA 3L6FA 3SDXB 5FYKE 1KIRA 1KXVC 4V1DD 4F7EB 2QQNL 5AD0A 4OZIE 5FUOL 1KTDA 1CLZL 4KVCL 2DQFB 4FZ8L 2E8YA 1ZWIA 1AXSA 4NCC2 3KWWB 1QSFD 5MEPB 1XGUB 4A6YL 1AGFA 5EUOB 5C70A 3RVWC 4XVUD 5MEQA 1CICA 3LDBC 4X6EA 3IGAA 2NX5B 3HNSL 2GK2A 4PRHB 5E1AB 2ERJB 2X09A 4Y16B 1MIEH 1TVHB 4PJAE 1QR1B 5F7NC 2CR6A 2LVEA 3ORJA 4CVZB 4LHUA 2Q76A 1X7QB 1R3JA 4XWGL 1I8LC 4NUGL 2CXGA 3VXUB 3NIDF 5D7LE 1QBML 4NYLB 1LO0L 3UDWA 3VG0H 2NXZD 1IAOB 5ACZA 2X4UB 2C3GA 4M6OH 3QWQB 4G7VL 2AK4E 3HKFA 3TP4A 1OTUD 1U58A 1RZIA 4Y2DC 5EN2B 4H0GA 4G6KH 5IB1A 1IGIH 2YMXL 3P0YL 5F44A 1S7TA 1G6RB 1MJ7L 1O5DT 4D3CL 3UPCA 1XF1A 3GKZA 4ORGB 1QBLL 1JZ2A 1U8MB 1DCLA 4L3EB 3RY5A 3VWKB 2FJFB 3MLSH 1RZGB 2WP3T 1K3ZA 5CZVH 32C2A 4XVSH 3C09C 4JPKH 1N26A 2X4SB 4P2OC 5C9JA 4UUJA 1I4FA 3QB7C 1IM9B 3VRIB 3RJQB 2EH7L 1EHLL 1DBMH 5EWIL 1F42A 5EU5B 2XTJE 3MBED 5CSZA 5FB8A 5HGDA 4XCNA 1PLGH 2V7HA 4DW2L 1G9ML 5KSAD 3EO0A 2NY6D 4HK0A 4MD4A 4FQXD 4PJFB 3SKOB 4OLXH 4QWWC 1VESA 1CDHA 4I4WB 3KLHD 1CDBA 1G0XA 5INCB 3SDXA 5IIEB 3D2UB 3DXAD 2J6EH 4F7EA 3DYOA 4NN7B 5DUPH 3UPRB 2DQFA 3KWWA 5MEPA 1XGUA 4K07A 5F7EL 3WFBL 2GUOB 1OW0C 4ZS7L 3U9UB 1R24B 2P42B 4PJEB 4LCYA 9CGTA 4OZHF 5L0QB 3IDJB 3RWEB 2NX5A 4PRHA 5E1AA 3SDCC 4Y16A 1TVHA 5IBTL 2LTQB 3ULUC 1QR1A 2VLMD 4M3KB 5ACMA 4CVZA 1ETZB 1X7QA 2B4CC 3VXUA 4NYLA 5K59E 2ZOLB 3FO9A 5EOCJ 4JRYD 1IAOA 3L9RB 4PJBB 2X4UA 4YFLI 4NC1C 1CGUA 5LCVH 12E8L 3QUYD 2YD5A 3OAUL 2HLFD 3QDMD 5L7XL 5EN2A 5DC0A 4B7LA 2QKIB 3DIFB 3QRGL 3SDXE 3ZDYE 4AG4H 2Z92B 4ZO9A 2G60H 4MAYC 1G6RA 4L8SB 1IVLA 3TM6A 1TZGH 2OL3B 2OX5A 4O5LL 1J7VR 3ZKMC 4ORGA 1GGTA 2KQNA 4KUCD 1U8MA 4ZMAT 4L3EA 4YDLC 3VWKA 2FJFA 3W2DH 4PLNC 1RZGA 2FX8H 3VE0B 4HBCH 3BN9C 4ONFL 2X4SA 2NX5E 2XFXB 3FT3B 4PRHE 1IM9A 4G3YL 2VKXA 3VRIA 3QDAA 5FUZL 1JHLL 5EU5A 3VXUE 2V2WB 3P2TA 1RU9H 4GG8B 2LU7A 3VD3A 1CVSC 1UA6H 4WI9A 1T7YA 4KKLC 4PJFA 3SKOA 1X5ZA 5AUMB 3JV6A 4G6AD 3WLWC 4I4WA 3MMEB 2BRQA 2PXYC 2XA8L 5INCA 2AJXH 1ND0B 5FEBA 3IU4L 5IIEA 3D2UA 1UZ8B 1IT9H 1T5WB 2H2PC 3GJFH 4TSCH 1IQDB 1BVZA 3DI2B 5LXGH 2EE9A 3UPRA 1SY6A 4NQDD 1YNKL 4ERSH 4L3EE 2GUOA 1SJEB 3ZLQC 1R24A 4PJEA 4LIQH 3O8XD 5E2TH 3MRJB 4P59H 3IDJA 3RWEA 2AJSL 3LN9A 2OXGA 3BFOA 3HS0B 4YHZH 1NKRA 4ZSOB 5E6IB 3FN9A 3RWDB 1ETZA 5EUKB 5IHLB 2WQ8A 3RGVD 1KCUL 2F58L 4K94H 2ZOLA 2OQJA 3K4DA 3L9RA 4PJBA 1FC2D 4QXUH 1SEQL 1RMFH 4PJFE 3SO3C 1QRNB 3EOTH 4OLVL 1F6FB 2QKIA 3DIFA 1WZ1H 1VACB 2Z92A 3CXDL 2XQYG 5BXFB 2CO7B 2IMNA 1ROWA 2FHCA 2RFXB 3IDIB 3K74B 3CPLB 4L8SA 4KXZH 1HXYB 4XVJH 2OL3A 2PYED 2ZCHH 4TQEH 4JFQB 5KSVB 5CUSL 3HE7C 2D7QA 2RQ8A 4UV4H 4Z7UB 3L3KB 4PJEE 5DA4A 4J6RH 2XFXA 3FT3A 2F19H 5EBWB 1GL4B 4HS3B 5IESL 1CK0H 1JTOA 3MX0A 2CPCA 3MZGB 4XVTL 5CD3B 1RIHH 3MGTB 1JK8B 4NKMB 2V2WA 4GG8A 3I2CH 3ARZA 4PJBE 4FTVD 1F4AA 1HHIB 2IG2L 1NEZG 5FYLH 3RRQA 1D5IH 3KYOB 5IKCA 4OCMC 1MFCL 2IJ0C 3IYLW 5AUMA 5FYLD 2ZCKH 4P9HC 3MMEA 2JJWA 1UH4A 2VITB 3GO1L 1ND0A 3I6KB 5JW4N 2FH8A 2XRAL 4S1DC 2FSEB 1UZ8A 1T5WA 2QQKL 5HI3D 3SO5A 1MPAL 3CU7A 1IQDA 2ICCA 3GBML 5DF0A 4OLXL 1DQML 3O2WL 4ZUSB 3S96B 3QDHA 4Z76B 4Z7OE 4FOMA 1JF6A 4NZUH 5E5UB 3MRJA 5M95B 3IJHB 4Q7DA 4KDVA 4NRYB 5DRNB 3TA3D 4OQTA 2F8VA 3JWNC 3HS0A 4BELD 4ZSOA 5E6IA 5JR1L 3RWDA 3T0XA 1MWAH 5EUKA 5HSFA 4ZUVB 2J5LB 5MI0C 3PWUB 3CK0H 4ZTPH 5EC2B 3GMMB 3DVFA 1KJMB 1NGWB 5A1AA 1J1PL 4POZC 1IEHA 2I60H 4Z95L 4RX4D 1VACA 5BXFA 2RFXA 3IDIA 3CPLA 5E8NB 1HXYA 1MFDL 1QNZH 1TZHB 5C09D 1U93B 5J06A 2HKHH 1MH5B 4JFQA 5KSVA 3GSXB 3QIUC 2GI7A 4OD3H 4W4NA 1N7MH 4GJTB 5E9DD 5GGTA 3FRUB 4AG4L 1UWGL 4Z7UA 3L3KA 2VXUL 2ESVE 1I3UA 4MMZC 3GI8H 1JHKH 1RHFA 4YFEA 5EBWA 4HS3A 1JZ4A 4ZSOE 5IFHH 3SGKA 5CZKA 4N0CC 4PJHB 1U6AH 1EMTL 2NY0D 3CVHB 4HBCL 4K2UH 4LGRB 5CD3A 3MGTA 2OR8A 4OLUL 1JK8A 1PY9A 4NKMA 3U36B 1ZE3C 3QXVA 4EI6B 4XP9H 1R6VA 3CSGA 1HHIA 2WBJC 3TPKA 3KYOA 1IAKB 1YN6B 1NMCC 1SQ2N 2CDGB 2JJTC 2VITA 1DQDL 2O5ZH 3I6KA 3MJ9L 4M9PA 1T89C 2FSEA 4R7DB 1FC1A 3NCBB 3FZUD 3WNOA 2ADFL 4BZ2L 2R1YB 4G6FD 43CAB 2A77H 3S96A 2AJXL 2EDDA 3HA0A 4Z76A 2EIZB 4Z7UE 2IGFL 2HT3C 3LKSB 5C6WH 4U1KB 3IJHA 3QEUB 4WFEE 4NRYA 5DRNA 4XTRD 1CFQB 5BO1L 3QXUA 4ERSL 3I6GB 4LIQL 2W1NA 1KN4L 4ZUVA 3SE4A 3PWUA 3IDYC 1OSPH 5EC2A 3Q2CA 4XT1C 4YHZL 3T0BA 3QCTH 1NANI 4FXGB 1NGWA 2XZAL 3CUPB 5EA0H 4EXKA 1J1XL 4WGVB 1RURL 1RMFL 4NQUA 5E8NA 2AV1B 5DA0B 1TZHA 1CBVH 1U93A 1MH5A 3GSXA 1JPSH 3B9KD 4JQVC 1I85C 1N5YL 2FIKB 1WZ1L 3MRCB 3FRUA 1DVFA 5I18L 3LKOB 2KUTA 1J0KA 2YBRB 4XVJL 4GFTB 3LMJH 3FJTA 5IW3A 5E03A 4FQHB 4X6FB 4X9FA 4N9OB 4PB0H 3HNTH 3MCG1 4LSVH 3LQAL 4N5EC 5FGBA 1OTUC 1AHWB 5I1KH 2D31A 4PJHA 1RJLA 3CVHA 1KJVB 3QIBB 4J6RL 2VLRB 3U36A 5J3HD 3T0AA 5D72H 4EI6A 5EU3B 1P4IL 4YHNB 3ULSB 1I9EA 1IAKA 1YN6A 3F7RA 2FRGP 2I07B 3KPSD 3QO1B 2CDGA 2IPKB 1AJ7H 2AERT 1AXTL 2NY1B 3O6ML 3N1MC 3VDBA 4R7DA 3DHMA 3KR3L 4OZHB 1MQKL 4U3XA 5BOPA 2R1YA 5T1KD 3BJ91 1HH9B 2H41A 4CDHA 2EIZA 4EXPX 4F9PA 3LKSA 4GRWF 4DVBB 4U1KA 4QNPE 1JVKA 4RWYH 35C8H 4KK9D 1EUUA 3QEUA 4M6AA 3REWB 1CFQA 2ORBH 3PV6B 3I6GA 1JGVL 4LCIH 4CJ1A 3KLHC 4PJHE 1I3VA 3NABL 1T7VA 3MJ8B 1CT8B 4NBZB 3VFRB 4KJPD 4XCFH 1FO0B 2A83B 4FXGA 4HWBH 2E7MA 4X98B 5E2VH 4J3VA 1PZUB 1RSFA 4NRXB 3GMLB 3HG1D 5ITBH 1K85A 5FV2A 2AV1A 4ZDHB 2BJML 5C7XL 3KPPB 4Z7QF 5KAQG 4V2CB 3QXDB 1MF2L 4XBPB 1VPOL 2FIKA 5F9WC 1WLHA 5IV2B 2W0PA 3LKOA 5CJOH 1EAPB 2YBRA 1MY5A 3NIDE 2FB4L 3QEGH 1U0QA 3LZFH 2H26B 5CWSB 3D69B 4OM0L 4FQHA 4X6FA 5I6XB 5EU7C 3LCYA 1PSKH 3QUYC 5I8KL 2HLFC 1AHWA 1CXKA 1HHHB 1ZEAH 4HMDA 5B8CC 3MLXH 3OGOE 1KJVA 5J6HB 1U95B 2BOCB 2R4RL 3H3PH 2VLRA 5C07B 1QKZL 1YEKL 5EU3A 4YHNA 4FFVC 3ULSA 3L1OL 3UTTB 2OJZL 1XZ0B 4LSSL 4LSDA 4YE4H 2BDNH 4YR6B 1YEFL 2I07A 3QO1A 4QTIH 2IPKA 1IAIH 1VFMA 1QYGL 2WUCL 5D1QD 5I30L 1FFQA 3X3GL 4OZHA 3WLBB 1P5VA 5D96B 5I8CA 4R8WL 5BW7C 1FNSL 1HH9A 1XGPB 3MRRB 5C0GB 3KAAA 2BNRD 4HC1H 2IAMD 4X6DF 4XPGH 4DVBA 1JNHB 5HVWA 5HI4C 5FCSH 1DEEA 1B88A 3REWA 2FATH 3CGTA 4G6AC 1I1RA 2WZPD 1F6LL 1NGPL 4I3SL 4R0LC 4Q9QH 1MNUL 3BX7C 4KK5C 3MJ8A 1ADQL 4F15C 3GMPB 1CT8A 3VFRA 2VLRE 3LD8C 1T1XB 2IFGA 2E7CA 1FO0A 2A83A 4PIRF 4LU5H 5DJ0B 3BKYL 3JVGA 1ZS8B 1BAFH 1K6QL 4X98A 2APTA 1KJ3H 5EIVA 3I6LD 4AL8H 4NRXA 3GMLA 1WISA 5CINL 2J12B 4OZHE 3MLVL 1JIBA 2MPAL 3KPPA 7FABL 4Q6IC 4UT6L 3QXDA 4D9LL 4AEIH 2Y6SD 4P2YA 5SWQB 3SCMB 5IV2A 4JM2F 4N1HB 3QQ3B 3BRFA 1CR9H 1FNGB 1EAPA 4JQXA 5CWSA 2H26A 3D69A 3WFDH 1TDQA 4XHQA 3ULVL 1HHHA 2E9JA 1U95A 2BOCA 4JKWA 5C07A 4UAOC 2I5YH 5B3NA 3ALPA 5SX4H 4NDMB 4JZJB 3UTTA 5I1KL 1YQVH 2E6PA 1XZ0A 3C87A 5FAAA 2VXTH 3BO8A 3QXWA 5E2WL 5H35B 4CDGC 2VB5A 3PHOB 1K3IA 1ONQB 1WZKA 1VDGA 4NN6B 4P46B 3WLBA 1CLYH 4NGHH 3WO3B 7CGTA 1OPGH 2KKQA 2HVKB 1XGPA 2WMPA 4RDQG 3OTTA 3MRRA 3LSOB 4OKDA 5C0GA 2RAMA 1CQKA 1KEML 2QV2A 1JNHA 1AD9B 5DWUH 1OL0A 1MJ8H 4Z18A 5FYKL 4LLAA 4I77H 4OAWB 2L7UA 4UV7H 5T1LB 4WUUB 4W4OA 3RY6C 4HSQA 1FG9C 3GJFK 3GMPA 3MLTB 3MRHB 4F8QA 5C07E 4JFED 1EXUB 1FNHA 4Y2OA 1T1XA 2X1XR 1E6JL 4CMMB 1BP3B 2NY3D 1I1AD 4DN3H 2AQ1A 3UTTE 1FBIH 5DJ0A 3RTQD 1S3KL 5EORH 5JLZB 1ZS8A 2Y72A 1QA9B 4I2XB 4WTZG 3VG9C 4XZUB 3CFBB 3FO0L 4FXKB 2CR3A 4HXBH 3TV3H 3HHRB 1UKTA 3R06B 4POUB 4EOWL 2CDFB 1CLOH 1NL0H 5DT1L 1KCKA 5SWQA 3CIQA 3SCMA 2ATKB 3QQ3A 2G9HB 1I9RL 1FNGA 3WS6A 3NGBC 3OG6B 5SV3A 4PJIB 1RULH 4TNWK 2DAVA 5E8DH 3RDTB 2AEPL 4MA1C 4JPWL 3MV11 2YRPA 4JR9H 4WU7B 4S10A 5DRWB 3ZDZE 2ED9A 4IIQC 4LEXL 2NY5H 4L9LC 3SBWC 1FNEB 2FECI 3Q0HA 1OAKH 1F3JB 4NDMA 4JZJA 2WNGA 4X7EC 3WN5B 2V9TA 3E2HB 3EOBB 4LPWA 5H35A 2VUYA 3AREC 3PHOA 1ONQA 1F3DJ 2D4DA 4S1QH 3RIAK 3LPGA 1EK3A 2VKWA 2W65B 3B2UC 4U6VL 4MQ7B 2B5IC 4P46A 4WHYG 2FL5A 3HE6B 2VR5A 3CSPA 4O51B 1M4KA 3D39B 1T83A 1A9BB 4XC1L 1S5IH 3PL6B 2HVKA 1N64L 4QTIL 2JE8A 1V7NH 3Q1SH 5I74C 3LSOA 2AJVH 1A6AB 4ZS6D 4GW1B 3QHFL 1AD9A 1AI1L 1HH6B 4S0TD 1AC6A 3FQRB 3QXTA 4OAWA 1JGUH 5D93B 4CUCA 4KHTL 5E08H 5T1LA 3FQTA 5FM5O 4WUUA 1P7QB 1S8DB 3P9MB 3MLTA 3MRHA 2VDNH 1EXUA 4CMMA 2V5YA 1A6ZB 2GKIA 3FZUC 4J4PA 4JO1L 5HHMB 1UADC 4ZUUA 4YHMH 2K1MA 5DRXA 2DWEB 4JKPH 1PY4A 5JLZA 2F54E 2ICWJ 1QA9A 4I2XA 4PP2B 3TJHC 4XZUA 3CFBA 5DHXB 4FXKA 2YR3A 4P3DB 4PRAB 4ZTOL 3R06A 1GIGH 4XTRC 2CDFA 3VMNA 4O2EB 4GAJH 1VFOA 2VZ3A 4UNVA 3WFEH 1FG2B 1WFUA 4GSDH 2ATKA 3AAZB 1A02N 2G9HA 3KYKH 4FFZH 3QQ4A 5D71L 1HWGB 5I19L 4PJIA 4AEIL 4P23B 3RDTA 4ONGL 1GHFL 4X80H 4WU7A 5DRWA 2AXHA 2VR9A 5SWZD 1HXMB 1QFWI 4WUUE 4RGNB 4Y7MA 4PJ5B 1E4XH 2P5EB 5JPNB 4OCSL 3IDUA 1FNEA 4N68A 2JCCF 3W0WD 4RBPK 1F3JA 4UTBH 3WN5A 4OF8A 2F8OA 3WNNA 1OOAA 2HVJB 1N4XL 3EOBA 2P7TA 4G8IB 1WCBB 4I2XE 1MFEH 2EH8H 1FSKC 2W65A 4G5ZH 1MCJA 3C5ZB 4MQ7A 1HZHL 3HE6A 2VERN 4O51A 3D39A 2NXYB 4FQ1H 4NP4H 1A9BA 1J9CT 5BV7L 4WEUD 3WXVL 4IOFC 4NFCA 3BKML 1A6AA 4KV5F 4QHKI 4NQSB 4GW1A 2AK1H 1DQQB 4M4PA 2WAHA 4GT7A 4B5EA 1HH6A 5HDBF 4PJIE 3FQRA 1G6RL 5D7JC 3JWOH 4Y89A 1P7QA 1S8DA 5I0DA 1Q0YH 5FOBB 5E5MB 4MD5B 4IRSB 1A6ZA 5CIPB 3I85A 1NGYB 2XWTB 1YECL 1MI5D 2DWEA 4C55A 3NCFB 5L9DH 4PP2A 3DETC 5FIEA 4U7SA 1V3MA 5JQ6H 3PE9A 4P3DA 1U3ZA 4KK9C 5B21A 3D39E 3LPFA 2W60B 3H9SD 1AXIB 1U91B 2X1OA 1NUDA 4O2EA 4HLJA 4P2CG 4FNLL 5CGMA 1E4WL 1FG2A 3TV3L 4WGWB 4YBQC 3CSYB 1MRFH 4UILH 3VXRB 4JG1L 4KJPC 2J3SA 1I75A 1ZT7B 3REVB 3O81A 1RUAH 2NR6C 4X5LA 1CLOL 1WZMA 3QQ9C 2VN4A 4P23A 1FVEB 4HV8B 3O41B 1A64A 2AXGA 1HXMA 1VA9A 5C2BH 4PJ5A 1UEYA 1SY6L 4YK4C 2EDHA 2P5EA 3NVQA 4OJFH 5JPNA 4P2QD 2N56A 2XG4A 1S9WB 3WHE0 1KUMA 3C5SB 1CF8L 2HVJA 1FJ1B 3I3DA 4G8GB 3RQ3A 4ZO6A 4G8IA 4LPCA 1WCBA 3GMRB 5H94A 3C5ZA 4X6DB 4LLMB 4TUKH 4HZLB 1TVBB 3A6CH 3NCYS 4YQXL 5IBLD 4S1QL 3VDAA 3QDGD 4WW2B 1KTKE 3T65B 4NQSA 3WHE1 4XPHL 4R4FL 1DQQA 1FYTB 3WDHA 1UCTA 4LVHC 4XXCA 1JFQH 4RMWA 2R0KH 2XZQL 3CFJB 3QEQB 1IC7L 4P4RB 1BGXH 1CZ8H 1XF2B 4NWUL 4RGNE 2OL3L 2A1WH 3IB4A 4PJ5E 3MRBB 5FOBA 2P5EE 1EJOL 5D1QC 5E5MA 4ZD3L 4MD5A 5I16B 5CIPA 3C8KB 1NLBH 1Q9LB 4HT1L 5GSRB 4GQ9L 1NGYA 5GS1C 2XWTA 4LDEB 3ISWA 3CFCH 4MQXC 4NN5C 2R0LL 5JTWA 1F00I 1A14H 5DD1H 4ENEC 2W60A 2UUDH 5ALCH 1U91A 3ZSSA 2GSGB 1HOCB 2ZUQB 3LS4L 2P24B 4IMKA 1KNOB 3VXRA 5IVOA 3QUXD 4BFIA 1CXEA 1U3HD 3DGGB 1RQ5A 1ZT7A 3REVA 3O2DA 4YX2L 1FVEA 1BWMA 1H3UA 3O41A 4HV8A 1MCFA 1I9IH 3OWEA 4O58H 4S1RH 3D85B 3L3DA 4GRLC 1R3LB 3CFKB 3PP3H 1QFPA 3WO4B 1FGVL 1S9WA 3C5SA 1FJ1A 5DJCB 3ZTJH 4Z7QE 4G8GA 1JNLH 4OQTL 3ZKXC 3HI6L 3GMRA 4JPIB 3VI3F 1FVCB 1D6VL 4HS8L 3VD9A 3QHZH 1BOGA 2PO6B 3OKOB 2VL4A 4X6DA 4LLMA 4HZLA 5IROA 1TVBA 1PW3A 1HINL 1SMOA 1MFEL 3VMOA 4UINL 4JGUA 4WW2A 3T65A 3RIFK 5CEZE 3VXRE 1XMWA 2ZUWA 1FYTA 1UYWL 2X1WL 1FZKA 3WNPA 4PJ7F 3A67H 4PG9B 3CFJA 1NMAH 3QEQA 4P4RA 1HHKB 1OT2A 2DWDB 1XF2A 3MRBA 4JDVA 1MCLA 3NIFF 1WSST 2YEZB 5GGTL 4LKCB 3X11B 5I16A 2OZ4L 1Q9LA 5GSRA 4H8WC 1ACYH 3AY4C 2P5WD 3QIBD 4N0YH 5HVHC 3QCVH 4JANB 4DZ8B 1RUPL 4HGWB 1A7QH 2N7BA 4JG0H 4X6DE 3SDAC 2OLDA 4KI1A 2WSKA 4XAKE 5KG9B 1P84J 2GSGA 1JZ7A 4OI7A 3N1FC 1HOCA 1TETH 1QOKA 1A7OL 2VTFA 3P4MB 1GJIA 2P24A 3T0WA 1KNOA 1PG7H 4OIIH 5DJAB 2LE9A 1FYTE 4DGVL 2R9HD 2NY3C 3DGGA 4OGAD 1I1AC 4ZFFB 5ADPH 4LBEB 1KCSL 3T77B 3VGEA 1W72H 5DEGB 3D85A 4ZFZB 1R3LA 4FMKA 3BW9B 5F9OL 4K7PX 3O6KH 1TJGH 5ITFB 4LQFL 3SJVD 4IJ3C 2ZUYA 2DL9A 1CIDA 5DJCA 1ZLUH 4FQLL 5C2BL 3RVTD 4R90H 4JPIA 2YA0A 1FVCA 4K3DH 4D9RE 4M7LT 2PO6A 3OKOA 1A6UL 4N5UA 2GK0B 1YNTB 4YWGL 1K4CB 2UY7A 1FL5B 5DD5H 3MLRH 3N85L 1LDPH 1C1EL 2J8UF 4LSUL 1L7IH 3EYFB 4GMSH 1NQBA 4PG9A 2I9LA 3CMGA 4OUUA 1XFPA 3WUWG 4NQCD 1OM3H 1GGIH 1HHKA 3WXWH 2DWDA 1F13A 4HWUA 5FGSA 3LQZB 1KV3A 1NGXB 2A2QT 4P0DA 5L8LB 3G04B 3X11A 2YEZA 1NCTA 4LKCA 5BZDA 5SWSA 1XF5B 2A1WL 2YZ1A 3VFOB 5BS0B 5CILL 3RBGA 1TTFA 4JANA 5HDLA 4AEHL 4YHPB 3ZZ1A 3CLFL 3T1WA 1KLFA 1DEDA 4HGWA 3CVHL 4TRPL 3BRGC 1RVFH 1N0XH 1OAUH 5KG9A 3ARSA 3IXTB 1OAZH 4PRNB 3CFCL 4K55A 1CGWA 4TOYH 3GI9L 1OGTB 3P4MA 1YEGL 4M5ZH 4PGCB 1A14L 3AS0A 5E2UL 5DJAA 3WS3B 5IQ7L 4ZFFA 2JCCB 1Q1JL 3W39B 3T0EB 4HGMA 4LBEA 4Y5VC 3T77A 1MFNA 5DEGA 1SBBA 4ZFZA 4X9HA 3NCCB 1WT5A 3O3DB 1BFSA 2FDBP 3BW9A 3V0WL 2DKMA 5DHYB 4KZDL 5ITFA 2QQLH 2CDEB 5SWSE 1DR9A 3BRDA 1NMBH 3LN4A 2Y06L 3FOMB 5D8JH 4TULH 3ARDD 3TF7C 5HPOA 1GZQB 2DLTA 2GY5A 5J89A 5L6YH 3WHXB 2P45B 4DFHA 1K4CA 1FL5A 4FABL 3UBXB 2MKLC 3RWJB 2B1AL 2P8MB 1QFWL 3FN0H 2XT1B 3VXTB 4LPXA 5GRJL 1UH2A 3GRWA 2DN7A 4NRZB 3WDIA 4KPHH 3EYFA 3KPMB 4P4KB 1YEEL 5ECJE 2JJSA 4OSUH 3UJIL 3LQZA 1NGXA 4NBXB 3G04A 4HPOH 3A67L 3WJJC 3IKKA 1RK0B 3HPJB 2OJEB 1XF5A 3IRPX 3IAQA 2NZ9D 2O93L 3FFCD 3VFOA 1EZVX 5BS0A 2AEIT 3B83A 4YHPA 2EZ0C 1MRCL 2FD6H 4OQ1A 4N1EA 4YBHA 2F53B 5MENB 4FHBD 4JFZH 1A21A 3IXTA 4PRNA 3RWCB 5B22A 3MR9B 1OGTA 1GH7A 5ADOH 4N0RA 1TXKA 2Y5TB 4PGCA 1IQWH 1JBJA 4JG0L 5C6TH 1A1MB 3UO1H 5D7SL 4EN3B 4W6WB 3WS3A 4XXDB 2JCCA 2PTTB 4YDIL 3W39A 3T0EA 4I0PD 2D7TH 5IBUG 4MB3A 3ARGB 4YXKL 2UZXB 3LIZH 2ADIB 3E1F1 4RAVA 2WK2A 4ODXB 4R97B 4DQOH 4XP1H 5J13C 2X42A 5DHYA 3UMTA 2CDEA 1QTYT 4YH6A 1IBGL 1RAMA 1A0QL 3FOMA 1XIWB 2HLAB 5BS0E 3ZSTA 4UTAL 1GZQA 3E6HB 5ANMB 1TJGL 5TDPB 5JXAH 3WHXA 1S7UB 4GH7B 3CJJA 3SGJA 5GZNC 4JFHE 3UBXA 3RWJA 2FO4B 3AB0C 3VXTA 2EXYC 1S7RB 1FO0L 4NRZA 3C08L 3KG5A 3EO9L 3MROB 4FQIH 4FQCH 1VCAA 2JCCE 3KPMA 4P4KA 3U30B 1G9MC 3MV8D 3T0EE 1MEXH 5D9SB 4I48B 4EVNB 4U4BA 4M8VA 1A3LH 2P48B 3PQYD 2I24N 1PQZB 5C1MB 4Y4KD 4AY0A 1J86A 1RK0A 3HPJA 2OJEA 4JY5L 2W0FB 2GY7B 5HHQB 2OI9C 2Y5EA 4YGVB 2MWCA 3CXHJ 2DLFL 1Z3GH 2F53A 3ES6B 5MENA 3HTLX 1QHOA 1BMGA 3RWCA 5CJQH 4WI8A 3MR9A 5EFIB 2Y25A 3KJ4C 4KJYB 2Y5TA 1A1MA 4Y5XB 3TIDB 1N6QH 4EN3A 1A7NL 3PL6D 4XXDA 2PTTA 3L3GB 3V0AC 5FKAB 4BSWB 1PKOA 2DL2A 2R0ZL 3PWPB 4XCCH 3ARGA 4KZEH 1V7MH 2ADIA 3TVMB 1CGYA 5D2NC 4JFDA 5LQBH 2HT4C 2Z93B 2KDGA 4ODXA 3TZVD 3ULUF 5GS0H 3L95B 3KVQA 3QUZD 2ZUXA 4ZXBD 4XMPL 4LSQL 2NMSA 5EBGA 1XIWA 1P4BL 2HLAA 1CFVL 2YWZA 1UM6L 4K3GA 1C16A 3E6HA 4JO2L 5ANMA 3TC9A 3QUXC 1U3HC 5B3JF 2QQLL 5TDPA 2GSIB 2F53E 1FCCA 1S7UA 3HZYB 5MENE 1LO2L 4CL7A 4PJ7B 5D8JL 2FO4A 1MCEA 5FA3B 3MLWL 1S7RA 3NCJL 1J8HB 4M1CD 4YHLL 3U6RB 3V5KB 4RRPG 1RFDH 4XP5H 3MROA 1P7KB 3SGDH 3MBXH 2Q8AL 5ILTH 4G6JL 5L88L 5D9SA 3H9HB 4I48A 4Z7NE 3MV7B 4P2RB 2AABH 1NPUA 4EVNA 4E0RB 4KPHL 5DJ8B 1FV1B 2K7PA 4NJ9L 5C92A 1INDH 4OCWL 4JFDE 2A0LD 4WWID 4L8BB 1PQZA 5GISL 1W8OA 5C0NC 2NY2D 2W0FA 4OSUL 4Y4FB 5E4EB 5HHQA 5IOPB 5EULV 4YGVA 5ANME 3BDXA 1C8PA 4DFIA 1KB5A 4HK3J 4UB0H 4F33B 3O6FC 5KOVC 4HKZB 3WD5H 3C6LC 3D18B 5EFIA 4GRWH 3WV0A 1EZVY 4KJYA 4XRCB 5HXMA 1L0QA 1PD6A 4Y5XA 3P4OB 3TIDA 4XBGA 4WO4D 1MHHB 4R6UA 5TQ0L 1UJTA 4RGOL 3TBTB 4TVSa 2ILLA 1IKFL 3L3GA 2FWOB 2W91A 4XPFH 5FKAA 4BSWA 3QI9D 5K33A 3PWPA 3BQUB 5IG7B 2V5RA 3TVMA 3U2SB 3QFJB 2UUDK 1MJUH 1Q9WB 3ULVD 3MRFB 4KROD 5AAMA 3L95A 4C56D 4M8QB 1BEYL 5FO9B 3T3PF 4QT5B 1BQHB 5D6DA 4OF3A 3MLZH 1CTNA 1NJ9B 1PJ9A 1F8TH 4HKBA 1RZ7L 2QEJA 5IVZB 4JGMA 1U2CA 4Z5RB 5D7IA 2J8UB 1AO7B 4LASH 2O5XL 3L5XL 3HZYA 4FP8H 2C7UB 2EIDA 1IC4L 1KT2B 4PJ7A 3R1GL 4O02H 5FUCE 5FA3A 1J8HA 3PP3K 3V5KA 3INUL 2NY4C 1DP0A 4P5TB 4LFHD 3RWHA 3QP3A 1IGCH 3KPNB 4TVPE 3H9HA 3HZMB 3PWPE 3RVTC 3MV7A 4P2RA 1P4LB 4UIKL 4WUKH 5DJ8A 1FV1A 3SE8H 5KVGL 4FQIL 3VI3E 3LH2H 3TH4T 1UJ3C 4L8BA 3BGMB 4MAUL 1CGVA 5BVPL 5JMRA 3BKJH 4ODTH 1NUGA 5FHAH 1OD7A 4L5FH 4GBXD 4Y4FA 5E99H 3VXMD 4PV8B 5T3XE 3MA7B 4CMHB 1A3LL 2Q3AA 5IOPA 3OJDB 4HIEB 3C5JB 5D7IE 2VXSH 1SJVA 3L3HB 5IT2H 4QOKB 4PJ7E 4F33A 4IRJB 4HKZA 3D18A 4U6TA 4UI2A 3QO0B 4BQCA 1J8HE 4XRCA 1N2RB 3HC4H 2EYRB 3PHQB 3P4OA 1TQCB 4EKXA 1MHHA 3TBTA 4JHWH 4EI5D 1G1CA 3JV4B 2FWOA 3OX8B 1XT5A 3BQUA 5IG7A 3MV7E 4P2RE 3L3JB 2EKSB 1D6EB 3U2SA 2UWEB 3KPLB 4HCRA 4M1GH 1WK0A 4W6XB 4AZ8A 6FABH 3QFJA 4N90E 1Q9WA 3H3KA 3MRFA 1I1CA 3C2AH 5FO9A 1H3GA 4M8QA 1MCRA 4QT5A 3ZYJA 1J0JA 1BQHA 3MUZ1 5ISZD 4RFOL 1NJ9A 1EV2E 3O11B 4Z5RA 2Z35B 2V2XB 2ZZUT 5GS0L 5A40E 3WE6A 2AJUL 1AO7A 3QIWD 3JWDH 3KDMB 2C7UA 1MCPH 4J8RB 2BNQB 4KQ4L 2JELL 4DN4H 4LHUD 5C86A 1YNLH 1HK6A 4JM2D 4NZTH 5KSBF 1P6AB 5ID0A 4HUKB 4P5TA 3TO2B 1ZLUK 4OGYH 2AP2A 2B2XL 5KANG 1C7SA 3KPNA 4KTDL 4PJDA 3HZMA 5ESAB 1P4LA 4MDJB 3ARDC 1RFDL 2X89D 5ILTL 3QFJE 3EGSB 3BGMA 5DHVH 2R29H 3V7AE 4I8DA 1FORL 4PV8A 2OR9L 3MA7A 2UZIL 3WIHA 4YXHH 1U8LB 3OJDA 5JDSB 4HIEA 3C5JA 4QHNB 3UBXI 5F7FA 3L3HA 4LVEA 4ZAKB 1Y6MR 4TTDC 1AO7E 2UYLB 4QOKA 4IRJA 2YA1A 4WY7L 1T2XA 4PGEB 5C0JB 2NNAB 3QO0A 3QNXB 3LDBB 4QHKJ 1N2RA 5I1CL 2EYRA 3PHQA 4R26L 3RKDD 2QBWA 3HR5B 4Y1AD 5DC4B 1BD2D 3D3VA 2V9QA 1YPZF 1L6ZA 4BQ8A 3JV4A 2YRLA 2V17H 3OX8A 3LS5H 2P1YA 3VWJC 4ZFOB 4PJDE 1MFAL 3L3JA 2EKSA 1D6EA 1RUMH 2Q86B 3GSRA 4AH2B 2V5SA 1BF2A 2BMKB 2UWEA 3KPLA 4HLZH 5E8EA 1SM3L 2A9NH 1T0PB 3F12B 1SHMA 5DUML 1I7TB 1MCWM 4NHCH 4ZG1A 1KFAH 4EIGB 2W07A 5ICXB 5JXEC 4YDVB 5GJTH 3CLEH 2Z91B 2HKFL 3O11A 4EDWH 3ETBF 2DQUL 4O9HL 2Z35A 2V2XA 3V8CA 1ZLSL 1EUTA 5F8QC 5I1EL 3D25B 1VGEH 1B6DA 3KDMA 4H88H 1AKJB 4QOKE 3QG7H 4D94A 2BNQA 1JNNL 4H1LG 3OQ3B 1F8TL 2MFNA 5FKPB 2JLLA 5JHDB 5ACLA 3LQAC 4HWZB 4P2OB 1G9NC 1QRKA 2IPUK 4LASL 4U1SB 1DLFL 1C5BH 5CEXB 3TO2A 1CU4L 1BZ7B 3D3VE 3HFMH 2YPVH 1X6LA 5ESAA 4MDJA 2CK0H 3FB8B 5DO2C 2WQRA 4YJZL 2UWEE 3IJSB 3PP4L 5TF1H 3EGSA 3ZT5A 2QJDA 3OAZH 3VGAC 3LPWA 3VMPA 1HQ4A 5CEZL 3V4UH 1SEBB 2E5EA 3HMWH 1WITA 5F97E 3F6LA 1ZA6B 3O2DL 4LCWB 3EYQD 1MHCB 1U8LA 2HRPH 5JDSA 1BM3L 2HH0H 4QHNA 1DZBA 4HIJB 2Q8BH 5DD0H 4ZAKA 3BDYL 2B0SH 3VI4E 2UYLA 1G7PB 2BNQE 1A5FH 3O4OB 1INQB 1NDGB 4PGEA 5C0JA 2NNAA 5I1HH 3NBNA 3QNXA 4OCRH 4K3EL 5DSCB 2PTVA 1Z6JT 3E0GA 1NC4D 3KS0J 3SDCB 2VMFA 3HR5A 5IFAL 4Y4KC 3OG4B 1L4IA 3ARBB 5IGXL 3MCKB 1M7XA 4ZFOA 4JAMB 1S9YB 4HH9B 2FHFA 2IH3B 2Q86A 1WAAF 5CP7B 4WEBL 3TGXA 4AH2A 2BMKA 5I1LB 2HFTA 3EDFA 2B1HL 2DQEH 3F12A 1I7TA 3AS3A 2C1PA 1INEL 5C08B 5ICXA 1B6UA 1NBZB 4YDVA 4K23L 2Z91A 3O0RH 4HBQA 1QPPA 3MUY1 4HUXA 3H7BB 5D1XB 1BBDH 2VJXA 3D25A 5JUEH 1R0AH 5DK0B 1AKJA 4JHAL 3EDKA 5E8PB 2C1OA 1IEAB 5FKPA 5JHDA 2HFGH 2Y36H 4HWZA 4P2OA 2W9EH 2YRZA 4U1SA 2EDWA 2LAAA 3TCLB 3JWDL 2X70B 3TZVC 3HAEG 3QUZC 4OM1H 3JV5A 1OARL 1XCQB 1JGDB 4ZXBC 4XHJC 3BXNB 4FQ2H 5JW4R 2QHLA 3FB8A 3IJSA 4M7LL 3KHQA 4P5MB 4YBLB 3EYVA 1SEBA 1YJDH 4MJ6B 2CH8A 3BZFB 4XAWH 4LCWA 1ZA6A 2VLKD 5T33L 1MHCA 5F89B 4XP6L 4HIJA 3WJLC 4KUCF 4HFWA 5DVKA 4PREB 2C4XA 3BISA 2VWEC 1KYOK 1G7PA 1INQA 4H5SB 1NDGA 2H2SC 1CGSH 5CD5D 3QUMH 5JHDE 4GXUM 4K3JL 5DSCA 3BGFC 3QFDB 1GSMA 4MNQB 4PG2C 3D48R 3SDCA 4NWTH 4N9GB 3ARBA 3MCLH 4EUPH 3U0WH 1LO4H 5IQ9B 4JAMA 1QD0A 1S9YA 5K9QI 4HH9A 4G9FB 5LGHL 5SX5K 5CP7A 2LU3A 3TIEB 1FIGL 4PBVC 5I1LA 4ZO7A 3I9GL 5DZOA 3EJYD 1FAIH 5JQHC 1T03L 4CN1A 2IQAB 5C08A 4J3XA 1AY1H 1NBZA 4LCWE 4L4VD 5CEYB 2ESVD 4NIKB 4XX1G 3TH3T 4PBXA 3H7BA 3TN0C 1MCNA 5D1XA 3WSQH 1F2XK 3FMGL 3EDEA 5DK0A 4KQ3H 1X4XA 1WC7B 3PIQB 4XNMB 2R4SL 5E8PA 1IEAA 1UWEH 4KHXH 4ODWB 1ZTXH 4EDWL 4XC3H 5L2KD 1QSED 1RUKL 4JCLA 3ULVC 3TCLA 3V6OC 2X70A 3GSNB 3QG7L 4KROC 3TEUA 1T4KB 1JGDA 1XCQA 2MJWA 4XB8A 3STBA 5KZCB 1BVKB 5C2UB 4IOIB 2RB8A 4QRQA 4UT9H 2BOBA 2Y07H 4PJ9B 5IJVB 4P5MA 4JFOB 2OTWB 3BZ4B 5AYUH 5B3JE 4LMQE 3PNWB 5C08E 1MFBH 5I8EB 4MJ6A 2CK0L 3EFDL 3BZFA 1N3NB 2NW3B 5IMOB 1GGCL 5F89A 2BY0A 4OLWL 3V4UL 3BZDA 4PREA 5HBBA 2ZKHL 2RIKA 5C0BB 2YD6A 4JM4L 4HULB 1EO5A 5KJRH 4H5SA 5IEKB 2CGRL 1F4XL 1T6VN 4MA8H 4M5YL 1F4YH 2GTWB 4OBSA 3QFDA 1NH6A 1A5FL 4N9GA 3MA9L 4LKXB 5IQ9A 4GBXC 3C60C 4OCRL 1OAYL 4G9FA 3L5WB 1DQJB 1IKNC 5CP3H 3TIEA 3V52H 2YD3A 5J12C 2DLEA 4LLYB 3MC0A 4P5KB 3GRWL 3BPLB 1JZ6A 4IHOB 5E5RB 4XNXH 3RA7H 3H3BC 1KACB 2IQAA 4UMGA 3D0VB 2VC2H 1IGML 5CEYA 2ZP0T 5KW9H 15C8L 5D1ZA 1YC7A 5KSBB 3BT2L 3QIUB 4FZEL 4EI5C 2C3WA 3TBWB 1WC7A 3PIQA 2BSRB 4XNMA 4U3CA 4ODWA 5CCKH 2X10A 4KRPC 3OB8A 3MRIB 3CMOH 1IAIM 2HA1A 1F6AB 3GSNA 4WHCA 3UCRA 1NBVL 2FGWL 4WI6A 3SDDD 4GLRI 1T4KA 3WKNA 4S1SH 5L8KB 3FHQA 3OKLB 3VXQB 4ODSL 4RFEB 1X5YA 4QXTB 3RWIA 2HFGL 1BVKA 2JIXA 4QO1A 3U83A 3IS0X 4G9FE 4IOIA 1XCTB 1CICC 3UC0H 4PJ9A 5DQDH 2WBJB 4JFOA 2OTWA 3KLSA 2NLJB 3PNWA 4L4TB 1X5HA 3I75B 5D7KE 2XTJC 5I8EA 1HHGB 5HHVL 2L4OA 1N3NA 2XQBH 2NW3A 3VRLE 1R3KB 3LHPH 3T2NH 3UDWC 1REIA 4DVRL 1I7ZB 1YYLH 2D7MA 5T3XH 5C0BA 2ZNXA 1YPZB 3O3AB 4GQPH 1OP5H 2PW2B 4AIOA 5IEKA 2AQ2A 2DRUA 2GTWA 2W9DH 3N1QC 3O4LD 1HHJB 4KKCD 3FOLA 4ACPA 4LKXA 2IFFH 4U31A 4V1DB 3L5WA 1DQJA 3IDYB 5E95B 4GMTL 5ALBH 5B4MC 4LLYA 3KYMB 3MCLL 5D5MB 3FB6B 1BFTA 4XMLH 1HWHB 4M1DH 4IHOA 1EBPA 1DBBL 3A6OA 2CKNA 3D0VA 5EZIH 1ZVHA 3PGFH 1WCQA 5TE6H 1KG0B 1KENH 2ARJQ 2R69H 1LHZA 5KSBA 1MREH 1PZ5B 3QIUA 1UXSA 2YUWA 5C0BE 3TBWA 1N59A 4U6YB 3N9GH 5F3BB 2YPLD 1CVRA 2Z31D 1IFHH 2NXZB 3MRIA 3SE3C 2UY6A 3O9WD 1F6AA 4K7PL 4WFGE 4AEFA 4UT7H 3B2VL 4XNZB 3ZL4L 4G42B 3OKLA 4XC3L 4RFEA 2BSTB 4QXTA 1ED3B 3TJEL 3WFCH 1XCTA 1EERB 4BH7B 3CAFA 2DQIL 5EIQA 5IW6B 2WBJA 4NQVB 4Y16C 1RUQH 2NLJA 3ILPA 4L4TA 3IF1B 3I75A 1W0YT 1OVZA 1K9TA 1HHGA 1A9EB 1GXEA 4I1NB 5BV7C 1R3KA 4XCYB 1E6OL 1G84A 2Z8RA 5KSBE 1I7ZA 4LRNH 1EGJA 3Q5YA 1NFDF 4HS6B 5GJSH 3MBEB 1YPZA 3O3AA 4M7KH 2PW2A 4NM4H 5HHPB 5KSAB 3I84A 2NY6B 2VIRB 1HHJA 4FQXB 5DR5L 2DQJL 2DDQH 3ZTNL 3SE9L 2X9YA 5CZXD 4NFBA 2Q7YB 3VWKC 4D0DB 1I3GH 3DXAB 3IAPA 4V1DA 2CQVA 3CU1A 3K1KC 1R5IB 3BAEH 3KYMA 5D5MA 3FB6A 4JPVL 3MTRA 1QSFA 3QULB 1FFOA 4KKNA 4L4TE 4ELMB 4MXWL 4KAQL 5DDHB 4XGZB 4HWEH 2A9MH 4HIXH 1KG0A 4QTHA 1DSFH 3B8YA 3EYUL 4ZOEA 3RA7L 3P30H 1PZ5A 4LSTH 4U6YA 4ZNCD 4ETYA 5HYSB 4KMTH 4WCYH 1DQLH 4JRYB 3NA4A 1Q9KB 3QUYB 2F9BT 3QDMB 1DJSA 3LEYH 4G42A 1DTUA 3MLUL 1UZ6F 1KB5L 5HD8C 4XPAH 2BSTA 1ED3A 1WIPA 4V1DE 1P5UA 3KLAB 3DUSA 4LMQI 3TWCL 4BH7A 5L0QC 3S3JA 2VL5B 5IW6A 4ZODA 5D5ME 4RQQB 4NQVA 1QSFE 4Q9BA 2HT2C 2K9UA 1BZQK 3IF1A 4QRPD 3S35H 3U9PL 3IU3A 2GJ6B 1A9EA 3UC0L 4NKDB 4X6BB 2GT9B 3L3OB 4GUPB 4MQSB 4TVPL 1T7ZA 1EEYB 4KKAD 4XCYA 4P3CL 3AMKA 3WIIL 3S4SB 3KS0H 4HS6A 4QHMB 3MBEA 5F72S 1MIML 2D7NA 4YEEA 4MJID 5HHPA 5KSAA 3SQOH 1WAAA 3OAZK 3V9FA 2VIRA 3DUUB 4L8SC 3BDBA 5T3XL 1CXLA 5I1IL 3TO4D 2NW2B 4FQXA 4YDKL 4R0LB 3B8SA 1LO5B 3CD4A 4RAHA 4Y0GA 4F15B 2A6DB 2XXMB 4D0DA 3DXAA 2CMRL 3I3EA 2RGSA 3Q6FB 4TPRH 1R5IA 2J6EA 4PRBB 2FCBA 4F57H 2IFFL 4NQDB 1EJ6A 3QULA 4XPTH 2ZNWA 1WFOA 4G6ML 1LP9F 3UYPA 4TUOB 4ELMA 1A6WH 5DDHA 5ETUB 5CD5C 3O8XB 4XGZA 4OIBA 4HEPG 4QHUB 5ALBL 3ZE0E 1D9KD 3HC3H 4U0RB 3S8WA 3KXFD 3X3FL 3UZQA 4JCMA 2C4FU 4Q6IB 2KH2B 5AG8A 3JTTB 4ODVH 4HXAH 5J8OA 3RGVB 1C5CH 1OAQH 5JIHA 4NHUB 5HYSA 4FG6C 2R69L 1WAAE 1GGBH 4JRYA 4F58L 1JI2A 3HZKB 3GGWB 1Q9KA 3QDMA 4OT1H 3RWGB 1CCZA 3RVWD 3BZEB 1X4ZA 2QSCL 1IARB 3WCYA 1IFHL 2DMCA 1NKOA 4Y8AA 4XPBL 2CXKA 3DXAE 4OGXH 4R2GD 4JFPB 3KLAA 1NCWH 2R0WL 1JPTL 4LL9A 2PYEB 2VL5A 3VW3L 1UXWB 4RQQA 4ZPTB 3QWRD 4X7FC 5E6IC 3OAYH 4ELME 1SJHB 3RY4A 5GIRB 3S88H 4NKDA 4X6BA 2GT9A 3L3OA 4GUPA 1EEYA 1CL7H 3S4SA 4LAQL 1AE6L 1F58H 4Y2DD 1RIUL 2VLME 4HCRL 4QHMA 1FLRH 3V79C 5KVFH 2L0DA 3WYRA 1RJZB 3GSOB 4PJCA 3RVXC 5ID1B 4X5XB 4JRYE 1NSNH 3DUUA 4FTVB 4JRXD 2A6JA 5EU7E 2NW2A 1X5KA 3NACL 2AJYL 3QDME 4BSVB 4R0LA 5EB9A 4YXLL 3X12B 3DUHA 1LO5A 4LHUG 2F54D 3QPXL 2A6DA 1H8NA 1TPXC 3MLYH 5I2IB 5GHWL 3Q6FA 1ZK9A 4NQED 5LWYL 2J88H 4QLRA 4PRBA 5TPWL 3IFNH 4WU5B 3MXWH 5JW4Q 3UTZA 4EEEA 4RNRB 1KCRL 4NC0B 4TUOA 2XI9A 3VG9B 4TSBL 5ETUA 3LRHA 3O8XA 1BOYA 4QHUA 4N0FB 5KTEH 3MUJA 2RCSH 3TA3B 1JZ5A 1AGCB 3NA9L 4QWWD 4HPYL 1XEDA 3M8OL 1RZFH 3JTTA 5I0ZA 2O26U 3U0PB 3RGVA 4PJ8D 1A7RH 5IWLA 2VDMH 5BZWB 5TE7H 4NHUA 4MS8C 1OQOA 4PJCE 2DJ4A 1BHGA 4KY1L 4RWHA 3HZKA 3GGWA 2H1PH 3WIHL 3RWGA 3BZEA 1NCCH 1YUHB 4AK1A 5I1DB 1XGTB 4IIQB 2R8SL 4RZCB 5F8RC 5K93A 3DYPA 2LVCA 3ULUH 5IMKA 5C09B 2PYEA 2ZG2A 3ULUD 3RI5F 3FT2B 1JRHH 1UXWA 2B4CH 1MJJB 4ZPTA 1UM5L 4UOJA 5E9DB 3NCMA 3EJJX 4NJAL 3JTSB 1SJHA 3K0WA 5GIRA 3MRMB 2J5LC 4OZFB 5BMFL 4N8PA 2VLJB 4J3TA 4P9ML 2NY0B 3KPRD 5E00B 1HKFA 4JVPA 4MAYD 5F96L 1QFHA 1RJZA 4ODHL 1J05A 3T2QA 3GSOA 5ID1A 4X5XA 1FP5A 3ZKMD 2AKRB 3ARYA 4RSVA 4OFIA 4BSVA 2XZCL 1X5GA 3P11H 1FZJB 5EZOL 5HPMB 5F1OB 3X12A 4AQOA 1DVFC 5A2KH 1KPUB 4X6CF 5I2IA 2A74B 2H32H 4R4BB 5I1JL 2D4FA 2PYEE 4G6FB 4JDTL 4WU5A 3GBNH 5FGBC 4RNRA 4CU8A 3S37L 4KTEH 1H5BB 4KVNH 4MGXA 3GUTB 1XF4B 4MVBC 4TPRL 5H37G 2BFVH 4N0FA 4KKLD 3TA3A 3NTCH 4F57L 3T04D 1AGCA 3WLWD 5ICYB 4H0IA 2PXYD 5E7BA 1NCAH 4KDWA 1MAMH 3U0PA 3HC3L 1OLZA 2H2PD 5BZWA 4W81A 4CN6A 1X3DA 1UACH 2DMBA 3O2VH 4HXAL 4NZRL 5FYLE 1GRWA 3OGCB 1C5CL 2EE2A 2YS4A 1MHEA 1CTOA 1YUHA 1YEDB 4RX4A 3SHSA 5I1DA 1XGTA 4IIQA 3QR2A 3QNZB 4F9PC 4JN1H 4RZCA 4XNYL 4L3CB 1OGAD 5C09A 4Z6AT 3FT2A 3B9KB 2WP3O 1MJJA 5FDWB 5ESQB 1HIML 5E9DA 4V2BA 4E42B 2XKSA 4LLVB 1VADB 3JTSA 4XMKH 3ME0A 1NCWL 2CLZB 3GK8L 3MRMA 1FYHB 1I1FB 4OZFA 5GGVY 4YHYB 2VOTA 2DQGL 3VFGH 4JO3H 4ZFOL 3WMSA 4GKNB 2APWA 2ZWLT 3SKJL 3S3PA 1HYRC 5F70A 3WBDA 2Q7NA 2G5RA 4YZFE 1WWBX 3BE1L 5DJ6B 1FGNL 1WFNA 1UC6A 1OLLA 4LVOB 4Z0BH 2CJUH 3HE7D 3B4NA 2AKRA 3D1MC 2BY1A 3MYZA 1MCOH 4YC2C 3KPSB 3DX7B 1FZJA 4HUWB 5HPMA 3SDYH 4HQQH 1KPUA 2A74A 2AI0L 3ROLB 4XI5C 5C71A 5C09E 2Y7QA 5T1KB 4L1DA 4C57C 2XG5A 2DQHL 4JO4L 4DKAA 1OP5K 5E9DE 4YHOL 5C0EB 1H5BA 3F7VB 3TYFB 3GUTA 1XF4A 4OD1L 3CFDB 3NIGE 4JGJA 2E6QA 2J88L 4I18A 3MXWL 2E27L 4P9HH 1I9JH 4NZJA 1V05A 3U7WH 5ICYA 1WJ3A 5EOQL 5CZXC 4Z7VB 5J56B 3P73B 1NEUA 1W8NA 4M48H 4S1DD 5L8JB 4PY7B 5T1DH 3IXAB 1EFQA 2NY1C 3MGAA 4YHKL 2NTSP 2HTLC 5AWNL 2FR4B 2GITB 3RZWA 5EBMB 1PYWB 3OGCA 1NAKH 2JB5H 3V0VB 3LEVL 3BMVA 1LMKA 1FH5H 5GRXG 1YEDA 4IDJL 4OCXL 3QNZA 3HG1B 4D9QD 3EFFB 4L3CA 4U3HA 1KGCD 2H1PL 1ZSDB 4HFUL 4ONOA 1TJIH 3B9KA 1QG3A 5FDWA 5ESQA 4E42A 4LLVA 5GSVB 1VADA 1X6NA 2CLZA 4WV1B 5HDQH 1I1FA 3K80A 4GKNA 5LBSL 5CJXA 4POZD 2ICES 2H9GB 4I3RH 5JOEA 1FZOB 1KELL 4I5BA 1AFVH 1EFXD 1G7LB 4Q9RH 4APQD 1M7IB 5DTFB 3OF6D 3GZKA 4LSRL 4L29B 5DJ6A 4FS0A 4DGYL 2K3TA 3RAJH 1GC1L 2PETA 3SKMB 3AM8C 4AIZB 3KJ6H 3KPSA 3DX7A 4HUWA 3PABB 4HIIB 1T80A 3CX5J 3R8QA 1JYNA 4MXVF 1JPST 5D1QB 1M05B 4Z8FH 1CGXA 1H3VA 3QT2A 3ROLA 4JQXC 1RZJL 4EQ3A 3BIAX 4QXGL 4N0CD 5MEOB 5IR1B 4BJLA 2LFGA 4N8CL 3CDGB 5C0EA 1XGYL 4CKVX 3F7VA 3GIZH 1FNLA 3TYFA 2BNRB 1Q0XH 4NN5B 5FYJH 3CFDA 1X5AA 2PTUA 5IK3B 2IAMB 1L7TL 2VXQH 5FYJD 4BZ1L 4QHLB 3TH2T 1A7BA 4JFYB 1TZIB 1FNFA 1ZKAA 2Y23A 1BJ8A 2FLRT 2X41A 1KN2H 3MJGX 4MZ3A 4Z7VA 3P73A 1L0XA 5I15L 5TFSH 1DUYB 1NLDH 2FR4A 4OLZH 2GITA 5D96C 4H20H 5EBMA 1PYWA 3KPSE 4LOUD 2HT3D 4FXLA 3V0VA 5AG9A 3MACL 3RX7A 2OS7A 4XH2B 1J18A 3HG1A 2XYCA 2YXFA 5I1GH 1D9KC 1XR9B 3EFFA 3IS1X 4U6HB 3ZO0A 3CVIL 1AQKH 5C0RH 1ZSDA 4K9EL 5HHXH 3S34L 4K8RD 3O3EB 2IBBA 3U1SH 1T1YB 3ZKXB 2HP4A 5GSVA 4W4OC 1R5VB 3EYSL 4WV1A 1S7XB 3DJ9A 2FX9L 2H9GA 1FZOA 2EYSB 2VDPL 3OJ2C 5GS2D 2AJ3B 3ZMRA 4M7JH 3ARFD 1HILA 4Z7VE 2MQCA 4P57B 1G7LA 3HI5L 1M7IA 2R2EB 5DTFA 1UZ6E 2DM4A 1KJ2H 4R2GC 4JO3L 3VFGL 1ZAGA 4L29A 4QKXB 2DQDH 1CGTA 2E9BA 1QVOB 3BVNB 5DVNA 3SKMA 4AIZA 1RI8A 5C0DB 3IKCB 4WHYH 4QF1B 2QHRH 4LPUA 4WI2A 4KXZI 3PABA 3SCMC 4ZUTB 4BFIB 4HIIA 3HG1E 5D1QA 5IHZB 1M05A 3WS6C 1TIUA 4F9LA 3D9AH 4N5ED 2VSDA 1U8PB 4EIZC 5IR1A 2C4FT 4ZQKB 3DECA 3CDGA 1VFAB 3QISA 5HVHB 1OAXH 3H0TB 3GSNL 2BNRA 1HNGA 5IK3A 1IGYB 2IAMA 4TSAL 2VDOH 2HWZH 4HC1A 4QHLA 1YEHL 4JFYA 2E7HA 1TZIA 4FA8A 1NUFA 5AZEL 2ZOKB 4X83A 1C08B 1DBAL 2WLYA 1DL7L 1KBGL 1FE8L 3AMLA 4JFEB 2N7AA 2DLIA 1BVLA 4IMLB 4NN6C 1Q72L 2NY3B 5IMMA 5DVLA 1I1AB 2AAVA 2AGJH 2UVFA 1DUYA 1T83C 3FRPA 5JHLH 3RTQB 3EJZC 4CVUA 3UROR 2FEEI 1X5XA 4XH2A 3T3MF 5F9JB 1ORQB 1XR9A 2H3NB 4U6HA 3TFKC 4NO0D 3PG2A 4M6NH 4IJ3B 1LK3H 1U8HB 5CGYC 1MHPH 3O3EA 4NOFA 1H3PL 4PS4H 1T1YA 1AC0A 4PJ8C 3S6CA 5IEHB 5LGKA 4HF5L 1R5VA 2BNRE 1A1OB 2VDRL 1YYML 1S7XA 4FFWD 2MQ3A 1H3WM 1EO8H 4J4PC 2Q87A 3HNVH 5EUOA 2EYSA 2AJ3A 1CQYA 1Y0LB 4P57A 1D7FA 2R2EA 5BRZD 1OTSC 1RIVH 4X6CB 3OKNB 4OCYH 1QVOA 2AVGA 3BVNA 3EDJA 3OAYK 1JTTA 2CD0A 1GGYA 4DGIH 5C0DA 3MGOB 3G08B 4QF1A 2PNDA 3DSFH 3I6LE 3TT3H 1ZLWH 3MOBL 3B9VA 1HKLL 4MD0B 4OTXL 4PB9H 5DI8B 2R15A 4ZUTA 3ZTJG 1CG9B 1KEGH 5IHZA 4TUJB 5FHBH 2DJSA 1B2WH 3V4VH 5F9AC 3LQMA 3RPKA 1U8PA 2DYPD 1QSVA 5T5NF 4ZQKA 3RDTC 1VFAA 1G9EA 4KDTA 3H0TA 2DBLH 1IGYA 4FFVD 3GNML 3I50H 1AH1A 2X5PA 4M93B 3ESVF 5F9DC 5EUOE 1P1ZB 2YD1A 2ZOKA 3GIZL 2GJ6D 1C08A 1Q0XL 2YD9A 4R4NC 4DKFL 2ZPKH 4NM8L 4OUOA 4JFEA 2E9WA 4IMLA 5HVGB 2DTMH 3HE6C 3V4PL 43C9B 1F4WL 2WW8A 5DMJB 1I8KB 5FM8A 1AR1C 3RTQA 4ODBD 4HIHB 4PRPD 4HGKC 1DFBH 1WEJL 4Z7WB 1FL3B 4OKVB 1EGJL 25C8L 5HI4D 5F9JA 1ORQA 2H3NA 4LP5A 1B4JH 1FDLH 3G5ZB 4NOBA 4AQ1B 1EO7A 5J57B 4KK5D 1U8HA 4HMCA 5D93C 5IEHA 5TJWK 5JOFB 1BQSA 1RZKL 1NFIB 1A1OA 4OF0A 5MHSD 1DBJL 2HJKB 2NQCA 5SWZB 3U9UA 2AEQH 3S5LB 4A2MA 2DBJA 3SPVB 1U42A 4Y19D 5HTSA 3WKMH 2YUZA 1EPFA 4JFEE 4X6CA 3S36H 4KMQA 3W0WB 3SGEH 3F7QA 1NCDH 3B9AA 1HCFX 3LKQB 1BJ1H 3MGOA 4Q97A 4AMKH 4UZGA 2EIBA 2AEWA 4MD0A 5DI8A 2FLBT 4TTGA 1MIEL 1CG9A 5J4MA 1Z9OA 4MA3B 2HFEB 1KPRB 4TUJA 2FGZA 2D03H 4Q74A 3H42H 1U8QB 3RUGF 4C4KO 3RVUC 3B9EA 2MHAB 3P4LA 3VG0L 4RGNC 4M6OL 5CLTA 5I73B 4A6YB 2IALB 1SMAA 1ZANH 5MP6H 4G6KL 1IGIL 1P1ZA 1OAXL 4IEFB 1FRGH 3VE0A 4MHHI 3F5WB 2D0HA 3WNKA 1QP1A 1UT9A 3C5ZC 4X6CE 2VYRE 43C9A 2NXYC 3MLSL 4RFNC 5DZNA 1I8KA 1FL6B 1YEIH 1MI5B 3RX8A 5CZVL 4XVSL 4HIHA 4JPKL 4Z7WA 1UCBH 1FL3A 4OKVA 2VDKH 1DBML 2RJMA 5HYJD 3H9SB 3G5ZA 2XACC 4GKZB 3VRJB 4DTGH 1PLGL 2EKJA 3OKMB 5JOFA 4KMLB 1NFIA 4N1CA 1A2YB 4LLUB 3B6SB 5F6HI 1T66D 2NY7H 2HJKA 1CE1H 1SJEA 5SWZA 4PLJC 3S5LA 4PYHA 3SPVA 4WTWA 4Z77B 2J6EL 1GGUA 3UAJC 3HMXH 1FPTH 2C3HA 5DUPL 4P2QB 4LAJH 3VGBA 3HNVL 3W0WA 4JFDD 3FO1B 2Q3ZA 3LKQA 3T0VA 3V5HB 3BOVA 2IPUG 4Z7WE 5KVMC 2C5DC 1JI1A 4IMKC 5GZOD 4MA3A 2HFEA 1KPRA 4OCYL 3WJJA 1QRNA 4HK3N 1U8QA 2VXVH 1PG7X 1IC5H 2IAND 3QDGB 5HJ3B 4PB9L 1EIBA 4APQC 2FIRT 5LCVL 1B2WL 4A6YA 5FCUH 1WBXB 2IALA 3BWAB 4J3WA 5C0CD 4M62H 4ALAH 2HTKC 3J7HA 2G60L 1ZLVK 3ARED 4U05A 3B5TA 5SWZE 1DANU 3B2UD 3F5WA 4OZFH 1TZGL 3VH8B 3CFIC 2VLJD 5FOJA 3NCEB 3W0WE 3K2MC 2EDXA 3AVEA 3W2DL 5JW5B 1FL6A 2FX8L 3EYOB 1MI5A 5GRUH 2VE6B 1IAII 2YKLH 3TCXA 3MRPB 4WW2C 2LQRA 2DTML 1IGTB 2BVQB 4U1NB 3H9SA 5TF0A 4GKZA 1QRNE 3VRJA 5T5FH 3OKMA 1RU9L 4QRRD 5JZ7C 4B53A 1VGKB 3VFTB 1FFRA 1UA6L 1YC8A 4HAFA 3DNKA 1A2YA 3QUXB 4X4XB 5DEZA 4LLUA 1U3HB 5GGVH 4ZUSA 3B6SA 2EDFA 3WIFB 3HRPA 3TJHD 4LOUC 1IT9L 4TSCL 4Z77A 3NFSH 3CC5B 3MRKB 5EG6C 3RX5A 5LXGL 2FO1A 1ULVA 2EC9U 4ZOAA 4P2QA 1NAMH 3FO1A 1SVCP 1I7UB 2XNAB 4K8RC 4YFLF 3V5HA 5E2TL 4P59L 1F5WA 2ZUQC 2A6IB 3P0VH 3GMMA 1KJMA 2YUVA 2IBZY 2AJZB 3H9SE 5IHUH 5DJZB 3EHBC 1R3IH 3ARXA 5M94B 4K94L 1MRDH 3ARFC 2JTDA 5HJ3A 3QWOB 5GGRY 1UB5B 3MXVH 1A1NB 4KH2A 4QXUL 1KPVB 3K2UH 3GHBH 3EOTL 3BWAA 2IH1B 3VXSD 4ZFGH 2BSSB 2ZCHL 4TQEL 5SX4I 3VH8A 3U79A 2EDEA 4P2QE 4UV4L 1J1OH 2PR4H 5GPRA 1GOHA 2PO6C 3QH3B 4IOFD 4RGMC 5JW5A 2P5WB 1AD0B 3EYOA 1A6VH 1V3LA 3NH7H 2VE6A 2JJVA 4WJ5B 3MRPA 3T4YB 2F19L 1NUNB 4K7FB 1CK0L 1IGTA 2BVQA 4U1NA 3BP5B 1YEIL 4GW4B 5D7JD 1RIHL 2JB6B 3VJ6B 3I2CL 2CUHA 1VGKA 4I13B 5FYLL 1D5IL 1DBKH 3DLQR 4X4XA 3QUXA 2ZCKL 1U3HA 2XV6B 1JL8A 43CAA 3S9DB 4MB5A 4WRLA 3WIFA 4MMXC 3RJDA 4C4KT 2WWMD 3DETD 2FEEL 4KGJA 2J4WH 5DMIH 3DHJA 3C6SB 4O4YH 3CC5A 3MRKA 4X7DC 1FIEA 5T3ZH 5I8OH 4KK8C 1W72B 4FQJH 5T3ZD 3K3QA 4BSJA 3ZHDA 4OFDA 1AP2B 2B20A 3SJVB 4YPGB 4PTUB 1I7UA 4NZUL 2XNAA 4YBQD 2DI7A 3PGCB 4BKLB 2A6IA 1LE5B 3ULVF 3J8F7 2NR6D 1Q8MA 1UJ3B 2AJZA 4FFWC 1MWAL 3WNLA 3QQ9D 3GSWB 4AM0B 3CUPA 5DJZA 4DEPB 3VGDA 3CK0L 4DKEH 4ZTPL 3QWOA 3QCUH 1UB5A 2P46B 3VFWB 4PP1C 3ALXA 1KPVA 1ZVSB 1V5JA 4M43H 4CNIB 2MCPH 2I60L 3IDXH 3MRCA 2IH1A 4HX1B 3HI1B 4NQCB 3UJJH 1JF1B 1QNZL 2BSSA 2HKHL 4JVWA 4OD3L 1J0IA 1N7ML 1NCBH 4N8VB 3QH3A 2X6MA 2V5MA 4LCCB 5F7HA 3DURB 2P5WA 4NNPH 1AD0A 4DK6A 5B39B 3QIBA 3PV7A 3GI8L 1JHKL 4WJ5A 4X7SH 3T4YA 4K7FA 1FNAA 5D70H 2OMNA 4OZIF 5IFHL 3BP5A 1U6AL 4LLDB 4GW4A 4K2UL 2JB6A 1S78C 3VJ6A 5TE4H 4UDUB 3BIKB 4XP9L 2JJSC 4UBDD 3TBYB 1CD9B 2VZUA 3E8UH 1URLA 1CFNB 3F7YB 5DZLA 4PJAF 2IPTH 4BFEA 1ZHKB 4DWHA 2O5ZL 1EHNA 2H8PB 4MQXD 4Z78B 3N0PB 3C6SA 3HCVB 4HEME 5GGVL 1W72A 4ENED 3JUZA 3T3ME 3GM8A 5EOCH 2A77L 1VHPA 3PV6A 1AP2A 5C6PB 3SJVA 4YPGA 4PTUA 3KGRA 1PEWA 2P5WE 2XWJB 3FQXB 1G0YR 2XKNB 2VDLH 3ARDB 4AYFA 3PGCA 4BKLA 2SEBB 1EEZB 1YZZA 1RK1B 4GAGH 4ZPVB 1X4YA 1UJ3A