4M6NH

Crystal structure of anti-il-23 antibody cnto1959 at ph 6.5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
213
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFSNYWIGWVRQMPGKGLEWMGIIDPSNSYTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARWYYKPFDVWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of anti-IL-23 antibody CNTO1959 at pH 6.5
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CNTO1959 light chain
total genus 46
structure length 213
sequence length 218
ec nomenclature
pdb deposition date 2013-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m6nH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m6nH01
2VAJA 3MRJA 4R26L 1IGIL 4XBGA 5C0NC 4XPHL 3OHXA 1TJIL 3PGCB 3BXNB 1RSFA 3MRPB 4NSKB 2F5AH 4C59B 4XP9H 2E7HA 1X5YA 5GSVA 3QHZL 2FYYA 2I24N 4YHKH 1QFUL 1YEGL 1P1ZA 2H26A 4OF5A 3A0OA 4CU7A 3H9SB 1UM6L 4KRLB 4MQXD 3UZEA 4O4YH 4XC3L 5GGVY 1E6OL 4DKEL 1DE4A 1C08A 1Q72L 7FABH 5CLWA 4MD5A 1D6EB 4TQEL 4YAQA 4EKXA 3B3IB 5JPNA 5F1NB 1NAMB 3MRCA 1MCNA 1SY6A 3WHE1 3DURA 5I15L 4HKZA 3M45A 4TUOA 4PRDB 1JNJA 3CMOH 1VKXA 4FFVD 5HHXL 5CD5D 4AEEA 4PLJC 4LEXH 3VD4A 4ZXBC 2YSSA 4NO0D 3GFUA 4PJXE 1AGCA 4I0CC 2P8LA 1N64H 3VA2C 5BMFL 4PJXF 1BREA 1W8NA 4Z7VB 3NOIA 2HFEA 2NY7L 4FRWA 1U3ZA 1L7IL 4YK4B 1TJGH 4K71B 4D0CB 4JRXB 5CP7B 4HJJL 2I9LA 1QSEE 4JFYB 4WU5B 5I75B 3KYKH 4CVXA 2XTJE 4X4MA 4RISH 2O5ZH 3U7YL 3UPCA 2WLZA 2FBJL 2J8OA 3ARTA 3PHOB 1JV5B 5IVXA 3BH9A 3D69A 5ITBH 3S3SA 2IF7A 2Y72A 4PR5B 5DJ8A 5TDOB 1DQMH 4GT7A 1R0AL 4WV1A 4WV1B 4YE4H 5DMYA 1A1OB 2OR9L 2NCMA 3DVGB 5LAXB 1N2RB 5ISZB 4XMKH 2LVEA 2WQRA 4JRYE 4WGVB 2DL2A 2B5IB 4KKLD 3QIUA 5F8QC 4PJ9C 3DXAB 1PZ5A 3I6GA 4KRPC 3WD5L 3QRFM 3GK8H 1G7IA 1ZLUK 1PX3A 4PTUA 3FN9A 5DRZB 1T2XA 4HUVA 1PEWA 1Z0NA 2P5WE 4AIXA 3IDMA 3MCG1 3S6CA 3BP4A 3ZDXE 3OGCB 4G9FB 5GGSA 1WBYB 2VLMD 1GC1H 3UMTA 4BZ1H 5C0CA 1JZ6A 4JY4A 1OHQA 3VXNA 3OF6A 3IRZA 3ARRA 1PGRB 2MTPA 4FFWD 1F2XK 4JDTH 2WINA 3GMLA 5BRZB 3SKOB 2VWEC 4XPHH 4KTDH 2RQ8A 1IAOB 4XCEB 1WT5C 4AYFA 1S9WB 2HWZH 2NLJA 3QHZH 4YHKL 1QFUH 5EFIA 4IDJH 4QOKA 5L0QB 5C0BA 3IFOA 3VG0H 2VL5B 1I8KA 4Q7DA 5E2VL 1E6OH 4LHUB 2DQUL 4LHUA 4RFOH 4NQCD 5HGHA 5HGHB 4RNRA 1Q72H 1LEGB 5ESAA 3S3PA 1N5AA 1CLZH 1DBKL 4M1DH 3GNMH 2C7UB 3QIUD 2XWJB 5I15H 4JO2H 1IAOA 4Y4HD 2UWEA 4Q6IA 1T20B 3TBYB 4UUJA 1MCIA 3Q0HA 4N90D 3FT2A 4Y5VA 3P9MB 2XTJC 1HKFA 3SJVE 1U2CA 2FWOB 3GMNA 4P46C 5E8EB 2VISA 1TXKA 3WS3B 1KV3A 5ICXB 3K3QA 5F9OL 3EOAB 4Y8AA 1ADQH 5FO8B 3UROR 2P47B 5L88L 5ESQA 3VFVB 2BHUA 1I1CA 4OZHF 5H35B 5H35A 1AIFB 2XXCB 4PJXA 5F3BB 3AU1A 1LO3L 1XGPB 1HHIA 4LOUC 3G6AA 4GFTB 4MA1C 4RISL 3FN0H 4JG0L 4ZS7H 2EO9A 2FBJH 5C8JB 4ZD3H 1QHOA 4WFGE 3CPLA 3GSOA 1G0DA 3RWEB 4LRNL 1G7HB 5EBWA 5B4MD 4TVSa 1DQML 3FFCD 1UXWB 3VXOA 2AQ2A 3K7UA 3C6LB 3RAJH 2YRZA 5D96B 4NKMB 3DMMC 3NGBC 4HHAA 3RZCC 1HE7A 4RZCA 4FNLH 3IS0X 1ORSA 4M8VA 3DSNA 1GGCH 5DQ9A 4JPVL 2YC1A 4QHUA 3UBXA 3V6ZB 1ROWA 2FH8A 1BQHG 4JCLA 2NTFB 4YHNA 1KNOB 1ZA6A 5GRUH 3U0WL 3RWEA 2A73B 2IAND 4TOYH 1MH5B 3LRSA 1K6QL 2YD8A 4K2UH 4U3CA 1GC1L 4BZ1L 1T66D 4PTTA 5CEZE 4KROB 3L3JB 1IEAA 5BZWB 1A7OL 4EBQL 3RGHA 2X41A 43CAA 5BXFB 4JEGB 5E6IC 4U49A 1UACH 5DGQA 1TTUA 3HLAB 1HQRB 2YA0A 3RIFF 3BMVA 4PJDB 3TH4T 5JDSA 4JJ5A 5F97E 2XKSA 4E5XB 4QHMA 3VXMD 4QHNB 3ABZA 3MUHL 1HI6A 4UUJB 5JUEL 4C56A 1CLZL 1DBKH 1OW0C 2HMIC 1BZ7B 2PR4L 5K9OA 4JO2L 5J3HC 1HHKB 3NH7L 2DOCA 3WO3B 2I07B 3BP5A 1CFNB 2CD0A 3MNZA 4J1UA 5IFHH 1HEZB 2EDHA 2BVTA 1KJMA 1C5CH 1X3DA 1RV6X 3VFPA 5FOBB 4UBDD 5JW4Q 1A3RL 5F9OH 1AD0A 3DVIA 4NQVA 1ADQL 1QO3A 1YNKL 4XWOC 4BJLA 4QRTB 5L88H 1K8IB 4X7SL 4JY6B 3S4SB 1JZ8A 3SOBH 3WJLC 1WAAE 4KVCH 1S8DB 2DQHL 3H9SD 1I7RA 4X98B 4QRSB 5KVEH 4NZUL 3ME0A 4WIQA 1HH6A 4Z5RB 3PNWA 5HPMA 3OX8A 3QJHA 4R2GD 3S37L 5T1LD 4ZD3L 1U8MA 1VSCA 2AVGA 1ZT1A 4LAQH 4LRNH 5HGBB 4CVUA 5FFLA 3EW3B 3L95B 3VFNA 3AC0A 4PV8A 2C3VA 3G5ZA 1IE5A 1ZHBA 2WW8A 5B38A 5IMMA 4P5KB 2F74B 1A8JH 2JE8A 5D71L 4YGVA 4YHYC 4JPVH 3SKJH 5IBLD 1I8LA 2CXGA 4NQDB 4NZTH 1M05A 1IAKB 1P6AB 1F6LL 1RPQA 4Y19A 4JGMA 3SE3A 5C08B 5E5UB 5GRUL 3FFDB 3QG6B 2R0ZL 2P8PB 1CFSA 1WVZA 4OF8A 4G7VL 3LKQA 4C57C 2D4FA 3C09C 5EPMA 1K6QH 1TZIA 3MXWH 3ARPA 2W07A 3EYVB 2CLRB 4K2UL 4L29B 2NY2C 5ID1A 4YEFA 5I8KL 1A7OH 1FN4A 2HA1A 1KB5H 3RZWA 3U48A 4EBQH 4ZAKB 5KVGH 3O3BA 4P9HL 3TM6A 3HAEB 5LGKA 4P2QD 5KS9A 5DVOA 3ZE0F 4XXDB 5HHOD 5HXMA 1OM3L 3BQUD 5IGXL 1NLDL 1FVEA 3L6FB 3LS5L 2VMFA 5T1KA 1LGVA 3SDXE 1DBJH 2OSLB 1DN0B 4N8PA 2X2YA 5FYJH 3RU8H 1S7SA 4OI9A 1JF6A 3VWKD 1FL6B 1J88A 2Q7NA 5JUEH 4I2XE 3DI3B 2X5PA 1H8NA 1Q94A 2Y1VA 3JV6B 3KDMA 5I0ZA 4AIOA 2WBJD 5HVFB 2KZWA 3T2OA 3V5DA 1TETL 3T1FB 3B8YA 4EI5C 1F4WH 4GAYB 4DW2L 3O0RL 2CR6A 3DV6A 4FG6C 5CUSL 4DFHA 1JHKH 5AG8A 1U6AH 3RVUD 4RMUA 3IJYB 2OTUA 1A3RH 2EECA 2GJ6D 2W60A 1YNKH 2Z93A 4NRXB 3L7EB 1NCUA 4X7SH 4YHPB 2AEPL 1KCVH 3K74B 3PGCA 1KCSL 2YKLL 4LLUB 1BVKA 4KVCL 3K0WA 2PYFA 4Q6YA 4RA0C 5I76B 5KVEL 4JPWL 3TT1H 1SJHA 4NQCB 2NY0B 2UWEF 3S37H 1CBVL 4F3FB 2VNCA 3FT4B 3BZDA 3ZHKA 2X09A 3ARDD 1RURH 1FVCB 1H3PH 4PJAA 4XZUA 1YNLL 3LB6D 2X9YA 2ZKHL 3EJYD 4K23L 3WLBA 1KTRL 3VE0A 3D5OF 5SWZE 3G6DL 1JPST 1J0ZA 4LKXA 2EDJA 2G5BB 3PGFL 3VFRB 4AG4H 2JK5A 5D71H 1FGNH 3VXME 2A6DA 3SKJL 3HG1B 3MROA 5K33A 3E6HB 1KB9K 1YMME 1W0WA 2XN9B 3H7BB 3FN3A 1GAFL 4PLNC 2EDYA 3S96B 3LV3A 2AJXL 1WAAA 1A22B 3O3AB 5JW4N 2JJUA 3BQUC 2IPKA 2BVPB 3LN4A 1ZTXH 2DQIL 4F2MB 5BVJA 3V6OA 3H3PH 1VFUA 5D9SA 1H3WM 1TZGL 1X7QB 4TUKH 1NBZA 3CLFL 4Y16D 5IUSA 4LDOB 3QUZC 3LS5H 3MTRA 4J3OC 4JRXD 5HHMD 3WNNA 3QNXB 1OTSC 1PAMA 3QRGL 1L7TH 4PJ7E 1TPXC 1V3LA 2CO7B 1AGDB 3RY4A 2VO5A 1D6VL 5FYJL 2GIYA 1RZ8A 3EBAA 4NO2B 2X89D 1G0XA 4XH2A 2VLJD 4FG6D 3RL2B 3KAAA 3P9LA 1T21B 5JLZA 3U7AA 4RDQG 3GSRB 3DSFH 4AQ1B 4Z8FL 1DBBL 5FXCH 5KSAB 3BRFA 4ZPVA 5JZ7D 3I3DA 4LIQL 3FB7B 4DW2H 2ESVD 4OLYH 5CUSH 1ZWIA 4PRAA 4FQPA 3H42H 5F93C 5F1KC 2ZCHL 1C12B 5KW9L 3QQ3B 1EVUA 4WTXA 2DMKA 5MEPA 4I3RL 2Z35B 2WUCL 2JF1A 1RUAH 3ZE1E 3BFOA 3P73A 1IC5H 2AEPH 1E4KC 1KCSH 1UXSB 3PE9A 4OUOA 1IILE 4OFIA 3U6RA 1K4DB 3TV3H 1XT5A 1IBGL 1H15A 3DHJA 1NEZB 4XAKD 3L3IB 2C1OB 1UADC 4LEOB 3ZSTA 2WIIA 2VABA 4K8RH 4NBXB 3RGVA 4BM7A 5GGSB 3LQZB 5BO1L 1OB1B 4R96B 1AXTH 3KPNB 5F96H 1D9KB 1H3PL 1A4JB 1JHTB 2ADIB 2ITCA 3E8UH 3RDTD 2VITA 3BGFC 5FA3A 1U8JB 2WWKO 1BFOB 1NL0L 2IFFH 5F21B 3L3OA 3PGFH 1AGBB 3HC0B 4NYLA 5HDBF 4ZNEE 1NC2A 2A74A 3BSZL 5CMAA 5JPNB 1XCQA 5F9DC 3MV9A 4YO0A 1T1ZA 4KUZL 1A6TA 5EC1A 1MHPL 2FGZA 1CK0H 4Y16C 4Y2DC 2AJXH 1L6ZA 1J1XL 3NCJH 1A1NA 4PJDF 4MGXA 4Z95L 4ETQB 3MJ7B 3SBWC 4O5LL 5CJ5A 5HGDA 5CAYB 5ANMA 3RKPA 3RI5F 1TZGH 4ZO9A 3W11C 3DYPA 1KIUA 1WAAF 4PJ5D 3QEHA 1ETZA 4Q74A 3VFGH 2GSIA 2WQ8A 4AJ0A 3E6FB 2FHFA 1QPPA 3FQWB 5E4EB 1B3JA 1I85C 3FO1A 4NHUB 1DANU 1N5YL 1L7TL 5E70A 2VQ1A 5HHNB 3KPSD 4XP1L 4U0RC 1TNNA 1XGUA 3FRUA 1WV7T 3EIFA 1BHGA 1QLRA 3QUML 2DLTA 3MLWL 4KK8C 5KSAD 3MRKB 1L0QA 3SJVD 4U1MA 3VFWA 4YHLL 1WCBB 2D7PA 1DZBA 3DSFL 3UPRA 1ZT4A 3FONA 4PGBB 4LLYB 5IB1A 1TIUA 1SBBA 2IQAA 1X4XA 2XKNA 1DEEB 1T83A 2FX7L 2X10A 4KKAD 2LE9A 2ZCHH 5JPMA 5F1IB 3QDGA 1LE9A 2EDFA 4CJ0A 4CVZB 4JM2F 1RUAL 4Z7WB 4ODTH 4NQCA 4K3DL 3PDDA 4WO4A 4JG1L 1JMXA 5EU7C 3E3QE 5ETUB 3WO4C 2BSSB 2PO6D 3NN8B 3NN8A 3ARBA 5J1AA 2VLRB 2PW1B 4X80L 1MRCH 3NIGE 3TV3L 1MI5E 3MLVL 4NM4L 4L8CB 5IESL 1UA6H 4TULL 3NPSB 2NY6C 1G9MH 1AHWB 4JO4H 3FQNB 1LO0H 3LN9A 3VXUD 4F9LC 1QRNB 5KZCB 1OF2A 4RRPG 4Z7WA 4RAHA 2AW2A 4A2MA 5JHDD 4NN7C 3UBXB 3V6ZA 2NYYD 3WN5B 1NAKH 5L8KB 2GEEA 2J6EA 1GPOL 1OOAA 4M8QB 1LO2L 4JY4B 9CGTA 3B8SA 2IBBA 1UM4L 2YD2A 1N59A 1NBYA 2VDLL 2VDRH 2B1AL 3NAAL 4U2YA 1LDSA 1MHPH 1T89A 5H37G 3WS6C 4P2QA 1I1AD 1R3JB 4EIGB 1XH3A 4Z95H 3DX7B 1ZA3B 1Q1JH 5GGTA 4XXCC 3RZCA 3MRBB 3MV8A 2XZZA 3T3PF 1DJSA 4JM2D 2AV7A 3QDJD 4KPHL 2UYLB 1VFBB 1YJDC 2XWBB 2DI7A 4APQA 1YPZF 3VXPA 3EYFA 5IVZA 2R1WB 2F54A 4IS6A 3E1F1 4KJWD 2XA8L 4JFED 1C5DA 4UDUA 3BZEB 1ZVHA 1KTDB 4PS4H 5GIRA 3C5JA 1DBML 1WZMA 1ZLVH 35C8L 1K9TA 3GSQA 4KV5E 5IVXE 4U1KA 3SKMA 3X14B 1HDMA 3LQAH 3IJHB 3IJHA 3MGOA 3RL1B 5LXGL 4ENEC 2EXWC 3H9SE 3P0VL 4HUUA 4A6YH 1CQYA 1RD6A 3V7AE 2GTZB 3TO4B 3BT2H 4NC2B 4YDVA 4K3DH 4X98A 1I7RB 5EOCH 2EKSA 1IGYA 4MA8L 4MB4A 5EOQL 1IEBA 5FKAB 3FQNA 5JW5A 4QOKD 5IESH 4N0UA 5LGJA 1UA6L 3DPBA 4YBLC 4JANA 3WFEH 1G9ML 2EE2A 2VN4A 2W9DH 1MF2L 2BNUA 1MQKL 2EDNA 2DYPD 4JO4L 1LO0L 2BMKA 3HE6C 1FVDA 4UILH 3TO4A 3VGGA 3G5VA 1VFAA 4JQVA 1ITCA 3VMPA 4OUUB 4MJIA 4MD4A 5I1DB 1KTKE 4LLAA 3B5TA 2LTQB 1B9ZA 1BZQK 1YA5A 5I1HL 4C56B 5FO9B 2ARWA 1LP9B 2VDLH 3QCVH 3I50H 1P7QB 4O2CB 1M7DB 3KVQA 1V05A 1K4CA 5H2BB 4KC3B 1AQDB 3LIZL 1UJ3A 1P84J 5T3XL 4Y1AE 3ARFD 3GSNA 3OKKA 2QHLA 1OD7A 3AAZA 4RX4D 4U1LB 5T1LA 4HD9A 4JN1H 5IROC 3KDMB 1QFPA 4CMHC 1Z0MA 4QHNA 3HRZA 2MMXA 3WHXA 3GDBA 4M1GL 3T3ME 5LWYL 5DFVD 3CSPA 3QJFA 1MCQA 1UYWH 3HN3A 3WFDL 1RFDH 2NZIA 1SEBA 3TA3A 4S1DC 3C60C 4NRZA 5INCA 3VG9C 4PRNA 4KZEH 4K07A 1G7QB 4XAWL 3UZVB 3CX5K 3SE8H 5HYEA 5CILH 3DRQA 3BW9A 5DRNA 4M7ZC 4WO4C 5CJQH 3C6LD 1M6OB 4BSVA 4NFCA 5E2UL 2V2XA 2UY7A 4CADA 4ENED 4U3XA 2WIMA 1B4JH 1DBMH 4P57B 4YQXH 3CK0H 3G5ZB 4S10A 1D5IH 3GI8L 1S7TB 3CU7A 3BI9X 3PWUB 4LSSL 3REVA 3D2UA 3HG1D 3QH3B 3ZT5A 1AGFA 3BPNB 3MGAA 3LKRA 4YXHH 4V1DE 4A6YL 4JDZB 3B5GA 3GSOB 3C87A 4L4VB 3DHMA 4YHOH 5CIPH 4LSVL 3TYGL 3BD4A 2E7MA 4XWGH 2YBRA 1MVFA 4RWHA 3S3JA 2ZOKA 1WEJH 3BGFB 1FNSL 1WITA 3ULSB 3ULSA 3DMMA 4AEFA 4RX4A 2GJ6A 2GJ6B 4N90E 1W72L 1I3RA 3PDGA 1MHEB 3I75B 3OXSA 1SJEA 3UP1A 3O45A 4TSAH 3WFEL 1UQSB 4R97B 3X3FH 1MF2H 4JR9L 4I2XA 3BP6B 4LCCB 4HKJB 1N4XH 5F6HI 2XOTA 3SDAB 1F3RB 2OR8A 3DO7A 1Y0LA 1TMCB 1OGTB 5I18H 3V4UH 4PJ9B 1EV2E 1UB5B 2EC9U 1FV1A 2VDOL 4XPBL 1HINH 3G6JF 3IKKA 3T3MF 3ARFB 1SJXA 3KYNA 5ERWB 4NBZB 4RIRA 3HZVB 2VERN 5JO5B 3QCVL 1AGDA 3I50L 4LVHC 1C12A 4WFGD 3LMJH 3JWOL 4OIAA 3UEZA 4CRPA 5T3XH 5E9DB 2OJZH 5EIVA 1J86A 3DX8B 4LL9A 1YEFL 4G42A 3DUHA 4MNQD 5DT1L 4KVNH 3CZFA 4NQUA 1GOGA 4N9GA 5GJSL 4M1GH 1NGPL 3WE6B 1CL7L 5EB9A 3GKWL 4NJ9L 4PR5A 4Z7UF 2ZNWA 3VFMB 5GZNC 4XAWH 4LSUH 4I9WE 2NY3D 1KPUB 3IVKA 2NW2A 3CUPA 3CUPB 4QTIL 2PKDA 5E2UH 1Z9SA 2W38A 2WANA 4MA3A 1DN2A 5BS0E 1D9KD 1KN4L 2G2RB 3V8OA 4XBEL 2DKSA 4Z7NF 3C6SA 2CQVA 3CXHJ 5ECJE 4ZOCA 1HWHB 3N85L 1M7XA 5E94B 4JY5H 3WMSA 2DN7A 4PJCE 4AH2B 3N1QC 2BRQA 5ALBL 2DLIA 2R4RL 1W0VA 1IT9H 4E41E 3KPMA 4YXHL 2E5EA 1BGXH 4KAQL 4M7JH 2YPKB 3KXFB 4HBQA 3QIBA 4MZ3A 4YHOL 5FYLL 4LSVH 3P11H 4XWGL 4PRPD 2X4TA 2DDQL 5IM7B 4J12A 1JTPA 4Z0XA 4PIRF 5GRVK 1MY7A 2GTWA 3FMGH 1ZGLM 4LSPL 1FNSH 5ICXA 4I18A 1DUZB 3ZE1F 3ZL4L 4UB0L 3OKMB 4KTYA 1P1ZB 3VXRB 5DO2D 3QIWB 2PTTB 3TVMB 3B9AA 4EN3A 2R1XA 4X6EB 4MJ5A 5EUOB 2APWA 5IW3A 3PQYB 5BVPH 4UQ2A 4G6JL 2OZ4A 3FRPG 5L7XH 4ELME 2E7BA 4JM2B 4UOJA 1A9EA 4NJAL 5DK0A 2VJXA 2AV1B 2DTML 2OMNA 5E9DA 5IEHB 1A0QH 1NJ9A 1S7VB 2AEIT 2CK2A 3O4LB 4WI4A 3TZVD 2B1HH 1FL5A 1MELA 1HQ4B 4MNQB 1I9IL 4S11A 3LMJL 5E5MB 1T4KB 3JWOH 1XR9A 5E08H 1RK1A 3TWCH 3ARXA 3SE9H 3VXQB 2CGRL 3ZHLA 1AR1D 2OJZL 3R06A 2GJZA 1A14L 2ZCLH 2R23A 4NQTA 1YEFH 1QSFB 5AZ2H 4U6VH 1XGTA 4OLEA 2APTA 2A1WH 1T1YA 5GJSH 2EIBA 4LLYA 1HKLL 4QRPB 2DI8A 5C09B 5MENB 4S2SA 4W4OC 5TFSH 3BISA 1PYWB 1HILA 2RGSA 1E6JH 1IRAY 3MLUL 1RIHL 3CFBA 4ZTOL 1FZJA 2Q76A 4W70A 4FZEL 1NGZA 1NGZB 3BH8A 4NUGH 3QWOA 1UH2A 3L5IA 2COQA 1PY9A 4LLVB 4WU7B 4XPFH 2G60H 2R1YB 2QSCH 4FHBD 4G8IA 5LQBL 3LN5B 4HJ0D 2X4RB 4LSTL 4NCC1 4HFWA 4KK6C 3WYRA 3JUYA 3PHOA 4QXGL 2X4TB 4PTUB 3QCTL 3HMXL 4Z0XB 2FD6L 2W1NA 3SDXA 3RY6A 4M7JL 3D6GA 5BQ7B 1J8HB 5J4MA 4J8RA 3AB0B 2WK2A 1Y6KR 3M1BA 5KVDH 5IV2A 1Q8MA 3C9NB 1EAPA 4OCMC 1C8PA 2HT2D 2ARJA 2LU4A 1DL7H 4WI9A 2P5WA 5E5RB 1BFOA 3NCFB 1JGVL 4LASH 4TSBH 3FMGL 3MQIA 3N1MC 2HLFD 3CSYA 1V5JA 3D0VA 3HNSH 3IKCA 2VXVH 1H0DA 3O3EA 3ESVF 4KUCD 4PJEE 2ARJQ 5D7SL 5DHVA 2NX5E 3GSVA 4TTDC 4FQ2L 2D7MA 1A5FL 5GSRA 1NMAH 4LCYA 4G6JH 2RIKA 3P3YA 1CGTA 5L7XL 1CT8A 4M7LL 4PRBA 3LHPH 2F53D 2VXSH 2FL5A 1YEHL 4WGWB 4OZ4A 1EEUA 2E9WA 4C58B 1MAJA 3GJEA 3WKMH 4KK5C 1KPRA 2B1HL 3SDXF 1T20A 4OGZA 3LOWA 2HYMA 3SGDH 3TBYA 1ZANL 1HYRC 1V3JA 3WFCH 5E08L 2XACC 3MR9A 1FZKB 3Q1SL 4NPYA 2WM0A 1A6AB 4LCWB 5AZ2L 5EIIA 3D18B 1OSZB 3MNWB 3V4VL 5F1NA 2ITDA 1WC7A 4GG8B 1MSPA 1QFWL 3MBEA 1F4YL 2VKWA 2ORBH 1UM5H 5IIEA 2VZTA 5DYOA 2GYSA 4KXZI 2Y7QA 5DS8A 1E6JL 2IAMB 5FGBC 3MLUH 4XNZB 1K4DA 1D5XB 2LV4A 4XP6H 5F72S 3S7GA 4P49A 3ROLB 1DVFB 3U0TA 4MDJA 3PWPE 3C5ZC 1NCWH 4NKQB 1A6WL 1S7RB 3HNVH 1ZLVK 4OD3L 1F11B 5AG9A 1JF1B 4KJQD 4XPFL 3IDIB 1BFVL 43CAB 1U8QA 4G9FD 4JO1H 4NQED 2J8UB 1W0VB 4YDKH 1C1EL 2NNAB 1TTFA 2CRZA 3V5KA 5LQBH 1S7WA 3OKNB 1HCVA 4LSTH 4OZFA 1Y6MR 3QDMA 4L9LC 1ZLSH 2WP3T 1FNFA 3EO1A 3KGRA 4HXBL 4P3DA 1QSZA 3QCTH 1ZA6B 2FGWL 2PETA 2E9IA 3T4YB 5HPOA 2FD6H 4X6DF 1K8DB 1VCAA 4YGVB 4X6DE 5FF6A 5EN2A 4Q9QL 3I3BA 4MX7A 3NIGF 4LCUB 1R5VA 4M6NL 2EE6A 1LK3H 3ZYZA 3KPNA 4MCZB 1YN7A 2FJGA 1JHTA 2ADIA 3SCMA 3DUUB 1DL7L 3U83A 3AS1A 4QKXB 1WGOA 4XMLH 3W9DA 4NWUL 1DLHB 4MAYC 5DJYB 4LPVA 4PGCB 1JPFA 4M8QA 1B0GB 4XNXH 4HKXA 3HR6A 2IH3A 3HNSL 1KC5L 4GXUM 2R2HA 2LFGA 1IGIH 3DUSB 3UTSB 1B4RA 1S7QA 3V0AC 5D7SH 5EN2B 4IRJC 1PKQE 4NNYB 3V52H 4NDMA 4YK4C 4KI5F 1A5FH 1L0XA 5DJ2B 5H94A 5JA9A 4XP9L 4KI1A 4HGWA 2PYFB 1AD0B 2EH8H 4N0YH 3ZTJG 3OAZH 1YEGH 2VYRE 3QYCA 4JVUA 7CGTA 4U0QB 3LHPL 3QI9A 3NFSH 1UM6H 1IKFH 1YEHH 4MNGB 4I0PD 3TA3B 5INCB 4KMQA 4EUPA 4EUPB 1FJ1B 5DDHB 2XWTB 3QULA 2VUOA 3QUMB 1FZOB 1ZANH 5HHPB 4QOKB 1YNTB 4BQ9A 4P2RA 1RJZB 4P4RB 1YY9C 5DA4A 3MUJA 3VFRA 4FQJH 1JGLH 5DYOB 4G6FD 3V4VH 3R4DA 4FXKB 1XIWB 3DRTB 3A67L 4L3EB 5IG7A 4XVSH 4LEXL 1I7ZB 1EZVX 1QSEA 2NW3A 6CGTA 2YD3A 1QFWH 1QOKA 2MCG1 2HTLC 4MXVE 5DURD 3G6JB 4AT6A 1HSAA 5M7QA 1JZ3A 3V0VB 4Z7VF 3CXHK 4AEIH 1JJUA 1W0YT 1QBLL 4LLUA 3NIFE 1XF1A 2J8UF 4JHBA 1IARB 3HE7B 4YXKH 3KYKL 3FQXB 4QWWD 1N8ZB 1BECA 2QADB 1A6WH 3HZYB 2RB8A 3HNVL 2BNUB 2VAAA 2Y6SD 5JORB 2IANB 4OD1L 4OD3H 1OTTD 1IQDB 1S9KC 1CICC 2PF6A 3QUYB 1F6AB 1H8OA 3VXUA 1PW3A 2VN7A 4S0TD 5I19L 1A21A 1QSFD 4YIQA 3JTTA 4G5ZL 4CUCA 2FGWH 4QXWA 4X7DC 1U0QA 4XNMA 4LPUA 4ZUWB 4MAYD 3SGEH 1G84A 5EPMB 4XVUC 3RPIB 1MAKA 3RDTA 3WD5H 3MV7B 3C6LA 3GK8L 3F7VA 1FL6A 4QHKJ 1LD9A 1XZ0A 1CIUA 5FV1L 3MRMA 4P2RD 4TVPH 3VWJA 3CXDH 2ZWLT 4NWUH 3VH8A 4KRPD 4LLQA 4XNXL 4HK3N 1C16A 5J89A 1IAIL 4JDTL 4GRWH 1WBZB 3FT3A 4JFEB 4XHJC 5DGRA 3V52L 3IDGA 4UZGA 1KLFA 3BGMA 1G7QA 1MEXL 3IJSB 1OAXH 4RMWA 4JJHA 4XCYA 5EOTB 1B0RA 3VMOA 4J2XA 2W60B 1MCBA 2HWZL 2JCCF 3S36L 1NCAL 1IC4L 2D0FA 5EU3B 3BZ4B 3IU4L 5KJRH 4U1LA 4DGIL 5F88B 3C8DA 3KR3H 3VG0L 5E2VH 5D8JH 1WISA 3X11B 5F1SA 3UDWA 1G6RL 3T0DA 3F8UB 1I8IA 4HJGB 5MHSE 4N8VA 3VJ6A 4M1DL 3SE3C 3P73B 2J5LC 2Z4QB 4CBPA 2BDNL 2QKIB 3B2VH 3E3QC 3OXRA 4U1MB 1NFIB 3BYYA 4FQJL 1EIBA 1T7YA 3QZWA 1U3HD 1JGLL 4PRHE 1KJ2L 4WDIA 4GRWE 3K80A 2PCPA 5DJ8B 3A67H 4XVSL 5DK2B 5FK9A 5C6TL 4MJIE 3DX9A 1KEGL 4JFXB 3NCMA 5IF0B 3QQ9D 1I9EA 3BDXA 5JW3H 3HE7D 5GS2D 1BFTA 2EDDA 2CIIA 3Q6FA 2V5RA 1J18A 3B5HA 4P5TC 1CICD 1T1WA 1BQUA 5EWIH 3ZSSA 4MA3B 4AEIL 1NFKA 1HSBB 1NGYB 5FEBA 1JPGA 1J1PH 8FABA 5GS3A 3FN0L 4HUXB 4ZS7L 2QQKH 2P44B 4L29A 3IYLW 1S7VA 4M4PA 1BIIB 2H8PA 4MNHB 5EU7E 4P23C 3MX0A 3TPKA 5SWSB 1A3LL 3RWDB 2GFBB 3QWRA 3RJDA 1FIEA 4HKBA 5LGHL 3JVGC 1R5VB 3P4OA 4PY7B 5IBUG 5TGBA 4QXUL 5I19H 4QTHB 4MJ5B 3O6FA 3IT8D 2F53B 3HC0A 4LVOB 3ULUD 4B50A 3BWAB 3OSKA 2EO1A 3BX7C 4JGUA 1KIRA 1UEYA 2JJSC 4YAQB 5D1QA 4HAFA 2NY5H 2HVKA 3O4OB 3DROA 4FQXC 4OZIB 3RL2A 1AFVL 1KNOA 3UCRA 1U41A 1I9RL 4URTB 4DEPC 4YHIA 4LKCA 1NBYB 1DEEA 2R2BA 4TVPL 4LLDB 4UT6L 5TJWK 3NIDE 1TLKA 3MRNA 3V5DB 1MUJA 3PHQB 1IAIH 1J05A 1HXYA 2HT4C 5B39G 1C5BH 5FM8A 2HFEB 4H1LA 2G9HB 1MEXH 3ARWA 3LRHA 2XY1A 5MEPB 3S36H 1IC4H 1RIVH 3FO1B 4DGIH 3W0WD 2VQ1B 3KR3L 5IHZB 3VFPB 3ZKXC 5D8JL 1W72A 1WWBX 2IG2L 1FGVL 1G6RH 5KG9A 1FVEB 3P77B 4ZPVB 3HI1B 3VXSB 2OTWB 5GS1C 4OCYH 2BDNH 3WNOA 4QGYA 3NH7H 3MACH 3BD5A 3QEQA 2VISB 3U9UA 3I6LE 5IFHL 5L8LB 3BN9D 5F71A 1JYXA 2VXUH 3CJJA 5GZOD 1TZHA 4P0DA 3KYOB 1KEGH 3QXUA 3AUVA 1BZ9B 1T0NA 1YEDA 3OKEB 5J3HD 1YECH 1HHIB 2MQCA 2NY4D 5EWIL 4ZFOL 3DNKA 2DQHH 5J1AB 1YPZA 2X4NB 3AFLA 1GL4B 3MGTA 4IHOA 4U31A 4R4FH 5HYJD 2XN9D 4NZUH 5I30H 2GFBA 1TFHA 1K85A 2QQKL 1FZMA 3EO9L 3X12A 4JDZA 5E2JA 4PJBF 4O2EB 4LAQL 4IMKA 4UQ2B 1LEKB 1U8NA 1INDH 4L9DA 1UH4A 2V17L 1A3LH 1G7PA 1ERNA 2HAZA 1NEZA 3KPPB 4NN5B 3OPZH 1HYSC 1Q9KB 2VIRB 2YD9A 4R2GC 4FXGA 4ZFOB 4GQPH 1S78C 5C0CB 1KT2A 5I1CH 4V2BA 2X7LB 4LVEA 4ETQA 5I8CB 2PW2B 3ZDZE 1JIBA 5JQHC 2NY5L 3WL9A 1AC6A 1AFVH 3DETC 3TH3T 1URLA 3UTQB 8CGTA 4I9WD 3OAYH 3FKUS 2YMXL 4IIQC 5CSZB 2XPGA 2OZ4L 2PXYB 3HB3C 2B39A 4GW1B 4JDVA 5C8JA 5D7IB 5I8KH 4QHKI 5IB5B 2DYPA 2P42B 5DHVH 4P9HH 3KLHC 3QUXC 1JPSH 2P4AB 1XIWD 3U7WL 4QYOA 4ODXA 1DCLA 4XXDA 2EEDA 1OM3H 5IGXH 2ESVA 3EYQC 4XH2B 1NMBH 1U3HA 4HIJA 3VWKB 1VB9A 2JKXA 4QHMB 2AK4B 2EE3A 3F6IA 3UAJD 2AEQL 3MFFA 2EDKA 3EGSB 2IG2H 4L4TE 1D5XA 4XNQB 3WE6A 4LBEB 2CLZB 3SE4C 5GZOC 3PL6B 4JFQA 4BSVB 4NM8L 4FP8L 4K3HA 3D18A 5EIIB 3KJ4B 1X5LA 3WN5C 5JHLH 3MACL 1I85A 4NCC2 3O0RH 3S35L 3WXVL 1LP9A 1RK0A 2DM7A 2VITB 5ID0B 4UIKL 2P1YA 2F53E 4MB3A 1U6AL 3JUZA 1AGBA 3D48R 5L2KA 1MQ8A 1Q9LB 1D5MB 4KXZH 5F7FA 1QFWI 1YECL 4PGDA 3NBNA 2E6QA 4G9FE 4QRSA 4JFZH 2G5BA 2YKLH 5B3JE 1T03H 3FO0L 2F54D 1ONQA 1ONQB 1BAFL 1U8NB 4R4FL 2BY3A 1HYSD 2NY3B 4M9OA 5I30L 1OL0A 4NRYB 1T6VN 4XPTL 3EO9H 4N9OB 1CE1H 1CBVH 3W9DB 2NXZB 5EU5A 1SMAA 4OBRA 3MLTA 1YC7A 1G7IB 1TQBC 4PJHA 3RUGF 2ZKHH 3K1DA 3UO1H 3OPZL 1E27A 1P4LA 5CGYC 1X7QA 4QGTA 3VFTB 4AG4L 2F54E 2W65B 1NBQA 3HB3D 5I1CL 1T0MB 4UU9A 3WEXA 3DXAE 2AERT 2CDGA 1GAFH 3KYNB 5CS7A 4PRNB 1LO5B 5E24E 2Q6WA 5LBSH 2YMXH 3LKNB 1FRGH 1O7SA 2MWCA 2OZ4H 3BKYL 2DQEL 1RUQH 3H3PL 5E7BA 2V5SA 4LSRL 4LIQE 4TUKL 5DC4B 5IJVB 5DJ6A 3CLFH 3FAWA 1CFTA 4W81A 2M8XA 3U4AA 4P9HC 5KG9B 1S7TA 1NMBL 5IK3A 5HHMB 3EYSL 1AQDA 2GY5A 2X4OB 1FNEB 4KGLA 4F7TB 4WI5A 1D6VH 1NAML 2YHGA 3V8CA 2ITDB 5CKAA 4QRPE 4YHNB 5JNYB 2V7NB 4WTZG 1FAIH 2AGJH 2O61B 2EDQA 1G7JB 4OCSL 4NM8H 1XF5A 2A6DB 5FO8A 2CR3A 4JREB 3VGEA 1U8KB 2CLRA 4H8WH 4EDWH 3IDJB 1DBBH 1BFSA 2XN9A 4LIQH 5JIPA 1KCKA 2EXYC 4XRCA 1CVRA 3WXVH 3HZVA 1G7MA 4GBXD 4KKCC 5J6HB 2EDBA 4PJAB 5KW9H 5TH2A 5JIIA 3QQ4A 4MQXC 1CDIA 4LLVA 4WU7A 5CCKH 4I3RH 3TA3D 2WUCH 2I5YL 3HFML 4L8CA 3MLSL 3HZMA 5JZ7C 1IC5L 4WFHD 1A6VH 4G8FA 3UDWC 1KCLA 5I76A 2IEPA 3V95A 4JFZL 1N3NA 3FO0H 5IMOB 2PTVA 4W68A 1IBGH 3VI3F 3G04B 5D4QA 1LVEA 2XQYK 1I1AA 2AXJA 3VXTA 4XPTH 1CE1L 2H2PC 3KJ6H 3QFJE 3EOTH 1GIGH 1D5ZB 4NZJA 3KS0H 2O5YH 3L6FA 4ZXBD 5B8CC 5F96L 4U6YA 1IZJA 3TBTA 3E8UL 4X9GA 3KYAA 1FIGH 3HZMB 5D1QD 2WINB 2MQ3A 3GMLB 5BRZA 3ZTNH 4ZUWA 1ZOXA 1LK2B 2OTUB 3ROOB 1JPFB 4CN4A 2JCCA 5C3TA 3QEQE 3ULUL 3PIQA 3BSZH 1T5XA 1YNTA 3RVXC 1JGDB 2PYED 1CK0L 3OBAA 1KIPA 2X9WA 2H3NA 3ZKND 3D39E 4Y19B 5LBSL 2FB4L 5EBGA 1ZHLB 2P5EA 1FRGL 3ES6B 2I07A 2JELH 3BP5B 4JKPH 1RZKH 2A6JA 3JWDH 4K7PX 2VLRE 3BKYH 4O5LH 4PPTA 2Q7YA 3O6FC 1RUQL 2BRRL 5HYJB 3SBWA 4QF1B 2DBJA 2BHZA 1HHGA 4LSRH 3BKCL 5DEFA 1AIFA 1B2WL 4GBXA 1S7UA 3AROA 3HCVA 2FCBA 1U91B 1M71A 3BW9B 4LDEB 4QCIB 4KKLC 3DX7A 3DBXB 1Q9WA 4WHYG 4ORZC 3EYSH 3GUTA 4JZJC 3EO0B 3EO0A 3T65B 5DHYB 3DVNA 4H25B 4P4KB 3IVKB 3QUMH 3QDAA 4UNUA 4APQB 3MLWH 4U7MA 3BZFB 3JZ7A 4KKCD 3ALXA 1FAIL 4GRLB 4XPAH 2BXZA 3EHBC 4N9GB 2I25N 1KJ2B 4PP1C 4KZDH 4H8WL 1FHGA 3TA3C 3P0GB 4P2YA 1CE6A 5FGBA 4BQBA 3C2SA 2FEEL 5DQJB 1KACB 4WHYH 4PGZA 5L2JA 3B9KA 1CFNA 3NZ8B 4Z7QF 4Z7OF 3MO1A 3O11A 3FB5A 3H9HA 1JF1A 1RMFL 1DQQA 3HFMH 5D5MB 4ODTL 4X8XA 4QHUB 4ZG1A 3VFNB 1JF5A 2VLKD 1D6EA 1EXUA 2Q8BL 2CUIA 3RX7A 4M6ML 4X6FB 4YNYA 5DMGC 5EZOL 3BO8A 1EHAA 1MRCL 3REWB 3QXDB 3MLVH 3S4SA 4WY7L 2P24A 4NM4H 4Y4HC 4PG9B 4PG9A 3PWLA 4KWUA 3ZDXF 2R0LL 2RFXB 4K3EL 3KJ6L 3EOTL 3BEVA 1GIGL 1U8PA 5FUCC 5C07D 1EUUA 1R3LB 4JFFD 3ALWA 1KFAL 4Y2OA 4E0RA 3CD4A 4RA3A 2B2XL 4PYHA 4HUWA 1HIML 1NAKL 5ELIA 2P7TA 1Y18B 5E1AA 1FYTD 4DCQB 1G9EA 2A0LD 1MFBH 2IC2A 3MCKA 5C0AA 3RWJB 3ULUH 4J1UB 1I7UB 2YRPA 5KS9F 2VDRL 3NAAH 4PG2A 1OP9A 3DV4A 3QUKB 3KYOA 1YPZE 4OIIL 2F8OA 3F7PC 4JKPL 2JELL 4GAYA 5F7WC 4GG6B 3JWDL 5C6PB 1ETZB 3O2DA 5T1MA 5DJCB 3RP1A 4LHQB 5J6GB 2OI9C 3QULB 4H25A 4P4KA 1E4JA 2GT9B 3OJDA 3L5WA 2AAVA 2ADGA 1JYNA 4K3JH 4RBPH 3VRLF 1I3UA 4WUUD 3FB8A 4JFHE 1NGQH 3W0WE 2BSED 1G7JA 3FJTA 3ULVE 1T3FB 1U92A 5CSBA 2XA8H 3W39A 2DLFH 4KQ4H 4NQCE 2P45B 1J9CT 3BHBA 3OL2A 4HUNB 3QXAB 1JPTL 1T66C 3IDNB 3WIHL 4F37F 4PS4L 4XPAL 2BVPA 3LN4B 2ADGB 3SJVA 2C1PA 4HMEA 3TC9A 4DAGH 3FFCA 5L8JB 3U4BL 2FHCA 2OMBA 2QR0A 1JZ7A 4ZDHA 2DQGH 1ZSDA 3H7LA 3CFDB 1MHCA 5DMGD 2C1OA 3P0VH 1H9VA 4MNGE 4KJPD 1E4KA 4WW2F 5CZXD 5CD3B 2ICES 3VDBA 3H6JA 3P4MB 4D0DB 1RMFH 4H88L 5EZIH 3BT2L 3ULVH 5FF6B 3GMOB 4PJIF 4CGTA 3DVGA 5LAXA 2V5MA 2RR3A 1VFOA 4M6MH 5F9AC 1U2HA 2BNRA 5EZOH 5C1MB 4P48A 5ANME 5GS0C 5LKNA 1S9VA 2JB6A 2WUBH 4HUWB 4N0CC 2P7TB 4WI3A 2A0LC 5I17B 4FTVB 1J10A 3WS3A 5HI3D 4XWOD 1LE5B 4R96A 5KS9B 2B2XH 3O6MH 1XF4A 3T0EC 1HIMH 1FFOA 5HJ3A 3FOMB 5HD8D 1X5JA 4O58L 3VXQA 4HC1A 1TCRB 1XF2A 4C56D 4LF3B 1RJYA 1NMCC 2BC4B 3MBEB 2CLVB 4ZYKA 5KSBF 2QQLH 4AMKH 3KHQA 4I18C 3LIZH 5J1TC 1E4WH 4OIIH 3AXLA 2XG5A 4NT6A 4WDIB 2IADB 4N0RA 3PUCA 4GKZA 5DVNA 4D9LH 4ZUUB 4XCNB 4CADB 2V2WA 5DMKA 4PLKC 3K1KC 5C0BE 4I1NB 1ZEAH 5LWYH 2QLVB 2VRAA 1UYWL 4P2OC 2H41A 1RFDL 1DN0A 4LF3A 1EBAA 5IBLC 3A6OA 4K3JL 4L3AA 4MS8C 5F1OB 3MFFB 2B8OT 1JHLL 4NKDA 1U3JA 5L2KE 3VRJB 4KZEL 3OR6B 1CGYA 1NGQL 4J4PC 3KWWA 4WI8A 1Z2KA 4I0PB 3SE8L 5HSFA 4JFDE 4P99A 1PX4A 3RWCA 1JVKA 1JPTH 4G9DA 3RRQA 4FQLH 3WIHH 3WIFB 1LO4H 3VWJC 3C60D 1TVBA 1QZ1A 4L8BB 3NA9H 4GRMA 4YQXL 3WDHA 3CK0L 3O3EB 2CIIB 5JW4R 1D5IL 1CFSB 1F58H 3RZCB 2Q87A 3O6LH 4O2CA 4DAGL 3RNQB 3C6LC 1K4CB 3WJJC 5A2KH 4QO1A 4OLWL 2FH6A 2IALA 2EIDA 4MAYA 3VFSB 4M03A 5F3HB 3RUGE 2MPAH 5EO0A 4IOFD 1YN6A 3LEXB 3MRDA 2XKUA 1P4LB 3DURB 1UCBH 3AY4A 4H88H 5KVFH 5FYKE 2JK5B 3SY0A 3ULVL 3HUJE 1IC1A 4Y16A 1U3YA 4LLDA 2QJDA 3QIWA 4JRWA 3LKQB 1JWMA 2X4SA 2WBJC 3IAPA 4UT9L 2X70B 3QNXA 1WF5A 1AE6L 1IAIM 2AXGB 3P9WB 2VE6A 2WUBL 4EQ2A 4GRWB 4HEME 4TSAL 4Z7VA 2X4PB 4YGAB 2DRUA 1LHZA 5JMOC 3PV6A 1KJMB 4GG8A 3RVWD 1N4XL 4PJAF 1GGTA 4X8JA 3BXNA 3VFTA 3RQ3A 1I9JL 4P4KC 1DSFH 4N0FA 5FYKD 3O6ML 2B4CH 3CNKA 1NGWA 1H0DB 1KPVB 1YMHB 4GLRI 1ZA3A 5C0EA 5MEOA 4JLRA 2Z31A 4BH7A 1GJIA 2ZJSL 2VDOH 4O58H 4XPBH 4CVWA 1HINL 3MV8E 3UTTA 3T04D 3BAEH 1LDPL 3E2HB 4J3SA 2NPLX 2VLKE 3WUZA 3V6FA 4PG2C 5GRXG 2VC2L 3F7QA 1TDQA 2XT1B 3B4NA 3QXWA 2XI9A 3MREB 1PVHA 4OGXH 4KVNL 4A6YA 1TZHB 2XA3A 2GJJA 4HFWB 3D3VE 3WDJA 4I0PA 1NGXA 3DECA 1AHWA 5FCSH 1NGPH 2JLLA 3PWPD 4LSQL 4JFOA 4M61A 4Y5YB 3GKWH 4NJ9H 1GCFA 4E42A 3OXSB 4F7TA 1IM9B 4OIBA 1JHLH 1LQSR 3SHSA 3PXHA 4QRRA 3IGAB 5I66A 1CTNA 4P2OA 4ELMB 3MRFA 3EOYG 5C0BD 5GGRY 3IFPB 3HE7A 5I1AA 2YBRB 2H32B 3PWVA 4FQLL 4CNIB 3MRRA 2BNQA 5DTFA 4B0MM 3NVQA 1OQXA 2UY6A 3VI3E 1KN4H 4FTVE 1JI1A 4XBEH 1QA9B 1F58L 3O6LL 1A7QL 2Y23A 3P0YH 3N85H 2BY2A 4CDHA 1WK0A 3VW3H 4ODVH 4OLWH 1ORQA 3AVEA 4HS3B 3MXVL 1OTSD 5IFAL 4MCZA 3X3GH 2MPAL 3NFPA 1A7PL 4UQ3A 4UQ3B 1IT9L 1WBZA 3FT3B 4JFEA 1BGXL 4U05A 4DGVH 1UCBL 5KVFL 2BNRD 3LKNA 3L3JA 3IDYB 1Z9MA 2DDQH 2CRMA 2PXYA 3UBXI 5F7NC 1E27B 2OR7A 2EDOA 1MHEA 5TDOA 2M2DA 2X4UB 4LSPH 4NQDA 3LQAC 3G9AB 2CRYA 5FKPB 2XQYG 3EOAA 4UB0H 4OF6A 2WWMC 1H8SA 3MNZB 2AK1L 2FZ3A 4TVPD 5ADPH 4BUGA 1BMGA 5IW1B 5BVPL 1NGYA 3I9GL 1DSFL 1FNAA 4Q6IB 1N6UA 4OZFH 2B4CL 4IRSC 1CDHA 4M7LT 2VZVA 4NJAH 1F5WA 1MCCA 2ZJSH 1F4HA 3S5LG 5F89B 2DLGA 2YPVH 4GLRH 4DZBA 2ERJC 2JJSA 1PQZA 3BAEL 3U36A 5EORL 3NCYP 2V2WB 4PY8J 1RU9L 1PJ9A 1WC7B 3SE9L 2CGRH 2YPKA 3KXFA 3ZE0E 1YEKH 1QG3A 5ACMA 1P7HL 3UTZA 3LPFA 5DSCA 4CN6A 4U6VL 1DQLH 4OGXL 2PXYD 4ZODA 4C54A 2C3VB 1NUFA 3N1GC 3IRPX 3QAZB 4G8EB 1HKLH 5BZDA 3T0EE 3LQZA 5TFSL 3MA7A 2DQCH 1AC0A 4XT1C 1J0HA 5J12B 1H3UA 3GBMH 5ENWB 4HZAA 2Z4QA 3GSWA 4EN3B 3BZFA 4ZTOH 2CUMA 1UXSA 3BUYB 4F7PA 43C9A 4FZEH 2FEDC 1EEZA 5T1DL 2YK1L 1KLUB 5C07B 2P5ED 2L7UA 1C16B 4RMRA 2ADFH 3TBSA 4JN2B 4FQ1L 2BCKB 2GUOB 2W92A 3MA7B 1CQKA 1P2CA 1UWEH 2R0WL 1A7QH 3P0YL 1U93A 3KLAB 3ILPB 4XTRC 4HGWB 4QXGH 3TJHC 1MJ8L 1GVIA 3X3GL 1A7PH 4GRLD 4NKOA 3HNTH 4R7NA 3UTTE 1XGPA 4DGVL 5I1GL 1JWUB 1KULA 4J8RB 1Z9LA 4HJ0C 5KVDL 1B0GA 3EJJX 3KPLB 4YIQB 4ALAH 2YD1A 4PJHB 2AJSH 4JN2A 2YN3A 4LCCC 4EEEA 1N59B 4JQIL 4D9RE 1JGVH 4LASL 4TSBL 1MCOL 3RPIA 1XF3B 2GCYA 4HLZH 2HFFA 2F54B 4P23A 3ROOA 4LRIA 2JTDA 3MLYH 3WNPA 2K7PA 3R8QA 1G6VK 4F15B 1OAYL 1MFEL 4KKAC 2D03H 3ULVC 4FQ2H 5ADPL 1ULVA 3DO3A 3ELAT 2J8UE 3QWOB 4QNPF 2HKHH 4U1IA 2CDFA 2ESVE 2D4DA 2HG5B 5DRNB 4NZRL 2IBGA 1R5WB 2VXSL 2EC8A 5C9JB 1PEZA 1MH5A 2PO6C 3BYTA 1V7ML 4IIQA 1N6VA 3CZFB 2VWEE 2NMSA 5KSAA 1FH5H 3FB7A 1JTOA 4KK9D 3RTQB 4OCRH 4B5EA 3GIVB 4RIRB 4YPGA 3WFCL 5ICZA 4ZFFB 2VZUA 3MRQB 4Z7UB 3KPSA 1QSFA 1INEL 2YWZA 4K8RD 1YEKL 5GJTL 1NKOA 5BW7C 4H20H 1DQLL 1CD1A 3P9LB 3WLBB 3BIKB 3BIKA 1JGEA 4I2XB 4LCCA 3FFCB 2HVJA 5B22A 1RUKL 2DWDB 5IVZB 5IB2B 2DQCL 5C0FA 1U8IA 1UM5L 1XF5B 1IAII 5C0JA 3D39A 3GBML 1UWXK 4ZFFA 4NFBA 5I1JH 1OW0A 4XP6L 3BH8B 5FYKU 3MV7D 1VFAB 3QCUH 4J3TA 5DVMA 4KHXL 1NCWL 3MRJB 4HK0A 1A4JA 3DI2B 2GI7A 1NC4B 5SV4A 2RBLA 1B0WA 1MUJB 1BFVH 3LRSB 5KTEH 3D9AH 4TNVF 3NZHL 2FX8L 1TQBB 4FQ1H 4GKOA 1C1EH 2EZ0C 3MRHA 1QUNA 1UWEL 2R0WH 1QPXA 1MHCB 1TZIB 4MA7H 4OLUH 1ZLSL 4Y5XA 2FO4B 4N8CH 5CD3A 1OP5H 1FN4B 3SDXB 3PWUA 3QIWD 3JXAA 2VLME 2C4XA 1F00I 5IJKA 4Z7VE 3JV6A 1MWAA 1XGQA 2VOTA 1A1NB 5I1GH 1JZ5A 2NY6B 1LK3L 4LLQB 1J11A 1NC2D 4QTHA 3ULVD 4LLWA 4RMSA 1RK0B 1WBXA 1WBXB 3KPOB 3KPOA 4JQIH 4HS8H 4Q9RH 2DF3A 4YHZL 3VGDA 2OQJB 3KPRB 2ERJB 4NC1C 1G1CA 4RMTA 5E7FA 1KC5H 4NN6B 3VD5A 2FJFA 3MLYL 4NNXB 4OZGB 1MAML 1OAYH 1MFEH 3EOBB 3PL6A 4XBPB 2EXWD 5FUCE 1U8HB 3STBA 2H1PL 1OP3H 1Q0XL 3HRZB 5ESQB 2EH8L 4N0YL 5DHYA 5IWLC 1DVFC 1TVHA 1S5HA 4NZRH 5CEXB 3NFSL 1IKFL 4K8RC 5IIEB 1QO3B 4JM4L 4NKDB 1J1OL 1HSBA 1GZQB 4Y5VB 1ZGLA 4LPTA 1EO5A 4Z6AT 3MUGA 4OCRL 3DGGA 4YDVB 4KI5E 3FOLA 2FLBT 1INEH 2HTKD 1OLZA 4JFXA 2AI0L 5KAQF 3HE6D 5IVXF 5L2JB 5ISZD 1FSKC 4XX1G 4E41A 4E41B 1AR2A 3WLWD 2MKWA 3MNVB 4XB7A 5AD0A 3CDCA 4D8PA 1T1YB 1UVQB 3TBWA 3T4AB 5JHDE 4LEOA 3GSUB 5I1JL 1N7ML 1GHFL 4G9DB 1QBLH 2CPCA 2NZ9D 1FCCA 1KPRB 3GSNH 4YXKL 3WJJA 3PWLB 2HT3C 4KHXH 1G6RA 2OL3B 1HQ4A 4OD1H 3VD3A 2XG4A 5TF1H 2Q1EA 5L0QC 3QNZA 5KTEL 3G5YB 5DRWA 3MOQA 4MQTB 4H0IA 4YXLH 5GGRB 4MA7L 4OLUL 2JB5H 2P5WB 4I3SH 2J3SA 4RGMB 4G5ZH 2W0PA 5I73C 3NTCH 3TESA 4HKZB 1QQDA 3T1WA 4RFEB 4NNPL 3FQTA 4HPOH 1MJUL 4MNQE 4WO4D 4ZAKD 4V1DD 4X5XB 5IQ7H 3CH8A 1T89C 1MFCL 1KYOK 3IF1A 2NX5A 2QQQA 1VESA 3L5HA 2IAMD 4LNRA 1G7MB 5IV2B 5J6HA 4I48A 3B6SB 3B6SA 3C5SA 3C5SB 4I48B 4HS8L 4Q9RL 2ZG3A 4YHZH 1QR1A 1A7BA 1MCRA 1CXLA 3CXDL 3S8WA 1DVFD 5DEGA 1FC2D 3FOMA 2B5IC 5IQ9A 4LKXB 3SKUD 4M3JA 2AABL 1MAMH 4JFYA 5ICYB 2MFNA 3FQTB 3MBXL 3FTGA 4WV1C 3O41A 2H1PH 5DURB 4TVPE 3F12A 1GZPB 1OAXL 4PJIA 3EO1B 1IGMH 1Q9LA 1T3FA 1U92B 1NCAH 5DQDL 5SWZB 3IU4H 5KJRL 3RPKA 3PV7A 4PJGF 1HHHB 3EJZD 4MLSA 1Z6JT 5T3ZL 2A77L 2B0SH 2YPLA 4JM4H 4QRRB 4L4TA 5EULV 2YZ1A 1EJ6A 1JZ2A 4BFBD 3WLWC 5EU4B 1SYSB 3GJFA 3QFDB 3B2VL 1HILB 5I1LB 5A3ID 4ZO6A 2AI0H 5EOCJ 1SBSL 1KJ2H 5SX4H 3V7MA 1WWCA 1I7ZA 2Y4SA 4QY8B 1HZHH 4M6OH 2X4QA 3IAQA 5HYSA 1F6AA 4HV8B 2NZ9C 5C6TH 3KPTA 2UZYB 3BEWB 4MXQD 5JW3L 3I84A 1VHPA 2FRGP 5D6DC 2BZDA 4DVBA 3UYRH 3BE1L 3GO1H 3B9KD 4OGAC 1U3HC 3MSPA 3QI9B 5K93A 4AENA 3MC0A 3I3EA 4F7EA 1N7MH 4OV5B 3L3OB 2OJEA 1IGTA 1IGTB 2BOBA 2BOBB 2CKBL 3FRPA 1N3NB 1WWWX 3GSNL 1J1PL 5BZWA 3QUYC 3HI6H 4GRWF 5JA8B 3HS0B 4M48H 4Z9KB 3PV6B 3F5WB 5EO1B 3RGVB 2VXTL 3AMKA 2B20A 1RZIB 4P5TD 5DJ2A 2HJKB 5H94B 2XZAL 4HIHB 2J6EL 1EAPB 4PJHF 3NCEB 4U3HA 2HJLA 5LGHH 2JB5L 1PDKA 3TVMA 1JWMB 4QXUH 1HK6A 3I6KA 4EXPX 5IW1A 1SEQL 5I2IB 3NTCL 4OLVH 4PGCA 4NNPH 3ZKXB 1MJUH 1CWVA 4WW2C 1MNUH 3GSNB 4P23D 2M26A 4HUVB 3LKPA 5IQ7L 3MCLH 4HH9A 1FYTA 1BJ1H 1MFCH 5DK2A 5FK9B 1I9RH 2X4UA 2JIXB 3GMPA 1PSKH 1D9KC 2R69H 2BNQD 2VLJB 4L8SC 1XGUB 4U1GC 4Y4KC 4OI8A 4PRHB 4UT6H 4NO3B 3PL6D 3PXJA 5LCVH 3SKMB 1FC1A 3GSRA 4PJFF 1NCBH 3IDIA 4ONOA 4O02L 4GRLA 4UIMB 1FLTX 4PJXB 2E3VA 3IB4A 4JFFB 1C5BL 4MJID 3MBXH 2PYEB 3QH3A 1GZQA 3C6SB 4M43H 1GOFA 1RIVL 5DQDH 4X0KA 5FECA 3L5WB 3SDAD 2HP4A 2FIKA 2FIKB 1QLFB 4G8IB 4N1EA 5EBMA 1ND0B 1VFBA 2XWBA 3NACH 4WEUD 1FGVH 5IB3B 5ANMB 3GSWB 1E4XL 1XCTA 4XXCA 3TCLA 1S7UB 4M62L 1X5ZA 4OCYL 5FDYA 4K94C 5IMKB 2EDXA 5GS1A 4P2RB 4KQ3H 3OTTA 4G8EA 4Y5YC 5IMMB 3MR9B 3QDHA 4X6DB 4JRYA 3RWHB 2H9GA 2VXUL 4LCWA 1D9KA 4J4PA 5BS0A 5IOPB 3MNWA 4OZHA 3QUYD 3MV7A 5EZJA 1HNFA 4YHML 4MMXC 1Q0YL 3UYRL 3BE1H 3GO1L 4P5TA 4TUJA 4PRIA 4NRYA 3UBXG 1CGXA 3LDBC 2OK0H 3O3DA 1UZ8A 4L9LB 4WWKD 3RNKB 3BN9C 3EFFB 2AK4E 2CKBH 3QO0B 4WI2A 1R3HA 3WFBL 3R8BB 2EYSA 4D0BB 3BP6A 2D9CA 5HVHC 3WNLA 1VERA 5TF0A 4PYGA 1MCPH 2VXTH 4ZSOE 25C8H 4OZHB 1S9VB 3IJSA 3C5ZB 2XZAH 3D2UD 2J6EH 1INDL 2V17H 6FABH 5JOPD 5DHVB 5J57B 1NFDB 1UQSA 4FS0A 4PJFE 4OLVL 5K9OB 2APXA 3M1BB 3SN6N 5JR1H 1BD2D 5JXEA 3MJGX 4P3DB 1MNUL 4AEHL 4KKBC 1V7NH 5T3XE 1OVZA 2JJTA 3O8XC 3SGKC 1XAUA 1PSKL 4ZDHB 2R69L 5DD1H 4WW2A 1R3KA 1Z3GL 5E8OA 4S1RH 1S78D 1EEYA 4U1NB 2YPLD 4HUXA 1QEWB 3BZ4A 3FZUD 4FQQB 1J0KA 1GSMA 1NCBL 2A38A 2WSKA 4XVTH 3U82B 4HULB 1BBJA 1OLLA 3U0TB 1JPSL 3U7WH 3WUWA 5F7UA 4KKNA 5MERA 2YA1A 3G5XB 4FTVD 3QUMA 4LAJH 4JRXA 5AWNH 1CGWA 4ONFH 5AAWA 2R1YA 1CDUA 4HIJB 1U3HB 3VWKA 5IHZA 3DWTA 4O2EA 2IPTL 2Z92B 1MREL 1P7KB 2HT2C 3TEUA 2AEQH 5D6CA 1CGSL 1IVLA 2YR3A 1F90H 2ZUYA 3TFKD 1GOHA 2Y5TA 5M95B 1M1SA 5FUZH 5T1KD 3SE4A 5K9QI 3EYQD 3P30H 2LU3A 1T04B 3L7FA 3LPWA 3VGFA 2ICWA 3ARZA 4M62H 5ALCL 4E42B 4FP8H 2X7LA 5JXAH 3I02B 2AS5M 1KPUA 3UTSD 4TTDD 1GRWA 3UAJC 5JHLL 1N26A 3MRNB 1MI5A 4KQ3L 3EYFB 4C83A 2DWDA 3S35H 2X4RA 3STLA 1EZVY 4UIKH 3J8F7 4X5WB 1QVOA 5HVWA 2Q86B 3M8OH 2IMNA 1CLOL 2ZOLB 5A16B 3O9WC 4I77L 4BFGA 4YHMH 5IEHA 1Q0YH 4KK5D 1CI5A 1CXKA 4LFHD 4BFIB 1K8DA 2VQTA 2ZSWA 1RQ5A 1EHLL 1OP3K 3VMNA 3DV4B 5E5MA 3ZYIA 1T03L 3QHTC 3L3KB 2F9BT 1BAFH 4PY7A 3QPQC 5TGBB 4R4ND 4X6EA 4RAUA 2PUQT 1UZ6E 3MV9E 4UV7H 2BC4A 4PJGE 4EUPG 1AO7D 2N56A 3ARED 3HG1E 4JM2A 2IANE 3TIDB 1ZK9A 4UINH 4KI5C 3RBGA 1UB5A 1CTOA 5I8EB 3REWA 3LD8C 6FABL 3MUGB 3UO1L 4KHTL 1LE5A 5F44A 3FO2B 4M6AA 3BPCB 4DOHE 3UYPA 3VXRA 3U2SB 1F6FB 4YR6A 3KPQB 1OP5K 3RTQA 4FXLA 4MJ2A 1FORL 1OAUL 5A40E 5IJKC 3GMMB 1N6QH 3ARYA 4FFVC 5DD1L 3QZWB 4S1RL 2BHYA 1LNUA 2DQEH 1KJ2A 4UDTA 2PTUA 4GMTH 2YD6A 3GSQB 4XCCL 1DDHA 4BZ2H 2MKLC 5E94A 2BSTB 4PJ5B 3W39B 5IHLB 4FABL 5DK3A 1T21A 3ARSA 3PGDB 2NW2B 2XNAB 1WQVT 5DC9B 1NSNL 2KKQA 1HOCA 1X4ZA 5E9DD 3QNZB 1J0YA 5DD3L 2IPTH 3S36X 1QSEB 4PREB 2DIAA 1X5AA 4OF0A 1QHPA 4U6HA 3UXFA 1RHFA 3Q3GA 4HS6A 1NAMH 2V9RA 1H15B 1RZGA 1CGSH 2DWEA 3DBXA 1DVFA 5HHVH 1F90L 3RJQB 3MLZH 4G43B 4X5LA 2V7NA 3P30L 2UVFA 2EEAA 2AGJL 4WW1B 3T65A 4OCSH 5ACZB 4IJ3B 5ALCH 3ZKQD 5J13B 4ODBD 3LEYH 5INDA 4EDWL 2E7LA 1EFXB 3PGDA 4Q97A 1KJVA 1BF8A 1CDYA 5DJXB 5GQBA 5CJXC 4X7TB 3F58H 2NTFA 2RJMA 3QPQD 2LVCA 3M8OL 1CLOH 5GISH 2OXGA 5EBLA 4ZXBA 5CCKL 1YEJL 4O51A 4I77H 4MJIB 2I5YH 1HXMB 1WUNT 3MLSH 1VADA 2VSCA 4HG4J 1YDPB 1R3JA 1A6VL 1MHHA 4X4XB 1EHLH 4GBXC 4RGNC 2JIXD 1P84K 4KI5D 3MBEC 2DIJA 4Y5XB 3C8HA 4XCFL 5JMRA 5I8EA 1FV1B 2NR6C 3BPLC 3W9EB 4BH8A 3ARFA 5ERWA 4UTBL 3OKOA 2O5XH 5GRZA 3UZQA 4UI2A 4UV7L 5F70A 3KXFE 4EOWH 3HMWH 3O45B 1YYMH 1J0IA 4PJDA 4WFEE 1CD0A 4P2QE 4EVNA 4ZS6D 3VRIB 4X6FA 2O5YL 5E1AB 2DQFB 3N0PB 1WZKA 3TBTB 1FIGL 2F15A 4Q0XL 3WBDA 3ZTNL 5GGQH 2DJUA 3IKCB 4XGZB 4IIQB 5DJAB 2BVUA 5MEQB 1NFIA 4D9RD 1RJLB 3OQ3B 3DARA 2CO6B 2OTPA 3O3AA 4LK4A 2X1OA 1X9QA 3STZB 2Y6SC 5DHXB 3SKNB 5IMLA 1OAUH 4U1KB 1N6QL 2FB4H 4LHJB 4GRMB 1RZKL 2XTJD 5DC0A 1S5HB 2SEBB 2BRRH 4X6BB 1MCHA 4F9LA 3DO7B 3CVHL 4GMTL 1WTLA 4YFDB 4P57A 5JPMB 5TDNB 3QDJE 3BKCH 1QSED 3PQYD 1B2WH 1XR9B 4GAGH 3SEPA 4ODWA 3HZKB 1G7PB 1ZAGA 3HI1A 4G3YL 3UTTB 1FO0A 2Y5TB 1HHHA 1NSNH 3O6FD 2QV2A 4OQTL 5DD3H 4LOUD 3L7FB 3GIZL 3X14A 3CDFA 1QP1A 1RUPL 5JNYA 4QNPE 4NZDA 5HHVL 3SKOA 1I4FA 3EGSA 4CL7A 4OCNC 4I8DA 1JI2A 2AP2A 1UCTA 4G6AD 1LD9B 2VTFA 1RY7B 3DMMD 4KZDL 5C07A 4HH9B 4DOHB 4HV8A 4QXTB 3OGCA 4G9FA 4X7FC 4LGPB 1BX2A 3F58L 1ZMYA 2CH8A 2ICEB 4Y16B 3EHBD 3U9UB 4EI6A 1IQWH 3FFDA 3QG6A 3LVEA 1CT8B 4PRBB 4UU9B 1X5HA 5GISL 3QIUB 3ULUF 1YEJH 1PZ5B 3I6GB 1JRHH 4QF1A 5B39B 1R24B 1YY8A 4Y4FA 3SDDA 4PGEB 4NFDA 4ZS6C 3GM0A 1PG7X 1FZOA 5DD0H 5FYJE 5TE7H 2FX9L 2Q8BH 5DUMH 4DK6A 4YO0B 5J7CC 5EO1A 3F5WA 4U6XA 4LHUG 4Y0GA 4WY7H 1I8KB 5TDPA 1ODAA 5CWSA 4LP5A 3QDGE 4XPGH 4OM1H 3PP3K 3S9DB 2HN7B 1PYWA 2R0LH 2ZZUT 4K3EH 4EOWL 3HMWL 4JHAH 1NMCB 3FB6A 4PLJD 3ZZ1A 1NGXB 1R3LA 2KQNA 1KSRA 5AYUL 1KFAH 3CFKB 2ADJB 5KSVB 1R24A 3OV6A 3U79A 3ECBA 2ATKA 1YYLH 3OR6A 4JPKL 3RGVD 2FWOA 3GMNB 5IFJB 1MFBL 3O9WB 4YDJA 1MIEL 3TO2A 5EDXA 2XKNB 2IQAB 4U1HB 1ADQA 2E6PA 1EVTC 3O6KL 4IMKC 2D2OA 2H9GB 3VI4E 5ESAB 3IXAA 4ZNEA 4Y1AA 2BOCB 4R0LB 3T08A 1UWGH 3B9DA 2UZIH 3FB5B 3H9HB 1DQQB 3SO5A 4F57L 1UWXH 4NKOB 4JFHD 1E4XI 4GJTB 2XWTA 4DN4H 1ITBB 3TGXA 4WHCA 5EUOF 4HLZG 5D2NE 3QDMB 4GAGL 1NFDF 4L1DA 3BZEA 4QT5A 5FIEA 2YN5A 4G3YH 4KDTC 2DWEB 2P46B 2GUOA 2BSRB 3B43A 2VR5A 4MNHA 1WICA 3DVNB 4HWZA 1FL3A 1FO0L 4F9PA 1KOAA 1MIML 2MOVA 4G6AC 4PJDE 2DLFL 4KQ4L 1ZHNB 1XCTB 3TCLB 4WHTB 5JIHA 4GH7B 43C9B 5K9KA 4HAGA 3V6BR 3GSVB 4X6CE 2NY5C 3ZE2E 1BQHA 5DWUL 2QADD 1WT5A 4AL8L 3EUUA 5DS8B 4FFWC 5EC2A 2DQJL 3T4AA 5IW6B 3L3DB 4MSWA 2C3XA 1T7XA 4GMSL 5C2BH 1P4BL 1YEEL 2A9ML 4PRPB 3SGJA 2AJ3A 4MD0A 4M1CC 3X17A 3U4BH 3BP7A 4L8SB 5DEFB 3ILPA 2DQGL 3D85B 4ZMAT 3QB7C 3F7VB 2J8HA 2R15A 3WFHA 3TPUA 4YWGL 3FL7A 3MRBA 3V0WH 3O3UN 1X5GA 3P4MA 4D0DA 1J8HA 1OGAE 3GEWB 3KLSA 5EZIL 2APBA 5JXEC 1KIPB 4ONGL 4ZFOA 2L7JA 2XRAL 2P43B 3QEUB 3H3KA 2EYRA 4N8VB 5DD0L 3TNNA 3QIUC 2HJLB 2WBJB 1MCKA 5DUML 3VRIA 4LKCB 2R8SH 4KJPC 4IJ3C 4JE4B 3QA3B 4Z7WF 3MREA 4XPGL 2XZQH 4ISVB 4QRRD 4JHAL 3RGVC 1AY1H 1VENA 3TN0B 1Q9KA 3QT2A 3SPVB 2X1PA 5HDQL 5AYUH 3NPZB 3QWQB 2AV7B 1LMKA 3IDYC 4OD2B 4WNQB 3CC5A 5DLMH 5C0GB 2NXZC 4XX1E 3DRQB 1YZZA 3ESUF 1SQ2N 1HSAB 1CD8A 4PRID 3SQBA 4ORGA 4JPKH 4LQFH 1JMZA 5CINL 4X6CA 1YMMD 1QSFE 1I7TB 4PJ7F 5FGRA 5IB2A 1MCJA 1BZ9A 4ZYKB 2QQLL 4G8FB 4OZFG 4AMKL 3V79C 5D7KE 1E4WL 3QDMD 4Y4HB 1UWGL 3X13B 5I16B 4R90H 4F57H 3RVUC 4D9LL 5AZEL 4PJAE 4DN4L 1K5NA 1MLCA 2WMPA 1HH9A 5TH2B 1ND0A 5HHPA 4D3CL 1OD9A 1EBPA 1JE6A 4OZ4B 1U8LB 1ZEAL 3OZ9L 3LN5A 1OPGH 4F9PC 1CIDA 1JNHB 3RTQD 2GW5A 2QADC 3T0BA 4UTAH 3SDDC 5DTFB 3MA9H 2IANA 3DETD 1MIMH 2RCSL 2GQHA 3PWJA 3ARVA 4NO5B 1U8OB 1QYGH 5D7IF 3C9NA 1Q9OB 2HRPH 4DZ8A 5DWUH 2UZXB 2MCPL 1J5OL 1LO4L 3DGCR 3MUZ1 4AL8H 5I66B 5D70H 3NA9L 3VXNB 2DQJH 3RWGA 1XIWC 3PHQA 4LLWB 1FLRH 4HWBL 5E8PB 3ETBF 2WP3O 3CFIC 4F7CA 5C2BL 1BD2A 5JXED 1ZVSB 32C2B 2X70A 4RQQA 1DLHA 1TJHH 4HF5L 2BX5A 2DM4A 4R7DB 5HDOA 1P53A 3C09B 4YNYB 5I1IH 3G08A 3KPLA 3L1OH 4K3GA 1ZVYA 4ZAKA 3AAZB 3EOBA 2OYPA 4NGHH 3MJ8A 4YWGH 3V0WL 4XI5C 4DK3A 3RFZC 1GGUA 5IVOA 1QQDB 1CLCA 2VLLB 1CR9H 1RK1B 1R3KB 2XRAH 2Z91A 4ONGH 4QHLB 3VH8B 5BOPA 3MOBL 4U6YB 1N5AB 3O6FB 2HMID 3D39D 2R56H 4I5BA 4IOFC 3K46A 3V5KB 4UT9H 1UH3A 2R8SL 1AE6H 4BK5A 2CK0H 2D31A 4LVNC 5MI0B 4HXAL 3MMEB 1RIUL 3OJDB 1NDMA 3T2PA 4YFLF 2LU7A 3MJ8B 2W91A 5D1ZD 3RKDD 4LPWA 1I9JH 1FP5A 5DLML 1A9BB 2W59A 1PQZB 4DKAA 4JRXE 4KDWA 2IGFL 4NQSA 4WEBH 4LQFL 2HRLA 1HOCB 3W82A 1XGTB 4JFEE 2VH5H 1LDPH 3QEQB 4HSQA 5C92A 5IB1B 1F4AA 3B9EA 3F7YA 2VC2H 4X99B 4H0HB 4O51B 3RTQC 4ZUUA 3S34L 4HEPG 4K55A 4MDIA 4EI5A 5EU4A 2A6IB 4R90L 1SY6L 3UTPE 1BWWA 1EEQA 5AZEH 5F7DA 4LPCA 4D3CH 3KLDA 5GGVL 3UX9B 3RNQA 4LSQH 1OPGL 3IJYA 4IOIA 4M5ZH 5HYSB 3GMOA 3QFJD 5EZLA 3WIIH 4UTAL 1CD1B 1BVLA 2P48B 3EYOA 1BBDL 2XZCH 3VDCA 1P9MA 4N1HB 5HJ3B 3MA9L 2IPUK 2RCSH 1IMHC 3WV0A 4LP4A 3L3HB 1FBIH 5FDWB 1HCFX 1SYVB 1QYGL 4LNVA 2W0KA 1BJ1J 5D70L 3O11B 1R3IH 3PDOB 1KEMH 3PABA 4GXVL 3WFHB 1LILA 1FLRL 4HWBH 1S9XA 3V2AR 2ZUUA 2MJWA 3VFSA 5KSUB 1GGIH 1UEMA 1TJHL 1K2DA 3VW3L 3LDBB 4ODVL 5DFWH 2BNRB 1EJOL 4N8VG 3MXVH 2VSDA 4X9BA 4PGJA 5I1IL 5IFAH 3L1OL 3OKLA 4L3EE 4X4YB 4NQDD 4L4VA 4J6RH 3FCTA 1CF8L 3DX8A 4N0UE 5HYJA 5DJ6B 1IL1A 1QBMH 1XH3B 3VXRE 4TN9A 1F3DJ 1MFAL 4X7EC 1CR9L 3AY4C 2RAMA 5I73B 4PB0H 4ZUTB 5D5ME 5CHNB 5DRWB 3NGBB 4XHQA 2R56L 4LNRB 4N1CA 1JGDA 4GAFB 3F62A 2EEBA 4EI5D 4GSDL 3GUTB 1DQJB 3L9RA 3NCBB 2HKFL 5KBNC 4H5SA 3JTTB 3C2AL 1KF9B 4HXAH 2AK1H 5C07E 2O61A 5HGAB 4NN5C 3HC4L 5I1AB 4OF7A 5DI8A 1JNLL 2H32A 3PWVB 1HHGB 5C0DB 3D3VA 3I9GH 4R6UA 1QLRB 4F58L 5TPWH 5SWQB 4DVRH 3V6OC 1AGCB 4Y4KA 4MHHG 1OGAA 3VRLE 1IM9A 4AZ8A 5KOVC 2YPVL 2BVEA 2VH5L 1NUDA 5TQ0H 1HDMB 5EORH 4G8GE 2GSGA 3G5XA 2OL3A 2W0LA 1VFMA 3AMLA 1RU9H 2H2PD 3LD8B 1DR9A 2GAZB 5CEZL 2QKIA 4K7PH 5K59E 3S34H 1I1YB 1I1YA 3CVHB 3CVHA 3CFEA 2IAMA 1SY6H 4P9ML 3LB6C 2VE6B 1NLBH 1AI1L 3BOVA 1QVOB 4XNQA 4S1SL 2H6PB 5F6HJ 2WBKA 4QY8A 3MRQA 1PG7W 3HR5A 5GGVH 5I17A 4K94H 5HY9A 2BVQA 4R4BA 4D9QE 1J8KA 1YDPA 4M5ZL 1ZGLP 1KLGB 2FYYB 5FHAH 4PJFA 5IVNA 1WSST 1BBDH 2XZCL 4LLMA 1CG9B 1OQOA 4TRPH 3T0VA 1I4FB 3OJ2C 1DTUA 2FIRT 5TE4H 3ZKNC 3VXSD 1FBIL 4UIMA 2NY6D 4HIEA 5T1DH 2J12B 4KRNA 3D0VB 2YK1H 2UWEE 4M5YL 1K2DB 3BQUA 4POUB 4GW1A 4JDVB 3MRIB 3BGAA 1CFVL 1J8HE 5IQ9B 1R3IL 4JFPA 5A2FA 2ADFL 4X4ME 5C0AD 4GXVH 4HLJA 4BQ6A 4I18B 1QLFA 1TVBB 1LEIA 1GGIL 1NUGA 1XF3A 5HBBA 3DUUA 4EIZC 1MJ8H 1T80A 3CFKA 4MQ7B 3TH2T 4C4KT 3HNTL 1CF8H 3MLPA 1HHJA 5D1ZA 1QBML 1MFAH 3CDYA 5E8NA 5D7IA 4KV5F 3DROB 4WUKL 4OZIA 4ALAL 1G7LB 5EC1B 4XTRD 1T5WA 2AJSL 4QT5B 4JB9L 2HJKA 1AXIB 1J12A 3LKOB 3TIEA 4JM2C 1T0MA 4F33B 5D7JD 4GW5B 2Q3ZA 1MCOH 5SWSA 1DDHB 2APFA 3CAFA 3RWDA 5C0CE 4CNIA 2Z31B 3QPXH 3VFOA 4BH7B 3DOSA 2EC9T 1XFPA 4Z0BL 4I0KA 1ZS8A 3N06B 3C2AH 1U58A 2IPUG 2D03L 1QRKA 2YC1B 3IXTB 1EEZB 3DYOA 1BQHB 1JNLH 3SO3C 5I71B 3ZHDA 1YJDH 2HKHL 4P5MB 5TPWL 2CRIA 4C55A 3Q3GB 2FSEA 4HS6B 4YDJB 1QRND 3O9WA 5KZCD 3D1MC 5C09A 5MENA 5KS9E 3S5LB 4R0LC 1V7MH 4ODUA 5DVKA 2IMMA 4HWZB 4Q2ZB 1NEZG 5TQ0L 1FH5L 3CSBA 5J8OA 1NCNA 4QRQA 5EUKB 5DZNA 2EYTA 1F3DH 2R23B 4YDLB 3AU1B 3KPSB 4OZIF 1KG0A 3QUZB 4K7PL 4PV9A 4IOIB 4HUUB 5GJTH 4P9MH 1AI1H 3KYMB 1CXEA 4H20L 5EO0B 5IBTL 4RBPK 3EFDH 4YLQT 4LPYA 1FNGB 2GHWB 3OR7B 1MCWM 1OCWH 3JTSA 3WL9B 4PRPA 4K94L 1RUKH 4PJCA 5FB8B 4ZUVB 4X5WA 1G0YR 3UJIH 4B41A 3EDFA 3MJ6A 4O2FA 1HNGA 2YEZA 4Y2DD 1MCEA 5TE4L 3WN5A 5SWSE 4JQXC 3SDYL 1IEHA 4DZBB 3QCUL 2PNDA 4LCYB 3VU2A 2IH3B 2B4CC 1MY5A 3HUJF 1PLGL 3I85A 5JDJA 2DL9A 5GRYA 4XBGB 2FL5B 3DJ9A 3W11D 1V3MA 2R2BB 4BKLB 2E27L 3D9AL 4NQXB 3NZHH 2FX8H 5D6DA 1AJ7H 4PTTB 1NBVH 3SO3B 1MJ7H 5L6YL 1ZKAA 1M71B 1NGWB 5GGSY 5BXFA 1QR4A 3MRMB 4X5XA 3UJTH 4N8CL 4PJIB 4DKFH 1RZJL 3BKML 4HX1B 4H26A 2Y9RT 1CGVA 2A6KB 2W9EH 3K2UL 5HHNA 4MAYB 3T8XB 2R2HB 3OMZA 4KK8D 2P8MA 1DQJA 5DMJB 3ARFC 3H8NA 4G6KH 5JHDB 4DWHA 1FDLH 3UTQA 4JB9H 5IJVA 1S9YA 1XGRA 4MQSB 3OB0K 5EU6E 1Z5LA 1UGNA 3HPLA 2YS4A 5K9QG 3QPXL 4UDUB 1CXIA 1AO7B 4CDGC 3CPLB 3Q5YA 2KL6A 3X13A 3QDGD 3CLEH 4KJYA 4BA8A 4ODXB 4ELKA 3P4NB 2CIKA 3QO1A 4HIIB 1MCFA 1Q0XH 1X6NA 1RHHB 1S3KL 4EJ1C 2FBOJ 3UJJH 4P2OB 3MRFB 1I7TA 3FB8B 3U4EB 3U4EA 3QISA 3TBVB 5DR5H 3KJ4C 3CH1B 3QDJB 2H45A 1J1OH 4R3SA 2VLRA 4D2NA 2EDWA 4MHHI 4MXWH 5TE6L 3RVTC 3PWJB 1DEDA 4JFOB 4M61B 5B38G 3L5XL 1MJJB 3TF7C 5IEKA 5DJ0A 2NY1B 1EDQA 4DN3H 3G6JA 4ZFGL 5FA4B 3GBNH 4EUPH 1IM3B 4JZOA 1FPTH 4HWBA 4LARH 4CW1B 2HVJB 4P5TB 4OFYA 4TUJB 3LEVL 3EFDL 1OF2B 4U6TA 3STLB 1NCTA 4PRIE 5FM4A 1P7QA 3WFZA 15C8L 1T7ZA 3VCLB 3ZT6A 1GYAA 5HD8C 4HC1H 2HTKC 5E1HB 3MCKB 1G9MC 3RWJA 1VACA 1R5WA 1T0PB 3IFOB 1A2YB 1GHFH 1U8HA 1G9NH 2MNUA 1KELH 4X7CC 3S97C 2V9TA 4HMCA 3SDYH 1B90A 3C08H 1J7VR 2R1XB 1PLGH 3OWEA 2Z9TA 5EUOA 4JLRB 5TF1L 5T5NF 2UUDH 1I3GH 3CCHA 2E27H 4MVBC 2G9HA 3D87B 3CC5B 1AJ7L 3OAYK 3Q5OA 4PJ9A 5F9WB 3K81A 5CBAA 5D7JA 5SWSD 3ECBB 4YXLL 4DQOL 4MS8D 3U46A 3UTSA 2L4OA 3HAEA 4I3SL 3IAGC 4DKFL 1RZJH 3BKMH 5FYJD 1BM3H 1MWAB 1XGQB 4RAVA 3ZTJH 2GCYB 3T0AA 2R4SH 2WBWB 4HPOL 3K2UH 3EDEA 2ZUTA 1Z5LB 4WUUE 1DUYA 2ZCKH 1D3CA 3VFOB 4G6KL 1P7QD 3CFCH 3MRKA 3T2NL 2Z31C 3KPSE 1FDLL 3BWUC 3OJVC 3ARGC 3OAUL 1FNEA 4XP4H 1RJCA 4OFDA 4YBQC 5GHWH 4ZAKC 4XMPL 2K9UA 3HAEH 1PZUB 3WIFA 2AABH 3CLEL 4NHCL 2ICCA 1BVZA 3CFBB 1JK8B 1I8IB 4HJGA 4K7PY 1BLNA 2DLEA 3B2UC 2Q86A 4YBLB 4Y1AB 3FQUB 3D39B 4Y19E 5IB3A 2E6JA 1IGML 2FO4A 1WFNA 3UJJL 5ISZE 2C3HA 4G80A 4G80B 3KWWB 4KROD 5T3ZH 2A77H 2B0SL 3ZMRA 1MVUA 1INQA 1Q9WB 1NC4A 2CSPA 1OGAD 5CGTA 5TE6H 4NKIL 5HYFA 3W5MA 4CU8A 3L5XH 2BSTA 4JREC 3CU1A 1I1RA 5BV7L 3DXAD 2DICA 4DN3L 4PJCB 4ZFGH 5CEZD 1DQDL 3GIVA 4K9EL 4NN7B 4YPGB 3RVWC 5TQ2L 1SBSH 5E6IB 1EK3A 4P4KD 4L8DB 3UC0L 4DGYL 3HS0A 3CVIL 5HHOA 1VACB 2YSSB 1HZHL 4M6OL 5J13C 5DSCB 4ODSH 2G5RA 2PW2A 3WJLA 4F8TA 5D1XC 3PG2A 4EZMA 4MJ6A 1WFOA 3SQOL 3QI9D 1ZT7B 5D72L 3UTOA 1UG9A 1OGTA 1KELL 2B7DT 3VFUA 1ZGLB 3C08L 5D7JB 3HI6L 5T33L 1EAJA 4M48L 4B7IA 1RVFL 5T3XD 1GC1C 4M7ZB 4U1SB 3VXTB 1SJEB 2YPLB 3HLAA 1JUFB 3C60B 4Z77B 1FFRA 2UYLA 5C08E 3MRPA 4NSKA 1AXSB 4PJCF 4DQOH 3TLRA 4K71C 4EN3C 2Z31D 4N0FB 5MI0C 2CKBA 1IL1B 3QXTA 1BM3L 5F9WC 1SEQH 3OXRB 3JV0A 1P7KA 4WEMB 1CU4H 4R2GB 3ARGA 3SDCB 2EE9A 4FQXA 2CLZA 5I9QB 3MCLL 4MD5B 3CFCL 4DJMA 1VPOH 3ZLQC 4F37K 1WZ1H 1RZ8B 4U0RB 1OSPL 3B2UD 3OAUH 1T1XB 5EU6D 5MERB