4M6NH

Crystal structure of anti-il-23 antibody cnto1959 at ph 6.5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
218
structure length
213
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFSNYWIGWVRQMPGKGLEWMGIIDPSNSYTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARWYYKPFDVWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of anti-IL-23 antibody CNTO1959 at pH 6.5
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CNTO1959 light chain
total genus 46
structure length 213
sequence length 218
ec nomenclature
pdb deposition date 2013-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m6nH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m6nH01
4JRXE 3GK8H 3WUWA 1KNOA 1BAFL 5ICZA 1M6OB 1U0QA 3RL1B 1J88A 4Z78A 1MHCA 3WUWB 2XWBA 1BQLH 3ARZA 3N85L 5B3NA 1ITBB 1IAKB 5E8OB 4WGWB 3ZMRA 2HT3C 5BJTB 4IRJA 5EB9A 3SDXE 1A7PL 1CLOL 2VDNH 3O3DB 1CZ8H 1S9VA 3VMPA 1IM9A 2Z31D 3IETB 2FX9L 3EYFA 3MUHL 2NY3C 1XGYL 1RD6A 1HHKB 4H1LH 2KQMA 2GTWB 5T5FL 1I3RB 4X6EA 1YPZB 3RFZC 4XWGL 4J1UA 4YC2C 4X6DE 3V7AE 3IDMA 1IC4H 1XGPA 1NLDL 1T1ZB 3BD5A 3HNVL 4XT1C 3D2UB 3I50H 4LAQH 4A6YH 3GSXB 2NY4D 4FQ1L 4PBVC 4K23H 5L7XL 5IKCB 5CJXC 1SJXA 3CLEH 4MHHI 2X9WA 3RHWK 1CL7L 1O7SA 4FQXA 1G7MA 4GKZB 4PRIB 5FGSA 1RMFH 3IDXH 2BCKA 1M4KA 4WI3A 1FL5B 1PY4A 1T2XA 5AWNL 4G8GA 1UB6B 3EYQD 4OF3A 3QQ4B 1JGEA 4ZYKA 3G5YB 2GSIB 1L9NA 5D71H 1NC2D 2BVPA 3O6FC 4ZYKB 2XZAL 1ZVHA 3ZYOA 1ES0A 3H3KA 3E6HA 1CGSH 3O11A 1IM9D 4NQEB 1AIFB 3PE9A 1AIFA 2HTLC 2H26A 1A6VH 3SE9L 1Q9OB 3VFVB 3GBML 1I1AC 3ULVL 3DUHA 5T5NF 3MJ9L 4KQ3L 1GCFA 4BSWB 2OL3B 3GMMA 3MACL 5T1DH 3UYRH 1UEMA 5JHLH 4ZUTB 1EMTL 1KPRA 4JG1L 3KPSA 4M7KL 2LTQC 4KK8C 2V2XA 1IGFL 1NCAH 1W0YT 1B6UA 4YDKL 5MEND 4U6XB 1RIUL 2H41A 3GKZA 1HCVA 3MYZA 3O3EA 4UB0L 4CU6A 2J5LC 5IB4A 3KJ4C 3RVXD 3T2OA 3P30L 4ORGA 1OF2A 2W38A 4NHCL 5IKCA 4XNMA 4JDTH 1MFDL 2CGRL 2V7HA 3QXDB 4CRPA 5HPMB 3QG7L 1ZANH 3RUGA 3BO8A 1R3KB 4GMTH 3VXUD 4H8WL 5J89A 4M9PA 1JGEB 1XEDA 3VI4F 3ZTNL 2Y06H 1NJ9B 3S97C 5E6YA 1XR9A 2ESVE 5I75B 3BT2L 1P9MA 1F02I 2BNQA 1G6VK 4IRSA 3ZDZF 3ULSA 1XIWB 3LKQB 5KOVC 2D0GA 3KDMA 5AD0A 2Q20A 5KJRH 5L0QC 1XCQB 4POZC 3PV7A 4XNZC 4XMPL 1JPSL 1BD2D 3AB0B 5JQ6L 4MVBC 1FVEB 4OIIL 4CVUA 2EIBA 1PEZA 1UVQA 5C0BE 2IQAB 1UVQB 4HAFA 3VXME 4MX7B 5CBEB 5D2LB 3X3GL 4PREA 3ZSTA 1CD9B 1PZ5B 3MRKA 4K71B 1PG7W 1GZPB 1VB9A 3U7WL 3BUYA 5D6CB 4HKZB 1F3DH 2ZUWA 5B3JE 1R3JA 5DVOA 3GUTA 5CJQL 2ADFL 5H94A 3O81A 4GW1A 5LQBH 4UV4H 1QQDA 5TQ0L 5FAAA 5C0JB 3WKML 5GSVA 3DVNA 5A2LH 1UWEL 5GSVB 3RGVC 5HYEA 1QSFE 5IIEB 4KKNA 4M61B 3X12A 4OQTH 3RWIB 2HJKA 3QEHA 4UAOB 5IJKC 3PUCA 4LVNC 2ICEB 3U1SL 1BZ9B 4XMPH 5JW3H 3KLSA 5B4MD 1UH4A 3WIHA 2X1XR 3EYVB 4TTDD 4Y19A 3BH9A 3G04A 4BK4A 3MRJA 5CJQH 2ATPB 2BOBA 2X4OA 3HTLX 3OB0K 3IRPX 2WWMD 4PP2B 3FQUB 2LABA 15C8L 1E4JA 2P5WE 2DDQL 5MEQB 2DQUL 3QUKB 1CK0L 4F7MB 5D7LB 3KXFB 1OSPH 2D0FA 1OSZA 3VXOB 2ZUUA 5IGXH 3MC0A 3QDGB 1KN2L 4U1NB 4MSWA 1I1AA 3HB3C 5F44A 1Z5LB 4H20L 2X10A 4PBXA 4DW2L 1QA9A 1I1AB 3FRUB 4WTXA 3MOAL 5HTSA 1X7QA 3GB7B 3S6CA 3I02B 3LEXB 1BZ7A 4LMQE 2R0KL 2XA3A 2OR9H 5E8PB 4LDLB 1HKLL 5EDXA 5IVXB 4GW1B 4GJTB 3VDBA 4XWOC 5DGQA 2EEAA 5BMFH 4RRPG 1PYWA 2GAZA 1LDPL 2NXYB 3QG6B 4FXLA 2WW8A 2GAZB 2YEZA 1AGDA 5EOCH 2OR8A 1KTRL 2J6EH 3FKUS 3GMNB 5I71C 4JO1H 1BZ9A 3D0LB 1WFNA 3U36A 5EU5A 2EDBA 2DI7A 3TJEH 3UTSA 3KYOB 4YAQB 4KZEL 5D1XA 5BMFL 2CSPA 4JDVA 5SWQB 3BZDA 1TZHB 3FT3B 2DQIH 2CDEB 3IB4A 1L7TL 1HHGB 2EXWC 1U3HA 3QUZD 4FHBD 1FYTE 1RURH 4NC1C 1MFCH 5EZLA 2JIXD 1MJ7H 4Z7QF 3RX7A 2E7BA 3MCLH 1NCDH 3RY6A 4WUUD 1ZLUH 2CJUL 1MY7A 1R0AH 1WJ3A 1BJ8A 1G7IB 1WT5C 2V7NB 4O9HL 1NAMH 3CDCA 3ET9F 5DJ8B 2EDLA 3DVGB 1OAQH 5E5MA 4QRPE 4EI6B 4LDOB 3V2AR 4FA8A 5KSBA 3LEXA 5CZVH 1IGIL 4JPVH 5IV2A 4RMUA 5J6GB 4U7KA 1JNHA 1UWXK 4CVWA 5DEFA 2HLAA 1PYWB 3WHE0 3RKDD 1BIHA 2P5WB 1KCSL 3SDDD 1W72L 4JY5H 4WWID 1FP5A 3RY5A 4OV5B 1N4XH 1FO0B 4UT9H 2AJYL 1KV3A 4N5ED 4J8RB 1OAXH 2YD6A 1O0VA 4WV1C 1OGAE 1XCTA 1Q9KA 4IMLB 5ICYB 4N1HB 3UTSB 4GRWB 2XIDA 2NY3D 5DZNA 4CDHA 3DX7B 3ARFC 4OGZA 2E27H 3B9KA 1KG0A 1BBDL 3IDGB 1ZXQA 3IU4H 1XR8B 1S8DB 2WWKT 4ODHL 3EFFB 3VFSB 1OAZH 3V4PL 3EZJB 1ZVSA 1A6ZB 5IVOA 3EYUL 3MX0A 5E1AB 4AJ0A 3UDWA 1RJLA 2IGFL 4TUJA 5DJDB 1TMCB 2EZ0D 3KPRB 3GHBH 4TUJB 2UUDK 3VGAB 4NQSB 3GRWH 3LH2L 3VJ6B 1F5WA 1G7LA 1G0DA 2DQDL 5DO2C 3N85H 4U1LB 1N59A 2CIKB 3O3UN 4GRWF 5IT2L 3QSKB 1RIHL 5GGRA 1LK3L 2VABA 1RZIA 3QUXC 5ALCH 2IPKA 4L4VA 4HW6A 4C57C 4M5ZH 4Z7VE 3FB6A 1GZQB 4RCAA 5C0EA 1JVKA 2P8LB 4YK4B 5I1IL 4PJ7F 4JJ5A 2P8LA 2AK4A 3REWB 5JHLL 1CFTB 3U30C 3B9KD 1DQDH 4KMTH 4M02A 1NCAL 3MXVL 2FDBP 3OF6D 5CZXC 5D2NA 4MB3A 5DRZB 4C56E 1MCSA 1K8IA 4UZGA 5GJTH 4HF5L 4M7JH 1OCWL 2BMKB 5JA8B 5DK0B 1YNTB 5I17A 3RIFK 2ZKHH 1SY6A 4LIQH 3QQ3B 3CLEL 3TV3L 3CH8A 3L3OA 1U2CA 5JOEA 4M7LL 25C8L 1FORH 1X5IA 3MPCA 3VMOA 5I75C 1T89C 4FABL 1VCAA 2A6KA 3P0VL 4IRJB 3KYKL 3AREA 5H8DA 5LKNA 2DYPD 3T0BA 3VFMA 1EHXA 3QDMB 4F7EB 1MRCH 4NZRL 3LIZH 4KVNL 5KTEH 4M7JL 1EAJA 2K7QA 4ALAL 4PJBA 2I25N 2WIIB 3CSYB 1C16A 3K81A 2XRAH 4M5YH 4XXDB 5FUCC 1AD0B 4NUGH 5JPMB 4LVHB 4HLZH 3C5SB 1QLEL 1N0XL 2AJUL 1BM3L 2OTUB 1RZJH 3HS0A 7CGTA 3VG9B 2OTPA 2WSKA 1LNUA 4BQ8A 5E2TH 4KJPC 3S5LG 1OD7A 3CCHB 5K9QI 3KPMB 4PJFA 4RAHA 3MSPA 2R4SH 4GT7A 5KAQF 3TWCH 1C8PA 3O6ML 4JVUA 3W9EA 1UB6A 3FONB 2RQ8A 3KPNB 2XPGA 3NH7L 5J56B 2X5PA 5T1MB 1EZVY 4Z7VF 2DBJA 3GSNA 5T1MA 1CFQB 4X0KA 2EDOA 5I15H 3WIIL 3VFRB 2NR6D 2XTJB 1FNLA 3GM8A 1MI5D 2IJ0C 4NKOA 4LKXA 2YXFA 4D9RE 3QQ9C 4NNXB 1HEZA 3EHBC 1JFQH 4K3DL 2HN7B 3LV3B 5KSVB 3IETA 5C08D 4X5XA 3D18A 1CZ8L 3DTXA 5ETUA 1KYOJ 4MCYB 4P9HH 4BQ6A 4ZAKC 4S1DC 4YDVB 4WFED 1BBJA 5T1LA 1YPZA 3ARBC 4RMRA 2AEQL 5DRXB 1PSKH 2W60A 3LPWA 3O2WH 4FZ8H 3R1GL 4ORGB 2OTUA 4XNXH 4F57H 3CDGA 1IGJB 5IBUB 3WJJC 3MLYH 2PO6A 5GXBB 4WI6A 2FCBA 4KKLC 3F8UB 1D6EB 4YIQB 4LVNB 3BPLC 5B38G 4E41B 3HE7C 4NPYA 4HUVA 1ZT1B 4HKBB 5FCUL 3MCKA 1QOKA 4XP1H 4GAYB 5A3IC 3MCKB 4QWWC 2HJLB 3DJ9A 4OUUA 5E00B 1B90A 5B38A 3LKRA 2ZCKH 2EDHA 3MOBL 4KDTC 5HHVL 2H26B 1XAUA 2FJFB 2MMXA 3CFIC 2AJXH 4GRWE 4KJWC 1KTDB 2WWMC 1JRHL 1NFIB 4JFDD 1WFUA 1TQBC 2VN4A 4ORZC 4KDVA 3CMOH 1CYGA 2VJXA 4JPIA 2O5XL 5IW6A 4OIBA 1DQMH 2QHRH 4FFVD 2GJ6D 3RA7H 2H32H 3P0VH 5D2LA 3OR7B 1MVFA 4FQPA 4GAGH 2QQQA 4XPGH 4YHYB 3OR7A 4WENB 4L3CA 1A7RH 5F3HA 4EIGB 2CRMA 3D2UA 2EE9A 1MJUL 2M26A 3BZFB 4HIHA 3VXRD 3RDTD 1M71A 3CVIL 2Q8AL 3BZFA 3BO8B 1JK8B 3QWOA 2BNRE 4U6TA 3TT3L 2PXYB 1JK8A 3QWOB 1J5OH 2BNQD 3VXTA 1DUYB 3OQ3B 5EOTA 2FR4A 5DXWA 4NM4L 4PGBB 3MRCB 4X99A 3FFCD 2FEDD 2VISA 1UC6A 5E00A 3EJZD 4M7LT 1A1OA 5HGGS 5CCKL 3GEWB 3KPSD 1X9QA 3GI8L 1QR1B 2E6QA 4XMLH 1MJUH 5ITFB 4BUGA 3MRFA 3V6FA 2P1YA 3GMLA 5FHBL 4Y2DB 3UPCA 4N9GB 4JQXA 4LFHG 2YRLA 2W9LA 1ZHKA 2F15A 3BDBA 4U1SB 1W72B 1HSBA 1DZBA 2E8YA 1ZHKB 3CLFL 1UB5B 4OFIA 1T21B 1W72A 4R8WL 1HILA 4NM4H 2L7JA 1IEBA 2VXVH 4IRSD 4P9HC 5EU6A 5BVPL 3NAAL 5EZOH 4P48A 4G5ZH 4LGRB 4LLYA 4DGYL 1CF8L 1CE1H 4AIZB 1HINL 3UZVB 2BERA 3WD5H 4P2RE 4FNLL 1GZPA 4F7CA 4UT7L 4F9PC 5JW4N 1RPQA 2AAVA 4EQ2A 3JSSA 5KVFL 3RL2A 4AYFA 3VXNB 1EXUA 5F6HJ 3PGFL 3FCTB 2CRYA 4L3EE 1HHJB 1CTNA 5GGVH 2PTUA 1FDLH 3S3PA 5IIEA 3ZDYE 5JIIA 5I1JL 1T2QL 2X1PA 3DSFH 3NBNA 3D0LA 1PW3A 5CP7B 3OKEB 4PJ9B 3WNKA 5GS1A 3NTCL 1C5DA 4GQPH 1LGVA 1SHMA 1QRNB 2COQA 1KOAA 5FYLD 1RZJC 3QUMH 4TVPL 1F4HA 5C9JB 3QUKA 3TT1L 5JR1H 3K2UH 4PYHA 3DX6A 4WIQA 1PQZA 4JN2A 5FO7A 1WTGT 4JFEA 4OLVL 3VXOA 1FDLL 2YZ1A 3OKLA 5IB1A 4M00A 3G5VA 3OKLB 3QRGH 4ZO6A 1KBGL 3OXSB 3SDYL 1PZ5A 5GSRB 3ZL4L 3RKPA 5IR1B 1F90H 2CMRH 3OPZH 1BFVL 1YY8B 1X7QB 2YMXH 2ZNXA 3GB7A 3MNZA 3O2VH 1MAMH 3HZMB 3AS2A 3WIFA 3HZMA 3NPSC 1BQLL 1FG9C 2ICWJ 2P47B 4O2EA 4Y19D 1FL3B 1CBVL 1JWUA 5DVNA 5MP6L 5EOQH 1DANU 3SE8H 4GRMB 2OP4L 3W81A 3VI4E 1ZT7B 4LASL 1HHHB 5BZWA 2X4PA 3TIDB 4FXGB 2Q86A 1WZMA 4OZIA 2EE6A 2DIBA 5BO1H 5I19H 1K4CB 2NZ9D 4QY8B 3MRJB 1CFBA 4S0TD 1C5DB 1KJ2A 5HD8D 3OJVC 4YGVB 1CQYA 2IMMA 2IH3B 5HGAA 1G7QA 5FYLL 3S3SA 5IHUL 5DUPH 4Y2OA 3MUZ1 2DLIA 4FFZL 4K7PY 2YMXL 1YUHB 2HA1A 3X3FL 1QKZH 4IRSC 4LCWB 4XXCA 2PYEB 4TN9A 1H3VA 1YJDH 2QSVA 2K7PA 5ILTL 4G42A 4NWTH 4K8RL 5CSGA 2H6PA 3GSVB 5DRNA 4GRLB 1ZT4A 1BZ7B 4G6FD 2HRPH 3VJ6A 1IKNA 3DSNA 4UOW0 1NDGA 2I26N 1UWEH 4KROD 3RVWC 1NMAH 4CUCA 1MHEB 2ICWI 5FDYA 1Q9WA 4U1HB 1LEIA 3DXAD 3PDOB 4ZUVA 3KPQA 3BZEB 3QG6A 2YEZB 3MTRA 1ZT7A 4A6YL 5IT2H 1FN4A 5L9DH 4FXGA 1EK3A 2XN9D 1FC2D 4NHUA 2GY5A 3T0EC 3IFNH 3VRJA 3DX7A 2J8OA 2FO1A 2FRGP 5DD0H 3MRBA 2IH1B 2XKNA 1G9MC 5DJ6B 1KELH 1YNTA 2ITDB 4FTVB 1AP2A 3ZSSA 3BQUA 3BYTA 1L7IL 2J8HA 4OCYL 5JLZA 1JN6B 1JNNL 1KCUH 3E6FB 5DK2A 2W0KA 4LPYA 1VADB 1SY6H 4P57A 4LSQL 1MCBA 1NBZA 2KZWA 3AREB 3NH7H 4GG8B 5DF0A 3RNKB 1NBZB 1VGEH 3EYUH 3CMGA 3BDXA 4Z9KB 4K9EL 3LQAL 3NCYS 4F8QA 4HH8A 5IMOB 4R7NA 1N59B 4JG0H 3DMMD 5I2IB 3RI5F 1H3PH 4BZYA 3FTGA 5FO9B 4KWUA 1WBYA 4KPHL 2Y36L 4S10A 5DD0L 3MBXH 2C3GA 4HCRH 2QKIB 1RVFL 4YBQD 4DQOH 1CFSA 4N8VA 4V1DB 1HOCA 3H9YA 2F74A 5EUKA 5K9JL 4MMXC 3ILPA 1U8IB 3RVVD 5KVGH 3KPOA 4JDZB 1NAKH 3S3JA 3RVUD 1K5NB 1CFNB 2AK4D 5EBGA 1K5NA 1QNZH 1NMBH 5C0AE 1QG3A 3WS6C 1CU4H 3O6MH 4M6AA 3VFSA 1TQBB 2VLLA 1IC7H 2DI8A 3QDGE 4J3OC 1EJOL 4XPBL 3TH3T 4NN5C 1QPXA 4MVBD 1M05A 5ANMB 2DLHA 1CDGA 2UV3A 1M7DB 3SKJL 4HKJB 4PJBB 3KVQA 5JO5B 1IGCL 4HX1B 5C0CB 3CUPA 3SKMA 3QH3B 2WIIA 3ECBB 2CDFA 1C16B 4KQ3H 1N7MH 3H42L 2MNUA 4J3UA 4CU8A 3HMWH 3WMSA 1EO7A 1KB9K 4AT6B 5BOPA 5T1LB 4K7PH 2CR3A 3FTGB 2DIAA 4UIKH 1U8NA 4KTEH 3HUJB 1XF1A 3UJJH 5HDLA 1YNLH 1MRCL 3KS0J 3SBWC 5F89A 1P9MC 4M3KB 4V1DA 3LQZA 1OAUH 3FQWB 4P4RA 1H3XA 2DQCH 4XTRC 1TTGA 4JN1L 5GS2D 5L2KA 1IAMA 5EO1A 1UENA 3PWUB 1N8ZB 4P2QA 5HYFA 4HWUA 1GIGL 2VLJD 3CFEA 3FONA 4WY7H 1MHCB 4I0PD 4X0KB 3K8MA 3DV6A 4OUUB 5EO9A 4JFXA 4E42A 4PJ9C 2PUQT 5DUML 3T08A 3GBNL 2G5RA 2VDKH 1HEZB 1WFOA 1S3KL 2VAAB 1NFIA 4UOJA 1QSZA 2DWEB 2OLDA 5I1HH 3MRGB 4TSCH 3U0PB 3HG1D 4GUPA 5DRWB 3ARWA 3EDDA 4BH7B 2X41A 5EIVA 4N1CA 1TFHA 1AGEB 3MQIA 3G5ZB 4QRRA 1S7VA 1AGEA 5CGTA 1IGMH 3OKKA 2D03H 2H8PB 2W9EH 2EDRA 2ZCHL 3F58L 1OLZA 4JFHE 4PRIA 3EOTH 3L9RB 4P2OD 4S2SB 1QBAA 5LG1A 1AKJA 3D25A 5FM4A 3SN6N 32C2B 1RZFL 4NFCA 3M45A 4OV6F 4PJFF 1Q0YL 5D7LE 4YHML 5I1KL 3QI9B 2AJ3A 1LD9B 2XPGB 4Y1AD 4OFKA 4NJAL 1ES0B 4PP1C 1NLBH 1XMWA 2GSIA 2J8UF 1JIBA 3EJYC 4JFXB 1KFAL 2CKNA 1CDCA 1ZSDB 2DD8H 5DFWH 4RX4A 1VFUA 1U91A 4WU5A 4YR6A 4I9WE 1VFBA 4RMTA 4AM0B 4EI5A 5EZJA 4QRRD 4XHJC 3W39A 3EYFB 2IADA 4L8BA 4OI9A 1HSBB 4Y16A 5F96L 3ZKMD 2FHFA 1EUUA 3WN5B 2PYFA 4I48A 4RAUB 1A7OH 5DUBB 5IFAL 1I1YA 3MRMB 3O8XA 2Z93B 4Y88A 3NPSB 4PRID 1BBJB 3UX9B 3WFEH 2HVJB 1YMMD 1JZ8A 4PJHA 25C8H 1GGTA 1FSKB 4WEBL 1W2KT 5E99H 1ZV5A 2VDOL 4NQEE 3MV11 2DMCA 3ARDB 3G6AB 2HG5B 3FFCA 4PRPD 4L9LB 2X4SB 1OD9A 2E6JA 5ITBH 2BCKB 4JVWA 2OK0L 2VITB 1G6RH 1MFAH 2HJFB 3P4MB 1UH2A 2R8SL 1DBBL 4NZTL 1BFVH 5EBWB 1U42A 2FR4B 1DLFH 1KB5H 3VXRA 1A2YA 1JWSB 1A1OB 2V9RA 1G1CA 4M43H 1J10A 4JQIH 2G75A 4YZFF 5ITFA 1IE5A 1OQOA 4KZEH 1OTTC 2KBGA 2XA8L 4BZ2L 3GBMH 4I18B 3ULVH 4RIRA 4MCZB 1GH7A 3MCG1 5F71A 2DWDA 4E9LA 4JKMA 1ETZA 5FA4B 4R97B 2L4OA 3NABL 5CEZL 2X2YA 4G6JH 2OMBA 2OM5A 4M1GH 2IQAA 5FA4A 4YNYB 3U48A 3SQOH 4JM2A 4CMMA 5I74B 1WZ1L 5FHBH 5BRZE 1G6RL 1R3JB 1G0XA 5F1OB 3QRGL 4WV1A 3BUYB 2FD6L 3HNTL 3C2AL 4TNVF 1EXUB 1QR4A 2N56A 1MEXH 1IAIM 3I50L 4KROC 3T1FB 4LRNH 4OM0H 4X4XB 5EFIA 1Y6KR 2BP3A 2CD0A 4GAJL 4TVPD 1JZ4A 3LS5H 4L29A 1MAML 1E27B 2ICES 2FEEI 4F33B 4O00A 4ZXBD 4G7YH 4R7DA 3C60D 5EN2A 2O61A 4FNLH 4X5WB 4PG2A 4X6DB 4XVUC 4LPWA 3O41B 1BD2B 3OXRB 5D7KE 4M7ZC 4QXUH 4HPYH 2DKMA 1KJ2B 2VLJE 3EYVA 1SJVA 2VH5H 3S36H 3AM8A 2Z4QB 3CFBA 4MCZA 2ATPA 2BOBB 1JHLH 2X4OB 1GPOH 5SX4H 4DUXA 1U41A 2FH8A 3B6SA 2APXA 1AJ7L 1HIML 1YEIL 4JFFB 5TDNB 4PJIA 5MI0B 3AU1A 3DX6B 5FF6B 3EFDL 1S7XA 2YUWA 2MQCA 4LVOC 2IFGA 4CMMB 1QSFB 1C5BL 1P5VA 1R3LA 4FN0A 5CJBA 4WNQB 3L7FA 1U3YA 3Q5TA 5DFVD 1AY1L 1GC1L 2WNGA 4RGOL 2YKLL 3MNWA 3GBNH 3CDYA 4OLZH 4P5TC 1NC4D 2AV1B 4OLEA 3ZE1E 5DMIH 5DQJA 1JPST 2AV1A 5F7HA 1S7UA 4CVXB 1WITA 2CGRH 2FX8L 1G7HB 3VGFA 2NYYC 3X12B 2JB6B 4MJ2A 5B21A 3CJJA 3U36B 4YUEL 4IRZH 3ZTNH 1RZGB 4LVHC 1EEYA 1DUZB 1L7TH 5D7LD 2DS4A 5DJYB 4OF0A 4FQQA 1G7QB 4QHMB 3IF1B 3OHXA 4G8GE 4NCC1 1A6UH 3IF1A 2F8XC 1I1AD 2F9BT 3QP3A 5ERWB 1G9ML 3MJ9H 3JV4A 3WIIH 4KVCL 3U9UB 2NR6C 3E8UH 1V7MH 4G8IB 1NEZA 1JN6A 1U3HB 2MTPA 3B5HA 2VWEC 4DW2H 1VADA 4K7FB 4P57B 5IVZB 2X1QA 1MRFH 4QO1A 1I7ZA 3MODH 4K7FA 3HI6H 3TM6A 3GO1L 4P9ML 2LQRA 4KGJA 4LEOB 5DEFB 2V6HA 3WIFB 4JM2C 1IC7L 5I1IH 5DJCB 3IAGC 1H5BC 4O2FB 4X6FB 5SWSB 5CS7A 5JQHC 5E08L 2GITB 2X42A 4KH2A 3OKOA 1FN4B 3MUGB 1M1SA 1AGDB 4JB9H 5E4EC 1XCTB 1XZ0B 4HJ0C 2X4TB 3T0WA 3JTSA 1MCIA 2IANB 4J8RA 5FYKD 1N26A 4WEBH 5FGBC 3JTSB 1N6QH 5AG9A 1A6VL 3KYOA 2AJUH 4XCNA 2G2RA 2Y5TA 2F54E 3ILQD 4OQ1A 4J2XA 3F12A 4M7LH 3Q5OA 1XGYH 3QIWC 4QT5A 5KG9A 1XR8A 3F12B 3TN0B 1RUAH 3L1OH 4QHKI 3LPGA 4X9BA 3I9GH 1YEGH 1ZVSB 1NAKL 4LU5H 3RAJH 5ESAB 3VRIA 4CN4A 5E8NB 4KVNH 1FBIH 4EBQH 1MCOH 3MJ8A 5KAQG 4ONGH 1H3GA 3T3PF 3THML 4PRAA 3ARBA 4HD9A 3O9WD 1I7ZB 1UQSB 4NKDB 1X4ZA 3MJGX 3SDDB 4P3WA 5IBLC 5MENE 3ZHDA 4PS4L 4WW1A 2VC2L 4LEXL 4QOKD 1NGPH 5F7NC 2BJML 4JFYB 5J6GA 4WVRA 4XMKL 2QHLA 3ZO0A 1G7LB 5DS8A 1G9NC 2ADFH 4WW2C 1MHEA 2B8OT 4P5KB 2FATL 5IMOA 1FZOA 3PGDA 1PGRB 1NUGA 1GGBH 4JFEE 3ARGD 1OP9A 3C5ZC 2OTWB 2OJZH 1SJHB 4P2RA 5LCVH 4QHNB 1RUPL 5IFJB 4P5TA 2BXZA 1CFTA 1I9RL 3H3BC 5DVLA 3QEUB 4JJ5B 2CO7B 4MMZC 1NANH 3OGOE 1NGPL 2D7OA 4P49A 2C1PA 2CRZA 4G7VH 4ELMA 2BMKA 1MCOL 3IKKA 4ETQB 1FZKB 5EO1B 4WWKA 3OWEA 5BQ7B 3MRBB 4PR5A 4I9WD 4L5FH 1OARL 3F58H 1NGZA 3QXUA 2IALB 3CFEB 4LHJB 2NY0C 2B1HH 2QTEA 5KVEH 2BOCA 5EO9B 5F88B 2VZVA 1ED3A 4DVBA 5IEKB 4KJYB 5AYUH 3MLXL 4TOYH 4GW4A 1S78D 4HKJA 4GG8A 4NN7C 3QCTH 1TJHL 3VXPB 4NDMA 4MJIB 1M05B 3DPBA 4HS8H 5ANMA 4JR9H 4OUOA 4PGCA 2HVKA 2B5IC 4NBXB 2FX7H 4PTTB 4FQCL 4HLJA 5CMAA 1FZOB 3VCLB 4PTUB 4PJCF 3O6KL 2YA0A 3FB6B 1WBYB 2Z8WC 1U8KB 2J4WH 3DECA 4N1EA 4P2CG 4W81A 4U1KB 4KRPD 3KPLB 5D70L 4JM2F 5CINL 1UZ8A 3KPLA 3KPMA 3JUYA 2F74B 3BVNB 4L4TE 5C0IB 4J4PD 2X4QB 4TYUA 3BVNA 4ZQKA 5CD3B 3RDTC 1FNSL 1U8IA 3ALPA 3I6LE 5HYJD 5EOCL 3UAJC 4PRHA 4Z18A 2Q76A 2B2XH 1IL1B 4NO0A 2LV4A 3BKMH 1VENA 2GI7A 1YNLL 3L95B 2J4WL 1KNOB 5ICZB 1OT1A 3DV6B 4DVBB 4M8QB 1ODAA 2EXWD 1I1FA 4N0CC 4KK6C 1IBGL 3QPQC 3O6KH 3QDMA 1N5YH 4HV8A 4ONOA 3Q2CA 2CUIA 4WU7B 3SJVE 1C5CL 4FQJL 4HV8B 5EU3A 5IHBA 4WU7A 3HB3D 3F7QA 4HS8L 1I7UA 3GNML 1TZGH 2GTWA 3QEGH 4NT6B 4WI7A 1NDMA 2V2WA 2WUCH 3IJYA 4TVPE 1AD0A 1QZ1A 3BWAB 1QFHA 5DUPL 4DN3H 1AGCB 4U49A 5BVJA 2VLJA 5SV3A 2EO1A 5CUSH 4HJJH 4Y1AA 4Z8FH 1T80A 3TP4A 2ICCA 3KPPB 4FMKA 3QUYA 1S9XA 4Y4KB 3VH8G 1CXKA 1O7VA 1RU9L 5J0BA 5F7KC 32C2A 4I2XE 1JYVA 4MQ7B 5GGRY 5TDPB 4OCWH 5EBWA 2B1AH 1RK1B 2B20A 3QQ4A 4FQXD 2Y07L 1ZSDA 2CJUH 4C56D 2DDQH 4PD4K 1GL4B 3QXTA 3BZ4B 4Z7UE 4TVPH 3PGCA 2EH8H 3BZ4A 1GGCH 4LSRL 3TO4A 3O3DA 2D7NA 4NNXA 3VW3H 3LV3A 1G7PB 3QUXA 3DYMA 4WHCA 3IVKB 1DQLH 3L3IB 3SDCD 1I3RA 3VG0L 5B4MC 1BQHB 4RAUA 3TCXA 1JHKH 3VXSD 1NSNL 4EXKA 3ULVE 4Y5XB 3GKWH 3WIHL 1AGFA 3I2CL 3BP4B 1D3CA 2V7HB 3QXDA 5HPMA 2CXGA 3DUSB 4HFWA 5I1CH 4LCYB 3T1FA 3W5MA 4OZGF 3P0YH 1Z0NA 4Y89A 3L5JA 3GJEB 1R3KA 4B7IA 3IFNL 4F33A 3VWJA 2PXYA 1HKLH 2A2QT 3HI6L 2VLRD 4DVRL 1KCRL 4U31A 4YX2H 1LD9A 4R7DB 1IM3A 2MOVA 2O61B 5BO1L 4K94C 1UACH 3HI5L 1R0AL 5JIHA 4PJEB 5B22A 2NX5A 3IDNA 5ID0B 5IK3B 3FMGH 3HFMH 4F15B 4YO0B 1C08B 2ERJB 2DF3A 1QD0A 3CFJB 1KEGH 2BVYA 5EZJB 1H3WM 4HEPG 3C8KB 2R56H 2OL3A 3TN0C 5C07D 3IVKA 3QIWA 2DM7A 1IEBB 3C8HA 5C7XH 1MIMH 1R3IL 5E2VH 4JM2B 4D9RD 2DIJA 1AH1A 4G6JL 4BQ9A 4WFFD 4Y5XA 4L8SB 4HIXH 4XX1G 3K8LA 3S35H 4NO5B 3MJ6A 2WWKO 4BKLB 5FM8A 2RJMA 4HKZA 2NPLX 2IBZY 3RWGB 3SDDC 4MJIE 3T3ME 2NY5C 1JRHI 4GRWH 4GH7B 1ZK9A 1CGSL 1R6VA 5GHWL 4D0CB 1MUJB 4CDGC 4O02L 5I8OL 3OGCB 3HI1B 4IOSD 3B9KC 1TVHA 4OFDA 4AZ8A 1OAKH 4MZ2A 4I1NB 4B7LA 5CD5D 1XIWD 1JYWA 5DJ2B 1HH6B 1BD2A 1Q94A 3O3AB 4FQXC 4NN5B 3ARVA 3BP6B 3ULUC 4WI5A 4Q9QL 5JIKA 1EBPA 2FIKA 2ZP0T 3TH4T 3VI3F 3GSOB 3VD9A 3MRFB 4ODHH 2R2EA 1C08A 3BH9B 1INEL 4D9LL 3QQ9D 1CGTA 3VFUA 2PR4L 2APFA 3H7LA 5EIIA 4LLQB 2BFVH 3AU1B 3LRHA 5D93C 4W70A 1UB5A 4H1LG 4NUJB 4WWKC 2YRPA 1F90L 1FFRA 1A64A 2XFXA 2YSSA 5F93C 3U0WL 4D0DA 8CGTA 4CKVX 1GOGA 1AR1D 3HLAA 4NJAH 3FQTA 5KSBF 2V17L 4EOWH 3KXFA 1ZA6A 4BELD 5DJZB 5K59F 4QLRA 3CXDL 5GGQH 3QB7C 3IDJB 3AMLA 1QFUL 4UQ2A 4AEHH 1P2CA 2X05A 3RVVC 5E8PA 3STLB 1I85A 3VFPB 3H7BA 4ZFZB 1QYGH 1T0MA 4O2EB 3VXNA 3PGFH 5IVXA 1P7HL 5DC0A 4F57L 2B4CC 4X4XA 5EFIB 5I15L 4JKPH 1B3JA 2H2SC 4ZAKB 5JXAH 4PJ9D 3M07A 1G7HA 3OJDB 1E27A 3BE1H 1CE6B 1D7FA 3OJDA 5DTFB 1QACA 4D9LH 4APQC 1A14H 2UWEB 3GMQB 1NANI 3QEQD 1IFHH 2GIYA 3CD4A 4XAKD 2VZ1A 3OTTA 3BP6A 1II4E 1Z3GH 5CUSL 4Z0XA 1OWRM 3TBVA 5ANME 2Q87A 4Z0XB 4LCUA 2I24N 5D1XB 1PBYA 3QDGD 2V5YA 3MXWL 1YEFL 2C7UB 2IH3A 1B9ZA 1WVZA 2HWZL 3K74B 4JN2B 4JFFA 3QPQD 5BZDB 4YHOH 4KK6D 4P9HL 4P23C 2EDNA 4Q6IB 5GSRA 1UJ3B 1NCUA 3L7FB 3NAAH 5EZOL 1OPGL 1PKOA 2WANA 5D71L 5EA0L 5E2TL 4XP9L 5A16A 2MKLC 3T77B 2PTVA 1CLZH 3FQRB 4NM8H 1B4JH 4YFLF 1X5KA 4KAQL 3TZVA 3V0WH 3HPLB 1V3JA 5SWSA 4ODVH 4RMQA 3OKOB 2WBWB 2BY2A 3GRWA 4O2FA 1CE6A 4NKMB 4LPTA 1WIUA 1J1PL 2FLRT 4ALAH 4JY6B 1Q9KB 1CR9L 4K7PX 4FQCH 1BVLA 1F4XH 2HFEA 2IANA 4L3ED 2G2RB 1A9BB 1P84K 2LU3A 2Y5TB 3WL9B 1GVIA 1DUZA 1KTKE 5IMLB 4MAUH 1VSCA 2RHEA 1FPTH 4O51A 2JIXB 1KT2A 1UWGH 1X44A 4H88L 5DJAA 1KG0B 3ZYZA 4DK6A 2PYED 4WUUB 4YQXL 5BQ7A 2F5BH 4JREC 1KC5H 5KOMC 2YWYA 4F2MB 4FQLH 4G6FB 3MA9H 1AR2A 1UA6L 3E6FA 5EWIL 4JFDE 1F3RB 4O2CA 5EZLB 1AQKH 2DM2A 4JZJB 5GIRB 3QNXB 2Q7YB 1S7TB 3LN9A 4WRLA 1N5AA 1NFDB 3LN4A 2GCYA 2P5WD 2P43B 4MA1B 3WFEL 3WJLC 2GJ6E 3U79A 1MLBA 4PIRF 5DEZA 4KTYA 4NDMB 5TF1H 2UY6A 1A7OL 5J9PB 5DS8B 2CIKA 5E24E 4I3SH 4KKAD 5IJVA 4WFFE 4JFYA 4HXAH 2XN9B 1A1NB 1KSRA 4LSSH 4HULB 1S9WB 5ECJE 3EIFA 1B0GB 1FNGB 4WCYL 4NKQB 1QO3B 3P77A 5BRZA 4HIIB 4TRPL 2EYTB 3BP5B 4JCMA 2A0LD 4NN6C 1QEWB 4PB9L 2VLKD 3QO1B 2QKIA 5HHXH 3L6FA 5CP3A 5JW5B 2H3NB 5IHLB 5CINH 5EUKB 2H3NA 2DJUA 4RFNC 4ODSL 4XPTH 4OF7A 3SGDI 1H3TA 3ILPB 4ETQA 2R1YB 4HWEH 4PLOB 5J3HC 5I73C 3QQ3A 1S8DA 3ARED 5E7BA 4NQDA 4AY0A 5I17B 4POYA 1L7IH 4HMCA 2IALA 1OTUC 5ESAA 3VRIB 2BOCB 4JZJA 5TQ2L 2F19H 4HBCL 1D5XB 2P5EB 4KMLB 2OCFD 4YFLI 4PRIE 1FVDB 1LO4L 1R5IA 1YEJL 3LHPL 3N1GC 2C9AA 5F72S 3TVMA 5AYUL 5D8JL 2DTSA 1R5IB 4YC2B 2Z35A 5IJVB 3EO1B 4WUUE 4PGCB 2Z35B 4ZTPH 2VYRE 5IB2A 1JCKA 3LKSA 4JPKL 1UFUA 3MLVL 2BNUA 2ZG1A 1RZIB 1UZ6E 5EZIH 3CNKA 2J2ZA 4CGTA 5HYQA 1GZQA 4HIJA 1CDUA 5EORH 1JGLH 1CDJA 1U8NB 5HVGB 2AK4B 4PUBH 3REWA 2WUCL 3DX9B 3ULVF 2YK1H 3X14B 1NFDE 2VNCA 5CD3A 4PJ8A 3MACH 3V6OE 3S36X 2NY4C 3HE7D 3A6BH 3E2HC 3BKCH 1K8IB 3MUY1 1KJMB 3SOBL 1T2JA 5T3ZE 1JF1B 5EUOB 5DLML 4PJBE 5DA0B 1XGTB 4XBEL 5JA9A 2BVEA 5D70H 3WBDA 5IHUH 2QQLH 3MBEB 4J4PA 5BOZG 1EPFA 5IEKA 3BOVA 5DZOA 1F42A 1UWGL 2IPTL 1OAYL 5D7SL 4CBPA 1AHWA 5E03A 1MREH 3C6LC 1CLYH 5GS1C 2VXTH 3B9AA 4F80A 5J11C 1HYRC 1MCJA 4R4FH 5B39A 5ILTH 1A7NH 2GJZB 2GFBB 2YN5A 2AK1L 2VAAA 4JREB 1DSFH 4HX1A 5JW4R 4IRZL 1S7VB 1MWAL 2FWOB 3D6GA 4J3TA 1BQHA 1FFNB 2W07A 1U8JA 2IFFL 2FWOA 4OI8A 2BVOA 1T1WA 4J1UB 3HUJA 1YC7A 1H3PL 4U6VL 4KPHH 3BP4A 2VLJB 3X14A 4CMHC 4J7RA 4XBEH 1BEYL 4M6MH 4KK5D 4YUEH 5E9DA 3HCVA 4XNYL 3RWJA 1BJ1H 5E9DB 4HG4J 1JZ2A 1Y18A 2NLJA 4ZO7A 4MQ7A 4YHZL 3TA3C 3HNSL 2NZ9C 4DGVH 1J05A 8FABB 1IM3B 3QIBD 4CN6A 4PB9H 5BXFB 9CGTA 3N9GL 4X7TA 1G9MH 1UYWL 3O4OC 4E0RA 3SGKC 3TBSA 3QPXH 3DURA 1OTUD 5CEYB 3BSZL 4ODUA 4HUMB 2JE8A 2AXHA 5F9OL 4GRLC 4OSUL 3SDCA 1U58A 1KELL 1S9VB 2GJZA 1U36A 5A2JH 1U8HB 5D5ME 1FFOA 3RVXC 1QFWM 4I48B 5JORB 1SBBA 5EU3B 2AEPH 1NGWB 3B2VH 5BS0E 1A7QH 4ZUTA 4Y5VC 4HUXB 4N90D 5E4IA 1AGFB 4UNTA 1UKSA 2H8PA 3MRLB 2BFVL 2CIIB 3RVWD 4YDLC 2KH2B 1RURL 3DXAE 3I9GL 3NCFB 3QI9D 4Y1AB 1TENA 3OKMA 4GMSL 3GJEA 1EEUA 3QEQE 1BVKB 1G7MB 4GKZA 4Y4KA 4GKOA 4HIHB 4C56A 4HFWB 4HUVB 3FT2B 1RZ7L 4QRUB 2HMID 3BPNB 2HJFA 3KR3L 1MRDH 2X4RB 4DGYH 1JWSA 5D1XC 4HK3N 4PLJC 2Y23A 3MOAH 1N6QL 1YJDL 5JIPA 1HYSD 4O5LL 3GMPA 4OFVA 3LKRB 2DLGA 3HG1A 5ADPL 3ULUL 5E94A 4LNVA 3TESA 5I66B 3UO1H 2R9HC 3NZ8A 4X6CB 1FYHB 1TETH 2VXQH 3E3QC 4Z7NE 2P8MB 2RGSA 4Y2DA 4S1SH 1DL7H 4PJXF 4V2CB 1I1CA 5EO0A 5JORA 3RUGE 3TNNB 3BESR 1CN4A 5T3ZL 1UADC 1V5JA 1YEKL 2ICWB 5ENWA 1MRFL 5C3LD 5EU6B 3S88L 2QSCH 4Y5YA 2YHGA 2BSED 3KWWB 2IANE 1NCCH 2PXYD 4L8DB 5J11B 1AQDA 3KWWA 1YPZF 2VSDA 1LVEA 1OF2B 4FQLL 3NA9H 4AIOA 4HK0B 3OG6B 4F7CB 3L3KA 4FFYH 2QV2A 3FFCB 5JXEC 2A38A 3LN5B 2KKQA 1KN4L 4ZAKA 4OM1H 4WFEE 2CDGA 4C4KT 2IF7A 1MJ8L 3IGAA 3FT2A 5HHOE 2J1KA 3OGCA 5J1TC 3PWPE 5KS9A 2XOTA 1JJUA 4HK3J 4MXWL 3G6JF 4PJGF 5EN2B 2GK0A 1S9YA 3MR9A 4GQ9L 4HSQA 2W91A 4HKXA 4V1DE 1DCLA 1J0YA 2J3SA 3IXAA 4LLDB 4OGYH 1A14L 2IAMD 2XNAB 3NFSL 4IRSB 3V6FB 3NZ8B 4PY8J 4X6CA 2XNAA 5ID1A 4U1GC 2RBLA 5C9JA 3ULUH 2DWDB 1F4YH 5GRJH 1A5FH 5FF6A 1A6TB 4PJDF 2YPVH 1EVTC 3OBAA 5KJRL 3TNNA 3ZKXB 2A0LC 2ESVD 3MLZL 3BUTA 3GSNH 1T83A 5K33A 5CJOL 1WBZB 1A02N 1Z2KA 3G5VB 2AQ2A 1DDHA 1MH5B 1MCPH 5K93A 3UTTB 2ENSA 4JR9L 1AQDB 3GJFK 4JFED 4L9DA 4U3XA 3VFPA 4YXHH 3RWGA 3T77A 3HAEB 3HZVB 4XH2A 4O58L 4OCSL 2ZUSA 1QQDB 3PXHA 2QADB 3G5XB 2BC4A 4RBPK 3LS5L 4ELKB 4KHTL 5DTFA 1CDYA 3BGFB 1ZHNB 4JAMA 4H25B 3RBSA 1JF5A 4FOMA 2VAJA 4ZDHA 2IAMA 3L3GA 4K3JL 4PV8A 1MCWM 1CTOA 2EC8A 4Z7WF 4Q9RH 3MROA 5CP7A 4Z0BH 3GMNA 4LLVB 3TZVD 4JFFD 2I60H 1YECL 2VXVL 3WS6A 1IARB 5H2BB 1K4CA 4S0SD 5J12B 4WHTB 5ELIA 1QSFD 3W9DA 4XNXL 3BPNC 5D7JA 4DN3L 5I16A 5HGAB 1MI5E 4ZPTB 4JDTL 3JWOL 5FO7B 3ESVF 4NUJA 4YE4H 3KPSE 3UC0H 3S8WA 4OZFB 1JPFA 3SE4A 3FQTB 1NC4B 1JPFB 1C1EH 2HFFB 4ODSH 4PJ5B 1RZFH 4HIXL 1E6OH 3EYOA 3PIQB 4XRCA 4N0YH 1N5YL 3RWHA 4KQ4H 4XH2B 2VDLL 4HMEA 2F53B 4UIMA 1OB1A 4O02H 4UIMB 3BZEA 3PQYE 1WISA 3P4NB 3WKNA 3CFCH 3N0PB 4Z7UF 4K23L 4ZPVA 2HTKC 5SX5K 2DQCL 1J0KA 2EYTA 2JJTC 3T0AA 4YHNA 4IOFC 5DSCA 5EU5B 3RA7L 1JZ5A 3LRGA 4NYLA 3QWRD 1DLHB 1KIPB 5F9DC 1S3KH 4MQSB 1MFAL 3CDFA 1T66D 1JHKL 4YDIL 4Z77B 2DQEH 4LCWD 5DT1L 3GI9L 4PRBB 1CIUA 4WUUA 3L3DB 3ORJA 5DHVH 2Q8AH 4XC3L 4XHQA 2R2BB 4OJFH 2OZ4A 1GHFH 3MLWL 4H0HB 1MPAL 3QNXA 4IDJH 3U7YH 3QISA 4NZUH 5FM5M 4X8XA 1NC4A 5HHNA 3NA4A 4O2CB 3AM8C 4OI7A 5T3XE 1BD2E 3DVGA 4EI6A 3GSVA 2ORBH 2A6DB 1NSNH 3UYRL 1JV5B 3GO1H 2BDNH 4JO4H 1N6VA 3FO9A 2XN9A 3ULUF 5A2KH 1HI6A 4Y4HB 4P2QE 3EO1A 5IUSA 2IAND 4L3EA 2VDQH 1S7WA 3I75B 5HXMA 5D7IE 1NPUA 3KPQB 5CJ5A 4UBDC 4NKMA 2VABB 5DURB 3FRPG 3NIGE 5IFJA 5MERB 4FS0A 3IRZA 3PWJB 1R5VB 5ICXB 2VLME 2DB8A 3HMXH 1P7KB 4OCXH 1R5VA 4GXUM 3UJIH 1A0QL 4FFVC 4IMLA 4NHUB 1MFEH 4XCCL 1GYAA 3RBGA 3ULUE 4FTVD 1A7QL 1J9CT 4DN4L 3WHE1 2RFXB 5SWZE 3O4OB 3RWDB 3GGWA 3BX7C 3WDHA 3N1MC 3CU7A 4PR5B 2AXFA 1OQXA 4OLUL 1FZKA 5HVHC 2D4FA 4K7PL 1MWAA 1QFWH 4HDIA 4JY4A 5F1NB 4XZUB 3KJ6L 4M6ML 4HDIB 5KZCB 1P69B 4EXPX 4KJYA 2DQFA 4M48H 5CD5C 3MJ8B 4J3WA 3QIUD 5F88A 1KLGB 4NQCA 4P46C 1AHWB 1SEBA 4K3EL 3DMMB 4NIKB 3V8CA 1SEBB 1FIEA 4NQSA 4KJQD 5GRYA 3OAZK 4NBYB 4S11A 3FOLA 2VQUA 3V79C 3VWKC 5JOFA 2HVKB 4JEGB 4OSUH 1FFNA 5I2IA 3MLZH 1KIRB 2EIZB 3O6FD 2R0WH 3BP5A 3R0NA 4U0RC 1U8KA 4DKFL 1CDHA 2UWEF 3QEUA 4KKCC 1VFMA 4YHYC 3EZ8A 2EIEA 2Z92B 4L8SC 1D9KB 2RFXA 5D7IF 1I3GL 3FB7B 4OT1L 1BOGB 3CXDH 2DJSA 1VACA 5D7KD 2AABH 1N4XL 2Q76B 1NMCC 2R1YA 4BSJA 1N8ZA 2AJVL 4P2QB 5MEOB 3MA9L 3F65A 4NQDB 3SO3B 1NH6A 3RQ3A 4YHPB 3L3OB 4ZFGH 4K9EH 4G3YL 5F7EL 1CFQA 1CR9H 5M95B 3TJHC 4OD1H 3BRGC 5LBSH 1D5ZA 3FQNA 4OQTA 4M9OA 4GXVL 2EKJA 3QCUH 2WBJA 3MODL 3WFHB 5SWZB 3GSRA 1WZ1H 3KHOA 4EVNB 4KRPB 5DZLA 3LIZL 4HQQH 1P7QA 3DTXB 5ETUB 4Q7DA 4KU1A 4HUXA 2V9QA 5CJXA 1EUTA 3NABH 2DMBA 2AV7B 5HVWA 3WLWD 2EH7H 4C4KO 1G1YA 3L9RA 4ZS6D 5LCVL 1RZ8B 1AC6A 1JTPA 2WV3A 1FH5L 3ELAT 1RZ8A 4S2SA 3QUYB 3HCVB 4M93C 5JXED 3PQYB 2XZZA 1LEGA 1N3NB 5GS0L 3OB8A 1KGCD 1W0WB 2DLFH 4RDQG 1LEGB 4OCRH 1CGXA 5LJYH 4KKBD 1U2HA 2R0ZH 4U1JB 3NCBB 5HGHB 5BXFA 5D1QC 1LE5B 3WFDH 5TQ2H 3HG1B 3O2VL 5J1AB 1M7IB 2XXCB 2FJFA 1D5ZB 1U91B 1I7TA 2DWEA 2APWA 2HRLA 5C0DB 3BI9X 3K8KA 1U8QB 1T7XA 3I3EA 1D6VL 1J0JA 3BH8B 1EHLL 4BH7A 4ODTH 4MS8D 3G5ZA 4UU9A 4Y4KD 4PV9B 4UU9B 4IJ3B 4Q58C 3FT4A 4Y16D 2VDPH 3WEXB 1FJ1B 3BMVA 2V17H 3TFKD 1G6RB 3CDGB 4K3GA 3IYLW 1E4XH 3H9ZA 3U7WH 2MPAH 1AKJB 1YQVL 4LCYA 1K85A 2VLMD 3TYGL 1W0WA 1QSEE 2VLKE 4U7SA 2W65A 3UROR 3HN3A 3JV0A 5C8JA 1VFAA 5IK3A 4U7MA 3WNOA 5CEYA 3GMPB 1M7IA 4F58L 3MJ7A 5DYOB 3MMEA 2C5DC 4W6WB 1KXQE 1TVBB 3VXSB 5D96B 2RB8A 2ZOKB 4MA3B 2W9EL 1LMKA 2Z8SA 5F7YC 3TYFB 4YNYA 3SO3C 3T3MF 5E56A 3T65A 5C0FB 4JPIB 3MLUH 4P46D 2GTZB 3RJQB 4PRHE 3ARDD 4P9MH 5LXGH 4G80B 1WBZA 4P3DA 4OIIH 3LDBC 4GS7C 4ZD3H 1UKTA 4O9HH 1KJVB 3E8UL 1MNUH 2NX5E 2A74B 4L8SA 3V4UH 2OSLA 5CAYB 2VLRB 3HAEA 5DFTA 3HZKA 4BKLA 1C12B 2CR6A 4W4NA 2VLRA 2VDPL 3TPUA 5T3ZH 1M71B 2X4SA 3RL2B 1A47A 2EE3A 3MREB 4P59L 2L7UA 4XNUL 1ACZA 2X44D 2N7AA 4YHLL 4CAGA 4WGVB 3TT3H 2R4RL 3PDGA 4ISVA 1MJ8H 4TNVK 5KS9B 2YKLH 2VDRL 2GQHA 1EO8H 2G75B 3GSOA 5TF0A 2SEBA 4FFYL 4RA0C 4I13B 4YBLC 5ID0A 3MO1B 1J1PH 5C07B 2AGJL 4UQ3B 4YO0A 3H9SA 5ISZD 3MMEB 3WUZA 2HT4D 1QLFB 3W11D 3GI8H 1SBSL 4O4YL 2DTML 1CE1L 2QEJA 4JGJA 4QTIL 3CH1B 1S7XB 2YSSB 5GGSY 4D0DB 3STZB 3VI3E 2A9ML 3S4SB 4X7FC 4A2LA 1J18A 3C5ZD 4HZLA 5DJZA 1TVDA 3NGBC 3B5TA 4ZTPL 5EU7E 5FCUH 1K8DA 3SOBH 3MRKB 4B5EA 3UAJD 3S5LB 3OXSA 5D7JD 1MAKA 3OZ9L 1KCVL 2WMPA 2XKUA 1MF2L 3MOBH 6FABH 3DWTA 4KJPD 4GG6A 4ELKA 4JQIL 5CSZA 3D9AH 4RWHA 3CVHH 3TEUA 3B3IA 4O58H 4OCSH 4BM7A 4PJIE 4ZPVB 4H25A 2UWEA 3GMQA 1QLRB 4N5UA 4UDUA 3EO9L 4ISVB 4CJ1A 5F1IA 1FNHA 5GS1B 1DLHA 3RVUC 2Y07H 1D5MB 1T2QH 4FQQB 2ADIA 2C3WA 5D5MF 2LVEA 1F2QA 1G0YR 3IT8D 4E5XB 2NW2B 3BFOA 2KDGA 5FM5O 3SCMD 5JTWA 4G8IA 4PJHF 4TUKL 2XFXB 5BZDA 3BPOC 1QSFA 4U1NA 4PJDA 2E8ZA 2RIKA 4IIQA 3MRDB 1QA9B 4YPGB 4HAGA 2YPKA 2YD7A 1VESA 4OB5H 2CLRA 1P1ZB 4NBZB 4AQOA 5CJ8A 4ODXA 5L8JB 1ZT4B 4EQ3A 3H7BB 4HBCH 4ZFZA 4YXKL 4XP4H 3WNMA 1Z9SA 1TTFA 3QEQB 4U6YA 2B4CH 2DQJH 3SY0A 5LWYH 1OB1B 3QWRA 3A67H 4MAYB 4XNYH 3UBXI 1U6AL 1WWWX 1Q9WB 4U1HA 3LD8C 4G6AD 1IMHC 1J11A 4OD2A 5D1XD 5BZWB 2VXSH 3VXRE 4QF1B 5ACMA 5A43C 3WFBH 4MS8C 4GQ9H 1P7KA 5FK9B 4RBPH 2HFEB 5DVKA 1KIPA 4OBSA 4XP6L 4HMDA 4KRNA 2F8VA 2ZSWA 3T04D 3SQOL 3WNNA 2EDQA 5EU4A 4PRBA 3VRJB 4MXQD 3TN0A 1EMTH 4JG1H 1TDQA 2ARWA 2HT4C 3OG4B 5JMOC 2NW2A 5IB5A 1QBBA 3W0WD 4AENA 3GHEL 1QP1A 2HFGL 3HNTH 2ITDA 1RQ5A 4LCWA 5J1SC 1FIGL 1N5AB 4KK8D 2VSCA 3N1QC 4I5BB 1LQSR 4R2GC 5DQDH 3SDDA 5D2LE 1Q1JL 1SM3H 2DQEL 3SGKA 5DRNB 4GAFB 4XHJD 1J12A 4RWYL 2VZUA 5SWSD 4LPUA 5CEXA 3MRRA 3LS4H 4EDXA 5HI3C 1T0NB 3LKPA 1JWMA 2AQ1A 4YHMH 2YS4A 1FL6B 2Y7QB 5FUZH 1MPAH 1ACYL 5F7DA 2R9HD 1JI2A 1XF3B 2ENYA 4XI5D 2GITA 1R3HB 5DGRA 1XF3A 4QRPD 1LO2L 3UJTH 5LWYL 1ZGLM 1P4BL 4M1DH 3BKCL 5FK9A 1SJHA 4P2RB 2BDNL 4FZ8L 4XWGH 1RV6X 1YZZA 2VLRE 1BQSA 3HRZB 4Q6YA 4XCFH 5HHOD 3UP1A 3JV6A 4M6NL 5F6IB 2V5TA 3P9MA 1RZJL 3NCEB 1NFDF 5FXCH 3KHQA 2C1PB 3P9MB 4NCC2 5D9SB 2DQTL 1PD6A 3REVA 4QYOB 1NGZB 5FA3B 4Y16C 1AR1C 4G9FA 4KKBC 3OKNB 4QOKB 2W0PA 4AG4H 5EOQL 1F11A 2ZCHH 2F5AH 4XNQA 2QR0B 2UWEE 5E2UL 1ED3B 4XPHH 4HGMA 4NSKB 1ZHBB 1TCRB 3FQNB 4KY1L 4M6OL 1PJ9A 1TCRA 4GKSB 2DQGH 3KJ4B 1QHOA 3ARGB 1T0NA 1M7DA 3INUL 2FJGA 5JO5A 3IDIA 1JFQL 1EZVX 1R5WB 1KIRA 2EC9T 3PGDB 1B0GA 1R3HA 4XVSH 3T4YA 2D7TH 5JW4M 1VPOH 1YYLL 4JO2L 1ZLVH 1UM6H 2JCCF 1GGIH 3WCYA 4QTHA 2XRAL 1ZVYA 1R24A 1H0DA 2Z92A 1JHTB 1ZA3B 4BA8A 1U3JA 1UZ8B 5MEPA 2CK2A 4ZQKB 1A7BA 1BOGA 5J57B 4PLKC 5HHQB 5C0IA 3QIUA 43C9A 4P4KC 3C2SA 2ADGB 4N0CD 5HHQA 1XGTA 4J12A 4H88H 4XVUD 2GSGB 4JFFE 1JF1A 1FLRH 3T3PE 1BM3H 2VXTL 3AB0C 1CT8B 4NO0B 4QRTB 2E3VA 2PTTB 1JGDB 4XMKH 4JQVA 4DKEL 4LLMA 5IESH 4RZCA 4PRHD 3VXQA 1F13A 3DMMA 5ACZB 2AK4E 3VXPA 1KLFA 1WCBA 1E0OB 1J1XH 3RVTC 1P53A 5FKPA 2F53E 5DMGC 3ECBA 1F58H 1AO7E 1B2WL 1G9NL 4GUPB 4D8PB 5JW4Q 2J6EL 1NDMB 1PG7L 2Q3ZA 4PTUA 5BV7L 5JMRA 1WQVT 1KTLA 4PV9A 1MLCB 3ARDC 2DBLL 2DTMH 4RWYH 1WGOA 5GHWH 3K80A 4F37K 1QLEH 2AV7A 5AZEL 3FO2A 2FGZA 4UIKL 5I74C 3F6IA 3KPPA 3DO3A 3P11H 4EZMA 2XZCH 4PJ7A 3FQWA 3MBED 5DK3A 1JTOA 3PQYA 1S9XB 1ORSB 2CH8A 1OCWH 3RWJB 4JRWA 1HCFX 4JHZA 3SPVB 1N3NA 4HT1L 4KQ4L 1V7ML 3R0MA 4XP9H 4HH9A 4HCRL 1AXSB 5GS3A 4E0RB 2AJ3B 3DI3B 1YMHB 3ARTA 4CL7A 3IXTA 1FORL 4M8QA 2CO6B 3HUJE 3TO4B 4NKOB 4JANB 3VD4A 3RTQC 2VDOH 4WU5B 4YR6B 1ZS8B 3PGCB 3MV8D 3SGEH 1T22A 3ME0A 4JCLA 2BVTA 2GFBA 3G9AB 2ZOLB 4TSBH 4EI5B 3R06A 3TYFA 3WHXB 1PVHA 2VERN 3CZFA 2R0LL 3CSBA 4N8PA 1VEMA 4XPBH 1WC7B 12E8L 1I1YB 5E9DD 4YBHA 3G6JB 1KEGL 5I8KH 3MRLA 3WEXA 3HZKB 2QSQA 1HH9B 2Q6WB 4FQXB 3RI5K 1D6EA 4YIQA 4PY8I 3D25B 3QIBA 1J0IA 4ELME 3V4UL 5I18L 1HZHH 2IBZX 4WO4D 3FO0H 2E9IA 4C56B 1KCLA 5IQ9A 2E5EA 4Z7WB 1C5BH 2VITA 4OB5L 1H5BA 4P23D 4QHLA 1TNMA 2F54D 4GAYA 1VFAB 5HI5C 4AL8L 1YMHA 1BP3B 1DJSA 5F96H 3V5HA 5I66A 3QFDA 5DYOA 4ZFOB 4PJEA 4YEFA 5C07A 1T6VN 3IDNB 2LFGA 3PL6A 3DARA 3ETBF 3SDCB 4KK9C 3Q3GB 1CGYA 5F97E 3I6GB 3ZLQC 5ENWB 4JFQB 4YXHL 5EO0B 5C71A 4NCDA 1RULH 2HTKD 3H8NA 2C1OB 2V2XB 3KS0H 4M1CC 2ORBL 1HQRA 2UYLB 2YWZA 1BGXL 1WC7A 1HQRB 1RU9H 5TJWK 3V95A 2O93L 4PJHB 1CGUA 2OSLB 4OZGB 1CD0A 4L8DA 1KJVA 4HGWA 5CKAA 1FH5H 3TPUB 4WV1B 3JZ7A 2VR5A 3MV7D 4U6VH 1PX3A 5F3BB 2XWTB 1F4WH 4FFWD 4HHAB 1E4WH 2HT2C 5LGHL 3NZHH 3R8QA 3VXTB 1A9EA 3VWJB 2D0HA 4QRUA 2NTSP 2X4RA 5ISZA 1H5BB 1HH6A 1DR9A 3QUZC 5C8JB 4NC2B 5C0RL 4X4ME 5H35B 3U6RA 1AHWC 2IBBA 2OP4H 1MCWW 3DMMC 5E94B 1KB5L 2BNRD 5ID1B 4I18A 3F7VB 1XIWA 3LKQA 3QXWA 5C09D 2Y25A 2FBJL 1DVFD 4MDIA 4JM2D 1XCQA 2BY1A 3P30H 5EC2A 1IT9L 4JM4L 4MA3A 3I6GA 4GKNB 3RGVB 15C8H 1FVEA 2DKUA 4D0BB 3HLAB 3QIWB 4YZFE 1BREA 4LVEA 5GZND 3MLSH 1A3RH 4Y5YB 1LK2A 3DV4A 1KN2H 3S9DB 3GJFA 1LK2B 4H0IA 4OQTL 4CNIB 3S5LA 1CXEA 3IDJA 4UQ2B 5C9KA 1QRKA 3FB5A 2YK1L 5GRZA 3MNWB 3L3KB 2XKSA 3OAYK 3UBXG 3HZVA 3MLXH 3DVNB 3DBXA 2A77L 3ZT6A 3SY0B 1J0ZA 1DANT 4KK5C 3DBXB 2Y06L 3PNWA 5I8EB 2IAMB 3L3GB 4LLAA 3LSOA 2EH8L 4DFHA 3V6ZB 5BV7H 5I1GL 3VWKB 3NIGF 2CMRL 4X5WA 4HWZB 4L3AA 3CAFA 5H35A 3U6RB 4F58H 2YUXA 3DYPA 1KGCE 4B41A 5F1IB 2JJSA 1EFQA 1OAYH 5K9QG 3HR6A 4E5XA 1EEYB 1QLFA 3GKWL 4PP2A 3OHXB 4GKNA 3RGVA 5FO8B 4X98A 3DROB 2FZ3B 4JFEB 5I30L 1JMZA 5IB1B 1BEYH 1X5YA 3ARGC 3QNYA 1A3QA 1AE6H 4TNWK 4LARL 1UJ3A 2B0SH 2QADD 1NEZB 1Q0XL 4ZAKD 1I9EA 1P1ZA 1IKFH 3QQNA 4CNIA 3U82B 3PIQA 4XRCB 5HPOA 2YPKB 3VH8B 3JBG7 1XGRB 5L7XH 1FNEA 3RIAK 1CXIA 2F19L 3NFNA 2R69L 1FNEB 2QBWA 4TSBL 5LGJA 2DL9A 5DQJB 3P4NA 1A6WL 5CSZB 5E8DL 1TLKA 2B5IB 3QULB 3BT2H 4X6FA 2JKXA 3LRSB 4I8DA 1GAFH 3S34L 1MELA 4RMWA 1HYSC 3L5XH 1S5IH 3TA3D 2R0ZL 2VZSA 4MJ5B 2BXYA 4M8VA 1TQCC 3T2NH 5J06A 3L5HA 2AI0H 4MJ5A 4JKWA 4KJWD 3W9DB 4XCNB 5IMLA 3QO0A 4XCFL 4PJ5D 2WLZA 4XVJL 5I16B 3FN9A 3S7GA 2Z8RA 1FZJA 5IB5B 5HYSG 1CQKA 3OJMB 1YY9D 4CADA 1CLYL 5FA3A 4QNPE 3VGAC 3ROOB 2XZCL 3OKNA 5L8KB 2HKHL 3WXVL 3BJ91 4CADB 3M8OH 3KG5A 4UT6H 2HFFA 1EFXA 2WK2A 1CS6A 4ZUWB 3S88H 5TGBB 4HT1H 3RPKA 3ARBB 2A6IB 2CLRB 4MJ4A 4OF8A 1I3VA 4Y4FB 3VU2A 4HJGB 3UTSE 1KUMA 4G9FD 4EDXB 5HSFA 5DJCA 4DEPB 3CU1A 1B88A 4WJ5B 2XY2A 4L3EB 4Q74A 3TA3A 1F45A 1J1OH 2CK0L 2HKHH 1S9WA 2OL3H 2Z91A 4PB0H 4JFDA 1JGVL 4PJHE 4M1CD 4HIIA 2YUZA 2D7TL 5JW5A 3K0WA 2QQNL 5FYJE 1DBBH 3QO1A 1T04B 4NNYB 4YDIH 5DJ0B 2MQ3A 4Z77A 5F7UA 4MA8H 4J6RH 43C9B 3U4EB 4OLYL 5CZXD 3D5OF 2EZ0C 3LCYA 5FKAA 5SX4I 4UTBH 3BHBA 3LZFL 4F2MA 1YNKL 2R2BA 1BMGA 1F11B 4PJXB 1JGDA 1FGVL 1F00I 3WNPA 5FEBA 4I5BA 2FL5A 3KNBA 4U1GB 2QR0A 1C7SA 3CVHA 2WLYA 1UQSA 4IMKC 2VKXA 2IQ9L 1JV5A 4X9GA 5DURD 3B43A 1VDGA 3LKPB 4PJGE 1ZLSH 3ARGA 3UMTA 5FFLA 4I4WB 1P6AB 5F70A 1Q72H 2VQ1B 3E0GA 1A1NA 5KSAD 2VLKB 1LHZA 2HTLD 4TUKH 4HGKC 4M5ZL 2YBRB 4HIJB 1FNGA 5IMMA 2EIZA 4JHWH 4I3RL 3CFCL 4PJ8C 3D3VA 3HMXL 4AMKH 1INDL 3NIFE 1RJCA 3QUML 3LEYH 4NP4L 3LZFH 5IW1B 5T3XH 2AERT 3FRPA 4CN1A 4TPRL 2ED7A 4Z0BL 2A1WL 4JHBA 5DRZA 4BJLA 3NCMA 3CX2A 4C54A 3CFDB 3QIUB 3SEPA 2P5ED 4TNWF 4Q2ZB 4NOFA 1ADQH 1FAIH 3QXVA 4HS3B 5E8EA 4MD5A 2HFTA 3ZKXC 1BJMA 5CP3H 2A9NH 3Q1SH 4M48L 1K3IA 3O2DL 3BE1L 5J12C 4MD0A 4OZFG 4JKLA 1A1MB 3QUMB 4FABH 2FL5B 3CVHL 3U7YL 4QXTB 4XC1H 4LLMB 5B39B 2W0LA 1QYGL 1EO5A 3L1OL 5KTEL 3TVMB 3V0VB 4EVNA 1KCVH 4X83A 4K3DH 2WBJB 3V5DA 2ED8A 1IGCH 1I3UA 4LU5L 3RAJL 3VRLE 1MCKA 2CDFB 5IB3B 3IDIB 2VDLH 2Y6SC 2VDMH 5ADOL 5IB3A 3D9AL 2WIMA 3OF6A 1U9KA 3MOQA 4R8WH 4NT6A 5IROA 3HE7B 1U8JB 2X4UB 1KN4H 1T89A 6FABL 2C4FT 4QTHB 4LIQL 4GW5B 3UXFA 3C2AH 1ZA3A 5E2WH 5GGQL 1N2RB 4LRIA 3D85D 2J6EA 2Q7NA 4JN1H 1J05B 2R4RH 1H15A 3W9EB 4PYGA 5EUOA 5C7XL 5MI0C 2WP3T 3EDJA 4UOW1 2FECL 1EHAA 2A83B 3NIFF 1KXTB 3P40A 5K9JH 4WUKL 4PLJD 3TBSB 1OTSC 4BQBA 3L95A 2ZUQC 1J86A 1PLGH 2IGFH 3QDAA 2UY7A 1FG2B 4OJFL 3DURB 5F6HI 3PL6B 3MZGB 1SBSH 4O4YH 1Z9MA 5CZVL 4JANA 3V4VL 2VR4A 1LK3H 4KAQH 1ZHLA 5FUCE 5KSUA 4MAYC 5SWZA 1WCBB 4KI5E 4BYHA 1HNGA 3MZTA 4X5XB 4TTDC 2P48B 4RISL 5E95B 5JDJA 3CZFB 2W0FA 1DN2A 1WCQA 3QUYD 3QFJD 1FE8L 1GOHA 3FO2B 5HY9A 2CIIA 2EDDA 5CJOH 1FJ1A 4ONFH 5D4QA 4S1SL 1Z0MA 3UTOA 1K9TA 3QIBB 1ZEAL 3VFGL 2YRZA 5D1ZD 5F3BA 1WBXA 4MDJA 4KXZI 5EU7C 4DKAA 4FG6D 2V5RA 3I3DA 3W2DH 1EO8L 4IOFD 2JB5L 2FEEL 4AEFA 1WV7T 5I1KH 2GUOB 2I5YH 1DBAL 4BFBD 1S7RA 3ARPA 1CGWA 1KTDA 5I1GH 5GISL 4MDIB 4JHAH 2MCPL 3W39B 3R06B 4DOHB 3DRQA 5TFSH 3C8KA 1WAAE 4OKVB 4BQCA 3WN5A 4PJCE 2EICA 3QFJA 1MF2H 1NGWA 1V3KA 1KJ3L 1HWHB 3CXHJ 1QFPA 1JF6A 2XICA 3VFWB 3UPAA 1IEAA 4K8RC 2UYLA 4R4NC 5IBTL 3DETD 1V7NH 3QHFL 1CF8H 1YN6A 3G08B 3QDHA 4LSDA 1U92A 4DJMA 4ZSOE 5K59E 4K94H 5JOPD 2JCCB 3U83A 5FGBA 5HJ3B 1A7PH 3H2WA 4FXKB 4M1GL 1WBXB 4HK0A 4MDJB 1C12A 1KJ2H 3G6DL 3TNMB 4OZ4B 3MREA 3QPXL 4LOUD 4ZOEA 4MQXD 1BGXH 1DUYA 5GS0C 1HK6A 4EN3B 1BPVA 4LNRA 1TVHB 4F9LC 1ORQB 5GS0H 1RUKL 2ZJSH 1OTSD 4IOIA 1NGQH 1D9KC 2BHUA 1NCWH 4P46B 7FABL 4L4TB 1MCLA 2JF1A 4RIRB 3ZZ1A 2X40A 1U95B 5EC2B 5EU6D 4ODVL 4E41E 4NQVA 1A6TA 4NNPL 1CFVL 1NEZG 4OKVA 5F9JB 4Z7VA 4NOBA 4YHKL 3ROLB 3O9WC 4PJAB 2X7LB 3GMOB 2DLTA 4Y4FC 4C83A 5C0GB 5I1LB 1MH5A 4ODTL 3IU3A 2D9CA 1PFCA 5TE6L 2N1KA 4U0RB 3CVIH 1DE4A 4FZEL 3GSQA 2R1XA 3HC0A 3SE8L 5KSAC 3G5XA 2EH7L 2KQNA 4IBLT 4APQA 3ILQC 4OTXH 4J3SA 4D0CA 1YEFH 3PXJA 5IESL 5E7FA 4ZOCA 1SVZA 4OLZL 3IJHB 5ISZB 3QULA 1F6FB 1IKNC 1EH9A 1U8PA 5DJ2A 5JPNB 3RP1A 3T09A 3K1DA 1AFVH 3HRPA 3QIBC 4HWZA 3TBTA 4QCIA 2ITCB 3MO1A 3LPFA 4NN6B 4LLVA 1U93B 1VEPA 3QJFB 5LBSL 4P46A 3B2VL 2ESVB 3C5ZB 4X4ZA 5FUOL 1L0YA 1RVFH 4LCUB 5H37H 4WHTA 3TT1H 1RHHA 4QGYA 3ALXA 2C7UA 3QIUC 3UTTD 4JVPA 5D7JB 5F9JA 5FO8A 3JWNC 2P24A 1TJGH 3ROOA 1O5DT 4HQQL 4ACPA 2P24B 1UXWB 4Y4HC 2GW5A 1ZA6B 3EYOB 4LSPH 2BSRA 4MXVF 3VA2C 3A6BL 4PJFE 5I9QB 3RWFA 3KR3H 5DMGD 4XBGA 1DBML 3GSQB 5F21B 3MV9A 4HJGA 5AZEH 5I6XC 4WDIB 2DRUA 5DC9B 1JPSH 2F8OA 5JQ6H 4U4BA 1E4XL 2WBJC 3TZVB 1BZQK 1OAZL 3HPLA 1YYLH 1YQVH 1I8MA 1IAIH 3RUGF 3QR2A 3H9HA 2Z91B 3NTCH 4PJAE 2IPTH 4K94L 5D7SH 5DSCB 2P5EE 2HAZA 3MROB 4I77H 2AABL 4YXLH 5IWLC 1S7QB 43CAA 3O45A 5FYJU 2O26U 4MGXA 2IFFH 4OGXL 3SCMB 3TBWB 3VFNA 2OR7A 4WTWA 2HLFD 4NYLB 1CXHA 2EEDA 3QO0B 4YGVA 1UCBH 4QHMA 3PG2A 1QSEA 1QPPA 3HKFA 4A6YB 5T33L 3FOMB 4ZPTA 3EKCA 2GK2A 3DROA 3UTQA 3FOMA 4AENB 1CIDA 1YUHA 2ZUVA 3HG1E 3QNYB 1TJIH 3WD5L 4PRDA 1A8JH 1NMAL 2F53D 3SE3A 3KNBB 3L5WA 2OZ4H 2UZYB 5GIRA 1RUQH 3C08L 1T5WA 1NFDA 3LN4B 4LQFL 3WV0A 4B50A 2A6DA 1QRNE 4YHZH 5A1AA 3FO9B 3VGDA 5DUMH 4KV5E 4LEOA 3NFNB 4TUOA 4EDWL 4Y4FA 4WDIA 1UM6L 4K9EC 4TUOB 5HDQH 4KK9D 4PJCB 4RFOL 1EFXD 2YR3A 4GXVH 4Z6AT 5GGSA 4MAYA 3P9LA 5EPMA 2UZIL 4ONGL 5JOPE 4BFIA 3QCUL 3RX5A 5GJSH 2OJEB 3LRSA 3SE9H 3GMRB 4OGAD 1EERB 3LMJL 4D3CH 1ONQA 4HIEA 3SKOA 5KS9F 3W0WB 1IC4L 5BW7C 2MFNA 1ONQB 1BVLB 2VDML 4QHUB 1FLRL 1A9BA 4DVRH 4QHUA 3JV6B 4K2UL 5KBNC 4NC0B 3P3YA 3O0RL 4NWTL 1UM5H 5EUOF 1RSFA 5T5FH 2IG2L 2XT1B 2O5ZH 1QSEB 1B0RB 4KV5F 4PBWD 3U4EA 3REVB 4GG6E 3BHBB 1MFDH 4JRYA 2NY2D 4ZOAA 4FTVA 1PEWA 5LGKA 5E2WL 2DQFB 4XNQB 4DKFH 1Q8MA 2ARJB 5E2JA 3S4SG 5EU6E 4PRDB 3GIZH 3LOWA 4Y4HD 3C9NA 3L5WB 5CEZD 1I8IA 5LVEA 1MHHA 5KVEL 3T0EA 4NKDA 3C9NB 2J7LA 1NC2A 3PF2A 1OARH 4QRPB 4XVSL 1QFWI 2PETA 3RIAF 4AQ1B 2FJGB 2OS7A 2VQ1A 3C6LD 3LQAH 3LMJH 4D3CL 3NGBB 4NZDA 4KKCD 1R5WA 4UILL 2Y4SA 1DP0A 5GGSB 1KEMH 5HHOB 5HHXL 3EOTL 4S1DD 3B9VA 4JFZH 4M93B 5MERA 5K9KA 4DK3A 3ZYJA 4F37F 4MNGB 1U6AH 2IQ9H 3TPKA 5I9QC 3JXAA 4MQXC 2JJSC 4LBEA 1BHGA 1J8HD 1F4WL 1F8TH 3W0WA 3S96B 1OP3H 2HT2D 4OCYH 5I1AA 5J7CC 1YEEH 4YDLB 4FG6C 2J8UA 1JHTA 3UZQA 5C2BH 5IMKB 5KZCD 3RWDA 5D9SA 1V7NL 1E4KA 3QHFH 4UILH 4N68A 3FB7A 4UINH 4XAWH 1E6OL 1FNAA 3DYOA 4MB5A 3CFKB 1CFNA 4OFPA 2AXGA 5KS9E 4MXVE 2VDKL 4Q2ZA 1T20B 3BJLA 2AXGB 1TZIB 4BH8B 5C2UB 3HC3L 3GHEH 2ARJA 5D1QD 5E1HB 3C5JA 2FSEB 1XR9B 1ZTXH 3FN0L 3FAWA 1Q9LA 2K1MA 2A9NL 3Q1SL 2XI9A 3N06B 1FVDA 4DTGH 2F5BL 1YECH 3O6FB 1MIEH 4LSTL 1NUNB 3FOLB 5GQBA 2VZOA 1KYOK 3B9EA 2VLKA 2EDWA 1YEEL 1T7YA 4K3JH 2X9XA 4AT6A 1D9KD 5CIPH 4QXGH 3CLFH 5K9KB 2IC2A 4NQUA 3UJJL 3RX8A 5C6WH 5IVXF 4P2QD 3Q5YA 4JFZL 5KVDL 3QHTC 1P7QD 1Y6MR 4NQDD 4WI4A 2J8UB 4ZS7H 5FHAL 4LOUC 2E7HA 4P4RB 2X4QA 5MHSD 1FO0L 3CGTA 1ZOXA 2E9BA 3DVIA 1AXSA 4HS3A 4AIXA 4Z7QE 3SPVA 1X5FA 3WE6A 1LE5A 4G9DB 4YPJA 3RWIA 3CC5A 5SWZD 2JELH 3EYQC 1KXVC 2YXMA 4ODUB 5J1AA 1FIGH 3WDJA 4RGMC 1MQ8A 1RFDL 35C8H 4ZTOL 3JWDH 4JFPB 4Q9CA 4YDJA 2FX7L 4HF5H 3DRQB 3GSRB 5IF0B 2ZOLA 1U8HA 5T33H 1YA5A 2HT3D 1PLGL 1WIOA 4X8JB 5MEQA 2OYPA 3ZKNC 5C0AB 1MLCA 3EJZC 4OM0L 4R26H 1DQTA 2BY3A 2VXSL 1AC0A 5FYJH 1FO0H 1CFVH 2RAMA 3PQYD 4H20H 5LGHH 1G6RA 3BPCB 3FRUA 4IIQC 3V4PH 1YY9C 3BPCA 1RFDH 2XXMB 2EYSB 4RGNC 3SO5A 3NCYP 2VXQL 3TF7C 1HH9A 4JKPL 1ORSA 4UB0H 4R90L 2H2PC 2AJSL 4FQ2L 3TO4D 1A6AA 8FABA 3SDAA 1LDPH 2V2TA 1UM4H 3MV8B 4MYWB 5F6IC 4EI5D 5JW3L 1YN7B 1IGYA 3MV9E 3I85A 3WXVH 4XI5C 4ZFOA 4XWOD 1IGYB 1JL8A 1IAIL 2YZ8A 4BFEA 4KHTH 3SDXA 2VE6A 1JP5A 5GGVL 5I30H 1F4YL 3F7YA 3EOAA 2IADB 2DQJL 4L8BB 4Y16B 3NACH 4LSVL 3AUVA 5IF0A 5L6YH 2BSSA 2VQTA 4HJ0D 4G6ML 3JTTB 5IVNA 1DEEA 3AS1A 3HC4L 1FVCB 4HS6A 4G80A 3RNQB 2X7LA 4P5MB 2GTZA 1VA9A 1AKJD 1OGAA 3G08A 4P3DB 3BKJL 4KDWA 3RZCD 1WWAX 4HGWB 5F1KC 1MIML 4LARH 1FCCA 3I2CH 4P23B 3OKMB 2F54B 1L9MA 3EDFA 4Q6IC 4MHHG 1J7VR 1HXMB 3LN5A 5D5MB 1J8HE 3P4MA 4OCWL 2NW3B 1ORQA 3GSWA 1DBMH 3BAEL 3H3PH 3SGDH 3ZT7A 4H8WC 1PKQA 2SEBB 1RZ7H 3OZ9H 3QZWA 5IG7B 1ZLVK 1D6VH 4EIZC 1NUDA 4MA1C 4HKXB 4LHUG 2VE6B 5HVFB 1OAKL 1B4RA 1KPUB 2FB4H 1A4JA 3GZKA 3ROLA 1INEH 3EOYG 3JTTA 2HYMA 2Q8BL 5FUOH 4DAGL 3C6SB 5FV1L 4C83B 3S4SA 4WEUD 1UXWA 3MV7B 2PNDA 1NCWL 1T5XA 5EC1A 4X7SL 2BSRB 1WZKA 3WIHH 4MWFA 1U8MA 3T4AA 2A74A 3UTTA 4Z95H 1NAMB 3MV9B 2H32B 1WAAF 1T7WA 1IGTA 3EJJX 1WTLA 2BSTB 5FOJA 3RY6C 5AAWA 1E4WL 3T8XB 1I8KB 1MUJA 2CDGB 5DQ9A 4LPVA 5FV2A 4FP8L 2BC4B 2Y1VA 3O3BA 5DC4B 3P73B 2D4DA 1TCMA 4LVOB 5INDA 2BNRB 1QLRA 3VWKA 1E28A 5BV7B 5CZKA 5C09B 4HXBL 4IEFB 5C09A 4XPGL 2GK0B 1LO0H 2VIRB 3K4AA 4EJ1C 3MLUL 5DO2D 4HEME 5CFHA 4L4TA 1CVRA 3VGHA 1D5MA 5LXGL 5FYKU 1U93A 5I76A 2JJWA 4R2GB 3VFUB 3HAEH 2DQUH 1ZMYA 3MGTA 3S98A 2CXKA 4XB7A 1L0QA 5EIIB 5HHMB 2WAHA 5TE7H 5LAXA 3VFOB 4GMSH 4Z7VB 2AQ3A 1T03L 3HFML 4X98B 1WZLA 4JGMA 1CICA 3GMOA 4NO2B 4RFNB 3MV7A 3IFOA 4WEMB 1R3LB 3K46A 2AJVH 2EEBA 1CGVA 1DDHB 4MWFB 2D03L 4EUPB 1ZWIB 2ZSVA 4OT1H 1OM3L 4GO6B 1LE9A 2R1XB 1YEJH 5EIQA 4XGZB 2W9DL 3VWKD 1T0MB 3HC4H 5E4EB 5AG8A 1K2DB 4KTEL 3P2TA 4CU7A 4NC1E 2D7QA 4OLWL 1K2DA 3SDAC 5C0BA 3P9LB 5EPMB 4ZFGL 1KENH 3PNWB 2D7MA 4JRYE 5I8EA 2DYPA 1NBQA 3ZDXE 3CSYA 4QF1A 4KUCF 3LEYL 5KANI 43CAB 3PL6C 2UVEA 3RKDC 4D9QD 4KI1A 4HIEB 3LEVH 3SKOB 4PJEE 1S5HA 1RZGA 4UNUA 1DQDL 4KMTL 5EU4B 2NY6B 5CSBA 3L7EA 1ERNA 3CSPA 2D9QB 5FCSH 5F1SA 1OAXL 1FZJB 4WTZG 2M8XA 5LQBL 5TE4H 3TGXA 2PN5A 4LLWA 3X17A 5D2NC 3SJVD 2MHAA 3D3VE 2A6JA 2XWBB 3VFRA 5HHNB 2D2OA 5F9AC 4WI2A 1HKFA 1LEKA 4MAYD 3PHOA 4BUHA 4UBDD 1X5XA 3ZTJG 4ELMF 5IROC 3EAKA 3RWHB 1XGRA 3MBEC 2DL2A 3F7PC 2Y7QA 4HCRA 4KC3B 4PS4H 2R2HB 1DSFL 3K7UA 1JWMB 2AKRA 1I9RH 4MJ6A 3TA3B 4BFIB 4LPXA 3D39D 4R96A 3AMKA 2PW1A 4D94A 35C8L 4ZTOH 4NHCH 4R96B 4MCYA 3KJ6H 2CPCA 5CIPA 4OD2B 3BEVB 4OF6A 3NIDE 4LSSL 1N0XH 2X4TA 3PP4H 5IP4A 5ICXA 3QEGL 2NCMA 4FQIH 3S96A 4GBXB 1CU4L 2OI9C 3QT2A 4NNYA 5DJ0A 2XTJC 1IGJA 3L7EB 1X5HA 2VOTA 2CUHA 3FFCE 3LEVL 2JIXA 5DJAB 1ZKAA 5B8CC 2XTLA 5FOBA 5FKAB 4HBQA 4A6YA 3GGWB 4WW2B 4QYOA 2NMSA 4RQQB 4K2UH 1YEGL 2EC9U 3UTQB 1RZKH 3ARBD 5GRWA 1X5GA 4JRYB 4Y4FD 2NY0D 4H5SB 4G9FB 4J23A 4QOKA 2R23B 4NSKA 4LSUL 2Q7YA 4NKIH 4GG6F 3O0RH 1T5WB 1LEKB 2PYEE 4GKSA 2XACC 4QRPA 5I1DA 2H2PD 4MB4A 1LILA 1L6ZA 2EE2A 5I1DB 2X6MA 3TLRA 1RIHH 1P4IH 1FL6A 3D0VA 4P2RD 1OPGH 1SYVB 2VL4A 1DFBH 3S35X 5IMMB 5JOFB 2CK0H 1ZLWK 2PW1B 3VWJC 3QJHA 1QKZL 4ODWA 1QO3A 5BRZB 2VDQL 4QRQB 4WHDA 5ESQA 4JLRB 3HPJA 1PSKL 1IT9H 2VMFA 4JM4H 4YXLL 1H0DB 1KJ2L 5EORL 4BZ1H 1DQQA 1ZAGA 3L6FB 4DFIA 5AWNH 1WUNT 1KENL 1JZ6A 1MNUL 3VRLF 3U7AA 2AXFB 5SV4A 2GY7B 2FGWH 1EJ6A 2ZJSL 4UDTA 2QLVB 5C6PB 4GLRH 2VC2H 3ESUF 3SKUD 3DETC 1TZIA 3MLYL 3EFDH 2GSGA 1IZKA 4ZUUA 3O4LE 5EG6C 1CT8A 4QRTA 2VKWA 4BH8A 3U30B 2NY6C 2NXZB 1T7VA 4HFUH 4DGIL 4QRSB 3AVEA 1GGBL 2JCCE 5DT1H 5KSAB 1S7SA 1V8HA 2VZ3A 5DD5H 4RGOH 2OJZL 1WEJH 3ULVC 1MQKL 3V0VA 3VXUA 5E6IC 2AJZA 3U9PL 4I3SL 5EBLB 1J8HA 3DX8B 1QBMH 4XPAL 3WFHA 1MCPL