1LEGB

Crystal structure of h-2kb bound to the dev8 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Structural comparison of allogeneic and syngeneic T cell receptor-peptide-major histocompatibility complex complexes: a buried alloreactive mutation subtly alters peptide presentation substantially increasing V(beta) Interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1legB00
3KLAA 5FHBL 3SDXE 5IB1A 1SJEB 4AY0A 3HUJF 5DFVD 5HHME 4LSSL 4JN1L 2D03L 3FTGB 1MI5E 2D0HA 4JM2D 2ZUXA 2E9BA 1YQVH 4AIXA 4K94C 4KK8D 5DR5H 2F74B 2P43B 2V7NB 2IH1A 1MFCH 1FORL 5JOEA 1TZGL 3FRUB 4NN5B 2OJEA 3RKDC 4Y1AE 2FX7L 3F58L 4L3AA 2EH8L 3DX9A 4MNQD 1MCFA 1LEGB 4UNTA 4XVSL 2XIDA 5ECJE 3GB7B 2BSED 3MCG1 1ZVYA 2OXHA 3OAUH 5ITBL 3RQ3A 1A7BA 1XF2B 3DGGA 1I1AD 4WDIA 2RIKA 1L7TL 1N59A 4GSDH 1FNEA 1P84J 5H37H 3GJFK 3LB6D 3HUJA 1HKLH 2Q1EA 3LHPH 4NWTH 4HT1H 1T3FA 5JPMB 3BPNB 1N8ZA 3WFZA 3P4NB 3RWFB 5CAYB 2BNRA 2XN9E 1DJSA 4JO4H 3QR2A 5F6IB 2RGSA 4LAQL 5JIIA 5D6DC 5D96C 5C0CA 4N1HB 2W9LA 1DQML 2ATPA 3QEQE 3NZ8B 5FXCH 4HG4J 2VRAA 1M7DA 3O6LH 1DLHB 1NEZB 2VC2L 4BSWA 1UENA 5F1SA 4ZOCA 1MNUL 1C7TA 3JUYA 1U8QB 1G6VK 2VQ1A 3L7EA 4NQVA 1GPOH 2F53B 5BOZG 3U0WL 5HHMD 4P5KA 2CO7B 3O8XA 4WW1B 5A3ID 1EXUB 1MI5D 5F3HA 4BUGA 4DWHA 2QQLL 2C26A 1LDPL 5DD6A 5C8JB 3SOBL 5LVEA 4OAWB 4BH8A 2FNBA 5DQDH 4DKFH 2XKNB 2EE6A 1NLBL 4CW1A 1B2WH 1P4IH 2R1XB 2IH3B 4XPBL 4Y1AD 4WJ5A 4Y19E 3SKUD 3MMEB 2V5TA 3QXWA 3MRDB 4OF0A 3AAZB 3QFDB 3X12B 2YMXL 4YX2H 4NT6B 1J0ZA 4K3JH 3RVWC 1FAIL 2ITCB 2BERA 4AM0B 1YYLH 1QSVA 2JJSC 2OR9L 1M05B 4U1MB 2YHGA 15C8H 4OLVH 3PDOB 4KRPC 1S78C 1NANI 5I8CA 4QHUB 2H26A 1TJIL 1KBGH 2X4UA 32C2A 1FPTL 3P9MB 1X5KA 2XN9D 3RIAK 3GM8A 3QHFH 1RURH 5E5MB 2BVPB 1T80A 5FUZL 1BOGB 1RUKH 2DD8L 2CKBB 3D85B 1KB5L 2WLYA 1YEKH 4N8PA 4ERSL 1JWSB 5JUEL 2VXUL 3F12A 2F9BT 1NKRA 2Z31C 1R24B 4JRYB 4DN4L 1UZ6E 1AHWC 5JPMA 2WUBH 3P4NA 1BQLL 3NACH 4QHMA 4NUGL 1U8LB 1INEL 3EJYC 1FRGH 1W72B 3DGCR 4Z7NE 1U8HB 4HCRA 1BLNA 1P5UA 4FTVA 4PRPE 5I1AB 4FQCH 4W6WB 1OT1A 2G75B 1NCAH 4DVBA 3EBAA 1NEZA 1ZLWK 1NGZB 4LLMB 1K3IA 4XTRC 1U8QA 2JB5H 4R97B 1E6OH 2F53A 5HHXH 5ICZA 3NTCH 5CJXA 4WW1A 1JYNA 1EXUA 2NX5B 2ATKB 5BVPH 2R4SL 3V52L 2FH6A 1M6OB 2BMKB 5FM4A 4OLXH 5IGXL 5GJTH 4JRXB 2XKNA 1CLCA 5EBLB 4U0RB 3LQAH 3AS3A 4KZEL 1KT2B 4YDVB 4N9GB 4XAKE 2BRQA 2R1XA 3MRGB 5I75C 2YUVA 3NA4A 1A7PH 3MRDA 5J06A 1WWAX 2PTUA 3AAZA 1XGPA 3PXHA 1QRNA 1MJUH 1HE7A 3AUVA 1IQDB 2UZIL 5E2VL 1KYOK 2GCYB 4OZGF 3H2WA 1PFCA 3QZWG 4OFYA 3WFBL 2FX8H 1M05A 4MA3A 4WTXA 1H9VA 4P4RB 1IC4L 3RGVD 3BHBA 5CFHA 2FJHB 5KSVB 4OF6A 2GY7B 1UJ3C 3MBEA 2WIIA 3G5XA 3E3QC 1A1OA 5SWQB 1AXSB 2NPLX 4G8FB 5F70A 1YDPB 1WTGT 3CXDL 1BBDH 2BVPA 4P5MA 4PRPD 5HI4C 4JEGB 4XP9H 2NMSA 3R06B 4PGCB 3VWJD 3ULSB 2CKBA 2ED7A 3D85A 2PUQT 5EIIB 3STBA 4HEPG 1JWSA 4PJ5A 1PSKH 1UM6L 4HIJB 3R8BB 1LVEA 4F15C 4J3WA 4X6DF 1Z0MA 4U31A 1W0VB 4OZHE 2Q3ZA 3D6GA 2NY2C 1WT5C 4K23L 4OLWH 1U8HA 5D9SB 3MLXH 5I1AA 4Y4HB 1H15A 1NCTA 1BIHA 5DK3A 4M1CC 4UT9H 5LAXB 2IANB 3H0TB 3HG1E 1D9KB 3K8MA 4OCWL 4MDJB 2C1OA 3L5XL 1UACH 4PJ9B 3TV3L 1V7ML 3C5JB 2X4OB 4EN3A 4I3SL 3TWCH 1XGQB 3SGJC 4OUUA 4G6FB 1JCKA 2NX5A 3UEZA 4U1LA 1CFBA 5J56B 3ZKXB 5J3HC 5B8CB 4MJ5B 3QI9C 1M6OA 3U2SA 1UC6A 3CDGA 4JRXA 4HF5L 2BHUA 1NMCC 4KUZL 2QL1A 3VFUB 4YDVA 3AY4C 4RQQB 4N9GA 3D2UD 2NNAA 2Y4SA 1NGYB 4G43B 2VH5L 4G6KH 1R3IH 5IF0A 3FFCB 3TIDB 4D0DB 3KYMA 5I1CL 5HD8D 1OSPH 1OWWA 1BD2A 1B0RA 5FGBA 2CPCA 4YHZL 2EXWD 4K3DL 1E4WL 1G6RH 2GCYA 3WNMA 2F8VA 4NM4L 1F90H 4EOWL 4N0CD 1B88A 2DQUL 4DUVA 4OCLC 5L7XH 4P4RA 1FZOB 5F3BB 3UCRA 5KSVA 5JHDA 2X9XA 1EAJA 5IR1B 1CN4A 5DZOA 3BRDA 4AIZA 3TC9A 4G8FA 4RGOL 3G6AA 1YDPA 1LK3L 3QUZD 4GRMB 4ODBD 3TEUA 2J88H 4HQQL 2CDGB 3L6FB 3R06A 2YPKB 3MNWA 2VXQH 4FP8L 4PGCA 3ULSA 2R2CA 2DQHH 3TVMD 4QTHB 5EIIA 3X3FH 5B4MD 5FKPA 4LASH 3HG1D 1I8KB 4WENB 4KRMB 4LVHB 2QQNH 4PLJC 3O11B 1EO8L 5GSVB 1WCBB 5IHBA 1SJXA 1XEDA 1DDHB 1KCLA 3QNXB 1KB5B 1W0VA 4H1LH 1MAML 5D9SA 5JXEC 4ONHA 4Y4HA 4O9HH 4DOHE 4JO3H 3VD5A 4P4KA 5FB8B 5AAWA 4X9FA 1CK0L 2VDKH 3H0TA 3DIFB 3VE0A 1IM9D 2VAAA 4ZO8A 2XA3A 4WNQB 5EPMB 3C8HA 1IAOA 5CJOL 3KPMB 2DKMA 3UJTL 2ZG2A 3C5JA 5F96H 5HI5C 1IGFH 1H3GA 1XGQA 2WQRA 4KK6C 2GJZA 2AJYH 3O9WD 2DOCA 4IDJH 2ZUTA 2APVA 4KKLC 2M26A 3BDBA 4MJ5A 3ZDZF 2PETA 3PGFL 4DEPC 2A74A 4R4BB 1OD9A 4P5TA 4UBDC 5DGQA 4UUJA 1TVDA 4M1GL 1KELL 4HLZG 1NSNH 4FQIH 3GEWB 4KHXH 1LO3L 2DYPA 3GHBH 4NBYB 4RQQA 4BFGA 4CN4A 1JGDB 5I8KL 2QHRH 1ZHBB 4O2CB 5E5RB 1NGYA 4G43A 1UT9A 5IBUB 4L8CB 3TIDA 2VL5B 4D0DA 1Z0NA 1MREL 1JZ3A 5FKAB 5HHNB 5TQ0H 3K2UL 1CGSH 4NP4H 4ODXA 4R9HA 4EBQL 3RDTC 1GHFH 5HDQL 1P53A 2BSRA 3MXVL 3OKOB 3OX8B 1IEBB 1BM3L 3IFLH 1FZOA 5F3BA 3DTXB 4KROD 1VEMA 1QFHA 5BW7A 1GZQB 4G3YL 2GK2A 2QLVB 3X3GL 5A2KH 4QTHA 5F7DB 4ZUVB 2JJTA 4NKMA 1I8KA 4XP1H 4LSPH 4OLUL 1BF8A 4Y89A 5GZOC 1EA9C 2X5PA 4UT7L 3WLWD 3O11A 5GSVA 1WCBA 1DDHA 2OSLB 4LQ1A 1KB5A 5KTEH 3SEPA 1TZIB 4XBEL 5FM8A 5CSBA 3GJFH 4XVJH 3ARDB 3MCLH 4F9LC 2CSPA 3O6KL 3I6GA 1QA9B 3MRFA 4L4VB 4XCNB 5HVHC 2DB8A 3PP3K 1VFUA 3NGBB 4F7CB 5GGQL 4A2MA 3DETC 5HDBF 1OD7A 4Z7QF 3EYQD 1QFOA 2H8PA 2OQJA 4HWBL 2J2ZA 4EDWL 5E6YA 4K9EL 4P3DA 4LCWB 1JBJA 3KPMA 1K2DA 1WC7B 5J0BA 4NRYA 2BY1A 3NPZB 4B41A 1MH5A 1RZKH 3FQWA 1UM5L 3BWUC 1JPGA 1FIEA 2WAHA 2DLEA 1TJGH 1CZ8H 4W4OA 4XWOD 7CGTA 3HE6D 3QUML 2AABH 4R4BA 1KCVL 4TYUA 2XKSA 4M7KL 1J88A 3HMXL 4AENB 2DQDH 2JK5B 1LEIA 3W0WA 5TE7H 1JGDA 4NZUL 3SDCD 3RTQC 4PYHA 2F5AH 1MPAH 1I3GL 2VL5A 3U1SH 5ILTH 1SJVA 1MLBA 4F7EB 3EKCA 3SDDB 4G8EB 5FKAA 2YD9A 1JRHH 2AJ3B 2CUMA 3H3PL 3QCUL 3ES6A 4XCFL 1N64H 2HAZA 3PIQB 1X5JA 3WHE0 3NOIA 1JHLL 3OKOA 4IRSB 1IEBA 4HV8B 1ZT1B 3ULVC 2NR6C 2FWOB 2YXMA 1JPST 1MCSA 3DTXA 3SGDH 4R4NC 2OR8A 5BZWA 5GZNC 3MLRH 1S9VB 3VGHA 1GZQA 2R4RL 1VADA 4WFEE 2ZUQC 4X9IA 3MBXH 3G5YA 5DSCB 4ZUVA 2R1YB 4JDTL 4Y8AA 4WI2A 2R69H 1HSAB 3P30H 3QULB 3AS1A 3QUXD 4NQXB 3JTTB 5DTFB 4EUPA 2WBJD 4PRAB 4GRWE 3GDBA 3L7FB 3RZWA 4NN6B 3PV6B 3AB0C 1QA9A 3QDGA 1NLDH 2OYPA 4X99B 4F7CA 1YEFL 1ZA6A 4LP5A 2G60L 5I1GH 5E2UL 1CXFA 4PJAE 43C9B 4LQFH 2DM7A 3D3VB 5ANME 1WC7A 3B9KD 3TGXA 4JKPL 2X05A 4JLRB 3FO9A 3U0PA 3PWPB 4F9PC 2HVKB 2D4DA 4DQOL 5IW6B 2R0WL 5GHWH 4AQ1B 1IEHA 5HDLA 1RK1A 4XWGL 3NCEB 1EH9A 4ISVB 3BKYH 3V4PH 3U4EA 3INUL 5KJRL 3WJLA 3K46A 4Y88A 1QSEB 1QD0A 3AVEA 3H3KA 4JFZH 4AENA 2JK5A 1NC2D 5C0EB 5HY9B 5F7KC 1X6NA 3ILQC 3P40A 1WTLA 2VABB 2HWZL 1ZKAA 4N5UA 5KSBE 3AM8A 5D2LB 3SDDA 2OTPA 2ZP0T 4WFED 1RUML 4L9LB 3ULVF 3WXWL 4XNXL 2KPNA 3S34L 3CXHJ 3PIQA 4H88L 2AK1L 1K5NB 2HFEB 3DYMA 2R0KL 2H32H 4ZFOB 4HV8A 2FWOA 4F3FA 1F11B 4NRXA 5E8DL 2AEQH 1I8LA 4WI9A 1OM3L 1M1SA 2CLVA 3JV5A 2AJXL 3V6OA 4D9LH 1M71B 4QTIL 2W65B 3RTQA 2C4FU 5L2KA 4ELME 4HJGB 4UZGA 1KTLB 1UWGL 4MB3A 5T1LB 1I7ZB 4CVZA 1KTDB 3QULA 4FMKA 4NBXB 1YMME 4NQXA 4GKSB 3I9GL 4NSKA 4EI6B 1FJ1A 4PRAA 4MX7B 3TO4D 3ZTNH 5CKAA 4H0IA 3T08A 2DWEB 1AQKH 5DFWH 3PV6A 4LPCA 2AQ1A 1BZ9B 4HHAB 4PTUB 1VERA 1C16B 4X99A 3I02A 1ND0B 1K6QL 1VCAA 4X6BB 5EIVA 1FV1B 5AEAA 4S1QH 5LGHH 2V17L 2NY6C 3OF6D 1Z6JT 1CICD 4TQEL 3D3VA 5DMJB 4YDIH 2BFVH 3X13B 1JTPA 3LH2H 4GBXD 4MA7H 2HVKA 5I9QB 4LCCC 4P23B 2KQMA 3OAYK 4Y5XC 1ZA3B 5CEXB 4OZIE 4WGVB 2VERN 3QYCA 4GOSA 4EVNB 4YJZL 5C0IB 4PGEA 5J6GA 5HHQA 4LSTH 1QSEA 3PUCA 4W70A 4L8BA 1V3MA 3NCJH 1G1CA 3G08B 4OIIH 3IKCB 5C0EA 5HY9A 4OM0H 4PB0H 1SEBA 1MF2H 1DANU 4FG6C 5KVGL 1YJDL 1R5VA 2CRZA 3RL1B 3HZKA 2G2RB 2VE6B 3SPVB 3QXUA 2VDNL 4L9LA 2ZZUT 2R9HD 4HS6B 5CBAA 3HE7B 3WIFA 5JW4Q 2HFEA 3U4BL 3O0RL 4JG0L 5E6ID 3BZ4B 3C6SB 1QPXA 3KYNB 1P7QB 4GAFB 1YMMD 4WI4A 4S11A 2J6EL 1JNJA 3UPAA 5FYJL 3VWKC 2Q3AA 3P3YA 5HTSA 2XZQH 4G6MH 4X9HA 1XF3A 1G7QB 3MRIB 3OQ3B 4X5LA 1ERNA 2HJKB 4RRPA 2W0KA 1KTLA 3UXFA 5T1LA 4J1UB 4KGLA 4GAGL 4DGVH 4NN7C 5D1QD 5DR5L 3KG5A 5D7LE 1U92B 4QHKJ 1MFCL 2VZ3A 3GSXA 1Q0XH 5A2FA 1HIMH 3BPLC 4KDVA 3HZYB 4MX7A 1MVFA 1F58H 2VXTH 4Z77A 3VU2A 4S0TD 4HHAA 4C55A 3H8NA 3D9AH 2AJUH 1ND0A 3WN5C 5HYSB 4NRZB 4OFVA 4X6BA 5IVXF 3OAUL 5KW9L 3KPOA 4CVXB 3S88H 4GSDL 4K8RH 1HKLL 5EOTB 4NWTL 4P3CL 4HT1L 4M7LT 4HWBA 3E0GA 3ZDXF 4MQXD 3HB3C 5CEXA 2DIJA 5MERB 1J1XH 4Z9KB 4EVNA 3TBSB 5HPMB 4U0QB 5I18L 3DJ9A 4RISH 1N4XH 1UM4H 4JKLA 3O6LL 1GZPB 3G08A 2BVTA 3IKCA 3QIBC 2K7PA 1CFNB 3QUMA 1FO0H 4NQCE 3ARTA 2VKWA 1JNHA 1D5MA 4PJCF 5GS0D 1E4KA 3HMXA 3RL1A 1GPOL 5C2BH 2XY1A 3UTTB 3EHBD 4Z0BL 3SPVA 4W68A 5E4EB 5IVXA 3JVGA 2YXFA 3G5ZA 4YC2B 5HGBB 5ACLA 3CU7A 5DQDL 4TSBL 4Y16D 4DKFL 1P7QA 3QO0B 4M5ZH 5D7LD 5DURB 3P4OA 3MCKA 4AEEA 3V0VB 1JZ4A 1B2WL 1P4IL 4HGWA 3GKZA 5D1ZD 5DEFA 4BELD 3TZVD 3MRIA 1G7QA 4OCYH 4YHYB 1HYSC 3PQYB 4OKDA 3OJDB 1B4JH 4GS7B 4YIQB 2BVOA 4ZNEA 1CIUA 4R7NB 2C9AA 2HJKA 4YX2L 1Q72H 4GQPH 3AMKA 3CFKA 1C12B 3ARED 5C0NC 1WFNA 4PV9A 1YYLL 1U92A 2D4FA 3EYUH 15C8L 4OLVL 4PJCA 1XR8B 1ZS8A 5CJQH 1JHTB 2VXSH 2ED8A 3PNWB 1KBGL 1CLZH 4FFZH 4W81A 2NXYD 5E00B 3BN9D 1T66D 3TLRA 1OW0C 4KJPD 3IAQA 1MIMH 1TQCB 3QHFL 3CVIH 5F8RC 1RUKL 1MHPH 1I85C 2XTJE 3FT4B 2EE3A 3PP3H 5ICYA 4CVXA 3CFBA 2M2DA 5IVNA 3SCMD 4RGND 3IJSA 5DJ8B 3WFEH 4NQCD 5D7JC 4YHMH 4ZOBA 1RIVH 2V9TA 2H1PL 3NACL 5FM5O 2BSTB 4NDMA 1QLFB 3EYOA 1FRGL 1KACB 3LY6A 1UA6H 3NH7H 3QDMB 3JTSB 4G7YL 5KSAB 4FQCL 5HPMA 3RU8H 4HBQA 1XCTB 4Z7UE 1GZPA 1NCAL 3CK0L 5CP7A 4ZYKA 4I4WB 4YHOL 1R3KA 2GTZA 1IZJA 3L5WA 4XPFH 5C1MB 3HI5H 1LNUA 2JB5L 5IB5B 1E6OL 5JDSA 4A6YB 1YNTA 5HHXL 3JV0A 1L6ZA 5BVPL 4KKAC 3L95B 2VLRB 3QDHA 4C54A 4ZMAT 5HGBA 4OLXL 4XGZB 5GJTL 1D5IH 1CU4L 4PJ7B 1K3ZA 3D0VB 3FOLB 1O7SA 5C08A 3LQAL 2I25N 3V0VA 4ONGH 5D7KD 4HKJB 1YEGH 3MGOB 3GSVB 4MS8C 1A7PL 3PQYA 1IL1B 3TJHC 4WTZA 4R7NA 3RNKA 1MJUL 4M7LL 1KCSH 2FL5A 1PJ9A 5ABDE 1BJMA 5INDB 2FO4B 1C12A 2AQ3A 3EO0A 2XTJD 5F9WB 4HIEA 1HDMB 1HXYB 2FX8L 4PJXB 5D2NC 3V0AC 2ENSA 4ZXBD 1XR8A 3O4LB 3PNWA 5TDOA 1WZKA 4X80H 1MRDH 3P4MB 5E00A 3GSUA 4PLKC 5DMIH 5DRNA 3VMNA 4KTEH 1NFIB 4IJ3B 2NXZB 3FN9A 2P47B 1BBDL 3GSNL 4I2XE 3L3JB 1TITA 3HAEH 4PJ7F 5DJ8A 1HINH 1T2QH 2CDFA 2Z91A 5DUML 5CEYB 4PJGF 3TT1H 2C7UB 4G5ZH 1X5XA 3I6LD 3BPOB 3MLXL 2V5RA 5KSAA 3QDMA 4NC1C 5B3JE 5E24E 1IGYA 1XCTA 2Z9TA 4KAQH 5BJTA 4GW5B 4JHWH 5DJAA 2DTSA 2B7DT 4QRRB 1MJJB 4XVUC 5IIEB 4TOYH 3BO8B 2W07A 3PL6B 5IB5A 2FEDD 3VI4E 2YRPA 4UDUB 5DLML 1XIWC 4MAYC 4R96B 3DVGB 1BJ1H 5IT2L 5JA8B 1Z3GH 2IEPA 3DRTB 3IETB 3L95A 5E95B 1G84A 1OB1A 4XGZA 4GW1B 5E2WH 5HHOB 4PJ7A 3OHXB 1L6XA 3D0VA 3FOLA 4NIKB 1S7QB 3RVVD 1RY7B 1A7NH 3MREB 1IEAB 4WCYH 3MGOA 1Y0LA 5CD3B 4NQSB 4G6KL 1A14H 1R3IL 4YDKH 2YS4A 4F58H 5C9KA 3MYZA 2J6EA 3EOBA 1OSPL 2DLGA 1CLYL 4OBSA 5EN2B 3ET9F 4HPOH 1G6RL 1FVCB 4H8WL 3KHOA 1R0AH 1F90L 5L7XL 2AEIT 4WO4D 2VLLA 5DUBB 1WIUA 3O4LA 7FABH 5D7IF 5D6CB 2P8LB 4RIRB 1TFHA 4PRNB 3NCCB 4JFYB 5LQBH 3ELAT 5MP6H 3LRSA 4NQEE 3V8OA 1X7QB 2VYRE 1FL5B 3X3FL 4LASL 3L3JA 2AXGB 2GUOB 1VA9A 4FQPA 4YO0B 4KK9D 1WAAE 2QQNL 5FGCB 5F6IC 4EI5D 1JIBA 3VFGH 5CEYA 3EJZC 1LE9B 1KTRL 4HZAA 3IF1A 1WICA 3Q6FA 2AV7A 3BP7A 4O9HL 3WL9B 1KSRA 4PY8I 4LCUB 4X6EB 4JO3L 4WV1A 3UP1A 4JFDB 5HGAA 5DJYB 1FZKB 1RZIB 4GW5A 1VFBB 1D6EB 3Q0HA 2ZUSA 4TUKH 3QIUB 4NC2B 3D5OF 2JIXD 4PGDB 1S9XB 2EIZA 1FL3B 4HJJL 1IGFL 4R96A 3ZKSD 2AJYL 2VL4A 2QADB 3DRTA 3IETA 5H94B 4BK5A 1WJ3A 1F97A 1G9NH 1UXSB 1ES0A 3OHXA 2Y6SD 5K9OB 1S7QA 4J3UA 1NSNL 2X40A 3MREA 4FQIL 1HQ4B 4KHXL 3GHBL 4LRIC 1IEAA 12E8H 2QHRL 3K4AA 5HYQA 5IW3A 4WU5A 5CD3A 4NQSA 5CMAA 4Y4FD 3OBAA 4UQ3A 1NUDA 1QFWI 3GO1H 1A7OH 5TQ0L 1JK8A 1X5FA 3LQZA 4NJAH 1ORQA 1ZXQA 4FQXD 1FN4B 1GHFL 4FFYL 3OSKA 2KBGA 3QFJE 1IAIH 2KH2B 1OGAA 5JZ7D 4GW4A 4NKDB 4UTAH 5D6CA 2P8LA 4AL8H 4RIRA 4PRNA 4JFYA 3BN3B 3LPGA 4DFIA 1X7QA 5BRZE 2EKSB 1G7HA 1ZHLB 5IROA 1FL5A 4CAGA 1KLGB 4GG8A 2ZCHH 1XGRA 4XMLH 3IS0X 2I5YH 1QYGH 3TN0A 4XP1L 2GUOA 3CLEL 3AGVA 3D39E 5T1DH 3GSNB 4HWZB 3QIWB 4F7TA 1F5WA 1SY6L 1G1YA 4J7RA 5C0AE 5DRXB 1WVZA 4G9FB 5JR1H 2AK4B 4XVJL 1GC1H 3MCLL 2HG5A 3BGMB 4LCUA 3U7AA 3ZE0E 4JFDA 4YQXH 1PAMA 4LK4A 1VFOA 1FZKA 1U3HC 5FGRA 4GAYB 1CGVA 4RX4A 4G8GA 4B5EA 3VXOB 4ETYA 4CDHA 2X1WL 3NFSL 2VN7A 4NOBA 4LLWB 4PGDA 2FBJH 5FOBB 5FYJU 1AR2A 2VZVA 3B2VL 4U6HB 2A6KB 1LILA 1CFTB 2MCPL 2VR4A 2ICWB 4U0RC 3IDUA 2AABL 1J9CT 5DEGB 5DMGC 2NY1D 5K9OA 3TA3C 4UT6H 1OAZH 4HJ0D 5J13B 2DQDL 1HQ4A 4WI6A 3QXDB 3QFJD 5JIKA 4RWYH 1FP5A 1GXEA 1QFPA 4P2OB 2F5AL 4HFWA 1MPAL 1J10A 2UWEF 3VDBA 4HBCH 2X4PA 5ILTL 3U1SL 4NHCH 4K7FA 1IGMH 2OM5A 5ERWA 5IB2B 3MFGB 1QBBA 4JZNB 4LFHD 4JREB 4QRUB 5CJ8A 1DP0A 4YZFF 1N64L 2BK8A 3ZO0A 2YWZA 5FYKE 5JW3H 3HPJB 1P2CB 1ZWIA 3IDMB 3D39D 3WS6A 3SO3C 1FNHA 4JQVA 4OV5B 1Y6NR 1EJOL 1G6RB 2DBJA 2HTLD 4BFIB 2V7HB 4NKDA 3PHSA 1CDBA 4APQB 3S4SA 3MLRL 5C0AD 2P45B 2HVJB 3HUJE 4P59H 5GXBB 4EZMA 1FNGA 5KSUB 2CD0A 2EKSA 5I19H 3MBXL 2BNRE 2VIRB 3FCTA 3FB7B 1KLGA 4HKZB 5C0CE 1AC6A 2R69L 3P30L 2ESVB 5IMLB 1U95A 4YHNB 4HWZA 2UWEA 1HHGB 4XCCL 4E0RA 1G7JA 4WWKD 4YNYB 4K2UH 4XPHL 1HWGB 4L8SC 5DRXA 3ORJA 5D5MF 4OLYH 4IBLT 5K9QG 1D9KC 4QGYA 1NLDL 2FBOJ 4NPYB 4H1LB 3OV6A 4PJ9C 5K9KA 5I1GL 1HHIB 3UAJC 2VUOA 3VXOA 2ZUVA 3F7YA 4LQFL 4PLNC 3BVNB 3DECA 5FOBA 1WBXB 4ZAKA 5IFAH 3GMLB 5B8CC 5FFLA 5TGBA 4KWUA 5T5NF 2A6KA 2D9CA 3T2NH 1BPVA 1RZJC 4HZLB 3WUWA 2ICWA 3BKYL 2CDEB 3V4PL 3SGKA 5DEGA 1PKQB 4XNQB 4JGMA 1MVUA 5FYKD 2OL3H 4G8IB 3OGCB 1ETZB 1U9KA 1IKNA 4P2OA 4MNQB 5CKGA 3RRQA 1NFKA 2LQRA 1RJZB 2C3HA 5J9PB 5D5MA 1TENA 3U48A 4CNIA 1KTKE 2XWBB 4H25B 4X8JB 5IQ7H 1SEQH 5TDNB 4TNWF 4JZNA 1OAKH 2BNRD 4QRUA 4JVWA 2A0LD 5JW4R 5I8EB 4XZUB 3MRBB 3ARBB 3GI9H 3HI1B 2DAVA 1IKFH 1I1AB 4RZCB 5C0CD 1OHQA 3QUYA 3HPJA 3VGAC 3C08H 1P2CA 2W0PA 4MQTB 3V6BR 5T3XH 1BIIB 1G6RA 3BX7C 1RQ5A 2P5WA 3BQUA 5KANI 2AEQL 5TF1H 5DJXA 2YRZA 5KSUA 1EHAA 4D9LL 2LU4A 3T1WA 1AQDA 3U4AA 1XF5A 4LVHC 3O8XD 4HKZA 4WFHE 4FTVE 3BDYH 3LSOB 5IMLA 2ESVA 3IDXL 2NY3D 3SDXB 3UC0H 4YNYA 5HHMB 5I6XC 2CIIA 3H9ZA 4DW2H 3ZTNL 3TFKD 1AQKL 3L3DB 2V6HA 2X10A 4WU7B 1XH3B 3AS2A 5F1NB 2DJ4A 3LKPA 4XXCA 1U6AH 4M3JA 1RUQH 4NPYA 1QLRB 1A0QH 2FIKB 4H1LA 1U3YA 2M8XA 5MEOA 3UX9B 2ITDB 3GJFB 1QACA 1HHIA 2W92A 4S1QL 5LGHL 5B3NA 3QAZC 4Y1AB 2VOTA 5LBSH 1U58A 2PW2B 4QXGL 5F9AC 4WEBH 3LH2L 4MA7L 5FDWB 2YR3A 1NMBH 4UILH 3IT8D 1YEIL 4HZLA 1NBQA 2CDEA 1EO7A 3FO2B 3MRKB 5A1AA 3T09A 2W9DH 1EAPB 2H2SC 1PKQA 1CE6A 1QRNE 2KDGA 3FKUS 1U8MB 4X7FC 4XNQA 1RZFH 4AZ8A 5DVMA 2I07B 4G8IA 4JJ5B 4OCXH 2NY7H 4LU5H 4OIIL 3ILPA 2AEWA 1O7VA 1RUPH 2F8XC 1H5BB 4OM0L 4PB0L 5J9PA 1I75A 4MDIB 4P46B 3MLYH 5DUPH 2R1WA 2VDMH 1U8NA 2OTUB 5MHSE 4X8JA 2Q76A 4N1CA 3FZUD 2VQTA 4O2EA 3QEQB 1XGUA 4M5YH 4J3XA 4XXDB 4XZUA 3ARBA 2V2TB 2BC4A 3HI1A 4WFHD 1J0KA 3BW9B 1QO3A 4FTVD 4OGAC 1EMTH 3PXJA 3OKNB 4X5WA 3EDJA 1A4KB 2DQFA 4DKAA 2YA2A 4OD3H 3CH1A 2BHZA 4FA8A 4PJ5E 2EXYD 2VNCA 3QISA 1JPFA 5C3TA 4G6ML 1RULL 2BX5A 5BO1H 2EC9T 4FABH 4HUUB 2F53D 5EU5B 4XPGH 1F4YH 5I66B 2CLZB 1HEZB 3O3EB 1A7RL 1FSKB 3LSOA 1T7XA 2BZDA 4DGVL 5DWUH 4OZGE 4Y19B 1X5GA 1Q0XL 1HIML 1TJHH 1S5HB 3ARDC 5EU3A 1KOAA 1OCWH 3HA0A 3NGBC 4HD9A 3W82A 4OM1H 4RFEB 5HGDB 1MIEL 1PEWA 1XH3A 2J3SA 5F1NA 3RAJH 1EGJH 3B5GA 4ZODA 5E99H 3AXLA 2AJUL 3OMZA 4NKQB 1QRND 3QHZL 4X0KA 3GJFA 2APTA 3RY4A 2Y5TB 2WINB 5FM5M 5EOCJ 1NQBA 3QJFA 4P9HH 4KI5C 3U30C 3D69B 1E4XI 4OFYD 4GRLA 1ORSA 2Z93B 4X6DE 5FYLE 1P7HL 1A6TA 5FDWA 5MHSD 1AH1A 1PVHA 2D31B 4OF7A 3DVFA 4QF1A 2E7HA 3MBED 2H9GB 3GSQB 3MRKA 3QPQD 4QGTA 3GMPA 4DCQA 2YK1H 3TNNA 1BD2E 4RISL 3CFJB 4RA3A 1N4XL 1UM4L 2I07A 4JJ5A 3X14B 2RFXA 4AQOA 4KQ3L 4PB9H 2DLHA 3RGVB 4E41B 1CGUA 2IQAB 5CCKH 3D85D 1H5BA 5E8NA 1JF1B 1T7ZA 4BQCA 3F5WA 4KDTA 4MDIA 1DBKH 1JE6A 4P46A 3W81A 4PJ5D 4OKVB 3TBTB 2OTUA 3RFZC 5B39G 3RVWD 5C2BL 5JHDE 1SYVA 4PRPB 3VXMA 3QEQA 3VDAA 3VWJB 4IRSC 2MNUA 3DNKA 2V9QA 3C5SB 3R1GH 2V2TA 5SX4I 4MA1C 5JW5B 3L5JA 2Y1VA 3BZFB 3BW9A 4LFHG 5KZCB 3UTZB 1CG9A 1VHPA 2ICWJ 5B22A 3PABB 4FFVD 4M5ZL 1A4KA 5JA9A 1IVLA 2CIKB 2R56H 2YC1B 1FFRA 2ZG3A 1ZTXH 4EN3D 2KL6A 5HYJE 1F3DH 4YDJA 3BGAA 2R2BA 3MRRA 2NX5D 3O3EA 4NKOB 2ZCLH 5MEQB 5J11B 1K9TA 1WFTA 1EPFA 4Y19A 3EYUL 2EDOA 2FIRT 4KVCH 4JRXD 4NN6C 5CJQL 3D87B 2VXSL 3C2AL 1NAMH 5D8JL 1CLZL 3MUY1 4GKNB 4KRLB 5I8OL 4JPWH 3BP4A 4RFEA 5HGDA 1MIML 3HLAB 5D71L 3CVIL 2J8HA 3RNQB 3RPIB 4D9QE 4TRPH 4NFDA 4NQDA 1MHPL 5IG7A 3DV6B 2Y5TA 1BD2D 1S9WA 5HXMA 3B5HA 1T2JA 3MLSL 3LEXB 3OWEA 4R0LA 6CGTA 3D69A 3WFEL 2XZZA 3BZEB 3QEGH 4J3TA 2Z93A 4QEGA 1GGBH 4YHML 4CDGC 1RIVL 3OB8A 5JHDD 5CZVH 4KMLB 1KIUA 3GSQA 2R0ZH 1Q9KB 3UYRH 4Y5YB 3SE4A 3VFWB 2GJ6A 1UA6L 2XPGB 3NH7L 5JNYB 2N7AA 4YAQB 4R7DA 1KV3A 5F7UA 2IFGA 3X14A 3J8F7 3ULUC 2CUIA 1KJ2H 3ZT5A 4E41A 4FQ2H 1JF1A 2CGRH 4OZHB 4G42B 2GFBB 4OKVA 4XPFL 3U46B 3MYJB 3HI5L 4JZJA 4XX1G 4F8TA 1I1YA 3TVMB 4HUWA 1H8SA 3HG1B 3ZDZE 5JW5A 2H6PB 3RWCB 3BZFA 4Y4HD 4C59B 5EU7C 5BCAA 4P4KD 4HUNB 1U8JB 5A2IH 2O93L 4ONGL 4HC1H 4XH2B 4J4PC 1UCBL 1YEGL 2H32A 2YC1A 4GXUM 4NNPH 5IHZA 2PNDA 4JM4H 3TM6A 5A43C 4Q9QH 4G6FD 4D9QD 4IOIB 2APWA 4XRCB 1RMFL 2BNUA 3I3BA 4MSWB 5D4QA 2GW5A 1IGIL 5I1LB 4YGAB 2O61A 4LARH 2OX5A 2LVEA 1WZMA 2KQNA 4P5TD 4FQQB 3VFSB 4K8RC 3JWOL 5IVZB 2DYPD 1A21A 3O9WB 1MRDL 4GKNA 2E7CA 4PYGA 3GMQB 4X80L 1EEUA 1K8IB 3WE6A 3RVTC 5DMIL 3HLAA 4IIQB 1OAYH 4LVEA 3RNQA 3RPIA 2IPKB 1DN2A 4LMQE 3C5ZB 3DPBA 3ME0A 5EC1A 3EOYG 1VKXB 2ICEB 4O2FB 5DK0B 5AG9A 3E6HB 3ZHLA 5I9QC 4P23C 1HINL 1A9BB 3BZEA 1MFEH 3FT3B 3W0WE 1T89C 5FF6A 3JUZA 3KPNA 1HSBA 4LLUB 5GRVK 3STLB 3TT1L 1NAKL 3PWNB 1BZ7B 1Q9KA 4G5ZL 4Y5YA 3FT2B 3VFWA 2E3VA 2OJZH 4RAUA 5DT1H 1U8IB 5JNYA 1Q38A 4ONFH 5IEHB 4KAQL 1E28B 5HDBE 3CLFH 4Z7QE 4JHWL 4NBZB 3KYAA 1W8NA 4KROB 2Q8AH 5ISZA 3C60C 3LD8B 4G42A 3QP3A 2AGJH 2GFBA 5E94B 4U1SB 3QT2A 4HMDA 3MYJA 3U46A 8FABA 1FCGA 3EOTH 1MJ7H 4LCYB 1S7UA 2OBGA 3CNKA 4MD0B 4DOHB 3HE7C 1MCRA 1AGCA 1A1NB 1Z3GL 4ZFFA 3HG1A 3RWCA 2FX9H 4G6AC 5E2WL 3FB5B 4KDWA 1TVBB 1ZGLA 1EUTA 3DBXB 1U8JA 5E7FA 1A7NL 3GUTA 3R8QA 4XH2A 1DFBH 4WCYL 3DUUB 3WJJA 4MVBC 5IESH 3MRMA 5EH1A 2PTTB 1E27B 1M7IB 2X89A 1KN4H 4HPOL 3QDGE 5I1LA 4MJ2A 1R0AL 3A0OA 3LV3B 1BVKA 3N1FC 5B38B 3MGTB 3VFSA 3EW3B 5IP4A 3N50A 7FABL 3W0WD 3GMQA 1K8IA 1WCQA 3LEYH 5HHPB 1IFHH 1HH9B 1ZT7B 5LQBL 2Z35A 5MP6L 4IIQA 1B0WA 1TTUA 1I1CA 5JIHA 3VH8A 2IPKA 1X5YA 3C5ZA 2DQTL 4F8QA 3SDAC 4U7SA 5HI5D 3SDCB 3N1GC 5F7MC 5E2JA 5I17A 1FNFA 1Q0YH 1S9YA 3FOMA 3HMWH 3O81A 2A73B 1AGFB 3FT3A 3VFGL 1MHEB 3LMJH 3OKLB 4D94A 1WK0A 3ARGC 4LLUA 3STLA 1QSFA 3PWNA 1D5ZA 2ZCKH 4CGTA 5DA4A 4XVTH 3WLBA 2D0GA 2O5YL 1T20A 4S1DC 2ZNXA 3O2VH 3SJVB 5IEHA 4TPRH 1E28A 3JWDC 5IFJB 1FBIL 1U42A 4YXLH 3FQNA 3NAAH 1XGTA 4QYOB 4TUKL 3HPLA 3WNPA 4U1SA 2VXVH 5E4EC 2CH8A 3ETBF 4LCYA 2FSEB 4U1JA 1F4HA 3NA9L 3VA2C 4X7DC 4YC2C 4OTXH 1FO0A 3SKMA 1I9EA 4MHHG 1A1NA 4XNYH 4XP4H 3VJ6B 1G9NL 1TTFA 3BGFB 3V6OE 4Q58C 3QDGD 4BZYA 3ZYOA 3MTRA 5L2KE 1EEQA 1Q8MA 1TVBA 2XWJB 4PJHF 2Z8RA 3N0PB 1MUJB 2ARWA 4YHYC 1MCJA 2QSVA 3V7MA 1OP5K 3CGTA 1F2XK 1N2RB 35C8H 4XMPL 4GUPA 2PYEA 4LSUH 5FOJA 3SY0B 3GI8H 4ENEC 4JQIH 1J11A 1M7IA 4CMMB 1UB6B 3BP5B 3IXTA 4AH2B 1VENA 3GO1L 3ULVE 1A7OL 3IDIB 4KMTH 5HGGS 3S97C 4UINH 4JFHE 1CFQB 4NJAL 4J12A 3UDWC 3QEUB 4L29B 3NIFF 3B9KB 2IAMA 5KAQG 5CHNA 1BQUA 3MGTA 4Y5VA 4Q6IA 1XR9B 4UTAL 1TQCC 5C6TH 2P5EB 1HH9A 4YBQC 1KCRL 5F89B 5F7EL 3QCVL 1A2YA 2JTDA 4B7LA 4X4ME 3REWA 3SDDD 5I71B 5GS0L 1KYOJ 4ZS7H 1YYMH 2ZCHL 1BHGA 2IPUG 4D0BB 1HHJA 2I5YL 3G5VB 5LWYH 1YPZF 4MJ4A 1QSEE 5T1DL 2E27L 2A73A 5J89A 3I50H 1YC7A 1DBAH 4F37K 1KJ3H 1CS6A 2Y9RT 5JR1L 3FQXB 1LK2B 3HAEB 5E5UB 3T2PA 4ZPTB 4JGJA 1BQHB 3MRLB 2OK0H 1TPXB 3SJVA 3RTQD 3QWOB 5L2KD 2L7UA 3IFOB 5E08H 1FAKT 4PJ8C 5LXGL 4QYOA 1FGVH 4GRWB 4R8WH 3N9GH 2Y07L 2FBJL 2WWMD 3KPTA 1RIUH 1FLRH 2A6JA 5TH2B 3LN9A 5GS2D 5JHLH 4CKVX 1YN6B 1K4DB 1Z9OA 3BD5A 1KEMH 1KPUB 5FYLH 3ZKMC 4PJAB 1YPZA 3M1BA 3QH3B 4JFQB 4U6YA 4UT6L 1AD0B 5GZND 4GQ9H 3LKRB 3TO4B 2DKUA 4RWYL 4Y4KB 1U8OB 5IJKC 2VLKE 1KCKA 3SKJL 1MCBA 3D3VD 4HBCL 5ADOH 5DC0A 3U7YH 2FDBP 3FJTA 3QXTA 4ZS6D 3FQUA 1UB6A 3IDYB 3BP5A 4NJ9H 2DQCH 3HHRB 3BWAB 2E6PA 2FGWH 1CICB 2HT2D 1BBJB 2VAJA 3WS3A 4L29A 3BH8B 3S98A 1QSED 5KSBB 2NXZC 2BJMH 3D1MC 4I3RL 1JHKH 4J6RH 3IDGA 2P5EA 3SE8H 5IQ9B 4NGHH 3R4DA 5F89A 3S3PA 1KC5H 1C5DB 5I19L 4MB4A 1U2HA 2R0LL 4ORGA 4D0BA 5JORA 3B3IA 1J1OH 2KUTA 3W5MA 3WIHH 2OLDA 1S3KL 3RBSA 3K3QA 5FCSH 3PDDA 4GXVH 4WHYG 3BPOC 1T4KB 1F4WH 1DQQB 4LKXB 1BJ8A 4JFFA 4NYLB 3RJDA 5EBMA 3FQXA 3HAEA 1I3UA 4X4XB 5L9DH 2HFTA 4ELMB 2Y7QB 3WEXB 1BQHA 3CMOH 3JV4A 4M4RA 4HX1A 5IVXE 4N90E 4LKCB 1YMMB 3DRQB 5F72S 4ZQKB 3IFNH 3EO1B 3FQRA 3PL6C 5T1LD 2FEEL 1FVDB 5ID1B 2QR0B 5F1KC 2YD2A 2QBWA 4LHJB 3CJJA 4NUJB 3VCLB 4LDEB 4NZRL 5TH2A 3D18B 3ZDXE 4WI5A 1JWMA 1YN6A 4QOKA 4K3EH 3WBDA 1IAKB 1KPUA 5D1QB 5TE4H 1B6UA 4ZNEE 4JFQA 3C2SA 4PTTB 2CK2A 3MV7A 1FG2A 1RIHL 1AD0A 2OL3L 1WLHA 5FUCE 3FN3A 1OTTD 2Z0BA 1SJHB 2LU7A 1EUUA 1U8OA 3L3GB 4Y4KA 4ZO6A 1AD9B 4HK0B 1EFQA 1J0YA 4PJCE 1Q1JH 3DX8B 4D3CH 4PJ8A 5IQ7L 1MQKH 1SEQL 3QJHB 1S7TB 3L5IA 5I1JL 4JJHA 1CQYA 1IKFL 3RWJB 3B2UC 3S3JA 1R3LB 2HT4C 3IU3B 4MXVF 4KKBC 5T3XL 1NDGA 2NTFB 4JDZB 1UADC 5TF1L 1RAMA 3KDMB 1C5DA 5IJKA 4PD4K 1GOGA 4N90D 3C09B 4RFOH 2HFGH 3BDYL 3REVA 5EORH 1X44A 3KNBA 4CU7A 4JO2H 5C9JB 1P7QD 1FYHB 1DQQA 5BXFB 1SMOA 1QVOB 4DW2L 1JFQH 2XQYK 4J8RB 1OVZA 4HWNA 4DTGH 1UWXH 4OIBA 4X4XA 2MHAB 2ZUWA 1F4XH 2IADA 1UQSB 3GK8H 5C70A 2RAMA 2DMCA 4Y16B 1A0QL 2DQEH 3QIUC 4LKCA 5D7LB 4X7EC 3QEHA 3DRQA 4IDLA 4ZQKA 3EO9H 3U36A 1QLEL 5D1ZB 3BRFA 4HIXL 5GS1B 3TZVB 4FZEH 5LBSL 4EQ2A 5C08E 4DZ8B 2UV3A 3VFMA 4C56A 3NZHH 3VCLA 2Q6WB 3D18A 3CC5A 4ZFGH 1UXWB 1R3HA 2FJGA 3X17A 3PQYE 2L0DA 3AREB 2W9DL 5DD5H 3UJJH 3K74B 1RZFL 2YA1A 5GGRB 4OCXL 4LU5L 1CD8A 2W0FA 4WEMB 3L3GA 2NXYB 4HK0A 5BS0A 3MQIA 1PKOA 2CRIA 3MLYL 3DX8A 1KXVC 1YEJH 3KPRB 3D48R 3A67L 5HHVH 4JB9L 3DMMC 4BSVB 1S7TA 1V3KA 1U0QA 4M5YL 1RZGB 5L2JB 3O3DB 3SCMB 5BOPA 3RWJA 4MNHB 1QQDB 4PRDB 5DXWA 1E4XL 1AIFB 1BMGA 1EMTL 1R3LA 3IU3A 4YWGH 2VLME 1I8MB 3NIGF 2Q86B 4OD3L 2FZ3B 4N0FA 5GGTL 3RY6C 4HDIA 3VG9B 4LMQI 3KDMA 3MLWH 5BO1L 4FABL 4BKLB 4XPGL 4DN3H 1F4YL 1T7VA 3QIWC 3HNTH 4BQBA 3QDME 4KK5D 1LO2H 1CF8H 5DWUL 5E8OB 5F7WC 4G80B 2DF3A 1ZMYA 5C9JA 5C08D 4H5SA 1A22B 1OCWL 4J8RA 4IM8A 4QRPA 1QRKA 4JFOA 4JZOB 3KPPB 2DQIH 4NNYB 3FL7A 1YMHB 1ZLUK 2WM0A 1EGJL 1TNMA 3PQYD 3RAJL 1UQSA 1AP2B 3V6ZB 2QV2A 4JQXA 4HXBL 5FV2A 2X4RB 3U0TB 3NCYP 3OAZK 4P9HL 5I73C 4PJ7E 3C9NB 4AEHH 3DYOA 2EEBA 3LKNB 4MLIA 2AEPH 4PJGE 3QDJE 3RZCA 3E6FB 1ZOXA 1RSFA 4P2QA 1JZ8A 2XTJB 1U3JA 3ZHKA 1CXIA 1V05A 5FYJE 4CVWA 4X98B 4JVUA 5CLWA 2JCCF 4JY5H 4KJQD 3TT3H 2VLMD 3VGDA 4LF3B 3IJYB 3RWIB 2YRLA 5TPWH 2PXYA 4OLZL 3CU1A 1DBKL 5T1MA 3CSGA 2OL3B 3V5HB 1OP5H 4YUEH 3KPRA 3RX5A 1CD1B 2EDDA 3BIBX 4LL9A 4XHJD 4F7PB 1J86A 2UYLB 1T1YB 2GITA 4HPYH 3ZYIA 3BI9X 3P0YH 1RZGA 1LWRA 5I76A 4Z7UB 3O3DA 3R1GL 4X7TB 1AFVH 3UBXI 2O5ZH 1QQDA 1I4FA 3VFTB 1PG7X 2OP4H 3QDMD 5KSAD 5J12B 1X4ZA 1MFBH 4APQC 2YWYA 1BFTA 2FD6L 2Q86A 2FZ3A 1LO5B 2R56L 4QRTB 1X5IA 4JHBA 4I18B 1GOHA 2GTWA 3V7AG 4LSRH 4Q9RH 3OG6B 1ZTXL 4L1DA 3SQOH 1UG9A 2MMXA 3MODH 2JCCA 4FXGB 4TUJB 2ZCLL 5IJVA 5IB4A 3ESVF 3ULVH 4KVCL 4JPKH 2HTKD 4FNLH 4BQ6A 3BE1H 1NAML 5D7IE 3BZDA 4JZOA 3KPPA 4JPWL 5IMOB 1R3JB 5EUOF 4NNYA 3ZT7A 1GRWA 5LGKA 1A8JH 3V6ZA 4DZBB 3U0TA 5FYJD 2LV4A 5DFVC 2Y36L 3AS0A 3P77A 3ROOA 4OCSH 4MAUH 3C9NA 4FQJH 4JM2C 4LNVA 3WFHA 1OSZA 3BP6B 1GGBL 3LKNA 3RA7H 4KK8C 4I0PB 1P6AB 3ECBA 3O4LD 5CZVL 3F8UB 4I2XB 1Z2KA 3UYRL 3O4OB 1A3LL 2VSDA 3ROLB 3LZFL 4KUCF 1WBZA 5DRZB 4OCMC 3FHQA 4X98A 2FECL 2J8UF 2PO6C 3KPQB 3KYOB 5GGSB 4WO4B 1ADQH 4MS8D 3GMOA 4RAVA 3ZLQC 3IJYA 3RWIA 4FQ2L 1F02I 1QR1A 3I2CH 2LAGB 4LRNH 4GMTH 1R5IA 4ZNCD 2E8ZA 3CX2A 1H3XA 1IMHC 5EUOA 2OL3A 3V5HA 3MLUH 4QXWA 1D3CA 4LHUG 5DO2D 1CD1A 1OGAE 4RMTA 1BFVL 2DDQH 2ZG1A 1I1AC 2UYLA 1OF2B 1T1YA 1DVFB 2DWDA 3QZWA 3LB6C 2EICA 4MMXC 5J8OA 4U3CA 3T77B 5FO7B 4LSVL 4EI5B 2PF6A 4Z7OF 3K81A 4KXZH 4YDLC 4IRJC 2HLAB 4YBLC 4HC1L 3RY5A 4XBPB 1ONQA 1LO5A 3MX0A 3QA3B 4QRTA 3RPKA 5F1IB 1JF6A 3H9SA 3LKSB 2FO1A 4I18A 1J8HB 1HOCB 4PP2A 1GAFL 1U8KB 4JM4L 1A6AA 3CFDB 1LP9F 4HH9B 5F7YC 4U6TA 4FXGA 3S35L 2AI0H 1RU9L 2EDXA 2PR4H 4JRWA 4LARL 1UH3A 2JIXB 1F6LL 5A3IC 3ARWA 4Y2DC 4P9MH 1FL6B 4Z95H 3T0EB 2FR4B 4G8GE 1OAXH 1BEYH 4PREB 5C09A 4RMRA 2MFNA 1MLCB 2A9NL 5EBWA 5IMOA 3O6FB 1R3JA 3HZVB 1UEMA 3W11C 3H7LA 5SWSA 1S8DB 1OAYL 3LRGA 1G9ML 3GBNL 1FQ9C 4IOFD 1I8IA 1H3PH 1X4XA 5INCA 5C0JA 1PG7H 2JJVA 3JBG7 1ZEAL 2P8PA 5TFSH 5D1XA 3UYOD 1T83C 4Y4FB 1MFEL 4I0PA 4NQEB 1OGAD 1LP9A 2EDFA 4I2XA 1I7UB 3P4LA 3CCHA 2RCSH 3ROLA 5DT1L 3KPQA 3IS1X 4ONFL 3WO3B 3CLFL 4PJEF 3CX5K 5GRYA 3NFPA 5HYSG 3TN0D 2AGJL 1MFAH 4MXQC 5FUOL 4YK4C 1MJ7L 3T4YB 1OF2A 1WQVT 1DVFA 2W91A 3VD3A 3SDYH 4V2CB 5CEZH 3CVHH 3W9DB 2YPVH 4CADA 4S10A 4XCYB 5FO7A 1IGTA 4JFDD 2D7QA 4LSDA 3G6JF 4XBPA 1DFBL 4G8GD 5F1IA 1AGEA 2PO6A 3LKSA 1J8HA 2UWEE 2L7JA 1HOCA 5I1DB 1WFUA 1B9ZA 3EFFA 1XF4B 2ZKHH 4NO0A 5DHVH 2NY5L 4PJEA 1KN4L 2QADD 5CIPB 4YZFE 5ESVA 3IDJB 1ZHNB 3T0EA 4WIQA 5JMRA 4PREA 5I1HL 4YGVA 3A6OA 5J1SC 4P57B 3O6FA 3LEYL 4IRJA 4M3KB 1S8DA 2X9WA 3QRGH 3CD4A 2NY1B 5EOQH 5DJDB 1NAMB 3WCYA 4PJBB 4JHZA 3V0WH 4K94L 4AK1A 3G6JA 1DN0B 4N8CH 1T1ZB 5CSZA 4TUOB 4WW2C 1EGJA 1NFDF 3VXUB 1J18A 3KR3H 1IE5A 3K80A 3F65A 1NMAH 3HMWL 3KXFA 1N7MH 3LMJL 2CK0L 3ARQA 4NQEA 1T21A 2AJSH 5BRZB 2B1AH 4Y2DA 1TZHB 3T4AB 1I7UA 5D5ME 3DX6A 2ZCKL 4HIIB 3VXNB 3RGVC 4XVTL 3O2VL 2P24B 4TPRL 4B53A 5C0GB 2RQ8A 1I1FB 4K7PX 5F9DC 4X7CC 3RX7A 1CXLA 3NAAL 3C6LA 3TH3T 1TQBC 3WNKA 2VXVL 3VWJC 3W39B 1T7YA 2OS7A 2X1OA 2P5WE 4OTXL 2DLTA 3RGHA 4XNYL 3W9DA 4XP4L 4LAJH 1A3QA 3DV4B 3MRNA 4BK4A 1NFDA 2YKLL 4PJBF 3WXVL 1NGPH 4LVNB 4WWKB 6FABL 3T3PF 4MB5A 2CXGA 3KLAB 2A77H 3KLSA 4LSUL 4TVPE 5IB1B 3GI8L 2BXZA 1LEKB 1JPTH 4ZAKD 1UYWH 2W9EH 3B43A 4XPTH 2X9YA 4OZ4B 1NCWH 1OOAA 3TCLB 3DVIA 3IDJA 1HKFA 3MR9A 4TSCH 2IH1B 2VZ1A 5K93A 2IMMA 3MOBH 1B90A 1UZ8B 3BH9A 5C6TL 2Q7YB 1EEYA 4P2OD 1CXKA 2EE2A 2AJVL 4LOUD 5GRZA 3MRCA 4WW2F 1KIRB 5DJDA 4GKOA 1NAMA 5K33A 4PJBA 4TNWK 3RVUD 3SGEI 4ZS7L 5FO9A 1YYML 1ZLUH 1DN0A 2D0FA 3GSWA 4TUOA 2JE8A 1S7XA 5HD8C 3VFNA 3VXUA 5LWYL 1L9NA 4XMKH 1H0DB 3DGGB 1NCDH 4WDIB 1N59B 1NJ9B 2BNQA 3TH4T 1U3ZA 2EXWC 3MROA 1J0IA 3OR7A 3QUYD 3I50L 4OT1H 3HUJB 1DBAL 4HWUA 3ARXA 1KJ3L 3BKCH 1T3FB 2DM2A 1N8ZB 2ADGA 5BRZA 1TZHA 2P5WD 3T4AA 3BQUD 4N0CC 5DQJA 4HIIA 3VXNA 2MQ0A 5C0CB 4WWID 2OK0L 4RAHA 2VR9A 2ATPB 3OKKA 5KG9B 1NCBH 3W2DH 5E08L 3QUZC 1DBMH 2ESVD 4R8WL 4HFUH 3N9GL 3TVMC 2VQ1B 1KJ2A 3L7EB 4NQVB 5B4MC 3W5NA 1FLRL 5EA0H 1P4LA 2QQKH 1CD0A 1SM3H 5JOPE 1JNLH 3VGGA 2EZ0C 5EU6B 3MACH 2ILLA 4P5KB 5JHLL 2P48B 1RZ7H 1AXTL 1KEML 3DV4A 4XC3L 5FYLL 2HLFD 4KTDH 3EDFA 4BH8B 2NY3B 4RCAA 4L3EE 1P9MC 2IALA 1IC5H 1QNZL 4GQ9L 3DUHA 2ZPKH 2HN7B 3L1OL 4JFPB 1FFQA 4N8VB 4WJ5B 1I7TB 1T1WB 3UZQA 5ADOL 1LEKA 4WY7H 3T1FA 3U7YL 4BYHA 4HC1A 5FO8A 4NJ9L 3O2DH 4OZ4A 3NN8B 1WBYB 3TCLA 2BXYA 4KY1L 1EVTC 3O9WC 5GRWA 2E7MA 4TN9A 3NBNA 2WZPD 3RIFF 4K7PH 5I8CB 2HKHL 1UZ8A 3DHJA 2H26B 1JHKL 4J6RL 2Q7YA 2X4UB 3SE8L 5ID0A 4NGHL 32C2B 1CLOH 1KIRA 2MQ3A 5D7SL 4PJDF 2D7MA 1EZVY 3N1QC 3IVKA 1J1OL 4NZJA 3ARBD 3WIHL 2AXFA 2R2EB 1H0DA 3OB0H 5IWLC 1NJ9A 3F12B 5GGVL 3IDNB 1OPGH 4GXVL 1CGWA 1F4WL 1DQLH 3QG7H 2AQ2A 4PRBA 3UROR 3T0BA 5DD0H 2F15A 4QHMB 4NHUA 5L9DL 1MCIA 5DDHB 1BLNB 4FTVB 4KROC 1JJUA 3CMOL 3VXME 1DANT 2DQJL 3LD8C 5KG9A 1OAUH 5IM7B 1HI6B 3IFNL 4DVBB 1QFUH 4D9RE 2DJSA 1EIBA 1T0PB 5CINH 3GBLA 3ARFA 5D70H 5BVJB 1FFPB 5KOVC 4LBEB 5DEZA 5EU6A 5ICZB 1BGXL 3WLWC 4PJDA 4K3EL 5TE4L 2EYRA 5J1TC 3IAPA 2QQQA 2HN7A 4JFPA 1VDGA 5I30H 4N8VA 4YE4L 1U2CA 1I7TA 3RUGF 1T1WA 5EULV 3WFCL 1Q1JL 1RV6X 3EYQC 4GRLD 2HYMA 4Z5RA 3RWHB 3ZDYF 1XGPB 1MQKL 1PLGH 2VITA 2WWKO 4I0KA 1QRNB 2Q87A 1N0LA 5FIEA 3NN8A 4U2YA 4L4TA 1WBYA 3ARZA 3MRPA 3WNNA 3QDAA 1EZVX 4NQDE 2AVGA 4XWOC 4MA3B 1A7QH 3HE6C 1ULVA 3BHBB 4PV8A 5KS9F 2BVQA 3BAEH 2NZIA 2OR7A 5CBEB 1F45A 2WIIB 3MBEB 3G5XB 4Q97A 1P4BH 1A1OB 1FZMB 1MWAH 4P46D 3S5LG 3EDDA 3ZL4L 2XICA 3SDCC 3FMGH 4FQHB 4O58H 1P5VA 2MPAH 4P5MB 3LDBC 3EFDH 1LGVA 5BQ7B 3VXMD 3QEQD 5L8LB 4RFOL 2GJ6E 2ZSVA 3ZKQD 2HFGL 1UCTA 5EORL 2R2EA 3OXRA 4HKXB 4PJ5B 4D9RD 2F5BH 2VDRH 3IDNA 3RUGA 4E41E 1YEEL 3DHMA 5E9DA 3LRHA 5ESAA 3VI3F 1CI5A 1CWVA 2B2XH 4EKXA 5DDHA 1H15B 5GRVL 5FK9A 1T7WA 1C7SA 3GK8L 1T04A 4OZGB 1M7XA 2ORBH 5AYUH 2DQEL 5IM7A 1HI6A 4FN0A 5KS9A 2C1OB 4V1DA 2IQ9H 2GSIA 4Y19D 5BVJA 1FFPA 2E8YA 3NZHL 4BQ8A 4EN3B 4LBEA 3BGFC 4M7ZC 4ZFGL 5DJ6B 4OUUB 3QUXC 4U1LB 3BFOA 2MCG1 3GMMA 3ZYJA 3TPKA 4DGIL 2WBJC 5DD5L 3U2SB 4LPWA 4F57H 3CDGB 1AC0A 2EDYA 4UIKH 3VFPB 1HILA 4NQDD 5D6DA 4JDVA 4X6DB 2EDQA 2PCPB 4CJ0A 4MXWH 2NNAB 1ZLSL 5LGJA 1MCOH 5IHUH 4Q7DA 1XGYL 5IEKA 3RWHA 3WHXA 1YEJL 5IF0B 4Z6AT 5HHVL 3KYMB 3U79A 2JJUA 1LE5B 4NO2A 3B9KC 1BD2B 1B0RB 3MV8A 3NMEA 2L4OA 2EDJA 1CL7H 4NM8L 1DTUA 5IBTL 2GJ6D 3SKOA 3VFRA 5DD3H 4YWGL 1MHHB 2QEJA 3GIZL 4PJIF 2A83A 3QPXH 4E41D 2IPTH 2GAZB 5C6WH 5JHDB 3QCTH 1X5ZA 3JWOC 1ODAA 5CBEA 3JSSA 3BYYA 5IHLB 1FZMA 4AIZB 1UEYA 3AU1A 3G6AB 3MJ7B 3B6SB 4FQHA 1FH5H 4FHBD 5BQ7A 4DN3L 3MNWB 4DUWA 3HNTL 4M8QB 1LO2L 5FKPB 4HKXA 5KZCD 2EDRA 1ZV5A 2QSCH 2EDTA 1MCNA 5ISZE 2RHEA 4MJIB 4R90H 1Y18A 2EDHA 3VXSE 2JJSA 2YPLE 2DQIL 4ZFZB 5HYJB 1KLUB 4ONHB 1I9JL 4OZGA 1UJ3B 4P4KB 4P2RE 4JR9H 3VE0B 3GIVA 4CU8A 4JGUA 2VAAB 5C0DA 2NLJB 1IJ9A 5AYQA 4EXPX 5HGHB 1JTTA 4AEHL 4V2BA 4XAKD 1GGIH 1IAOB 3G04B 1W72H 4PG2C 2AEPL 5DJ6A 2K7QA 2GJZB 1G7PB 1IBGL 2Z31A 1RVFH 4F15B 4KKCD 5DMYA 3BIAX 1AHWA 4IMLA 3T8XA 3TO4C 2A74B 4O02H 3VFPA 4DKDC 3VXRB 2NY2B 4NWUL 4P5TB 3TT3L 4UUJB 4X4ZA 1KULA 1OTUD 4X6DA 4JE4B 1P69B 2DYPB 2PCPA 5B21A 2EDKA 5EBGA 5TPWL 1A5FH 4POYA 4LPYA 3N85L 2WLZA 4GO6B 4YUEL 3GZKA 1CICC 2ENYA 1KEGH 1LE5A 3PE9A 1LHZA 1AR1D 1ZSDA 1ZLVK 3P0YL 2F54E 5F9JB 1D6VH 1AFVL 2XG5A 4IS6B 2Q8BH 4GBXC 2O5ZL 4ODXB 3ISWA 3WFDH 2FHFA 4ZUSB 2BSRB 1MHHA 3KLDA 4QHNA 5L6YH 4YXKL 4XB7A 3LN4B 1JGVH 1YUHA 2GAZA 3QI9B 3R0MA 1GIGH 2VMFA 2EDNA 5IB3A 5ISZD 1FC2D 4LSRL 4Q9RL 3MJ7A 5E0QA 2ICWI 3B6SA 5ESQB 4E9LA 3SQOL 4JN1H 5CSGA 1QSFE 2D03H 3MODL 4TVPH 4M8QA 2HRPH 4NKMB 2XTLA 4QWWD 4DK6A 3ULVL 3K2MC 4PRIE 4PY7B 2EDWA 4JPKL 2F8OA 2R9HC 5KOMC 4XNZC 3SE9H 2XG4A 3LS4H 4FNLL 4KV5F 2HJFB 3OJMB 4MJIA 3WIHA 5E6IC 3KS0J 3BSZL 4ZFZA 1V8HA 5HYJA 1KLUA 4OFDA 4WTWA 1UKTA 3I6GB 3MRFB 1Q94A 1UJ3A 3HC3H 4KGJA 5GRJH 1PQZA 4RA0C 4CVUA 5ITBH 2NLJA 2X89D 2H8PB 2YA0A 2OQJB 4OCSL 1QBLH 4MAUL 5HGHA 4FQJL 2COQA 4P3DB 2XRAH 3G04A 1BVLA 3VRJA 1K2DB 4NRYB 3RA7L 4NQUA 5D1QC 1MH5B 3FQWB 2PYEE 4MCZB 1G7PA 1JPGB 1A9EA 5AUMA 4ZSOA 1GGYA 3VXRA 5CGMA 3EYVB 3K4ZA 1WT5A 5DYOA 4M8VA 4NQTA 3C5ZD 5GQBA 1LEIB 3I2CL 3W0WB 4BSJA 4LRNL 4GMTL 5SV4A 3QNYA 2ID5A 3BEVA 1MNUH 1AKJA 1RHFA 3QQ9D 2VJXA 3KJ4B 2EEAA 3MLUL 1CE1H 2DDQL 3V4UH 5FCUH 1MLBB 4QXTB 3U0WH 1QSFD 2IWGA 2DQGL 1RZJH 5F9JA 3MO1B 1ZANH 4IS6A 3ES6B 4ZUUB 4KC3B 5CGYD 1WWCA 1LDPH 3SGJA 4ZUSA 3SOBH 1C8PA 1ZT4B 4MQXC 4PJHE 3FFDB 3LN4A 3RVTD 3QI9A 3J7HA 4DEPB 4OZFG 2QSTA 2P8MA 3GSOB 4KKNA 4HWEH 5BZWB 1NGXB 3C8KA 1N3NA 3L3HB 5C0BE 2BOCA 4WHYH 3AY4A 5ESQA 5JW4M 1FZJB 1VADB 1NCCL 3SE3C 1NPUA 3G5YB 1ITBB 5GS0C 2AI0L 5BV7C 4M48L 1FAIH 2PR4L 3EHBC 2X70A 3SJVE 3NIFE 4LHQB 1KB9J 4XNUL 4PY7A 2D7OA 1T0NB 4X5XA 2OR9H 3B8YA 1GYAA 1OAXL 4EUPB 2HJFA 5GGUA 3RDTB 4UIMA 4QKXB 1TJIH 4GG6F 2PYED 3O2WL 1CDCA 3QDGB 1QUNA 4YPJA 3Q48A 3K7UA 5D1ZC 1F3JB 2ARJB 4M61A 5GS1C 1ZA6B 1HK6A 3TZVC 1TCMA 2BOBA 3UBXB 2DD8H 2FATH 3TO2A 1YPZE 3IRZA 1PG7L 2B4CC 4MYWB 1CXHA 4ERSH 2A9MH 4PJFB 4Z76B 5TFSL 2IAMD 1CR9L 3AREC 3FO9B 4PP1D 3U0PB 4I1NB 2HA1A 2EYTA 4G7VH 4MCZA 3G6DH 3B4NA 1RK1B 4J3VA 3WIIH 4NUGH 4ODWA 2RCSL 3GNMH 1C5CH 3U4EB 2NXYC 3EYVA 2JJWA 3BN9C 1T66C 2E6JA 4KJPC 5JXEA 2VDPH 5KVFL 2ZOKA 5DQ9A 4GG6A 1J0JA 1MFAL 3GSRA 4DFHA 3LKQB 4ZOAA 3SCMC 4OQTH 4RGNC 4QXTA 2P5EE 2J12B 3MO1A 4M6ML 5CEZL 1YECH 4PRHA 4ZUUA 1T5XA 1YC8A 4M62H 1MCDA 4JFEB 1ZT4A 1OTSD 3RWGB 2C5DC 4L3CA 5DHYA 3SJVD 3FFDA 5J57B 4OF3A 4UDTA 4F3FB 1UH2A 4KZEH 1CDYA 4NRXB 4X6FB 1QOKA 3GSOA 1FG9C 3LCYA 4PJFF 1NGXA 1I7RA 2OCFD 3L3HA 2G9HB 2CLVB 1FZJA 4JFFE 3RTQB 5L2KB 1IT9L 2ZKHL 3MJ8A 1VSCA 1WWBX 3O41B 4CVZB 2UZIH 4JN2B 5E2VH 1QKZL 3IGAA 2MKWA 3FN0H 5J6HA 3V5KA 3WFBH 1A6PA 1T0NA 3MRJB 4OSUH 4O51A 4NSKB 2IG2H 3QXAB 3RDTA 1FJ1B 1DSFL 1J0HA 3ZE2F 2SEBA 4I13B 4KVNH 5AZ2L 3DSFH 2O5XL 3I02B 1F3JA 2ARJA 4QOKE 4LPUA 2G5RA 1JRHI 3UBXA 4LLVB 3VD7A 4N8CL 3K0WA 3IFPA 5I1IH 5SX5H 3MV7E 1UKSA 3SHSA 3P11L 4PJFA 2Q7NA 4Z76A 1NMAL 4ZUTA 4U1KA 5AD0A 2JB6B 2EO9A 2XTJC 3VD4A 3B9VA 1S7RA 3F7QA 3SGDI 2GT9A 2P5ED 4NKIH 4ZXBC 2QHLA 4PGEB 5J6GB 5HHQB 4L8BB 3GJEA 4F9LA 2CQVA 3AB0B 4OCWH 1AGBB 2R29H 2CJUH 1SEBB 3BXNA 5I1KH 1KG0A 4R3SB 1GGCH 3T0WA 3F6LA 3TBVB 3LKQA 1R5VB 3FRPG 3HZKB 5CZKA 2BSSB 2P49B 4JFFD 5J12C 1AJ7H 4S0SD 1HNFA 1NDMA 1KIQA 2NYYD 5CBAB 4JFEA 3WIFB 5HBBA 3BIKB 3RWGA 5IMMB 1KENH 4IRZL 8CGTA 2LE9A 2H45A 2CRYA 1OGTB 2BHYA 4HF5H 1NGPL 2PKDA 4P0DA 2ADJA 2PW1B 4F37F 4X6FA 1AY1L 2A77L 2IBBA 1QZ1A 1XF3B 4MZ3A 2G9HA 1JGUL 1XAUA 1JPTL 2HFFA 4BM7A 3VDCA 2R2HA 2W9EL 3S96B 4RMVA 1MFDL 2HT3D 3O41A 4QOKD 1NCWL 2AKRA 2WIMA 4U1NA 1E4WH 4MNGB 4JN2A 4Z0XB 4MXVE 1TETH 2VLKB 3GSXB 3MRJA 3MV7D 2DQUH 3S7GA 2GHWB 3QXAA 1OAQH 5DZNA 2YOCA 2W0LA 4Y4KD 3WDJA 1XMWA 1UVQB 2Q20A 3HI6L 3RVVC 4Z77B 4C56E 4U6VL 5FAAA 1JN6A 2ICCA 4PJ8D 3FO0H 4YEEA 4KJYB 4HQQH 5HJ3A 5TE6H 4LLVA 5IKCA 3KPOB 2BY3A 4XMKL 4Q9BA 3MLTB 3IU4L 2JB6A 5CS7A 3O4OC 4JY6A 1VFMA 3BKCL 3B5TA 4X4MA 5BS0E 1A64A 4NFBA 4U1HA 5C3LD 1H8NA 1PG7W 4WO4C 3KPSA 3M07A 3NFNB 3G9AB 1U91B 3K4DA 1NCBL 2BP3A 3T0VA 3W2DL 1EEZB 5GJSH 3QUKA 3PWVA 1AGBA 1DBML 1G7LB 3QUMB 1TXKA 2QJDA 4R3SA 4HFUL 4HW6A 4TVSa 3P2TA 4OD2A 1JNHB 1D5MB 3TBVA 1ADQA 1NGQH 5EA0L 2QQKL 3QWQB 1SM3L 3PWLA 1JNLL 3MACL 2BSSA 1A3RH 4KK9C 5IVXB 1Q9WB 1ROWA 1RZ7L 3G5ZB 4EI5C 2JLLA 5IMMA 4F9PA 3BIKA 2VZTA 3PGFH 1ZLVH 3M17B 4Y5XB 3ULUH 3T2QA 1OGTA 1WUNT 1IC5L 1D5BA 3MCKB 3P4OB 1KELH 1VEPA 2PW1A 1ZK9A 5C2UB 2ADIA 2ZPKL 5I8KH 3S36X 4HGWB 3FHAA 3MA7B 5DEFB 3V4VH 2DIAA 3CSBA 2FGZA 5I0DA 4WY7L 3TBWB 3UZEA 4C56D 2GY5A 2BVOB 4QRPE 2XQBH 1WITA 2Z8VC 3S96A 1NL0H 4UNUA 3O2DL 1L9MA 4JHAH 4ZUWB 1YQVL 5D93C 4MNGA 1Y6KR 3CFKB 4Z0XA 4PV9B 2CXKA 2VLKA 1FFOB 1TCRA 4K7PL 4PJCB 3NIGE 5JOFB 1ZS8B 3WO4C 5HVGB 3HTLX 2Y6SC 5L8JB 4UU9B 5ACZA 1UVQA 1ACZA 1NBVH 2OTWB 2RR3A 1AO7B 5BS0D 5GRXG 4P48A 1BFOA 2X1PA 4MMZC 3DXAB 2DBLH 4KJYA 3X3GH 4I9WE 4P2QE 4Y4FC 3E2HB 2AXHA 5ICYB 3CFBB 5AWNH 2HP4A 4OLUH 3IJSB 3MLTA 1OPGL 2H3NB 5T5FH 4LLQB 3LHPL 1DQLL 4FQXC 3QG7L 1TVHA 4NN7B 2I60H 3WDHA 4K71C 1DE4A 4JO4L 4QRSB 5DD0L 5F93C 4NDMB 5B38G 3EYOB 3UTQA 3KPRE 3BPLB 3NFNA 5JZ7C 5DJCA 3O6KH 1U91A 1OAUL 3HS0B 1EEZA 1QFUL 1G7LA 5CP7B 3CUPA 4ZYKB 1KJMA 1R3KB 3WN5B 2WP3O 2C1PA 2GTZB 4YPGA 3L5WB 5D70L 1LNUB 3EYSH 1H3TA 4X83A 5JDSB 4J23A 1YNTB 1BX2A 3HNSH 5EWIH 1HHKA 5MEPA 1Q9WA 4TTDD 4QRPD 2FRGP 4ODHH 3I6KA 2NQCA 2X4QB 4LCCA 3M17A 4Y5XA 2JCCE 5C08B 3CVHA 4M7KH 3UO1H 3NVQA 3MA7A 1CDJA 1PBYA 4LPVA 3MLZH 4QNPF 1OLLA 1WSST 1I3VA 4ETQA 3QIBB 3TBWA 3RNKB 4HAFA 3KHQA 5T3ZH 2FL5B 4K3JL 4ZUWA 3H3PH 3RZCD 3EO0B 4P2QD 3QXVA 4HIEB 1LD9A 2WWKT 1FFOA 4GLRH 2XXCB 2XZAH 1A7QL 4MWFB 4OCRH 5DHVA 4H0GA 5GPRA 5JOFA 3DYPA 5CD5D 1EO5A 4ALAH 3BAEL 4KPHH 4UU9A 5TDOB 2NY1C 2PXYD 2OTWA 4HJ0C 4WUUB 1AO7A 3GSUB 1MWAL 3TBYA 1T2XA 4BZ2H 5DRNB 1DL7H 3DXAA 3KPRD 2R4RH 3FMGL 1RURL 4O58L 3VWKA 1Q9OB 2MPAL 3EFDL 4F2MB 4M6OH 3MOAH 3QHTC 2ZOLA 1YEKL 3O3UN 1ZVSB 1VB9A 2VDRL 4X6CF 4DGYH 2CDFB 2Z91B 2H3NA 4LLQA 1YQ2A 4LEXH 4UQ2B 2WUBL 3OKEA 4QRSA 3S36H 3MV9A 5HSFA 2B2XL 5EUOE 4MD5A 4C57C 1FLTX 2HTLC 1NBZA 1A4JA 1MCWM 3F7VA 3T04D 3HS0A 1IGYB 4E5XB 4PR5A 5BJTB 1IAMA 2G60H 5DJAB 4D2NA 3RP1A 3WN5A 2V2WB 5TQ2H 1NCNA 3P9LA 1WWWX 2VZSA 3NTCL 3H9SE 4FFWC 2MOVA 3LVEA 4JFXB 2B8OT 4WWKC 5T3XE 3RI5F 2X4QA 1BECA 1OB1B 3INUH 2J8UE 3JWDH 3GMNA 5IOPA 3MLPA 3IKKA 3H9HB 1BQHG 2FLBT 4BUHA 2VDLH 4MXWL 4PJGB 1MFNA 1JI2A 5IHUL 3EYFA 1Y0LB 2R15A 3QDJB 5F88A 3NCYS 3QIBA 5C09E 3EOBB 2FB4H 4N0YH 5SWSE 4H88H 4I77H 1AE6H 2APFA 5DD3L 3FO1B 4Z7OE 4MWFA 2VLLB 3QPXL 1WV7T 2IPTL 3Q5TA 4PGBB 4WUUA 4HS3B 1T0MA 3U9PH 4R2GD 3LRSB 1LP9E 2HJLA 1Q9OA 4QTIH 4F2MA 1G9MC 4XP9L 1UJTA 1X3DA 4N0UB 2X4NB 1PSKL 1ZVSA 2A0LC 5EDXA 1I3RA 5SWZB 2QSCL 2UUDK 1A6ZA 4UQ2A 4OIAA 1A6UH 4R90L 3TPUB 3IF1B 3Q6FB 2AV7B 5D2NB 4OLWL 3BP7B 2BDNH 2NW2B 3H9SD 3TJEH 4N9OB 1P1ZA 2DI7A 4DJMA 2EH7H 4RNRB 3P0VH 4KUCD 5T3XD 4WV1B 5HGAB 4E5XA 4UT9L 3MPCA 1IGCH 2VLJA 1OW0A 4JR9L 1PW3A 2V2WA 5D7IB 1JYXA 1UACL 1GGIL 3O8XC 1I85A 1W72L 2EIZB 4LP4A 1YA5A 3TWCL 5J1AA 1JPSH 5C09D 1J5OH 2ADFH 2NY3C 1J8HE 1FYTB 5D7JA 4JFXA 1RVFL 4X9GA 1AI1H 3S8WA 2ICES 5SWSD 3TFKC 1ES0B 5M94B 4PJEE 4LIQH 1DZBA 4M7JH 4BA8A 3H9HA 4A6YH 3HN3A 4BJLA 4PJGA 4PUBH 2XI9A 3MNZB 4WU5B 5HYQB 1A5FL 1W2KT 3QDJA 3T0EE 5CMAB 1KJVA 1UWEH 5D1XD 5KVGH 1EJ6A 4UQ3B 4I0PD 1L7IH 4OLEA 1WGOA 1CBVH 1JK8B 1D6VL 2Q8BL 3CZFB 3LQZB 3WFDL 1ORQB 4ZD3H 4IOSD 4NN5C 3WNOA 3U4BH 1XIWB 3O0RH 3FO1A 1UB5B 4XCEB 2KZ1B 5L6YL 3O2DA 2X7LB 3G6JE 1JGVL 3OG4B 1OGAB 4GW4B 4PGBA 4MQ7B 5GSRB 1GIGL 1CVRA 4HS3A 4KU1A 3KXFE 4RGMB 2J88L 1G7HB 4TVPL 1DVFD 2VXQL 2DQHL 4GG8B 2XA8H 1MWAB 1XGRB 1EERB 2HRPL 4HGKC 4N0UA 3FZUC 4I48A 4GAGH 3TN0B 2X4NA 3BPNC 4FXKA 1W0WB 3CDCA 3CSYA 2OZ4H 4F7TB 1ED3B 5SWZA 3CSPA 4ACPA 3SE9L 5FHAH 3LS4L 4MZ2A 3TPUA 3SKNA 4WHCA 5D2NA 5SV3A 2WBWB 2PO6D 3OXSB 2NW2A 3HZMB 1J8HD 2HG5B 5DMKB 5IW1B 4PD4J 5JQHC 4RNRA 2EXYC 4L4JA 3HC3L 3ALXA 1WZLA 5GRJL 2VDKL 4NO0D 4R4FH 5KW9H 4G8GB 3BUTA 1NFDE 4UV4H 1QBLL 5D7IA 4JCLA 1CGTA 2E5EA 5CJXC 2XRAL 2AERT 3H7BB 1U41A 1RK0A 5F96L 3T0ED 2WUCH 2X4SB 4P3CH 1EDQA 2P7TB 2YEZA 1FYTA 3KLHD 4IDJL 3O6FD 4G6JH 4IRJD 5CJ5A 1IM3A 3ZZ1A 3THMH 5FECA 5I18H 5H2BB 1NANH 2GJJA 3EAKA 2DKSA 3RBGA 1MAKA 3MNZA 4BFEA 4WHTA 4H26B 4F7MA 4HFWB 4LEOB 2WMPA 1CE1L 2X4PB 3KXFD 3V4UL 5FCUL 4K7FB 2EKJA 1S7WB 1HWHB 4NQED 5ERWB 4Z0BH 3RJQB 4YHPA 1RZJL 1ZANL 4F33A 4Y2DD 3CZFA 1CGSL 3HFMH 4NP4L 3VFVB 1G0DA 1XIWA 4MAYA 1MCLA 1UB5A 4PJBE 4XCEA 4TSBH 3WKNA 3MBEC 2F58H 4C4KO 1ZWIB 2X7LA 3QPQC 3IFLL 3FONA 5HI3D 1VFAB 5T1KB 3T3PE 3W11D 3E8UH 2Z92B 4MQ7A 5GSRA 3VXUE 1ZGLM 3SQBA 2WW8A 2LAAA 2BNQE 3C6LD 3S4SB 4HWEL 4X4YB 1SJEA 1FNGB 3QO1B 3PHQB 1P6FA 2AS5M 4IMKC 3FTGA 4CUCA 3FCTB 2MWCA 4Z8FH 1MWAA 3V8CA 2VQUA 4LSPL 2HMID 1U95B 2F74A 3ZYZA 1W0WA 1XFPA 1OP3H 2V7NA 1ED3A 4ORZC 1EHXA 2UWEB 3OKYA 3S37X 4E0RB 1G7JB 3FRUA 5KTEL 4ZO7A 3HC4H 4KH2A 5KVDH 1W8OA 4FFVC 3OXSA 3HZMA 1LQSR 5DMKA 5IW1A 1OWRM 1LEGA 4L8DB 1PD6A 2XXMB 3GB7A 4M4PA 5K9KB 4MXQD 2FATL 4EN3C 4R97C 3F7YB 1FIGH 1XF2A 2OI9B 2A9ML 3H7BA 1YNLH 5DFTA 4ZDHB 1MJ8H 4ZAKB 1IAII 1RZKL 5TGBB 2X4SA 4UB0H 4FMFA 3UYPA 5ICXB 4G7VL 2H1PH 2P7TA 3G6DL 3RWFA 1P7KB 4ZOEA 1TJGL 1CZ8L 3WIIL 3WUWB 3GNML 4S1SH 1C5CL 4G7YH 2Z8WC 2V9RA 3NZ8A 4UOW0 1MVUB 5H2BA 5IBLD 1EV2E 4OFKA 2VDPL 1DLHA 3CK0H 3QNZB 3UJIH 2EYSB 4O00A 5TE7L 3WDIA 1MRCH 5LG1A 2LABA 4H26A 4YHOH 5A16B 3VXUD 4LEOA 3KWWB 5FGBC 5D5MB 1U3HB 2BNQD 4CNIB 2Y25A 1S7WA 4OQTL 1BF2A 4DKEH 1JRHL 5BRZD 1YECL 4M43H 3VFVA 1C5BH 4M62L 5KANG 4JO1H 5C8JA 4OAWA 3QUYB 3RVXD 1CU4H 1F13A 1VFAA 3A6BH 5T1KA 5K59F 1KCUH 2Z92A 1Z5LB 2P5WB 5JMOC 3BQUB 3U7WH 5AZEH 4ZO9A 4X4YA 2IH3A 3TA3B 3EOAB 1T03H 1H3WM 4PGZA 5DJXB 3MMEA 4ONOA 1JYWA 2NY4D 2NY0D 3QO1A 3PHQA 4LRIA 3QFDA 5FYKU 3L3OB 1AQDB 3X12A 4M7LH 1XF5B 4NT6A 4KFZC 2ITCA 3FN0L 4AM0A 4M03A 4OSUL 2YD1A 4U1MA 3PDOA 2IG2L 2DM4A 4QHUA 4Y4HC 3WNLA 2CIIB 1XZ0B 5EOCH 2NZ9D 4P4KC 3P9MA 3SO3B 4KVNL 4U1GB 1II4E 4L8DA 3UZVB 3DSFL 3LKPB 5EU6E 5E5MA 1BOYA 3GSNH 4PJDE 1BOGA 2AW2A 5MEOB 4NCC1 5DHXB 2AP2A 2R23B 3BMVA 5KAQF 5I1IL 4IMKA 4ODSH 3RKPA 1U58B 4ZDHA 4YBHA 1R24A 3RIFK 4JRYA 2WV3A 3ZKXC 3EZJB 3MLVH 5DUMH 5ICXA 2ARJQ 5GHWL 1P7KA 1U8LA 4PS4H 4P5TC 4NKIL 4XI5D 5T33H 1W72A 2M1KA 5L0QB 1X4YA 2VTFA 1CE6B 4IEFB 4L8SB 3IAGC 4W6XB 4N5ED 1RI8A 2G75A 2YD5A 4JFZL 4L4TE 3QNZA 2UZYB 4NNXB 2EYSA 3ILPB 1NGZA 2R29L 4LLMA 2FCBA 2CJUL 5A16A 5I1KL 1GGCL 4RDQG 3KWWA 1PZ5B 1U3HA 2P4AB 2MQCA 2R1WB 4XP5H 1U8NB 3S37H 4WI8A 2Q76B 4TNVF 3PWUB 4RBPK 3ARRA 4O2EB 1FHGA 1QR4A 5DLMH 1XGUB 2VDOH 1AJ7L 5IT2H 2ATKA 3T65B 4JPVH 3KAAA 2BC4B 3Q5OA 3SO5A 2BMKA 1KENL 1QO3B 5MENB 3CIQA 2YZ1A 4X5WB 5EBLA 2DQFB 4KJWD 5BW7C 1IRAY 3CH1B 1Z5LA 2KKQA 1KT2A 2XNAB 5DVKA 1KN2H 2FEEI 4NO3B 1N5AB 3TA3A 3EOAA 1JPFB 3MRGA 3RUGE 3ZDYE 2ZUUA 3ARFD 4NCC2 5E9DE 2JJTC 3L3OA 2UY7A 2XFXB 3CDYA 5HYEA 1IARB 5EU6D 1CLYH 4L3EB 4QXUH 1YY9D 1IQDA 4H8WH 3VRLF 1TETL 5ALBH 2HRLA 5EU3B 5KS9E 1OAQL 1XZ0A 2H2PD 4YFLF 2FJHA 4V1DE 5MI0B 3VGAB 2UUDH 1J1PH 5SWQA 1AXSA 2BCKB 1MCWW 4QCIB 5M95B 2ZWLT 3AXLB 3NCBB 3VXTB 3FO0L 1HHHB 2ZUYA 5LKNA 4X0KB 3MSPA 2R23A 5TE6L 5CZXD 4L4TD 3QJFB 3VGFA 1JGEB 1TDQA 2ZSWB 2OXGA 1RZ8B 2EZ0D 5DF0A 1M4KA 4GRLB 4YDIL 4HIJA 1J05B 1ORSB 2BFVL 1NGWB 4W4OC 1VESA 3P0GB 1A6TB 2V2XB 3TESA 5F8QC 3VI3E 1EFXB 4QF1B 5EC2B 5I6XB 3GMPB 4L5FH 4L8SA 4DCQB 3TCXA 1KXQE 4LSTL 3TNNB 3MV8E 3NCJL 5LAXA 2IANA 1SVZA 2RFXB 5GJSL 1D9KA 3KJ4C 4NNXA 4MDJA 1WEJH 5E8NB 3F5WB