1LEGB

Crystal structure of h-2kb bound to the dev8 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of allogeneic and syngeneic T cell receptor-peptide-major histocompatibility complex complexes: a buried alloreactive mutation subtly alters peptide presentation substantially increasing V(beta) Interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1legB00
4HDIA 4DWHA 4PRIE 4D3CH 4RDQF 3EJJX 1K8DA 3RKDD 2WANA 3IS0X 4MA7H 3HZVA 3JWDH 3B9KC 5FUOL 4LVEA 1FIGL 2DQCH 4OI7A 2AK4A 1K85A 1CI5A 5HBBA 4K23L 1BJ8A 4LLWB 4EN3B 2JF1A 2MJWA 5DUMH 1CLZH 5GGTH 5J7CC 2VXTL 2CLRB 5KANG 5HVWA 5AAMA 3FQRA 1S7QA 4WGWB 3VFSB 4BSVB 1IJ9A 5F6IC 5FAAA 4HHAB 5I18H 2R2HA 3TT3L 3FO0H 3DVNA 5FHAL 4NKIH 5DMGD 5JW4M 2FHCA 4LEOB 2AI0L 3VWKA 1NCUA 1MFEH 5KVDH 3EO1A 3HG1A 2VC2H 4W4OA 4J3TA 4OT1L 4KGLA 4OUUB 3UTQA 2V9RA 1DBJH 4GO6B 4G8IB 2F54A 5F1SA 1OAYL 4ZUTA 3OR7B 1FYTD 2DQIL 4KPHL 2YEZB 4JREC 1A7NL 4QGYA 5LQBH 4AQ1B 1ZHNA 3B9DA 4KTDH 5I6XB 4QRSB 1I1FB 3H6JA 4M61A 1IC4L 2WM0A 4JVPA 4PG2A 5E5RB 3TBYA 4Q9CA 4YDVB 4MQXC 2DI8A 1MI5A 4HWBH 4P4KD 2P5WA 3I3BA 3IDXH 3KJ4B 3WFHB 2RR3A 5EG6C 1QR1B 2WIIB 4MLIA 5SWQB 1IAIL 4Q7DA 5D7IB 1GC1H 3V5KB 4PJBE 3NIGE 3Q1SH 1FCGA 3LPGA 3V7AG 5A43C 4B5EA 1RFDH 1INEH 3J7HA 4JFQA 1MFAL 5ENWA 5IVXA 3VJ6A 2CSPA 2AK4D 1ETZA 3KNBA 3QJHA 4MCYB 3DBXA 2DQTH 5SV4A 3CU1A 4PRBB 1TFHA 3F5WB 4JO4L 4F80A 2KZWA 4GG6B 3ES6A 3RNKA 1AQDB 4UT7L 2DLGA 4KMQA 4NQCE 4WU7B 3BAEH 4KJWC 5C0EA 1U0QA 1UH4A 4DVRH 1HSAB 4O4YH 3CVHA 4RFOH 1XGQB 3VRJA 1K4DB 2ZP0T 4MA1B 2A9MH 4DN4H 4PV8B 1FFOA 3GMMB 5ACLA 4JVUA 4UU9B 3GJEA 32C2B 4P2CG 2CO7B 5C0NC 4LLQA 3WL9B 5CGYD 4JLRA 4CN1A 3QNYA 1OPGL 3MJ9H 1UGNA 3SE3A 5F7NC 1A22B 1FZJA 3BZEB 2CXKA 1XCQA 3C5ZB 5BS0B 2CDEB 3LD8C 4HBCL 1IKFH 2D9CA 1CFQB 2ZOKA 4W6XB 2YK1H 5C0AB 4OZFH 2DLFH 3TBYB 3IAPA 4N9OB 1DR9A 3MNVB 1RV6X 3AVEA 5EO0B 3WN5A 2GAZB 4WI7A 3WFBL 2ZWLT 4JG1L 2OL3A 4J2XA 5KZCB 3IU4H 4Y5XA 5DDHB 1MAMH 3QWRA 2YPKB 1CICB 1ZEAL 3FFCB 3G5YB 1HH6A 4OT1H 4N0CD 3EGSA 1ZGLP 5FCUH 2K7PA 1PLGH 1T1WB 2A6JB 3MUY1 4XX1E 4QRRD 5GPRA 4TSAL 2I9LA 2BP3A 2ZG3A 1MCOH 3IDMA 4UV4H 2X1WL 2X4QA 4FQQA 1IC4H 4K3DH 4PJBA 1NJ9A 1DE4B 5BVJA 1H3PH 3Q48A 3EYQC 4PRAA 5J9PB 3LMJH 4JY5L 3O6FB 1W2KT 2F19L 1X6NA 1MI5E 4WFGE 2FB4H 3SCMB 4R0LB 1QRND 4CJ1A 3MO1A 2GJZA 3X3FL 1ZVSA 2PTTB 2DI9A 3LKRA 2FEDC 1DBBL 4ACPA 3WYRA 2YZ8A 3GRWA 5D1QA 5DYOA 5GGVY 3BP7B 1A0QL 5GGRB 4HG4K 3IS1X 3SE4A 1L4IA 1KCRH 4NPYB 2Q76B 1N0LA 1RIUL 4JGJA 4WFFE 3FN0H 3IF1B 4JO3H 1RU9H 3VFSA 1QEWB 3WXWH 3Q5TA 3SDXF 5IHUL 3X3GH 4NNXA 3HFML 5FYKH 2W60B 3BKML 5B8CC 2EDNA 4Z7NE 1KPRB 3ULVH 1LDSA 3CFDA 5KW9H 4ZODA 4YGAB 5F96H 3BRGC 3S35H 4RA0C 1J05B 3F62A 5EWIH 3OKOA 7FABH 1MJ7L 3NGBB 4FQCL 2FBJL 3C6SB 5EO1A 4OCWH 1MREL 4QRPE 5KSBF 2Z91A 3SDDA 4Z0BL 2R1YB 4G9FE 5C0IA 2DMKA 4TULH 3QNZB 3EO0B 2DWDB 4U1KA 3DYOA 5CHNB 4HC1A 4ZG1A 1FN4B 5JPNA 1F4YL 5DI8A 2BVTA 1NLBL 2HJKB 1TPXC 3WUWA 3F7VA 3TBWB 1M71A 2BNRA 2FX8L 5TGBB 5D1XD 5KG9A 2EE9A 3GMPA 3FL7A 4FXLA 1XH3B 3MROA 1J5OH 4GKNB 4ZS6C 4U6YA 1AC6A 2VITB 5GSRB 1AHWC 3W9EA 3UJIL 5FF6A 2DQJH 4KXZH 1UWEH 3KYOB 4X4MA 4P0DA 4NM8L 1NCWH 5CZVH 3MRBA 3ES6B 3AS1A 4NO2B 1VFMA 2B5IC 3IF1A 4PJGE 1U8IB 2JLLA 3OG4B 1HDMA 4QRTB 4JY5H 2Z8SA 3VMOA 5BMFH 3CNKA 5E99H 3W5NA 2PYFA 4XNQA 1HQ4B 2FATL 4KJYB 2LAAA 4OGAD 2FLRT 5FM5M 3LAFA 3QFJA 4ODHH 4NT6A 4LAQH 4HC1L 1EHNA 4OZHB 5C9JA 4WI4A 4PJEA 1QPPA 1WBYB 4I3SL 1QRNE 3SGKC 1KBGH 3SKMA 2GSGB 3C5ZC 3DPBA 2BHYA 3HMWL 2HRPL 4N1CA 1MNUL 2OR7A 4CVWA 2NXYC 3FRUA 1DLFL 4YQXL 1FAIH 3EO0A 4D9LL 4R96A 3PDOA 3O8XC 4M03A 1A6PA 1Q72H 1F97A 1D9KD 4XVTH 1QBML 3W0WE 1KXVC 2CD0A 2P7TB 2GKIA 5KOVC 5FFLA 3EO9H 2YPKA 5F3BA 5KAQG 1J8HE 1FL6B 2O61B 4YBHA 4IIQB 1WISA 4X7SH 4P9MH 1P7HL 1W0YT 1D5ZA 2A6IB 1I1YA 4XCCL 1R0AH 5EZIL 1KCUH 3D18B 4JHAL 4EDXA 3DX7A 1DDHA 3TO2A 3OSKA 2JIXA 1I9IL 5EU3A 1JPSL 2VDLL 3DUUA 5L2KA 4P2YA 3MBXH 1Z6JT 1ERNA 3WO4C 1FIEA 2IAMD 1N6UA 4HD9A 3L1OH 1WFUA 4XTRC 3MLXH 3P4MB 4GMSH 5EUKA 4BFIB 4P4KC 4J1UA 3QCTL 4EIGB 4FQXA 5I66B 4JFOB 2OTWB 2ZSWB 2Q8AL 3DYPA 2OXHA 3ZSTA 3HE7D 4LARL 1A1MA 4QT5A 2VQ1B 4Y4KB 4OLXL 3RHWF 5DEFB 3ARSA 2VO5A 1RULH 2LTQB 3UYPA 3HZMA 4E41D 5DK3A 1IM9A 4KQ3L 4MQ7B 1FJ1A 1A9BB 2FRGP 4U2ZA 4NUGL 4Y16D 4I0PD 1TDQA 2HP4A 2E27H 1FVDB 4L9DA 1CD9B 1MCBA 3QDMA 4WCYH 1OM3L 3A6CH 2LTQC 4C83A 4N0YL 5DTFA 4PP2B 3OKMB 1JGLL 3KYAA 4PRIA 3IJSB 3VGDA 4QHKI 5KN5B 4YDVA 3C09B 5GJSL 4LQFH 43C9B 4G6KL 1F11A 4ELME 4OM0L 3P30H 1SJEB 2AS5M 4K8RL 4PJEE 3IDJB 1FHGA 5L6YL 2X4NB 5FYLD 1CDJA 2IGFL 2NW3B 2WV3A 5AG9A 1RVFH 2GYSA 4PJXA 1I9JL 1ZLUH 5IGXL 3OAUL 3QXUA 4FOMA 4P3WA 4MD0A 2OP4H 1OW0C 5HHPA 5DURD 4HIXH 4XVTL 5C07E 4PD4K 4MNQE 4EOWL 2UYLA 5HHMD 4JVWA 1XH3A 5IM7A 3UTSA 2A6KB 4ZSOB 2H6PA 3HE6A 1AC0A 3VA6A 4FQXB 5I66A 1HI6A 3O2WL 2LV4A 4FHBD 3TO4A 2CKNA 2D31A 4AIZB 1QSVA 1L6ZA 4WTZA 5DLMH 2CK0L 2XA8L 4LRNH 2IFFL 4ZPVB 4JPIB 4ENED 2PW1A 2BNQD 1VKXB 3O2VL 1NCAH 2BDNH 2VWEE 4Y5VB 2OR9H 2ZG1A 2Q6WB 4Z76B 3RZCB 5E94B 5ADPL 5HDLA 3D87B 1U58A 1W72B 4NO0D 5FGCE 2IFGA 1XFPA 2Z93B 4W6YB 2OJZL 4K94L 3QO1A 3L5IA 4LHQB 3NZ8B 4Y4FC 4OF6A 1NDMB 1OGAD 5CEXA 4ISVA 3L3KA 1GRWA 2Q76A 1EGJH 3HAEH 2H32A 5LAXA 3U9PH 5HI3D 5KSAD 1PBYA 3HR5A 3TH2T 2R9HD 5GSVA 4Z7VB 1A6VL 4NZJA 1HHHB 4G6MH 1BEYL 1VERA 3N9GL 3QYCA 1FNFA 5KJRL 5A2LH 2Z0BA 2DQEH 3OPZH 4GH7B 4IRSA 1TETH 1W0VB 5FECA 2ESVE 3PDOB 1NGQH 5D7KE 2BJMH 4XVUD 3K7UA 4KKNA 1CZ8L 2ZSVB 1YDPB 5E8DH 1FC2D 4CN6A 1CFNA 4WUUA 5ITFA 2BSRA 1MIML 4GRMB 2NY5L 4NM4H 4HQQL 1RZJC 2B5IB 5DD5H 4UBDC 1A4KB 5BW7A 9CGTA 4PY8I 4KKCD 4V1DA 4L4JA 4M1CD 4OZFB 4LHUD 4XP9H 5IK3B 3QNZA 4PLJC 1YEJH 5JHLL 3F8UB 3HZYB 4L8CA 1EXUA 4AH2B 1U8LA 1NMCC 4JQXC 3ETBF 5KVGL 4M6AA 5JPMB 4O02L 1T04B 3QAZB 1CCZA 1MFEL 1MCCA 4O5LH 4X98A 3C2SA 4U05A 2NXZC 4DFIA 3MJ7A 1A7RL 2O93L 2NXZD 2VWEC 1Q0XH 3ILPA 2Q6WA 2G9HB 1UH3A 3VXPA 1TVBA 5CEZE 3W0WA 2NQCA 1YQ2A 4ZYKB 1Y6NR 2AEWA 4H20L 4ZUWB 1GOHA 1DVFC 1T4KA 2A77H 2ZCLH 2ADJB 1D5XB 2XTJC 5M7QA 5I15H 1YN7B 1WIUA 1ZXQA 4RMVA 1I9RL 1CLYL 1QBAA 2AV7A 4LSRL 1CLCA 4I13B 5H8DA 5CINH 1CTOA 3JWOH 3V6BR 3QFJE 5TF1H 4APQD 4TNVK 2W0FB 4OZFG 4WV1B 1I4FB 1R3LA 3DSFH 1INEL 5MI0C 1WBZB 2W91A 3MRDB 1PZ5B 4UDUA 5C9JB 5E8OB 4PPTA 5IWLC 1S7XB 2ADIB 2AKRB 4C54A 5GS0H 4DKDC 1IAIH 2GAZA 3HB3D 2JJVA 4P57A 3MA7A 4NFBA 4OTXL 3QBTB 4PREA 1M7IB 2IQ9H 5B39A 1MLCA 5H94A 3TT1H 4D0CB 4PJDF 4KY1H 2IC2A 5A2IH 2F74A 4F3FB 3ZKNC 5ACZA 3VXNA 3OPZL 5JIPA 3NA9L 5D1XC 1G0YR 4WUUE 4JO4H 1VSCA 4XCNB 3VDCA 1FZMA 1H3XA 1R5VA 1ACYH 3DRQA 3ELAT 4GBXD 1GGBH 3KPQB 2Q8BL 3FQTA 3WUZA 3O6KH 5IEHB 3FZUC 5GQBA 2QSVA 3TO4B 3RWIA 1S5HA 3I85A 5FUCE 4PRNB 2J8UB 3QUZB 2RFXA 2APTA 4LKCA 4L29B 2CUMA 4WY7H 4O2EB 5F1OB 4K9EL 3SDXA 5IF0A 4M00A 2JJTA 2ZKHL 3LB6C 1NANI 5HGGS 3CMGA 3L3GA 3N85L 4HS8H 1N59B 4IOSD 4NZUL 4J4PC 1JZ6A 2VDNL 3V6ZB 3EBAA 1MFCH 5E9DE 5EBLA 3PV7A 2FGWH 4PJIA 3KPSE 2J8UF 5MERB 1P69B 4ISVB 5CJQL 4Y4KA 2P46B 2WUCH 5KSVA 5CP3A 1PQZB 1HH9A 4APQA 3IU4L 4XVSH 5E1AA 4X7DC 2RHEA 3B9KA 3IXTA 3IDNA 4J6RH 4QRUB 4CW1B 1BQHA 2ICWJ 5MEND 5B38G 2BFVH 1N0XL 3RPKA 5E7FA 1FBIH 3RIAK 2JIXB 2X89A 2FYYB 4MXQD 2B1HH 3A6BL 4QNPF 4GQ9L 3EYQD 4PJXE 5F44A 2VUOA 3MGOB 3RJDA 1DUYB 4XCNA 1NGYA 2UWEE 4LASH 2DTMH 3AFLA 1H0DB 2HVKB 3U79A 3C60A 4LHUB 4WI5A 4JR9L 5TGBA 4QXUH 5CSBA 5DJ8A 3QIBC 4LLYB 5FYKL 2UVFA 4NKQB 3WHE1 1DJSA 4XT1C 4DKEH 1B0GA 4Z7VE 5KANI 3V6FB 4P5TD 5FDWB 3R8QA 3MRPA 3HE7A 5I16B 1KLGB 3VXMD 1Z9OA 5IHUH 3TJHD 1KT2B 3MRBB 1N7MH 3O4LE 3ULVF 4F9PA 2X9YA 3WFEL 4PGEA 4JM2B 1GPOL 4F8QA 3TJEH 3NACL 4WUUD 4JHBA 2XZZA 3O41A 3PXJA 1YEDA 4HHAA 3JV6B 3T1FB 5KTEH 1EAPA 2IADA 1MUJA 3BH8B 2Z8WC 4J3SA 3O3EA 1EFXB 3HI6H 5D70L 4AENB 3TCLB 3QULB 4CVZB 3CFBB 3KXFA 4XBPA 4Z76A 1QP1A 2BCKA 2AQ3A 5HGAA 2AI0H 3NABH 5C0CA 2D0GA 4G8EB 2I25N 3NFNA 4F57H 1FO0L 2NZ9D 3IT8D 2HFEA 5AEAA 4LSSL 1ZLVK 3TA3A 4HJGA 5TDOA 4HUXA 4KKAC 4IOFD 1HINH 3B8SA 3CVIL 2BSSA 1WEJL 1X4YA 4KPHH 1QNZL 3EYSH 1A6WL 2IJ0C 1U9KA 3F7YA 3MLVL 4OFKA 4OZ4B 4H0HB 1HILA 4RGNB 1HHHA 1CFSB 3RL1B 5C0ND 4Y2OA 1WWBX 3ZZ1A 2VKXA 4YGVB 4RQQA 1MCQA 5IHLB 4BK5A 4ZD3H 4MJ2A 1PGRB 5IVXE 5FM8A 4MWFA 2D31B 3RVVD 4PRPD 4N1HB 4XP1H 4YC2C 3GJFB 1AP2B 3U4BH 5IFJB 3ARBD 1AXSB 3TIEB 4OF8A 4HIIA 5C0AE 4U1SA 4LLDA 4TUJA 4Z7VF 4WFGD 3LQAC 4OF0A 4ODHL 5DK0B 3HCVB 3SE8H 3F7PC 2W0LA 1HQRB 3ULVE 1N8ZA 1FAIL 4XAKD 4OJFH 2YUZA 3L9RB 3CAFA 2UY7A 2WLYA 4L8DA 1TTGA 4P5TC 2NY0B 2VE6B 2VDPL 1F4AA 4PJCA 1YY8B 5E2TH 3QHTC 4UI2A 2H3NA 4F7PA 4NN7B 1X5AA 3HC4L 2CUHA 4N0FB 8FABA 3MOBL 1WGOA 5GRYA 2FDBP 4YPGA 4G8GE 4MJ5A 4Q9QL 2BVPA 1CFNB 4WUUB 5ITFB 3C9NB 2FJHB 2B1AL 5J1SC 3LKQB 5D93B 3QUXB 3GMOA 2QQLH 2NY6C 2W0PA 1MF2L 2Z31A 4FQLH 2V5TA 4F9PC 4LF3A 3K3QA 5JZ7D 4BZ2L 4ZFOA 3ARGD 3EGSB 1G7IA 2EYRA 2ICWB 4FMKA 4X6DE 3P77B 4HMCA 4M6OL 5DXWA 1VGKB 4HS6A 2DQHL 3GM0A 3MREA 4GAJH 5CLWA 3MGOA 3RTQD 5C0DB 1Y18A 5FB8B 5B8CA 1HINL 3IKCA 3SE9L 1UXSA 3X12B 2CJUH 4I77H 4F2MB 4HXBL 4RGOH 4L1DA 2WIIA 1H3UA 2XWJB 3SY0B 5EZLB 4MA8H 1T7VA 2IAMA 1A7OL 4Y4FA 2DBLH 1FNSH 3BEVA 4I5BA 3WS3A 2X4SA 2Y6SC 4ODXB 2JIXD 1NCCH 1RUKL 3B9VA 4N0YH 3D3VD 4D2NA 1N8ZB 1KV3A 4LLUA 1J0HA 3ZKND 3VD9A 4NUGH 5D1QC 2JCCE 4P59H 5D1QD 2F15A 1HEZA 1GH7A 3V95A 3UPRB 3WV0A 2MQ0A 3MRMA 3G5XB 1EX0A 5T3XD 1K8DB 2IPKA 4GXUN 5TFSH 5I74B 2Y07H 3WS6C 3MR9B 3CX5J 1U3HD 4JFDD 4PRDA 4G6KH 3G9AB 5C0EB 4UT9H 2ZOLA 1BREA 4LSQL 5LVEA 3PV6B 4ZAKB 1O7VA 5E6IC 3HUJA 1FSKB 4OF7A 3MA9H 3DO7A 3IFNL 4K3GA 5HVFB 4KZDH 4KWUA 4ZQKA 2P4AB 1KB5A 2M26A 1WIPA 1JCKA 5I8OL 4FFWD 2ZJSH 5E6YA 3DI2B 4R7NA 4ZAKC 1C08A 1N5YL 5EU6B 3SBWC 4HKZB 1N6VA 5C08B 1WZMA 2ZOKB 4PGCB 4TSBH 3DROA 1R5WA 2A73B 3Q0HA 1HKFA 3T0XA 1M71B 2B1AH 1J8HD 4CDGC 4JFHE 1EJOL 3KPPA 1HKLL 3MGTB 4LSPL 3TNNA 1B9ZA 1J0IA 5IEKB 4YK4B 3WIIL 4TTGA 5DFVC 2X4SB 4GQPH 4WGVB 1T03H 3KPOA 1OWWA 4AZ8A 3KJ6H 2COQA 2OMBA 2BC4B 4HJ0D 1ZLVH 4L8SC 4HFWB 4Q58C 4LKXB 5IB3B 2HWZH 5D8JH 4IMLB 4BSWA 2BVOA 1A3RH 4PJ9C 3IXAB 3GSNB 1H0DA 2HVKA 3P73A 3CUPB 1U8IA 1NBZB 4XP5H 1D5MB 5JLZB 2CIIB 3A67H 5DRWA 2NX5D 3BHBA 3VXSB 2C1PA 2EIZB 2FD6L 3BI9X 2I9TA 5SWZE 4UV7H 4LP5A 4PJ9B 1MCWM 5IESL 3FB5B 1T5WB 2N7AA 4JDZB 3FOMA 4Y4KC 4HFUH 3QRGH 1YUHB 5KJRH 1KLFA 2CR3A 1PG7H 5AG8A 3MV11 1TETL 5L7XH 1OD9A 3IVKA 4S1DD 1CK0H 2XKNB 3GHEH 1J0KA 5D9SA 5KS9E 3GJFH 4PLJD 4I3RH 4LCIH 5C7XH 4NRXB 5L2JB 1UZ8B 1MY7A 5JXED 5I75C 1LE9B 1T83C 1OAZL 3C9NA 5HHME 1A02N 3UYRH 3GUTB 3MCKA 2DB8A 5IB5A 3U0WL 2Z31B 3MZGB 4PJCE 2Z4QA 1JUFA 3I84A 1LO5B 1Q72L 1F90H 4DAGH 4ZPTA 4R90L 3GSUB 1SY6H 1UVQA 1EO7A 1CD0A 2DWDA 4YHOL 3CXDL 1CGSH 4EKXA 2R1YA 3QUYC 3V4PH 3K8KA 4YDIL 1V8HA 3N1QC 5I1AA 5D7LE 4P23C 3FFCE 2NY1B 1EMTH 2X05A 3IYLW 4IOIB 2NY6D 4EUPB 4S1DC 1X5KA 3OKNA 5EUOF 3ARWA 4HXAH 4LKXA 3SO5A 5IB3A 3V79C 4EQ2A 3R06A 3QIWD 4G43B 4JGMA 1JTPA 1I9IH 3B5TA 5GIRB 3WNLA 3L3IA 3PF2A 4L3AA 1EJOH 5FO9B 5E08L 3V6OC 5IEHA 1X9QA 1UM6L 3HZVB 3BHBB 1GCFA 2P47B 2BVYA 3JV5A 4JKWA 2VMFA 4NOFA 4RWHA 3REWB 3QDJB 3KDMA 1AR1D 3S36L 4EBQH 3SGEH 1HOCB 3MLWH 5IHBA 3QISA 4TUJB 1YQVH 5K9KA 2HKFH 3W0WB 5C0BE 1H3GA 3UDWC 3V6ZA 2YWYA 1DSFL 1TJGL 4WDIB 5JOFB 4OCYL 1LP9E 1JMXA 1NAML 1UZ6E 1UT9A 4MXVF 1ITBB 5F89A 5DD6A 4HV8A 2F8XC 4WCYL 1P1ZB 5F7YC 1Z3GH 4U49A 4U1JB 4F58H 1UWXH 4XZUA 4OZ4A 3LCYA 1BFSA 4D9QD 2PN5A 1T21B 3SKOB 5F9WC 4NNXB 3RWFA 1KELL 4JPWL 4K7PX 3VXQB 4PJ7E 3O6KL 4HCRL 2G75B 3RKPA 1HHGA 4OD3L 2DQCL 2RBLA 4DUVA 4I3RL 1LVEA 2HFFB 4FZEH 4YPGB 4TUOB 1T2JA 3PGDA 4PV9B 1J05A 1GGBL 3TT3H 3T04D 4WNQB 4XMPL 4U1SB 1IBGH 3M1BA 2VDKL 4MB3A 1CLZL 4FRWA 1IAKA 3BESR 3N85H 3S3SA 5B39B 2YRZA 2WBKA 4FXKB 3LRHA 3K1KC 2R0KL 4QRRB 2FGWL 3U7WL 2MKLC 4YXKL 2IBZX 5E6IB 1MCIA 3KDMB 1EMTL 4YFEA 1LGVA 2OK0L 1EV2E 2KDGA 1YC8A 2NY1C 1XGTA 4MNGB 1FFPA 3QJFA 4ODVL 5D7LD 1MHCB 4X6FB 4OBSA 1OLZA 5JA8B 1URLA 3WFDH 3QCVH 1D9KC 1A7NH 3CMOH 1ZHLA 3CXHK 4N9GB 1E28A 1JF5A 2OR9L 3NGBC 4DTGL 3NCCB 5B38A 3T4AB 3LN4B 4PRNA 1UM6H 5I1IL 2VXSL 2FR4B 3DHMA 5CWSA 2YOCA 3BPNB 2V7HB 4HWEH 1J1XH 3FHAA 2BK8A 4U1JA 3BKYH 4NIKB 4BK4A 3MLWL 3TVMD 5EPMB 5B3JF 1S7RB 4NQCD 4L8BA 3HMXL 3AU1A 5GRWA 5KZCD 2RB8A 2PYFB 4XNQB 3HPLA 2D7OA 5C09B 5TF0A 2E7MA 4PJBF 3V6OE 2GK0B 2MPAH 5EOCJ 5GS3A 2HKHH 5C0GA 5IMOB 4PRIB 3QDGE 3VG9B 5DS8A 3RUGF 4Z7OF 2V7NB 4F7MB 5E1AB 5DJAA 3GSNH 2YXFA 3ABZA 4ZO9A 1I1CA 1UXWA 2VXQL 1GGYA 3U6RB 2XWBA 3FO2A 4NO3B 1OP3H 5F8RC 3C8HA 4ORGB 4V1DB 4FTVB 2ZCKL 2FECL 5TQ0H 2VH5H 1UM4L 2ZUVA 4HCRH 1AJ7H 1G9MH 1KEGL 1VESA 5KTEL 1BFOB 1BOYA 4XBEH 4JN2B 1DUYA 1MI5B 3TIEA 3H9SE 1GPOH 4ZOEA 1C7TA 1ZA6B 3G6JE 1FNGB 2AXGB 3NPZB 3I3DA 1WWCA 4YXLH 2RGSA 4Q2ZB 4XMKL 4UTBH 3KLSA 5C6TH 3CH1B 2APWA 2GY5A 1MAML 4KTEH 1M05B 3NFSH 5CEYB 5T1LA 2AEPL 1IFHL 3MNZB 5ANMB 5IP4A 2NYYC 4ONHA 2VL4A 5DJDA 2FGZA 2MFNA 1MCOL 2M1KA 4XVJL 1XF3A 4AG4L 5DJ6A 2YD3A 1TCRA 1NSNH 3RZCD 2BY1A 1U95A 2HT4D 3HPLB 2CGRL 3QZWB 4MA3B 4TSAH 3HNSL 1IGFL 2IADB 3NCBB 2YA0A 4ORZC 1I8KB 3VFVA 4HK0B 4WFHD 2WWMC 2WBJC 1DBBH 3ZDXE 5T1LD 5I1IH 1ZKAA 4JFZL 5GZNC 2K7QA 4LLQB 3VXUA 3DX8B 1TQCB 1BFVL 3PWPE 3VMPA 5HJ3B 4AJ0A 1N6QL 4NP4L 3SKNA 3VFPA 3QEGL 3NFPB 2OBGA 1C5DA 3THMH 3G5ZA 1BZQK 2A74A 5TDPB 2HYMA 3U4BL 1KG0A 4N1EA 4LRIC 5HVHC 1T89C 2HMID 4K8RC 1K2DA 5SWSA 4K7FA 4NQVA 1A4JB 4DK6A 1JZ2A 3LSOA 1A6TA 4BQ8A 5K9OB 4KY1L 5DI8B 4XMLH 3UTTB 4S1RL 4OIAA 1RD6A 4MJ4A 4NHUA 1I7RB 4OB5L 3ZTNL 3DV4B 4OCLC 3T0EA 2P49B 4M62L 3O2DA 5DJ2A 5EZLA 2RCSL 3QI9B 2YSSA 3TBVA 5LGJB 3B3IB 4D0BA 1EO8H 2YC1A 3QCUL 5IK3A 3GIVA 5F7EL 4Z0BH 1OGAB 2IBZY 4NQDE 5F1NA 2J8UA 4FP8L 4DK3A 3O4OB 1R3KA 2EE3A 4JDZA 1JNNH 2YWZA 1A1NB 3ARFD 2G9HA 4L4VB 3P9WB 1NDGA 1K5NB 1VB9A 1LO3H 1ZLUK 4M6NL 1GYAA 1T22B 3BD4A 4Z95L 3LKNB 43CAA 2KPNA 3CSGA 2FEDD 4J8RB 5IOPB 2IANA 1CF8H 2ZZUT 4CVXA 3WN5C 4UIMA 1I3GL 1RIHH 2EH7H 4S1SL 3LN5B 3QIBA 4RBPK 2BX5A 4JM2F 5CJQH 4XI5C 3DO7B 3AAZB 4NO5A 4X9GA 4Z6AT 5F9DC 5HJ3A 5K9KB 1KUMA 4QCIA 4G6AC 1CDYA 4P9HL 4S11A 1JHKH 1NCWL 4RAVB 1YEEL 2CIKA 3JTSA 4L4TD 4GT7A 2GJ6D 5DSCA 1RJZA 1A7PL 4X8JB 4PY7A 2BY2A 5HSFA 3I2CL 5K9JH 1K2DB 2IBGA 5I17A 4Z7UA 4LCWB 5SWSD 1SEQL 2FJHA 4UINL 1RY7B 2CKBB 2EEAA 3WJJA 1BQLH 4BZYA 2BVQA 4PGCA 3FO9B 4N0UE 4LLMB 4TRPL 4PGJA 1WWWX 1VFAA 5IW1B 2E6QA 3QQ9C 1LE5B 3QXAB 4KRMB 4PJGF 5JHDE 4IIQA 4P3CL 4GRLD 4RGNE 1ZANL 1DVFD 3B3IA 3NAAL 1BM3L 3V5DB 5F9OH 1MNUH 4CDHA 5GGTL 3R0MA 2W9LA 3BGMA 3OGCA 4G9DB 5F97E 1EERB 2XFXA 2DKMA 3KS0H 3G6JB 3IFNH 4MNQA 5DMKA 4JQVA 4KK5D 5I1HH 1RJYB 4PJHB 4Y5XC 2K3TA 4X4YA 2EYTA 4HUUA 4MQXD 4QOKB 1U8NB 2L7JA 4FA8A 2YBRA 1DBKH 4IRJA 2ARWA 2ID5A 5H35A 1X7QB 5EZOL 4XNMA 4KVCH 4IHOA 1X5ZA 2FO4A 1GGCH 5E8NA 2ATPA 5JW5A 3Q6GL 4NRYB 4HT1H 4Y5YA 2VLJB 3EFDH 4PJ5A 1I8LC 4HJJL 3C5SA 2V5YA 4KK6C 4QCIB 3U9UA 2IALA 3RVWD 2V2XB 4KU1A 5D7JB 1F8TL 4ZOAA 3S35X 4C83B 1FZOA 4YC2B 1JPSH 4CL7A 4WW2B 3SDAB 2AGJH 1ZT1A 5L2JA 1NUNB 5FOBB 5FKAB 3IJSA 2O5XL 3PIQA 4G6JH 3RY4A 1OAXH 4LSPH 3L5XL 4E9LA 1MFAH 3L3HA 3VFWA 2ADFH 1KG0B 3MLVH 4RNRB 5JDSB 4CADB 4LK4A 1A3RL 3V5DA 4APQC 1AP2A 2BOBB 5DT1H 2X4QB 4FQQB 4EUPA 4PJDB 4JDTH 3PHOB 1FZKA 1OP3K 2VN4A 1NLDH 5GZOC 1NCTA 4NZTL 4OGZA 4B53A 2FX7L 3R4DA 1SM3L 3IDIA 4TRPH 3SDDB 1QO3A 5AZEH 2EH8H 3JUZA 3QQ3B 2GJZB 1WAAA 4W6WB 5B39G 1X7QA 3G5VB 3GSQA 5E7BA 3MRNA 1HHIA 3FB8A 1L0QA 2AQ2A 4PGBA 4Z7UF 1PG7L 4JFQB 4M7JL 4M9OA 1BGXL 1MH5B 3IFPB 1VENA 5MEQB 4AL8H 1EDQA 3V6FA 4QRQA 2I07A 1KPUB 5DHYA 4RGND 1YEGH 4LPWA 5I76A 3QQ4A 1A6UH 1CG9A 3QUML 4L8BB 4JFFD 3AB0C 1KLUA 5F1IB 5DQ9B 4YHML 1N26A 3BYTA 4M3KB 5IT2H 1ADQA 1ZS8B 12E8L 4RISL 1VGEL 4Z77B 2E6PA 4IRSC 1S9YA 3MV8D 3OJDA 1GGCL 4X6EA 4AY0A 1CLOL 4KHXL 2ZNXA 4HUWA 5CCKL 4W81A 4ONOA 5DRXA 5HDQL 2E7BA 4GMTL 1QSFE 5IG7A 3KR3H 1C5CL 2DM3A 3FT2B 4NQSA 5E08H 3ULSB 1KYOJ 1OTTD 3ROOB 2EO9A 4IRSB 2E8YA 1RJLB 3EYFB 3LMJL 4LEOA 1BFOA 4YHKL 5TDNB 2Y25A 3NH7L 5JZ7C 3MLSH 1Z9LA 3MRRA 4GW4A 4POUB 2ZPKL 1QVOB 1B2WH 1ZMYA 2L0DA 1Q9OB 1AGBA 2O5XH 3SKMB 2R0ZL 2VLKE 4G8IA 3C8DA 3GSUA 2ICES 3HR6A 5IJKC 3F7RA 3KPNA 3A0OA 4Z7NF 1RSFA 1QO3B 1ZSDA 4LNVA 1AGFA 4WU5A 5C8JA 1YPZF 4KRLB 2ESVD 1KCSH 2ZUUA 2ADFL 3TC9A 3AGVA 4OCYH 4JFED 2CXGA 1Q9WB 1BD2E 1YMMD 4KMTH 1V3JA 2AABL 3C5JA 4RX4D 1JYVA 1RUML 4JRYE 1K6QH 2V2TA 4S2SB 1Z3GL 5ESVA 1U3ZA 3SQBA 3VFRB 1I1RA 1VACA 2QADC 4Z0XA 3VD7A 1MIMH 4Q74A 2DDQH 1KELH 3L95A 4JPWH 4PLKC 3UXFA 3D18A 5DQ9A 5ADOL 1FVCA 1AD0B 1NGQL 5LXGL 2B7DT 5HGHB 4JDVA 4Z7WF 4J3XA 1MVUB 3RGHA 5JHLH 4LEXL 2NYYD 3OHXA 4JRXA 4M7JH 4PJ8D 5IFAL 4KJPD 1DQJA 2WINB 3ZT6A 4NRZA 1YY8A 3QG7L 4LPTA 2AJXL 3D0LB 4F7EB 1SYSA 2PYEB 4JPVH 3H7BA 1U3HB 2F5BH 4BFBD 3RY6A 1YEJL 3BPLC 1CXFA 3FRUB 4KRPB 3SE3C 4F7PB 3MMEA 5E2VH 4WV1A 2P5EE 5KVGH 1KSRA 4YBLB 2KBGA 2QQKH 3OZ9H 5ICZB 4N90E 2ZUTA 1SYVB 3I02A 3DX6A 2EKSA 3BWAB 5D2NC 3MRLA 3ILQC 4P2RE 3U6RA 3CDCA 4LCUA 2FX9H 3FO0L 1MLBB 1HCFX 3GFUA 4G8EA 3FKUS 2R4SL 5BXFA 2F5AH 1T20B 2WMPA 3MV8E 1MCFA 1U92A 3KPSA 2OL3H 3FQXA 2XA3A 2AJUH 2V2WA 4R26L 1IKNA 1JHLH 4FABH 1UXSB 4V1DD 3X12A 1CYGA 3EFFA 3WIIH 3INUL 1EIBA 5L88H 3MV7E 2QEJA 1FGNH 3P73B 2VLMD 3QG6A 4OZFA 2MCG1 3R1GL 2GW5A 1J11A 1FCCA 3MC0A 4I0KA 1NBYB 4AMKL 1IAMA 3MROB 3OWEA 1TENA 1XGRA 4QXWA 3X14B 4ONFL 3VMNA 3T2NH 4XX1G 3ARDD 1MFNA 2NX5A 5I1LA 3HMXH 2CDGA 2FZ3A 1AIFB 4HKXB 1DLFH 2BY0A 4Z7WE 3L5JA 3EYVB 3UC0H 1KOAA 1Q0YH 2B20A 1DBAL 1NMBH 3FB6B 4FQ2L 1KTLA 1NBVL 3H3PH 3MRIB 1F02I 1NKOA 5J56B 4RZCA 2AEQH 4CNIB 5IROA 3QA3B 2GT9B 4M43L 1ZTXL 4OLVL 4K23H 1CQKA 4TVPE 3K46A 5IFAH 5DUML 1E4XL 4ZSOE 2X5PA 4M7KH 4UTBL 4MXQC 3FZUD 4U0QB 4PG2C 5FYKE 3ULUC 5C07B 4P46B 4DUWA 4NC2B 4M5ZH 1A3LH 5ID1A 2VDOH 4UOJA 3PWLB 3TV3H 1RZJH 3VXTB 2ADIA 1CGSL 1YEHH 3DV6B 4H1LA 3QIWA 3RY6C 3OJMB 2P7TA 4HS3B 5FGBC 1BWMA 3UROR 2DQGH 3KGRA 3MLZL 3TBTB 3KPPB 2F74B 3UTSB 2VLJE 4KUCD 4Y2DA 2NY1D 2LAGB 5DJ8B 3GSOB 1JI1A 1S7WB 2MNUA 3BZDA 3OJ2C 3P11H 1HNFA 5TE7L 1KJMB 4OQ1A 5IJKA 2Z8VC 4M1GL 1U36A 2VTFA 4JFDA 4ZO7A 3T4YA 2Y23A 3KNBB 1J88A 5GS1C 4MSWB 1X5YA 4AG4H 5DR5H 3QH3B 1KCKA 1MCDA 3F5WA 3P9MA 1BFVH 1BIHA 3VDAA 1V7MH 4HZLB 4OGXH 5HPMA 4NP4H 1IGFH 4A2MA 5C9KA 3QEQD 5GXBB 3BYYA 2P8LA 3LHPL 4UQ3A 2CIIA 2WWKT 3CIQA 4GG8A 4NN6C 1CD8A 3MV7D 1EUTA 5EU7C 1QKZH 3VXME 4N0CC 1SJVA 1YUHA 3SE4C 3DGGB 1RJCA 3NCFB 1MJ8H 3O4LD 3BPCB 1IM9B 2BCKB 5HGAB 1RUAL 1RZ8B 3DXAA 1JPFA 3TO4C 5D5ME 3TN0A 1A7QH 3L3HB 4PJIB 4OBRA 1ED3A 1I1AB 5CJXC 1P4BH 4XWGL 4JY4A 1JFQH 1FNLA 5DTFB 3NACH 4MNHB 4KJPC 3FN0L 4PJ8C 5HYIA 1PSKH 4BKLA 2AEQL 3DXAD 4C56B 3I6GB 4PJHF 1M4KA 4JFPB 2VIRB 3QR2A 1CFSA 2EDTA 2BSTA 4CU8A 5ECJE 1IAIM 3MV9B 4YBLC 3RX7A 4C4KT 5EU6A 3BE1L 3LSOB 5IMKB 2F53D 4G8GB 4TVPD 5GJTL 1Q94A 4JO2H 1XR8B 3CFCL 4OQTA 3H9SD 2X89D 1HHJB 3UTTE 5F3BB 4PJGB 3QNXA 4YHPA 5I1GH 3LRSA 2VLRD 1FORL 3C6LA 5CSZA 4A6YH 4AT6B 1D5ZB 2K9UA 2EYTB 4MQTB 4ZUUB 1KULA 4H8WL 4PRPE 2Y5TB 4BQCA 2XY1A 5DUPH 1N3NB 1ONQA 3LDBC 1AY1L 4XPAH 5C0AD 4EDWH 3CMOL 2C4FT 3WFCH 2DS4A 2YKLH 2XIDA 1ORQB 4P9HH 4XP1L 1VEMA 2P1YA 1OY3B 3QUYD 4K3DL 2J5LC 2C4XA 3RWCB 5EIIA 15C8H 1ZGLA 1NCBH 4ZS7L 1CZ8H 4WDIA 3AU1B 4MLSA 2NCMA 2APVA 2Z93A 1HSBB 3IJYB 3RWGA 2VDQH 4JB9H 1XGQA 4CVUA 2I9TB 1TIUA 5IVXF 3ARBA 3TA3D 4WFHE 2QQNL 3SCMD 3VRIA 4XNUH 4O2EA 4X99A 5FM5O 4Y4HD 4MQ7A 4XP9L 3ECBB 1VFBA 4N0RA 2ZUXA 3VGAB 3R8BB 2FATH 4FQHA 2DQUL 3HI5L 3BPOC 1CFVH 3PNWA 4M1DH 1EZVY 2EDOA 1OSPL 4H5SB 5CBAA 1TZGL 3IRZA 3UP1A 4BM7A 2XTJE 5E00B 1S7UB 4K3EH 1JL8A 3FQWB 5GGSY 3WSQH 2HRPH 1A9EA 4POYA 3GMRB 1NCDL 2W0KA 2PTUA 4O2CB 3OV6A 4HDIB 2DAVA 3GK8L 1BQHB 3CSYA 3EJZC 3OKDA 4P48A 5HYFA 2GTWA 4E0RB 4FQLL 5DMJB 5D2LE 4XGZB 4NKMB 1QFPA 3QI9C 1AKJA 3ZYZA 3VI3F 4N8PA 1NEZA 1F4YH 2IQAA 3WXVL 4L4TE 4KTEL 3BQUB 4GAJL 2ENYA 4XC3H 4U1MB 4AM0B 1MHCA 3DETD 3T3ME 1NAMB 4XCFH 5IM7B 3GDBA 4IRJB 3RTQB 4ZUSA 4OCXH 3AREB 5L8KB 5B38B 1NBYA 3H9SB 1U8QB 3CPLA 4AEHH 3MMEB 4FZ8L 4IHOB 4WO4B 4L8SB 1OCWH 4X7TA 4GFTB 3MLXL 1JZ3A 3V4UH 5ALCL 3REWA 4M4PA 3VWJC 5MENA 2ITDA 4I77L 5JHDB 1YN7A 3K4AA 4HXBH 2NX5B 5I1LB 1UWEL 4PRBA 5BZWA 3SJVE 4NM8H 5TPWH 1J1OL 1H8NA 5EOTA 4JM2A 4NCC2 1YMHA 1QBBA 4ZMAT 5TE4H 1N6QH 3MRIA 5I8CA 4YHIA 3I9GL 4IRZL 1NUFA 1I85C 1P84K 4MNGE 1G7HB 5JR1H 1BGXH 3GMMA 4PB0H 3ZYIA 2Q7YA 4OUOA 1ZHBA 1LO0H 1IGJB 1YYLH 4O00A 1CVRA 3VI4F 1MRCH 2C26A 1V3LA 1OW0A 4M48H 4L9LC 3DV4A 4PJ8A 1RQ5A 1P4IL 4MJID 3PWVB 3FMGL 1FGVH 4OLWL 4NDMA 4X6BA 3CFEB 3UJJH 1KC5H 1PKOA 4HS8L 4U2YA 1LO4H 4MS8C 4LCWE 3NPSB 1J9CT 5D2LF 1NEZB 5HI3C 3O8XD 3QEHB 2Y72A 3RVVC 5CFHA 1A4KA 2AK1H 4FQXC 1OAYH 3L5WB 3GSVA 5KSUA 3MJ6A 5DJCB 3VFRA 4RMSA 5JQ6H 3GK8H 4HIHB 2CH8A 1BOGB 5LCVH 3RWEB 2HT2D 4LRIA 5E2UL 5F7FA 1G7JB 4QRPD 4GKSB 5EZIH 4X4ZA 2YRLA 1CD1B 1U93A 2FL5B 1TCMA 2OP4L 4J6RL 1DQLH 3SOBH 1N5AA 2HH0H 4PJBB 5CGTA 3SBWA 4LPUA 3RJQB 1T83A 1FBIL 4XHJC 3U36A 3NZHH 1K3IA 4U1LB 2CLZB 3MZTA 2EDHA 3IVKB 1YMHB 4DEPC 2IH3B 1RK0B 1UWGH 3RZCC 5IR1B 1U91B 1Y0LA 3LKRB 3MLYH 5SX4I 2XACC 3CCHA 1UA6H 1P7QA 5DFTA 4Q9RL 1G7LB 1CTNA 5J06A 5I8CB 3GKZA 1NCAL 2BDNL 3OR6B 4FQPA 4YXHH 4MDJB 3RVTD 1A1OB 5EU4B 1LDPL 5J6HA 2DIAA 4I48A 3EO1B 3UO1L 4A2LA 4PJ7B 3BQUD 3ARDB 5DRXB 4XP5L 2AAVA 3VXMB 3HE6D 1TJIL 3BAEL 1UCBH 3TZVC 4WIQA 5A40E 1QPXA 5TPWL 1CT8B 1RIVH 5CBAB 2E27L 1AO7E 2EKJA 1U3JA 3OL2A 4IBLT 4TTDC 5ADOH 3BP6A 5IBUB 1CE6B 5IESH 4XTRD 3DECA 2FYYA 2G5RA 4HAGA 3QHZL 5HI5C 1A6VH 1QACA 4KROD 3C5ZD 2ORBL 2DDQL 4U1HB 5DJYA 5ERWA 5JR1L 4MJ6A 3UYRL 5K93A 4KZEL 3BJ91 3VI3E 1X5LA 4I0PB 3C60B 3JV0A 4EDXB 1G7IB 2EYRB 2H6PB 2ICWA 4YHNA 4RFNC 5C7XL 3T3MF 4R4ND 1ZHKA 1MFBL 3PWPB 3QDJE 4H88H 1JV5A 4K3JL 4QYOB 4YHZH 2DLFL 4GAGL 4LHJB 4YHOH 5EC2A 4UTAL 4LU5L 3W39A 1BAFL 4OFPA 1FO0H 3VFNB 5EO9A 3FN3A 4Q9BA 4MA1C 1YA5A 4Y5YB 3K2UH 2ZG2A 4PJCF 3LRSB 4AT6A 5GGUB 1QLRA 1W72A 3VFMB 3QRFM 4XRCA 1T2XA 2X2YA 3RWIB 2WLZA 1XCTB 2PW2A 1MRFL 4RAUA 3UJTL 5GS2H 1E6OH 3P9LA 4X9BA 1SVCP 5ANME 4YDJA 2Z92A 2NMSA 3SDYL 3MJ8B 1BLNA 2EDRA 2JB6A 4DOHB 3CH8A 4X80H 2NR6D 1RZKC 4JQIH 2DRUA 2W07A 3G6DH 5INDA 3KPRD 1FPTL 1T21A 2IPKB 5FIEA 4GUPB 3VXSE 4P2OC 5E8EB 3MV9A 5CJOH 4OCNC 1IEAA 2XNAA 1JF6A 2ICEA 1LK3L 2E9WA 3VWJB 4ZFFB 5A3ID 2V9QA 5EC1B 5IB4A 2V17L 1NFIA 1G9NH 1KJ2H 1PDKA 4EN3C 1WK0A 3R1GH 5D96B 4D9QE 3EOTH 2IG2L 4MYWB 4MJIB 3BRDA 4QRUA 5CJ8A 2CO6B 3FHQA 3MFGB 5KG9B 3KYMB 2D7NA 2MCPH 2C4FU 5CJ5A 4QHLB 3F6IA 2DLEA 4KI5F 1JGUH 2QADD 2AJYL 1EEUA 3BMVA 4JFEE 2DQEL 3G5VA 3GSQB 1ONQB 3D3VB 1RK1A 3TO4D 1FRGH 1YMME 1AGEA 1DFBH 4JRYD 1CDGA 2GTZB 3PGCA 3BUYB 4U6XA 2JB5H 1B3JA 1Z2KA 5C0FB 3RZWA 4P2QE 1IARB 4X6FA 3JWDL 4KROB 2A6IA 4ETQB 1H3TA 2YBRB 1XGRB 5B4MD 2XPGA 4OLVH 4P5KB 2XN9E 5A2JH 3QPQD 4Y19A 4JFXB 4LGSB 2ZOLB 4LSTL 4PJEB 3DBXB 5C70A 2APXA 1CE1H 4UTAH 4PJIF 2YUVA 4NKDA 1YEIH 3BGFB 4M6OH 4UT6L 5E8PA 1IGCL 1J1PL 2P8MA 4LP4A 4PRHE 3HMXA 1U41A 5E8EA 4J8RA 3L5HA 5BQ7A 3RGVB 5IOPA 3TWCL 1AR2A 3EKCA 1PKQE 5D7JA 1PFCA 1AI1H 4I2XA 5DS8B 4PJ9A 3MBED 1ZT7B 1R5WB 3QULA 3MSPA 4P2OD 1F2XK 3NPSC 1GJIA 5DF0A 4QTIH 3SDYH 5DD1L 2NXZB 3QO0B 2VZTA 1CGXA 3O6LL 3VXRB 4YHKH 3I75B 3HC3H 2BY3A 5E2WL 1MLCB 2CIKB 3JTSB 2JJUA 4WHTA 5D2LA 3ZDZF 3DX7B 4TN9A 4X7EC 1GOGA 5I17B 3B6SB 4DN3L 4HF5H 5IMKA 1GSMA 3VD3A 4M9PA 3QDMD 3HC0B 5INCB 2Y07L 4NOBA 4PJDA 2YUXA 3LHPH 4YBQD 1DQTA 4BFIA 3H9ZA 3ARGA 1UYWL 5IQ7L 3SDCA 4YQXH 4U1GB 3MRNB 2IMMA 3ARYA 4BH8B 1S5HB 4TOYL 4GSDH 5BV7H 1P4BL 4XWGH 5DEFA 2DD8H 4XNXL 3G04B 1RHHB 2VH5L 4GRWB 1RUAH 3V4VH 2WK2A 1KXTB 5D2NB 3T0ED 1IVLA 4WEMB 4NKDB 2WBJA 3F12A 4RGNC 2QQQA 3ZE1E 2R2CA 4WO4C 1KCUL 4F7TA 3VWJD 3TN0D 1CGVA 4R8WL 1WTGT 1HI6B 2C1OA 4MA3A 4GKSA 1I8IA 1FYTE 4YE4L 1OARH 3O6ML 5FYJL 5CZXD 5C1MB 4TPRH 3IJHB 4ZXBA 2Z4QB 3BP5B 3OG6B 5EPMA 4YXLL 3EUUA 3U36B 4R4BB 1D6EB 2GSGA 5IG7B 2ZUYA 1U58B 4LCUB 5GGSA 3RKDC 3WIFA 1MJJB 4DGYH 1UB6A 4ZDHA 1I4FA 1MFCL 4F33B 1RULL 1A47A 5SWSB 1C5BH 2C3VA 1NFDF 3EDEA 2VXUL 1AE6H 3UTTA 4PJ7A 1JPGB 3L5WA 4BQ9A 5BS0D 2BNQB 4N5EC 5DUPL 2LVCA 1Y6MR 4O58L 2D0FA 1O7SA 2EDLA 4NBXB 3P0VL 1JGLH 3EYSL 4IJ3B 5GJSH 4LLVA 5C0DA 1Q9WA 4KDTA 2FJFB 5A1AA 1QSZA 3HB3C 4UB0H 5I1KL 4R2GB 1ZVYA 1EA9C 1VPOH 3O2DH 3QNXB 4YHPB 3WIHH 3QXTA 5FA4A 2EE6A 1E27A 3HI1A 5HY9A 2ZUQB 3PL6A 4JAMB 3VW3L 4OSUL 5C2BH 4PJ7F 1WFNA 4PJFF 1K3ZA 3MLUL 4XPTL 4YHNB 5IW6A 35C8L 3GMQA 3ARFB 4L4VD 4YX2L 4K71B 5LGHH 3ARZA 1HSAA 4XHJD 1TZGH 2R15A 5EBWB 4DKEL 5FCSH 1DBAH 4M8QB 1NAKH 3GSWB 4RFNB 3QCUH 4G7YL 1CBVH 4KVNL 4JLRB 3DVFA 1YEFH 3G6AA 1ZTXH 4FQJH 3RHWK 2R2HB 3NFNB 1HSBA 1SYSB 1JF1A 2I60L 4A6YB 2YMXH 4M6NH 2DQFA 5FGRA 2EIEA 1LK2A 3A6OA 4Z7WB 4FQXD 3OKLA 3GGWB 4OV6F 1UZ8A 3EOBA 4L3EB 5EWIL 2CRZA 4PJFA 3MRFA 3ALWA 4EVNA 3U7YH 1CU4H 4L4TB 3WLWC 3MGAA 4OCWL 4ZQKB 1S5IL 2AV1B 4G9FB 2YK1L 2DJUA 1HZHL 5DZOA 1LO5A 4WHTB 5D2LB 1G9MC 3LEYH 4PYGA 4X0KB 4JQVC 5C09A 4UOW1 4EBQL 1B0RA 3QHFL 1F4XH 3CC5B 1ZEAH 3S4SA 2G5BA 1DP0A 2Q86B 4QOKE 5E8OA 3WNPA 2J1KA 3DROB 1SJHB 3RWJA 4X98B 1IE5A 3GBLA 5TE7H 1JHTA 4HZAA 2DIBA 3K4DA 5BOZG 3O6FA 1B4JL 3UBXI 2XTJB 2VLRE 4UNUA 2OR8A 3D1MC 1ZSDB 3MJGX 2IPUG 4JRXD 4DOHE 2HT2C 2PR4H 1JPST 4Z7OE 5K9JL 1ULVA 4NFCA 5EORH 1WZKA 4JRWA 1NGPL 5E8NB 1A8JH 1SHMA 3BQUA 1X6LA 1A7OH 1A5FL 3QUZC 4J7RA 2NTFA 3RDTC 1LO0L 2FEEI 4R4FH 5EUKB 3UPAA 3VXUD 2HMIC 2FWOA 3X17A 2VR9A 1QKZL 5AD0A 4E5XA 5BMFL 3UPCA 5DC9B 2YD8A 4K07A 1RIUH 3BGAA 2OMNA 3T0DA 3MLTB 2VLLB 3MLUH 4ODTL 1KC5L 5JOFA 1I8IB 3FT3A 3QPXL 4WW2A 3SDAA 4YX2H 1MVUA 1KIPA 4JFFB 1GIGL 3HRZA 4IOFC 3IJHA 1N64H 5HYSB 4NHCL 1I9EA 1I8MA 2PTVA 1CN4A 3Q6GH 2DYPA 3TYFA 3UBXB 3UJJL 4EI5A 3LD8B 3WL9A 4ETYA 4KXZI 3D39E 3NCJL 5JXEC 1MRDL 5DJ0A 3IKKA 4MAUL 5C0IB 4MZ2A 3QZWA 1T1ZA 4GKOA 3BN9C 4M02A 4YDKH 4NN6B 4HWUA 3VWKB 3MACL 2CKBA 2E9IA 2JJSC 4HBQA 4OAWA 1WFTA 3T0BA 1D5IH 4HT1L 1KJ3H 2OLDA 4LBEB 5GRZA 5J89A 3QCVL 1ZA6A 5B3JE 3ARBC 1QLEH 4HJJH 1ADQH 2VAAB 1G1YA 3RL1A 3RVUD 1J12A 5E2UH 3MUGB 2F54B 4HS3A 4KUZL 1MF2H 1CICA 1TXKA 5AAWA 1F8TH 3RVWC 4FN0A 5FDYA 2R0LH 5I1GL 1QZ1A 3ESVF 4Z9KB 3B2VL 2FJFA 1FORH 5EB9A 1G0DA 4LPYA 1FL3B 3Q6FA 3SDDD 1WC7A 4KAQL 1QA9B 2XFXB 3OAZH 4HMEA 1ZOXA 4K7PL 3HC0A 5INCA 1LEGA 2QSCL 3T77A 5J13C 3AXLB 4Z8FH 2HKHL 3CGTA 3U4AA 3UJIH 1KPVA 3VXPB 4EDWL 4LCYB 4PBVC 2P5EA 3KJ6L 1U95B 3RWEA 4J3UA 1NFDA 4MA8L 2OTUA 5ID0A 2H1PL 4LSVL 1FNSL 2GCYA 3QFJB 5ENWB 5IVXB 1FIGH 1BBJB 1MHEA 4FNLL 4UIKH 4MGXA 1R3HA 4JANB 1PQZA 2CK2A 1D5XA 4XP6L 1KIPB 1FYTA 3BDYH 1RUPH 1MCRA 2EIBA 1NC2D 1TVHA 1WBXB 4P59L 4MAYC 1JPFB 4JPKL 3I50H 4TVPL 1Z0NA 4NYLA 2NXYD 3B5HA 2WW8A 5C0RH 4JFFE 2MHAA 2P5WD 2X70B 4DW2L 1ODAA 1RPQA 1IGTB 1C1EH 1FV1A 3U83A 1L6XA 3CFKB 5C71A 3M8OL 3RNQB 4WY7L 4CVXB 1CXEA 3DVIA 2H9GA 2NLJA 4P3DB 5I1EH 2XY2A 4XP4H 4UT9L 3QUXA 5KVDL 3ULUD 3SJVB 2HTKC 2IWGA 5AZ2L 1YY9C 25C8L 4G80A 1R24B 4LHUA 4IDJL 3B9EA 4ZFOB 1Q8MA 2FIKA 2CKBH 4QXTB 1IFHH 1WUNT 3CC5A 4M6MH 4QHLA 3EYUH 3P4LA 4HUXB 4KQ4L 3MCG1 2APFA 1LMKA 3HRPA 4YDKL 4J3OC 2IANE 4U1HA 1SY6L 5L9DH 4TSBL 4MVBC 2DM4A 2NR6C 1O0VA 3IDYC 2EDKA 1JMZA 3FQTB 2Y5TA 5EN2A 5DMIH 5FYJE 3OAYK 2X40A 2R0ZH 3GSOA 1XZ0B 5EFIA 4P4RA 5KSAA 3JV6A 4TNWF 2XYCA 4PGBB 5FUZL 2EXWC 4HLZG 3NH7H 4CMMA 2Y7QB 4ODUA 1ACZA 1EFXA 2KL6A 2V17H 5T1LB 3S97C 3IB4A 1YC7A 5FO7A 4BUGA 3PXHA 1FLRH 1FJ1B 1IILE 5AD0B 3NA4A 5CJOL 1OQOA 1HXMB 1V7NL 4X4YB 5MI0B 2MCPL 3LKOA 1IEHA 1MFDH 3MO1B 1FO0A 5I30L 4NQED 3ARBB 1PYWA 4JN1L 3RDTA 3RIAF 4ZUVA 3RY5A 3BP7A 3VGBA 5BVPL 3IJYA 3KVQA 1PX4A 2FCBA 1DN0A 1S78D 5E24E 1S78C 5FYLE 5C6PB 3DGGA 4NJAH 3I9GH 5T1MA 4POZD 4U1IA 4HFUL 1RZ8A 5FGSA 3JVGA 3VXRA 5HGBB 3Q5OA 4H5SA 1K8IB 5I73B 2X4UB 2YPLE 2X4NA 4MNQD 2CDFA 2Y36H 4HKZA 3KPSB 3OKLB 5HHNB 4QRSA 4OFDA 2CRYA 4WHCA 1F6FB 4BZ1L 3FONB 1HCVA 4XC1H 2WBJD 4WWKA 2EZ0C 1QSEE 2OXGA 3VE0A 3STLB 1I1YB 3WFHA 5JXAL 3BQUC 4XXDB 4G42B 4ZSOA 1F90L 4DAGL 4RWYL 3WO4B 3AB0B 4DCQB 3QDJD 4UMGA 1C16B 3BZFB 1H5BA 1AGEB 4D0BB 4CMMB 1Q94B 2N56A 3M07A 2EECA 3F7VB 1B6UA 2BOCB 4L8DB 4Q97A 4FABL 2GJ6A 2F58H 2R4SH 3TWCH 2FB4L 4GOSA 5E5MB 1G7MB 4LCCC 1SEQH 4ZUSB 3PABB 2VL5B 4XAWL 1BBJA 1MHEB 3UX9B 1FL5A 3DVGA 4NNYB 4JFHD 4LLUB 4OZGE 3PUCA 4R4NC 2R56H 2IF7A 2JELH 4QHNB 3TZVB 5L88L 1KCRL 5HHOE 4P3CH 1H15A 3BXNB 1MHPH 3UYOD 4NO2A 2AV1A 3D0LA 5DJZA 3MOQA 4LF3B 3U48A 5L0QB 4EUPG 3UEZA 1G9NC 2VSCA 3WKML 4HSQA 1U8JB 4DZ8A 3JV4B 1XMWA 2H9GB 1MWAH 4P2QD 1DQDH 4FFZH 1K9TA 5DVKA 3PL6D 43C9A 4X99B 3V2AR 5KN5A 3I02B 4NQDB 4XNZC 4TQEH 4WHYH 5EZOH 5ILTL 3V6OA 1KB5L 1AQKH 5DA4A 4PJAE 5FYKD 5K9QG 3ZKXC 4QGTA 4KZEH 4M61B 5CEZD 1MQ8A 1E4XH 3FFDB 1WWAX 3TVMC 5D7JD 5JOPD 4JFDB 2QQLL 2BZDA 3GO1L 4NZRL 2E5EA 5IMLA 3G5XA 3QG6B 5EU7E 5EA0L 4MB5A 4XC1L 2QHRH 3HE6B 1XGTB 5DMGC 3X13A 4HUUB 5EFIB 1YNTB 4XBEL 2BRQA 5DQDL 2OSLB 3STZA 1I7TA 4PJAA 6FABL 4YO0A 2W9EL 4G7VH 3DMMC 1NC4A 3RDTD 1FNHA 1T22A 3SPVA 3RZCA 1RZ7L 5CEZL 2LE9A 1RMFH 3LS5H 1FE8H 3SN6N 3U9UB 1JF1B 1B4RA 5F89B 1NLDL 3VWJA 2LU7A 4DTGH 3MV9D 2EC8A 4XVSL 4AK1A 3PWJA 5E6ID 4D0DB 4LAQL 4UU9A 4MJ5B 2HLFC 1DBMH 3KLHD 4OGYL 5I75B 1BMGA 5KVFH 1KBGL 1UM5H 2J4WL 1YYML 2D4FA 4PREB 1FVDA 3HMWH 2BFVL 4U1NA 3H3BC 4NNPL 1MJ8L 2DI7A 4LSUL 4TTDD 4PFEA 4XH2B 8CGTA 4JFZH 5F7DB 3RVUC 5HD8D 2BXYA 1H8OA 1RZIB 4PJAF 4X9HA 4XXCA 1YPZB 3ME0A 2RQ8A 3AMKA 3IGAA 2HFGL 2QTEA 1QD0A 4U6XB 4X4XA 3UBXG 3S34L 4GBXB 3ARQA 1VACB 2O5YL 4F15B 1D5MA 5CSZB 2V5SA 3PWVA 1M6OB 4FQJL 3D39A 5C3TA 1U92B 5DO2C 4S1RH 4C56D 3NCEB 4Y19B 1ZHKB 4OB5H 4P23D 1WFOA 4GMTH 2OTPA 2WUBH 2X4OA 3VGHA 4DN4L 1DQJB 1IL1B 3P4OB 3WFEH 4G8FB 3SKUD 1YPZE 4JZNB 5TE6H 2A6KA 2H2SD 2ZKHH 3MRKB 1L0XA 1J87A 2JJWA 1ZVHA 4JY6A 3X11B 2VNCA 4OZHF 2VLLA 3T8XA 1GOFA 3D69B 2FR4A 5MENE 3NFSL 1ETZB 4NT6B 3QDJA 5CJXA 3P9LB 5F70A 3HRZB 3TYGH 5HYSA 5MHSE 4MHHI 3MODL 1KYOK 3DIFB 1AI1L 2DIJA 1G9EA 3HE7C 4W70A 5D96C 1KCVH 2Y5EA 3B9KD 4CGTA 3IAGC 4P2RA 2A0LD 3KLHC 2EH7L 4S1SH 4GRWF 2A1WL 2H32H 3NTCH 2BMKA 1S7SB 3A6CL 4OI9A 5EC1A 4YK4C 3ULUH 3L3KB 4HEME 3EOBB 2ICEB 3STBA 4OFYA 4BELD 2X7LA 5T1DH 3UTZA 3OKOB 3GHBL 5CILH 3MRQA 1IGML 3PHQA 5L7XL 3S3PA 2ATKB 2AKRA 4JFPA 1QVOA 3ZKMD 4X4XB 2BVUA 4KC3B 1K4CB 2VDRL 3QDHA 5D7IA 3V5KA 1IKNC 1KIUA 1DN2A 1T0PB 1K8IA 5JUEL 5IFHH 4PJXF 5F6IB 2ENSA 4Y1AD 1NGPH 3X3FH 3N1MC 1BQLL 4F3FA 3SGDH 4MDIA 3KPOB 4JN2A 1MCLA 4TUOA 4GW5B 3MBEB 2AK4E 4B7LA 1GIGH 5HTSA 2VZ3A 4HUKB 1FNGA 2AXGA 3QIWB 3OB0H 5DJYB 3LQAH 5ERWB 3H9HA 3N50A 4ZNCD 4X8XA 5HYSG 1BM3H 4DQOH 5F7HA 3QPXH 3BN3B 5J4MA 2QQKL 4JY6B 4DCQA 1CFTA 3HA0A 1DLHA 5DD3H 5IHZB 2RFXB 4LKCB 2EDJA 1PX3A 2P42B 1OGTA 3TIDA 1BD2A 3FAXA 3SDAD 3VFNA 5F96L 1WZ1H 3CK0H 4CVZA 1KPUA 5IF0B 3SDXB 3KLAA 4HWZB 1MCJA 2SEBB 2VDPH 3O2VH 4IM8A 3PDGA 5DZLA 3TPUB 4OIBA 3BZ4A 1JNHA 4JJHA 3BT2H 5I1CL 1FDLH 3OXSB 3RGVA 4PJEF 5IQ9A 4HJGB 3PL6C 5BRZA 1RZKL 4NCC1 4HWBL 4YHIB 5LG1A 3TFKD 1REIA 2OM5A 2OCFD 3IDXL 4JRYB 1OL0A 4YDLB 4P23B 5D1ZA 4ZTOH 3WKNA 1I3GH 1RIHL 4JRXE 2AJSL 2XTLA 3OJVC 3EZJB 2OX5A 5F88B 3KLDA 1S9XB 5T5FH 4U1NB 3JTTB 1QEWA 5AYUL 5F72S 4E42B 4PS4H 4R7NB 1JHKL 4HUVB 4KKBD 4NDMB 2G60H 5IIEB 1FFNB 1OAXL 5H37H 1VFOA 4KK6D 4H8WC 4R0LC 1DQML 3TM6A 3BDYL 2ZCHL 2XZCH 3NIFE 4MSWA 4NQCB 4XAKE 1IGMH 4ENEC 1KTDA 3NN8A 1U8KA 4J3VA 3TNNB 3FB7A 3MV01 4M43H 2Z35A 2Z31C 3VXNB 1AFVH 1XZ0A 4OIIL 2XN9B 1KENL 5FYLL 2QSQA 1SMOA 1JRHI 5D4QA 4LCWD 3NAAH 5DQJA 4JM4H 1NDGB 4N8CL 2NW2A 3QSKB 4M48L 4P9HC 3BKJL 2B0SH 4Y1AE 3VI4E 25C8H 4J1UB 3C6LB 5C08D 3X13B 4C55A 1WCBB 3L95B 3ZTJG 1CXKA 4WO4A 5HYEA 3V8OA 1OSZA 1T6VN 2XG5A 2FHFA 2LU3A 4RMUA 3UMTA 3CZFB 3KYKH 4NQDA 3C6LC 5BZWB 3VXOB 3C6SA 2UZIH 4LSRH 1CR9H 4OD1H 5GSVB 4Y4HA 2F8VA 1LD9B 2MKWA 4J12A 3SKOA 5GHWL 2BRRL 4EI6B 5JDSA 4EJ1C 5F9JA 2J8OA 4U3XA 3K1DA 4BZ2H 5FUZH 3TBSA 3S4SB 3QAZC 3QT2A 3F58L 2Q7YB 5GRUH 5ID1B 1OAUH 2VZOA 5EO0A 3DX8A 5GGQH 2X4TA 4LIQL 5EIQA 4BUHA 1IGYB 4JKPL 4FFYL 2HN7A 4GMSL 1DEDA 2B8OT 2IAMB 1YNTA 2IQ9L 2CMRL 5BXFB 4RGOL 1WV7T 1UCBL 4ODXA 2Q8AH 1AR1C 4Q0XH 5EOCH 2LU4A 4OZIA 1GZPA 3IDGA 3HPJA 2DBLL 2GEEA 3U7AA 1UG9A 5GIRA 1FL6A 4NKOB 1TJIH 3MXWH 4HGWB 3BIKA 4YAQB 1HDMB 4NZTH 1MIEH 1QFWM 3WO3B 4X6CB 3VFMA 3V8CA 3QI9A 1DQQA 4ZXBD 5DK0A 4CJ0A 3SGJA 2HVJB 2BERA 5EBWA 1QRKA 1KNOB 3RL2A 3VRIB 5CD3A 3O9WD 3ISWA 1LHZA 2ERJC 4UUJA 4WEBL 1CK0L 4XPBH 2OZ4H 3G6AB 2HTKD 1L7IL 1DEEB 4L9LB 3BVNB 5CS7A 5BRZB 4P2QA 1AHWB 2DBJA 2W0FA 2IANB 1JVKA 5LGKA 5E9DB 4LU5H 3LN5A 1QFUL 4BFGA 5F88A 3BPOB 2WNGA 4BSJA 1EUUA 4QNPE 3ILQD 3OAUH 1B6DA 3I6KB 4LSDA 4NN7C 2PNDA 3KPRE 4OM1H 4RWYH 1CIDA 2AEIT 3OF6A 3QIWC 3NIFF 5CSGA 1MQKH 1B0RB 2UWEF 1KJ3L 2YXMA 4G9FD 4YNYA 2GJJA 4O2FA 5H94B 1QR4A 1AGFB 4WU5B 5C8JB 5IKCB 1F3JB 1ADQL 1N0XH 1F2QA 4FFVC 4OFVA 2YD7A 1XEDA 3G6DL 5SV3A 4N0UB 3SGJC 3S5LG 3T0VA 3K2MC 3QDGA 2ICCA 2XA8H 2PO6B 3FO9A 2OYPA 1MHPL 3K74B 2O5ZH 4JZJB 1QYGL 3THML 2BNUA 5KSBA 1MJUH 4QXUL 1F3DJ 3O4LA 3B5GA 5ESAA 1IM3A 1LK3H 3FN9A 4IRSD 3GNML 2XQBH 1N3NA 1TNNA 4GW5A 2GIYA 1OP9A 3QUZA 5F6HJ 4DVRL 3FCTA 1H3VA 1RUMH 2R8SL 4OFIA 4M93C 4HULB 5I76B 5ILTH 1HYSC 4XP6H 2NY4B 2NY2D 3MRMB 4XRCB 3SCMA 7CGTA 5HYJE 2G2RB 1TPXB 5D9SB 3CLFH 5BO1H 4PP2A 5C0RL 3S6CA 4LDOB 1JPTH 1DFBL 2IEPA 3DRTB 4PLOB 5F6HI 5FV2A 3T65B 3GHEL 4Q6IB 1IEBB 5KVMC 3LIZH 1FYHB 4C57C 1Y6KR 3QUYA 2JB5L 1LQSR 2VLJA 3Q5YA 1NMBL 1CWVA 1U2CA 3ECBA 1KF9B 3N1FC 3H3PL 1CE1L 2QHRL 1EO5A 3TYFB 3UBXA 4EI5B 2E7LA 3FJTA 4PTUA 1T6WA 5AZ2H 5T33H 3G5ZB 3WXVH 1RUQH 5IB4B 1I3VA 2H8PA 2ZUQC 4QHMA 4XVUC 5J3HC 4R96B 4JRYA 4L3EA 1WZLA 2VDKH 4KROC 4HG4J 2NZIA 4U6HA 2YPLA 5EO1B 2YD6A 5DK2B 2VIRA 5HHOA 1FG2A 3M17B 4QOKA 4FTVA 2BNUB 4M5ZL 1H3PL 4KDVA 5ALCH 4GRLB 2FX9L 1YZZA 5EN2B 1GGIH 4RNRA 3TV3L 3QP3A 4U1KB 4WV1C 1T7ZA 3C5JB 3X14A 4Y8DC 4JG1H 4RGMB 4X6CE 4DKAA 1FZMB 3AXLA 4MZ3A 4GW1B 1NMCB 1A0QH 1EHLH 3BN9D 2X4OB 1BZ9B 3FRPA 4ODVH 1HE7A 4UQ2B 5CD5C 5T1KB 2GY7B 4GKNA 4NNPH 3RTQA 3KG5A 2CRMA 1Z5LA 2AK4B 4OLEA 1YYLL 3CVHB 4P2OB 4L8SA 4X7TB 1NC2B 1II4E 3DRTA 5GISL 5TJWK 4OJFL 5CZKA 1MUJB 5JPMA 1PEZA 1P4IH 5EU4A 4JREB 4ONHB 1J0ZA 2XV6B 1G7PB 3AS2A 4MXWL 5K59F 3AS0A 2FWOB 1I7UB 2R8SH 5BJTB 5MP6L 4I2XE 1DBKL 2HJFA 1YJDC 3O8XB 3L3DA 3QUXD 5EBLB 1WT5A 5F1IA 3MV7A 4QHUA 4FXGB 3O3BB 5F8QC 1S7TB 1T80A 5DO2D 3BIBX 1XR9A 1TZHA 1HIMH 2NY6B 2BOBA 2O5YH 5I74C 3CZFA 1S7VB 1AXIB 2AJZB 5DRNB 4P3DA 4P49A 4EXKA 5GS0C 5DK2A 5M94B 1NGZA 1NLBH 4Y2DC 1AD9A 1T66D 3ESUF 5TDPA 3RI5F 4HIEB 1TZIB 1U8PB 1I1FA 3Q3GB 3V5HA 2XN9A 3CFEA 1OT1A 2WUBL 3TGXA 2QKIA 1M7DB 5IFJA 1A9EB 3OXRA 4OD2B 5KBNC 1MAJA 1U42A 1UWGL 5JA9A 4Y1AB 3N0PB 1T7WA 1FH5H 4LLDB 4Q9RH 4G6AD 5HHXL 1TVBB 3SDCB 5C6TL 1U8HA 3LDBB 5E5MA 5DVOA 5DD0H 3HAEA 3CFCH 1OVZA 4GXUM 4BH7A 4WJ5A 2A38A 1SBBA 5D1ZD 2V9TA 2R69L 4ZPVA 5JIHA 2GTZA 3G9VA 2BNQE 3MOAL 1OT2A 1P7QD 2HTLD 3CFIC 5GS0D 1I7UA 4NKOA 2EH8L 5BV7B 4HKJB 3KPQA 2BJML 4O58H 4XXCC 2A9NH 2W65B 4HWEL 3MV7B 3CDFA 4NJ9L 4U6VH 1ED3B 1FVCB 2NY5H 3V52L 4NQEA 5CZVL 2XKUA 2VLME 4O9HH 3SCMC 3MV9E 3TA3C 4ZAKD 35C8H 4P5MA 3LVEA 1HYSD 3FOMB 5DD6B 5DEZA 1E0OB 1KEML 4HK3N 2WINA 3D5OF 2GUOB 4C56E 1LWRA 4R3SB 1YN6A 4WI6A 2M8XA 4Z7VA 4D9RD 5BZDA 4XPTH 5DWUL 4O02H 3RU8H 5HGBA 5HGDA 5LGHL 1TQBB 5BQ7B 1LP9B 2IBBA 4OZIB 1I7ZA 2ADGA 4GKZB 4HK3J 2YMXL 4JHAH 3RFZC 3V0VA 3ROLB 3LKPB 2DQUH 3HI5H 1CL7L 5IBUG 1SBSL 3CK0L 3G08A 5FOJA 4XXDA 2ZCLL 2A9ML 1DL7L 4P5TA 3KPMA 2P48B 4QXGL 1XGPB 3BEVB 1EHAA 4MDIB 1HHIB 3FB8B 1P9MC 5MEOB 1NJ9B 2J88L 3DJ9A 3JWOL 3OKNB 5J12B 4P9ML 3QH3A 2GJ6B 5D7SL 2XZQH 5ICYB 3UZEA 3O3AA 2W59A 1NGYB 2B4CC 3MYZA 2P8LB 4N9GA 4WFEE 4LQ1A 5L0QC 3W9DA 2GK2A 3DVNB 1HN1A 1ES0B 1UQSA 3H42L 3IETB 3CXHJ 3QUMA 3ARUA 3KPSD 4MX7B 4RFEA 3U1SH 1BD2B 4X9IA 4RRPA 1OF2A 4JPIA 4KK5C 1U8MB 1DQMH 3ZMRA 4QHNA 1ZAGA 3WLBB 3L7EB 4M5YL 3WFCL 3IXTB 2EKSB 5HVGB 2V7HA 2WWKO 4I0PC 2KQNA 5DJZB 3HG1D 3GIZL 2BSED 5IUSA 1J8HB 1NCBL 1KTLB 1ZT4A 1PYWB 2YZ1A 5CBEB 3FQXB 5F9JB 4U3CA 4PRHB 2YN3A 1RJLA 1AKJD 3EYFA 4ZTPH 1RZIA 1I3RA 4BJLA 5I8KL 1A6TB 1A1OA 5J6HB 4ODTH 2QQNH 4Y16B 4C56A 5T1MB 1MCWW 1I7RA 3D39D 3BKJH 3BH9B 2F8OA 1KJVB 1INQA 4XMLL 4AEIH 3ZSSA 1V3KA 4Y16C 2ZUWA 1OGAA 3OXRB 4JHWL 4OD2A 2AJVH 5EU5A 2VLKA 2VDMH 3FONA 3OAZK 1JTTA 1W8OA 3EW3B 5H37G 4LRNL 1CL7H 2FIRT 1KGCD 1HILB 5J11B 3DMMB 4FXKA 4DVBB 4K7PY 1MJ7H 2WQ8A 4MAYA 7FABL 2EZ0D 3WS6A 4N68A 5D6DA 1I9JH 5ISZA 5DRWB 4JFOA 2AJUL 3PWPA 4OCRH 4KUZH 4AQOA 4YJZL 2XPGB 3TF7C 4YO0B 1UQSB 4HLJA 5DJXB 4HIXL 3T4YB 1JZ5A 2DYPD 3QEUA 1L9NA 1U8MA 3EFDL 1P53A 3GJEB 4L3CB 1RZFL 3MCLH 3W11C 2D2OA 1TMCB 2VZVA 1N59A 4AMKH 4LGRB 5DLML 1D6VL 1ZHLB 1QFWL 2CMRH 3D85B 3TA3B 3TCXA 1IGTA 4GG8B 2JK5A 1FNEB 5JHDD 1M7XA 5ITBH 3ZTJH 1I3RB 4HCRA 4UOW0 3MCKB 2QSCH 1GAFL 2YPLB 4Y19E 1ZA3A 1BVKA 4FNLH 4UIKL 3ZE1F 3SJVA 4M7LT 4PJFE 1NGWA 2YR3A 1UKTA 4FQ2H 1V5JA 3LOWA 5F71A 3S98A 4Q0XL 3GI9L 5EOCL 1KACB 3B4NA 5GS1B 2R2BA 4BQBA 3CD4A 2YD2A 1F3JA 1TLKA 3K8LA 1WCQA 1E4WL 4MNHA 2PXYD 1N7ML 1JGEA 4KGJA 4NCDA 5DJAB 2FECI 3QZWG 1G6RB 1XIWA 4CU6A 3ZYJA 4L4TA 5I8KH 2AJZA 1A6ZA 5DRNA 3MLRL 4MB4A 3MJ9L 5F93C 3T0EB 2XWBB 5FA4B 3IGAB 1IGYA 3SKJH 4H26B 4W4OC 4HC1H 3CSYB 1AD9B 1JYWA 4HGMA 4XPBL 3WCYA 3HCVA 1C1EL 3IDYB 4YUEL 5FUCC 1BIIA 3VWKC 1T0MB 2ORBH 5DGQA 1U6AL 3KXFE 5JPNB 1QA9A 1X4XA 2QKIB 5SX5H 4BSWB 2XOTA 1Y18B 5FB8A 1XR8A 3AS3A 1AXTL 1NGXB 3PQYA 4I8DA 3BISA 1N2RB 2VDML 2CDGB 2KH2B 2E7LC 3C5SB 5E4IA 2AK1L 1WT5C 2X44D 1QBMH 1UACH 4KDTC 3QWOB 4I5BB 3WS3B 1G7QA 2VXUH 2EDEA 2C1OB 3ZKMC 3ARRA 12E8H 4PLKD 1Q1JL 5DMIL 1KGCE 5CD3B 4BA8A 1TVHB 3T65A 4QY8A 5EBMA 3WJLC 2FSEA 4OLUH 4YIQA 4EN3A 1MCPL 5T5NF 3AAZA 1P1ZA 4NO5B 3UPRA 2DL9A 1EVUA 2O5ZL 3MBXL 4NQEE 4PBXA 1CXLA 1FLRL 1FP5A 2QR0A 1QQDA 2D4DA 3O2DL 4Z7UB 3ZHKA 5I73C 2EXWD 4X8JA 2NLJB 3H3KA 5I9QC 1CVSC 1JGEB 4Z78A 2R1XB 2EEBA 2DL2A 3PP3K 1EPFA 1MJUL 1RU9L 2HWZL 3BGFC 3F7YB 3VA2C 1I85A 3IFOA 5HHOB 4H25A 1FFRA 2YEZA 2XZCL 3FB7B 5LBSL 2GSIB 2VQUA 4PRPA 1JI2A 4OZGB 1JFQL 1G9NL 1KB9J 1PVHA 2PUQT 1BZ7B 5D7IE 3WDIA 4AH2A 5E2TL 1UADC 2EIDA 3HC4H 3TT1L 4NHUB 3ORJA 1NL0H 1W8NA 3MLRH 4K9EH 5SWQA 3MRHB 1HWHB 1MWAA 1KLUB 4MCZA 3NMEA 4JZOA 4OM0H 4X6DA 3U7YL 1CGWA 1H3WM 2Y7QA 2YD5A 4GAYB 1ACYL 4OZHA 2H2SC 1WC7B 4I4WA 4PG9A 1S9YB 2WBWB 5GRJH 4X9FA 2EO1A 3ZDXF 5FA3B 5FHBH 3JSSA 3MQIA 2UUDH 4XVJH 5E95B 4D94A 3K2UL 4GXVL 2QJDA 2Q20A 2FEEL 2ICWI 4DFHA 4LSTH 5CP7B 2EICA 2IALB 3T1FA 4NKIL 4A6YA 5B22A 5CCKH 1ES0A 3QUMB 4GBXC 4JCLA 3RIFF 3ZE0F 1X5HA 5IB2A 4TUKL 1B4JH 3OZ9L 1C5CH 3O3EB 5E03A 3GGWA 4LGPB 2R1WA 1BJ1H 3TVMA 1IQWL 3E6FA 5JORB 4GQ9H 5ISZE 3IFOB 5EOTB 1E4JA 2Z91B 3VFOA 3WIFB 4WW2C 3AM8A 3SDAC 5JW4N 1NEUA 1ZT4B 5F3HB 4PY7B 1A5FH 2H8PB 3T2OA 3MNVA 3WN5B 3PHOA 4OZGF 4K2UL 3GUTA 3MRQB 5CJBA 5ESQA 4S2SA 1CDUA 5JNYA 2HG5A 4FFWC 2PKDA 1DQDL 4DUXA 4M1DL 3ZE2F 4G42A 1QOKA 4RAHA 2I5YH 5D72H 1F13A 2Z35B 3MRHA 4X6CA 2YHGA 2RCSH 1S8DA 1KB5H 3QUKA 4K3EL 1A64A 3MXWL 2YUWA 1MH5A 3IFPA 4MXWH 1NAMH 1R3HB 3WE6A 5SWZD 3FB5A 1A3QA 1MRDH 3WNMA 2ZJSL 5ANMA 4JG0H 4TQEL 5C07D 5DQJB 2P5ED 4LNRB 3T2PA 4HZLA 4L3EE 2BHUA 5T3XE 3H2WA 3ZYOA 3HUJF 3QQ4B 4E5XB 1PD6A 2W65A 2PW2B 4RAUB 1CFTB 3UZQA 5F7MC 5D93C 4AIZA 1NC2A 2EXYD 5CWSB 3UZVB 2AV7B 1HH9B 4U7MA 1L0YA 5CZXC 4Y2DD 3TJEL 2R1WB 4ODSL 1OPGH 1JE6A 1R24A 3B83A 2HJFB 2DOCA 4V1DE 5GGVL 2C7UB 1SEBA 4OUUA 5HHXH 2QR0B 3OKEA 1BVZA 1J1PH 2IH3A 3MX0A 4GXVH 3NZ8A 1Z9SA 3FT2A 5I8EB 3WEXA 5F3HA 2R0KH 4P99A 1GZQA 3M45A 3I2CH 4GLRI 3FFCD 3O4OC 5J1AB 3LZFL 5I0DA 3IAQA 3T0WA 2B2XL 2A77L 1J1OH 4OKDA 3WMSA 5DD1H 3GKWH 1AO7A 4D0CA 4XWOC 1IQWH 3VFWB 2H26B 1EFXD 2A83B 3LS5L 1GHFL 1FE8L 3P77A 4B50A 5GS1A 3S96A 1HHGB 3MXVL 3SHSA 1GGTA 2W38A 2F9BT 3DI3B 3HAEG 4PB9H 4F7CA 1ZGLM 1SY6A 5ISZD 2UWEA 3PWUB 5FDWA 5KSBE 4F2MA 5IMLB 3MUHL 1A6ZB 4IJ3C 2IQAB 4ONFH 5D2NA 1JYXA 2BNRD 2J12B 5EDXA 3GZKA 1T1YA 5J6GB 1NAMA 1DQQB 2EDXA 3VCLA 4O9HL 3WLWD 1P2CA 4XP4L 3VH8A 3IU3A 3KPLB 1G6RH 1U8QA 3HUJE 5I9QB 3KPRA 1K4DA 4GSDL 1P84J 5HGHA 3MOBH 5BV7L 4UUJB 4X5LA 3L3GB 2FBOJ 4LVHC 5E1HB 1CDBA 5JDJA 3CFBA 3MJ7B 4XZUB 3V4VL 4WTZG 3MRJB 3SE8L 3WLBA 4NGHL 2K1MA 4KQ4H 3H7BB 1S3KH 3WXWL 3X3GL 5FO8A 3HFMH 3BP4B 5E9DD 5J3HD 1UB6B 1KTKE 5C07A 2CDFB 3FT3B 1HHKA 1F4WH 3TEUA 2HFFA 4LVHB 4LMQI 4XPFL 5F9AC 1VFBB 5EBGA 3SDXE 1OARL 2XWTA 2Y6SD 3O6MH 5FYJH 3B8YA 2JB6B 2DYPB 4H26A 3AROA 5CIPA 4Y5XB 3NOIA 2VDOL 3DX6B 2UV3A 2CJUL 2A74B 3BO8A 5I2IB 2GFBB 5HYQB 1RZGB 3MFFA 2C3WA 4K7FB 4NWTL 4X6BB 4DJMA 5C0GB 2XZQL 2AXHA 1J0JA 4N0UA 3BW9B 3RTQC 4PRHD 1IGIL 4Z7UE 5I30H 1N2RA 1T5XB 2R39A 5MEPB 3R06B 3ARGB 4PIRF 3CDYA 5C09D 3VFGL 4OZIE 3HI1B 5HPMB 1VA9A 3D25B 4QTHA 2WWMD 2C3HA 3D39B 3GKWL 2GSIA 4LOUC 2EDYA 5DR5L 3H7LA 1TQBC 4YPJA 3VJ6B 4NJAL 1V7ML 3LN4A 4OGXL 3ULUL 1CXHA 1W72H 3FFDA 3V9FA 1W0WA 4HUNB 3MXVH 5T3ZE 1GZPB 3IDGB 4WI9A 1UCTA 2VLRB 1PAMA 1K5NA 1F5WA 1JZ7A 5JW4R 4LCCB 1KPVB 1T2QL 3WJLA 1VCAA 1X5XA 5FO8B 4PTTB 5IFHL 3DXAE 1QQDB 1UKSA 1ZWIA 3VXSA 1ZE3C 1FO0B 3OKYA 4GAGH 2OSLA 5JW3H 4RX4A 2EC9U 4DZ8B 1MOEA 3CFDB 4G6FB 1S7XA 4RISH 5DD3L 2ESVA 4EI5D 1ZA3B 4HH9B 4E41B 4KJQC 5E8PB 2R23B 1KJ2A 4DQOL 2X4RA 4Y7MA 1XCQB 5BS0A 1J8HA 1NGWB 3UTTD 1OSPH 5GZND 3L6FB 1E6OL 4TNVF 3CFKA 3T0EE 3LH2H 1YJDH 4OCRL 1XF5B 3BT2L 2XQYG 2C3VB 2N1KA 2AJ3A 2YPVH 4OGAC 4QHMB 4YR6B 4WFED 3PGCB