1LEGB

Crystal structure of h-2kb bound to the dev8 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison of allogeneic and syngeneic T cell receptor-peptide-major histocompatibility complex complexes: a buried alloreactive mutation subtly alters peptide presentation substantially increasing V(beta) Interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1legB00
2DQCH 3ROLB 2JF1A 3QUYA 4HKXB 3CPLA 3DX8A 3MRBB 4ZDHA 4CAGA 4FFVD 3OKLB 1TPXB 3QWOA 2D7TH 5BRZB 1OGAB 1IBGL 5DJYB 1MREL 4ENED 2NLJB 4HV8A 1QFWL 1KFAL 2Y06L 4YO0A 5FGCE 1WGOA 5CZXC 5TDOA 4LBEB 1NCAL 2R2BA 2Z91A 4AENA 2CLVB 4L8BB 3RTQB 2GY7B 4CMHC 5HYQA 1FAIH 3QDJB 1K8DB 3GJFB 3S34H 4FQIL 5HGHB 3AB0B 2ZP0T 3S35H 2AQ2A 1AR2A 3QXAB 1T5WB 5IT2L 3DO7B 2YPVL 4H5SB 5GJSL 5D1XB 4EI6A 3V5DA 3O0RL 2HT4D 1T0PB 1NC4D 3DURA 1XMWA 1CGWA 3QULB 5HYQB 4RBPK 2IPKA 1Q9KA 5GZOC 1MY5A 1CFTA 3BE1L 3E2HB 3AM8C 4UV4H 3BPOB 2B5IB 4F2MA 1N64L 3HS0A 2NLJA 3WSQH 1DQML 1NGYA 1I1YB 1NGPL 4FXKB 1S78C 3QA3A 1ZA6A 2OL3H 1D5IH 1UKSA 5FGBC 5CJBA 4HF5L 5I71C 2Q3AA 4KUZH 1HKFA 3GSWA 4P4KC 4P5TC 4X6EB 1DLHB 3H9HB 2OQJA 1NGZA 2J1KA 3BP6A 3GKZA 2A1WH 5DJDB 2DYPD 2JIXD 3KG5A 3KYAA 1EAPA 3MLTB 4N0YL 4LFHG 3WS6A 1KC5L 4G6FB 2PNDA 3VGDA 3TNMA 2FH6A 4GKZA 2JJTA 3IU3B 3QIUB 2BSTB 3GO1L 4XPAH 4Y5VA 5FF6A 5DMYA 4GW5A 3PWUB 4OZ4A 5CJOL 5FM5O 4KI5E 1FDLL 4IRJC 2Q8AH 4XNQA 4X6CF 2OJZL 2YD4A 4P4KD 1FSKC 3HI5H 5HDBE 1RU9H 2PO6D 5D2LE 3MX0A 4ERSH 1M6OB 4K7PL 5JW3H 5T3XE 3CMGA 4HIJB 1I9RH 1F13A 3TBTB 1DEDA 4P2OB 5IB3A 2PO6B 4QYOA 1C7TA 4OCYH 1A5FL 3V52L 3OJDA 4UILH 2DLHA 4G9FB 1P84J 1QSFD 1CE1H 3FHAA 2D03H 4HMDA 5DA4A 5KSBF 3VW3L 1V8HA 2YPLE 3UROR 3DX7A 1TENA 3TT3H 3O2VH 1RUQL 1S7QB 5IVXB 1KEML 4Z7VE 3SKJH 2P7TA 1F02I 4JO3H 5FM8A 1NKRA 1PLGH 4ODUA 2BVOA 5ISZE 4JFEE 4EXKA 3H9SB 4BSWA 2QSCH 1CGVA 5KVEL 5KSAD 3BWUC 2RIKA 3VD4A 1QO3B 2J7LA 2XWJA 4PRHD 4EI5D 4DN3L 3L3JA 4HH8A 3OR6A 4XP6H 1YPZE 4TTDC 3QHZL 2VYRE 4K3JH 4LQ1A 4H8WC 4G43A 4OFIA 5JORA 2CDEB 5E6IA 3VD3A 4JO3L 5EZOH 3TBWA 4OGYH 3CFJB 4BZ2L 1CDHA 3WIFB 3O6LH 3UZVB 4MA8H 4GQ9L 5DJ0A 4Z8FL 1KTRL 3LSOA 1HH9A 2O5YL 4UV7L 2M26A 3TO4D 2R9HC 1XZ0B 4YZFF 2O61B 1PKQE 2PXYC 1ZANH 3GIZH 2VZTA 3IDXL 2KZ1B 3L5XH 5IJVA 2VLRB 1ZMYA 1TVDA 5MEOB 4FP8L 2UZIL 3BKJL 3L7EB 1JV5B 1YNLL 4JFEB 4UDUA 5CSGA 4X4YA 3D87B 1HN1A 3D2UB 2BFVL 1LGVA 5JORB 3SOBH 3ESUF 1FE8H 1KCSH 5DK0B 3W2DL 3GUTB 4X4XA 4NM4L 3P4LA 1IFHL 1UEMA 4LDOB 1UACL 4HJGB 5MERB 2V5YA 1X9QA 5IB2A 1AKJA 2UYLA 3DMMB 3T4YB 2VSCA 1HH6A 3WEXA 1HOCA 4ODTL 4K9EL 1R3HA 4S1SH 5DQ9A 4MVBC 1DBJL 4LEOB 2V7NA 5L7XL 5CS7A 4F3FB 1N5AB 4Z7UA 4X7CC 5JIPA 4Y16C 1QQDB 5HHPA 3ZTNL 1A6AA 3BGAA 4B7LA 1INEH 3WD5L 3BOVA 4RQQA 4G42A 1W0WA 2I60L 5D4QA 1FPTL 2X09A 3MOAH 2IAMD 4PJBF 4WU7A 2AXJA 4XTRD 2A74B 2R2EB 4G6FD 4RAVB 2CXGA 1A9EA 5DMGD 1GGIL 1A3RH 2LVEA 3L7FA 1HHGA 2V5TA 3KPTA 3V8CA 5L8JB 1S8DB 5GGRY 4IJ3C 2R23A 3S8WA 1OARL 4IOIB 1MFCL 5HHXH 1F8TL 3LCYA 1HILA 1M6OA 2X6MA 3OJVC 1M7DB 5EOQH 2DN7A 5JOPE 4NUJB 2Y7QA 4XAKE 3GGWA 2MNUA 1CFVL 3U36B 1I3GH 2MHAB 5EB9A 1SYSB 1TZGL 4Q9RL 2M1KA 2ARJA 4JR9L 3LN5B 2IALB 3QIWC 1A7QH 2H1PL 3IFLH 3LS5L 3C5ZC 1BLNB 3P73A 1XIWB 1MCEA 3GK8H 1WFUA 5TF0A 1NC4B 3ZDZE 1ONQA 1J87A 4MLSA 4EIGB 3I84A 3MRIB 3I50H 1DVFC 4JRXB 1CDUA 4JPKL 3MRHB 1D5MA 1HKLH 2DQDH 5LGKA 4APQD 2H2SD 2BRRL 3U9UB 4LLVB 3ILPB 1MEXH 3BZ4B 4MSWB 3BFOA 1YDPA 2EIEA 3WHXA 4KUZL 1N7MH 4YX2L 3DGGB 1AD9B 1CFSB 1H9VA 4WEBL 3NFPA 4LDLB 5I8OH 3LEVH 4OM0H 3C9NA 1Q72L 1DTUA 1O0VA 2MKLC 4F7EB 3P4OA 3C08H 2X4PA 5GGVH 3HC4L 3IJHA 1BZ9B 2WBJD 3L1OL 1LE5A 1JGUH 4BQBA 1BFOB 3HI5L 4PLKD 2VRAA 2CO7B 4JM2C 5CEZE 3JUYA 4MDJA 2VZ1A 4PB9H 1B9ZA 4ACPA 4G8IA 5K59E 2GI7A 2OL3A 2FSEB 1RFDL 1I1AD 1NGXA 1UEYA 2B20A 3K4DA 4HUXA 2ZNXA 5C0AD 1VERA 1SJEB 4IRZH 3VFSB 1L0YA 1KNOB 4A2MA 1EVTC 3RJQB 1MFAH 3U0PA 3RFZC 2IWGA 5F9WB 4KV5F 1LNUB 5C6WH 2EO9A 2RCSL 3KYNB 1C12B 4Z77B 5GGSB 4KV5E 5I1HL 4HS6A 1T4KB 2DQFA 4RGOH 1XCQB 4LPUA 2GHWB 1D5BB 5FGRA 5T1KB 2ATPB 2XKUA 4HUVA 2DAVA 1KPUA 1KJ2L 2J2ZA 1CLCA 3T8XB 1QBML 1DBAH 2ZUQC 3HE7D 3OKMA 4OF7A 1EGJH 1R3KB 1EEQA 1EHLH 1HSAB 2J8OA 1ZHNB 3QHZH 4NQEE 4NO2B 3TO4B 2IF7A 3MV9E 3VFOB 1JPTH 5JW4Q 1MI5B 5ITFB 2ZG2A 2VC2H 4MQ7A 4Y19D 1FFNA 4R26L 3ALWA 5E2UH 1NSNL 5ID0B 4G7VL 5I1IL 2AEPH 4GW1A 2FATL 1SEQL 3SDXF 1EHNA 3GMQB 4C83B 3VU2A 1WZMA 5EU6A 5EUKB 3MCLH 3PGCA 1DQJB 1IJ9A 4TUJB 2AK1H 3VFNA 3QJHB 2FEDD 4I9WD 3GSVB 4U0QB 5FO8A 1DBML 4X6DB 4I9WE 1NC2B 4BK4A 5EC1B 4OCXL 5BO1L 4JFFD 3N1MC 3TO4A 3GNML 5LGJB 1GHFL 4UIKH 4P2OC 2EH7H 5I1CH 5KBNC 1XGPB 2GITA 3SQOL 3ZT5A 5F3BA 3C6SA 1PLGL 4V2BA 1FNAA 3FN0H 3OKMB 4CNIB 1WWAX 1CD1B 1F42A 2IJ0C 5F8QC 5B38G 4X5WA 4KK5C 4P2QE 2DWDB 3SKNB 4YHOH 2OTUB 4R0LA 2H6PB 5CD5D 5EO1B 4X83A 1D6VH 3AUVA 1IM9D 2FEEI 4QWWD 4Y5YA 5JIKA 4QHUA 1G7PB 2DQUL 1J05A 4LHQB 3P77A 2G9HA 1RIVH 5BJTA 1YEHL 3GBML 1MWAL 4ZFOA 1Q94B 2YRPA 5DFVD 3QRGL 3QDME 4QF1A 3TC9A 3U4EA 3F5WB 3VXUD 1NKOA 5B8CB 1BWMA 4MJIE 1AD0B 4P4KB 4WTWA 2Y36L 3IDNA 4G6AD 3LS4H 3MRNB 4EVNA 2PW1A 4KMLB 4QOKE 4RMWA 5AWNH 5KZCD 3ULVE 4LQFL 1NLDL 1YEDA 2KUTA 4BFIA 3QIUD 4OTXL 4R7NA 1N6QL 1GAFL 1T04A 5F89B 1EUUA 1UC6A 4Z0BH 1BFOA 1JPGA 5IB2B 3CZJA 1K85A 2JIXB 5DUPH 1U8JB 2VXTL 1JMXA 3G08B 4YH6A 3O6ML 2FNBA 3HR5A 4P46D 3TIEA 4B5EA 4M7KL 1YEFL 5D1XC 4OLZH 1N6UA 1N59A 3RWGA 5ITBL 2AEQH 3L7EA 2VNCA 2R0WH 5I76B 3D3VE 3QEQA 2UV3A 2FYYB 5CIPA 1AGDB 3NFSH 1U8OA 3V6ZA 1A6WL 4UUJB 4PBXA 1A1NB 2HN7A 4JO4H 2JJWA 4MNGA 1IAOA 4WHDA 3HB3C 1CU4H 3MREB 2R39A 5GSRB 3MRHA 1GIGH 3T2NH 2W9LA 2ICCA 4HUUA 5D1XD 1MPAL 35C8L 3CVIH 1A6UH 5KS9F 5F6IC 3MJ7B 2EIZA 4FNLL 4MNGB 1R5IA 2IFFL 3VFTB 5CJXC 5TE7L 5E5UB 2YMXH 1WEJL 4NZRL 3S5LA 3WN5B 4XC1H 3ZYZA 3I2CL 1BX2A 4LHUA 2B4CC 3C2SA 4L29A 4TSBH 2B1AL 2ZOKB 3TF7C 1OAKH 4HXBL 2ADGA 2YD8A 3TPUB 1OARH 2NW3A 1IAII 4NYLA 1RK0A 5F71A 3CH1A 3VXTA 4FFWD 4RWYH 5FM5M 5DEFB 2HFGL 2Q86A 4YHZH 3B3IA 1T0NB 2ITDB 1AJ7L 2WBJA 2VIRA 1J10A 1QACA 2N7BA 4TVPH 2Q8BH 1Q1JL 5D7LE 3ARBB 3I2CH 3O2DH 1P7QD 1FO0H 4A6YB 4U2YA 3DROB 1TIUA 2KKQA 1JE6A 3KJ6H 3RWJA 5GS2H 3ULUE 3MO1A 4NCDA 3O9WB 4FQQB 4G8GB 5ISZB 5J1AB 4QEGA 1XH3A 5SWQA 2SEBB 1I9RL 3BZEB 4PJ5B 3MJ8A 4HFUH 1A14L 3CXHK 1MJUH 4JFDA 4NM8L 5IOPB 1CFBA 2PXYB 1QUNA 4L4VB 1KEGH 3VFVA 1E4JA 3GIVA 2C3VB 3MV8A 3BZEA 3HFMH 3ESVF 3UBXB 2P48B 4C55A 2JJSC 2UUDH 1QPPA 2HH0H 4KGJA 3BWAB 4XCYA 5KSBB 4XVSH 4PJDE 4WUKL 4H88H 3PE9A 4JFEA 3U7AA 4JQIL 1A3LL 2C4XA 3UDWA 2P5WE 4CKVX 3FRUA 2VXVH 4YXHL 3ARDB 3MRMA 3KPLB 3M8OH 5SWZD 1KELH 1OSZA 4ODVL 5JOFA 4PJGE 4OZGA 4X6DA 2CXKA 2ZG1A 1YNTA 5JNYA 5DRXA 3REVB 1QD0A 3DGGA 1OTSD 1SBSH 4KROB 4MQTB 4GQPH 3OR7B 1IE5A 4NYLB 4N68A 4KK6D 3I02A 4LSTL 3PGCB 2VQTA 3QIBB 2Z4QA 4TSAH 3MMEA 4XPGL 5ETUB 4P9HH 1L4IA 1JUFB 3WJLC 5HYEA 1MCCA 4HHAA 1P1ZB 5E9DD 4ZOBA 1GZQB 3CAFA 2R29L 3O4LE 3WLBA 2BDNH 3A6BL 4LLQA 1P7KB 2XA8L 4KRPB 3GSRB 1AXTH 5HJ3B 4ORGB 4PY7B 3OR6B 3VFVB 1KF9B 1GC1L 1N2RA 3CSGA 3WXWL 1QR1A 1N4XL 4JFFA 3QJHA 4PBWD 5SWZE 2AK4B 1HCFX 3ULSB 3LY6A 5D1ZA 5IJKA 3FTGB 5GGUB 1U0QA 1RY7B 5BS0A 1YNLH 1LO5B 5D1QB 1EHLL 4Y8DC 1FO0L 4Y88A 4ODSH 3SBWC 1QVOA 1V3KA 4O02H 4NPYA 2W38A 4IRSD 1LWRA 1XGTB 5GRVL 4MZ2A 1G9ML 5ACZA 4JKWA 2MKWA 3KDMB 4Z77A 1NANI 5BMFL 4OLWH 5J13B 1X5LA 3CSPA 1Z0MA 5LXGH 3UX9B 1TITA 3QFDB 3KLHD 2XIDA 4U1LA 5A43C 2OZ4L 2JCCA 1GGBL 3DYPA 4R0LB 1INQA 3UAJD 4WI9A 4LNRB 3X11A 3HR5B 4JAMB 3TIEB 1G7QA 3QI9C 3T0EB 4OZGF 1ULVA 1EDQA 2B2XL 1FNLA 4IOFD 5D1ZB 1DUZA 1OAUH 4R7NB 5F6HI 3RZCD 5FF6B 3PWUA 4L3EE 4MA1C 1JCKA 4GG8B 4HX1B 5F44A 5FUOH 3S7GA 3VG0H 4GAYB 5D70H 2W9EH 3DXAB 1ZTXH 3QUYD 1IZKA 4OI9A 4OV5A 5DMIL 4LVNB 4U1LB 5J11B 4HWUA 5EUKA 3LQAC 4IOFC 5HD8D 4NCC2 4U7KA 3ZKND 2R1WB 4X4MA 4DUWA 2UZIH 3BKJH 3MNVA 4X0KB 3PWPA 2QQKL 4W6XB 5AYUL 3OGCB 3SKNA 1BBJB 4TQEH 3PF2A 4CN1A 4UB0H 3HE6D 3MR9A 2ZCKH 4TOYL 3LKOA 5CJ8A 4L3ED 2AKRB 5I1LB 2VN7A 1WAAE 2XYCA 3IJSA 4XPHL 2QADB 4B0MM 5HYSG 3DURB 2VDMH 4U49A 4F7EA 4HUKB 1TPXC 3C60C 3PGDA 1YEEH 4G6MH 5MHSD 4YDLC 2L7JA 2KL6A 1A1OB 1JGDA 4DUVA 5L7XH 4GG8A 4OD1H 3HNVL 2IEPA 3BGFB 3R1GL 4QRRE 1N5YL 1IAIM 5CINL 3WLBB 5IEHA 4Z0BL 1AO7B 3BH9B 3KLDA 2NXYB 5CD3B 4JQXC 2Z31D 3LKRA 4MB5A 3NA9L 5C09A 3T3PF 3BX7C 4F57L 2BVUA 1H3TA 1KB5H 1RVFL 1E4KA 3BGMB 3F5WA 4F8TA 4QF1B 2HFFA 4E41A 1HHGB 5SWQB 3NCJH 1EEYA 1VGEL 4JN2A 1MFEL 3U46B 1MCJA 2YUZA 1ZGLP 3W39B 4GAYA 4KAQH 3PDDA 3DYMA 5DD5H 5F9DC 1CDJA 3ULUH 1S7XA 3HPJB 1PX3A 4N5UA 1NUFA 1WJ3A 1MJUL 2YD3A 3FT4B 1KPVA 1N26A 1ZGLB 3U48A 4QNPE 1MCOL 2NY1B 4HGKC 3U7WH 2GY5A 5I9QB 1FGNH 1S5HA 4U1MA 5E6IC 3F7QA 5C8JB 5KVGL 3OG6B 4IS6B 4C54A 5CBEA 3LN4A 3C87A 1MSPA 3DMMA 2IANA 2EE6A 2CIIA 4EUPA 2IAMC 1QFWM 1G7JB 3MRCA 5T1MA 5CJOH 3CFBA 4Q74A 3S5LB 3WN5A 4NZDA 4P59H 3O4LB 3BD4A 4UT6H 1QQDA 3MRDA 5HHPB 3U1SH 1BQHG 3MO1B 2YR3A 3HMWH 5E6ID 1YEJL 5F93C 1QLEL 3WKMH 4PUBH 5TQ2L 4OQTA 2WUBL 4TSCL 4HG4K 4LSUH 2AK4D 3T1WA 2CRZA 1Q9WA 3B3IB 4KMQA 4WVRA 2F58L 2R8SL 1P4BH 5IFAL 5E2UL 1HHKA 1DQMH 4C4KT 4LCIL 3MRRB 2FBJL 3BAEH 5DJAB 2FYYA 3EOAB 2DQTH 4NDMB 4ZXBD 4XAWH 3TBWB 2IMMA 5I1KH 5F97E 2CDEA 3JXAA 1ZLWH 2MFNA 2FJHB 4JG0H 3O2WH 4PGBA 1OTUC 3DHMA 1D5BA 2DD8L 1WAAA 3H6JA 1XIWC 5GSVA 5C0BE 3GJFA 2X4RA 4S10A 3AY4C 3SO3C 4MJ2A 5BO1H 2PYED 3LD8C 5MI0C 1IM3A 3E3QC 2IGFL 4UINH 2A73A 5GRYA 4GG6A 3FFCE 3NCYS 5BW7C 3MRNA 4OGYL 3STBA 1P9MA 5HI3D 4GUPA 1BGXH 2NTSP 3QJFB 5TQ0L 5GQBA 1T0MB 5H35B 3I3EA 1C8PA 4ZFGL 3MRBA 4JVUA 3CPLB 2BSED 3EAKA 1DFBH 1PQZA 2YPLA 4GH7B 3QEQB 3U2SB 2DQUH 4JM2D 5D7LB 5IQ7H 1DN0A 4LKXA 5IM7A 2XZAH 2OMBA 2IQAB 2XN9E 1B0RB 2P8LB 3L5IA 3GMLA 1JPTL 5HY9B 1MCBA 3GSOB 4PJ5D 1Z2KA 3G08A 2EC8A 1V3LA 4HK0A 4M62L 1GOHA 2P5WB 1I7UB 4HD9A 5H2BA 1D6EB 4IHOB 4JLRB 2Q87A 2APVA 1Z9MA 3DX7B 4K7PX 3OF6A 4OTXH 3WHXB 4FFYH 1G6RL 1FFPB 5IQ7L 3PWLB 1IZJA 3KPRE 4Y89A 3IRPX 5K33A 5B8CA 3F7VA 3MPCA 4JKMA 3GMOA 4C58B 4R8WL 1JNNH 1FC1A 1FZKA 5BV7B 3V6OE 5EULV 2HMID 2MTPA 3TCLB 1MJ7L 1ZEAL 4RMUA 3C2AL 1LP9A 4PJ5E 2Z8SA 4APQA 3K1DA 4WW1B 4HC1L 3RWHA 2ZOLA 3QO1B 3DUSA 4ONFH 2HG5A 3SPVA 2OTUA 2GAZB 5GGVL 1FZMA 1BQLL 2OTPA 3BEWA 4HBQA 3RWFA 3WIIH 3DX6A 3BN9D 1NUGA 3FB8A 4P5KA 1NCDL 3CLEL 3TA3C 4FP8H 1IKFL 3LB6D 2IBZY 3OKNB 4I4WA 1PY9A 1NH6A 2XNAB 4EQ2A 2NXZB 4FMFA 2V9QA 2DRUA 3PL6D 1TETH 1CLZH 5LKNA 2F53B 1OM3L 1BAFL 2P5EB 4V1DE 1RZ7L 2LFGA 3INUH 1LE9A 2DI9A 2YXFA 1JHLH 4OZHB 4TULH 4OAWA 4R4FL 2PYEE 4YUEL 3E6FA 1I9IL 3WFCL 4C83A 4YGAB 4ZFGH 5L88L 1KJ3H 1G7MB 5I30L 1EGJA 5DD5L 5LVEA 2ICWJ 1KTLA 1KXVC 4ETQB 2ESVE 5TFSL 3DX8B 4OCNC 4AG4H 1K9TA 2COQA 4FQXD 3D5OF 2EDBA 3QDJA 1A7OL 1VHPA 2J8UE 3WE6B 1S3KH 3EJZD 5E8PB 3BKCH 3SO3B 3BKYH 2OL3B 3BDYL 4JCMA 4GW5B 3VD9A 5HHNA 3BPLC 4AEIH 2P24A 2VLJA 1HDMB 1BVLB 1RULL 2AJXH 4QCIA 2YK1H 4D0BA 1DBKH 3D2UA 1MHHA 3HLAA 2VB5A 1SVZA 4TNVF 4M6AA 4OT1H 1IEAB 2CKBL 2Q3ZA 4JO2L 3BP7A 4K55A 2G9HB 3U9PH 2XXCB 3WNNA 2HVKB 3BQUD 1NGYB 4HJJL 4KHXL 3GJFH 1GGCL 4X6DE 3SE8H 4GKSB 2CUHA 1FG9C 3LPFA 4NGHL 5CBEB 3GK8L 4LLVA 5IB4A 4X7FC 1IKNA 3WO4B 3O4OB 5IMLB 4PJEE 4L8DB 2GKIA 1SQ2N 1BQLH 3ZKXC 5EORH 2NX5B 5I71B 3BO8A 5IBLD 3FTGA 2FBOJ 1BEYH 2ITCA 5JHDD 4I2XA 4R3SB 1A1OA 1JGDB 9CGTA 4YFEA 4LEXH 2DDQL 5BOPA 4LGPB 1IGYA 3EFDH 5CHNA 3O8XC 1I75A 3PGFL 4LBEA 4X7TA 4NC1C 2AEWA 4HZLB 3QEGL 3UYPA 1U8KB 5EN2B 5BV7C 3GBNL 4MA3A 5CFHA 3L6FB 3IF1B 5K9OB 1OQOA 1RIVL 1YNKL 4WNQA 1RUQH 1REIA 3R06B 3DO3A 1WBXB 2AQ3A 1R5WB 1FFNB 4POYA 3OR7A 1U3HB 5FYJU 5DFWH 4H20L 2P46B 5ICZA 1MUJB 1MOEA 3OJDB 1XGYL 3MLSL 1LNUA 2DJ4A 5IB3B 3VGEA 1FJ1A 3GMRA 3MCKB 3E6HB 3O6KL 3WJJC 4X7TB 5BOZG 4GRLA 3TO2B 5D8JL 2XZAL 1TNNA 4XVUC 4UQ3B 1QRKA 2ADIB 5DUPL 3S4SG 3NA4A 2I26N 1I7ZB 4HPYH 5CP3A 5JA8B 2YPLD 4J3UA 1FQ9C 5IBUG 3PWPB 4JM2A 4YHKL 1Y18A 1SY6L 1U41A 4KJPD 4KHTH 4XCEA 3U4EB 4YDLB 5TE4H 3CCHB 3SCMD 5EFIB 3MLUL 2EE2A 2OQJB 3FO0L 2D0GA 2EECA 4JFPA 3RWIB 3FMGL 1G6RH 4OM0L 3RBSA 1MRCL 3LRGA 5IFJA 4HLZG 4HUMB 2C7UB 4KVCL 5HYJE 4NHUA 3ARRA 3QEQD 3C09B 3F7PC 4U7SA 4MWFB 4J6RH 3FQRA 3FQXB 3O2VL 4LLUB 4U05A 3OF6D 5ABDE 1E4XL 4HIIB 3AMKA 5E5MB 2CRIA 5FKPB 1AQKL 4RGMB 3SOBL 1DLFL 1QYGH 2YN5A 2VXUL 3RY5A 3MFGB 1S7UB 3WNLA 2ITDA 2WBJB 1NQBA 3KLSA 4AH2A 4AIZA 3E6HA 1BOYA 1U3ZA 1MLBB 1WFNA 3FJTA 2B1AH 5D6CA 3LKSA 5FYKH 2X42A 2JCCB 5D7JD 1EEZA 4QRQB 2ATKA 4YQXL 2XQYG 2J5LC 2CIKA 1N6QH 2HFEA 2ICWB 1ORQB 5AYUH 1EH9A 1LDSA 4YDIL 3SEPA 5JXEA 3OKKB 1E4XH 4WW2F 5L2JB 1MHEA 3QO0A 5ALBH 2ZOLB 2EDHA 4DQOL 2W65A 4KMTH 3MXVL 5TDNB 1FL3B 3UO1H 1DANU 2ZPKL 5E1AB 3ARTA 4FFZH 2VDML 4GRLC 3VFWB 1QFUL 5TGBA 3TV3L 4LRIC 3ZKSD 1FVCB 5F96L 4KJQD 1LK3L 4OF3A 4LMQE 3RA7L 4XCNA 3IDYC 3WFCH 5E4IA 2ED8A 1JGVL 2BVQB 1XF3B 3OXRA 2DIAA 3VFRB 1JZ2A 2BOBB 4FFYL 3U79A 4YDIH 4MXWL 2F53A 5IG7B 3RIAF 2ITCB 4UNUA 2DL9A 1OL0A 1OAUL 1PKOA 1EUTA 3FO9B 1M7DA 2RGSA 4F80A 3DRTA 3QDJE 5C0DA 1V7NL 4IOIA 5FA4B 3TWCL 3O4LD 5DLML 5C0EA 4H8WL 2IH3A 2YA2A 3KXFB 3ME0A 3O81A 2ADJA 3IDIB 4N0FB 2AXGA 2NY4D 4LRNL 1G7IB 1NAKH 3MACL 1R3IH 4U1IA 5CWSB 2PN5A 3DVFA 4M7LT 3HTLX 5B3JE 5E7BA 3RWCA 4OF5A 1A0QH 5IVZB 3S4SB 3SDAA 4Z7WA 2FIKB 2ZUTA 1FORL 2BC4B 4NWTL 4N8CH 5DVMA 3QFJD 4HIEA 1IRAY 3VFSA 5ISZD 1FZOA 3U4BH 3GMOB 5IEKB 1JV5A 3NH7L 3UJTL 4RA0C 1MRFL 1JNHB 5T3XD 1Y6MR 4BSJA 2VE6B 3AC0A 4O00A 2XA3A 4Z7WB 2I9TB 4UTBL 3UZQA 3Q2CA 4KROC 3BGFC 4G9FA 4R4FH 3VG9C 2C3VA 4UV4L 4E0RB 3VXMD 3QZWB 4PRBB 2P5WA 4ZUWB 3ARED 3ZDZF 2D4FA 2X4PB 3MZTA 2P42B 5GRWA 2M2DA 2XA8H 1WZ1L 2XI9A 4PJCE 3UBXI 4TRPL 3T77B 3RKDC 3IETB 1JL8A 2EDOA 5KSAC 4JFED 2NXYD 3QUML 5E9DA 4ELME 1QKZH 4J4PD 3UTSA 1DDHA 2HVJB 1W72H 4LSUL 3VFPB 3RVWC 2M8XA 1GGTA 3GDBA 1YYLL 1R5IB 2YHGA 3VFTA 4JFHE 1U3HA 1SY6A 1BOGB 3RA7H 4O02L 1AFVH 1BJMA 1ZT7A 2Y06H 2BY3A 2DQEL 3DXAE 3GZKA 5J11C 3VI4F 4YDVB 2HFFB 4IMLB 5CEYA 2H41A 5IBTH 3V9FA 4L3EB 3MA7B 3DECA 4G43B 4G8FB 3G04A 4R90L 1A64A 5DRZB 2AERT 5T3XL 5L2JA 5IIEB 2VO5A 4NKOA 2HJKA 7FABL 2I27N 2XN9A 4LHUB 1ROWA 2A77L 1UXSA 1YC7A 3WNOA 4EUPB 5DK2A 4KZEL 3OBAA 2FX8L 5KSAB 3OJ2C 4P9HL 4RX4A 3ULVL 1UJ3C 3SKMB 5J12B 3CVHL 5F89A 5C08B 1FO0B 4PB0H 3G5YA 5EUOE 3TZVC 3BVNB 3T8XA 4IRSA 2YUVA 5T1KD 2GTWA 2NR6C 4XRCB 3DVGB 4NQDE 4TN9A 1NMCC 1CE6A 4KTYA 5GGRB 2FECL 2Y6SC 4XWOC 2WUBH 4TSCH 2UZXB 2DMKA 4QRTA 1MJ8H 2C3GA 4LF3A 4JDVB 4ONGL 5I76A 3NAAH 3CFDA 1JVKA 1Y0LB 3L9RA 4NFDA 2AJZB 3W5MA 4Z7UE 1IL1A 3SDAB 4ODSL 3UPRB 2OI9C 4XWGH 2FBJH 4XCEB 3RWCB 5HPMB 3HLAB 1MHHB 3QIWB 1U9KA 2EC9U 3D0LA 1DQLH 4FQJH 5E8OA 5IM7B 1IM9B 2OSLB 1I1FA 5D7JC 4JEGB 1BPVA 2GCYA 5TH2A 4IRSB 4G8IB 3BVNA 3QB7C 4ODHH 1CD1A 3ULUF 3HE6A 1T0MA 4D94A 3IDXH 2EZ0C 1J0HA 1F45A 3W0WA 1K2DA 1QZ1A 2DQJL 4JDZA 3PIQA 1IC7L 3V0VB 1RURL 1FJ1B 3ARFD 3KJ6L 5GRZA 4L3AA 1X7QB 4QXUH 4W4OC 3PQYA 4PRIA 1ITCA 4KJQC 2G5BB 5F9OL 2D7PA 4QTIH 5FYLH 2FX7H 1NEZB 3DI2B 4XAKD 4RFEA 2QKIB 5DZNA 3SDYH 1CI5A 2YD5A 2H6PA 4PRHE 1UWEL 2IANE 3IDYB 4NT6A 3T08A 1VFOA 1AP2A 4WI5A 2B1HH 4ZXBC 1FN4A 1TJIL 3O3AA 1QRNE 1RQ5A 4FQ1L 2DQJH 4LNVA 1TVHB 5JQHC 4WHYG 4KXZH 3WNKA 1NCCL 3OAYH 4TTGA 4C59B 5HYSB 1Q0XL 1ZT1A 3HFML 4JRXA 1KXQE 3FB5B 3JWDH 3UTQA 1JYVA 1XIWD 5K9KA 2DLIA 3EGSB 2B5IC 1N2RB 4NN5C 1ED3B 2GCYB 2VH5H 5TH2B 1A4JA 1MI5E 3FOMA 3MYJA 5HPOA 1DDHB 3MBXL 3QAZB 2B39A 5F3HA 5FO8B 1WBZA 4HIHA 1I1AA 3VWJD 4DVBB 1ZSDA 4R7DA 4X6CB 2YUXA 3SN6N 4IOSD 3QH3B 1LO2H 1TJIH 5BRZA 4DOHE 5GIRB 2GQHA 4LFHD 4GMSL 5DQJA 3O9WC 1SBSL 3HAEH 3WSQL 3W5NA 3L3KA 1MCIA 4TSAL 1IGML 3QRFM 2HVKA 4JKLA 3BKML 4K3EH 1NMAH 4P2OA 4UOW1 3Q1SH 3ARWA 3V5HA 5K59F 3ARVA 1J11A 3S37X 4CMMB 1F6AB 3AS3A 2BOCA 3K8LA 4N0UE 4O2CA 4ZUTB 2XKNB 3EZ8A 4PJDB 1I85C 1A6ZB 4U1MB 1ACYH 1T20B 1NGXB 1QFUH 1U91A 4GMSH 2FIKA 4MHHG 5J7CC 2DF3A 3KJ4C 1T2XA 2G75A 2OJZH 3KPRD 2VXSH 1OAYH 2PYFA 3EGSA 3B9KB 3DSFL 2QQKH 5IVNA 3VD5A 3B9KC 5I18L 4P5MA 2DQIH 4P2QA 3GM8A 4QHKI 3BH8B 1JJUA 3KJ4B 5FDYA 2CLRB 3R0MA 4PJ7A 4RWHA 1MF2L 4OI7A 5LAXB 5D7SH 3RNQA 3WFHA 4M1DL 1YUHA 3MV01 5FYKD 3UP1A 2VLMD 1VFBB 1ACYL 4HWNA 1ZAGA 2HMIC 4Y4FC 3OHXA 2NNAB 3D3VB 1GGBH 4RRPG 3S37H 2BHUA 4RMVA 4S2SB 4DW2L 1WCBA 2QJDA 4OQTL 3S88L 4I3SL 2RAMA 1N64H 4HW6A 4NQCD 5AUMB 4PV9A 4Z7OE 4M5ZL 3IGAB 4DKFL 4ZOEA 1F3DH 1AHWC 1IGTB 3VFPA 2Q20A 4M9PA 4U6HB 3FONA 4UT9H 5C2BL 2V5SA 2D9CA 1MHCA 1A7QL 2H1PH 3PP4H 1RULH 5SV3A 2AJXL 1G9NH 3EUUA 4MNQB 2XN9B 3TJHC 4HKZA 4NZRH 3MRRA 4YHYC 3CFKB 4YO0B 5J8OA 5J57B 1R3LA 2DLFH 4TSBL 5D7IF 2KH2B 3CU7A 3H0TB 5B4MD 1FNSL 1JWMA 3LHPL 2L4OA 3D1MC 4IIQC 5D1ZC 3KWWB 1T2QH 3H42H 4LU5H 3OKYA 1NAMB 2NY3C 4JZOB 1DQDH 3RPIB 3VXUA 1ORSB 3X13B 1EHAA 1U6AL 4XI5C 2VDKH 1VGKA 3QHFL 2FECI 4XB8A 2R4SL 1CDYA 5JNYB 5L0QC 4LLWA 2F54B 4MD5A 1U8MB 3QG6B 5IVXA 5KZCB 2IANB 2BDNL 1G7IA 1ZLVH 4R96A 1UWGH 1UKQA 3RIFK 3T0EA 3GSOA 1R3JA 1NBQA 1BHGA 3AVEA 4NRXB 4PTTA 1OP9A 2Z92B 1AC0A 2EXYD 4DZ8A 3L7FB 4R6UA 4I48A 2X10A 4BUHA 4HDIB 4ONHB 1T1XB 3VXSB 2VLKD 1KLFA 3OXRB 3HG1D 2WLYA 1HIML 4LLYA 4Y4FB 4K71C 4PD4J 4O2FA 1TJHH 4IM8A 1OB1B 4XVSL 4YDVA 2W9DL 3QBTB 2JKXA 4BQCA 5ID1A 2FX9H 3ZZ1A 4YUEH 1HZHH 5D7IA 4JB9H 2OM5A 4WTZG 3VFGL 3G5ZA 2GFBB 1UWEH 4YWGL 3MBEC 2BNQE 1EK3A 1LO3L 3PQYD 4KJYA 3T4AA 2VL5B 3T4YA 2JK5B 2NW2A 4R2GB 1BMGA 3SGKA 5INCB 1YEHH 3GBMH 4OUUB 4UUJA 1PZ5B 3IAGC 4P23D 5EOQL 3TA3D 3IFPB 1RD6A 1ZT4A 3OX8A 4UAOB 4WV1A 1A2YB 2BZDA 2EYRA 4OLXH 3DRTB 3WV0A 2HKFH 3FB8B 4P5KB 2IPKB 4LLDB 5I1AB 1J7VR 2LAAA 3ZDYF 1K3IA 3BH8A 5H37H 1E6OH 3HRZA 3Q48A 3CFCH 3I3DA 3LRSB 4PV8A 3PABA 3H3PL 4LOUD 3MV7E 4R2GD 3O45B 1HHKB 5E7FA 1BWWA 2ID5A 4WTZA 1FIEA 4XNYH 2GEEA 3G5ZB 1GAFH 2AK1L 4M1CC 5FO7A 4N0YH 1MRCH 3DTXA 2HT3D 1JZ8A 3CGTA 4MCZB 5FGBA 3RVVD 3QUXC 2FL5B 1M1SA 1FZOB 1TLKA 4YC2C 1OGAD 3QR2A 5DJYA 4GBXC 2AP2A 3TH2T 3LH2L 4LPTA 4NO5A 4XP9H 3CFBB 3GHEL 4ODBD 1XR8A 1NAKL 4GKNA 5BVJA 2K3TA 2L0DA 4ZAKB 5F9OH 2ADFH 2GSGA 3M1BA 1A6WH 3ARBC 3MRJB 3X14A 5IB1B 2F74B 2D31B 4X99A 3T0EC 4PRNA 1DSFH 1U58A 2VXSL 4GW4A 4FFVC 3EYVA 1MPAH 4HXAH 1AIFA 2XWBB 3PWNA 1CVRA 1M71B 2HTLD 5J0BA 3ISWA 3X11B 5FCUL 4JJHA 4JPWH 4YAQB 5HVGB 4O2CB 4ZUTA 1MIML 2PF6A 2J6EL 1YEDB 3CNKA 2XTJD 3NTCL 5IQ9A 2OK0L 2HLFC 3P4NB 1KCRH 4ZFOL 1L0XA 1HHIA 2J8HA 4PRDB 1C5CL 5F9AC 4P2QD 2H2PD 3I50L 1UM5L 5E1AA 4K2UH 4DKDC 4G6KL 2A6DA 2PTTA 5E00A 4PJ8A 4H1LB 3WS3B 3BRGC 4BJLA 2DWEB 4I5BB 4K3JL 3WDHA 3VWJB 1HXYB 3GSNL 3WBDA 3WDJA 4JGJA 1PFCA 4JPVH 1FC2D 5JHDA 1LVEA 2ADIA 1YMMD 3MUZ1 4U1NA 4D9LL 1FVDB 3IDGA 2R0WL 5HHOE 5ELIA 4LRNH 2ILLA 4CNIA 4ZPVA 2Y4SA 2X4NA 1IARB 5E4EB 3T0EE 1ZS8B 4Y2DC 3PXHA 5DEGA 2H9GA 2P1YA 3W9DA 3F65A 1KIRA 2QV2A 2AKRA 5ETUA 3IJSB 4M7JL 3MMEB 4O2EB 3QIBA 1MJJB 4J1UA 1S7SA 1A02N 3QA3B 5DYOA 1LDPL 3K4AA 5M7QA 4OBSA 5F1OB 5F72S 1AR1D 5GS0D 1RIHL 4NHUB 4NQDA 1YNTB 2GJZB 1T4KA 2JK5A 3D3VD 2E5EA 3STLB 5HYJB 3RX5A 4P4RB 3ZMRA 1NJ9A 1VACA 3EOTL 3GBNH 4AYFA 2A9MH 3D48R 1S9KC 1HINH 4Z0XB 1JF6A 1J1PL 4OZFA 1ZWIB 2NY3B 3AAZA 3QWRA 4ODTH 5CBAA 1MFEH 4HEME 1W72A 1FDLH 3GSQA 3TFKC 4KH2A 4NQTA 4P57B 4M3KB 4TNWK 2KQNA 3GI8L 4UBDD 4WFGE 4XPTL 2HTKD 1UWXK 2JJSA 1PX4A 1IC4L 3OGOE 5I73C 5E08H 1OM3H 1VEPA 1NL0H 5GZND 3MTRA 3QDGB 3SGEH 3SKMA 3NAAL 3WJLA 4CW1B 5C71A 4XHQA 2I9LA 3ILQC 4MQXC 3DIFB 1YJDH 4LP5A 4ZD3L 5HSFA 2JCCE 3RKPA 4GFTB 3VGGA 5KG9B 4KTDL 4FQQA 5DVNA 1B2WH 5IB1A 5F21B 3WNMA 5D7JA 2A74A 4QGTA 4R4BB 4FMKA 4PJGB 5ACZB 2ED9A 5IIEA 3KDMA 2GJZA 4GLRI 3P30H 1CFSA 3NIGE 3OXSB 4NIKB 2VSDA 2CJUL 2Z31C 1U95A 4RZCB 3EYQC 5KSBE 5DJ2A 2Z35B 2OR7A 4F37K 4JR9H 1QLEH 2A2QT 3GI9H 3KPSD 1DEEA 1JGEB 2FWOA 2W1NA 1RHFA 3WUWG 4U6TA 3IXAA 2OXGA 3O6MH 1S9VB 2OMNA 1P4IH 4ZS6D 4XPAL 5LQBL 2F58H 1C5BL 4BSVA 4PJDF 4QRSB 3BD3A 3HZMA 4OZFB 3ARGC 25C8H 3FN0L 1U8LA 3HZYA 2Z4QB 1D9KB 4WO4C 3SE8L 2P47B 3QUXD 4U1JA 1EHXA 4KI5D 4P23B 1P4LA 2V7HB 2J6EA 4PRBA 2APXA 4ONOA 5DD6A 4MXVF 2F5BL 4ELKB 4ODXA 3M45A 4LARL 5MENB 4YBHA 5J6GA 5FO7B 2A9ML 1XZ0A 1U3HC 3TIDB 3E1F1 2D7QA 4JDTL 3QPXH 3K1KC 4RMRA 1CWVA 4M9OA 5EU5A 25C8L 2D4DA 2HVJA 3L3HB 1NBVH 5J06A 5DSCA 1NC4A 1H5BC 3HG1B 1IC4H 3VXSD 5LAXA 1LEIA 1OAKL 4HXBH 1NLDH 4I0PD 4KTEL 3GIVB 4ORZC 5E8OB 4DN3H 5CWSA 3QAZC 1TDQA 4JZJA 1MCRA 1N0XL 2F74A 5A2FA 2F19H 4G9FD 4PFEA 1E28A 5LCVH 3T0BA 4AT6A 4MA1B 1VPOH 3ZL4L 2WINA 1HCVA 1EFXB 2X4UB 3SDAD 3KXFA 3ORJA 4F33A 4YNYB 1UH3A 1XEDA 1DEEB 1JGEA 1NCNA 3VXRD 1R24A 5ANMB 1T83C 2MCG1 4YLQT 4LNRA 4P2RE 1RJZA 1CIUA 4OB5L 4LP4A 2C9AA 4PJBE 4G8GA 3TYFA 3D25B 5EOTB 2J4WL 4X4ZA 4EJ1C 3HCVA 3CD4A 5EBMA 5SV4A 3DSNA 2JCCF 3QT2A 1HEZA 5I75C 5I30H 1IM3B 2BC4A 1UM5H 3BUYA 5HHOA 2WIIB 3NGBB 3Q3GB 2MQCA 5DHVA 1T03H 2A6JB 1DQQB 2VAJA 2BVYA 2R0LL 1A0QL 3WKNA 4QHNA 4WFEE 5EIVA 3V0WH 3NZ8A 1TVBB 3JV6B 2Y25A 2YKLH 1VFAB 3SGEI 5CEXB 1DE4B 3VE0B 1MF2H 2NW3B 2V7HA 4HUWB 5DHXB 3UO1L 4OFPA 4K8RH 3W0WE 4D0DA 1KACB 3P9WB 4JN1L 4LLDA 5E4EC 2YWZA 5GIRA 3ULUD 4J2XA 1U3JA 5D5MB 2YK1L 3SDDA 3MBEA 3GB7B 2CIKB 1R3LB 2ADFL 4XXDB 4UNVA 4QKXB 5I1GL 2MMXA 3KYKL 4JQXA 1Q9WB 1RIUH 4P9MH 3VFRA 5JZ7C 3CSYB 3S3JA 1TZIB 3L3OB 3LQAH 3N1PC 1ORSA 3X13A 3TBSB 4RMSA 3I6KA 5TGBB 2J8UB 4MYWB 2EDRA 5EZJA 3F6LA 3E8UL 5C0AE 3HC0A 5E8EB 3EOTH 4XHJC 4ELMF 4ZOAA 3ARSA 4PRIE 1MHEB 5DHVB 2NPLX 3HNSH 3TFKD 1IGIH 1HE7A 5AAMA 4HDIA 4ONHA 5H2BB 1S7SB 1JFQH 1X5AA 5EORL 3D3VA 2VN4A 4LLMB 2WV3A 1JMZA 4MJ5B 1N59B 1NLBH 5C09E 5GZNC 4D0DB 3KPOA 3GRWH 4Z7QF 3KR3L 4FQ2L 4JM4L 2H32A 2C4FT 5BQ7B 5J56B 4JDZB 1MCPL 1IGFL 1KPVB 3LDBC 5D72L 5DD0L 5CEZL 1IGTA 1TQCB 2ZZUT 1T89C 4GJTB 2YC1A 4LASL 2RHEA 3MXWH 4KRLB 2YBRA 1MWAB 2DB8A 1HHHA 2X1OA 3P9LA 5HDBF 2WANA 5ILTL 5KVFH 4QOKA 4P57A 1A7PH 3MV7A 3T2QA 3BN9C 1WQVT 2YSSA 3G5VA 5E2VH 2A6DB 2EDLA 1FBIL 1Q8MA 2DQDL 4J3TA 1IEBB 2BNUA 4YNYA 5K9JH 5ICZB 2X1PA 1Q94A 1MQ8A 5DUML 4DVRH 1L6ZA 2B1HL 1EXUA 4ZSOB 4XZUA 2O5XH 1YN6A 5C8JA 1UCBH 2YZ1A 3W11C 4K8RD 5DJCA 1TQCC 4LCUA 4YHMH 2R56L 4WNQB 2ORBL 4CJ0A 2HT2D 5F7EH 1ZHBA 4W6WB 1DVFD 1R3JB 4ZNCD 4OFVA 5FA3B 1S7WA 3K8KA 3KNBB 4AM0B 3F58H 1XFPA 4LPXA 1RAMA 2ESVA 1U8HB 5A2LH 3ARFA 4TUKL 5JO5B 5I1LA 3OPZL 1JTTA 3Q5YA 4HAGA 1PBYA 4J8RB 1LO3H 3NZHL 3FQWA 3NFPB 3IKCA 3WKML 1L7TH 3NFNB 2A6IB 1U8PA 4YFLF 2VZOA 3QHFH 2Q6WA 4WFHE 4Y8AA 3D39B 5ESQA 4KVCH 1F2QA 5D71H 5EU6B 1PAMA 3FAXA 1LO0L 3V8OA 4NSKB 1MFAL 3RI5F 4AL8L 4BFBD 3MA7A 2Q76B 1YNKH 5JPMA 1AO7A 4NJAH 3ES6A 5GRUH 4GT7A 2HN7B 1ZV5A 1U8PB 4Y4HD 5ID0A 2GTZB 3BPLB 2JJTC 5EZLA 5MI0B 1AGCB 5IW1B 2AJVH 3H7BB 3IJYA 5L6YH 4QRPB 4ZNEE 4I0PC 5GS2D 3KPLA 4XCCH 5D93C 4YBQD 4PLOB 4WJ5A 2VDQL 5HVHB 1VA9A 4I0KA 4G6ML 4ZFZB 3NCCB 4M43L 5CEZH 3SDCC 4RFNC 4L8SB 4NQEA 5FYKL 4QHMB 4OLYH 2BX5A 4KTEH 1CIDA 1KN2L 4AM0A 3SO5A 1ZT1B 3BWAA 4O9HL 1MCNA 4XCYB 1NCCH 5FKPA 3RUGF 2XWBA 1HHJB 1K8DA 5EWIL 43CAB 2GW5A 3IGAA 4ALAH 5FDWB 4Z5RB 2UWEB 2X4SA 5IB4B 1DZBA 2GK2A 5DJCB 3N1QC 4NZTH 1OLLA 2R1WA 3KPRA 2DQFB 1ZHLB 4R4BA 3CH8A 4OB5H 1RZIB 3BQUB 1TTFA 3T0WA 3TVMA 4XTRC 1QFWH 5J12C 2BSRA 4KAQL 5DMIH 1WZLA 2ED7A 3CLEH 3ZE2F 3SCMB 5KVDH 4HKJB 3PUCA 3SE3A 4RAUB 1EFXA 3P9LB 2WINB 2CDFB 5L2KA 4QOKB 3DROA 4R4NC 3DJ9A 1HHHB 4LAQH 3S34L 1JHTA 4X9GA 2R0ZH 2CMRL 2HKHH 3MRGA 3FN3A 3U0WL 1KYOJ 4QRRB 3EDJA 1QR1B 3T2PA 3NTCH 2OK0H 1W2KT 3MC0A 4JFQB 1F3RB 4NQCA 3TPKA 4YHYB 4J1UB 1MCQA 4EDXB 1ZOXA 2BNQD 1U91B 4X80L 5CZVH 1LE5B 4WU5B 3IU4L 4NNPH 2YN3A 4PIRF 3NZHH 1FVEB 2H26A 2WNGA 1ZS8A 3IS1X 5DEGB 3MOBH 3V4VL 3IS0X 4R4ND 5C07D 3X14B 4M61B 1AE6L 5IB5B 4FHBD 4TYUA 5FIEA 1CU4L 3ZSSA 1KJVA 1NC2A 1U8IB 2WWKT 3G6DH 1J1OH 4NQDB 5J6GB 5MENA 4OZHE 8FABA 2Z9TA 5F88A 3MLWH 1I7RA 5JMRA 4OFYA 5DVKA 2X05A 1ES0A 3GHEH 3M07A 3E8UH 5F7DB 3EIFA 3JVGC 3QUZA 3AS1A 4RCAA 4Y7MA 3QRGH 1DBKL 4OZIF 2AJVL 5D7SL 3G5XA 1O7VA 4HZLA 1LO2L 3TEUA 3MJ9A 3SJVB 2K7QA 4JHAH 4U1SB 2AABL 2Q6WB 3V6OC 1IAMA 5F96H 2DIJA 3BISA 1N8ZB 1PY4A 1NFIA 1BBDL 5EIIB 3NVQA 1LDPH 4JKPH 2R4RH 5IV2B 1NUDA 3SDDB 2O26U 3EJJX 1SJXA 3MBEB 4RBPH 5ACLA 5GXBB 1K4DB 5F6IB 2QEJA 4PP1C 5FHBL 3V7AE 4U2ZA 1Z9SA 1CGTA 1Q72H 4I18B 3I02B 1FCCA 4HUVB 3PP4L 4K71B 5LXGL 2QADC 1VFAA 4PLNC 1AH1A 3HC4H 3ETBF 1Q9OB 1Y0LA 4JPIA 4JG1L 4N1CA 1S7UA 4N8VA 5E03A 1C12A 1UH2A 3JWOH 4LPYA 3Q3GA 5GGRA 3DVNA 4OCMC 5DJ6A 1Q9LB 3FQUA 3GJEA 1T0NA 2A38A 3P9MA 4P5TD 5JPNB 4JRXE 4MNHB 4Y2DA 4ZD3H 2R1YA 4PJ7B 1KULA 5F8RC 3EO1A 5C0CA 3EO9H 5CZVL 2ICWI 3CCHA 3BJLA 1NAML 1IM9A 3ULVF 1YN7B 5IBUB 2JE8A 3QEQE 3ULUL 4NBZB 2YRZA 2AI0H 3TCXA 4NHCH 1CICB 3MLVL 5E1HB 1OTSC 2DWDA 3CFCL 1SM3L 4X4XB 1QFWI 4C4KO 4NO5B 4AK1A 3OPZH 3PQYE 2J88L 1MCOH 3U7WL 4FG6C 1VACB 1HNGA 2CKBA 2QLVB 2WWKO 4LHUG 2WQRA 5D8JH 3C5JB 1PKQA 4JY5H 5DRXB 1Q1JH 3REVA 2B0SL 3MUY1 3UJJL 2GT9B 2J5LB 3TT3L 1BFTA 1JIBA 3B2VL 1J1XL 2F53D 1A1MA 3PDOA 3PL6B 3O3DB 1CFTB 4TUJA 3C5ZA 3G6JF 3K74B 2JB5L 5AYQA 5DRWB 4IEFB 5I8EB 1HQRA 1CXLA 1RUAL 3U1SL 3QG7H 3T0VA 1DCLA 3QYCA 1CD8A 5HBBA 4L9DA 3FMGH 3L6FA 3PGFH 1ZXQA 3CU1A 4ODHL 1YPZA 4X98B 3JV4B 2ARJB 3SDCB 4W4OA 2V2WB 2W07A 4E42A 3FB6B 1FL6B 4Z76B 3P0GB 1ED3A 2IADB 43C9B 1IBGH 1U92A 2C1PA 3A67H 5C9KA 2FH8A 5SWZB 4P3DA 4GRWF 4ALAL 2ZG3A 4X4ME 3EYSH 4WO4B 3K8MA 1QLFB 2OP4H 5ISZA 4OSUL 4FN0A 4UZGA 3RGHA 3QIBC 4OKVB 4HFWB 4RFEB 4F7CB 3AM8A 4PD4K 2DQGH 4MD5B 4NC0B 4RQQB 5DXWA 5DMJB 3DETC 1OF2A 3GIZL 1ZANL 4MAUL 1DL7L 2IQ9H 3CFIC 2PXYD 3QUYC 2FB4H 1FNEB 1RK1B 5ERWB 4LVHC 4KKBC 3V6FA 4OCRL 4PJ9C 1MVUB 4PRNB 2ZUQB 1C16A 2FHFA 4OSUH 4TUOA 1RZJL 4KK9D 4WTXA 5F7NC 1UKTA 2R2HB 4FZ8L 3EYFB 5JUEL 4O4YL 1JF1A 3UTSD 5C6TL 2PYFB 3IU4H 4DVBA 3PWVA 2FCBA 1GC1H 3DMMC 5F3HB 4BZ1L 3VH8B 3KS0H 4KK6C 3GKWL 3OAUL 3S36X 3AAZB 5CBAB 3QPQD 1MCFA 3CX5J 2XICA 1W0VB 1YPZF 4MVBD 3QUMA 4M48H 3FB5A 1J8HA 1TJGL 4X8JB 1WC7A 4PS4H 2O93L 4ENEC 2X70B 4JRYB 4L9LA 5I8KL 1KTDB 1EEYB 4HPOH 2VDOH 4U6HA 1QEWB 4EZMA 4JE4B 5EO9B 1GC1C 4KDTC 5EH1A 2I60H 3EFFA 3GSNB 4HLZH 1R3IL 4XPFH 4PGDB 4Q0XL 5GS0H 3ILPA 5DJ0B 4J12A 2VJXA 5IK3B 1ORQA 5IB5A 4OCYL 5IESH 4G9FE 3L5WA 5A1AA 1GZPB 1WITA 1RUMH 3C5SA 1D6VL 4GAGL 4XXCA 1G0DA 3QISA 3W9DB 5EA0H 3C60A 1T1ZA 1LEKA 3LPGA 5HI4C 4MXVE 5JR1L 4KI5C 3MGTA 4GMTL 4WW2A 2EH8L 4M93C 4ZMAT 1FVDA 5INCA 2YD9A 4GOSA 3HE6B 1TCRA 1PGRB 2BVQA 5FOJA 3HNSL 3SKOA 2DM3A 4NQDD 4AEIL 4KI5F 5KVEH 2NX5D 3HUJF 2G75B 3BPNC 3GSNA 4QT5A 1MCWW 2VISB 3BRDA 3OHXB 3LEYL 3MNZB 3NIFE 3UYRL 4XVJL 4RNRA 4P46B 2E9IA 4PRDA 2NY7L 2EYSB 3KGRA 1W72L 1JZ4A 1G7HB 4HWBL 2YPKA 5GZOD 1QPXA 5I6XC 5A3IC 3OWEA 3RL1B 1Z3GH 3WHE1 3H3PH 4C56E 1QBAA 2I9LB 1S7TA 2Z93B 4F3FA 4Y0GA 1BZ9A 4JFDE 1G84A 3LKNB 2ATPA 4Z78B 1NUNB 1CT8B 1VFUA 2EKSA 2JLLA 4ODWA 4PG2C 5DJZA 3NACH 1TZHB 3MRJA 4PJAE 4DN4L 4HQQH 5HY9A 3UDWC 3VGFA 5ADPL 4OGAD 5HI5C 3T65B 3IU3A 1W8OA 2J3SA 3HZKA 2DDQH 5IW1A 1MUJA 5HJ3A 5HPMA 4NC2B 5L0QB 2EYSA 3G9AB 3MFFB 4M93B 2JELL 2N56A 1K4CB 2F5BH 5AG9A 4N9GA 3RPIA 3BYTA 4HCRL 1QBLH 3R06A 3GJFK 4M6ML 2XY1A 3KPSA 4CDHA 4DGYH 1ONQB 1OTUD 1ZSDB 4R7DB 4X6CA 5FKAA 1TXKA 3RAJH 3RZWA 1J0ZA 4WDIA 1JI2A 4RAHA 3H3BC 3O2DA 1MI5A 4OIIL 3LN5A 4ZAKC 4MB3A 2G5BA 3C8KB 2MHAA 2BMKA 4JG0L 4UDTA 1I9JH 1ZK9A 4OCWL 1HSAA 1RZ7H 5B39B 2ESVB 4RA3A 2APWA 5HTSA 1QRNA 3QUXB 1Z0NA 3GMNB 5SX5K 3RU8H 4QLRA 3HRPA 4N0UB 3ZHKA 3L5WB 4EXPX 4Y2OA 4XVTH 3BEWB 1OAXH 1HQRB 5L88H 3QQ3B 4FOMA 1NCBH 4AENB 5CGTA 4I0PA 2VDRH 3V4PL 1MY7A 3Q6GH 4XCCL 3G04B 4E0RA 1PJ9A 4HFUL 2J4WH 3ARDD 3VCLA 4JB9L 1VFBA 4GXUN 3FRUB 3V6BR 5T3ZD 6FABL 4JFOB 5IKCB 2VLLB 2VZ3A 5MHSE 5E94A 1YJDL 1I4FA 5A16A 3HE7B 3GBLA 4Y4FA 4PYHA 1W8NA 5HVFB 3V5KA 4K94L 4BELD 1BVLA 1CBVL 5T1MB 2FJGB 4L4VE 3MRLB 5IR1B 5CIPH 4L4VD 1E6OL 4U1IB 4GS7C 4GQ9H 5JUEH 5DD3H 4LCCB 4Z18A 4HWZA 5KOVC 3CVHA 4BQ8A 2FIRT 3I6LE 4E41D 4G8GE 5I16A 1T6VN 5I8OL 1YA5A 2QR0B 1Q0XH 1XF5A 5J9PB 1T7VA 1FNEA 3MOQA 3P0YH 5E8NA 1S7TB 2Z93A 2E9BA 3T3ME 3HA0A 2CDGA 3ZE1E 1SVCP 2K1MA 5SWSE 2F54A 5IG7A 2YPKB 5FV1L 5F7MC 1F4YH 3TN0B 1MELA 5C0FA 1G7HA 4KMTL 3CDYA 4PPTA 3RRQA 2BVPA 4DK3A 2QQNH 1UM4H 5C7XL 2NY3D 3PXJA 3B6SB 5JHLL 1DN2A 2K7PA 4M43H 5DK3A 4AQ1B 3BGMA 2NY6C 1NL0L 5F70A 3LAFA 1CLYL 3IYLW 2VABB 1M4KA 1U8OB 3NABL 2E27H 3V6ZB 3QIUC 5FGSA 1E27A 1T89A 4Z76A 3KR3H 4HSQA 1G0XA 4NKDB 2NQCA 4NUGH 1D5ZA 3HN3A 4MS8C 5L2KE 1RZGB 4LKCB 3RWGB 1MIMH 3IFNH 3HE7A 4XNZB 5T1LA 2Y6SD 4APQB 5B8CC 4PJBA 1UJTA 1UM4L 5C7XH 1X3DA 4Q6IA 4YZFE 5FYLL 1PEZA 4JN1H 3O2DL 4ODUB 4AH2B 2NY6D 3BPCA 2BVPB 1GZPA 5EU4A 1T3FB 2O5YH 1MFBL 2F8OA 3LKQB 3NABH 1VKXB 1UZ8B 2E7LC 3FQRB 4X6FA 1BJ1H 4D3CH 1TCMA 4O5LL 1MAML 5E6IB 4F37F 1JNHA 1UJ3A 3NH7H 3W0WB 1OP3H 3IETA 4CVXB 2W65B 2ZPKH 4FFZL 2D7TL 3T77A 4FQLH 4WIQA 1FP5A 1XF1A 5DD1L 1K8IA 4KHTL 3PDGA 5A40E 3OAZH 4NNPL 2VABA 2H2SC 4ONFL 2P8LA 4OCSH 2Y9RT 2IQAA 4QHKJ 4JFDB 3VJ6B 1NFKA 4NKIH 4XH2B 2PYEA 1P69B 5GHWH 1F58H 1FG2A 4G8EB 3JTSB 3HG1A 4PJIE 3VXNA 2LU4A 4GAGH 2ZUUA 2NY1D 1D5XB 4JDVA 3MLWL 3QPXL 4CMMA 4GS7B 1F4YL 3RL1A 5GS1A 1DLFH 1T66D 3ZKNC 2O61A 1HYSC 1MJ8L 4ONGH 1JHLL 3DVNB 1YEGL 2QQNL 1V05A 2VWEC 3BIAX 3TJEH 4U6YB 5E56A 1T7WA 1VDGA 2D9QB 3EYUL 3S98A 1CL7L 4M6OH 1CZ8H 5BZWA 2X4RB 4P23A 3HE7C 4KPHH 3QQNA 4JN2B 1IEAA 1UYWH 3TBYB 2RR3A 3QH3A 2J88H 4LCCA 3WIHH 3RY6C 5FCSH 2PUQT 5FA4A 4LEXL 3IFOA 1NFDE 3FZUC 5DWUL 5GS1C 2MSPA 3WDIA 4YHLL 4Y5VB 1FLRH 1AY1L 3U4AA 3SY0B 4XBGA 1KTKE 2EIZB 1ODAA 3LS4L 3ZYJA 3B2UD 2CKNA 4OLVL 2EDXA 3ZDXE 4U3XA 5FOBA 2EO1A 3VGBA 4M3JA 5JQ6H 1H0DA 4LVNC 1RUAH 2ZCLL 1D9KD 5ICYB 1WICA 4PR5A 4Y4HA 3QO0B 1TTUA 3MRDB 3E6FB 2ARJQ 4NO0A 1CE1L 4PJGA 2D03L 5I66A 8FABB 6FABH 4YX2H 1A1MB 3SDXE 3NFNA 2RJMA 3DX9B 1L7TL 2OBGA 3UZEA 3K2MC 4MAYA 2Z8WC 2QQLL 3O3UN 5IGXH 3ARDA 3MRMB 5HDLA 1T5XB 3QCUH 4X7SL 5D1XA 1GPOH 3QI9B 1OY3B 2OP4L 4H0GA 5GS1B 4Y4KD 3DUHA 2R2CA 2ZCLH 5FOBB 3OQ3B 3V79C 3SE3C 3BXNA 2XZQL 1A7NL 3N9GL 5AEAA 2LU3A 4X80H 2X9YA 4Y4FD 1AXSA 1NPUA 4IBLT 2XY2A 4PJXB 4RGNC 1QFHA 2P24B 1P7QA 3VG9B 3MCLL 1N4XH 1UCBL 4WW1A 1T7XA 3RVXC 3ALXA 3IXTB 4X9FA 2APFA 2R4SH 5GGTH 2B4CH 3P4OB 5GGQL 4EN3D 3W39A 1NGZB 4DOHB 2HKFL 2BOCB 2DKMA 1CL7I 4KKNA 2HTLC 4YK4B 1T5XA 5IF0A 1XH3B 1NMAL 1EFXD 5IVZA 4FZEH 2R0KL 5C0AB 2N7AA 1UWGL 1NBYB 1T7YA 2ZJSH 3H9SE 3PWLA 1AD9A 3FKUS 1X5HA 2DLEA 1ZHLA 2OJEA 3KYMA 1TTGA 4HX1A 2V2XB 3MV8D 2KBGA 2NY5C 3O2WL 2VLJD 3ZKMD 2GUOB 1AXSB 4Z7VB 4YHLH 3QQ9C 4NPYB 3BZFA 4JY4A 4YHOL 4UQ2B 3PJSB 1IVLA 4JPIB 1T80A 3QUZC 3ULVD 3OB8A 3VXNB 1RJLA 3HI6H 3OKOA 4ZUUB 3JTSA 1QLFA 4HWZB 2O5ZH 1XT5A 3IDUA 5D5ME 4OZHF 5DQDH 4ZFZA 4XBEL 3MQIA 1UB6A 1UCTA 4ZO8A 2FO4B 3NCBB 4HPYL 5E2TH 1KCUL 3RWFB 2IADA 5CILL 5LQBH 1CD0A 1F3DJ 4GLRH 1HXYA 4XPFL 3JWDC 5HGBB 4CN6A 5EZLB 3O6FC 5FKAB 4R90H 3B8SA 1BD2A 3QUZD 5FYLE 3JZ7A 5CCKL 2OR9L 5T1LD 1I7TB 4JFOA 4QGYA 4ZDHB 4D9RD 1JTPA 1NGWA 3OKKA 3CX5K 4O5LH 3QDHA 4U0RB 4Y19B 1MIEH 4KDTA 5JW5B 4XMKL 3P0VL 4LCWB 5D2LF 3RTQD 3T65A 2IALA 1KCRL 4X7EC 3KPMB 3DUUB 4PB0L 1XGQB 5ITBH 2ZWLT 4O4YH 1G9NL 4QHLA 5IHUH 2LE9A 4Z7UB 1YY8B 2N4IA 1NBVL 5KOMC 4D8PB 1IGJB 1Z9LA 3WFBH 1A4KA 5BZDB 1FZMB 5GHWL 5DJAA 4LCUB 2V2XA 4LRIA 4LSTH 1YEIH 2J8UF 1J0JA 4KJWD 2W0KA 4QTHA 4KKAC 2XTJE 2Z0BA 1SJVA 4QXGH 4U6YA 5I74B 3ROOA 3KHOA 2BFVH 1CDGA 3VXQB 2VDKL 4PRPE 5H94A 1MH5B 1HQ4A 2A83A 4MMXC 4HCRA 4NKMA 3CDCA 4CU6A 1RVFH 1WEJH 4KUCF 1CGSL 1ADQH 1RJCA 1T21A 4JPKH 5GGSY 1RHHB 1VGEH 1JNLH 1FGVH 4WHYH 3TYGL 3S4SA 1FFOB 3RZCA 2NCMA 4G3YL 3TVMB 2OR8A 1DBBH 4IDLA 1AXIB 5EO0B 2VXQL 3U7YH 5EU4B 5JR1H 5CJ5A 4K3GA 3DRQB 1LD9A 2APTA 4XBEH 3AMLA 5CUSL 1C16B 2YKLL 1BQSA 5I1AA 3O8XD 1JZ5A 1FRGH 3VXTB 5L8LB 4XPHH 3BIBX 3C60B 5CGMA 1IGJA 1H3WM 3C08L 4NZJA 4LPVA 2DTML 1B0RA 4DGVH 1YEEL 4BFEA 2ZSVB 5T33H 2CGRH 3D85B 4U1GB 5I1DA 3H9YA 5I66B 3SGKC 3VD7A 5BVPH 2X9WA 4CGTA 1U2CA 1D5MB 4IDJH 2QSCL 1BQUA 1I8KA 1SEBA 4L3EA 3H7BA 5TQ0H 5K9OA 3QEGH 2P49B 1ZA3B 1KTDA 4C56D 3ZT7A 3MNZA 4M1DH 4J3WA 4KGLA 4P2YA 4PJ9A 2LABA 3V4UL 3NCJL 4M5YL 4MXQC 5ALCH 1S5IL 1UADC 5CSBA 2F5AL 4HK3J 1S9WB 4HEPG 2H32H 2A9NH 3CXHJ 4QRPE 4XNUH 2DMBA 4U1HA 1UB6B 2EE9A 5D6CB 1RZJC 3M17A 3N9GH 3RJDA 3CZFB 4OIAA 2PXYA 4S1RL 5AAWA 5LWYH 4WGVB 3QG7L 5I16B 1ZHNA 1QBMH 2XPGA 1XF4A 4NNXB 1CT8A 3EW3B 2F15A 1H3PH 1Q0YL 4WW2C 2BMKB 2BXZA 4FQCH 4J7RA 1ZGLA 5FA3A 3RGVA 1IAOB 3BPOC 2IAMB 3S6CA 4MWFA 3E2HC 5SX4H 5CZXD 4AEHL 4OI8A 4WI7A 5DURD 3SE4C 1QSFB 2EEAA 5TDPA 4XP9L 3TM6A 4M61A 2BRQA 4H26A 1T2QL 2QTEA 4MJ6B 5E2VL 4KK9C 3O4LA 3CXDL 1FYTA 2CPCA 4OV5B 2DQIL 5J1TC 2W0PA 3AROA 4EUPH 1I9JL 1KNOA 2FGWH 4AMKL 4C57C 2YSSB 4OUOA 5FHBH 5HHNB 2EDDA 1DBJH 2AJYH 5IMMB 5LJYH 3DMMD 3QCTL 2IAND 1YN7A 1DFBL 5I6XB 4IRSC 3CFKA 1U2HA 4JZJB 4XP6L 2N1KA 4U1GC 4YHPB 2AK4E 3RIFF 4F7MB 1OPGL 1OT1A 2BY2A 3TO2A 5H35A 1S9YB 3MJ9H 1J8HD 5E2TL 1LILA 4NQUA 3IDNB 4XXCC 4OD3L 1AD0A 3O3BB 2AS5M 1D3CA 4POZD 4TVPD 3T0XA 3QI9D 3SDYL 1I3UA 2D7MA 3HPJA 5AUMA 3K3QA 4FRWA 2EDQA 4LSPL 4Y19A 5JW5A 1ETZB 4XNYL 5HYJA 4CBPA 1RUKH 4PJHE 5FUZL 5B38A 4RIRB 1E4WL 2C3XA 3U46A 4NN6B 4HV8B 3AREA 4I3RH 1A7RH 2I07A 3THML 5TF1H 5GSVB 5KVGH 4G5ZL 5C6PB 1EFQA 1I7TA 2EDYA 4LAQL 4MNQD 3BE1H 4Q58C 2CO6B 3RI5K 2VTFA 5DGQA 4Y16D 3WNPA 5C09B 5KJRH 2BK8A 3D39A 5ESQB 4WO4A 3MBXH 1VADB 3LS5H 4J3VA 3GSXA 4WFED 4XGZB 2GAZA 4H5SA 2NZ9C 5LGJA 5CHNB 1C1EL 5F7HA 3NOIA 3B9KA 5DDHA 1IT9L 3C8KA 4MQ7B 43C9A 3VRJB 1KPRB 4KVNL 3HHRB 4KKAD 4S0TD 3BO8B 2MCPL 1AGCA 2CLVA 2NX5A 4P0DA 1AE6H 3QXWA 3CUPA 4ZXBA 3MRGB 4XGZA 1JF1B 1RMFL 1XF2B 4U6VH 3IB4A 3L95A 1WT5A 1I85A 3B2VH 4QRUA 4HMEA 4Q6IC 4TOYH 3OGCA 3NCFB 2JB5H 2J6EH 3WL9A 4NP4L 1W0YT 3MOAL 2ICES 1A9EB 1KGCD 3MRPB 4ZS6C 3S35X 3BP5A 3KYOA 3UTPD 5E6YA 4M8QA 4QHUB 5C0CE 3KPRB 5JO5A 4DCQB 5AD0B 4OM1L 4L1DA 4XNMB 1KBGL 3U30C 3TBVA 1BIIA 2VZVA 4WUUD 3P11H 5KVDL 4H0HB 2X44D 3ARGD 2WLZA 1IAIH 3MV7B 5DRNA 1CDCA 3ZL4H 3EFDL 4UAOC 4JHWL 2DL2A 1R24B 5ANMA 3O6FB 3MXVH 5T1KA 2X7LB 1QTYT 3MJ9L 4LEOA 1CFVH 3PWVB 4XH2A 2FO1A 1UACH 1G6RA 2ZUWA 3BKYL 4V1DD 4EIZC 4LAJH 3RDTD 3TNNA 3T2OA 5SX4I 4N90D 3MRFA 3WYRA 5C0NC 5HHMD 4LSVL 5HGAA 3VXOA 3P3YA 4E41E 2YZ8A 3ZYOA 3NCYP 3Q6GL 4FQ2H 1CXFA 1PVHA 3E3QE 4IDJL 4H26B 2XFXA 1GGYA 5CJQL 1O5DT 1LEGB 5ADPH 2WMPA 3V2AR 4Q2ZB 1QLRA 1II4E 1LE9B 3VXME 5I2IB 1FHGA 43CAA 2AEQL 1MLCB 4MA8L 2VDLH 4YBLC 3RP1A 4X5WB 1GXEA 1JPFA 2XT1B 1R5VB 3VWKD 3D18A 4JFZH 3OKNA 3I6GA 4UV7H 4ZODA 5EN2A 1INDH 4NNYB 4HWEL 1T1ZB 4C56A 3DPBA 3L3OA 1IMHC 4P3DB 3RNKA 4GXVH 5C0BB 3CSYA 4XI5D 3TH3T 1JNJA 3VA6A 3P73B 4IRJB 3DXAA 2NY2C 2ZOKA 1NMCB 4NQCB 2DQHH 5T3ZE 5FFLA 2NY7H 3IDMB 1CQKA 2O5XL 1ZLWK 1J0IA 3EDFA 2X4OB 3TZVB 3R0NA 3C2AH 2R2HA 1MHPH 1KENL 3MUGA 3ABZA 3WIHA 4ELMA 2PTTB 3MJ8B 1E4KC 4JM2F 4MB4A 4HKBA 5ACMA 4GAJL 1RK1A 4JDTH 5ERWA 5IW6A 3F7VB 4LSSL 3FO1B 2EXYC 5FK9A 4DN4H 3ARXA 2R2EA 2XKSA 5I0DA 4BM7A 1QG3A 3LN4B 4MA7H 4BQ6A 4PJIF 4TTDD 1TETL 4L8CB 3AY4A 3ARBA 4JHWH 5EPMA 1IGFH 1H3VA 2DD8H 1NGQH 4P3WA 4QO1A 2BNRB 4RRPA 5KN5B 4TULL 1JN6B 4QYOB 3JTTA 2EDJA 2WK2A 5F1IB 3J8F7 1FGNL 3WO3B 1WIOA 5FYJL 1F90L 1K6QH 5C07A 1OAQH 4GKOA 4GBXA 5HI3C 3NZ8B 1UXSB 3JWOC 1A3RL 5J1SC 1HOCB 2C1PB 4M4PA 3RVWD 3HG1E 1S7XB 1NFDB 1FYHB 3WUWA 5C86A 4GKNB 3FAWA 5DRZA 5TFSH 3EOBA 3G6JE 3SDCA 1MFDL 3D2UD 1P7HL 1OQXA 1ZHKA 4CU7A 1SYVB 4WWKC 2WZPD 5I0ZA 3I6LD 4KK5D 2IG2H 3FO0H 1YEJH 1ZWIA 4HKBB 4HUXB 4DTGH 1U6AH 1RUPL 2IBZX 4PJFB 1JGLL 8CGTA 3BIKB 2A73B 1ITBB 4JFFE 2ZCHH 3VCLB 5SWZA 1F4WL 1C08B 3HR6A 5HVWA 4WHTA 4KQ3H 2VKXA 1V7MH 3MREA 4LCWD 5GRXG 3RVUD 1F3JB 1KCUH 4ZNEA 2P5EA 4LCWE 1G7PA 2PCPA 4OLZL 4JGUA 3TVMC 3P30L 4M7JH 3FB7A 4PJIB 4QTHB 1B3JA 1U8IA 3HMXA 1AO7E 3KPOB 2W92A 4JY6B 2Y7QB 4MNQA 4G6AC 4NQVA 4X5XA 4FQ1H 4KC3B 4F9PC 5IMKB 5ENWA 1JRHL 2UY6A 4RMQA 2YD1A 3LEXB 2IFGA 4L8SA 4NQEB 4PJIA 3DYOA 2BHZA 1PZ5A 3UYOD 3QXAA 2NR6D 1MIEL 4UT7L 1CGUA 1HNFA 2R15A 5I74C 2I25N 3AU1A 5E8EA 1S9VA 1FLTX 3IJYB 1N8ZA 3SE9H 2A6JA 1QLRB 4FZEL 2LQRA 4PRPB 1X5JA 3LH2H 2IFFH 1L9MA 4NN7B 4UTBH 2FATH 3MLUH 2CR6A 3D25A 2W9DH 4RZCA 2BVTA 5CMAA 3OKDB 4GRLD 4U31A 1RFDH 2UVFA 2XWTB 3F62A 4GW1B 4LGRB 2V17L 2BSRB 2NTFA 5CGYD 1XGUB 1JYXA 3UBXA 2JJVA 4OD2B 2XACC 3VXMB 4LMQI 1A9BB 4GXUM 3HB3D 3QIWD 3TNNB 4KKCD 3F7YA 1UG9A 2XRAL 4G9DB 5C0ND 4YAQA 3U82B 2EYTA 1UWXH 1J0YA 4ZUUA 1INQB 2BVOB 1RZJH 4Y1AD 1IEHA 3ARFC 1I8LC 3H2WA 1BD2E 1XGYH 5DURB 3MLSH 2FJGA 2XG5A 1NMBH 4L8CA 5DUBA 1KJ2H 2VR5A 4JO1L 2D31A 1CF8H 3VA2C 1UB5A 4NZUH 1PG7L 2VAAB 1AC6A 1JWUA 3GSUB 5C2UB 3MLRH 5FK9B 5CEZD 3FT3A 3KPNB 4GUPB 5JHDE 4FXGB 5CJQH 1B6UA 4DVRL 3LQAL 1P2CB 2PKDA 3DI3B 5I8KH 1NEUA 2BHYA 3OKDA 4R26H 4HGMA 4LK4A 3AB0C 4S11A 2VISA 4NQXB 2X41A 5GISL 2AEPL 5DHYA 3IXTA 2HFEB 2ICWA 4XC1L 5IEHB 4F2MB 4HJ0C 3ZHLA 2ATKB 2YS4A 5HHQB 3GUTA 4KY1L 4HGWA 2BSTA 5CSZB 3TH4T 4LLQB 3VRJA 4PJXA 5DFTA 2E7MA 4K9EH 4PJEF 3DETD 2CKBH 1YEIL 3LN9A 2CLZA 4I77H 3T04D 4TUKH 2DM2A 2OI9B 2R1XB 4PV8B 2LVCA 5MEOA 2VLRA 4N1EA 3LRHA 5C2BH 5FEBA 1CXEA 1JPFB 4YHIB 2NXYC 2EH7L 4JY6A 2FGZA 3TIDA 4JREB 1TQBB 3ALPA 2Q8BL 3VRIA 15C8L 1BJ1J 1FPTH 1UQSA 4HIXL 1CXHA 4YJZL 4WY7H 4H25B 1N6VA 1Z9OA 4DGIL 1VCAA 3BZ4A 4MSWA 4MAYD 2OTWA 4PLJC 1A7PL 5DVOA 3ZDXF 2P45B 1QP1A 2ZJSL 2PW2A 2RFXB 3QULA 5LWYL 1GIGL 3T2NL 4Y4KA 3UJTH 3RNQB 3MFFA 1EMTL 4JQVC 1YMHA 4M8VA 3LPWA 2ZSWA 4PBVC 1JPGB 3UTTD 2YMXL 4JFQA 1CGXA 1OWRM 2YD6A 4X8XA 4XXDA 2AXHA 5DR5L 5FO9A 1F6FB 1OW0C 2VMFA 2IC2A 4KRMB 1CFQA 5EWIH 4Q6YA 1JHTB 2PR4H 4LSDA 3UJIH 3BHBB 4PJAA 5M95B 2CSPA 5FYLD 4F9PA 1OGAA 1PG7X 2R23B 3GRWL 5EU5B 4I3GA 2HLAB 4D3CL 5IW3A 4N9OB 5DZOA 3PWPE 1AJ7H 4CADA 3UCRA 4XVUD 4KUCD 3VW3H 3UTTE 1RIHH 1YYMH 4LASH 2NTFB 3UTSE 3CK0H 5HDQL 4M1GL 4YXKH 1N0LA 4PJFE 4BYHA 4ZTOH 3O41A 2NY0C 3NFSL 1X4YA 3TPUA 1UZ6F 4XMLL 4KJPC 5T1DH 3L95B 4XNUL 2W9EL 4OZ4B 3K80A 4ELMB 4J4PA 1D5IL 1NAMA 3O3EA 5FUCC 1AGEB 3P4MA 1SY6H 3N1GC 2YC1B 1GH7A 2QSVA 4QWWC 4WJ5B 1KPRA 5DDHB 3TNMB 1U3HD 4HJGA 2NY2B 1G1CA 1JRHI 1KC5H 3PGDB 4K23L 1JHKH 1V3JA 3BW9A 4JVWA 3ZT6A 3H9HA 2HT3C 2EICA 1ZVSA 5FECB 3QUZB 4UDUB 1EERB 1J0KA 3QDMB 4UB0L 4Z7WE 4X9IA 1P2CA 2DQTL 1LMKA 1B0WA 1R5VA 3L3GB 5CILH 5GGVY 4ZUSB 1CXKA 3HPLB 1RZKC 5CIPB 4JZJC 4ZOCA 5T5NF 5EZJB 3KVQA 5C0GB 1J5OL 1JI1A 1WCBB 3SDAC 4KKCC 5IHLB 2HLAA 1DBAL 5KSBA 1U8HA 4XC3L 4RX4D 4WU5A 1T83A 4PGZA 4K7FB 1M71A 1X5FA 5J3HC 2VXQH 1FZJA 4BZYA 4OQ1A 4LLYB 5EG6C 4CRPA 2VLJB 2F53E 1BJ8A 3MV8B 2YBRB 3GB7A 4XMKH 3IFNL 2W59A 4HC1H 4K94H 3WHE0 4NKDA 3GGWB 2ENSA 5SWSD 5GGSA 3QP3A 1KIPA 4Q9BA 1C08A 5I75B 4P2RD 1NCAH 1RHHA 3RL2A 2AAVA 1NCUA 4P5TB 4Y1AA 4G5ZH 4L4TA 1DQQA 3U83A 4A6YA 3FN9A 3V0WL 1J88A 1VB9A 5HI5D 3OXSA 3BUTA 5H94B 4PREB 3JWNC 1MQKH 4N5ED 1VENA 2NY4C 1PG7W 1A3LH 3GRWA 4WCYL 4XP5L 3RY6A 1YZZA 3I9GL 5GGUA 3TBTA 4U6XB 4U33A 3C6LC 4H0IA 1QRND 3MRIA 5I9QC 5BW7A 4J4PC 3HMXH 4FFWC 4TPRH 2Z8VC 2D0FA 4I1NB 1AQDB 4P59L 4GG6E 4M48L 4YXLH 2XZZA 2DS4A 5E99H 5I15L 3HZMB 3GSNH 2AV7A 2CUMA 3IDMA 3BDYH 2HJKB 3ECBB 4M1CD 1OSPL 3W2DH 4K7FA 3RX7A 1BREA 3REWA 2GFBA 2EKJA 3C6LD 1ZGLM 3A6CL 3NIDF 4UMGA 5GRVK 4PJ9B 4BSWB 3LIZH 1J8KA 4KKBD 5JOEA 3TV3H 5FGCB 4LVHB 5D5MF 4PJ9D 1MREH 4KQ4H 5EUOF 1WVZA 4YPGB 4S1SL 1U8NA 2VUOA 4KI1A 4PRID 4MJ4A 4P2CG 4JANB 2D7OA 3L3IB 1XR9A 5I15H 2ERJB 3G6DL 4ZSOE 2ERJC 2O5ZL 3MLRL 3LEXA 3BKMH 4K3EL 2FR4B 2HFGH 1T22B 4U1KA 3T3PE 3TO4C 2HTKC 2CK2A 4UILL 2WWMD 3SE4A 5IT2H 3RNKB 5IVXF 1IQWL 1YEFH 5CKAA 1OVZA 5ICXA 2V6HA 1FVEA 2H26B 4H8WH 4JRYD 1QRNB 3QUXA 1U8JA 3T0AA 1NDMB 1NDGB 2YUWA 4P3CH 1NAMH 3X3FH 2A9NL 2UZYB 3KYNA 1JYNA 2BERA 2HLFD 2XWJB 2LV4A 4XPTH 3MLVH 2QSTA 4QRRD 2UVEA 3V7MA 3VWJA 2OSLA 1WFOA 4X9HA 1HZHL 1QSFE 4CN4A 5J1AA 2E7CA 4XP1L 4O51B 5DUMH 5FYJE 4FA8A 2C7UA 3TYFB 1N3NB 7CGTA 1VGKB 5F9WC 5JIIA 2XKNA 1CDIA 5ECJE 3IFLL 5FYKE 1E4WH 1S9XA 3L5JA 4ZFOB 4N9GB 1KCLA 2YEZA 4JFDD 3GHBL 3MUGB 2IPUK 5D6DA 1QSFA 3VXQA 4PRHA 1L9NA 3MYZA 3TJEL 4EI5A 1NCTA 3F6IA 4JM2B 1FNFA 4AJ0A 3LSOB 4X6CE 1X6NA 5KANI 2WM0A 3AS2A 4Z7VF 4OZIB 3KXFD 4FZ8H 4HC1A 5JDSA 5EOCL 2FJHA 3S35L 4I18A 4OF8A 5IJKC 3BDXA 5HDOA 1YY9C 2FRGP 4KK8C 1FNHA 1FO0A 4UT9L 2Y72A 1EGJL 3C9NB 4JM4H 4XNZC 3O0RH 4KXZI 2HJLA 3C6SB 1XF2A 1L6XA 3SGJA 4RWYL 3UEZA 1ZT4B 3NPSB 4PJHF 2ZCKL 4X99B 2A6KB 1KB5B 4WO4D 2HYMA 1XGQA 4M8QB 4QHLB 1CICC 2VUYA 3M17B 3S5LG 4NWUL 5CAYB 4DAGL 4KQ3L 1O7SA 1P4IL 1FNGB 1X5ZA 2VL5A 4ZUSA 3FO2B 4OLEA 1CBVH 2W91A 2DI8A 3VDCA 3O3EB 5C0IA 3I6KB 3SJVA 2V9TA 3MROA 3TBSA 1TJHL 1R5WA 3QDMA 4Y16A 3KWWA 4YGVA 1QSVA 3Q5OA 5KSVA 1G9MC 5TE6H 5E08L 3BMVA 5I1EH 1RZFH 3DBXB 1T66C 5J4MA 3MROB 3BI9X 4I2XE 2FD6H 2EXWC 5F1KC 5EU7E 5HVHC 2HJFB 3UJJH 5D7JB 1AQDA 1NBZA 3NCEB 1G6RB 5BV7H 5D7IE 5C3TA 3K0WA 5DQDL 1VADA 2Y5TB 1A22B 1WTGT 2FX8H 3OKOB 1C5DA 3F58L 3JTTB 4YK4C 4U4BA 1E0OB 1IKNC 1RJYA 4WUKH 1TVHA 3CXDH 1F2XK 3R4DA 2XOTA 2FJFB 3IDGB 3ARQA 4OIBA 1JP5A 1KUMA 3P2TA 3TN0D 1A6ZA 1SJHB 4UQ2A 4FQIH 1C5CH 2GUOA 1LK2A 1XCTB 4Z7VA 2XQBH 1GGIH 1UXWA 3BPNB 5JLZA 1YN6B 5DHYB 4GKSA 4LSRL 3OKEA 4V1DA 4M5YH 5JDJA 3EYOB 3RUGE 4XT1C 4PGEB 4Z95H 1F4WH 4ZO6A 3SCMA 2DM4A 4PS4L 4JFXA 1LO0H 2XWTA 2V7NB 2CLRA 4HIJA 1T21B 3LKPB 3MRQB 4OD3H 4PJCB 1K2DB 3LKRB 1BP3B 5DO2C 3QNYA 2CRYA 1RZIA 2I5YH 4P4RA 1RI8A 1T1YA 1GOGA 5EUOB 4D0CB 1I8MA 2X4OA 3U6RA 3O9WD 5H37G 3CJJA 2FSEA 4M00A 2HRLA 4AQOA 3MLXL 1RUKL 4FXLA 3VMNA 5A2JH 1SJHA 3RDTA 5MENE 4P99A 5ESVB 3UC0L 1LP9E 2VLKA 3CDGA 5MEQA 2YA1A 1Q9KB 3MGAA 3NACL 1I8MB 1RUML 2KQMA 2DQHL 2V2TB