1LEGB

Crystal structure of h-2kb bound to the dev8 peptide
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Structural comparison of allogeneic and syngeneic T cell receptor-peptide-major histocompatibility complex complexes: a buried alloreactive mutation subtly alters peptide presentation substantially increasing V(beta) Interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1legB00
5C08D 1DSFH 1YJDC 1A7NH 3FN0H 3MRDB 1I3GH 3LVEA 4P3WA 4APQB 4GUPB 3FHAA 4GXVH 3X13A 4GRWH 1K4CB 5JHDA 4YZFE 3PQYD 4QOKE 2WBJD 2F5AH 4L3ED 1YN6A 3RWIB 3HNVH 4B5EA 3IGAA 1NANH 3GI9L 1OM3H 4YBQC 1YJDL 3SDAC 4MJ6B 4JN2A 1JPSL 3AVEA 2ZCLL 3HMWH 3M45A 4R96B 4TUKH 3KHOA 3G5YB 5FO7B 4PJ5D 1WZMA 3UP1A 4BUHA 1NLDH 3QO0B 4P3CH 2ZCHL 1FL6A 4RSVA 4HGWB 5HGHA 4HAFA 1UADC 4IIQC 1A0QH 3KS0H 4HXAL 2LVCA 2YZ1A 3PP3H 4ZDHA 2A6IA 4XVJH 3B5TA 5T1MA 5FA3B 3VFPB 4XCCL 4KJWC 4NC1E 3TJHC 4R7DA 2X09A 2ZSWA 1RZ7H 2Q7NA 4HKBA 2AABL 5D1XC 5DVKA 1NUFA 3O3EA 32C2B 3L3HB 2ARJB 2RR3A 5IW3A 2HTLC 2BRQA 3LMJL 5CJXA 4LPXA 5I8EB 4XGZB 4KXZI 5FFLA 3B9AA 4PBXA 4KTEL 1IEAB 1F2QA 1XGPB 3BMVA 5DRZB 15C8L 3THML 3MLWH 1GZPA 1D3CA 4O4YL 1IQWL 1ED3B 3ZE0E 4LEOA 2OR9H 1A1MB 3HAEB 2XWBA 3PGDA 5F89A 3UJIH 4S0TD 4UOW1 5EBLA 3PWJA 3A6BL 2DLFH 2Z4QA 4MA8L 2BVUA 3CC5A 4OLXL 2B5IB 2YD7A 5DT1L 5HPMA 4HS3B 2XZAL 1HWGB 1MRDL 4EI5C 1X6LA 4NRZB 4ODXA 3TBSB 1XF5B 5J3HD 3V0WH 3RPKA 4WCYL 4Y19B 5FXCH 4LBEB 1K5NA 4H8WH 3G5ZA 2E7LA 4I18B 3D2UA 3X3FL 1QRND 3TNMA 3GHEH 2OTPA 4YDKL 4TVPL 1GAFH 3O4LE 4Z8FH 1IM3B 1NSNL 2QTEA 5C7XL 1RK0B 1QLEH 2QQLH 4PG2A 5C6PB 1XH3B 1MELA 3RWDA 3IJSB 1U0QA 4J3SA 3W82A 4GW1B 4I2XE 1X4ZA 5K93A 4LOUD 1IGTB 1WBZB 1HSAB 3F7YB 4OCSL 2GSIB 4EDWL 3DMMA 2NYYC 3ET9F 3EFFA 2VXVH 5DD0H 4JFHD 3IFLH 3KS0J 4M1GL 4KPHL 4TUOB 4RAUA 1RUMH 1QPPA 1E4XI 3BHBB 3D85B 2CH8A 2X4RB 3MRQA 2QSCL 5A3ID 3D0VA 1AI1H 4R2GD 2X7LA 2OI9B 1V8HA 4KK8C 1AD0B 3QNZB 3GMNA 4M93C 4PJCE 3QAZC 3BJLA 1R5IA 2QQNL 5E24E 1RZJC 3QUZC 4WUUA 1Y18B 5GHWL 2WUCL 3RBGA 4LSVH 3VXUD 1AHWC 1MQKH 1ZT4A 5CIPH 5D2NE 4AJ0A 4PRDA 3ZKXC 4URTB 5D7IE 1D6EB 4MCZB 4YH6A 5BMFH 2W0KA 3H42L 5DHVA 4OUUB 3Q48A 3AS1A 4BELD 1HEZB 1INEH 1RZJL 2X6MA 4JFDE 5EA0L 1IAIM 1E4WH 4GKNB 3BOVA 2D7QA 3UMTA 3DRQB 2OL3A 4AMKL 5LAXA 4MJID 4KUZH 5I71C 3N06B 4OGYL 5E0QA 2KBGA 1HXYB 4RGMC 1EGJH 2CIIB 5JPMB 5JMOC 3QR2A 1UQSA 5HDBF 6CGTA 3EYVB 4A6YH 3ROOB 3O3AB 4LSPL 4PS4L 4QTHB 1WUNT 5EIIB 1PEZA 5EU5A 4K8RD 2GK0A 3V6FA 3OKYA 3VDCA 1KPRA 1WTLA 2MKWA 3ZDZE 1T2QH 4D8PA 5KSBF 4I48B 5EB9A 5C92A 3FZUC 2VIRA 4QHNB 4X4ME 3BP5B 1GGIL 3RGVC 2YD5A 2QSQA 3RNQA 2WMPA 4XPFL 1YQ2A 4FQ2H 3KPMA 1QFWI 3H2WA 4UU9A 1G9EA 2BOCB 2BSSB 3ME0A 2HKHH 1IT9H 2Q8BH 1BEYL 5F44A 5FUCC 1XF4A 1DQDL 3SGEH 4NNPH 3TIEA 1YQVH 3SHSA 2BCKB 2R1XB 1MJ7H 5E4IA 1WZ1H 1BD2A 1U8LA 4JREB 4XCEA 5FGCB 2DQFB 4WHCA 2YD2A 3ILQC 3TNNB 1BFVH 5IVXE 4XBEH 2R2EB 2UY6A 1CFNA 3G6DL 3GMQB 5E2UL 4ONHA 1JGUL 3JV5A 1N2RB 5MENB 5GGUA 1TVBA 2P48B 4HUUA 1MHEB 4N0RA 4HPYL 3MC0A 2AK4E 4OCYH 3C60C 4GAFB 4Z7OF 2CD0A 4U1NA 1UCBL 4L8CA 4E9LA 4F7PB 1OAUL 3SCMA 4JG0H 3TEUA 1LP9B 4X6DA 3UPAA 1YC8A 2MSPA 5JQHC 3QCTL 5MEOA 1BIIB 2ORBL 2YA1A 2JJVA 1X5IA 1I3RA 1CICA 2R4SH 2VQ1A 4M8QA 4ISVB 4P2RB 2VZ1A 1O7SA 4BSVA 4UQ3A 1A6AB 3DNKA 1IGYA 1SYSB 3G5VB 3Q2CA 5I1KH 2ZUSA 3ZE1F 4OM1L 1NAKL 5E2VH 1U93B 5FECA 5C08A 5ACZA 4UNUA 4H5SB 4GAGL 1KT2A 2QHLA 5TH2B 3U79A 3ZYOA 3ULVH 3GSOA 1NMBL 4ELMA 3PQYA 5FYKU 1C1EL 4LEXL 3MUGB 1LEIB 1CTNA 2F53E 5D7LD 5BZDB 3EDKA 4XP9H 5J06A 4ZO6A 3NH7L 4DN4H 2I27N 2FH6A 1JPGB 2OTWA 3C5ZA 5SWSE 4E0RA 3VH8G 3NA4A 3NPZB 4MDIB 2B7DT 2BC4A 4MVBD 3G08B 3M8OL 5HVHC 5BCAA 2YKLH 4PJ5A 1MFEH 1KLGB 1HH9B 3L9RA 2IMNA 3RU8L 5IOPB 1D9KC 5EU3B 4JHBA 4FFWD 4IEFB 3VA6A 3FO9B 1H5BA 1KB9K 1NQBA 1IKNC 5CGYC 3UYPA 4K2UH 2Q8AL 4O2FA 2E7CA 4Q9BA 4PREB 3WFDH 4I9WE 1KCRL 3FQUA 3V4PH 3TWCH 4L4VD 2BFVH 1YYLH 3P9MB 2QKIA 1F45A 4FQXB 4WTZG 1Q94A 1I7TA 4ZTOH 3CDGA 2EH7H 2C1PA 5E94B 4QEGA 2VDKH 3FQWB 4WI5A 4FFZL 4OZIA 1HWHB 4WW2B 2NX5D 4P3DA 1AR1D 5D70H 3UBXB 3LKQB 1SJHA 4W4NA 4W6XB 5ICXB 4NBXB 3RWHA 4O9HH 3ZLQC 3QP3A 1V3KA 1WT5C 2EH8L 2B39A 2D03H 3HI6H 2WLZA 1CWVA 4PLJD 3OZ9H 2FGZA 3CMOH 3MYJB 2ZWLT 4M62L 4MCYA 4MXQD 2Z91A 5T1KB 4IDLA 3QUML 2AJYL 3MJ8A 2OLDA 1YC7A 2GUOA 4ERSH 1JK8B 2WWKT 5JIPA 1DCLA 3UC0H 4DN3L 4KGJA 4PJDA 4G8EB 3JV0A 5DJYA 3BYYA 4XVTL 1FDLL 1AJ7L 1YNLL 3T2NL 4FHBD 4M02A 2NY5C 3MBEB 5CJBA 1XGQA 4HQQL 4EJ1C 2CKBL 5JR1L 1QRNA 3OXSB 4A2LA 3GO1H 4YHPA 1RMFL 5DI8B 1QLRA 3HMXA 3TA3C 3RDTC 4M7LL 1IBGL 1CL7H 1BQHG 2PYFA 3VXTB 2Z8WC 5E8EB 1PSKH 4OFPA 2GFBB 1KTDB 2AXGB 4ZXBB 2NY0B 4NQDE 1X7QB 1N26A 3GB7B 5BJTB 4ZUWB 1RU9L 3K3QA 1AO7B 2VLLB 5J6HB 3IKKA 3MTRA 4PJ9D 1I9RL 2D0FA 2YUWA 2YS4A 3SDCD 1EEQA 1KN4L 1S7XA 4RBPK 4FG6C 1Q9WA 1S9VB 4TSAL 3CUPB 5FYLL 1R0AH 4JFXB 2ESVE 5HJ3B 4TNVK 5EU6B 4B50A 5C0RL 1G7PA 2Q7YB 4I3SL 1HH6A 1N7MH 1UH4A 4HXBL 4OQ1A 1HHGB 4G9DA 4EN3C 1JHKL 3MCLL 4QHUB 3VG9C 4K3DL 2X70B 4D0CB 3LZFH 3VXUA 2EIEA 4Q9RL 2DQCH 5I17A 4OAWA 5F7EL 1JMZA 3P30L 2ADJB 4JY6A 2K1MA 3OV6A 5DJDB 1J0JA 2QEJA 1XF3A 3CLEL 4ELKA 2XQBL 1ROWA 5GGRA 1VEMA 3L3KB 3SQOL 1MJ8H 1I8MB 4H1LA 2VSDA 1U95A 4WO4B 4P2OB 3HZKB 2D4DA 1GC1C 2J4WH 2ZUTA 2G75A 5HYSB 2OZ4A 4MJIA 5J1SC 3C09C 1QSEE 3DGGA 2ZPKL 4ZPTA 5JW4N 3QA3B 1JPFA 3TBYA 1MFCH 4M7ZC 2V2WB 5HXMA 1SM3H 1TVDA 5EC2B 4BQ9A 3MLVL 3BP7B 5MERB 1LE5B 1CI5A 3KPOB 4JKWA 4X8XA 3UTTB 4KROB 1J1PH 5B38B 2Y06L 3GUTA 4HWEL 4HV8A 1K8DA 1S3KH 4D0DA 1J8HE 5IESH 1T0MB 2W91A 4QRRD 1CFBA 3LKOB 4IJ3B 4WVRA 3Q6FB 3CFBA 3FFDA 2CPCA 2HJLB 5L0QC 4LCCC 4PRNA 4YBLC 1V7NL 2Q20A 5I15L 1XIWA 2PO6B 2HFGH 4Y5YA 2DQJH 4F57H 4LVNB 1BF2A 3F7RA 5C0AE 3U0TA 5TQ0H 5DF0A 4POZD 2VL5B 4CU6A 3FCTB 4MSWB 2FBJL 4Y1AD 2YPLA 4PUBL 3BEWA 3H9SB 1A1NA 1ZHLB 2V2TB 1YEIL 4QWWC 1FZJA 3EGSA 5GS1B 3ULVD 1S5HB 4UINL 1FFRA 1OVZA 1I85C 5EO0B 4OM0L 3VFTA 1M7XA 2W9DH 4OGAC 4MXVE 2DI7A 3MBXH 4M7KL 3GMMB 1G6RA 1T6VN 4Q0XL 1MJJA 4OCRL 1K3IA 1G0DA 2VMFA 4KKAC 3D0LA 3W11D 1YN6B 5FKPA 3U30B 3IGAB 4NQSA 1K85A 1QZ1A 1EIBA 3GM8A 2FB4L 3O6ML 3DGCR 3QEQD 4NQED 2BNRE 3VRLE 4I3GA 2X4NA 3S4SA 1EMTH 1S9YA 2JIXA 1FIEA 1Z9MA 1P84J 3S3JA 2V5MA 2NXZD 3RP1A 1CK0H 2EKSA 2NY3D 1FL6B 1DFBL 4D9RD 4OSUH 5HGHB 5EZIH 3T08A 1F6FB 5KVDL 5FCUL 4LAJH 4F15B 5CEZE 1IC5H 4WWKB 1IAIH 2NY4B 2EYSA 4TTDD 4ZDHB 5T1MB 3QIUA 4ZO9A 2IALB 2EDKA 3HLAA 3T2OA 2QSVA 2ZSWB 4PJBF 5IWLC 4HUXB 3O3EB 3OKDA 5EOCL 3VU2A 4ZPVA 4XXCA 1I3UA 1VPOL 5FB8B 4WTWA 1AXSB 5D7LA 3A0OA 1MUJA 1LVEA 1FL3A 3QHFH 3UTSE 1MVUA 4ZSOE 5HDLA 1RZKL 4X4ZA 1RUKL 3BKCH 5FUCE 4KZDL 2VWEE 1VESA 2GHWB 4C83A 3O4OB 5CBEA 5ILTL 4KY1H 3U4BL 1U3HD 1MFBH 3S88H 3PWJB 3QPXL 4ODUB 2PCPA 3RWJA 5J1TC 4WFFD 1K8IA 2Z4QB 3R06A 1FZKA 3C6LC 4MB5A 4KJPC 4TPRH 4HH9A 3KPLA 4HT1L 3TCLA 4PP1D 4X5WA 2JB5L 5FDWB 1A1OA 2CO7B 3ES6A 4ODXB 1MEXL 2AXHA 3TT3L 4XH2A 4L4VA 4AEIH 2C26A 2HT3D 1KV3A 4LLDB 2PTVA 1K5NB 1HYRC 2DWDB 5BZWB 3EOBA 4JB9H 3HB3D 3TNMB 1HQ4B 1BZ9B 2FL5B 3QDME 2NXYC 1NCBL 2DD8H 4G8GE 3MV8D 3T04D 5MP6L 5CWSA 3CPLA 1YEEL 3RWDB 3D3VA 1CE1H 4ZD3L 4X7FC 3W81A 4XBGA 2X9WA 4MD0A 5ITBH 4RGND 5FYJH 1GOGA 1DBML 1JN6B 2ITDB 2EE3A 2DKMA 4L8SA 2UWEE 3EFFB 1DZBA 2XFXA 5E5MB 4J3WA 4RAUB 1ZANH 4TYUA 1NFKA 1ZLVK 1E0OB 4NHCH 3HNSH 5ESVA 1A4JB 2X7LB 1QLFA 1PGRB 5T1DH 1KFAH 1FGVH 5I1CH 3T8XB 3IJYB 5D71H 1R5IB 5E56A 4Y5XC 4Y4HB 4WDIA 3FO2B 4LHQB 4N8VB 1A6UL 3UTZA 3BE1L 3MRNB 3DECA 4PRDB 3ARFD 1F97A 2EEDA 5DHVB 5C09B 1S8DB 3LS5L 1M05B 3PNWA 4X6EA 3VGGA 1GRWA 3ARGC 5E03A 1ITCA 4NQXB 2JK5B 2YRZA 2EO1A 2YUVA 4KRNA 3KNBB 1R3IH 3QDGA 2X1QA 4PJ9A 4OZHE 3S98A 3SDCA 3DXAD 4BFBD 5LAXB 5EUOE 1CGXA 1S5IL 5CS7A 2C9AA 2X4OA 1UJ3C 5ACLA 1IC7H 4NT6B 1T5WA 5DK2B 4U6XA 2M2DA 2R4RH 1LO5A 4PJXF 2WZPD 5KSVA 1UQSB 2EDBA 5IT2H 1IEBA 1VACA 2C3HA 1PX3A 3G6JE 3QQ4B 2GK0B 4KRLB 3V6FB 3LQAL 3S34H 3H7BA 4C56E 4PV9A 4O5LL 3BUTA 2DQGL 3GJEB 3RVTC 4DVRL 3F6LA 2UZIL 4R8WL 3GKZA 3WEXA 3WLWC 1MCHA 4GH7B 4CJ1A 3RNQB 3N1PC 2Y25A 1RIHH 4UQ2A 1YMME 1SBSH 1SJEA 3KPMB 3MRIA 3MLZL 3ZL4L 4D9QD 4HULB 3CVHA 4IRZL 1KACB 3U7WL 1AC0A 1XF4B 4ZUVA 2X44D 1J1OH 5I76B 5JO5A 1NGPH 2OXGA 3KR3H 1E28A 3G9AB 3IXAA 1RZGB 4EBQH 5DJ2A 3GSNB 3N9GH 5IK3A 4UT9L 4YPJA 4AIOA 4YHOL 4XC1L 1UWXH 1Q1JH 4UAOC 1QFWM 1BD2B 5HHQA 3MR9A 3LV3A 1RIVL 3OXRB 4X6CE 1YMHA 3TJEL 3PWPD 3TH2T 4QRPB 5IB5B 1H3WM 1CFNB 3H8NA 5GRWA 3WO4B 4ONHB 1CLZH 4YGAB 3HE6D 2J5LC 3T0VA 2B4CC 2V6HA 5ALBL 4QRRA 3LHPH 4KHTL 5FHAL 3SDDD 3BP6A 2N7BA 4HUUB 4KMLB 1QKZL 3MRCA 4KWUA 1X4XA 3FQRA 5F6IC 2NW3A 4BYHA 4JGMA 1NUDA 5EBWB 4JDVB 2EDLA 3IT8D 3NCJH 4OCWL 4CNIB 3VXSB 4L8CB 3PWLB 1DUYA 1L7IL 1O5DT 3T0XA 4GSDH 5CJ8A 4LU5L 1CR9H 4I5BB 5IM7A 3JWOC 3VRIA 3LKPA 3FKUS 5MEOB 2AQ3A 1I3RB 1CICB 4Y1AA 2VQ1B 1A7BA 5L9DL 1TNNA 4FQIL 1JRHI 2DJ4A 2ZKHL 1ZLWK 4BSVB 3B9KB 3EUUA 4KK5D 5DO2D 4G6JL 5C08B 5CCKL 5ACZB 5DMJB 5FUZL 4QXTA 1KT2B 4DOHB 3MJGX 3S5LB 1RFDL 3JWOL 4Z95L 4QRTA 4MXWL 1KJ2A 2ZOKB 3ZTJG 2XRAL 4PJFE 4WGVB 4Z77B 2WBJB 3ARWA 1KCVL 3T77A 3CU7A 4L3EB 5EZJA 2Y07L 2B2XH 3WBDA 1NAMH 4NM8L 3L6FA 1TMCB 2XA3A 5I1AA 3QEQA 4NQEA 3MUHL 4QOKD 2APTA 1XMWA 3NACL 3SPVA 1X5YA 5E5RB 2VDMH 2RFXA 4E0RB 4FRWA 4WEBL 5IMLA 3VMPA 1CG9B 2XV6B 5DFVD 4J3OC 3VFOB 3TFKC 4JFPB 4XCNA 1GIGL 2AGJH 2AK1H 1MCOH 2NZIA 3PWVA 1GHFH 4K71C 4LARL 3SKMB 5AZEL 3MXVH 1TVHA 4BK5A 3WO3B 1H5BB 3WUWB 5D1ZC 4RMQA 4O2FB 1MWAA 4WI7A 4QYOA 3MOBL 3ARQA 3FQUB 3PV6A 1IZKA 2YC1A 1LEGA 4K9EH 2QKIB 2GY7B 4LF3A 4OIIL 3SY0A 4XP1H 1I1AD 4NN7B 1GGBH 5I74B 3U0PA 1RUAL 5EO9A 3QIWD 4RFNC 9CGTA 3MZGB 4OZIB 3ZTNH 4YHYB 1X5LA 4M5YH 4XBPA 4JM2F 3VWKD 4X98A 1LHZA 3V5KA 4GQ9H 4YK4B 5FCSH 4YIQA 1BWWA 4XNXL 2EYTB 3LB6C 1G9ML 1MAMH 5C0CD 2VXUH 1U3HA 2BVEA 2A1WL 3OKOA 5F96L 4C57C 3BEVA 1OP5H 1MLCB 1FFPA 2Z91B 1TQCC 1IGCL 2W9LA 4LIQL 4ZQKA 2JELL 3MNWA 4BSJA 3MJ8B 2GUOB 4XT1C 1FN4A 3VWJC 5C0EA 2YZ8A 1XR9A 5DJYB 1EEZB 4XAWH 2R56H 4XC3H 4ZFZB 3T0EB 4IHOB 5C0FA 2DB8A 1LNUB 4X9GA 2WQ8A 1CDJA 1Z9OA 4MAYD 2JKXA 1QLRB 1E6OH 3IDJA 2ED8A 4UV7H 2O5XL 4G8IA 3MV8A 4OLVH 1H3XA 3IDXH 3BD4A 5IJVA 1N64H 1L9NA 4QXUL 1K2DA 4KHXL 5HDOA 5E8OA 3I02A 4PB0L 3OQ3B 2I5YL 5I18H 2I9TA 2WSKA 3N1MC 4HHAA 4KQ4H 5ABDE 4ORGA 2F15A 1M1SA 4ZODA 1DQLL 1Q9WB 3QDJA 4CN4A 4WU7B 4Y0GA 3G5XB 4R2GB 5E2JA 4MX7A 2VQUA 1J5OH 1HH6B 3FT4A 2AJ3A 1A6ZA 4G9DB 5F6HI 2HG5A 2YD3A 2HT2C 2ICEA 3CLFL 5CSZA 3VXUB 3ABZA 3MACL 5I17B 1YECL 3GI9H 1KB5H 2JB6A 4OAWB 1YJDH 3G6AA 3ARFA 4LKCB 3MJ9L 3WSQL 3ZYJA 4Z7VE 1PX4A 1MSPA 2AJSL 4NUGL 3T09A 5GGRB 5D7JC 3IDIA 4Q58C 1NKRA 4R90H 5FV2A 5A43C 2IBGA 5GRYA 5DRWA 3T1WA 2BSRA 1U95B 2VL4A 5CEXB 3U6RB 4HLZG 2ZCHH 3DXAA 4R4ND 5T5NF 4NOFA 3MLRH 2B1HL 1NCTA 4JFDD 4HXAH 4NWUH 5F3BA 5H35B 4ZPTB 1RUQL 3TBYB 4OV6F 3WCYA 1J0ZA 5IIEA 1B0WA 1FE8L 3ILPA 1DBKL 3EYUL 3EJZC 2AABH 4KXZH 5FKAB 1M71B 3DO3A 3T1FA 5IMMA 3ZT6A 4HV8B 1K8DB 4D0DB 2X4PA 4NQCD 1NKOA 2C5DC 1KUMA 4PJHE 4YWGL 2XN9D 4MQXD 4KTEH 2HMID 2H2SC 4L8DA 4PRNB 3Q0HA 15C8H 3THMH 2AJUL 4P23D 4O4YH 1IQWH 3BZEB 3LEYL 4Y5YB 3HE7C 5FGRA 4K3EL 5T5NG 1ZHNA 3U0TB 2HJFA 3W2DL 4DGVH 4L9LA 4F37F 1BJMA 5KS9A 3OAUL 3DRTA 3A6BH 1FZMA 3O6LL 4EXKA 5GGVL 3U9PH 4MA8H 4OLXH 5D2LF 1R3KB 1FZJB 2CRYA 3AROA 1PYWB 1ZXQA 2AXFB 5I2IA 2YMXL 1BAFL 4WCYH 1GGTA 1KTLA 3BP4A 4CKVX 4G80A 2VUYA 5E8DL 2W9EH 3QXUA 3GI8H 3PWPA 1BMGA 5MHSD 5J0BA 2IWGA 2BNUA 4JM4H 1MJJB 5D72L 3HE6A 3X3FH 3ALWA 3IAPA 3D0LB 3MRJB 5KSBA 3SDDA 4PGEA 1NSNH 3BW9B 2EXWC 5IHLB 4NQSB 5C7XH 5I19L 3O2DH 1JYXA 2R0LL 3FO1A 5IFAH 1WBYB 2KH2B 3UJTL 3A6CL 3AS3A 3GBNL 1H8OA 4U3HA 1BLNB 2X4NB 3S4SB 3RKDD 4RIRB 4WIQA 5ELIA 3RHWF 1CGUA 2FD6L 2QADD 2VRAA 4PTTA 4WUKL 1E4XH 4U1LA 2IAND 3HFMH 1P6FA 4K55A 1S78C 5E8PB 1HYSC 4HS8L 3CK0L 4PJ7A 4NRXA 2IPUK 2EYSB 2A9NH 4WU5A 3ZMRA 4CAGA 4EXPX 3D18B 4WWID 3HLAB 2QQNH 4LCUA 5GHWH 2WUCH 3KWWA 1BREA 4G43A 3V6OA 1CXEA 5JNYB 5E9DE 3KHQA 3LEXB 3OX8B 4ZPVB 3WD5L 3R4DA 5CD5D 4HGKC 5HBBA 3H42H 1MUJB 4L1HA 3U7YL 4QOKA 1CXIA 1N3NA 1MVUB 1RZJH 3MROB 5EA0H 1J12A 2XOTA 5DRNA 3RTQA 1KC5H 2F53D 3HRZB 4MQSB 4LAQL 4C83B 3ZDYF 3VH8A 2JTDA 5IB2A 3RKPA 3RUGB 2V7HB 4J8RA 5B4MD 3R06B 1FZKB 5CSGA 3FOMA 1ZHBA 4Y2DA 4HH9B 3TCLB 1CE6B 1FFNA 4HJJL 4X5WB 4LSPH 4PS4H 3ES6B 3ULSA 3BN3B 3PL6D 4XZUA 2P5EB 3EYSL 4XH2B 1ORQA 3W9DB 4K7FB 4GBXA 5MEQA 1DANU 3QG7L 4P46B 3BXNA 5JZ7C 3B43A 1I1AA 2DJSA 1QFWH 5DJ0A 3MV7D 4WTZA 2YUXA 5HY9A 4GW4B 3GSWA 4EEEA 3O45B 1GGIH 2VDLL 3IAQA 5EBMA 4MQTB 3QIWA 4G6ML 3X14A 4JLRA 5DSCA 2NX5B 2OL3L 1QBAA 4XPFH 4LDEB 5IR1A 2BHZA 4R97B 3VWKA 3QWRD 1I9EA 5CWSB 5T5FL 1Y6KR 3CPLB 3RNKB 2J6EH 4YHNB 1C5BH 5ISZE 3SKJL 1BEYH 4YFEA 4X80L 4MD0B 4X9FA 1T03L 3VA2C 1P4LA 2DIJA 4NZJA 4FQQA 2DQUL 3MV9D 4L8SB 4FNLL 1G7MA 5IF0B 4HMCA 2XFXB 1T1YA 2FRGP 1VKXA 4N0UE 3WFEH 2XTJD 4M3KB 4O51B 2FHBA 5BRZE 4GKSA 1JNJA 3IDYC 5ESVB 3RI5K 3G6DH 5E2UH 1P7HL 3BKJH 1JGUH 3NPSC 5CIPB 4Z7UF 5E2WH 1ETZA 1FYTE 3ARBB 3SDXB 1MCPL 4L8BB 4WDIB 1NFDB 4GOSA 3QBTB 4G8FB 3U9UB 4MAYA 4HPYH 5GQBA 4X9IA 4LHUG 2DN7A 1MFDH 5D93C 3WLBA 4X6EB 4Z78A 1BQHA 4XHJC 3L5WA 5IHZA 4YBQD 3SDAD 3O4LA 4NN6C 4MNGE 3QCTH 3C5JA 2ORBH 1KGCE 4Z7VF 4PJ9B 4AM0A 5EU7C 1YPZE 4MZ3A 4A6YB 3NCCB 4D0BA 4I2XA 3B2VL 4PRHE 4NQDD 4PJEF 1FV1A 2P44B 4G9FD 3U36B 1FNHA 5FM4A 3BAEL 4GAGH 5B21A 2ZUQC 1FH5L 4JZNB 1CQYA 5GIRA 1VACB 4Z7WF 4RFEA 2A38A 5DD3L 1C1EH 2ESVD 5GRZA 4LEXH 5HGGS 1ND0A 4KJWD 3H7BB 5DD6B 1U8NA 3TJHD 1KULA 1VADB 3BPLC 5C70A 4N5UA 3TESA 1WK0A 2MHAB 5D1XD 3WEXB 5IHBA 3NH7H 2HTLD 2LFGA 4HEME 1CQKA 1ZLSH 1MI5D 1UA6L 1SJEB 1G0XA 3MRIB 3L3JA 1DVFC 1Q9KA 3M8OH 4BJLA 5D2NA 4G3YH 5D7IA 3QRFM 3BO8B 3C5ZC 2XG5A 3NFNA 4JFDA 3FMGL 2DL9A 1RZFH 4PRIA 1TQBC 1OW0C 3WKNA 4KI5E 1KCRH 2R69L 4HD9A 4HLZH 5D8JL 5LGHH 1QSED 2FJFB 3HG1D 4EI5D 4HCRA 3WDIA 3ULUC 4YO0A 4LVOB 4NQCA 5DD1H 4FFZH 3BP6B 2VZVA 4JFFE 2NW3B 5IGXL 4RWYL 3GSUB 5I66A 2DQDH 4P23A 3MQIA 4Z7QF 2YR3A 1S7QB 2X4UA 3TVMC 5F7WC 4GMTL 5CJOL 3FT3B 1DUYB 1QFUL 3BUYB 2EH8H 4ZUUB 4NQVA 3DI2B 3QH3A 4X4MA 4YX2H 2VE6A 3QUKA 4NSKA 5I1IH 1SJVA 1PQZA 3VRIB 3H6JA 4M62H 1U8IA 4IBLT 4OZFH 5D7SH 2MQ3A 3QUMH 2AJYH 4WTXA 3S36X 4K3JL 2WIIA 5B8CA 1DQQB 1UXSB 5C0AD 3V0AC 2NYYD 1LK3L 4DN3H 4NO3A 5ID1B 3KXFD 5EPMB 1E6JL 3IFNL 4HK0A 3ZHKA 1FDLH 1G7JA 3P40A 1NH6A 2B8OT 3F5WA 3T2NH 4QRTB 1OY3B 3P4MA 2VERN 1BECA 2BY2A 2CKBH 3OG4B 5JR1H 2XZZA 1CD9B 4KK8D 1TPXB 4JDTL 5AAWA 1U8KA 5EZJB 3KJ4C 5IVXA 4QHKJ 3ZKQD 1IBGH 4JRXE 5HD8C 1CD0A 3QEQB 4NQEB 1HIMH 3X11A 3D25B 1H3PL 1A7RH 2RFXB 1PZ5A 1JZ3A 5IMLB 2NY5H 2V17H 3E2HC 5T3ZE 1RU9H 2PYEB 1N4XL 2AK4A 5I8CA 1SMAA 1CGSL 2NXZB 1I9RH 3DYPA 2K9UA 1KN4H 4WFHD 1MJUL 3I6GB 2NY3B 4UDTA 1P7QA 1TVHB 4NC0B 5FYLH 1J1XH 2GJ6E 3QEUA 2AV7B 4EKXA 4M7JL 3WNKA 2ENYA 5C0RH 4EOWL 4QYOB 1BBDL 3HMXL 3FAXA 4AH2A 4DGIL 1C5CH 4HXBH 4JFOA 4FXLA 3ZKSD 4X4YA 1RZIA 1W0VA 3BSZL 3UTQB 1JHKH 1LEGB 4K3DH 3PHOB 3EJYC 1AE6L 5CLWA 1NFIA 4LF3B 4DUXA 5DXWA 4Y5VB 5E4EB 3RX8A 1QOKA 4TUJB 3V79C 4XAKE 3U0PB 5F7DA 3SQBA 5A2KH 4NHUA 5H37G 4CN6A 3S97C 5KSAC 3CLEH 2X1PA 5HGBA 2XQBH 3IB4A 4WHTA 1KIQA 3FZUD 3SQOH 4M6OL 3U1SL 1BBJA 3V5KB 3RGVD 1AQKL 2YN3A 5LWYH 4JFEE 5IBUB 2F53A 5DTFA 12E8H 3K7UA 4D9LL 1B88A 3RRQA 3CFEB 2NY1C 1U3HB 1JTPA 4WFGE 4CRPA 3BEVB 3TN0B 5ADPL 2ZPKH 4F58L 3U48A 1FFPB 3BPOB 4ZQKB 1OSZA 4ETQA 1F4HA 2ZSVB 2FEDC 3MLVH 1JYWA 1NCDL 3KPSE 4OI7A 1IGJB 3UDWA 1QG3A 2E3VA 2Y06H 4PJIE 4WI2A 1GC1H 3DV6B 4HWEH 4PJBA 1KJVA 1UC6A 3ILQD 3IKCA 5C0FB 4OKVB 5SWQA 4LP4A 5BXFA 3MV7A 4X7DC 5JPNA 4NKMA 3SGDH 4MS8C 4J2XA 1V7NH 3IDJB 1EZVX 4GFTB 2OZ4L 1G1CA 3ARDA 4G8IB 4CJ0A 5C8JA 3QWRA 2YUZA 4YXKL 1F5WA 3C60D 2N1KA 3OB0K 2MFNA 5E8OB 3C87A 1AKJD 4RGNB 1WAAE 2PW2B 3KPRE 4M43L 3CH8A 2FBJH 3D48R 4K8RL 1AY1L 1XIWC 2A6DB 3GHBL 1YEIH 1J10A 1ZGLM 2VDRH 4JCMA 4HKZA 4UINH 4MA3A 4HMEA 1N8ZB 4X83A 1EX0A 3VFWA 3BH9A 1GJIA 1GH7A 1DN0A 4JY5L 2HWZH 4MX7B 5GZOC 1P7KA 2VN4A 4Q0XH 2P42B 5C0BD 2AJ3B 1KB5A 1A6ZB 2ILLA 4OCRH 2A77H 1URLA 2W0LA 1UACL 3PP4H 4HPOL 5CSZB 2XACC 1LD9B 1V7ML 4S1SH 5IMKA 2VDPH 1SY6H 4FZEL 2FB4H 3QCVL 3G6AB 3BIBX 2AJXL 1RJZA 3QO1A 5I75C 3FN0L 1I3GL 5DUBA 1JGVL 4JZJC 3SDAA 4GXVL 3IDIB 1U2HA 3A67L 5DRWB 4GQPH 3MRMB 2BSRB 1OAZL 2YD6A 1U41A 3HNVL 1G6RL 5FUOL 3STZB 5KVDH 5FCUH 4NCDA 4AENA 3AUVA 4NQDA 2RJMA 3BGFB 4HKJA 4LK4A 2VITA 4G9FA 4XVSL 4PRPD 1Z5LA 1U3YA 3HC4H 4P59L 4IIQA 3K8KA 2H26A 1NLDL 2ESVA 3OG6B 3QIUC 5EOCH 4F7MA 3ARXA 2K7PA 1OAXH 1VPOH 2VLKE 5D1XA 3WS6C 1RK1A 3NIFE 4KFZC 2MKLC 3H3PH 4DKEH 1YN7A 1MI5A 3HUJE 1RUKH 4KZDH 4I4WB 1RZ7L 2NZ9C 4WV1B 1CDIA 4M1CC 3TYGH 3INUH 1ZHNB 3RPIA 3U4BH 4L9LB 3L95A 2WP3T 3I6LD 4UBDC 1FZMB 3QPXH 1MH5B 4N9OB 1YMMD 1BGXL 4N1CA 3FO0L 3RWCA 3CH1A 2BVPA 3CSYB 2MMXA 2JB5H 1X4YA 3EDFA 5ANMB 1S9WA 5E99H 5I73C 2DIBA 4V2BA 2OR9L 1QSEA 3HG1A 5IV2A 1I8KA 4RFOH 4EI5A 3JUYA 4FQCL 5DR5L 2PW1A 2BNUB 3UJIL 3O2DA 1SMOA 2GITA 2DLFL 1S9XA 5L7XL 5KSBB 3KYOA 1P6AB 2F54D 4ONGL 5HI4C 2J3SA 1NGXB 4R4FH 4UT7L 5D5ME 4M9PA 5MP6H 1YEEH 5JOPD 3BWUC 5DQDL 1J8HA 4ZD3H 5D6CA 4RNRA 1FVCA 3RDTD 3KJ6H 1UGNA 1ZTXH 4U1LB 1ZHKB 3FOLA 4N9GA 3C6SA 1A6VL 4HWZB 2Q3ZA 1TTUA 5DZOA 3PXJA 4YE4L 1NMAL 1GAFL 5K9QG 1T0PB 3LQZB 4BH7A 4Z8FL 3LS4L 3DX7B 4JHWL 5C0AA 4HFWA 2DQHL 3H0TA 1ZV5A 1QO3A 2ICCA 1U6AL 3KXFA 4WU5B 1J05A 4FG6D 3BRDA 2IQ9L 2FGWL 3TIDA 1RQ5A 4LCUB 3UJJH 1QSFD 4G43B 4NFDA 5BQ7B 4OBRA 5DJ8B 4BSWA 5EOCJ 1A4KA 1XF2B 2KUTA 2VXVL 3DV4B 2J8OA 5DD0L 3MA9L 3TF7C 3SKUD 4EN3D 1U8PA 2GSGA 3QUZA 3BE1H 5EIVA 1JZ2A 4J12A 5DK0A 2YXMA 1AHWA 3BPNB 4QOKB 3TO4A 3SDYL 1N3NB 1FNAA 5JIHA 1I3VA 3VI4E 1EZVY 5DRNB 5DZLA 1W0YT 1ZS8B 5FF6A 1T3FA 3MMEB 4LSVL 3ZE2E 4OCMC 1Q72L 3CX5J 1UXWA 1MQKL 5CD3B 1NGWA 1QBBA 1NDMA 2DYPB 1OPGH 3FOMB 3LAFA 3S37H 3MRPB 1FFNB 3RVUC 1AIFB 1F11A 2VKWA 1NMCB 4U1IA 3P9LA 4JQIL 1JHLL 3ULUE 5D96B 1WGOA 5HTSA 3BXNB 3QEHA 3VFMA 5C0GB 2DQGH 3RWEA 1I1AB 2GT9A 1DUZA 1G9NC 2BNQB 4KUZL 4G6KH 4Z9KB 5EFIA 3GGWB 5HY9B 2UZIH 4R8WH 4JPIB 3GSWB 2J6EA 5EBMB 4WY7L 3QIWB 2RGSA 3GBML 3X14B 2DM4A 4JLRB 5DSCB 1XR8A 5DEGB 3T65A 1YY8A 5IR1B 5DC0A 3VWKB 3MLZH 1EHNA 3ZL4H 1Y6MR 4IRZH 4F7TB 4S1DC 3RGVA 1NLBL 2OR7A 4OZGE 3GKWL 2IFFL 4HBCL 5CHNA 5C0CB 1P69B 4LMQI 3ETBF 4OLUL 4FQQB 4XP5H 5LQBH 3UTSA 5JW4Q 4ZSOA 3SE8H 3NTCL 5F9AC 2R0WL 4UT9H 1I9JH 4YHOH 1T1YB 3PABA 2DQTL 2XZCL 1VKXB 5C2UB 2ATPB 3DJ9A 2C4FU 1RIVH 4GKSB 3TJEH 3D69A 4C59B 4QWWD 3ZYIA 4YUEL 2HKHL 1M6OA 5GGTH 2HN7A 4PJAE 5BOPA 4U0RB 1BFOA 1ETZB 3OPZH 4Z76A 1I4FA 5ALBH 3CVHL 3LRGA 4OF7A 3UZEA 5ENWB 4OGAD 5FHAH 1SEBA 4MAYB 1QKZH 4QRSA 1A6TA 1UM4L 1KPUB 5L2KE 1WZ1L 5FYJU 2DL2A 2Z8RA 4KKAD 5GXBB 4OCWH 4LHUD 4JVWA 4K3GA 2RQ8A 5ICYB 3ISWA 1L7IH 1BFVL 4DAGH 4XBEL 4I0PC 1I1YB 3WLBB 3C60A 2Q86B 1JRHH 3QDMA 2B4CH 3NOIA 5IHZB 4FQXC 5L2JA 4XP4L 1AKJA 1HOCB 1LK2A 4G8GA 4XMLL 3DSFL 5ITFB 2P5WD 5L9DH 1A02N 4AM0B 4FQIH 2LU7A 2ZKHH 3RA7L 3AM8C 5J1AA 3LRSA 3MGOA 4G6JH 5CCKH 2FEEL 4TNWF 3OB8A 3H7LA 5FUZH 2UWEA 1RFDH 2GYSA 3I9GH 1BX2B 3JWOH 4JG0L 4Z95H 2D9QB 3SJVE 2XRAH 4RFEB 3I3BA 5DQJB 3MLSH 2R4SL 2BX5A 3VXME 4CDHA 3PGCA 2DMKA 3MNZB 5AZ2L 1ZGLP 1EK3A 2KZ1B 3NACH 2APBA 3QZWG 3UX9B 5GRVL 1CN4A 4WEBH 1CDUA 4MA1B 3UBXI 5GJTL 1GGCL 3L3JB 1CGTA 3P4NA 3ULVL 1Q9KB 3WNLA 2XKUA 2GTZB 3QPQC 1VCAA 5HYFA 1GSMA 3NIGF 5JW4M 3GSXB 1UVQA 3NFNB 1KJ2L 1PY9A 1D9KA 2XWTA 4PRPA 2VISA 1AGDB 4OZHA 3B9VA 1MRFL 1HSBB 1IKNA 3C6LD 1LEKA 4KJPD 1CT8A 3JTTB 3OR7B 1A47A 3GJFH 2YKLL 4XWGL 4YAQA 5BVPL 1KIUA 3WN5C 5SV3A 4NGHH 1OL0A 1HCVA 4CU7A 4NQCB 1MIML 3EO1A 2XN9B 4PYHA 1TZHA 3H3KA 1WBXB 1HKLL 1G7HA 2E9IA 1NCWL 2NXYD 2FO4A 4QRUB 4IDJL 1AQDA 1JIBA 5C1MB 4XNXH 2FX7H 2N4IA 4CVZB 1MWAL 3HI1A 1G9MH 1DLHB 4NQVB 5BO1H 1FNEA 4NO0D 4DKDC 5F96H 3ARPA 2EYRA 1PQZB 5C3LD 2EH7L 4E41D 5FA4B 4P57B 5HVFB 1YMMA 2VDKL 1U8IB 3V7AG 1IGCH 4LIQH 3HRPA 2HH0H 5E8NB 1RJLB 2JELH 4BZYA 2YWYA 2G60L 2WIIB 4XMPL 3WIHH 4CVXA 2AEPH 5GRUL 4LLAA 4KTYA 1NCAL 2R8SL 5HGAB 3K81A 3P0GB 4DEPC 4HK0B 1MOEA 4X6DF 5F7LB 3KGRA 1G7JB 3MRBA 4OCXL 5DGRA 3HI6L 4WO4C 4P2OC 1NAMB 3OZ9L 4F7CA 3P4MB 2CDEB 3MFFB 2HTKC 5TE6H 3Q5TA 4X6CA 1U8KB 1FNGA 2EDQA 1EHLH 1WFNA 3SGJC 4LASL 3MRHA 2O5XH 4ERSL 3W0WD 4Y19E 5F7NC 1OP5K 3X11B 3TA3A 4KHXH 1PZ5B 4KROC 3RX7A 3RDTA 2VR4A 4R7NB 4TRPL 4PB0H 4JRYD 4ELMF 2I5YH 5I8CB 5IEHA 1AGFA 3DROA 2EDFA 2IANB 3ARGD 2WUBH 3GO1L 1DQLH 4J3TA 3IU4H 3IYLW 4UDTB 2EDDA 5D2LA 3TH3T 5I1HL 2V5SA 3WNPA 1UKQA 2XT1B 1B4RA 1XFPA 3RVXC 2EXYC 4WRLA 1PSKL 3V2AR 1BZQK 5EUKA 3FRPG 4JFOB 4X4YB 4WFEE 1W0VB 4LVNC 1SYVB 5DEFB 2CDFB 1EAJA 5SWZD 1MHHA 1NFIB 1T04A 5C0DA 1YECH 4L3AA 2AW2A 1JWMB 4EN3A 1AGEB 4YHKL 2XY2A 2MCPH 1R0AL 3GSVA 5GS1C 4NHUB 1C7TA 2MPAL 3MJ9H 1FVEA 3HZMA 1JUFA 3PWNB 4PD4K 2PTUA 3WSQH 3PIQB 4PJFA 4Y4KC 2AJSH 5TDPA 5CFHA 4NUGH 5HGBB 3RVTD 4WHTB 1KIQB 4K94C 2Z92B 4OB5L 2EECA 1OTTC 3LN9A 3WLWD 1BBJB 2YRPA 4AYFA 2P24A 1XF1A 5IW6A 5DTFB 2F8XC 2AI0L 4GLRH 1GZQA 3ZKMC 3LZFL 1EEUA 3T2PA 2VLMD 2ARJQ 2EEAA 2E8ZA 2H2PC 1UJTA 4XCYA 4DVBA 2NNAA 5EO1B 5CILL 4M48L 3HCVB 4U6VH 4AEHL 4EVNA 1NC2D 4ETQB 1MCLA 2FJGB 1X3DA 1ZWIB 4N0CC 1FE8H 4HAGA 1OF2B 1DBKH 4KJYB 3PL6B 1MCBA 2CDGA 3LN4A 4GMSL 4U3CA 1Z6JT 4LPTA 4KAQL 3LPGA 4XX1G 2D7MA 4PJBB 4POYA 1KJVB 1MCKA 1OGAE 1YEFL 4G6FD 2YA2A 4TSBL 3AU1A 4YDJA 5BXFB 3MV7B 5E2TL 4YWGH 1HKFA 4HJGA 5HHPA 4WWKC 4OCNC 5CINL 4F80A 4RAVA 2D7PA 1SM3L 4QNPF 4PJDF 4MWFB 3VGAB 1P5VA 4FA8A 1J1PL 4LCCA 4XRCA 4K3EH 3T4YA 2GTWA 3OF6D 3W2DH 4P5MA 3Q5OA 2EC9T 1MAJA 4FQPA 2JCCF 5HHVH 1IAKA 1CLYL 1K6QL 3MV9B 3T3PE 4LSSH 4GKZA 1A9BA 1F90L 1KYOJ 2I07A 4U2ZA 5F6HJ 2VKXA 2FIKB 3GMLA 4MA3B 2YMXH 5IJKC 2XTJB 3M07A 4DK3A 3BH9B 3EOYG 1JJUA 5E8DH 2YHGA 1N0LA 2EDRA 4Y16C 4ODWB 4I3RL 4F57L 4CMHC 1P7KB 5TQ0L 1T6WA 1KB5B 2ADGA 1SY6A 5D72H 1I85A 4ODVL 2GY5A 1UB5A 3CFJA 4IMLA 1B3JA 4JRWA 4XB8A 3ZDXE 3EO0A 5IMKB 3HR5B 5I19H 5HDQH 5FGCE 3AC0A 2R0LH 1II4E 1ZEAH 2JE8A 2WLYA 4L3CB 4LKXB 1EAPA 3UJTH 1WCBB 2VTFA 4LHUA 4XPTL 3A6CH 3GBNH 4WENB 2YD8A 4U6HA 2Y7QA 5EORL 3QO1B 3JV6A 5HYJE 5F70A 3MBXL 5DUBB 2FD6H 2DLEA 5MENE 3X12B 4MD4A 5FYKE 3FTGB 3MRKA 2D9CA 2EE6A 5KOMC 5DQ9A 1I7ZA 3TFKD 4HS8H 3EHBC 4LLQA 3SBWC 4AENB 4NQDB 4ZS6C 4UUJA 3TBVA 5CZVL 2VITB 4G9FB 5AUMA 1F3RB 2APFA 4BH8A 1Z3GH 2CXKA 4LMQE 3IU3B 1LP9E 3VDBA 5D1ZD 1DBAH 3QQ9C 3VI3F 4JEGB 2H26B 5DMGC 3CCHA 4P2RE 2YSSB 3UYOD 4WI3A 4OSUL 4UDUA 3WD5H 3T0DA 5JOFB 2H45A 3QRGL 1ZE3C 5IWLA 1IC5L 4X8JB 1IAIL 1JBJA 2AEQH 4J3UA 8FABB 4PPTA 4WGWB 2VLJD 5GZNC 4GRLB 4C55A 1MI5B 3GEWB 3OKEA 2W65B 4LAQH 5HHNA 5K9OA 3C8DA 2R1YB 5JMRA 4LPYA 3MJ7A 1MCFA 3RPIB 4DZ8B 1C16A 2H6PA 4Z7VA 1T0NA 3F58L 3LB6D 5T3XL 1PVHA 3IS0X 3RTQC 3SKOA 4OZ4B 1QP1A 4PJEA 3CH1B 5DJ6B 1FG2A 5DFWH 3JUZA 4PJXB 3QHFL 2KL6A 1P4BL 2HP4A 2B0SL 4L9DA 2BJML 1S9WB 2VR9A 3BKCL 3C6LA 5DHVH 4HLJA 1QSEB 3RVWC 3HG1B 1VENA 1VEOA 4Z7WA 5IV2B 1I8KB 4EI5B 5F1NA 4LRNL 4Y2DC 3ZZ1A 3VWJD 4WW1A 2YK1H 2GITB 5K33A 5T1LD 3EYFA 4X99A 5GGSY 4EIGB 4G6MH 4JANB 1NCNA 4YHIB 4TPRL 3TLRA 2OL3H 4GBXC 2GKIA 1Z0MA 4GRMB 1T5XB 1U92A 4JAMA 4N8CL 4RNRB 1Y0LB 2R0KH 3C8HA 4E42A 1T03H 3FOLB 2DQUH 2AKRB 4YEEA 1L0XA 4JB9L 4N9GB 1RJYA 2EDWA 2G9HB 4BH7B 4PGJA 4ZFOA 2IG2L 1CE1L 3KXFB 3QIBC 1J05B 3GMOA 5IHUH 3K74B 3CFDA 3RFZC 5ETUA 1JYVA 3U4EB 3L3IA 1D5BA 4N68A 4LNRA 3HAEG 4ZOAA 5B39G 1CF8L 4BSWB 4M93B 1JTTA 1RD6A 3QAZB 1T66C 1OCWH 3ECBA 1UWEL 1U8PB 3I2CL 4LSTH 4Y5XA 1CDGA 2XY1A 3OKLA 2HT2D 2ICWI 2HFEA 4HUNB 4KRMB 4PRID 2PKDA 2Y5TB 2LE9A 2A6KA 1U91A 2OBGA 3MV11 1FGVL 5I1CL 4JRYA 5D71L 3ZKXB 3WO4C 5DJXA 3HC0B 4JRXD 5FF6B 1VEPA 1T3FB 5C71A 2CXGA 4KUCF 2AAVA 3MGTB 4P5KA 3ARGA 1WWWX 1ADQA 1UXWB 3KPQA 5D7JD 4CMMA 3B2VH 1IAMA 2Z9TA 1UCTA 4L29B 5LG1A 2EIBA 1RI8A 1NDMB 3BAEH 4RGOL 4OF3A 2EDYA 1F11B 1FH5H 3CXHK 1CDCA 5D1QC 5I71B 3Q1SH 3D87B 4KRPC 4W6WB 4U1IB 4RGMB 3P9LB 1AO7E 5FAAA 4BM7A 1R3IL 4BKLA 5DUML 5FOBA 3C5SB 1NPUA 2GT9B 3EJZD 4GT7A 1OGTA 1FC2D 1IC7L 1JGEA 3B9KC 2R4RL 5EU6E 3RZWA 3C08H 5LGKA 1JV5A 1XR8B 3T65B 3STLA 1UA6H 3DX9A 4WEMB 1MHCB 1HCFX 4XAKD 2H2SD 1FLTX 4CU8A 3S34L 5CHNB 3WL9A 1KLUA 2F8VA 2ENSA 3I3EA 3P3YA 1SBBA 4HUKB 2CLRA 3HE7D 5F3HA 2CLVB 2JJTC 5JIIA 1U8OB 1NC2A 3PABB 3N0PB 5GGTA 3LEVH 3RIAK 4DGYL 4NKQB 5DMKA 5GSRA 3AS2A 3RWGB 3WIIL 4LP5A 3T3PF 5D8JH 3DTXA 3NIDF 5DJAB 4FMFA 5C6WH 2OCFD 1M6OB 1WC7A 4OV5B 2HN7B 1CGYA 1NGPL 3CXDL 1IE5A 2DLIA 5IVZB 4Z76B 4U1GC 4YDLC 5DHYA 1CBVL 5HHMD 3KPSD 5JXEA 3VRJA 4AEEA 1SEBB 2UUDK 2E27L 5TFSL 1NBYA 2OJZL 2SEBB 5IGXH 1CYGA 4BA8A 3UTTE 3C2SA 2QV2A 4GMTH 1FYHB 4JM2B 4NKOA 5CJOH 1QFUH 1J87A 4CW1A 2FYYA 3C60B 4N90E 2YD1A 5L2JB 4Z6AT 2OM5A 5IB1A 2NLJB 4ODSH 1LK2B 3LHPL 4HZAA 4W70A 5I74C 5TGBA 3BWAA 1T1WA 4A2MA 4HCRL 3ESUF 1LK3H 1AGCA 1TETL 1QA9B 3MGOB 3NCJL 4PG9B 5AYUH 1E6JH 1EPFA 4YPGA 1HYSD 5J9PA 3PJSA 4Z18A 2EIZA 4F9LC 1C12A 5CSBA 5TPWL 1OT1A 5C0BB 5B8CC 3DMMD 3L3DA 3H9SE 4JDTH 4RDQF 1KEGL 3QXTA 3VDAA 3PGCB 4Y4FC 2H8PA 3VMOA 3QNYB 3GIZH 4NO2A 3B5GA 4E5XB 3CFKA 2LTQC 3VW3H 4Y8DC 2P8MA 3LH2H 4MDJA 3GZKA 1BOGB 3N1FC 1N4XH 1N5YL 4O2CB 1ONQA 3T0EC 4YHML 1MJUH 35C8H 4HKXA 4H20H 2PR4H 1I7RA 2IMMA 4KJQC 5HVHB 1UVQB 3QG6A 4HW6A 4H0GA 4MNGA 3GJFA 2XWTB 1M7DA 4H25B 4EOWH 4PRPB 4W6YB 2VISB 1BBDH 3HMXH 4Z7NE 4DGIH 1CLCA 5F97E 1YPZA 4B7LA 1LEKB 5D1ZA 1T7ZA 2FZ3B 3O11A 4U49A 2NR6C 1CT8B 4LOUC 2IEPA 2MQCA 3M17A 1R5WA 4P5TC 3MO1B 4YAQB 1MCOL 5SX5K 1GHFL 2R23A 1LDPH 3EO1B 3DO7B 1KG0A 2OTUA 2GK2A 5JZ7D 4ZFGH 5HYIA 1PAMA 2X2YA 2G2RB 3RAJH 3MREA 2ZOLB 4AIXA 1AQKH 2AQ2A 5KVMC 3DARA 2VLKD 1AQDB 5CKGA 1AP2A 4PJ8A 3UPRA 4OZFB 4D9LH 3HI1B 5IFHL 3QUMB 3HPLA 3WIHA 1NEZB 1BQSA 5ADPH 3VMNA 3DUSB 3NFPA 1LO2L 5DRXB 5B3JE 1NCDH 1ZGLA 3VXNA 5CGTA 1NBQA 3MA7A 2CKBB 1J88A 3L5XH 3VD9A 5J11C 1GCFA 1YA5A 4RZCA 4F3FA 3W9EA 1RPQA 5ALCH 3VWJA 2JJWA 3WFHA 4W81A 2X9YA 4H1LH 2R2HA 5T1LA 25C8H 1A3LL 5E7BA 2NCMA 1KXQE 5I16B 2F54B 1HHHA 3WS3B 5GISH 3MRHB 3IS1X 3P77A 5KN5B 4YXKH 5I6XC 2IQAB 3RDTB 5ICZA 4XAWL 3IDMB 2A0LC 3QHZH 4M43H 3P2TA 4K8RH 3DROB 1ZA6A 3ARDC 3BT2H 1AY1H 4KK6C 5CGMA 4L1DA 3QNXA 3GHBH 3BRFA 4XHJD 4OBSA 1G7LA 1JVKA 1IL1A 3FFCD 4R26H 1E6OL 1NDGA 5D2LB 4QRQB 3VCLA 3IAGC 2EC8A 5F71A 1F4WH 3UBXG 1JZ6A 1N64L 2J8UF 4NNYA 1AD9B 1ZOXA 2DDQH 3CSBA 5IQ9A 2DMCA 1MHHB 3CSGA 4JO1H 5ID0B 1QSFB 5FK9A 4HPOH 4KQ4L 1T04B 3RL2A 1FLRL 4EIZC 1R3LA 1FNFA 2DM2A 3HPJA 4FZEH 1JF1B 2IAMC 4R3SA 3VG9B 4ZNEE 4HUMB 2Y6SC 3GSVB 5C0NC 4HX1B 5INCA 4JR9L 2AJXH 4GG6F 1FVEB 1KJMB 2AJZB 2DBJA 1FPTL 3CX2A 2HVKB 2ADIB 2AQ1A 1JGVH 1J5OL 4XB7A 3A67H 4GJTB 1SHMA 4JRXA 3ALXA 1OAZH 3VXQB 1Q0XL 1J8KA 1HILA 1T1XA 1G6RH 3I75A 4HC1H 5D7JA 1KB5L 5FUOH 4X7SL 2VABB 4XCYB 4RRPG 5FM5M 4XVSH 5F9JA 3UO1H 3L3OA 5C09E 1S9KC 5T33L 3C5ZD 5LGJA 1H3VA 2YEZA 1FFOB 4P59H 3K46A 2W0FB 2HRPL 3C09B 1NJ9A 1PD6A 5F9WC 4I1NB 2IH1A 5HI3C 3LN4B 4LLYB 4R90L 1CDBA 3NZ8B 5GS0C 2JF1A 4M7ZB 1OB1A 4ENEC 1L4IA 3MLRL 4GAYA 1SVCP 3GMPA 2O5YL 3RJQB 5IMOA 4FFVC 4NWUL 2OXHA 4IRSC 4HJGB 5HHPB 4IRJA 4X7TA 3ULUD 1Q0YL 4JFQB 4RAVB 4BFIB 4YGVB 3TBWA 4UTAL 5GS0L 5L0QB 4LCCB 3VXOA 4XRCB 1QSZA 3B9DA 5FO8A 4P5MB 4ZAKB 2BVQA 3P73A 1T7XA 4QCIA 3HR6A 3TVMD 1IAKB 1AXTH 1DDHA 4TNVF 5HHXL 2F5BH 4XI5C 5EH1A 1BGXH 2IH3A 3FO0H 5JLZB 3HE7A 4MMZC 2MWCA 3N50A 4JFEA 1NGYA 2O61A 3GMRB 1WWAX 3MRGA 3D5OF 4RA0C 4RA3A 3BX7C 2DLHA 4FQCH 5D7KD 5DR5H 4DGVL 3EYQC 2ADGB 1UM5H 3QDAA 4LDOB 2C4FT 3KYKH 3QJHA 4IMLB 3U9PL 5L7XH 3KPSA 4FFWC 4LGPB 4NJ9H 3MRRA 5CJQH 4ONGH 1BD2E 3EO0B 4PJIA 4JPWL 4UT7H 4N1HB 1SEQL 4QY8B 3O9WB 5DQDH 3GIVA 1ZLUK 4QRPE 3OL2A 2Z31B 4H8WC 2Y7QB 1PG7W 3I84A 2W9EL 3GI8L 3JV6B 3VGBA 5HD8D 2GIYA 1NBZA 2X4SB 2R1WA 5B38G 4JM4L 1JYNA 4P46C 4UIMB 1ORSB 1NUGA 4NN5B 1A6VH 1FSKC 1IFHL 4YE4H 1NMAH 2P5WB 1ZA3A 2BMKA 3LS4H 1TJHL 4DCQB 4JHWH 1I7ZB 4QHLB 1A7OL 4LLQB 3O2DL 2HJKA 3W5MA 2DQHH 3FRUA 4WHYG 4UUJB 1FL5A 3VXSE 5IFAL 4XNUL 5L8KB 5AUMB 1YUHB 1U6AH 1WAAA 3GSRA 4BH8B 2R39A 4M03A 2IQ9H 2FGWH 5IFJA 1T22A 1YNKL 4X9BA 3S3PA 3QJFA 4GKOA 1E4XL 3FT2B 1JI1A 3CCHB 4Z7UB 2IJ0C 3HFML 2G5BB 1DEEA 3MA9H 3UROR 1QD0A 2CO6B 4GAJL 4UDUB 1FJ1B 3EJYD 1JPTL 3SJVD 5C08E 5BV7C 4ZO7A 4ODTL 1NL0L 3FB5A 2A9NL 3SDYH 4DOHE 4EI6A 3I6KA 2IADA 3VXMD 5IQ7L 1Q9OB 2FWOA 4JKMA 5KSAD 3QZWA 3PHQA 2HT4C 5ESQA 3ARBC 4L3EE 4ALAL 2M26A 1Q72H 4N0YH 2ZG2A 4FXKA 3TO4C 1IGIH 4Z7VB 2X42A 2XQYG 2OJEB 1T0NB 1UZ8A 4OGXL 4PJEB 2DTSA 1S7UB 2NY1D 4S2SA 1MHPH 2ZG1A 1VFBA 4JE4B 4NKIH 4JQIH 1JHLH 5JA9A 3IETA 1KC5L 3QUXC 5KS9F 1Z2KA 2VJXA 2FEDD 4Z7WB 5F1NB 4JFYB 4OF6A 5HHOD 4WW1B 3L7EA 5CP7B 4X99B 4WY7H 5ECJE 3GBMH 5MEPB 1TJIH 3QYCA 4MNQD 4U1HB 5J89A 5J4MA 4U7SA 1JNNH 4LGSB 3IVKA 3WDJA 4L5FH 5GSVA 5IP4A 1U92B 3OAYK 4JAMB 2NXYB 1NLBH 1YNTB 4MQ7B 1GVIA 3GKWH 4MS8D 2GJZA 2VLKA 4JN1L 4YEFA 2IFFH 4HBCH 4E42B 1G9NH 3O41A 4NO0B 4OLUH 1QFWL 1UM6H 4ONFL 3GK8L 5H94B 3EOAA 3NTCH 3OBAA 2R0WH 4NDMB 1S7SA 3O2WL 4E41B 4ZFFB 3HUJA 4OZIE 4WJ5A 1O0VA 2DQTH 2XZCH 2ZJSL 1RZ8B 2A83B 1NGQL 4ZFOB 1L7TL 1XIWD 2L7UA 2J6EL 2VDOH 1BWMA 4YUEH 3DVNB 4ETYA 3P0VL 1C5BL 3EOTH 2AS5M 3T3MF 5ETUB 3EKCA 3E6FB 2VWEC 3L3IB 1QEWB 4LNRB 3CVHH 1T1ZA 1Q9LA 5DGQA 2YPLD 3OJMB 2A6JA 4DKFL 2CR6A 4F7EA 1UM4H 4KV5E 4RQQA 3VFNB 3ECBB 4PJ7F 3WFEL 3MCKB 3AXLA 1H8NA 3MLYL 4JY4B 5INDB 3W0WB 3BKMH 1P2CA 2XWJA 5IROC 1U91B 4M6ML 1F3JA 3BKJL 3DX6A 3DX8B 3MLTB 5LCVH 3T0EE 4XP4H 4JRYB 5DC9B 5MI0C 3IDUA 4ZNCD 5E2WL 5DWUL 1RV6X 1BZ7A 3M1BB 4PGCB 4XMLH 5D5MA 3DSFH 3AB0B 2WBKA 5CZXD 4P5KB 3ARGB 2R9HC 1T80A 3RA7H 5EOTA 4NZUL 4KU1A 4CMMB 3BKYL 1A2YA 3FFCA 1U8MA 1FCCA 1MFDL 4YZFF 4S1QL 1WVZA 3OKMA 1XT5A 4W4OC 4P2QE 3FB8B 1UJ3B 5IKCB 2JIXD 3B8YA 1BQLH 4EUPG 1HQRB 2DWEB 3OR6B 5SWZB 1DP0A 4FQHB 2JLLA 5CMAA 5FOBB 1ES0A 1HXMA 2WV3A 5E6ZA 3FB6A 4NNXB 3IDNA 4JFHE 1KCLA 1OP3K 2PF6A 4ZS7L 1OGTB 1B0RB 1IQDA 5JDSB 1U8HA 1XCQB 4LLWA 5GGQH 5GS2D 5KVGL 1JGEB 4RISL 5AZ2H 3LKRA 3RL1A 3SKNB 3HZVA 3QIUD 3VFUA 3FQXB 1JV5B 4NP4L 3TZVB 2VAAA 3DX9B 5GJTH 4F9PC 1GGCH 3QFJD 3V5HB 2YPKB 4UOW0 3VXUE 3ELAT 3X3GH 4XNMA 3WL9B 4KUCD 1KLUB 1BOYA 2P8LA 2J2ZA 4M6NL 1DVFA 4JPVL 4YXHH 4NUJA 3NCFB 2NZ9D 2CLRB 5K9JL 1KJ2H 4M1CD 1MF2H 4N8VG 2W07A 4PGBA 5IG7A 2COQA 2GCYB 5E6IA 4UBDD 1NC2B 3KLDA 1ZLSL 4Q6YA 1MCCA 3DETC 5GSRB 1MRFH 3IXTA 3TPKA 2XICA 4FXGA 1OW0A 4G3YL 4NCC2 1U3JA 4YC2C 5I1LA 2VO5A 1FIGL 1WC7B 4OD3L 4UAOB 4XWGH 3SOBH 5BVPH 1T83C 1JWSB 3KLHC 2O26U 2XNAB 1EJ6A 4IM8A 3AS0A 4G6FB 3ZE0F 4DJMA 1MIMH 4NPYA 3VRJB 1RZFL 1JWUB 4CVWA 1NBYB 2J5LB 1UG9A 1HKLH 1FFQA 1ZVSA 1TDQA 4FMKA 1OGAD 1NCWH 1ERNA 1MREL 4FS0A 4IDJH 4NKOB 5EU4A 1LE9A 4CW1B 5HI4D 5LGHL 2FYYB 2A2QT 1MWAH 1AGBA 1C08B 1KF9B 3IDGB 1ZT7B 2WWMC 2P7TB 3TVMA 4Y5VC 5E4EC 5DD1L 3D39D 3FQNA 1OAKL 5TGBB 1YEKL 3DIFA 1U8JA 1FVDB 2G60H 4XMPH 2NTFA 2DQDL 5GRUH 3O6FC 1NCAH 2R8SH 1AGCB 1NBVL 2DICA 2R0ZL 3D3VD 2YPVL 5C0JB 5J9PB 5JW5A 3ZSSA 4OCXH 4Q74A 4YX2L 5F1IA 3S7GA 5I1IL 3L7FA 4LCYA 4U1KA 1IAOA 1S7VA 5AG9A 1J9CT 1D5MB 3TN0C 3HZYA 5D7SL 2EKJA 4HZLA 5BS0D 4V2CB 5E95B 4OLWH 4LASH 4PJAA 4GRWE 4NO2B 4PP1C 3AMKA 4LCWB 4EDXB 4UZGA 4G5ZH 2P8MB 4TRPH 2W59A 1X5HA 3DURA 4MDJB 2DF3A 2WINA 5L2KA 2K3TA 1DL7L 2WNGA 2BRRH 2JCCA 3BQUC 2EDOA 1RUPH 1KB9J 3GSQB 4PJCF 3HB3C 4RBPH 5HYJD 2ZG3A 5I1HH 1F00I 5F8RC 2RAMA 2VLRD 5GRXG 43C9A 4AK1A 1H3UA 1CXHA 3GJFB 1M7DB 1HIML 1A7RL 2X1OA 2NY5L 2V17L 3I50H 5D1ZB 3O11B 3QDGD 4OFVA 5D7IF 4FQJH 4O2EA 4OIBA 3RVUD 3WHXA 4MB4A 5E1HB 3C2AH 1M7IB 3REVA 4YHKH 1RHHB 1J1XL 3OHXA 4L4JA 5ESAA 2Q6WA 2MPAH 1JZ7A 4HFUL 1KG0B 4JKKA 3SJVA 1JPST 4TSCL 3E8UL 5IEKB 2VLJB 4OB5H 1C5CL 4GG8A 2GAZA 1VFAA 3AREA 4CN1A 3CVIL 3TPUB 3VXMA 2ITCA 5KSAA 2KDGA 2AI0H 3O81A 2LAAA 2X4QA 1U9KA 3S5LG 3QXDA 1TZIA 3F12A 1WV7T 4M9OA 3VGFA 3HPLB 3MRDA 4S1DD 1U58B 2ZUYA 4GUPA 3NFPB 1MCSA 3PG2A 5CILH 4M48H 4AEHH 3O3BA 4NFCA 2BERA 3RWIA 3ZDZF 1ZGLB 3VXNB 4GMSH 2R15A 1TQCB 5LWYL 4KAQH 4HH8A 5DS8B 3UTPD 4MJ6A 1A9EB 12E8L 5E1AB 3RUGE 4RZCB 5HVWA 4O58H 1YEFH 1K3ZA 4R4BA 1PG7X 3W9EB 4TSBH 3VWJB 4OCLC 5HHOA 1BVLA 5E2TH 1DBJL 3G5YA 5FO7A 5T1LB 3BGFC 4OLZL 5CINH 1U2CA 3EW3B 4MNQA 3QO0A 3EIFA 4QXGL 3WUWG 1D5ZB 2P5EE 3P77B 4QHMB 5GGVY 3OGCA 4J3VA 4N5EC 4HIEA 2XQYK 3V4VL 1GC1L 4M5ZL 5FA3A 5AYQA 3VFPA 1FO0A 3KPNB 4K7PX 5TE4L 1NGZB 1CLYH 1K6QH 1ZA6B 4I0PD 5IVXF 1F90H 3PUCA 4NBZB 2OSLB 3BDYL 3OAZK 2E9WA 2E7HA 2NX5E 3L3HA 2ARJA 3SN6N 3IFOA 2OQJB 1NDGB 5CBAB 3VCLB 4HGMA 1JMXA 4ACPA 1J18A 4LQFL 4XGZA 4I3RH 4YBHA 3V7MA 1IEAA 4WV1C 1XGPA 1CS6A 3DWTA 4ODVH 4DWHA 5KG9B 3MLPA 1ED3A 4QTIL 3WDHA 4J6RH 1R3LB 1A1MA 3HAEA 2VDRL 3RJDA 2UVFA 5B39A 1OTSC 2FHCA 4R3SB 5INCB 4PRIB 4XPTH 4KTDH 3F8UB 5EORH 3V4UH 3WE6A 2ZCKL 2HWZL 1QUNA 2VH5H 3R8QA 4HC1A 3SDXE 2A77L 3X13B 5JHDB 1NFDE 3TBSA 1XF5A 3PP4L 4B41A 2APVA 1FCGA 4Y19A 1HILB 1DTUA 4LBEA 1WEJL 4S1SL 1RY7B 4JZJA 3I75B 5D7JB 5FHBH 5M94B 2VDPL 1SY6L 3QPQD 5CZVH 2V9QA 4NOBA 3L3OB 4JN2B 4Y7MA 5LGJB 5LXGH 2YEZB 2X89D 1OWRM 2IH1B 2DKUA 5DJZA 1RK0A 3P4OA 4R0LC 1XH3A 1WISA 4P2CG 3IJSA 3S35X 3TM6A 4AEFA 4JZOA 3GMPB 1IGTA 3QRGH 2HFFA 1WBZA 4OFIA 1HSAA 5DJCA 4X7TB 3BISA 2P45B 2A6IB 4HIJA 2HLAA 1N59A 3HC4L 2LABA 3TBWB 4R7DB 4TUOA 3SE4A 3WS6A 2P49B 3QFJA 4FABL 1KPVA 4ZOBA 4HKBB 3BHBA 3D85A 2X4RA 1OTUC 2RIKA 4L4TE 5FO8B 2BVQB 4MAUH 1L0QA 2CJUL 1AD0A 3NCYS 3F58H 1OAXL 5T3XH 2IH3B 3HE7B 4BQBA 3H3PL 1P4BH 2B0SH 3BPNC 4DKEL 3UCRA 1GZPB 4JQXC 2BJMH 3NABH 4LEOB 4PP2A 1D6EA 2XWBB 3TYGL 4OUUA 1JFQL 4LRNH 3INUL 3PGDB 5F89B 2BZDA 1HEZA 5EBLB 5LBSL 4NQTA 1M4KA 2FX9H 5BW7C 2VDNL 1X5XA 3QJHB 5HHMB 3MXWH 1ACYL 3CC5B 1AFVL 4GKNA 2PTTA 4WO4D 5HPMB 2GJJA 2HTKD 3KDMA 1OGAA 3B83A 3GIVB 5E99L 4N8CH 1VERA 4NFBA 3U2SA 3U7AA 2NPLX 1HXYA 5JPMA 3PF2A 4RFOL 1JCKA 3EFDH 4GRWF 3G5ZB 3ROOA 3E1F1 4QTHA 3D2UB 5EIIA 4KROD 3D39A 2DBLL 2BMKB 2MQ0A 4R4FL 4YFLI 2IG2H 1EBAA 2HJKB 2J8HA 2W0PA 3FRUB 5GRJL 4YHZH 1FL5B 1VGEL 1ZLVH 2E6QA 5KJRL 1P1ZA 1TCRA 2FX8L 1MLBA 4GXUN 2P46B 4OLYL 4I77L 4QHNA 4G42A 5IFJB 1XAUA 2AV1A 5J56B 1WF5A 3KJ6L 1ZTXL 3BJ91 3QJFB 4HWUA 3RVXD 2EXYD 3DMMB 1HNFA 1RULL 1CF8H 3B9EA 2VSCA 4OUOA 1DEEB 2BSSA 4KGLA 2VZUA 2CK2A 3CSPA 3VXRE 1UWEH 3I2CH 3QDJD 2FO1A 3QQ3A 5BS0A 3ULVE 4PGDA 3MRQB 3D0VB 2BCKA 1EJOL 2Y4SA 3FB5B 1FORH 3GMNB 4ZFOL 5DVLA 5I8KL 4WUUB 3QZWB 1KIPA 4NYLA 3UJJL 4Y4KD 5ESQB 5FEBA 3TNNA 5EOQL 2WAHA 5JW3H 4H0IA 2R2EA 1OTTD 4FXKB 1ZT4B 3PDOA 5HYJA 3N85L 2O5ZL 2C1OA 1UZ8B 4K7PY 5MENA 3ZKMD 4NQEE 2VLRA 4K23L 4RGOH 2XKNA 4S2SB 2UV3A 2H2PD 3LSOA 1MQ8A 1BVKA 1GGYA 1NCUA 4UV4L 1MCDA 2PYEE 3S96A 2IC2A 4HDIA 1V3LA 5C6TH 5DUMH 3B3IA 2K7QA 3FB7A 4CBPA 1UZ6E 4N0CD 2XYCA 4D9RE 2OL3B 4F7PA 1HINL 5D6DC 3ZT7A 5KAQG 5D4QA 4HG4K 2VR5A 3L7EB 1F6AA 1CXFA 4AY0A 3QULA 1BIIA 1OPGL 3S37L 1A7QH 3OTTA 1OWWA 2RCSL 2IPKA 1ADQL 4YNYA 5E7FA 4ISVA 4P2RA 3IVKB 4LPVA 3VD3A 5EU5B 3HNTH 3VGDA 3ZKNC 4HIIA 1E27A 1KPRB 4H5SA 3W39A 2CKNA 2DQIL 4D8PB 5JW4R 3ARUA 4G6KL 4EQ2A 3EOAB 2V5RA 1S7SB 1WICA 2VIRB 4P9HC 4Z0BL 4WJ5B 1UH2A 4DGYH 5KOVC 3H9HA 3MUGA 3WIIH 3QUYC 1LEIA 5CKAA 1NCCL 4UU9B 2PNDA 4QT5A 3NZHH 2ICWJ 3LIZH 3V8OA 1JPGA 3TIEB 2CUIA 3CXDH 2C3GA 1CD1A 1Q9LB 1CBVH 4XP5L 3IDYB 4Y16D 4MDIA 5LQBL 4WFFE 3SE8L 3G08A 4HEPG 4OD2A 5B3NA 2E27H 1I9JL 5TFSH 4F7EB 2OJZH 1EVUA 3NPSB 1HH9A 5IOPA 1U8LB 4XCEB 1IC4H 2VUOA 5A2IH 5EU3A 1H15A 2OK0L 2M1KA 1HZHH 3FO9A 2XWJB 4X0KA 5F93C 5JXEC 5GGTL 3DX6B 2IPUG 4UOJA 1FHGA 5GGUB 4DKAA 4HWNA 3OPZL 4P48A 1TVBB 2EDJA 1QBLL 5D93B 1K9TA 4I0PA 4Y2OA 1H9VA 1JNLH 4OIAA 3P9MA 4MXVF 4FQXA 4HCRH 4G7YH 3CAFA 3FFCB 1TETH 2HMIC 1TENA 4U1NB 5E94A 4DAGL 2NY2D 3B6SA 3SCMB 3AM8A 1JRHL 3EHBD 5TPWH 3O2VL 4RGNE 1ZK9A 4ZS6D 2B4CL 4X6DB 1PKQA 3UBXA 3LKQA 5ICXA 5I9QC 3VRLF 1KEGH 2ZUQB 5CMAB 4M8QB 1ES0B 3IDNB 3QQ9D 3IF1A 4UQ3B 5DMGD 5JUEL 4M7LT 1IGYB 1OQXA 1U8HB 4LLWB 5K9KA 2P8PA 5FECB 1GL4B 3RL1B 3HZVB 4OKDA 1VGKA 3BN9C 5T1KA 3I9GL 4ZO8A 2V2XA 1N5YH 2NY6C 3J8F7 3GSOB 5T3XD 4ELMB 3PQYB 1JK8A 2FBOJ 1KCUL 4LLMA 4YHMH 5GZND 3QQNA 1J86A 3RY6C 3MLSL 4O02L 1KJ3H 4UB0L 1N6UA 1B2WH 1KCKA 2P8LB 5E6YA 4NUJB 2OS7A 3RI5F 4PGBB 5IG7B 3TC9A 3MBEA 2X5PA 2QHRH 1QACA 2OTWB 3C5ZB 3CIQA 5EZOH 5TF1L 5KW9L 2X89A 3RTQD 2BXZA 2BC4B 2J8UA 1A5FL 4QF1A 3OKKA 3RKDC 1TQBB 2NMSA 4PJ5B 4JKLA 3VXTA 3E0GA 3L9RB 3LKSA 5E8EA 5C09D 5M95B 2AXGA 4P2YA 3MOAH 4G6AD 3GB7A 4NPYB 5HVGB 3RVWD 1KIRA 4Y2DD 1AO7A 2VLLA 5J6HA 3WN5A 1TITA 4GG6A 4K9EC 1ZVSB 5AG8A 1S9VA 4K07A 2XTLA 5EU4B 1F3DH 4GBXD 4OF0A 3ARZA 5IFHH 1Q94B 1I7TB 5EU6A 3R0MA 4NGHL 1MIEL 3CDGB 3TVMB 1WITA 2C1PB 2Q7YA 3VFSA 1KSRA 1LO2H 4AT6A 4MGXA 5J12C 2X70A 4P3DB 2D0HA 4PJ8C 1SJHB 1TTFA 3RWHB 3MPCA 4D9QE 1G6VK 4U1JA 5GGRY 4HMDA 4XNZC 2ADJA 2FX7L 1OSPL 5DJDA 5BO1L 5DEZA 3QIBD 2CUHA 1IAOB 1S7VB 3L3KA 4MCYB 1A3LH 1I8MA 2HH0L 4HZLB 4WO4A 5ANME 4P2OA 3RZCC 3WIHL 5HDBE 4XPBL 2AEPL 4NCC1 1JGLL 2UWEF 4KI5C 4PJDB 1T66D 3JWNC 3KJ4B 1DBBH 3QA3A 3PL6C 3SGJA 1XCTA 2KZWA 4HIXH 3DURB 1CFVL 1IEHA 1I75A 4HBQA 1CZ8H 4QGTA 4XMKH 5F7MC 1XGQB 2UZYB 1GGUA 1QRNB 3KPOA 3UTTA 5KSBE 2JCCB 1LE5A 4YHPB 5TE6L 1HHJA 4QRPD 5B38A 3PDDA 4HIHA 3E2HB 1R5VA 1EHLL 2PYFB 2DM7A 3JBG7 1T0MA 3LKOA 3SO3C 3Q6FA 5C0IA 2HJLA 3O4LD 3MFGB 4X6BA 1TFHA 4DW2L 4HS6A 1MPAL 1CXKA 1IGML 2PO6A 5D1QD 1F58L 5LKNA 1FLRH 2WUBL 4KRPD 1QQDA 1S7XB 4HSQA 2DOCA 3IU4L 4X6FA 4ODHH 1Z9LA 2VL5A 4UNVA 2Q6WB 3FCTA 4JR9H 4MSWA 1FPTH 2XTJC 3SJVB 4OZHF 4XTRC 1IJ9A 3H9SA 5EUOF 3W5NA 1G7PB 2V2TA 4U4BA 1F3DJ 2GAZB 4GG8B 5GS1A 4M6AA 4NM4H 1S5HA 5KSAB 2X4QB 4Y4KA 1Q0XH 3F12B 2I60H 2VNCA 5EO0A 2DM3A 4X7SH 4NQUA 3G6JF 3GMMA 2MCPL 1X5FA 4Z7OE 3K1DA 4LGRB 3U82B 5K9QI 4JY6B 1P9MC 5T33H 4NZRL 3O3BB 2NY1B 1CDYA 1XF3B 3X17A 4ELKB 5C07E 1IMHC 2HRPH 1YYMH 2BK8A 3CZJA 3RWFA 4YXLH 3F65A 1WFTA 2Y23A 5SX4I 4H1LB 5E08H 3HKFA 2G75B 4R4BB 3VFGL 4MJIB 2O5YH 5HHOB 1BVLB 3DGGB 3FJTA 1JPFB 1EVTC 3ZE1E 4U6VL 1Q0YH 4MNQB 3PWUA 2VC2L 5I1GL 4RWHA 4UTAH 5GS0H 4LHJB 5T3ZL 4YFDB 4Z5RA 3OGCB 4WWKA 4HIEB 5C86A 4IRJC 3O8XC 3GUTB 4FQ1L 2BNQE 5JHLH 1FO0B 2IALA 1HHIA 5HHXH 4X6CF 4KVNL 4OQTA 3DYOA 1HNGA 2H32H 4JDZA 3CFBB 3FFDB 4HUXA 5FO9A 4P99A 3IFOB 5FYJE 4LFHG 1YEHH 2BSTA 1XIWB 4GRLC 2VXSH 4S1RH 5FB8A 1AXSA 1TIUA 3PP3K 3SGKC 3P9WB 5C0CE 5IJKA 4JQVC 5IBUG 2OR8A 5HHVL 1WWBX 3BZFA 4Y16A 3R1GL 2YPLB 4LSSL 3BEWB 1INDL 1A1NB 1WZLA 4CVUA 5ERWA 4WI9A 3EGSB 4JPWH 1G7QA 5B39B 1Y6NR 3HHRB 1SEQH 1TJGH 1UWGL 4ODUA 3KLAA 3U4AA 3VFTB 3WE6B 4Y4FD 1F4YL 4AZ8A 3TP4A 2QQQA 1G6RB 2PETA 2FATL 5FDWA 5I75B 1IM9D 1IFHH 5FM8A 5FKPB 4QKXB 3S6CA 1TJHH 3FL7A 4JZJB 4N1EA 4LLDA 1A7OH 5HDQL 1DQTA 3B2UC 1ZEAL 3T0ED 2DWDA 4XNUH 4PJFF 5BZWA 3GRWA 1HQ4A 1BZ9A 2FL5A 4KJQD 1YNKH 3C8KA 3SBWA 1XGTA 1S9YB 2AK4D 2JIXB 5DJZB 1LMKA 4MLIA 3P4OB 5F9DC 2EKSB 1WIUA 4EUPA 1P7QD 4P2QD 1L9MA 4GAJH 4UMGA 2NR6D 1V3MA 4JZOB 1JPTH 2HFFB 3NFSH 1EH9A 3MSPA 4P5TD 5DJCB 1JN6A 2KQMA 2YD9A 3LRHA 2ITDA 4ODTH 1NL0H 1Z3GL 3QIUB 1HK6A 1MFAH 4HIJB 2HLAB 1N59B 3ZSTA 1CU4L 4ZYKA 2JJSC 5E5MA 5IQ7H 1VHPA 3QFJB 1DBAL 1RVFL 4KDTC 4PJGE 1KPVB 4M00A 2ZUVA 4AG4H 3WXVL 4Z0XA 4ZNEA 4ALAH 5C9JA 2Z93A 1A4JA 5F72S 1A3RH 5D9SA 3OKDB 3T8XA 4YHLL 1W72H 3IJYA 5BV7H 3QCUL 4Q6IC 2P4AB 4HWBA 4OGXH 4X9HA 2VZSA 5D7LB 2OMNA 4Y4HA 2AEQL 3FO2A 1IILE 1JF6A 1FL3B 1ULVA 3ZTJH 1LQSR 4N8VA 4P9MH 2N7AA 1RAMA 3U0WH 3MRNA 4J4PC 4U1MA 4PP2B 4PY8I 2UVEA 4JCLA 5CBEB 4PB9H 2ZUXA 5C09A 1S8DA 1M05A 5SWSD 5I73B 5KSUA 2PXYC 2PCPB 3RWJB 4NQXA 2JK5A 4JJ5A 1PJ9A 1K8IB 3JV4A 3KNBA 2PTTB 4PLNC 3KPLB 4X4XA 1A1OB 3H9YA 1CIDA 3A6OA 3KDMB 1OGAB 2X10A 4NT6A 4L4VB 3U2SB 4JN1H 5DK2A 3D9AL 5AWNL 3MODH 3I85A 3EOBB 4NQCE 4ONFH 2IFGA 3GK8H 4I9WD 2YK1L 3O2WH 2XN9E 3D39B 5CEZH 3QQ4A 3KYAA 2A0LD 2YRLA 2XZQL 2ZJSH 4U6TA 1P4IH 2E7MA 1NGQH 3ARDD 4KK6D 1L7TH 1BJ1H 3NCEB 2ICWA 3GJEA 1MAKA 5F7UA 4XNQA 4RMRA 3D3VB 1P1ZB 1TCRB 3P0VH 1MLBB 4XBGB 4G42B 1W2KT 2R0KL 2AV1B 2O93L 1JNHA 4X7EC 3EDDA 3Q6GL 3QIBA 5F1SA 4DKFH 5HGDA 2ERJC 3QQ3B 5BS0B 4XPGH 1LO4L 5I76A 3MLYH 4PGDB 3BI9X 5IBLC 4M6MH 1RZGA 1QLFB 3MJ6A 3V6ZA 3QI9C 3GSNA 5IHUL 4IOFC 3K2MC 2IAMD 5MHSE 2E9JA 2Y6SD 5C0ND 3ZYZA 1OARL 3PGFH 5DWUH 1D5IL 1QR4A 3NCBB 2FJHA 1KIPB 4NYLB 4MHHI 3OXRA 3QXAA 4NZUH 2OX5A 4QRPA 5IB5A 3UTZB 1FAKT 1OCWL 3BKYH 2RBLA 3PDOB 4LSTL 5HYJB 2C1OB 4S1QH 4GS7B 2VLRB 3FN9A 3K0WA 2XKNB 3EZJB 3LSOB 3QXVA 3PNWB 4JM2C 1FRGL 5L8LB 1BVKB 7FABH 4YQXL 3S96B 4HDIB 4PLOB 4CADA 3QDGB 2IANE 5EBWA 2MNUA 4JDVA 5KANI 3B3IB 4CNIA 1JZ5A 3FB7B 3VXSA 3PWLA 5D1QA 3SDCB 1KELH 4BQCA 5HI3D 1QFOA 2X4OB 4ZS7H 3BDXA 4P49A 5GS0D 5KVGH 1F6AB 2WM0A 1T5WB 4I5BA 4U6XB 4RISH 3QULB 1LO5B 4ENED 5K59E 5KSVB 4YFLF 2IPKB 4NP4H 4XHQA 1IEBB 4YNYB 3RIFK 1EFXD 4FFVD 5JORA 3Q1SL 4IRSD 4P4KC 3B9KA 4KKLC 4XVUC 4HIIB 1E27B 3W39B 4PV9B 4M6NH 4JPVH 5K9JH 3S5LA 2Z35A 3MRLA 4ZOCA 2VZ3A 1UKTA 2EO9A 4PJCA 2ZOKA 4JO3H 1BJ1J 4Z77A 2WBJA 3DHJA 3C08L 4L3EA 3H9HB 4DZBA 4XI5D 4UQ2B 3CVHB 2EE9A 2JJTA 4PJHF 4QO1A 1F6LL 4ESKA 4QT5B 1FIGH 4OD3H 4U2YA 1G1YA 5E6IC 4ZUVB 5JO5B 2MJWA 5GRVK 1E28B 3IXAB 4JFZL 2W60A 1CD1B 4F2MA 1CG9A 2CRIA 1IKFH 5DJ2B 4OD2B 5IK3B 3VFOA 4JFPA 4QHKI 2LU4A 3EYQD 3SEPA 1VA9A 1GPOH 3SKMA 3LEVL 5HHQB 4QLRA 1MREH 1H15B 3MOQA 3LV3B 3MR9B 1YMHB 4X0KB 3QEGL 3WUWA 4PJBE 1MCNA 5I1EH 3MV7E 4QRRB 3V8CA 2P5ED 4I0PB 1OAKH 1A3QA 1PLGL 1X5ZA 1YEKH 3HC3L 3MRCB 4KKCC 3FQRB 4P46D 1NBVH 2R0ZH 1XGYH 1J8HD