1JERA

Cucumber stellacyanin, cu2+, ph 7.0
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
110
structure length
110
Chain Sequence
MQSTVHIVGDNTGWSVPSSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFVNSDNDVERTSPVIERLDELGMHYFVCTVGTHCSNGQKLSINVVAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CUCUMBER STELLACYANIN
publication title A missing link in cupredoxins: crystal structure of cucumber stellacyanin at 1.6 A resolution.
pubmed rcsb
source organism Cucumis sativus
total genus 24
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 1996-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02298 Cu_bind_like Plastocyanin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1jerA00
1A65A 3QQXA 2BP8B 1OCOB 1PZCA 5AKRA 3FU7A 1URIA 3UAEA 2XVBA 2FTAA 4BK5C 1PNCA 5B1KA 4BDVA 2DWTA 2GB2A 1ZIAA 2IDSA 3CVDA 2J55A 1J9QA 2DYSB 1AR1B 2P80D 1OE3A 1L9PA 1TU2A 2BW5A 3G5WA 3T6WA 1ID2A 2XV2A 3ZBMA 2IDUA 4HALA 4A68A 1ZIBA 3C75A 4KO9A 2RACA 3EH4B 1BYPA 4AKPA 2XU9A 3FT0A 4E9SA 2GC7C 2BHFA 1ILUA 3FU9A 2YAOA 1L9TA 2QPDB 4JHUA 1IBYA 4HZ1A 1NPNA 1L9RA 1X9UA 2I7OA 5I5JA 3X2QB 3U25A 5I5MA 2CUAA 1HFUA 3NP3A 2IWEA 2QDVA 3SBQA 4YSQA 5AFAA 5IY5B 3NP4A 1WS8A 3H4FA 1ET7A 1ZDSA 7PCYA 3WG7B 2EINB 4DP1X 2ZONA 4M3HA 4HHWA 3X1NA 4CSZA 3TBCA 2IDTA 3UACA 1CC3A 3FPYA 1WA1X 1WS7A 5TK2A 4F2EA 1OV8A 4YSAA 1BQKA 4RH4A 4KO6A 2BO0A 2YARA 5EHFA 3EHBB 1AIZA 2QDWA 1DZ0A 1JZJA 1PNDA 2IAAC 2UX6A 1BEXA 1ZDQA 2PCYA 2GIMA 4KO5A 4PAZA 2YAPA 3NSDA 2BP8A 1PAZA 4GP5B 4HIPA 3AG3B 3WKPA 2HX9A 1SFHA 2TSAA 2GSMB 1BQ5A 3S3BB 3DTUB 1SDDB 1OCRB 1ILSA 3QJVB 1SHWA 4DPBX 3NT0A 1KYAA 3IBOA 3WNIA 4YSOA 1CURA 1JZIA 3QJSB 1M57B 4AX3A 2FNWA 3WNJA 4A2DA 2WO3B 4FA7B 1W6WA 3JT2A 4P5SA 3KW8A 3OD3A 2PPDA 4ENZA 3FU8A 2AZUA 3NJKA 4YSEA 1XB8A 4HAKA 2IH8A 2WSDA 4F7KA 5B3SB 6PCYA 5I6PA 1V54B 3V9EA 1N68A 3QJRB 1JOIA 5B1AB 4DP8X 1XB3A 2I85A 2AFNA 2W88A 2BZCA 3OMIB 3N2JA 3PPSA 2VW7A 4YL4A 2VW6A 2PP7A 1E5YA 2FT7A 1KGYE 2HXAA 2Y1AA 5I6MA 2GHZA 4E9VA 5B7FA 1MG3C 1ASPA 1AAJA 3GDCA 3DKHA 3QJUB 2ZXWB 2FQFA 3X1GA 4X4KA 5A7EA 3QJTB 4GP4B 2H5UA 1E30A 1A3ZA 1GR7A 2DV6A 4GXFA 4UAHA 3ERXA 2NRDA 3S3DB 7PAZA 2OCCB 1HAWA 1JERA 2XX1A 4DP0X 4G71B 2HLEB 2XV3A 2CALA 4E9QA 2UXFA 4A2HA 5I6LA 2FWLB 1TEFA 4YSCA 4YVNA 1HAUA 1AOZA 2VW4A 1J5CA 5I26A 1L9SA 2N0MA 3FQYA 1AZBA 2IWFA 5PAZA 9PCYA 3ASOB 3FSWA 1M56B 3ZIYA 1MDAA 3IEAA 3X1EA 2PPFA 2JKWA 2BP0B 1RZQA 3T71A 3UABA 1KV7A 4YSUA 1RZPA 1QHQA 3OMNB 5F7BA 4NERA 1BYOA 5D4HA 1NICA 1JVOA 4AKOA 3T9WA 2QT6A 2XWZA 4W9ZA 1IUZA 4AZUA 2YAHA 2YAFA 4TXVB 3UADA 2J5WA 2LLNA 1CYXA 1AS8A 3TBBA 1CYWA 3WIAA 2WO2B 4EF3A 2YXVA 4KO7A 4YSPA 2JFCA 3KW7A 1FWXA 2CJ3A 1BXVA 1NIBA 5D4JA 2VM4A 3CVCA 2H47C 2XXFA 2UXTA 3AG4B 4G7QB 2CBPA 2GBAA 2OV0A 1NDTA 3FQ2A 5LDUA 2I7SA 3PAUA 2ZOOA 3TA4D 1ETJA 1OOWA 2VN3A 4A67A 2JXMA 2IDFA 4E9YA 1IKOP 3AG2B 2X88A 1OCCB 2IWKA 1I53A 4QKTA 2IH9A 3FYEB 3NJHA 1W8EA 2VSMB 1IC0A 3S8GB 5B1JA 4DP5X 3NJIA 3S8FB 4G72B 1PMYA 5FC9A 2FQEA 1ZV2A 4W1TA 4A66A 1AZNA 3OQRA 3CZUB 4G7SB 4HCGA 4KNTA 1PZBA 4BDVB 1ASOA 3H56A 3PXLA 2YQBA 4E9RA 1GSKA 6PAZA 5TK4A 1GY1A 4K9JA 3NJLA 3CDZB 1BAWA 3FS9A 1AZCA 1J9RA 4DP2X 2VMJA 1KBVA 3T6XA 2YXWA 3SQRA 1WA0X 4DP9X 4NB7A 4QLWA 3AG1B 2UXGA 4P5RA 4G7RB 4FAAB 1JXFA 1SF3A 1PLBA 3BVDB 4KNSA 1AS7A 3FYIB 1JZHA 2GI0A 5ANHA 5B7MA 4MFHA 1E5ZA 2PP8A 3D12B 3GXUB 3EF4A 1XB6A 4GP8B 1DYZA 4DPCX 2HRGA 1T5KA 2PP9A 1MZYA 3BQVA 1A8ZA 3NJMA 4GYBA 4HCIA 4UANA 1OE1A 1AG0A 1A4BA 2E86A 3PCYA 1GW0A 3WI9A 1X9RA 4AI7A 3FSZA 2H3XC 2X87A 3JTBA 1SFDA 4DP7X 4E9WA 1A4CA 4F2FA 3N55A 1MG2C 3QPKA 1YLBB 2PPAA 4JKNA 3ZX1A 5D4IA 4GY4A 5PCYA 3FSVA 5B7EA 5B1JC 3T6VA 3AW5A 1R1CA 2DY2A 2BW4A 2IDQA 4PCYA 4HHGA 1L9OA 3UGEA 5I6NA 1PZAA 1NIAA 1RCYA 1BQRA 1BXUA 3L45A 3FQ1A 1M9WA 1PLCA 2EILB 3NJNA 4AKQA 2AVFA 4BWTA 1SDDA 1QNIA 1W6LA 2AANA 4A2GA 1PLAA 3CVBA 1OE2A 1BXAA 1A4AA 4KOBA 1ADWA 2XUWA 5E9NA 1AACA 3DIVA 2B08A 2R7EB 4Q89A 2YAQA 3NYKA 5AZUA 1SNRA 2HRHA 3CDZA 1N70A 8PAZA 1KDIA 3EH5B 3ABGA 3ZDWA 1FA4A 3NSYA 3RYMA 1OCZB 1PF3A 5I6KA 3ABMB 2UX7A 3ASNB 1CUOA 2HX7A 2VSKB 4KOCA 3FSAA 1NWOA 1ZPUA 2VM3A 3ABKB 1JZGA 1OF0A 4DP4X 4HCFA 4E9XA 1JVLA 1GS7A 1AZUA 1AG6A 3IN2A 4WTQA 1JXGA 1E65A 2FT6A 1QLEB 1GS8A 1JXDA 1SF5A 2PPEA 2FQDA 2QPEB 3GYRA 1FFTB 3AY2A 4BWWA 1NIFA 1AQ8A 1GYCA 2PLTA 4YSTA 3X1BA 3NJFA 4YSDA 2DYRB 1ET5A 1NZRA 5I6OA 3HB3B 3NJGA 1JZEA 1KBWA 1SJMA 3IE9A 4JHVA 1WA2X 2YAMA 5F7AA 5I28A 2DWSA 3X1FA 1ASQA 2AZAA 3UAAA 1ET8A 2XLLA 1PY0A 1MZZA 3FU7B 1B3IA 2HZHA 3H4HA 1SHXA 4ZK8A 1J5DA 2GC4C 4UF7C 2OJ1A 4N4YB 3OMAB 2P80A 3OM3B 4YSSA 3PAVA 4CSPA 3CG8A 3MBWB 1V10A 1KCWA 3EH3B 1KDJA 1V55B 4BWUA 2Q9OA 4KNUA 1WAEA 2XYBA 1L9QA 2ZWNA 3NSCA 3SBPA 1F56A 3TU6A 1IBZA 2Q5BA 2Y69B 2MTAA 2HX8A 1AZRA 2R7EA 2FQGA 2TSBA 4A2EA 4G70B 4M4RB 1EHKB 1PCSA 2BP0A 2UXVA 1J9SA 1NINA 2J57A 3NJJA 1GY2A 1AS6A 4DPAX 4NAJA 4E9TA 3T6ZA 3PAZA 1E67A 1KCBA 2MRYA 2CAKA 4WKXA 1NPJA 4Q8BA 1RKRA 3PLYA 1UATA 3V9CA 3ABLB 3HEIB 1GS6X 3WKQA 2YAEA 3QJQB 4DP6X 1EZLA 3TASA 4BXSV 3FPXA 4A2FA 5B1BB 3NSFA 1TKWA 2PCFA 1NIDA 1TEGA 4YVUA 4YSRA 2BZ7A 1NIEA 4N8UA 2EIKB 3AZUA 2J56A 4L0PB 1VLXA 2XV0A 5I5IA 4BXVA 2PPCA 1NWPA 2BWDA 2EIMB 2XX0A 1NTDA 2CCWA 2XXGA 2FT8A 2EIJB 2W8CA 3MX0B 1AANA 1JZFA 2B3IA 2FJSA 3IN0A 2A3TA 2BWIA 1J9TA 1XMEB 3S3CB 3SBRA
chains in the Genus database with same CATH superfamily
4LCYB 3SO3B 2CO7A 5DUPL 4BE5A 4L4TA 4S2SA 5DR5H 3TM6A 4X0KA 3EOTH 3HC0A 3D33A 4PS4L 4CU6A 2CK0H 4NP4L 2X9XA 4RIRA 4ZMWA 4N0FA 2YQGA 1MVFA 2MCAA 1G7QA 2VDQL 1FL3B 5LUMA 2BRRL 1TU2A 2DQIH 3IGKA 3ARTA 4XPAL 5EBMB 1BAFH 5CP7B 1U8IB 4CA4A 3VXSD 2ADFL 2IDUA 1B2WL 1XSIA 2A99A 5K9KB 5ERWB 1FL5A 1W91A 3PGDA 1S9XB 4LESA 4AKPA 5GS1B 5I66B 1TTFA 3KPPB 4X7EC 5D5MB 4X5LA 1BG9A 4HD5A 3FQWA 3I2CL 1YVLA 2IAMD 4N68A 1IFHL 2OSWA 2B8OT 2I7OA 3CPLB 5I5JA 2W0PA 3WS3A 3B5HA 3IPBA 4MAUH 5DMKB 1EO8L 1RP8A 4HMDA 2CUAA 2A1WL 2XA8L 5ALBH 4LEOA 4AE0A 4U7MA 2EINB 1CDCA 4DP1X 5A7BA 3SDCC 4G6AD 5C8JA 3QI9A 3LIZA 4Z7OF 2G0KA 3BUYB 5CEZL 1G1OA 3TBCA 2BFVH 3HMXH 3KH3A 4Q52A 3O9WB 4JG1H 1UZ8A 1FZOB 1OW0C 1SEQL 1JF1A 3CSBA 2Y0SA 5DHVH 4FG0A 3LB6D 3O0RL 5ESQB 3SDYL 2H0EA 5GS2D 5JMRA 3CD4A 4Z9KB 1HINH 5GHWL 1I8IB 4EIUA 3V4PA 2IJ0C 1CXKA 3MX0A 1WBZA 3AWEA 3FC8A 4RAVA 3H3PL 2H3NA 1S7WB 4G9FA 3V79C 2GK0A 4YHPA 2JJSA 5CU9A 3SSGA 4XVUC 4GOSA 4CUCA 4YEFA 3LPWA 1G7HB 4UT9A 2HX9A 1TJXA 1Y6MR 4OM1L 5C08D 2R4RL 3FH8A 3TO2B 4EMZA 1C5CH 2IG2H 3MHZA 5AUMA 2DJ4A 3STZB 3TURA 5ECJE 5JXAL 3FAWA 1SDDB 3IDXL 1KJ3H 5F89A 3TIEA 2OAAA 4PWFA 1SHWA 3I02A 3W2DL 3GRGA 3NT0A 4JPVL 4IRJB 3KPRD 1JZIA 3PF2A 2RTTA 4KAQL 2RIKA 2WM0A 3HI6H 2EDXA 1CFBA 5GS0D 5EIVA 3U9UB 4J3BA 4C4BA 2ZX8A 3HVNA 2BZDA 2NYZA 4GKZB 2V9TA 1HQ4A 4APQA 5F7DA 2XDHA 1DE4A 3CH8A 5LNGA 1SPDA 4BJLA 4ZS6D 4QGTA 4TLKA 5I8EB 2NUTA 1TQCB 4WW1A 4AIXA 4S1QL 3LMJL 3WNPA 5ABZA 5I6PA 2EO9A 1UD4A 3TEZA 4QF1B 1Y07A 1F4HA 1BMZA 4JFZH 2HFFB 1F2QA 1NAKH 3KHQA 3GSNA 5BJTA 4NO0D 4LMQE 5KSBB 4QMEA 1DANU 3QFJD 4XNZB 4NC1E 3IJYB 5C7XH 1GA2A 1LTXA 2H0FA 3T1WA 2XWDA 4G8GE 5I16A 1FNGA 1G9HA 5IVXA 3F58H 3KEDA 5ICYB 3O8XD 5EORL 1E6JH 5ENWB 3PABB 2F58L 4JNXA 1CL7I 3HN3A 3F7PC 3WLBB 3GSWA 4V1DB 1CJYA 1S7RA 4G7VH 4ONFH 2XNAB 5CJOL 1AE6L 3QT2A 2E7BA 5I1HL 3MLSH 2DQHH 2CLVB 2V2XA 3OZKA 4RFEB 3U7YH 2XZAL 4YZFE 2HLAA 2NY4B 2WXMA 3M6DA 4NO3B 5C0AD 2HLEB 3L2LA 2QADC 4PJFE 5K39A 1ECZA 4P5KB 1XTMA 1AVAA 2WBJC 1IKFL 3NRFA 3VI4E 1OO2A 5FM5O 2VR3A 4ELDA 2WP3T 4Y5XB 4YZFF 1USZA 2WKLA 1ZANL 1KN2L 2C9QA 2EYRB 5DVKA 1ZE3H 1AKPA 3M46A 4PJFF 5D72L 1Q0EA 3RWEB 3X1EA 1DO6A 1U6AL 3UTSD 3VI4F 4ZFQA 2UZXA 3RPIB 1W2KT 4TSBH 5F93C 2QV2A 3T0EC 3RDJA 2D03H 2X6BA 3CFIC 4AQ1A 4OB5L 5KSVA 1DLFH 3OPZL 4PJ8D 4PRPE 4ODWB 5HDBB 2I5YH 4AKOA 3BRDA 2XWZA 3RVWD 1ZT7B 2A4EA 4G42A 5DMIH 3U1PA 1MJ8L 3AS0A 4NPJA 3ARPA 3UZVA 1ORQA 1DEDA 1NFAA 3QAQA 4JJOA 3ME0B 2I32A 2WQXA 3EHBC 1J5OL 1MCFA 2XPGB 4JHWL 4P06A 1ZHKA 3SDDA 1XEDA 5AD0B 2DWEA 3SD5A 3LQZA 4G6ML 2O6PA 3GSVB 1NCBH 1WRFA 1S7SA 1E7UA 3OR6B 3T3MF 4PJ7B 1W8NA 4AC2A 3RX9A 2GIXA 1PKQA 3HE7A 3DXAD 2Y24A 1MNNA 4POUB 4RDBA 3BUQA 4DGIH 1F18A 2NY3D 2K7QA 3QH3B 3T4AC 3SQBB 2E9JA 2FX9L 4LVOB 4CRPA 1A14L 5B1JA 4F8LA 4LSSH 4EI5B 1G9ML 4AJWA 3ARDD 3TPUB 3IXTA 2WCGA 4G7SB 5GGUA 4IBLT 3ROOB 1A9BA 4UTBA 3PXLA 4M03A 2AJVL 4BRVA 4HWUA 1HHIB 2V7NA 3G6DL 5BRQA 3UO1H 4AYID 4Z76B 5LBSH 3KPNA 4TNVF 4K3JL 1ZTMA 1NOLA 2Y2YA 4MZ2A 4E42B 5AVYB 4Z3FA 4NB7A 1WFMA 4ONHB 5DD1L 4L5FE 5HYQA 3KS0J 2XZQL 3BI9X 1M7IB 4PY7B 4UT6H 5MI0B 5FCUH 2QSCH 4HXAH 3T0EE 3ZTNH 5B7MA 3MRJB 2J72A 2BNRD 4U1MA 4KUZH 1YQ2A 3D18A 5AZ2L 3ZR5A 5I1GL 3Q8BA 4DPRA 3D4YA 3GQFA 4N8VB 4TTDD 2J1ZA 4JFWA 5KVEE 1R3JB 2PXYD 1GW0A 3LHAA 2FECL 1EGJL 1Z9LA 3UCRA 5CN3A 1B0IA 4YHKH 1WG3A 4FQ2L 3IFPA 1DBML 1UENA 5EN2A 1Z0MA 3KPQA 1FZMA 4TVUA 3G5XB 4LASH 4ZBJA 4J1UB 2EH8L 35C8H 4NWTH 4P4RA 3HZMA 1KENL 1EEYB 1JG9A 2WQAA 2OZ4H 2VISB 3UTOA 1U8MA 1DL7H 2XN2A 4N85A 4Q97A 3VYPA 1GCYA 1SY6A 4J12A 2NXYC 3WO3B 4HGMA 4YXHH 1M05B 4LLDB 4YHMH 2LQRA 2WYIA 4NQEB 2DBLL 3FT2B 1A4JA 3EYFA 2D7MA 2XVLA 2VMEA 2F19L 2VXTL 4Q58C 2G75A 2X40A 3TJHC 1NCWL 5FUOH 4A2GA 2F1AA 4U3XA 3EJUA 5KZCD 4L1LA 5I15L 1OB1A 5IQ9B 2E7MA 5J13B 1E8YA 1AKJD 1CDHA 1LHZA 5SWSB 4F8NA 4GQPH 4X0NA 3BKYH 1BLNB 1OTSC 4D0DB 5JW3L 5EU6A 1ZLSH 3SKOA 3QPXH 5CEYB 3TBSA 3H9SE 5LO7A 5BUGA 5FR3A 5E2TL 3DVNB 3F8UB 1Q72H 2J8UA 1ZLUH 5F3HB 2OMVA 4LNVA 1JGLH 2L7UA 4OJDH 1R3KA 4XN5A 5LDSA 2B59A 3T77A 3QE5A 1Z32X 4OLVL 1AO7D 5DHMC 3V52H 2XWTB 2GVYA 3US1A 1MF2L 1OF0A 1U8QA 3TCTA 4ELMB 1AGBA 1E3FA 4ZXBC 1JVLA 1M7DB 1NBYA 1AZUA 2LFGA 3IN2A 3O6FB 4KX7A 4K5MA 5FK9A 4K23H 4QRSA 1GZHA 1BZ9A 1FFTB 3QGVA 4PCTA 4R7DB 2CO6A 1FSKB 3NJFA 2AAAA 5LVEA 3UYOD 3LVTA 5B8CC 2J1KA 2R4SH 4JHVA 2DQTH 5D1XA 2DB8A 1WD8A 2HKAA 4IS6B 1ASQA 2AQSA 3X1FA 3QO0B 1C5DA 1YEDA 4PJBE 3K8LA 2JKJA 4S0TD 3BKCL 4WK2B 5E9AA 3FU7B 3WKMH 3N42F 3MJGX 3SJVB 1MY5A 1K4CB 4ZK8A 1CK0L 1A7NH 2BPBA 3R18A 4G8FA 5FCSH 2OSLB 1JHTB 4QY8A 3HJEA 3UYPB 1VFAA 2N7AA 2DWDB 4IDLA 4QTHB 3P73A 1V10A 2IV8A 4PJBF 2NUPB 1FG2A 3FUHA 4DUXA 2WD0A 4G43A 5ISZE 2EZ0D 4FFZA 5T1KB 2J88L 4FL4B 3WTXA 3LAFA 1IBBA 3MRLB 3TJEL 4RQQB 2J43A 2HX8A 2J8HA 3BXNA 1QNZH 1EHKB 4U6XA 2VDMH 2OL3H 3BCDA 3NIFE 2OLDA 1K8DA 4GKSA 3ZT6A 4W9CC 3HHRB 1X5IA 3PWVA 1JHLL 5DYFA 5DA4A 5I0XA 3ZHDA 3H1ZA 2FL5B 3HEIB 4LPTA 2G4EA 3VA2C 3ILDA 5CJQL 3ZOAA 1Y18B 4LHUG 4ZS7L 1PFOA 5IW6B 3WEBA 3WIIL 1MNUH 1NIDA 4OV6F 2B4CC 3ZDXE 2IWGA 3ARGC 2WVVB 4OD2B 1TEYA 5KJ7E 2Z0BA 3QUYC 1VZIA 3QULA 3RPKA 1JPSL 4ZTPL 4KUCF 5HVHC 1LP9B 3HPJB 3WS6C 4WWKB 5L88L 3ALXA 1AYRA 4P9MH 5SX4H 1I8UA 4WKZB 4C56A 4OZIE 3ECQA 4I0PC 3NMEA 4IMKC 3ZDXF 5E2UL 2XX0A 4ZUSA 3CXDH 5DJYB 5H2BA 5IV2A 5IQMA 2VJXA 1BZ7B 4X7CC 3VFTA 5I8CA 1UWGL 5LGHL 2B3RA 2B15A 3CQQA 2R1XA 5J6GB 3KXFD 3BPOB 4IGBB 4ABQA 1JGVH 5E8EB 3GUTA 3GMRA 1CLZL 2HN7A 4LVNC 4YK4C 4YDMA 1IE4A 3GNML 4OZIF 4MJHA 1A65A 4M1DL 2BP8B 4URTB 5AKRA 2KYIA 4HIJA 1FNSH 2AXFB 3D6GA 2YPVL 3IDJA 2Z0UA 3SY6A 4DZBB 4G5ZH 1WEJH 1R5VA 2NSXA 4KJWC 5DC2A 2BW5A 4M7LL 5I0DA 1UWEL 4L1DA 1TCMA 5E6IC 4I8DA 2ZP9A 4BQ9A 1CGSL 3KR3L 1P1VA 4YPGA 5F9JB 5DK2B 1YNLH 2BVOB 2Y7QA 2G30A 2QJDA 2Z8SA 3S5LB 2VDNL 3NCYP 1TCRB 3II3A 3BP6B 2NY2D 4HUUB 2EVHA 4LPWA 4YGAB 2K3TA 1CO1A 3FU9A 3P9LA 1HE7A 5E00B 3GTTA 1SYVB 2Z31D 4OKVA 3BW9B 5F6HJ 1JNLH 5I9QC 1INDH 3V0JA 3EOBB 4JPWL 2QQLL 4NKQB 4QXTB 4XMKL 2SEBA 1BQLH 5IK3B 2DM3A 2AEOA 1X5GA 5HHOB 2GHWB 4OI8A 1DQJB 4GG6B 4H44C 2QVIA 3MLXL 3DOSB 3O4OC 4DO4A 5JPNB 2C7FA 4AV0A 4I9WE 1HHGB 5C0JB 1RUPL 3TYGL 4NRYA 4KKPA 4F2EA 3RGVB 5TE6H 3LNGA 4MMZB 1AGCA 4UINH 2HVBA 5DF0A 4ODVL 1WVZA 1WFTA 4TQPA 3AITA 4M6MH 2F53B 4M8QA 5F0LB 3DHUA 5D1QC 1LO3L 2UWEB 1T1WB 1ZDQA 2PCYA 4G9FE 4TKWA 1CBVH 3MJ9L 3EJZD 4M8RA 3KYOA 3U2JA 5I76B 3B2XA 3LN5A 4HIPA 4X4YA 5BRPA 5AOJA 4Z6AT 3CFDA 3MKKA 3CMGA 2ZSVB 4B9JA 4IU3B 2N4IA 1D5MB 2FJHB 5J12B 3F83A 3ILQD 2XTJC 3FH7A 4MRBA 4OF7A 2G4GA 3D0LB 5CZVH 1TVBB 4G80B 3TVMB 5IJKA 2PR4H 1NGZA 1G7MA 1BM7A 3OKMA 2MCG1 4Y4FA 4KKCC 3H9HB 4LLVA 4P59H 2AK1L 5LG1A 3W82A 5JQHC 3H9SD 1UM5L 4ZMOA 4OFIA 1DFBH 4XTRC 3B3IA 1TZIB 4ZPTA 4N1CA 3CHXA 4AITA 4UQAA 3KPMB 4YHNB 5FGCB 4HK3N 4HEMA 4MMXA 5GRVK 2QPUA 5ANME 2OR8A 2AZUA 2P8LA 3C60C 4HCRH 4OGXH 1XB8A 4JDVA 5C0GB 4XCCL 4YEEA 3I6KB 6PCYA 1CQYA 4FXLA 3QJRB 4HPOH 1JOIA 1I4FB 5TE4H 5F7HA 2NW3B 1Q9OA 5F7EL 3PWPA 5F0MB 5CKAA 3VD0A 1QATA 2GSGA 3A6OA 1CFQB 2ITDB 4I3RL 1PQZA 4TUOA 4XN4A 4LF3A 3IRZA 2V2WA 3AJ7A 1OZUA 5IVXE 1OM3L 4ZFGH 5SWQB 1ED3A 1TVDA 1RZFH 1XGRB 3QEHB 4ODSH 4Q6IB 2ERJB 4M62L 2DWYA 5BW7A 5L0QB 3IM1A 3RWHB 3RZCA 2F9BT 5D2LA 1FIGH 2K6WA 4JGUA 3VNZA 3ULVE 3ARFD 3WEXB 2Z8WC 1N9PA 4Z77B 4LQFL 3ULUL 4KY2A 5I75C 4LEXH 1JTTA 4WO4C 4K7FB 4YC2B 4PJGB 1QR1B 2FB4H 3BKML 5BO0D 4WFEE 1ZD6A 3IXAB 4HUMB 4M5TA 4FA8A 3HAEA 3VG0H 1MIMH 5CIPB 3ULVF 2CLZB 4ODTL 4ZUUB 3GJFH 5JIQA 1BOGB 4NENB 5F96L 3NAAH 1J9CT 3HLAA 2FWLB 2XQYA 1P6WA 3X12A 2ETWA 3V6ZB 1HAUA 3MTRA 5GRVL 6CGTA 1L9SA 5DK0B 4HGWB 3SKUD 4WI5A 7CGTA 1QEWB 4WJKB 2P28B 3BN9C 3FQUA 5F7LB 4GMSH 3A6CL 5J8OA 1AP2A 4MJ5A 5C0IB 3VJ6A 4TVPH 2RBLA 2AS5M 3CFBB 3V4VL 1FO0A 4QHLB 5C2BL 1A6UL 3P40A 1T66D 4F7TA 3E9TA 4B9FA 3CMOH 1G1CA 5EV7A 1DBJH 3MLWH 2QGCA 4XP4L 5EOCH 3CSYB 4GS7C 1IFGA 4XNQA 4N22A 5CLWA 2YMTA 3PS6A 4PG2C 4RWHA 1RURH 5G55A 1GYUA 3RVVC 2WO2B 5F70A 5T1LA 1CD9B 1YY9C 2KDYA 4KDVA 4MQTB 4WCYH 4WSKA 2UZIL 1AQDA 1T04B 5E56A 3N43F 4FDWA 2FCBA 3QFGA 4OCXL 5DEJA 4BZ2A 2VXQA 2VQUA 4FI6A 4XP9H 5EFIB 3AG4B 2DQCH 3L8QA 4Z7UA 2CBPA 1PKQE 2GBAA 3SDCB 4OQTH 4X6CB 5GS0L 5LDUA 5HVGB 3RL1A 1J5IA 4NQSB 2GBTA 3BISA 5FEBA 4QRUA 3UBHA 1AXTH 5DRXB 1M7UA 1IKOP 3AG2B 1FGVH 2CDEA 1SM3L 2J4WH 4L4TD 12E8L 1WZMA 5H35B 3IU4L 3ZZ1A 1KPUB 3NJIA 1A6WL 3ETTA 3GDBA 2DMCA 4HUNB 5G4OA 5F7FA 3GXDA 5T5FL 4A55A 3HS0C 4DQAA 4W4OA 5KYWA 2GPZA 1FFNB 5C0DA 1AXSB 4IRSA 2P5WE 5DD5H 1JZ4A 3IJHB 3AAZB 1BVNT 3K8KA 1XGUA 3GINA 4AIZA 2C5DC 5K59E 4M43H 4M1CD 3FBKA 4ZUTB 5T1MB 2GAZB 1FVDB 4N2KA 2N3JA 2FAUA 3C5SB 4XAWL 1P7QA 4RAUB 3RURA 1KBVA 4ELKB 4FXGC 4LCVA 3S48A 3SQRA 3CX5J 4FKKA 4D0BA 1L0PA 1ZVSB 4L8SA 4GBXA 4P5RA 1LLAA 4MJID 2DPKA 2XN9A 5K59F 3ESUF 4HX1A 4FTVE 5AW0B 1QD0A 4KNSA 3QIWC 5FYLH 1BF5A 4MFHA 3L9YA 2K6ZA 3E80A 4QO1A 1OAXL 3ATFA 2ADJB 3DX9A 4FQXC 1A66A 4NFCA 3MBEC 5BQDA 1M6OB 1R4XA 2CRYA 4HCIA 2X3BA 3FCBA 3B2UC 4XMZA 1NGQH 5AYQA 3PCYA 3QI9D 4NSKA 3O3EA 1UHVA 2DTML 2DBJA 4PJCE 4JFFA 3EGXB 5I1KL 3QG7H 4TUUA 2QFPA 3MR9B 3SBWA 2HVJB 3JQOB 4JJ5A 3QUXA 3T3MB 4H40A 3GBEA 4OGYL 4UQ2B 5M94B 1OHQA 3U9PL 1OTUC 1ACYH 4IIQC 4KROD 2VDOB 4XBEL 4PJCF 1BP3B 1UOWA 3VFSA 5EIIA 1MCWM 1U4EA 2XBTA 1KF9B 1TSRA 4JHAL 3TT3L 4JANA 5DFVC 3W9EA 4JPQA 5IFJB 2OXGA 1CT8A 3GIVB 1PLCA 4FQQA 4FNTA 3KPLB 5L8KB 4ZAKB 1VFOA 2B1HL 4G6JL 3CVBA 1LD9A 5B39A 2D7TL 4GW4B 3T2NL 4NRZB 5E9NA 3DIVA 3OB0K 2XT1B 1YEKL 3LS5L 1BW8A 4NDMA 1QRNA 2ITCA 3LZFL 2A7BA 5EU6E 3OAZK 5ILTH 4H2CA 1DHKA 4FNPA 4NPKA 2QADB 3DDFA 4DN4H 2VDPL 1KB9J 3IU3A 4LCUB 2J8UE 5JR1L 1TIUA 1HVXA 4APQD 4GPVA 2WBJB 1HH6A 5EWIH 3QUHA 3HFMH 2VMDA 1RZ8B 1GSMA 1J05A 2UX7A 3OG6B 2KLTA 4L1HA 3W1ZA 2VSKB 3NZHH 3BEWB 2LAAA 3SKNA 4BUHA 4G9DA 1N67A 3UPAA 4J3SA 2VM3A 4L1SA 2AEQL 3AXHA 4J3VA 5FHBH 5C0FB 2XKUA 2A83A 2FYYB 1GS7A 2YD8A 2JWYA 4HIEA 1Z5LA 4ACTA 1JZ2A 3NZUA 2R1WA 4ZDHA 2JJVA 3PJSB 1DLHB 5JZ7D 1L3NA 5CINH 1RULH 1RV6X 3KLHD 3CU1A 4ONGH 3RWDB 3SCMC 2WWOA 4L1TA 4WEMB 3VTMA 4WHCA 5DC4B 3GS7A 1MFBH 4I85A 1NFDF 1P4IL 2YAMA 3D2UB 4R83A 2FLRT 2WAQA 1Q9LB 5B38G 4XO8A 4KTDH 2ZWKA 3GTVA 4PJ9A 2CH8A 4DUWA 4TOYL 1ITCA 2X1QA 3IFOA 4K2UL 3GS4A 4KFZC 2OW7A 2WZPA 4UF7C 5CBAB 4ODHH 2Z92A 1VCBC 4WFED 4CSSA 1DCLA 3ZDZE 3W11C 2ISDA 3Q48A 1URZA 1TUPA 5AW3B 2KZBA 3FUIA 1V55B 4M5YL 2GT9A 3RTQA 2WP3O 3T4AB 3FTSA 4A37A 3OBAA 2BOCB 2Q5BA 2R7EA 1T0MA 1LILA 3GSQB 5DRNA 4OZFH 5CLZA 4EN2A 3MLVH 1U0QA 1F6AA 3L3HA 1QTPA 4QHKI 1MHHA 4JO1L 2P5EB 3GMNA 5FB8B 3DX7A 5D7JC 3GSRA 3IK2A 3WSQH 2VDLB 1SBSL 1F3JB 1S6NA 1C9SA 2ENPA 3IMUA 2NT0A 3MYZA 1TTRA 4DEUA 1OP5K 3IKCA 3QPQD 4HBQA 1MFMA 4KK9C 3EO1A 5BVJA 3CVIL 3WJJC 3DGDA 2NY0C 5A6MA 1NKRA 4C56E 2EYTA 4LHJB 4AL8L 3DYMA 3GBMH 3ZT5A 4QIRA 4N2OA 4JHZA 1UKTA 3VW3H 5E03A 1QSEA 1LE5B 4PGBA 2E27L 3W9DA 2A9NH 1JF6A 1OARL 1PG7L 1Q0XH 4TF4A 4BHUA 6TAAA 1KCSL 1LVEA 1VB9A 4HPYH 3HE7D 1MCKA 5DJAB 4WJ5A 4PR5A 2WXIA 2ZWLT 1JGEA 3IN0A 4R7LA 3WL9A 3PYCA 4YBQC 1VCAA 3LKPB 3WE1A 3N40P 3QQXA 4F2MA 5BV7H 1PZCA 4JFDB 3BAIA 3SE8H 4PJEE 1QKZL 3IGAB 3ZXAC 4R96B 2B39A 3QHTC 3CVDA 2NXYB 3BD3A 1RK0A 5IMOB 4A7TA 5DD3H 3E6FB 4B50A 3VFGL 2HT2C 4PJEF 4JMNA 2DL2A 2ZKXA 5I6XC 1JSYA 4OCRH 1AJ7L 4UIKH 4KQ0A 1IQWH 1AR2A 1G43A 3IDMA 4L3EA 5LXGL 1KIPA 1QFWH 5I1JL 3HUJF 3CBJB 4G6AC 1KB5B 4QT5B 4Y9BA 3TF4A 3VMOA 3O3UN 3FSOA 4IKJA 1KTDB 1L9TA 3HG0A 4AQZA 5K9JL 1EVTC 5I5MA 2IFFH 3C8DA 5L4MA 3WUWG 4UOZA 3BYYA 4KK6D 4OTXL 3IE4A 2ESVB 5DO2C 3SPGA 1DEEB 4GRLC 5ALCL 4WSGA 3LRSB 1MRFH 4S1DD 4G8IB 3GSXB 4CSZA 2H3KA 3CX5K 5FLVA 2NSMA 2ZCHH 4N9GA 4OFPA 2CUHA 1XSOA 2B0SH 1JYWA 1TQWA 3ESVF 4NNXA 3RWJB 4MWFB 4NKDA 5TK2A 4HIIB 4JRWA 5EN3A 1SEBA 3U6XA 1C8PA 3FOLB 4H0HB 4LLAA 5EHFA 5AVQB 3VI3B 4YR6A 3TEYA 4XI5C 3K71B 1HILB 5IOPA 4LOUD 3BIKB 1THAA 1ZMYA 4JFEB 1CE1H 5DWUL 2ZXGA 5F1SA 4UM9A 2GIMA 4K3DH 5DHVA 1WICA 2KT6A 1NOFA 5CUSL 2YAPA 2FEEL 3QXAA 1A1MB 4MCYB 2JTYA 5C0ND 5B8CB 4YDKH 1S9WA 3RU8H 1KFAL 4LBEB 2QKIC 5EUOB 2K0RA 2ICWA 1FVEB 4BFGA 5CP3A 4MGXA 2WUBL 4QXGH 4GIPD 2IQ9L 4IKIA 3TBVB 5DFAA 1S9KC 4PBVC 5A2AA 5HYJA 1XGPB 3LRKA 4QTIH 5EU6D 3W5MA 2F54B 3SE4A 2ITFA 5CD3A 4MKTA 1JHKL 4XPBL 3R4DA 1H3UA 2BHYA 1FDLL 2CGRL 4HLZG 2Q7YB 3DJSA 1HCFX 3OD3A 2CBMA 3BUPA 4HEME 1B4LA 2XY1A 1CF1A 5CJXC 5ACZB 3A21A 2EDMA 4H8WC 2IH3A 2OBGA 4WI0A 1HWWA 1MCDA 2B1AH 3DIDA 4JO3L 1MKFA 3T1FA 1A6VH 3Q2LA 1N68A 1IC1A 1RMFL 4JFOA 4QWWD 2BFGA 3PWPE 4O2EA 4NQXA 3K2KA 3VFRB 1IU1A 5BOPA 3QXTA 4NEHB 3UBFA 3NZ8B 5KG9A 3O6KH 2FT7A 3W0WB 2HWZL 2CR0A 2P44B 5HJ3B 3P77A 4F8QA 1KB9K 1S9YA 3HMWH 5IHBA 2YJQA 3D07A 5B7FA 2WQSA 3GXNA 3NRQA 3QDAA 3BH9A 4PJIA 4YUEH 5FA4B 4NQCE 1OPGL 2IO5A 2MNUA 3ARGB 2HKFH 4X99A 1CPUA 3QUYB 5D1XD 3U30B 2YD9A 1E30A 3P2DA 5HVHB 4OM0H 2WO4A 3BOVA 5KW9L 3SGEI 4UB0L 3FFOA 4L5FL 3ZE0E 25C8L 2YBGA 5F6IC 8FABB 1A7OH 2RJMA 3MRPB 3RHWF 4PGEA 4I0PB 3MACH 3IMSA 4OCSH 3RKPA 2EJ1A 2Z1PA 3H0TA 4N5EC 3QDMA 4J8RB 1HSAB 2ENJA 2ZX9A 2OJZH 3R1GH 2XWJA 3SE6A 3BAEH 2X0VA 2AHIA 3OV6A 2IQAA 4PREA 1M53A 3ZE0F 2W1NA 4LVNB 5KVEL 1IGTB 3GK8L 4JEGB 1W0VB 1GGIH 3QJHA 3QK0A 4LDCA 1VADB 4DJMA 4OUUA 3VCLB 4LRIC 5TPWL 5AWNL 1BA9A 2G60H 5J57B 4PJ8C 3GRWL 5CGMA 3K2UL 1FF5A 4XNDA 1QPPA 5IOKA 3RVWC 1U2CA 4YDVB 1QASA 4ZMQA 1RPQA 1KWGA 3AWGA 1FPTL 3V0FA 2VQ1A 1HKLL 2HRPH 4GRMB 5E6IB 3RUGB 1L5GA 1PX3A 4MA3B 3RBSA 1BHGA 5IBLC 4F7CA 4I2XA 3HHSA 4OH2A 2G5BA 5DQDL 3KLSA 2L4OA 1DVFA 3FRPA 2ZOKA 1UJ3A 2QQKL 2YAFA 3FJTA 3IDIB 3R0MA 4IKNA 4LSVH 3PNRB 4PP2B 2AP2A 4H1LH 5JW5A 4CVZB 2NR6C 3QUZC 5T1DL 3ZQXA 1DQQA 5I1AA 1QWNA 3D3VB 2J71A 1NFKA 3U0PB 2YXVA 2R0WL 4W9DC 1EFXB 3DV4A 4C56D 3NCJH 4HC1H 4ZW6A 1YZZA 2M1KA 5TQ0H 3K6IA 1JPGB 1DQDL 5E6SB 1NGXA 2RHEA 3TCLA 4JLRB 4Z7UE 3VMNA 1MELA 3LRHA 3SY0B 1KLGA 1OQOA 3OXSA 1HX0A 2VL5B 2W59A 2OV0A 3QQ3A 1XQ4A 3R7RA 1OOWA 3O4OB 3LQAC 2NQDA 2OMTB 3GHEL 1U3NA 1FH5L 4HWZB 2DQDH 4OGZA 3ZU8A 4BZ1A 3ZMEA 2R0ZL 4MJ6A 5CSBA 4XO9A 4POZD 1UT2A 1NKOA 2E9GA 1ZOXA 4W1TA 5I0YA 3LKOB 1TZHA 5A16A 1T03L 4KNTA 4FJZA 1DZBA 2VTFA 1NOAA 5D1QB 1Z9OA 2ARJB 1KIUA 5CJBA 2R69H 1NCTA 3KVPA 3N0PB 3OKOB 5J11C 3BGFB 4M56A 3IMRA 4GRWB 4N8CH 2FH8A 2YXWA 1YDPA 3L1GA 4JRXD 2UY6B 3DPBB 2XN9E 2ITEA 2ZYSA 1H3PH 5LCVH 5GSRA 5AAMC 2QVFB 3MVSA 3BFWA 2XTJB 2H6OA 4XOAA 1CD1A 1YAZA 4QLRA 3ARVA 4YNYA 1IMHC 2F7QA 3GXUB 3L1EA 2BY3A 1DYZA 4MYPA 2FR4B 2PP9A 5BO1L 3UTZB 1YMME 1AG0A 2A0LD 1H0DB 3C09B 3WXVL 3SDAA 4ENED 2I9TB 4AQAA 3WXWL 4EN3C 5IGXH 4AI7A 4UIMA 1SFDA 3DVGA 4JFFE 1A4CA 1F3DH 4U6VL 4Y4KB 4R2GD 2XICA 4PJAA 2ED8A 5AAWC 1MAKA 4MB5A 4N2GA 4R4BB 1UWXH 1QBBA 1ZT1B 2ARWA 1P7KB 1CXLA 2WWKT 1E0OB 1OPOA 1BPLB 1W72B 1CXEA 4XP6L 5D4IA 3PQYD 4JE0A 4IRZH 4PM1A 3RE0A 3L6FB 5FO8A 4YXLL 2XHNA 3CHOA 5G4MA 4NWUL 4F24A 3OPUA 4NZTH 4UOW1 1T4KB 4M6NH 5EC2A 5KS9B 1BQRA 4MDIA 2JB6A 1E2ZA 1BD2B 2FJGA 2E56A 3OKLA 3FO1A 3FN0L 3VFWA 4NHCH 2EDQA 1RVFH 1W6LA 4UM8A 1UA6L 1MJUH 3MROB 1R9FA 4JUSA 3CZFB 2PYEA 3B34A 4PLJD 5JIHA 2YRLA 5I75B 4JRLA 1JP5A 1S7TA 5GGRA 1MPAH 1QRNE 3H53A 4PRAA 4YHLH 5FOBB 5KVGH 4RFNC 2OYMA 5TF1L 3P30L 1XXDC 2IH1B 2IGLA 3EFFB 1BFOB 3WD5H 1YPZA 1T89A 2VZUA 5EOQH 3HG1B 1G7PA 4QOKA 1K4DB 1V7NH 5DUBA 1S78D 3KWXA 4ZX6A 3ABMB 1NC4A 4NYLA 3T0WA 3EOAA 4WEBH 5J6SA 2WTRA 4MCMA 4Y7MA 3ZL4L 2ATPB 5JHDA 5IUSA 3PWPD 2W65B 3E6HB 1OAJA 1U92A 3LXBA 3AS3A 3PWLB 4U1SA 4F8PA 2J1XA 3MNWB 1GC1H 3DPDA 4ZD3H 1CDUA 2FT6A 5JYLA 2W0FB 4AJ0A 2QPFA 3GYRA 4PRNB 3JV4B 1Z3GH 1NIFA 4EIZC 1AQ8A 3ZRCC 2Q7NA 3L5XH 1U21A 1F1DA 1NGPH 3RZCD 4GS7B 2Z35A 4X6FB 3WJLC 3UTTB 1A7BA 5J06A 2CDGB 3J27A 4B6ZA 2NX5B 4MCNA 4P5TC 1CDYA 1NJ9B 7FABL 1TNMA 3T8XA 4N87A 1YUKB 2EZ0C 1FI8C 3FZUD 1SHXA 5HI4D 4IBZA 1J5DA 4KMTH 2Q2EB 2QR0B 1ETZA 2Y1YA 4JVWA 4GAAA 4NHUB 5SWZB 1WFJA 1U58B 1UFUA 3QIBD 3PAVA 3P0VH 5JOPE 1T0PB 2QGDA 4OCMC 3EH3B 3MJ8B 5AVVB 3ETBF 3VH8G 2DQUL 3VU2A 4KNUA 5C0BB 1L9QA 4BBWA 5E5MA 1F86A 3HS0B 1GAFH 1TYRA 4UUJB 4DPAX 1MCNA 2BCMA 1YNKH 4JKWA 1HOCA 4X7SL 2CAKA 3T0AA 1AGEB 1NM9A 4UDUA 1RKRA 4WTZG 2MPAH 3O6LL 4WNQB 3UZQA 2ARJQ 3DV6A 2R2CA 1U8KB 4BXSV 4IHOB 4U6YA 4FXGB 1DVTA 1UFGA 4JPSA 3CFKA 3AABA 3KCPA 5A2BA 2AK4A 1LMIA 2YGNA 4UT9L 3CUPA 2Z64C 4KKZA 3NFPA 5JNYA 1XO8A 2PWEA 3FUEA 5T1LD 3VFUA 1MJJA 3QIWB 4KQ4H 5KSUA 2X3AA 2ZICA 2AKRB 1OF2B 3AREB 3SPVA 4FQXB 3ZL1A 5FO7B 3MBEB 3WFDH 2GYSA 1C12A 4BFIB 2EXSA 2F8OA 4WZ9A 5I1EH 2Q3ZA 2FT8A 1VSCA 1CR9H 3INUH 4CADB 4L1BA 1KYDA 4ZMPA 2NQ3A 1TDQA 1UH4A 2ENQA 2C1PB 2IALB 5F3BB 3VG9C 3S3CB 4F2ME 4Y4HA 1GYAA 3DX0A 3SBRA 3Q5YA 4WLCA 3FQRB 4Q4IA 5C6PB 3LKQA 4M4PA 5AZEL 1HSBA 1VFBB 3KYMA 1KJ2L 4JFQA 4OCWH 4U6HA 1EJOH 4GSXA 4NKOB 4ECNA 5B1KA 5DQJB 1A1OB 4IIQB 5M95B 2VKWA 3EH1A 2H1LM 3UTQA 4LIQE 4N6QA 3WFEH 1SVZA 1YEFH 3GSNL 1JI2A 4HKJA 2G2RA 5GGTA 1QO3B 1ZLVH 3ZQ9A 4XBGB 4NPYA 4HALA 1MCCA 1NUFA 1ZA3A 4JO8A 4W93A 4DT2A 1P7QD 1MW0A 3EH4B 2VWEC 4DEWA 2FZ3A 1CYGA 1BM3H 1UOKA 2NW2B 2ZSWB 4L3EE 1LO2H 1XF3A 2VXUH 2E4FA 4GBXD 4GUPB 2XN9D 5HHVH 3KPSA 1UM4H 4JHBA 3RNQA 1DR9A 1BVKB 3PJLA 1P9MA 5IB3B 1TQSA 3ROLA 3WTVA 4HZ1A 1TENA 1X9UA 3ULVL 4M3KB 2PW1B 4XOBA 4U05A 3U25A 1AMXA 2DTSA 3GMMA 1A25A 3GI9H 3L3DB 2JI1A 1WAPA 2Q8AL 3KLAB 3FU5A 4L9DA 5EEUA 5J89A 3MC0A 5C3TA 3RWFA 3HBGA 4RMUA 2EO1A 3VFOB 3I6GB 4FXKC 3HZYB 4HHAB 4JFFD 3S4SA 3ZIMA 1AHWB 3LQMA 1TT6A 4OZGA 3QQDA 1QVOB 3WNOA 4J6RL 4XH2B 1IGJB 4XB8A 1VJSA 4MQSB 2Z7YA 3AY4C 4QCIA 2NCMA 4QHMA 3U79A 3S96A 3C08L 3VXNB 5HBBA 1FC2D 2Q20A 3I3DA 5DHYA 1UCTA 2HFGH 5F7NC 3SE3A 3MRQB 1XD0A 3ILQC 4P2QD 1MI5B 4I48B 1KIQB 1OSPH 3MODL 3SCMB 5KYXB 1JFQH 3HI1B 3ALPA 3NSDA 3V5DB 1A3LH 1Z2KA 4MDJA 4FZEH 4ZPVB 3MGTB 4JY6A 3AGVA 1U8HB 1JPFA 1N59A 2APFA 4RA0C 4FEIA 5TE7L 2VITB 2O61A 3IFNL 5HYJE 3OHXA 1OT2A 1QRND 2ZKWA 2X28A 4XGZA 1OCWH 3D4GA 3NIGB 2ZUQC 3ZSTA 3GT6A 4DGWC 2YSTA 3WNJA 4NT6B 4DVRH 5D1ZB 3HUJB 4FA7B 1OTTD 1RZKL 2R23B 1XF5A 5AW7B 4GQ9L 4QRQB 3JT2A 1FBIL 1UG9A 4TSAL 4CJ0A 5KYYA 3HR5B 1RSYA 3L4TA 5CSGA 3EH2A 2CKBL 4B9YA 1IEAB 2EXWC 1UQSB 4L48A 1ZE3C 1MCEA 4XNYL 2YWZA 2B2XL 1WC7A 2IH8A 5B22A 3WFBL 1XH2A 3P3SA 3K6FA 1XF4A 1UEYA 2D4DA 5F88B 4C59B 5DQ9B 3QUMB 5LLIC 3TN0A 1RZJC 1ZT4B 1T83C 2QLVB 3BESR 3NBNA 2JIXD 3N9GL 2VC2L 1XCTA 4OUOA 2VW7A 1RZ7L 4LSUH 4YL4A 2QELA 2VW6A 4XMUA 5FV1L 5ETUB 3U48A 2YK1L 3F7QA 2A77H 2A6JA 4UTBL 4XWOD 5DJ2A 3TX4A 5D7JB 3E2HC 1RU9L 4PJIE 4WEUD 3WU1A 3TTSA 3GDCA 1K9TA 3JWOH 2DF3A 4Z23A 2C7UB 2HJKA 5DI8A 5AQ0A 4EBQH 2D0HA 2X5PA 5DJZA 5EZJB 5H4YA 3WIFA 3TV8A 3IMBA 3CVHA 4FG4A 4WWOA 3C5ZD 4M7ZC 1A3ZA 1JPTH 1MQKL 3K4AA 4N9OB 4PJ9D 4PJIF 2NY0B 1JZDC 1IX2A 4UTAA 3MYJB 2WZPD 1V7ML 4M5ZL 5DUJA 5AENA 3O41B 7PAZA 1IC7L 4MQ7A 1L3WA 1ZSDA 1NEPA 4AYGA 2FWOB 3VXPB 4JDTL 2CUIA 4N6RB 3AXLB 1XR9A 1Y7VA 1XZ0A 4HJJH 4GNKB 4XCNB 5FUZL 3G6JA 1W0WA 5JOPD 3U82B 4YSCA 2CBOA 3QO1B 3RTQD 4C4UA 1TVHA 1XF2B 2VSCA 1O7VA 1WIPA 4XPHL 5T1JA 2NTFB 2DRUA 3D1MC 3FQYA 1KG0B 3O2DH 3TBYA 1A6TA 4PUBL 3LPFA 3NACH 2E8ZA 1SN0A 1KTBA 3GJFA 4KY1L 1ZHBB 3QUKA 2R8SH 3Q6GL 1HJBC 4JFTA 2IAMB 4NAQA 1SY6L 3SEPA 1RZPA 3WY1A 4ETYA 2JMRA 3HZVA 2JKNA 3UIZA 4TLUA 4APXA 4PRIA 2VXSH 4UV7L 3OGOE 1UD3A 5DJ8B 5HHQA 5IQNA 1N7MH 4MASA 1T7XA 4K7PX 4K7PH 3M17A 4R5TA 1U42A 1E43A 3C2AH 1WCBB 3NFSH 4XR8C 1F58L 2CIKA 3UFIA 2YZ8A 1UB6A 5DMGD 4LL4A 3BRGC 2DDQL 3G08B 1QSED 1G7JB 2YFNA 2ZXQA 5IMLB 1NCIA 5D4JA 2W0KA 4KH9A 4XXDB 1ZHLA 4Z5RA 2CDFB 1I7ZB 4OGQC 4OLZH 3DIFB 5E1AA 4MXQD 3BZEA 4NUJB 5FOJA 4C55A 2H2PD 4XVOA 4OSUL 1LNUA 3OAYK 4HS8L 3MUUA 4KQ3L 3WFCH 2DMBA 5AVSB 3JUZA 3IAQA 4LHUB 2IWKA 5E9DB 4HJUA 5DLML 3NJHA 2L8AA 1GJWA 3NEEA 2CCVA 2V2TB 3WJMB 1SOKA 2YSSA 4MXWH 5C08B 4BA8A 3L13A 4LSTH 4AK2A 4WU5A 2XIBA 4DKEL 4WDIB 2PO6D 3UGXA 4MMYB 2XN1A 1UUSA 4G6KH 4IM8A 4LBAA 3CFJB 3KPRB 3P0YL 1DBBL 1MREH 3CN1A 4Y1AA 3K8MA 4XO5A 5DO8A 1U3HA 4L29A 4OZFG 2FIRT 1I7RB 2V33A 2QKIB 4AC4A 5TFSL 1YYML 3D0VA 4NQVB 4U1GC 1DQIA 3DETD 5DJDB 1RIVH 2ZUUA 4AM0Q 3EADA 3DNKA 4QDGA 3P4MA 1MWOA 3GSUA 4AEFA 2QPSA 3NABL 4JR9H 1NCDH 1XB6A 1NAMA 1A5FL 2HRGA 2WVTA 4YDIL 1WT5C 3BQVA 4Q9QL 2DMGA 1JGIA 1QWHA 1OE1A 5D7LD 2GUOA 4XWGL 2VLJA 1PKOA 2CMRL 4NO0B 3OXRB 1ZVYA 2NYYD 4JZNB 3FCSB 3QFJB 1S7UA 3CBRA 3QQ9C 4L4VA 3QA3A 1KCUL 2GTQA 4JPKL 4OZ4A 3RI5K 3DK2A 3UCQA 4EUPG 4MB1A 1ZCRA 4F2FA 1FHGA 4PJAE 5CHNB 4F91B 4AENA 1KELH 1YEGL 3QVAA 5I2IB 3BPCB 1B4JL 3MUGB 2BOBA 2ZUVA 3B7SA 4P3CH 3RDTA 4ZYKB 3GSOA 3MCYA 1MEXL 3FO9A 4YO0B 5HGGS 3QDJA 4ETQA 5BRZD 4LPXA 3QNZA 1AR1C 1VEOA 4PCYA 2BXYA 2EEFA 3IJSB 1E2WA 4HV8B 3SGEH 4UM9D 1KY7A 1FNEB 2XC8A 1JRHL 1BXUA 1JZ7A 1I1RA 4BE6A 4PGCA 2EDOA 3U6RB 1M9WA 1BQSA 5C0AB 3S6CA 3NJNA 2C9SA 5F9OL 2CRIA 5F8RC 4JQXC 4LDOB 4JFXB 2C9PA 1LWHA 4P2RA 1VACB 1JGUL 2X4SA 2PYEE 2F6AA 3VXQA 4IOFC 2VN5A 4YX2L 3KAAA 4AEHL 3IWUA 4OFKA 2ZKYA 1CCZA 3C5XA 4OD1L 4F1ZA 4Y2DC 5HYJD 2DLGA 3TO4C 4JGNA 2EC9U 4JFYA 2AQPA 1YPZE 4KKLC 3ZDWA 3UTSB 4M7JH 2P47B 5DJXA 2ZPKH 3BVNB 2EKSA 4NCDA 3KH4A 4I7ZC 4QOKE 4F5CE 1CMOA 1OP3H 3L7FA 3GHPA 3N1QC 5I6KA 5JDSB 1GGCH 4PJ8B 5BZWA 1CUOA 2HX7A 1AFVL 2H6PB 2PCFB 3NOIA 4P46D 2Z34A 5AAPA 1NWOA 5JHDE 1CICC 1T7WA 1Z3RA 3F12B 3OX8B 1YN6A 4H88H 1VRSA 2JKLA 5F7KC 2ZD0A 1NGWA 2JKIS 1UM6L 1YNTA 4GMTH 3HPLA 2O93L 3B43A 3ARUA 2CLRB 3GGWA 2BERA 3TH2T 5KN5B 3POCA 3MUZ1 3JWNE 4JDZA 3PJNA 3F05A 3VMPA 2J21A 1HHKA 3I50H 3LNFA 4HIXH 3DUUB 3CSPA 5I28A 2RB8A 2OA9A 1IT9L 2HUEA 1XDTT 5IW1A 4NNYA 5MENA 2BNUA 3QDMD 4DFHA 5IROD 1WUZA 1ZHNA 4RGND 1X4XA 3ARDB 1MRDH 4CSPA 4QEGA 1N64L 3CN0A 1DN0A 4JG0L 1KDJA 4F57L 3F7KA 3DO7B 1OGAA 2V8LA 4FQCL 3JWDL 4PGDA 3PHAA 2XYBA 3W81A 2WVUA 5EZOH 4FJ6A 3WHE0 5EU5A 1EDYA 1J8SA 3VWKC 3I84A 4A2EA 4ZRGA 1F1AA 2HPOA 3L95A 4WV1A 4ANXA 5HGAB 1NINA 3II2A 2NLJA 1HZHL 4PCSA 4LP4A 4NAJA 1OM9A 4HJGB 5EIIG 5SX5K 3RNKB 1M2VA 2GIYA 4XMPL 5IJDC 3WTTA 3HNTL 1B0GA 4JG5A 5HD8D 2EE3A 3NFNA 2BNRB 5JORB 2VLRA 3QJQB 1UTDA 4KKRA 4Y19A 3ABZA 1DVFD 2J6EA 3S2CA 2L7JA 4KZEH 2YA2A 5KUKA 3IAPA 2AK4E 3BT2H 4U6TA 4EI6B 4L8BB 1UACH 2CUMA 2PXYB 3DUHA 4PRBA 5D7HA 2BSCA 5AYTA 4AXWB 1BFTA 2BZ7A 5C07A 2V5SA 1VFUA 4WJG3 4GAGH 1FRGH 1O7DC 1QWUA 5KBPA 3MRMB 1H3GA 2XV0A 4X9HA 1G1YA 4K94L 5F1NB 1W16A 5ADOH 1WTGT 2BIIA 2R2EB 1N4XL 1KBGL 4PTUA 5JW4M 1DUZA 3O81A 2YRPA 3F6IA 2B7DT 1FZJB 2O4EA 1TQBC 4RSYA 3EFOA 4XBPA 1AANA 1R3LA 3PL6A 1IM3B 4Q9BA 3Q05A 2XQYK 3CFCL 2JSFA 1JYNA 4OR1A 1J9TA 4O02A 2J1WA 5HP5A 1F00I 1QUNA 2NY5H 5LB1A 3WY3A 1BQHA 4YHZH 4YDLB 3DTXB 3G5VA 5KVDE 2YXMA 2ROXA 1IBFA 5DS8A 4JM4H 4K8RL 4JZOB 2UY7B 1F2XK 1ND0B 4WK4B 5KZCB 2WXKA 4NC2B 2FO4A 2GITA 1OGSA 4Z0BL 4IHBA 5EC1B 1E7VA 5JLZA 1QTSA 3L3OC 1Z9SA 2ODIA 1ZS2A 4YAQB 2YOAA 3BH8B 4M4RA 3KPSE 4E9SA 3UBGA 5ACLA 1D7BA 4S1DC 5I30H 1ZLDA 2BHFA 2XXMB 2NT1A 3NVQA 4FKEA 4S1SL 2YAOA 4D9RE 3OVUB 5AW2B 3U7AA 4ZOBA 4PY8J 2VT0A 5JPMA 4W9JC 5EOTB 4UBDD 4RFNB 1PX8A 4YSQA 2QDVA 4IKKA 5ELIA 4H1LG 4R97C 2H41A 1AO7B 5A2KH 2WIMA 2KUTA 3OB8A 4Y1SA 3SDAD 4P57B 5J9PA 1XIWA 4FFWC 1NMBH 4LOUC 1LE9B 2J25A 3UC0L 1V27A 1TTGA 3QS3A 5AYUL 2A73A 5AG8A 3LSOA 1MHEB 2C3GA 3UAJA 3VWJD 1DN2A 1IAII 2HH0H 5F1KC 3CHSA 1HH9B 3KJ6H 5IQ7L 3FHAA 1CE6B 3JVGC 2WWKO 5IQOA 3P2BA 2NOYA 4I3GA 2X4RA 1A3RL 4AUJA 4KFMA 2K6YA 3PGFL 2W9DH 3BQUC 4N3UA 3DUSA 1U95B 2HT4D 3TA3A 4OT1L 1MWAB 2VR8A 2QMKA 4QJ3B 1F6FB 1FL6A 4HBCL 5DU7A 4LCWB 4OLEA 1H9DA 3FB5B 2WXJA 2AJZB 3X3FL 2EXYD 4D8PB 1YEEH 1ZTXH 1F4WL 4QI3A 2JB5H 4BH8B 5TH2A 1P7HL 1A7RL 5E8DH 4MX7A 5EUKA 2DLEA 3CHQA 4UDTB 3S3JA 5B3NA 3HHMA 4DOHE 5EF1A 2HJFB 1WE5A 1UD6A 3GMLB 4EZJA 5E8PA 1QSFA 1Z1WA 1IGIH 4Z8FH 2Y2TA 1RUAL 4JCWA 3RFZA 4Y5YC 1HEZB 4X5WA 5C09A 5EZIL 3CLFH 2AQRA 2F61A 4NKIL 4S1RH 3CFQA 1Q1JH 2LVEA 4QWWC 1KSRA 4BZ2L 4XCEB 3O3DB 1SQ2N 2VIRA 1LL1A 3ESMA 1GTNA 2BC4B 3RWIB 1WUNT 3KW8A 3W56A 4AZ8B 4XVTL 1PG7W 4QOKD 4QRPA 3LRLA 3JV5A 2UUDK 4UNIA 43CAB 4ZW5A 4V11A 1GVIA 5FUCC 2FNBA 3BGMB 4URKA 1ZLWH 1L7IH 3GS0A 1U8CB 2KLRA 3G5YA 1S3RA 2QEJA 3QXDA 5D7IB 4F7EA 1BREA 2XZCL 4GAJH 1V54B 4HH9A 4DP8X 5IIEB 2ICWJ 2X2UA 4GXUM 4R8WL 3PHOB 1J8HE 2WPGA 2O6EA 2C9AA 2W88A 4GKLA 4IBSA 1KCKA 2PP7A 2FWSA 1G9NC 1UH3A 1N0LA 1PX4A 1BFVL 1IAOA 2X4UA 3ILEA 4RGOL 5KBKA 5CSZA 1ONQA 4TNFA 3LH2H 4WFHD 5AVWB 3SQOH 3NA9H 4R90L 3EDFA 1P84J 4K9EH 3TV3L 2A74B 5GGQH 2GY7B 1J88A 3U46A 5HVFB 1R3HB 2P8MA 4RDQG 5E2VH 3WMPA 4LAQH 1KJVA 3KXFB 4GP4B 2G5UA 2W5PA 1N0XH 3L1FA 3V4UL 1UCBL 2WLKA 1FH2A 1CZ8H 1HL9A 2NNCA 3VRLE 4RRPG 2DIBA 1JDCA 2QGBA 1JERA 3RP1A 3WNNA 5D1ZI 4R3SB 1CFVL 3LDBC 4G71B 3PP4H 3MBWA 2GSIA 1RJLA 2IBGA 3EJQA 3G6JE 4P23A 1ZK5A 1U8PB 3EZ8A 3KM2A 5I6LA 1XL4A 3PFUA 2F74B 1LQSR 3VG9B 3QCVL 4LB8A 4PD4J 4P4KA 5E8NB 2VDLH 1D5IL 2DQEL 1GHFL 4UILL 3NH7L 3G6JF 3QNFA 4Z7VB 2JJTC 4WI6A 3FT9A 4CMMB 2AEPH 4WFFE 1BX2B 1IAKA 4GQZA 2QSVA 3E3QC 5GRUL 2Z31B 3B9KA 3L9RA 5JO5B 4AEIH 3CTTA 3FOMB 1LEIA 2AJSH 3N0AA 2Q8BL 3AGWA 2WMPB 2XJLA 2PTTA 4XNBA 3V7AE 4PRIE 2W92A 1IUZA 1BMWA 3D25A 2MH4A 2AK4D 2YRBA 1F8TL 3QRLA 3WN5A 3E1F1 4TVPE 1LO0H 5FYKU 2LLNA 5E8OA 4Z3GA 3ZE1F 2EDFA 3TWCL 5IR1A 4HJ0C 2XXCB 4KI5D 4N0CC 4PIBA 4EF3A 3LEXA 2EECA 4NZ8A 5TDPA 3CHPA 1B9KA 2VUOA 3A6BL 4YSPA 5DJCA 5GRWA 5I5RA 3F7LA 1KLUB 1NDGA 1PZDA 2FHBA 4POZC 4YWGL 4FABL 1BXVA 4H26B 5L4JA 2F5AL 3QIUC 3EG9A 5LAXB 1OALA 1CFSA 3CE1A 1TMQA 4YL9A 4FXKB 2E9IA 3OSVA 1PZUB 4EKXA 4U3SB 3EUDA 5ECGA 2EO7A 3FK3A 4KBPA 4Y4HD 1JXJA 2R0LL 3ES6A 4ORZC 1OCCB 4NUGH 2FVNA 1AD9B 4WHTB 2XWEA 3TT1H 3U6XS 3A4DA 4PW3A 2OQJB 1WFNA 5GJTH 5HDQL 1VPOL 5ICXB 2WGNB 5CXPA 1SYSB 3UG4A 5EBMA 3H42L 4I1NB 5CP7A 1U8IA 5DUPH 1RFDL 1Z9NA 4E9RA 1GSKA 3NSJA 3DRTA 2HTLC 5ERWA 1S9XA 4Y1AE 2Z65C 5JHMA 1H3TA 1H19A 4K9JA 5GS1A 5I66A 3KPPA 4NP4H 3UZEA 4BH7A 5D5MA 1MFEH 5I8OH 4LU5H 1X7QB 4OLUL 2VDQH 5FA3B 3H9SB 3CGTA 3OWRA 4HDIB 1KFGA 3OL2A 3QXVA 4XPAH 2A0LC 3UDWC 3KPSD 1YJDL 2UXGA 2BS71 3KGUA 4G7RB 4DESA 3RY6C 2DQFB 3W39A 2EVGA 3IMVA 5D6DC 1TYJA 1JDDA 3CPLA 5DMKA 2R69A 4OLYH 1FZKB 2F2HA 3CLEL 3ZKSD 4DW2L 4AVKA 2ZUQB 4ZTOL 1XSKA 5CCKL 1BFSA 1YN7B 5F44A 3RTLA 1N19A 3MA7B 3LPGA 3QHFH 4UANA 2BS8A 1IFHH 2VLJE 1R5IA 4LXFA 2IBZY 5FYLE 2MNWA 1EO8H 1X9RA 2AGJL 1UXSB 3ZKXC 3C9NA 2A1WH 4L4VE 2E0PA 2X87A 4JO4L 3IFLL 2CXGA 4ZFOB 1G4MA 4LOVA 3TXAA 2C9XA 3ARSA 4NQTA 1AQMA 1JV2B 2YWYA 5CEZH 1CD8A 3PV6A 1I8IA 4WSJA 4YFLI 3QDJE 4P9HL 1KTCA 3K6NA 4HZLB 3ARFB 4ZMYA 3R8QA 3WIHA 4WNSA 1SEQH 2B14A 2EC9T 4PLJC 3LH9A 3MO1B 2HPTA 3ZUCA 2RR3A 1G7HA 2Y5QA 1I1AA 3WUWB 4F20A 5CZKA 5JUEH 5IUCA 3TO2A 5GHWH 3RWGB 4TPRL 3F5WB 3FN9A 3STZA 5INDB 4RCAA 1SDDA 2R9HD 3FB8A 2OP4H 4P2RE 4P99A 5I73C 2I24N 4FG6C 4P2YA 3NG5A 2X1XR 1S78C 4Q7DA 3MRHA 4IBUA 3L2NA 2R4RH 2E75C 5E4OA 1ADQA 5IM7B 1NLBH 1SNRA 2HRHA 4J3UA 3T2LA 4G6FB 1OAUH 3BLPX 2OKMA 3U2SA 3VD5A 4CMHC 3UJJH 5I8EA 5C3LD 2RFXB 4HFWA 2JI2A 4KAQH 4YHOL 2OTPA 3VGAC 3GMPB 2Q3XA 2X09A 3HE6D 4QF1A 4I0CC 4Y2LA 1JCVA 5DC0A 3Q3GA 5DURB 1IL1A 4LLQB 1QW8A 3BSZA 3QNXB 3A3YB 2HFFA 4HUCA 2BY1A 3M1BB 3GZOA 3MRGB 3HG3A 5E1QA 2YD1A 3IJ9A 5MEOB 3IDUA 3LMJH 2YBRB 4E41E 1DJYA 5IREA 1Y6NR 2WBXA 2KKQA 5CEXA 4LCCC 5IWLA 5ICYA 3FZUC 5ENWA 3PABA 2HT3D 1EUUA 5DR5L 1HXKA 3EOTL 3WLBA 2OULB 5IB2B 4V1DA 2CK0L 3QJZA 4FN0A 1KBWA 4ZG1A 4FTDA 3SB3A 1AI1L 2MQCA 3QIBC 2GEEA 5T5NG 4OF6A 3MRNA 3S36X 1ET8A 2CLVA 1BAFL 3AU0A 3RPBA 5EORH 3WEAA 3S36H 4AE1A 3KE0A 4L4TB 2F58H 3H7BA 4S2SB 2X4QA 3GD1C 4X0KB 5C0CA 4PJ5A 3OM3B 4RIRB 3M7FB 2X1WL 1G7QB 4HUWA 4I18A 4XMTA 1P84K 1B4TA 5BV7C 3RVTD 5I1HH 1SJHA 2WXGA 2R83A 4FQHA 4M93C 3ZLQC 3TNMB 3RG1C 1T21A 4D0CA 5C70A 2F5BH 3FAXA 2EYRA 2DJMA 3RWEA 4X5QA 5FW6A 4AIOA 4G70B 4MD5A 2A6DB 2FLMA 1JGDA 2HTKC 1IKFH 3CFMA 3MV8D 2UXVA 3B2VH 3RPIA 2J57A 4MJIB 3FQWB 1LEKA 4LOFA 4ERSL 2WYTA 3ESPA 2BVQB 3F01A 1KCBA 5EG6C 1ZANH 1XR8A 2P52A 2E7LA 2BFVL 3B8SA 1KN2H 1R75A 2J6WA 1H5BA 3K81A 5AVTB 1I8LC 2VLRE 2P4AB 4JG1L 2IGFH 4Y19E 4ZI8A 3FPXA 4OF8A 3S35X 3FO0L 4D9QD 2FDBP 4JN1H 1F90H 1P6AB 3ME0A 3FFDB 1D7CA 3EBAA 4DKFL 5C07E 4OB5H 5K5YA 4U1GB 3VB9A 2XPGA 4HSQA 5AD0A 1UZ8B 3SGJC 5A3ID 5E24E 2DIJA 3GSVA 3UJIH 3OR6A 3MLUH 4U1NB 4PJ7A 2VLKB 3LN4B 2AVGA 2EIBA 1J5OH 3A23A 1C5CL 3V4PB 4B9CA 3MX0B 1TJMA 1KJ3L 4WW2A 4G6MH 3BWUC 2VYRE 4YHPB 4LARH 3F04A 4GRWH 4EI5A 3NN8A 1URIA 3GWJA 1MVUA 3UAEA 4BGLA 4A7UA 5D70L 4GBXC 4LAJH 1WP6A 1M3IA 5IMKA 4GQRA 1ZIAA 5EBLB 1J9QA 1AR1B 1HHIA 2R56H 3I02B 2JQAA 2FX9H 4BD4A 4CBZA 1IZKA 2H0PA 1QLEL 1A14H 1DSFL 1WWAX 4NS0A 1BG1A 2AMGA 1E4KA 3QDGD 4B3EA 1U3HD 3MRCA 4E9LA 5HGDB 4E42A 1T1XB 2PETA 4ONHA 2Y1VA 4S0HA 4EQ3A 2XWXA 1UH2A 4HG4J 2BVPB 2AJVH 4JFZL 3G6DH 1GRWA 4H8HA 5F7DB 1M7IA 1DE4B 1MW1A 4PY7A 4F3FB 2VRKA 4WW1B 4GINA 3KGSA 3KNBA 4LSDA 4JHUA 2CJSA 3VD4A 3TO4B 2OMYA 3KGTA 5DD1H 4P2AA 1BXXA 3F58L 2NY1C 4N8VA 3D69A 3SBQA 3KBFA 1R3JA 1E6JL 3M86A 2XZQH 4XNAA 3WG7B 2ZONA 2VLJD 5EZPA 5BJTB 4HHWA 2P24B 3MRDB 2IMNA 1J48A 4L4VD 4G7VL 3LRGA 4J3OD 2FLBT 3KDMB 2F0CA 1RIHL 3AT0A 1EEYA 3UMNA 2VISA 1CICB 1M1XB 4JKPL 2YARA 3TCXA 3MNVA 3RDTD 1G6RA 3GSWB 4OBRA 1S7RB 1DBMH 3QDJD 3M1CA 4LSPH 2AI0H 4LLDA 4RX4A 3BFQG 5E1IA 3MZTA 5HHNA 3HJ0A 4NQEA 4D7PA 3FT2A 1BEXA 3A4EA 3NCFB 1KENH 2GTZB 2FX8H 2V2XB 1H15B 3G5ZA 3MV9A 4E5XG 4RZCB 5AOIA 1PAZA 1UD5A 4OBSA 4Z7NE 1CIUA 3VRIA 3W37A 2DBLH 3J07A 5IQ9A 4TSBL 2UVFA 1ILSA 3BWUF 1QSFE 2F19H 2VXTH 2D03L 1BLNA 4DNLA 3LJ3A 5C09E 4N90E 3B5GA 1L0XA 1INQB 5KSAD 4Z7NF 2KL6A 3LVEA 5DMIL 2BSRB 2UZXB 1IJ9A 2KZWA 2XN0A 5F3HA 4AV4A 1UB5A 4QRPE 4C83B 3ZZLA 5JOFB 1KC5H 1T4WA 2WQ8A 1KGWA 2HSIA 4P2CG 5CLXA 5JW3H 2XKSA 4JM2C 4MVBD 4XWOC 1E5CA 4CU7A 4ZSOB 3DTDA 2A38A 3RIKA 4NQDB 5E2TH 5B3SB 2VABB 4IOIB 4Z7WE 3RB7A 2XWTA 4KZCA 4DEPB 2XQBL 4LGRB 3VNYA 4ELMA 4XAKE 1M7DA 2ICES 3O6FA 3R19A 2BZCA 3N2JA 2ZCKL 3VSQA 3C5ZC 2X9WA 3O2WL 4N0UB 3WAKA 2JQMA 4FS0A 1ZHKB 1BZOA 5EH1A 4DK3A 2MTPA 2DWEB 4E9VA 3LQZB 4Z7WF 4D94A 1MG3C 4X42A 1Y6KR 3U4AA 1MF2H 1HNFA 3VB8A 1S7SB 2O6CA 1MLBA 4U1KB 2ZNXA 2LT9A 4FNQA 1PKQB 4QHUB 3ULSA 4IS6A 5EZLB 3QZOA 3HE7B 3QO0A 3BGAA 3RVUD 2WBWB 3PV7A 3BAXA 4EQ2A 2YEZA 1LK2B 2YD4A 3SJVA 1K4CA 2E7DA 5MEND 1JWMA 3EGDB 1K2DA 5LBSL 3BUIA 3BPNC 4PBDA 3V4VA 2OCCB 1IIIA 3UYPA 1ES0A 3GLZA 4DWHA 4KK5D 1I82A 3SOBL 4F92B 2DWDA 4QTHA 2YA0A 4GO6B 3I3BA 5JQIB 2NUPA 3BKCH 3FUJA 3B2DC 4U1IA 1GGYA 4XNUL 3MRLA 3ENEA 1OGAD 4RQQA 4UT6L 5AB2A 5FCUL 4HXAL 3ZTNL 1JYXA 1J5CA 4HT1L 4Z7AA 4Y5VA 1BWMA 3SN6N 4ZW3A 1LK3L 3S98A 3ZKND 1XBDA 3WAJA 3QP3A 2WTOA 2O6DA 3A0OA 3QZWG 4QXVA 4GFXA 2J88H 2FL5A 2GJ6D 4YHKL 3IMTA 2Q0ZX 1INEH 2H32H 1Y18A 2YPLA 2VLRD 3L3OB 4XXCC 5LXVA 2Y06H 4J3WA 4Y19D 5M7QA 4LASL 1NICA 4LOEA 1UWYA 3EYSH 35C8L 2FGZA 2WVVA 4NWTL 2PCXA 1MCPL 1JHLH 1U3JA 3LZLA 3RGBA 3WLWD 5C97A 3HPJA 1DL7L 3O9WC 5IFHH 1CYXA 4YIQA 5EA0H 1IKNA 2V6HA 3IFPB 4YXHL 5CJQH 4FCAA 3ZUNC 2H2PC 4JM2F 4WKZA 1FZMB 4KO7A 3WIIH 4AEEA 2OX5B 1IAIH 1BZ7A 5BS0D 5EU4A 4OAWA 3WFHB 3ZZSA 4ZTPH 3QARA 4OU3A 2XXFA 3C87A 3U36A 3OZ9L 4IGBA 1YEJL 1T6WA 2FBOJ 3BKJH 3BUBA 2J12B 1MH5B 1QEXA 3FQXB 2PO6C 2VN3A 3JV0A 1SJEA 3L17A 2F08A 3P9MB 1A4JB 3EYFB 4L3AA 1Y1DA 1UWGH 1I53A 4AV5A 4CVWA 2AXFA 3BKYL 3P4OB 5IB5B 5E99H 1ZLSL 3QPXL 3ZO9A 1IO4C 1CLZH 3LXUX 1U3ZA 1FLRH 4KRPC 1AZNA 3BQUB 1ULVA 3GNMH 4QHPA 3RA7H 2X6UA 1Q72L 4X6EB 4M1DH 1UZ6E 1ASOA 1HWHB 3K72A 1JGLL 4I0KA 4UZSA 5FYKE 2V17L 4XMVA 5DK2A 2YPVH 5D5ME 3SKOB 3LIUA 3S5LA 1TCRA 3TBSB 4LLUA 3BPLC 4HUUA 4UYPA 3T6XA 3QEQD 4MSWA 4GI9A 4DP9X 1D5ZA 1G5AA 2E5EA 2J8UB 5E00A 4IQHA 3W5NA 1SYVA 1UZ6F 3JZ7A 3BW9A 2OMVB 1CGSH 3KR3H 1OSEA 3LRMA 2QQNL 4K23L 1OHZA 1AS7A 4QXTA 2VLMD 3VAEA 2D73A 1A47A 2Y7MA 1N5YH 2DKUA 3T4YB 1T5WA 4LGSB 4RMQA 5HHOA 1AGBB 1E4XL 2Z6FA 1XIWD 1NBYB 2R4SL 4PLKD 1YEWA 3DOSA 4JPWH 3ZE1B 2QQLH 1A6AB 1Z5YD 3UC2A 5JPNA 3PWNA 4YHIB 1HHGA 4PWHA 3RGVA 3UAJD 3OKYA 2OR9L 4R7NA 4MMZA 5IJVB 4TSCL 1A7NL 3Q2CA 5FYJH 1GC1C 2Y7LA 3GEWB 3SYAA 2A4CA 3MLXH 1PIFA 5FXCH 3NK3A 1PFCA 5D1XB 4HS6B 2QTEA 1Q94B 3AW5A 1R1CA 2UWEA 4NOFA 2BW4A 3QZBA 4X5XB 3TA3D 1KPVB 3TYGH 1T0NB 2HYMA 3F64A 1L9OA 3SPJA 2X4TA 2WANA 4XB7A 4ODVH 1OD9A 4G8FB 5F7WC 3P11H 3KVQA 2R39A 2VDKL 5EO1B 1VFAB 2VDML 2ZSVA 3ZDZB 2AVFA 2OL3L 3P73B 2VRAA 5ID1B 4A7SA 3VFPB 4Y5XC 1FG2B 4CKQA 1GGTA 3MJ9H 3MJ7A 3MOAH 4G43B 4XZUB 3D0LA 3T2OA 3TVMA 1TVBA 4G80A 5I0VA 1HJCA 3KGRA 2XUWA 2WOBA 3MOQA 1R5WB 5AW6B 3H9HA 5C09D 1AYOA 3L2MA 4N90D 2YAQA 1JPST 3BXNB 4P46C 5AZUA 3CDZA 3LDBB 1N18A 1TZIA 1O0VA 2AJXL 3Q44A 4RDQF 3RJQB 5I23A 4YHNA 1CN4A 2WWMC 4GKSB 5BUAA 4QRPD 4CC4C 2JCWA 4MNQD 2RGSA 1S5IL 1WHPA 1CLOH 4D9LH 5C0GA 1JZ3A 3LKRA 4HJ1A 5KVGE 1WBYA 3OJDB 4C57C 1UM5H 1I4FA 2ZCZA 4H7VA 4P9ML 4TNGA 3ZYOA 3EFDL 2AJYL 3CXDL 3DO3A 2NW3A 3X14B 1A9VA 2BVYA 3G9AB 4UT7L 1AGFA 5KVDL 1CFQA 1SOSA 2ITDA 4BINA 2J7LA 3O3AB 1JGVL 1I1CA 3SGDI 4OW6A 2RA1A 3FW6A 4QRRA 3CQFA 2CWRA 1XGRA 4ZUSB 3QEHA 5GGTL 3BMWA 5H2BB 5ADPH 4LEBA 1U36A 3M7OA 1EMTL 4M7LT 3VFTB 4V1DE 5IROC 1F11A 5KSBF 1FNSL 1P4UA 4A6YB 4RGNC 5I6OA 3L5JA 1GZPB 2N1KA 3WEXA 4PRHD 4Z77A 1OM3H 4G5ZL 1OOAA 4KVNH 4XN2A 3WENA 5LJYH 4K7FA 3UJTL 3CDCA 1QR1A 1EDQA 1KLFB 3KM1A 1TLMA 3ATAA 3ZHKA 2WB1A 3IXAA 5DS1A 4XX1G 5C0CE 3RJDA 5D8JH 1JWSA 1YNLL 1MAML 5CIPA 2CLZA 3DJZA 4ZUUA 1GZQB 3QIUB 3IDJB 3T8VA 4P23D 1XX9C 1X5LA 1R5VB 3V6ZA 2EDBA 3K1DA 3QW9A 4KKBD 4OLWL 2ORBH 1GXEA 3U4BH 1DQTA 2IPKB 4J3OG 3BKMH 2OMWA 4HGWA 3U1SL 4YPGB 5L2JA 4L8CB 1E40A 4OIIH 2CA3A 2FD6L 4MQXD 4P4KD 3WHE1 3TFBA 4ODTH 1KCRL 2V7HB 1SJVA 3FNKA 5F96H 3AUWB 4JRXB 2DMKA 1BQLL 2BSBA 2EDYA 4M8VA 1KWKA 5MI0C 5C0IA 3P9LB 3Q9QA 3CFBA 4XHQA 3B9KD 4L9LA 1HZKA 3OHMB 5HDBE 3MREA 4EXKA 3WGUB 1MIEH 5D2NC 3V5HA 1PJWA 3HI5H 3A6CH 3MRFB 2VDRL 3COOA 4IYKA 4UCFA 5TE6L 5GS2H 5KAQG 1OVZA 1G5GA 5TGBB 4BRJA 4EOWL 2PMZA 2EDEA 3QQ4B 3GIZH 4G1MB 4DGVL 1TJIL 2BWQA 5HDBF 5C2BH 3T5WA 5C0EB 3APCA 1YC8A 2EIKB 5LGKA 5GGVL 1T04A 1Q90A 3DX8A 2LTQC 5ABDE 2EYSB 3I74A 4R2GB 1R0AL 2I07B 1NWPA 2WIIA 2O5XH 3Q5OA 4PJ7E 4MD0B 3F62A 4M48L 3SDCA 3VFMB 1NTDA 2VERA 1X9QA 3VM7A 4PH8A 2BNQB 3V0HA 2CCWA 4X6CA 3PQYB 3AFLA 2GQHA 4G8GA 4NQSA 3ZKXB 1IRAY 2UZIH 5A6IA 5MHSD 1OW0A 5KYUA 4OCXH 1JK8B 1KPUA 3K4ZA 4PJ7F 4UQDA 3RILA 5CZVL 2HFEB 1OCOB 3LN5B 4H20H 1VDGA 4K5NA 1FFNA 3LZQA 3CIQA 5GS0H 1AXSA 2F18A 4KZDL 2BY2A 3IJHA 3AAZA 3GJFK 2KERA 4H8PA 4ZUTA 12E8H 1KV3A 3IU4H 5FYKD 4W9EC 3LEYL 1A6WH 3C5SA 3KDPB 5ES4B 3P4NA 3QWOB 4ELKA 1JZ6A 4PJFA 3ZQWA 3S37X 2OXHA 3OC5A 3S37H 4HPOL 3ECWA 3SYOA 1ZVSA 5TE4L 3ISRA 5IFAL 1WV7T 2XU9A 3B3IB 5I73B 5JHLA 3DA0A 4Z0XA 3QQNA 2P8LB 4XAWH 3CVHL 2XOTA 3CZLA 4H8WH 4JDVB 2QPDB 2BM3A 3B2PA 2WC7A 4KJPC 2ADJA 1HYRC 2BY0A 1M6OA 2DIEA 3VWJC 4UTAL 3NP3A 1WZAA 1RZFL 2W07A 3VDCA 3L7EA 5LBGA 1Q9OB 2D3VA 5DD6B 3MNMA 2YLHA 1BF8A 3G04B 3DVIA 1MCWW 2KPWA 4PRPA 4CMHB 1PQZB 3NGBC 4IMLB 4TUOB 1SXSA 3EGXA 1FSKC 2V2WB 2R29H 2Y9RT 4Y2NA 3MR9A 2X0UA 1B2YA 3PHQA 4OZFB 1PW3A 3QR0A 4JX0A 3RVXD 4UQ2A 3T3PB 4FF9A 3RZCB 2BDNL 1ETB1 1ACXA 1YUHA 4WWNA 3S3SA 5D2LB 5D4QA 3VG0L 4W81A 2OSYA 5CD5D 3D87B 1BJMA 1DTUA 5I1KH 4H8QA 4KK8D 4HETA 3NAAL 4NQEE 4LK4A 3JWOC 2J3SA 1FV1B 1QA9B 4LCCB 4U3CA 1I1AD 1FN4B 2DH3A 4X80L 5FGRA 3UBXA 5IFJA 4OGYH 5HGHB 3U9PH 5CKGA 1NSNL 5LGJB 3HAEB 5KVFE 2GCYA 1TTAA 2TSAA 5HDRA 3NEOA 1RJZB 3MV11 4FL4C 3QIBB 3HLAB 2XZZA 1T89C 3Q13A 2MOVA 4NRZA 5SWSE 4AGMA 3D30A 4TVPL 3FHEA 5F3FA 3TT3H 4EUPB 4KVPA 2X38A 4QRAA 1UXLA 1BBDL 4FHBD 1QACA 5IJCC 4TV3A 2WXHA 2PN5A 1HHHB 5T3ZE 3T6QC 4L2LA 2B1HH 4G6JH 1QRKA 4AVIA 3CMOL 5TDOB 4NBXB 2MQGA 1AP2B 3MLWL 5EOCL 2WBJA 3T2NH 4ALAL 3EYUL 3QJFB 3VJ6B 5ICZA 4M61B 4P5SA 5KYNA 1RURL 1QBML 3LS5H 4LGPB 1FO0B 4WI4A 3KLLA 3LZFH 3DHMA 2VGLM 3ATDA 3BEWA 1ZPLA 4YSEA 5C6TL 3EBIA 3L9EA 1C16B 1RP9A 3DI2B 4WCYL 3UEZA 1JNJA 4F7TB 1U8NA 2VDPH 4OF5A 4ELME 3IGUA 3PGCA 1XB3A 5C0FA 4XNQB 4XP9L 2FYYA 2V4LA 5C7ZA 4WWKC 2DQCL 4JDEB 3T0EA 3OMIB 2H26A 2KS0A 3TLRA 3DGGA 4R26H 5I6MA 1FYHB 3EO0B 3ZKQD 4GLRI 1RUML 2JJWA 3RWDA 4HWEL 3EJRA 1FGVL 3KZ8A 4ELMF 3JUYA 2BIPA 1N3NB 3IF1B 4I89A 1RERA 2XKNA 1P4BH 3BPOC 1SMDA 5E0QA 5FDWB 4U31A 3X1GA 4X4KA 4ZW7A 4I13B 4NZRL 5E4IA 3D2UA 2X10A 5SX4I 5A2JH 2VZ1A 4JL2A 3NCEB 3SJVE 1S3KL 2ENSA 4NM8L 3L4ZA 5CBAA 2DQGL 3CSFA 3FB7A 2K9UA 5C0CD 1SLVA 4PJ5D 1P4IH 3V0IA 3UPCA