3LRSA

Structure of pg16, an antibody with broad and potent neutralization of hiv-1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
221
Chain Sequence
QEQLVESGGGVVQPGGSLRLSCLASGFTFHKYGMHWVRQAPGKGLEWVALISDDGMRKYHSDSMWGRVTISRDNSKNTLYLQFSSLKVEDTAMFFCAREAGGPYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PG-16 Heavy Chain Fab
publication title Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively neutralize HIV-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 221
sequence length 237
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrsA01
5HYQA 1IBGH 1AJ7H 1BP3B 1YECH 1NPUA 2IPKB 3KJ4C 2EDFA 4WFFD 3ILQC 1EHLL 2R1YB 2PTUA 1TQBB 3UXFA 2V5TA 1QBBA 3S34H 4YE4H 1CS6A 2DWEA 5CJQH 5DMGD 3PWLB 4HIIA 3T08A 4KRPB 2NW2A 5CILL 2LV4A 5EBLB 3S35H 5FO9A 1ACYL 3G6JB 3WN5C 5ICZB 3WCYA 2GITB 1MREL 1C1EL 2JJUA 4KI5F 1GAFL 3VJ6B 4X6CF 1DBJL 1I7RB 1DEEB 3OQ3B 2IH1B 3S36X 3ZE2F 3MOAL 3ZYZA 5FYKH 3KLDA 4CU6A 4PGJA 1BZ9A 3NCYS 3CSBA 1A14H 2Q87A 3LPFA 1J5OL 1S7SA 1FL5B 1CU4H 2LAGB 1OW0A 5LGJB 4U7SA 1FFOB 3FQTA 4NBZB 4L4VD 4UB0H 3WO4C 4JFHE 4LHUB 5GGQH 3MLTB 4NRZA 4WU7B 3QIWD 3QISA 4LRIC 2KBGA 3U36B 4P9ML 5BRZD 3P30H 3B8SA 4WCYH 1UWEL 5IVXB 1F4XL 4XMKH 3U7YL 5J11C 4Y16D 2FR4B 3GK8H 3P73A 3Q0HA 2VLJD 2K9UA 4JRWA 5TF1L 5L7XH 4BSJA 4N0UB 4JDTH 4OLXH 4JANB 2QQNL 4XVUD 4LCYA 4D0CA 4XHQA 1BQHG 4MD5A 4DGVH 4WI2A 1MHEB 4P3CH 3EOTL 4HKJA 3OXRA 3BRFA 3DTXA 4GAYB 3HI6L 5JW4M 4HSQA 4PB0L 3FN0L 5BJTA 4B7LA 2A1WL 2C4XA 5K9KA 4AL8L 2ENSA 4PRIB 2JLLA 2VDOL 4M61A 1P9MC 3QFJD 1DBML 5JR1L 4GS7B 1U93B 2H41A 3OKOB 3F7YA 4PGDB 1NL0H 3RPIA 2EDKA 3TO4A 2V2XB 4B53A 2ATPB 4ZUSB 2Y07H 4U6YB 1KTLA 1RZFL 3VFTB 4JM2B 4Y5XA 1A6AB 4YAQA 4GAJL 3L1OH 4XP1H 3UTPE 1VA9A 3NIGF 2XTJC 3O45B 4YR6B 2HN7B 5CS7A 5DLMH 3LPWA 4ZS7L 1KT2B 3G6JE 4PRNB 3ALXA 5IFJA 1I3GH 4LMQI 3DX8B 1U91B 5HPMB 2AJSH 2DLIA 4UBDD 2VISA 3U46A 5HY9B 2QQLL 4X80H 3SKUD 4XMPH 3QULA 3I84A 4KQ4H 1T0NB 4WFGD 4PJIA 3TT1H 1W0VB 4HCRL 4GJTB 1GOGA 4K8RH 2HFEA 3BPOC 4IDJH 2GT9B 1JNHA 5C0FB 1SJHA 1MAMH 4NO0B 1CLOH 5C9JB 4NNXB 2GK0B 1XCTA 1G6VK 3TIEB 3TBVA 4MCZB 1T0MA 3EDKA 4YDJA 1P4BL 3HZMA 4RFNB 1DVFC 2Z35B 4Z7VF 5CD3A 2ESVA 3GUTA 1WVZA 4N0UE 5DWUL 3LQAH 2EDTA 2OP4H 3WDIA 3S5LB 5F72S 3QI9D 1TVDA 4Y1AA 5IWLA 3EGSA 1RIHL 4KJQC 5J6HB 3SDAB 1G7JB 1UZ8A 1AGDA 3HNTL 1ZT7A 3IETB 4OM1L 4KTYA 4PJXF 3UO1H 5DUBA 5IHUH 1RPQA 3VFSA 5HDQL 1NDGA 3PGFL 2PXYB 1HCFX 1IGCL 2A0LD 5JORA 4PRIE 1WZMA 3P4OB 1S3KH 4FQ2H 4UV4L 2UZIH 5AWNL 1IC5L 2W60B 1T4KB 1X5ZA 2XRAH 3QA3A 3QCTH 4HQQL 4KRMB 4EI6A 5DR5L 1P1ZB 4L8CB 1KN4L 4U3HA 2QLVB 4NRYA 4R4FL 5H2BA 4NQVB 3DIFA 1NCWL 1BM3L 4KC3B 1MFAH 1G0YR 4XX1E 2ERJC 3MRIB 4XPTH 4TQEH 3ORJA 5FYLD 1QYGH 5GIRB 3SGDH 3U30C 2ADIA 4HHAB 3QWRD 3V8CA 1HKLL 3PWVB 1HWGB 4H0IA 2BNUA 2G5RA 2OL3B 2VXVH 2MQ3A 4M93B 1EZVY 3ESUF 4EVNB 1UGNA 2ZCLL 2GYSA 5F9OL 3OZ9L 2O61A 1PDKA 2DIAA 3ILPA 4U0QB 3FKUS 3TA3C 4OBSA 1KELH 1ULVA 4OLUL 4MGXA 1KEMH 4G6KL 3ROLA 4MHHG 4F37F 4NQTA 5DK3A 3LH2H 3O6FA 1A64A 3LSOA 1N7MH 2XZZA 4P4RB 1U9KA 3L3DA 1EA9C 2EYSB 2NY2B 3RVWD 1YDPA 3DJ9A 1WBZA 1WCBB 1CLZH 2PCPA 4R7DB 1N8ZB 1LO3H 3ZT7A 4KROC 4F2MB 5ESQA 3O3BA 3KXFD 4XWGH 2FLBT 3PHQA 4L4JA 1CL7H 4ORZC 5DJYA 5FYJH 2NNAB 3BP6A 5HI4D 1P7QA 5AZEL 3W9EA 1M7DA 4XZUB 1RJZA 1JNLH 5KN5A 4CVXA 3JWOH 3UC0L 3AVEA 1QRNA 3L7FB 1PBYA 2GUOB 3HE7A 5EC2A 3F6LA 5F1IA 1T7YA 4ODSL 4Q9CA 2VL5A 1I8IA 3ELAT 3QNXA 4YDIL 5FM5M 2HWZL 1A6UL 4PYGA 2Y5TB 1S9YB 4YX2H 2IFFH 5GJSL 5C6PB 3DECA 4KK5C 4PJ8A 4F57H 2NLJB 3MJ9L 2F54B 4PRDA 5M7QA 3GMPA 2CDFB 5C0BD 1DBKH 3OAUL 4DKFH 5EUKA 3W39B 5DJ0A 3FFCA 2N1KA 3VFGH 4XCYA 3I75A 2BHYA 2XN9A 1U92A 5DURD 2NY5C 2YRZA 1E27B 4HC1H 3IDUA 2WSKA 4PS4L 4QRSB 5BV7B 4Y0GA 4PLNC 5HHQA 3MBEA 1D5IH 5CLTA 2W9DL 5J1AB 1DUYA 1G7PB 1BJ1H 2ZSWB 5LQBH 4OIAA 2R56H 1ONQA 3VFVB 4LCIL 1MJ7H 2WBJA 1INDL 3QEHB 3DMMC 1EX0A 2IADB 5I1IL 5J8OA 3O6LL 4XCCL 4K3EL 3ULUC 1FO0H 1CQKA 4R0LB 1PJ9A 4H88H 3QT2A 1MH5B 1DQDL 1QBML 1P5UA 2HLAA 4OFIA 4C4KO 3DYPA 5BV7L 3IAQA 1U8OA 1WC7A 5IV2A 4G9DA 4JFZL 4XNQB 1YEIL 3U4EA 4G42B 1MNUH 3FMGL 5BO1H 2BCKB 2J88L 3O4OC 2XG5A 4PJEA 1KGCE 3V0AC 3CX5K 3OB0K 3KPSD 1P84K 1IEAB 1QFPA 2SEBA 4XXDA 3UYRH 2E9JA 1M6OA 4JJHA 4MAYB 1R5VA 4E5XB 2Q20A 2E9IA 5IW3A 2YA2A 1A1OA 4M1DL 3B9EA 2Y36H 1S9XB 4PV9B 3QUZD 5IB1B 4PLKD 4PJ5B 1OVZA 1XGYL 4JO1H 4TVPD 2V5YA 1FGVL 1RU9H 4YPJA 1C7TA 3TPUA 2JELL 2X1OA 3L3IA 4GBXA 4FQQA 1WISA 4NFDA 3V6OC 3IYLW 4NUGH 2ARJQ 4XPAH 1AKJA 5TH2A 1MFDL 4QRPB 2BVOA 2QHRH 2NX5A 1J8KA 4NBXB 4ZS6C 1FRGH 1X44A 1AR2A 2F54E 2DJ4A 3MV7B 4GXUN 2GSGB 4ERSH 3RWFA 2JB5L 2VH5L 5I1DB 4H26A 5IMOB 2A83A 5JOPE 4MWFA 5FDYA 4ZAKC 3VGHA 2AV7B 5CP3A 2X89A 2ILLA 1KN2L 5HI3D 2R2BB 3AROA 2XZAL 4LLYA 1KPRA 1C5CL 3REWA 3W0WB 3O0RH 4MNGA 2DIJA 3BT2H 3RX7A 1I7UA 3TYGL 1OGAD 5FUZH 2HRPH 2P46B 3Q5TA 3WNOA 4PGCA 1YEFL 1NGZB 5E6IB 4KHTL 4XB8A 3P4MB 5LCVL 3RWGA 2GJZA 1XGQA 1FG2B 3U1SL 4PP2B 1OAQL 1ZWIB 3IXAA 2CIIB 2ORBL 3O6KH 5D1QA 5MI0C 1JGLH 1J9CT 3LRSB 1OF2A 1C5BH 3VGEA 4CVZB 2CD0A 1FG9C 2Q8BH 5E94B 2GSIA 2VDPH 1D9KD 4H5SB 5E9DD 3HZKA 3GSRB 4UT9L 4J2XA 5J11B 1N0XL 1YNLH 4KK6D 5JLZB 3W9DA 2X2YA 5J9PA 4HK0B 4XWOC 1R3IL 4HLZG 1U8PA 2XYCA 3IU3B 1YMHB 2CPCA 3MUHL 3KYOB 1EJOH 2BZDA 5E8PB 3VG0H 4KZEL 3DURB 1HYRC 2A74A 1LO2L 3GHEH 2OS7A 2P45B 1E4XL 4N5EC 5TFSH 1IAKB 1QZ1A 2B4CH 5BZWA 1JUFB 3K3QA 4JKKA 3U9UB 4ZO8A 1NEZB 3KDMB 2FWOB 4JGUA 2NZIA 1NCUA 2HVKB 4P3DA 1LE5A 2MTPA 2X5PA 1J8HB 2X09A 2JK5A 3Q6FA 1NCCL 4ZNEE 1RFDL 5GGVY 3NCEB 2EICA 4GXVL 4QRPE 3CH8A 1JWUB 2YWZA 4M5ZH 1VESA 3QSKB 4JQXA 5DVKA 4GQ9H 1KNOA 3OGCB 3SE4C 1JP5A 2DM7A 5HHVH 5CBEB 3WIIL 4BSWA 2IG2H 3MV7E 4KKBC 1ITBB 5DT1H 1W8NA 1JPSL 2IF7A 4OTXH 1AO7B 5I1HH 3PL6D 3ES6A 2NY3B 3DBXB 3HCVA 1F00I 3BZFB 4M7JL 3NABL 3PHOB 4ZFZA 1D6EB 5CKGA 5D5MA 3T3MF 2AW2A 4X8XA 4ZSOB 5GRXG 1U8LB 3MNVB 1Q72L 3TWCH 4PJBB 3NH7H 1DBAH 1JVKA 3W0WE 3GI9H 1GGUA 3FB7B 3CAFA 2DLTA 2OXHA 1MCKA 2QL1A 4W4OA 4LKCB 4NHCH 5HD8D 4JFXA 1FAIL 4YFEA 2IBZY 4P2OD 3RKDD 3VU2A 2BRRH 2JF1A 1DLFH 3IVKB 5ERWA 2LABA 1U36A 3MV8E 5CKAA 4PJ9D 3S96A 5J1TC 5A2LH 2HT2D 4GKZA 2B0SH 5F71A 3RIFF 5E00A 4WTZA 5CGTA 4YZFE 4OZHF 4LSSL 5D7JC 5CJOH 4ZOAA 3ARTA 2BDNL 3DUUA 1JGVH 3C5SB 3SCMB 4NKOA 3QWQB 3QHFL 2P7TB 1GAFH 3BPCA 1DVFB 4ODXA 2PO6C 4PRPA 2NXYB 4LLVB 4HX1B 4Q74A 5HDOA 3EO0A 1B2WL 5BCAA 3KPQB 1BJ8A 1NANI 1LEGA 4OF5A 1B3JA 1YNTA 4PJAF 4M5YL 1XCQB 2IAMD 1ZLWH 5DZNA 4QRRD 1MFCL 3EYVB 4IMKA 3TNMB 1XMWA 3NOIA 3T0VA 4LLWB 1FFRA 5DVLA 2P44B 3QCUL 3K1DA 1UYWL 3EFFB 1FVDB 3EFDL 1GGBH 3MSPA 1J8HE 4I0PD 1LEIB 1VENA 4TRPH 3U7YH 5FUOL 1OPGL 5C0GB 3JUYA 2A6KA 3GSNB 2H45A 4YDVB 2FJFB 4KKAC 1J0HA 3QNYB 4RZCB 2QQNH 1UWGL 4XAWH 1BGXL 1RHHB 4RIRA 1AO7E 4O2CA 3PJSA 1UM4H 1SVCP 2BVTA 5SWSD 3E6HA 1T6WA 3S5LG 3WFZA 5DRZA 3TO4C 3HI6H 4PB0H 1HEZA 2HJKB 3CMGA 2BY2A 4ZSOE 5T3XL 3TA3B 4KUCD 1JF1B 1JRHL 1NGXA 4P5TD 5F70A 4PJBE 3S37L 3VRLF 4OLVL 4Y5XC 5JR1H 2EDWA 5DK2B 1HSAB 5H35B 3TVMB 3ZHDA 2FX9L 4L4VA 1HXMB 2K1MA 1RZ7H 3GSNL 2HH0H 3NA9L 5C8JB 5I8OL 3V7AE 4JFDA 4RWYH 5FK9A 3P9LA 3WIHA 1WTLA 3PABB 2VLLA 5BRZA 4ZFGH 2EIEA 4Y16A 3V6BR 1F3JB 4KV5E 1U8QB 2EIBA 2RCSH 4M8VA 3C08H 5D9SB 3BEWB 4C83A 1Z0MA 1FNEB 1L4IA 5DRWB 4WGVB 1BVLA 2BSTA 2QSCL 3HMXL 2X7LB 3S6CA 1JZ7A 1V7NH 3HUJB 1CFNA 5GPRA 2AJZA 5F88A 2I9TB 2DBLH 2J8UF 4GKNA 2QV2A 1CDHA 3RL1B 4U1SB 5EOCJ 4QRUA 4DCQB 3SKMB 4ONGH 1VPOH 4HZLA 2GCYA 4JG0L 5DGQA 1CFBA 4EJ1C 2DYPD 5IW6A 1KG0A 5CP7A 1EHAA 1JNNL 2VQTA 4P9HH 4RBPK 3D0VB 5EU5A 4WUKH 4PTUB 5IWLC 3UYOD 2FO4A 1P4BH 2HTLC 5C0AB 3T1WA 3RGVB 3DVGA 1DSFL 3KAAA 5FM4A 4U1LA 1AXTL 1FZMA 3KYAA 4F9PC 5ICYA 3DMMB 2DM3A 1UZ6F 4XGZB 1ETZA 2UVEA 3ULSB 3BKJL 1GC1L 1G7IB 1KENL 2CKNA 3DX9A 1IEBA 3HNTH 4MCYB 1TMCB 4KPHL 3IKCA 4JFED 5AAWA 3KYKL 4NWUH 1G6RL 2BSSA 2BY1A 1MCPL 5KG9A 4UV4H 4U1KB 5AWNH 5KVEL 1ZLUH 4UQ3A 5JIPA 3BGAA 4QHNA 1W8OA 4BZ1L 4HIXH 1BMGA 5DHYB 3SDXA 2Z92A 1KN4H 5DF0A 4IOIA 3O4OB 2R9HC 4LP5A 4R4FH 4YHPA 1UB6A 5CSZA 5A2JH 1BIIA 2OTUB 4G7YH 4HS6A 4OZFH 3TYFB 4JHAL 4OD3H 2JCCF 4UIKH 4UDTA 1U8KB 4U7KA 1CFVH 5F9DC 2P8MB 5I6XC 1HKLH 4OUUB 2CMRH 3ARYA 3O6FC 3OJ2C 2BOBB 5JXED 2GEEA 1LE9B 4ZUUA 3QI9A 2BXZA 2RQ8A 1CBVL 5EZOL 3SKJL 2Z8RA 1G9MC 2AJXH 1X5LA 3HUJE 2WAHA 4QT5B 1L6ZA 5TDOB 3CFEA 4LLUB 1JGEA 4RRPG 4U1GC 4JFOA 3C87A 3QO1A 4K7FB 4Z5RA 1OLZA 4NNPL 4MMXC 4CJ0A 5CINH 4Y5YA 3CFKA 5ITBL 5JOFB 2OK0L 4YFLI 1K3IA 2R1XB 2VZSA 4N8VB 1CL7I 1RD6A 2DQUH 2VABA 5ICXB 2OL3H 2ED7A 3L5HA 1GGCL 4JVPA 1C8PA 4JRYD 3FAWA 2OMBA 2MCG1 4WHCA 4P4KD 1WZ1L 2XWBA 4NWTH 2FBJL 4ZD3L 3QWRA 4KTDL 4PJ8C 2Z93A 4U1JB 1QA9B 1QEWA 4R3SA 3KPNB 4ZOCA 4ODSH 2PTVA 2GTZB 4YDIH 4AY0A 1A6UH 1GXEA 4HWZB 1BLNA 3VGAC 3MJ9H 5I0DA 4EOWH 3LKRB 3ULUE 4HH8A 3MBEC 2WINB 3PGDB 3DGGA 3TCLB 4BUGA 3QDJD 4GSDL 4O4YH 3EBAA 4PS4H 4Y8AA 3SDYH 4HGWA 3T2PA 2Q76A 3I3DA 1YYML 2X4NA 3KXFA 2Z9TA 5JHDB 4URTB 5H37H 3VA6A 5IB3B 1NGQH 2NZ9C 2A77H 2I24N 4LCIH 4I5BA 1AXIB 5EBMA 3MRBB 3B5HA 4P5KB 2FO1A 5DQDL 1HNGA 4MJ5B 1JYVA 4M6OH 4I18A 1DQQA 4JLRA 3V79C 2HKHL 5J6GB 1PKQA 4M7LL 1U8MB 5IESL 1DQDH 2YC1B 5IROA 5KVDH 3KJ6L 1J05A 4ZUWA 4XC1H 3BD3A 3VFOA 2QTEA 3UTSA 1FGNL 5FOBA 3V6OE 4HEME 4Y2DC 3P4NA 1IAII 4M62H 2J88H 3H9SB 3GBLA 3KLSA 4UILL 4Z77A 1R3HB 2HTKC 4TUJA 5ITFA 4TOYH 3T4AB 4IOSD 3UAJC 2DWDB 3V95A 3DWTA 3X12A 1MCFA 5E0QA 4PP1C 3F7VB 2CUIA 4GBXC 4C56B 5I18H 2XA3A 1YA5A 3CPLB 3RWCB 2DLHA 2E7HA 4DKEL 5HYQB 1OHQA 3RZCD 1KJ2L 3J8F7 3V4VH 3BUTA 5ALBL 4NN7B 4DKAA 2VKWA 1S7WB 2YWYA 3QP3A 2DWEB 3PGCA 4JY6A 3VH8G 4HIIB 4HWBH 1F8TH 1NAMB 3T0WA 5AG9A 2NW2B 2YN5A 3U7WH 3DO7A 1VFBB 1MFDH 4K3GA 3DARA 1IJ9A 4HXBH 4J3OC 5FO9B 1UENA 3NN8A 4Z8FL 1NUFA 3BGFB 1UB5A 1CFTA 2EXWC 1NCBL 3PE9A 4KKNA 2V7NA 4KKLD 3H2WA 1VFAB 4LFHD 3C2AL 5IJKA 1SQ2N 1Q0YH 2EDYA 3KPSA 5IVXF 3S97C 1A02N 4N0CD 1CCZA 2PYEE 1EEQA 1MHHA 2E6JA 3G5ZB 3NTCH 2K3TA 2M1KA 3QR2A 4N9GB 4YDLB 3AUVA 3CVHB 1XZ0A 4HIHB 5KZCB 5JHDE 2XPGA 5IBUG 4E0RB 1NAML 3BAEH 2CUMA 2R8SH 3QAZC 4I0KA 3QUZA 5D1QC 1A9BB 4X5WA 3TYGH 4NN6B 5EOTB 5IQ7H 3ARWA 4NRZB 3VXUB 4CN1A 3RFZC 5FM5O 1PD6A 1MCCA 3GSUA 4KTEH 4PRAA 5EU3B 4JREC 4E42A 1RZ8A 4Z7NE 5D7IA 2YN3A 2DQDH 4LCYB 4RA3A 2R2CA 1ZLVH 4D0CB 4MD5B 5T5NG 3EOYG 5AAMA 3FOMB 3CVHL 4P2RD 5KSBA 4UT9H 1FLRH 4CDGC 2ZUQC 1I9RL 5E4EC 5FCUH 4HKJB 5DQ9B 5FGBA 3H9SE 3OGOE 3OXRB 4JM2F 1FBIL 2VLRA 3PF2A 4B0MM 5T33H 3DTXB 4XPHH 5C86A 1F11B 4QYOA 5BJTB 2NXZD 3MLYL 1N6QL 3TJEL 3ZKNC 3F8UB 4PY7A 4H0GA 1E4XH 4C56E 3F7YB 1OGAA 2VL4A 2I5YH 5DEFB 4G8GD 5HI5C 4LOUD 3TBTA 1N3NA 1ZSDB 1KTLB 5JPNB 1KCUH 4Y5XB 5DS8A 2QEJA 2AK4D 4YAQB 4F9LC 1GVIA 3MRKA 3MLPA 1RFDH 4L29A 4QWWC 5FF6A 1IL1A 3RHWF 5CMAB 3CMOH 3OX8A 1UM5H 1NUNB 4AEHL 1D9KA 5IFJB 3S7GA 1F97A 5E9DA 5A2IH 4LDEB 5C08B 3U46B 1HQ4A 5T1KB 3BKYL 3QULB 3UEZA 3NABH 5E2UH 5EU6B 4HKBA 1H3PL 4L8DA 4PJIB 2B2XL 1FPTH 4PLJC 4RAUA 5FO8A 2HFEB 1SJHB 3VXMD 4U0RC 2D9QB 3HPJA 1RQ5A 4L8SA 5T3ZE 4R97C 3VCLA 1F4WL 1T66D 3VXUE 1V7ML 1YNKH 2O5ZL 1OARH 2ZWLT 5HHPB 3TBVB 1T0MB 2AKRA 4JZJA 5D7KE 4XPGH 3DSFH 3HZMB 3ARSA 1U95B 1REIA 5CD3B 2ESVB 4NFBA 2E8YA 2A73B 3ZDXE 3LKPA 3KR3H 4Y1AB 4APQA 3EGSB 5LGKA 1UZ8B 3PL6A 5DTFA 1AGDB 2J1KA 3PXJA 1ZT7B 2F58L 5ISZB 4NJ9L 3I85A 2AEWA 2YUWA 1F3DH 5DUBB 3BUYB 3VFSB 1NDGB 3PXHA 2WK2A 3DRQA 4U6VH 5IBLD 5JORB 4HKZB 2VYRE 4HWEL 2A6IA 1OP3K 3BH9A 5C0EB 3QA3B 5CEZD 5FHAL 4OZIB 4EI6B 3GMRA 3HC4L 4RMSA 3GGWA 2H3NB 4X9HA 1T5WA 4NRYB 1H8OA 2DTMH 1ERNA 3DIFB 5E2JA 4X5XA 5FB8B 4R7NA 4LCUB 5CIPA 5F21B 5DUMH 4ETYA 4PJ9A 1OPGH 4I3RL 1Q9OA 1EDQA 2NY1D 2BNUB 3GSQA 4Z7QF 2BSED 3SJVD 1VKXA 2XKNA 1I9JL 3L9RA 2O61B 3IDNA 3PNWA 3ILPB 3PDGA 4GMSL 4OGZA 1AR1D 2ZZUT 2PW1A 4QOKD 3O6FB 3LSOB 2FYYA 4ONFL 3MCKA 4S1RL 3P2TA 2FIKB 5D6DA 3UZQA 4GW5A 3DX7A 4PJIE 1JHKL 1MCWW 4FTVB 3VGBA 1Z3GH 1YDPB 2IBBA 3QIWC 1WBZB 2PCPB 1A3RL 4U3CA 2DQJH 1X4XA 2IAMA 4EBQL 2Y06H 4LEXL 4QRRA 2AV1A 4Y16C 4U1GB 1YY9D 5ESQB 2XACC 5HDBF 4DWHA 3ZL4L 3GSNH 3RY4A 5GS1B 4KVCL 1J1PH 2YPLB 1BZ7A 5D96C 3PHQB 3QIBB 5DJYB 1KTDB 1A7PH 4XVUC 1A6ZB 1B0WA 3BP6B 4PB9H 2AI0L 1P7QB 4I0PA 4FMKA 4FRWA 1FV1A 3W9EB 1FFPB 4EUPB 1CZ8H 4X4YA 4V1DD 5KN5B 2OZ4H 4YQXL 3HA0A 1T20A 1QRNB 1KSRA 3D69A 2ESVE 2IEPA 3X3FL 3HE7B 1IGFL 5EC2B 2OX5A 3GNML 1ZHKA 4YGVB 5ESVA 5F1IB 5CD5D 2VL5B 1CD9B 3QNXB 2IPTL 4Y1AE 3IAPA 3OAZK 4LVEA 1EEYA 1BOGA 4X6DA 2QSCH 3GIZL 1J10A 4PJ8B 3HMXH 1S5IL 5GGVH 1MHCB 5SWSA 4PRDB 5HSFA 3GMPB 3T8XA 5AD0A 2CSPA 5EUKB 1UKSA 5T1MA 5DJ0B 3FFCB 4XCYB 3I75B 3O9WD 2AXHA 1ZV5A 2XN9B 1MJ8H 1ORSA 1U92B 3FQWA 4PJFA 1K6QH 1P5VA 1KCSL 1UJ3C 4P5TA 3K8KA 1MFBL 2EZ0D 2VLME 3VGAB 4WFHE 5HHQB 4XBEH 3MBEB 5E5MA 1DUYB 4L1HA 1UQSB 2P43B 3BIBX 5KSAD 1ONQB 2ICWJ 5J89A 5GS2H 2X4PA 4YC2C 1CGSL 2FDBP 2WBJB 4J3SA 1WEJL 1QLFA 1HILA 4FQLL 3BKML 4JHWH 5CAYB 1HIML 2YPKA 1XF3A 1T04B 4UBDC 2E6PA 1C5DA 1ZGLP 5CHNB 2VJXA 1AXTH 4AM0A 2VXSH 1MY5A 2IANA 5GISL 3KS0J 1WC7B 4RGOL 1OWWA 1E6JL 1CK0H 2NPLX 1QBLL 2V9TA 3U4EB 4OQTA 3NFPB 4GMTH 2DQEL 4WFED 2NY5H 3VXSD 1MJJB 4NO5A 5KS9B 2SEBB 2ICEA 4XXDB 3VMPA 1M6OB 3FQXB 1R5VB 1XGRA 4LGRB 4P46A 2DYPA 3C6LD 4H8WC 5KTEH 1A1OB 4PJGA 3WNPA 1MUJA 2I9LA 5HGHB 2YMXH 5J12B 3EW3B 4UTBH 2F5BL 4U05A 3C9NA 3QI9C 4ODWA 4X7DC 1F4YL 1ZAGA 4JHAH 1YN6A 4ODVL 2UYLA 4NGHL 3P0VL 4BZ2L 4DVBB 5INCA 4DN4L 5IGXH 1QRNE 3ULUH 3CXHJ 1AFVH 4HUVA 3TPUB 1R0AH 3L3IB 4S10A 4GBXB 4MA8H 5EC1A 1NUGA 4WJ5A 2QBWA 3RVXD 2PN5A 1AKJB 5TH2B 2BVOB 1WIPA 4Y5YC 2B5IC 2A0LC 4ODUB 5D70H 1LK3L 3RGHA 5C9KA 5IEKA 3L5XL 1UXWA 2VZTA 3RWFB 4JFEA 3FFCE 3GBNL 4NNPH 5I1KH 2XN9E 4XNXL 1FJ1A 2OK0H 1QPXA 4W6WB 4UTAL 4UUJA 5C07B 1JF5A 5EIVA 1CGVA 5IEHA 2A6JB 4MB5A 5C3LD 3K4ZA 4JM4L 4XCEB 5DJAA 4YZFF 1KPRB 3DV4A 4MNGB 1I8LA 5GRZA 1P7KA 4XPBL 3VXNA 1I7UB 1NGPL 1CTOA 4KI5D 2DS4A 3V9FA 2IQ9H 2E9BA 2FGWL 4Q9RL 1JCKA 2VDRL 4ZD3H 3RWGB 2GJZB 4K07A 5I8EA 5CWSB 3IXAB 3WO3B 4QXGH 5LWYL 3P0GB 2XQBH 4K3JL 4YDKH 1KLUA 1TJIL 1M05A 5JXEA 1RJCA 4F15C 5IP4A 4OF0A 1OF2B 1JHLL 2ZOLA 3RVWC 1IARB 2GY7B 5L9DL 3VWKD 3EYQC 2O93L 2GSIB 1NBVH 1TNMA 1YEEL 4EQ3A 3GRWL 3HZKB 4JREB 3GMOA 2AJVL 5I2IB 2BHUA 1M71B 1U8PB 3ARVA 5KS9E 4LVOC 3STZA 2EH7L 1I1AD 3OTTA 3GIVA 4M43L 4GSDH 1QSFD 3FO9B 1VHPA 5HYFA 1WSST 1CE6A 2DDQH 4NZUL 3NIDF 5ANMA 2YZ8A 1K3ZA 4YBQD 1N5AA 4I18C 2E5EA 4JRYA 5BZWB 4HWUA 2R29H 4FQCH 2VDML 4P4KA 3PG2A 4EXKA 5IMMA 2DQHH 4P3DB 5IROC 2D0FA 2FNBA 3C60A 4ZDHA 1LE5B 4P59H 1W72A 2VXTH 5HHNA 4M8QA 3Q6FB 1IQWL 1C08B 1O0VA 4KGJA 3RAJL 1SY6A 5GSRA 4MB4A 2XWTA 3ROOA 4PJBF 3HRZA 5IESH 2VXQL 2NX5E 2DQGH 4WTWA 4BSWB 5BXFA 1YEDA 2X4TB 1W0WA 2J4WH 2DM2A 5LXGL 3ES6B 1EFQA 4ZODA 1TITA 4AIOA 5IQ9A 4ZFZB 5T5NF 3W2DH 3QJFB 5C07E 5D5MB 4MA3A 5B39A 1RUAH 1PAMA 3L3GA 3S3SA 2RB8A 4HFUH 4JRXD 5TGBA 4MNGE 4XPFL 4RA0C 4MSWA 4PJDF 4NPYA 1JFQH 1TVBA 4DKEH 2NTFB 4JFXB 1PLGH 3VD7A 2R4SL 4JO2L 3U79A 4LVNB 4F7EA 5M94B 1SYVA 2R0KH 1FFNB 3B2UC 4OGYL 5ERWB 4Y7MA 1X5IA 4CKVX 4GKZB 1UH3A 1KEGH 2XA8L 3JXAA 5E00B 3FO2A 5IJKC 4WRLA 4PJHA 2PF6A 4H25A 3UTQA 1IGTA 4UI2A 4JGJA 3DUUB 3SO5A 5DJZA 1NCBH 4X6BA 3MJGX 4RAVA 2P49B 3BPCB 4Z78A 5HVWA 4ODXB 1JI2A 4N1CA 4PRPB 5E1HB 5IJVA 5B8CA 2LU3A 2VDLH 3QUZC 4DVRH 4PLKC 3MACL 1WWWX 4MQXC 1LEGB 3PP4L 1EEZB 1YNTB 4NHUA 3MRMA 1E28A 5HHMD 5HHXL 1BEYH 2WANA 1WK0A 4OCRH 1CF8L 4YNYA 1DQJA 1NAMH 3HNSL 3U2SA 3H3PH 2J7LA 3V4PL 2X44D 1NMAH 1AE6H 4N0YL 3RZCA 1KIPA 4KQ3H 1CGWA 5GRJL 5ACZA 3HS0B 3GB7A 1DL7L 5JO5A 3B9AA 2DMCA 1J1XL 5BMFH 2AJ3A 2A6KB 2BC4A 3QEUA 3O3DA 1LGVA 3MR9A 5HI3C 5E99H 2ICWA 2ZG3A 5IB5A 3QNZB 1MLBB 1CXEA 4RIRB 4O2CB 5I0ZA 1I9RH 2ZUUA 4HKXA 3LCYA 1N5YH 1JMXA 1T0PB 5T3ZH 5DRZB 3T0ED 3GDBA 1KCRH 1NUDA 1HEZB 5D5ME 1U6AH 4YFDB 5TQ0H 1CTNA 1NGXB 3D85B 3LS4L 1RJLA 2Q86A 2XXMB 4KUZL 4L4VB 1LO4L 3K2MC 5DI8B 2ZUWA 5E8DH 4RFEA 1A7BA 4JFDB 5C7XH 3GI8H 5FK9B 4AIZA 5IOPB 2J8OA 4Z76B 3HUJF 2VAJA 1MFNA 3OMZA 2VLLB 5BRZB 1D9KC 1A1NB 2Z8SA 3LKNA 4Y16B 3ARGD 4KK6C 2PR4L 3V0WL 2ZJSH 4LSUL 3T4YA 4C83B 3SQOH 4G6MH 5GZND 1N64L 1AGFA 4IDLA 4R2GB 2G9HB 3GMQA 2W07A 2BSTB 4P2RA 1SBSL 3M17A 4D8PB 4PRPE 1CFNB 1A47A 5F88B 3UROR 4WW2A 3BKYH 1E4JA 1FH5H 1NQBA 1NSNH 4L8SC 3OJDA 1H3PH 1LDPL 4GKNB 1BVKB 1PX3A 4R26L 3AXLB 4OZ4A 4QRUB 1YJDL 4JZJC 4G7VH 2VR9A 4MVBD 3BHBA 4HZLB 3CFJA 4LSPL 2GCYB 5C0DA 1I3UA 1P6FA 4OIIH 1KG0B 5CP7B 4KK8D 4XTRC 4WFFE 1CT8A 5EU5B 3ULUF 4M48L 1E4WH 2DKSA 4NZTL 4DQOL 3H7BA 1JL8A 2H32B 3ZKQD 5GGTL 4OLZL 2MJWA 2FECI 4U1LB 1Y6MR 2DLGA 1IGYA 5CEYA 3QRFM 4MQSB 3QIUA 1FZMB 4YC2B 4YHYC 1D5ZA 5ICYB 3SE8H 2RIKA 2PYFA 4EUPG 5F9WC 3MBXH 5J57B 2N7AA 4OM0H 1ETZB 3EYOB 2YD4A 1Y6NR 4HJJL 5FGSA 3DX9B 3JWDL 1IEBB 3CVIL 5E7FA 2AJUL 3IKCB 2LU4A 4LSDA 5HD8C 3F7QA 4NC1C 3RKDC 4KHXL 4P2OC 2CGRL 4EEEA 3QWOA 2BSSB 5KG9B 4UQ3B 4QHNB 5FHAH 1LNUB 3VXMA 1IM3A 4L4VE 3SDXB 4JVUA 4PJ9C 3HC4H 4IOIB 2HT2C 4X9BA 2YD6A 4JFDE 3TZVB 4YHPB 1UB6B 2F8XC 5CSZB 4LLDA 1OAYL 1U8IB 3GBML 5FYKD 3MXVH 3DPBA 4HS6B 3LB6D 5E2VH 5I1EH 4RMTA 5BRZE 3N85L 4UDTB 3ECBA 5KBNC 1LQSR 3ARUA 3S4SB 4HS8L 1ZGLB 3HI5L 5D6DC 4ZUUB 3QI9B 2RJMA 5L8LB 3FHQA 1AC6A 3L3HB 4GMSH 4UT6H 3AB0B 3PHSA 2WNGA 4Z7UA 2DF3A 3LKOA 3QO1B 5EB9A 5SWZB 4Z5RB 3LV3A 3NZHL 1CICD 3RL2A 5I73B 3D9AL 3F5WA 1ZVSA 3CFKB 2B5IB 1J0KA 4FQXC 2IGFH 3JBG7 3MNZA 4HWNA 1EVUA 4I0PC 3VRJA 1Q8MA 4LEXH 1YQVL 1A7RL 2H2PD 2VABB 4K7PX 3EIFA 4BZYA 1EGJA 3L5IA 2O5XL 3WKML 3BPLB 2P5WD 4J3XA 3GMLA 2AI0H 1OCWL 3S36H 2XWBB 3B43A 4NQEA 3MLVL 3QQ9C 2FX7L 4YQXH 1MCEA 2Z93B 2AEQL 1QEWB 1T1XA 5CZVH 4YHNB 5I1GH 1Q38A 3ARDD 3VXOA 3SJVA 4LF3A 5I1LA 1ODAA 3QEGL 4XCFH 1G9MH 4C58B 5ADOL 4P5TC 3GMNA 1WT5C 4WEBH 4XNYH 4QOKA 1ZGLM 3WFBL 2DQTL 1U3HD 2CK2A 3MLRL 1UKQA 4CADA 4WFGE 4LHQB 3BDYH 1XF4A 3DGGB 2FLRT 3LEYL 1SEBA 1WFOA 4EUPH 2P48B 3FT2B 4KJPD 4RAHA 3VW3L 1NAKL 3MCLH 4HGWB 4PIRF 3SDXE 3FQUA 2Q76B 3FL7A 1FP5A 2X4NB 3KXFB 4QF1A 1QFUL 3HZYA 12E8H 1HHKA 4LVOB 1ZANH 4D0BA 3IDJA 1CGSH 2WZPD 2NY7H 1I9IH 3BYTA 4I5BB 5BQ7A 1Z9SA 4V1DA 1FNGA 1CDJA 3IDYB 4K8RD 1ZMYA 2Q3AA 4LASL 3U0PA 1GHFH 1PQZA 4JFYB 5D8JH 4I18B 1DQQB 4JLRB 5F7DA 3ULVD 1R5WA 5DHXB 1GIGL 1PKQB 6FABL 2P24A 4LMQE 4JY5H 5HHOD 3VI3E 4DKDC 1PG7X 3VXRD 3VFOB 4RGOH 3ZE1F 3UTSB 5FOBB 4AMKH 4BQ9A 4WY7L 4I48A 3P4NB 1HWHB 4YHKL 4YHMH 3HAEG 3O9WA 4KROD 4KXZH 4WNQA 5HYSG 5DURB 5ITFB 5KOVC 2AXJA 3QUXD 3K1KC 1R24A 4IRZL 4UU9A 2X1XR 4NN5B 3X12B 1P4IL 2C4FU 5DD0L 3I9GH 5KSAA 5JUEL 4WHYG 3C8DA 5JDSA 5IHBA 2AXFB 3STLA 5FYLE 1IC4L 1TENA 4EZMA 2OR8A 3WFCH 2OTWB 1DFBL 2OR9H 4JY6B 4K23L 2BP3A 4YXHH 2VC2L 3DO7B 4YHOL 3NN8B 3QXAA 1SMOA 1UB5B 1CFTB 3IU4L 3PP3K 1MQKL 4L1DA 5A1AA 1GJIA 1BD2A 3VXSA 4ISVA 1J0YA 4JB9L 5HTSA 3UBXG 4AH2A 4LCCA 3KPSB 4XNXH 4UTAH 5JMRA 1YEJL 5GS0L 4OI7A 4ZPTA 1JJUA 3KYNA 1U3ZA 5EUOA 4JM4H 4L3ED 1QSED 3C6LA 3ZDXF 1XZ0B 3KXFE 2XPGB 4X6EB 3QUZB 5JXEC 3E3QC 4H0HB 4X5WB 2R69H 3MA7B 4WVRA 2WUBL 4NFCA 3WEXB 4R96A 3WLBB 3BSZL 3FJTA 5EU7C 3BKCL 4DFIA 2X4QB 1JPFA 4LDLB 2VDRH 4GG6A 4PRAB 4EN3A 4Z95L 2ADFH 3KPMA 1RVFL 1RZ8B 1TJIH 4JFQA 4ZTOL 3BVNA 4NDMA 5D7IB 2ADJA 2DOCA 1PKQE 5CP3H 3G04A 1CLYH 1VDGA 2YRPA 3CXHK 2ZKHH 5F7UA 1NMCB 3UTSE 5KSBB 1MCBA 3RVVC 1IZJA 5CEXB 5KVGL 2WUCL 4XNUH 3A6BL 5I9QC 2VLRB 5GGSY 1XF1A 3GMMA 2X05A 2EH7H 4P4KC 1YYLH 3HFML 5HGAA 5CZKA 1C12A 1OT1A 4PV8A 1XR8A 3SE9H 3SGKA 5FECA 1SJEA 3LN9A 4C54A 1I1FA 4PY7B 1IGIH 2JJVA 1OGAB 1OAKH 1B88A 2CK0L 1OAZL 3ARBC 4X6CA 3MUY1 5E2WL 3TBTB 1R5IA 1AQKH 3ZTNL 1ZHBA 1N3NB 2HMID 2H26B 4HF5H 4XI5D 5DS8B 1ADQA 1A8JH 1A3LL 3MRKB 3RAJH 2ZNWA 1G9NH 4L29B 5FF6B 5D1XD 4MHHI 4MXQC 1UACH 4TNWK 2CO6B 5CUSH 4W68A 3OX8B 2ZCHL 3QXWA 1T03H 1MPAL 4PG2A 5E9DB 1X7QB 4JR9H 4J3WA 4YXLH 2CKBL 3L3OB 3UPRA 2MOVA 5FHBL 3HN3A 1YEKH 1HQ4B 4HW6A 2I25N 4AJ0A 1TVHA 3KPSE 4HKBB 3WS6A 2A38A 4A6YL 1I1AA 4L8DB 1QSFA 3O2DA 4FQIH 4L4TB 2FH6A 4RAUB 5FO8B 4E41D 1BAFL 1OTUD 1TCRA 1A9EB 2J6EL 3AS3A 4M7KL 3L3KA 1RMFL 3HPJB 3QCVH 3VCLB 2GTWA 3BO8A 4TVPE 4RNRA 5C0ND 2UZYB 3QG6A 1ED3A 1G0DA 5IF0A 4JO2H 3WSQH 2AKRB 4KY1H 4G8IA 4XC3L 2DBJA 4DW2L 1ORQA 3MV11 1P6AB 4MXWH 3RDTC 5D7IE 5AYUH 2C1OA 2XA8H 5B8CC 2Q7YA 4OZIF 3LKPB 1KB9J 4NC0B 4APQB 3MA9H 2NY4D 4XWOD 5KSBE 3PL6B 5DTFB 1ZOXA 2PUQT 2CLZA 3KWWA 1FYHB 3SOBH 2VLRE 4YBLB 3BP4B 1RURH 1CG9A 4L8BB 3RWEA 2FZ3A 4IRSC 4RDQG 4OCLC 5JXAH 3MFGB 4MAUH 4QHLA 3H9HA 2A6IB 5F7EL 3BH9B 1RUMH 4JRXA 4WGWB 4KVNL 5HHXH 1CF8H 1RZGA 2HKFH 3GMRB 3HNSH 3O2WL 1FAKT 3GGWB 1OGAE 1T5WB 4N1HB 3JTTA 2QADD 2UUDH 4N0YH 4BJLA 4YGAB 4XT1C 5KJRL 4L3AA 4X5XB 4Q6IA 2D0GA 2P8PA 4LAQL 4R7NB 4U49A 1XGPB 5CIPB 1WAAA 1GYAA 4FQHB 1Y0LA 1HKFA 4PJ9B 5DD3L 5GJTH 1Q9OB 3V52L 1J1XH 1KCKA 4FZEL 2Z0BA 2CJUH 3GSQB 4KKBD 5B4MD 1I8MA 3U82B 2XKNB 2R2EA 3L9RB 1EO8H 5E9DE 3IDNB 3PNWB 4ZO7A 3VDCA 4PR5B 2VIRA 2PW1B 1AI1L 4GLRI 4OD1L 4DGIH 1FQ9C 2GFBA 4LQFL 2C7UB 2FYYB 3VFUA 3MCKB 2KKQA 4HEPG 4MA1C 4N5UA 4Z7VA 1GZQB 2OTPA 1T89C 2I07A 2IAMB 3RWJA 4KDVA 3UJTH 4QRRB 1D6VL 2E7LA 4D3CL 2BMKA 5CJXC 1BZ7B 5DZOA 2YPVH 1G7MA 3VGDA 4OBRA 3GO1H 3VFRA 4JPKL 1BF8A 4G9FD 4I0PB 5TE7L 1FV1B 4F7PA 2VSDA 3QG7H 1M7IA 5C0JA 1CDGA 1PKOA 1T20B 5D7JD 4I77L 5C2BL 5FIEA 3D69B 1VFUA 4XH2A 4D0DA 1S9VB 4KMLB 4WW2C 4BK4A 5SWQA 3BQUA 1GPOL 3BI9X 2DIBA 5L6YL 2YSSA 2NXZC 1DBBH 3S9DB 1EEYB 1BOGB 2O5YH 2I60L 4I4WA 3S4SG 1IBGL 3ARPA 1AJ7L 1K4CA 1YECL 5SWSB 4UZGA 5F96H 3X14A 3T8XB 5AD0B 1R3KA 3WHE1 1MVUA 1I8KA 3OG4B 3WIHH 4WI5A 3NFSH 2ITDA 4YE4L 3S34L 4LOUC 5CJQL 4F7MA 1ORSB 3FQWB 3N50A 4M6NH 5CFHA 4R26H 1N59A 2DKUA 3P9WB 1S9KC 1JZ6A 3S35L 4LSPH 1DE4B 1XF5A 3WHXA 4NC1E 4AENA 4JFFD 2NYYD 2X4PB 2R23A 2YUXA 1BJMA 1QLFB 1HILB 1QHPA 3QEQA 4DQOH 5FYKL 2YPKB 4X6FA 1XF3B 3UMTA 5JMOC 1A14L 3WN5A 5IT2H 2QJDA 1IC7H 3P0YL 5KS9F 4OLZH 1JYNA 1C5DB 3IFPA 1CU4L 1A2YB 2VR5A 1GZPA 4AM0B 3OSKA 2NY0C 4YXKH 3P77A 2BY0A 5GXBB 2IANB 4GRMA 5GGQL 1ZHNA 3MGAA 4HUUA 3TH4T 2XWJA 1UJTA 2EO1A 4WCYL 4XMKL 1HHGA 4LNVA 4LNRA 4KHXH 4NO5B 3GK8L 2LFGA 2Y5EA 2VZ1A 2CRMA 3EAKA 2ICEB 4P2QA 5FO7A 4QRRE 3HC0A 4JDTL 4OLXL 3TBYA 3IDMA 1J18A 1DLHB 2DYPB 4LRIA 4P46B 4P57A 1TETH 4XP6H 3MRGA 5DMKB 4DGVL 3FQNA 3ME0A 1MUJB 2VDQH 3GJEA 5I15L 3IXTA 4P3CL 2JJTA 5C0CA 1QD0A 3C9NB 4ODWB 3T1FA 4K55A 1YN6B 3VG9C 3MRJA 5INCB 3BGMA 4NNYA 2HT4D 4X7SH 5HYJD 1FZKB 3BZEA 4HUVB 4WJ5B 4HS8H 5F3BA 4P99A 2HLFD 4LSTH 4O02H 5DK0A 4WU5A 1B4RA 1LHZA 1KF9B 5IBLC 4X6DE 2EC9T 4ENED 3JV6A 1NL0L 4HT1L 4M4PA 4TSCH 4LU5H 5IEKB 1NCDL 5SWSE 1UXWB 1HHIB 1IKFH 2Y07L 3LHPH 3ZDZF 1A4KA 1P9MA 4J1UA 3TN0D 4PJFE 3L1OL 4XP1L 5I1JH 5DEZA 3G5VB 4S2SA 5DLML 5IEHB 5DHVA 5EBWA 4ZYKB 3ETBF 1A7RH 2X70A 1BJ1J 1HQRA 1I3GL 2NY1C 3EOAA 1P7KB 5KAQG 3VXNB 1A21A 2DMKA 2FBOJ 3FCTA 3ZZ1A 4X80L 4XMPL 3JWDC 3RUGF 1RHFA 1I7ZA 1U0QA 2DN7A 4KQ4L 4PPTA 4R4ND 5I8EB 1KB5B 3RVTD 1QOKA 2AEQH 1KLUB 4A2MA 1S8DB 4BFIA 2FEDD 5K59E 4IDJL 2ZOLB 5JW3H 2DI9A 3KG5A 3B3IB 3T3PE 1MAML 5ADOH 4BH7A 3LKQA 2IANE 5CCKH 1CLOL 1G7HA 3PV6A 4U2ZA 1HH9A 3CZFA 1YY9C 1CICA 5K9OA 1TTUA 1X6LA 1OAUH 3P11L 4GG8B 4XCNB 3GIVB 3LDBC 1G7LB 3MRDA 5F3HA 1U42A 5FYLH 3LQAL 1KXTB 2FGZA 4X9GA 1NAKH 2OP4L 1QO3A 3VW3H 1KB5L 1MWAA 3T2OA 3OKKA 5I9QB 4GAGL 5A3ID 1N5AB 4JRYB 5CD5C 5EOQH 2A6DA 2P5WA 1OSZA 1XIWC 4P4KB 1F5WA 4LEOB 3U48A 4FQ1H 3L6FB 4JDVA 3QO0A 3C60B 4ZDHB 1FHGA 3UO1L 4JM2D 1W72B 3G6AB 4ZFOL 1IGMH 1WFUA 5D5MF 4DK3A 4WENB 1S3KL 5C71A 4FQ2L 1NCAH 3NFNB 2XRAL 3ARFD 1MCJA 4HBCH 3QCTL 3O9WC 5TPWH 4Y19B 4HUXA 1FVEA 2OM5A 1SM3H 2W65A 2EZ0C 3GJFA 1YEDB 2LAAA 3KHOA 4OAWB 4EDXB 1U3HA 1FN4B 1WZLA 1MQ8A 3CX2A 4KXZI 1GGYA 1MFAL 4LGPB 3MLUH 2EXYC 2G75A 2XT1B 4TQEL 4V2CB 5ESAA 1QYGL 4ZUTA 5IQ9B 1TQCC 2BHZA 4NM8H 5B39B 3UTTD 2VXVL 2A2QT 4WI8A 3NGBB 3HNVH 3NIFE 1SY6L 1YC8A 4MSWB 1JIBA 2VLKA 1KELL 1UEMA 3L5JA 5IB2A 2F8VA 4NO0D 1KEML 3FQRA 1TVBB 4N0FA 3LH2L 1TXKA 1N7ML 4X4ZA 1N6UA 4YHZH 4F7EB 1K9TA 2D0HA 1ZA6B 1SYVB 4TULH 4YUEL 5FOJA 1EH9A 1WWCA 3OAZH 2VTFA 1CLZL 3E3QE 5EO1A 4WV1A 3O8XC 4LCCC 2ZOKA 4PJHB 1EXUA 5HHOA 4GFTB 4H25B 5D72L 5EU7E 1GH7A 3UTQB 2RFXA 4NYLA 1CL7L 3SDAD 5DJZB 4X6BB 5FYJL 5ID1A 1ZXQA 1X5XA 3C6LC 4Z78B 1MQKH 3LD8C 5IJVB 2AGJH 1JNLL 5B8CB 3JWOL 3QUXA 3OKYA 3QZWG 1F6AB 4ELMA 1RK1A 3ZYJA 1M1SA 2VQ1A 5GS0H 4NHUB 3MRMB 1E28B 1ZTXL 4LQ1A 2DI8A 4LPCA 4PGEB 5ID0A 4OSUH 4K71B 1UM6H 2R1WA 1AD9B 2H9GA 3U2SB 4JO3H 2FL5A 4JRYE 3RVXC 4F57L 1X5FA 2V17H 3RZCB 3ALWA 2V2WA 4RX4D 4N1EA 3VFMA 1DBKL 1KIPB 1KYOJ 3BSZH 4DKFL 5ACZB 2C3XA 3BKCH 2FD6H 1BQHA 3VFGL 3GB7B 1XGTA 1NGWA 3CZJA 1TFHA 2KQNA 5JO5B 2XTLA 2EO9A 4HC1L 5TQ2H 1MI5A 2AJ3B 2BERA 3QEUB 5H8DA 3O3DB 4D9QD 3V6FA 3MR9B 1D5IL 5IB5B 4Y2DD 5LQBL 2MSPA 2R56L 3MRFA 3MRPB 3SGKC 3ZDYE 4YPGA 1T7WA 2LQRA 2AAVA 4OCSH 2WUCH 5KVGH 2YHGA 5FUCC 4KI5C 5DVOA 1MCDA 4TVPH 2NY2D 2VAAA 1FO0L 4G5ZL 4W70A 4L3EA 1QSEA 4IHOA 4H88L 4OZHA 3IDIB 1RJLB 2Q86B 5JW4R 5I76A 1YPZF 4RDQF 3WUWA 1LWRA 4QY8A 4ACPA 4AIZB 4MA1B 2C1PA 3C5ZB 5E2WH 1MNUL 3VWKC 5BO1L 5E08H 3RJQB 4PG2C 1YY8A 5DRXB 3LKNB 1UVQB 4U1NA 5ABDE 1IAIL 1H3VA 1Q9WA 4PJAA 3UYRL 3W81A 1AGBB 1N0LA 4NQCA 3T4YB 4FZ8H 4MQ7A 1RUKH 1KPUA 4PJHE 3WS6C 3GKWH 3AAZA 1AGFB 1I1AC 5E7BA 3E2HB 1MELA 1RAMA 4O58H 3B6SB 2F54D 3M07A 5BVPL 4JPVH 2CRYA 4JO1L 4LIQE 4YBQC 4WW2B 1RU9L 5JOPD 2YK1H 1ZS8A 1OAXH 4NQDD 3KYMB 3CH1A 4NUGL 4XPAL 1IFHH 3SGEI 4OZ4B 3WL9A 2Q8AL 2P47B 1IAIM 4HS3A 3N0PB 2QHRL 2MQCA 1BAFH 3QDGA 3BHBB 3CFJB 1FRGL 5C0DB 4GW1A 5IG7A 3OR7A 4NUJA 4RFOH 1CT8B 4AYFA 4PD4J 3TBWA 3T2NH 1BPVA 1RJYA 4XHJD 4EQ2A 3MODL 2MKLC 4O51A 4X7TA 3DI3B 5L2KD 3N1FC 4U1IA 1QFWH 1VB9A 5J06A 3AM8A 4TUKH 5C6TH 5CEYB 4OKVA 3CDFA 3QIUB 1RSFA 1D5ZB 4GUPA 4JPIA 3SDXF 2PYFB 3O0RL 1INEH 3VA2C 3ZMRA 2GQHA 3OAYH 1U8HA 4L9LB 2HRPL 4KFZC 4GRWB 2APBA 4DZBB 1K2DA 4DUWA 2FB4L 4FXKA 4JN2B 1T80A 4LP4A 5E24E 4Q6IC 3QWOB 1JGLL 1Y6KR 4MAYD 1C5BL 5F7EH 4E41A 1TZGL 4NQSA 2VDKL 3VXMB 1IM3B 2Q8BL 4MLIA 3O2WH 5LAXA 4P0DA 4WWKB 2VDPL 3Q6GL 3K4DA 5DJ8A 1ZT4B 3O3EA 5D7LB 2X4SA 4PJ5D 4O9HL 2R0ZH 1JYXA 4PRHD 2ZUXA 4DK6A 2C3VA 1QLRA 4U1MB 2QHLA 3F12A 4ZPVA 2OCFD 1JWMA 5DD3H 1EJOL 3CFBA 3VG0L 1RZJH 4G8FA 4GXUM 2VWEC 2IMMA 5I75C 3GHEL 4GW4B 4P2RE 5DUPL 2B4CL 4HPOH 2QR0A 1MOEA 2V7HB 5CJ5A 4XRCA 1J86A 2E7LC 4DEPC 3LVEA 4Z7UB 3LKOB 2BNRA 2F9BT 4JFPA 4PLJD 3LV3B 1KB9K 4QHMA 3RL2B 5IW1A 3F5WB 5INDB 1ZVSB 4UNTA 1B9ZA 5CIPH 1EIBA 3HLAA 1RZKC 4M5ZL 2YOCA 5F6IC 1B0RA 1EFXD 4JKLA 3JV4A 4GQ9L 2VDNH 1MCWM 5HHVL 3W0WD 1X6NA 2Z4QB 4HJGA 3REVA 5DT1L 2AVGA 2EC9U 4OTXL 4ONHA 4MNHA 1D5XA 5I1HL 3SKNA 3GM8A 5EPMA 3WNNA 2DI7A 1VFOA 5TE7H 1IZKA 5I30H 4C4KT 5E6ID 2UWEF 4NQEB 3SE4A 4Q97A 5C2BH 2NY1B 1P2CA 1T1XB 1TJHH 1AY1L 3D3VD 3SJVB 3CLFH 1H3XA 3TWCL 4LF3B 1OB1A 4ZMAT 3T0EC 2EDDA 2X1WL 3MV9D 3NH7L 3RU8H 5I1LB 2Z31B 3MGTA 4G3YH 5L6YH 4KK9D 4GOSA 1DN0B 3GMNB 5I1AA 4NHCL 4KJYA 3STBA 1U8NA 1UWXH 4H1LB 3MJ8A 1KJVA 4GRWE 5J13C 5KANI 1OM3L 2JCCA 2BRRL 3ARXA 1DLFL 1MRDH 5JIHA 4QHKJ 5C0IA 4P49A 1H8SA 1XF4B 3NZ8A 2B0SL 3VXME 3ARGC 4OFYD 5CJOL 5SX5H 3EJJX 1HHJA 4FP8H 4IMLA 4QF1B 5F1SA 1JGVL 3AC0A 2WIIA 1KPVA 4PRBA 5D7LE 1HHKB 5GZNC 4G9FA 4D0BB 3IDJB 3INUH 2GJ6D 5BQ7B 4V1DB 1FNGB 1FLTX 3R1GH 5D7JA 5KAQF 1FIGH 5B3JF 3P0YH 3TFKD 4K7PY 3U0PB 5JIKA 3MGOA 4YHIB 3X17A 5F7DB 3OKNA 1NANH 4WDIB 5B38B 1R5WB 1BQLH 2PO6A 3AU1A 2P24B 1I7TA 3MJ7A 2BXYA 4Y2OA 5FM8A 1Z9LA 4MVBC 2ZSVA 3LIZH 5JQ6H 1GGBL 1AO7D 4Z7UE 1F45A 3DX6A 4J4PD 3FOLA 4I48B 3U83A 1YEHH 5FV1L 5AG8A 2PNDA 4TYUA 3O9WB 4KK8C 4TRPL 3CUPB 1R24B 2JJTC 4UU9B 4FXGA 5CEZE 4JEGB 4F8TA 4O5LH 4P2YA 1QUNA 3RP1A 3QRGL 4XAWL 4AK1A 3QQ4B 4JFFA 3ZKXC 5KSAB 5I15H 1WWAX 1UM4L 4F8QA 1L6XA 3HB3D 1D5MB 3IKKA 3STLB 4NQEE 2WIMA 4QCIA 4OQTH 5LKNA 2V6HA 1KTRL 4LARH 3V5KA 2BNQD 3O3AA 3SJVE 3DVNA 3DYOA 5ALCL 2AXGA 1RZ7L 2HH0L 4LSQH 1X5YA 4QOKE 3EO9H 4HT1H 4RWYL 3SCMD 1NCDH 2GJJA 4UAOC 3D6GA 4LK4A 3RIFK 2NXYD 1BD2B 1EMTH 2XQYG 3VXSB 2XQYK 4ISVB 3SBWA 4ZFGL 2B7DT 3WIFA 4NCC2 3LB6C 5GRUL 4OV5A 5I74C 2FH8A 2RCSL 4ZPTB 3C08L 3KYNB 5D7IF 4WTXA 3O41A 5EUOB 3C6LB 4P2CG 1ZT1A 3TT3L 5E8OB 2AABH 3I6GB 3L95B 1QHOA 3LRGA 4RGMB 1V7NL 2KQMA 3H7LA 3N1MC 2CR3A 1Q9LB 4FG6C 4R96B 4V1DE 2C3HA 5BW7C 1J0ZA 5D71H 2DBLL 1JPFB 5T3XD 3RIAK 5HYJA 4GG6B 2APFA 2XY2A 3PWLA 4EN3B 3OL2A 3KPMB 3MNWB 4JFQB 1CICC 3BVNB 4NDMB 2ADJB 1HINH 4ONGL 1VPOL 5HVHB 1CLCA 3G04B 3V5DB 2BFVH 2XNAB 4PUBH 3K8LA 1JN6A 4P9HL 4NBYB 4WUKL 2H2PC 5HGGS 2IH1A 1IAMA 2QKIA 1HH6A 2OXGA 3TN0A 5F89B 4OF6A 1DQTA 1FL5A 2Y23A 3P11H 5HGAB 2D7QA 3WDHA 5EZLB 1C12B 3WKNA 2HFFB 4YO0A 3I2CH 1KB5H 5SX4I 1FFOA 5FECB 1SJEB 3TVMD 1I1FB 3UDWC 4OZFB 2D7PA 3ARDC 3MRQB 4GAGH 5MP6H 4KAQH 1S5HA 1L7TH 1DJSA 1ZA3B 4WU7A 3V8OA 1ZKAA 1R5IB 1ZHBB 2P8LA 4D9RD 3SPVA 4F9PA 5IVXA 4NWUL 1U3HC 3IFNH 1GOFA 3RWDA 5IVNA 3D39A 4HIXL 3MLSL 5GS2D 4FABH 4R9HA 2YEZA 1IE5A 4JQVC 3ZLQC 3AGVA 4KJPC 5DD1H 3UPRB 4G7YL 5GSVB 4OD3L 1BD2E 4UIKL 4WFEE 3VXSE 3BZ4B 1TVHB 4GAYA 3UP1A 1CFVL 5FKAA 3KPRA 2CMRL 1TZHB 1NLBH 1W72H 4J3TA 5EUOE 3R8BB 4K8RC 1TPXC 3H3KA 4QRTB 1TCRB 1SY6H 3ULVC 3L3KB 3AMKA 2AJXL 2V2XA 3MO1A 2ATPA 4WV1C 3BO8B 4RNRB 4U6YA 4I1NB 4NKMB 3VFTA 1DUZA 4HCRA 1QLEL 1A6AA 4JM2A 5IF0B 3BD4A 4GG6E 2FJHB 5CINL 4YUEH 5TF0A 5FYKU 4G8IB 4HUKB 5C0AD 1H3TA 1NGYA 5F7NC 3EYQD 4PGBA 3ARFA 5DD6B 1GGIL 5MHSD 2C1OB 3PWUA 1KT2A 3LQAC 3QUXC 1JPGA 2Q7YB 2DQUL 2OL3L 5D72H 4BQCA 1FE8L 1EHNA 3BE1L 4X4XA 3BWAA 2DRUA 3KWWB 4TTDD 4G43A 4NWTL 1CG9B 1XH3A 1JPTH 4K9EL 3RWEB 3UTTA 1W0VA 2WWMD 2WMPA 3H9HB 1ZTXH 3ZHLA 1QPPA 4M1GL 4AG4H 4JRXB 2QQKH 4QKXB 5AUMB 4KI5E 1A7NL 35C8L 3EHBD 4NOFA 3UCRA 3JTTB 4EOWL 3H42H 1IQDA 3LQZB 4Q6IB 3LZFH 4U6HB 2EDQA 1MSPA 3LMJH 4GRLB 4Z7WF 3HI1B 4Z9KB 1Y0LB 4M1CD 3PWPD 1JTTA 1T6VN 2FX8H 2AS5M 4LIQH 4O4YL 4OZGF 3SDYL 3S5LA 1I8MB 4HAGA 4HXAH 3BRDA 2R2EB 3MV01 4RQQA 5J6HA 4XNZC 1G7JA 2PTTB 1NGQL 2A77L 1KXQE 4DGYH 2BX5A 2GFBB 5I71B 5AZ2H 1H3UA 1BQUA 3VFUB 4ODBD 5E6ZA 4C55A 4JPWH 3GSXA 4S1QH 2MKWA 1LK2A 4AT6A 1QSFE 4LLQA 1AGEA 3EOBA 15C8H 4Z7VB 4M6OL 4G5ZH 3JV0A 2D7TH 4HK3N 2I07B 5HJ3A 3QDMA 4NT6A 4L8CA 4HIEB 1PZ5A 4R90L 5KVDL 1I75A 4XC1L 1FL3B 1NC2B 2NTSP 1G7MB 4RX4A 3B2UD 5CLWA 3MFFA 4NQXB 3RTQD 4M62L 5IBTH 3TIDA 4TOYL 2EYTB 2WWKT 1IAIH 3N06B 5C0JB 3PWVA 3WXWH 1WIUA 3SN6N 4XH2B 1YN7A 4NZJA 3ARED 5SWQB 4PBWD 1NBYA 3BQUB 2YSSB 4Y2DA 3BP5B 5I18L 1NJ9B 3FB6B 4I4WB 4FA8A 3THMH 1F6LL 5GHWH 5EWIH 4MQXD 1K4CB 4F58H 5BVPH 3WBDA 3KNBA 1F3DJ 3N1GC 4P4RA 3V4VL 4BELD 1R3KB 1MVUB 1I8KB 3HC3L 2ITDB 3OWEA 1WCBA 4F7MB 4HWBL 2HMIC 1N8ZA 3SDCD 1F8TL 4XI5C 3G5XB 2Q8AH 3U7WL 4JRXE 3MJ9A 3RKPA 5J13B 4DN3L 4OJFL 1BFOA 3JWNC 3KJ4B 4HXBL 4HIJA 4MNQD 3T3PF 5JHDD 5D1XC 1XF5B 2Y7QA 3T65B 3WHXB 4OCNC 2NNAA 3AM8C 1CXIA 4POYA 2R23B 3J7HA 3VFPA 1MVFA 1WAAE 3QEQB 3P9MA 4E9LA 4F33A 4X6FB 3MODH 3WFDH 4LSVH 1Q0YL 1W2KT 1QFWI 3B5TA 1BBDH 2UVFA 3L7FA 3KPOA 3WN5B 1QNZH 3BFOA 5HBBA 4DUXA 1OP9A 3IFPB 3QXUA 3NTCL 1HCVA 1GZPB 4FQPA 3MYJA 3B83A 3BAEL 4PREA 2W0PA 1S9YA 2R8SL 4I8DA 3P77B 2E27H 2F54A 1CGUA 2X40A 1Y18B 2W0KA 5IQ7L 4GRMB 1ZHNB 4IRJD 1OTUC 1B6UA 4HUUB 3W39A 4H20H 3H9SD 2FB4H 4X9FA 4NQDA 5DFTA 4KTEL 5K9JH 2XZCH 3NPSC 4LNRB 4Z7VE 5C0NC 3WO4B 5DQJA 3MV8B 4H1LG 4P2QB 5FO7B 4QRSA 4UNVA 1ZEAH 1L0YA 1TZGH 2FJGB 2DQDL 2VDKH 3TBYB 3IDMB 2XIDA 4JZNB 4P57B 5DA0B 3MRGB 1G7PA 3OKEB 3FQNB 3Q6GH 4C56D 3GJEB 3HG1B 5F1OB 1FLRL 1OGTA 5IB4A 5C0CB 5FCUL 1E6OH 4O9HH 3T1FB 2J5LC 2WBWB 2NY4C 4K2UH 5T33L 3BGMB 4NNYB 4GRWH 4XPHL 4K94C 5EA0L 5L2KA 4AEIH 2VUOA 3BZEB 4RRPA 5F3BB 4PD4K 4AZ8A 4WU5B 4NCDA 2L4OA 5DUPH 3JV6B 2I5YL 2J12B 4KKCD 2W0LA 4G42A 4PGZA 5FYJU 5B38G 2B1HH 4M6MH 1IT9H 1A4KB 1KCUL 4RMRA 1DEDA 2XY1A 5D6CA 3ALPA 2QADC 1AXSA 4CVWA 4J1UB 4N8PA 5I66A 2IC2A 4GAFB 5C09D 4MAYA 4LHUG 5GZOD 4ELKB 4S2SB 5DHVB 4DJMA 5EBWB 4UAOB 3CMOL 4XTRD 3CD4A 1UM5L 2X70B 5KZCD 3LS5L 4XNMA 2ZCKH 5GGUB 5E8NA 5B4MC 5F44A 1T1YA 4F9LA 3FCTB 4M7ZC 4PJ5A 3WDJA 5DRNB 2XTJB 3VXUD 4OT1H 3QEQE 3GHBH 4PRHA 2F5AH 5JPMA 1I7ZB 1XAUA 5D2LF 5E2UL 4PJCF 1HHHA 5EULV 1BFVL 2XKUA 5D1ZD 5J56B 5BVJB 1SYSA 3S37X 5MEQB 1PYWA 3GFUA 1FPTL 3VI4F 1AY1H 4BFIB 4NKDA 3S3PA 3TBSB 4BH7B 3LKQB 5CEZH 5DYOA 4YEFA 3ZKSD 4A2LA 1DDHA 2GSGA 1TNNA 4ZFFA 5DVMA 1HH9B 3FRPG 1YNKL 1OM3H 1OARL 4JQIH 1PY4A 1CICB 3BPOB 1EGJH 4XPGL 3DSFL 2R2BA 4P2QE 4Z0XB 5F3HB 2BVYA 3MRDB 3RRQA 1EFXA 3L3JA 3RWIA 4FFYL 1QO3B 1N4XH 4XX1G 3WNMA 3KR3L 5BS0D 3OKKB 3HG1E 2D31A 5C0CE 1OSZB 2H8PB 4N0RA 5E6IA 1AQDA 2Q3ZA 3P4MA 4JDVB 3QO0B 1FG2A 1WTGT 1T5XA 1ZWIA 4H1LH 5IHZA 1LP9A 1X3DA 4YFLF 5F7FA 4RSVA 4U6VL 3D3VA 4OFPA 1EBAA 3MV9A 3RIAF 4QNPE 4HUXB 4OLEA 2EDBA 1CE1H 3GJFB 4OCMC 2DTML 3NBNA 4FQXD 3JVGA 1QSZA 1QBAA 2HG5A 4HMEA 5C08D 3RHWK 2HFTA 5T1KD 1NBZA 3BN3B 2G75B 5EU6D 5ESAB 5IVZA 2NYYC 4ZUTB 3ET9F 5KVMC 5DUML 4WUUD 2NR6C 4MD0A 2BSRA 3VXTA 3QRGH 4OFYA 1T2XA 4OB5L 5FA4A 2NMSA 3NCMA 2ERJB 3WE6A 2VLKB 1N2RB 5J3HD 3VH8A 2AEPH 4QXTB 3U30B 3QQ9D 2IQAB 3FQRB 2GJ6A 2XTJE 1JWSA 4Z7OF 3O81A 5DMJB 4OZFG 5AYQA 2RGSA 1FC2D 5CJBA 5GGRA 1Z3GL 1U3JA 2DQJL 1XGUA 2Y06L 3VFNA 4PYHA 1FNHA 5EO1B 3SBWC 5ALCH 2ZOKB 5FFLA 1EXUB 5HHOB 3LN4B 5F8RC 4MD4A 2RFXB 1J1PL 4NYLB 2RAMA 5IFHH 2EDHA 1AO7A 1A7PL 3TH2T 3QIWA 5ID1B 4PB9L 2R4RH 2VZ3A 5ISZD 4KROB 1FORH 1CZ8L 2OZ4L 3QUXB 2VLJA 4ZSOA 5GRUH 4ELMB 4Q7DA 2VQ1B 3MJ6A 1MJUH 1TTFA 5CGMA 4PJBA 1TQBC 2HT4C 3LEXA 4FNLH 3TT3H 3FB7A 4JJ5A 2R1WB 2XZQH 4KRPC 2HLFC 5GGVL 2P5WE 1HI6B 3R0MA 1S7QB 2V2WB 3CFCL 1QRKA 3VFMB 2BVPA 3JV5A 2IMNA 5LBSH 4ENEC 1BQHB 1F2XK 1HZHH 3WHE0 1XGTB 1MJ8L 2VZUA 4OKDA 1K6QL 2BNQA 4JY4A 1SHMA 3LEVH 1MI5B 3QFJA 3TN0C 1CDYA 5JNYA 1CXKA 3V6FB 4XBEL 4PJDA 4YIQA 3PWJA 4G8EA 2P7TA 5JW5A 4ORGA 1SVZA 3MRFB 1UJ3A 4LLVA 3RY6C 4YPGB 4JHWL 3QXDA 4W81A 3KPQA 4TN9A 1SBBA 3WFHA 4HH9A 4FTVD 1H5BA 2VAAB 4L3EB 2VSCA 1QSEB 4FOMA 4IHOB 3KPTA 3MOBH 1DR9A 1EEUA 4R4NC 4FS0A 4DZ8A 3RVTC 3EYVA 4JHBA 1A6VH 1A0QH 2VLKE 4LLWA 2VXSL 3WUWB 2YPLD 2FEDC 1BZQK 4QY8B 3EFFA 3QIBD 1CK0L 2WWKO 3DETD 3OKLA 1PGRB 3KLAA 3MPCA 1VSCA 2X1PA 43C9A 5H37G 4GMTL 1YY8B 2NY5L 1LEIA 1X5HA 3ULVE 2XKSA 3C6SB 4YDVA 3BJLA 2FJFA 2J2ZA 4NQCB 4TSAH 5FAAA 4MQ7B 1KPUB 5HHOE 2XXCB 3MLSH 5KTEL 1OQOA 1RULH 1RHHA 4K7PH 1RIVH 3I50H 2YMXL 2WQ8A 3QUMB 4G6FB 1FNLA 4UTBL 5EO9B 2OQJA 4GS7C 3OJVC 1W0YT 2G5BB 5A3IC 3T09A 3BESR 5IGXL 5GRVL 1I85A 3ULUL 1AFVL 1ZS8B 2YD8A 3BJ91 3JSSA 4ELME 1R0AL 4MA8L 2DLFL 1JF1A 3CH1B 3OG6B 4J3UA 3WL9B 1UCBH 4JM2C 3L5WA 4HS3B 3TVMA 4QXUL 1ADQH 3TNNB 4NSKA 3QDGB 5I8KH 3U4BH 2GAZA 5D70L 2H6PB 1SMAA 4KGLA 3ARFC 3VMNA 5IG7B 1QVOB 3OR7B 4NUJB 3DI2B 4EXPX 3TBWB 1RJYB 5CZXD 1QLEH 5DSCA 3QUML 5I1KL 5KSVB 3O2VH 3T3ME 1S7VA 2UY7A 1MI5E 4O51B 4X7TB 1BECA 3BEWA 1GGIH 1Q0XL 4F7CA 4JN1H 4OKVB 1FNEA 2WQRA 1VERA 4KDWA 5DRWA 4JPIB 5F8QC 3RVVD 3O2DH 5TDPB 1Z2KA 1FE8H 1NFDA 1G1YA 4ZAKB 1VGEH 3BE1H 3M8OL 1A6WH 2IQ9L 3IFLH 1B6DA 5JIIA 3R4DA 2ICES 3PWNB 1EAPA 2C3WA 1K2DB 5A2FA 2I26N 2F19H 4FXKB 4K9EH 5EIQA 4QXGL 3IDXH 1S7RA 2XQBL 3IT8D 4YDKL 4JG1H 3VMOA 4DCQA 4L3EE 1QSEE 5IVOA 2OJEB 4OZHE 4M1GH 4E41B 1WWBX 3ARBD 5IMKA 3NCJH 4RFNC 3O6ML 4JKPH 3GSOA 5LAXB 5M95B 5DJ8B 1A7NH 35C8H 1NBVL 3O3EB 2L7JA 1DCLA 1PG7H 2X4SB 4PTUA 4RISH 1G6RA 5MI0B 3SDAC 2JJWA 2OJZH 3IJYA 1QLRB 4MXQD 5C0AA 4QLRA 4X98A 3EO1B 4ZPVB 4PJAE 1KFAH 5EZIH 4BKLB 2FSEA 3CFBB 2PYEB 4NQCE 1IMHC 4G8FB 1AKJD 2DDQL 3MLXL 3BP7A 3QDHA 3RNKB 3UX9B 4PY8I 4I9WD 2PXYC 3CK0H 3MRNA 1F90H 2QR0B 2R29L 4FQCL 4CVUA 5J1SC 4XVSL 3F7PC 4XRCB 3KVQA 5H94A 1ZLVK 2DQHL 4P59L 2BNRB 1E0OB 4JFPB 5EU4A 4QHMB 2D3VA 4ZTPL 1Z5LB 4AQOA 2VXTL 1F58H 3RWHA 1UADC 4XVJH 3TGXA 5C07D 3HLAB 4WO4D 2FCBA 3WD5H 2VITA 4R90H 1EUTA 3QDGE 4IBLT 2DQGL 4OLWH 4S0SD 4L9DA 3BN9D 2ICWI 4HJGB 3REVB 5DMIH 4M93C 1BWMA 2J4WL 1RUPH 3VGFA 2R0LL 5A16A 3OKMB 5C0BA 4MNHB 1D5XB 5EPMB 3RDTD 5DJCA 1U8KA 3PWPA 3U7AA 3W2DL 1S7TA 3UJJH 3FO0H 1P2CB 3FO1A 4O2EA 3VRLE 1RUAL 4Y4FD 2V5SA 1LE9A 4M7ZB 1OB1B 3EJYC 4HFUL 2NY2C 3G6JF 4KMTH 3UBXI 3Q3GA 2FATH 4ZUVA 5I1AB 3T77A 1JFQL 5TDOA 3HE6D 4KJYB 1U8NB 1JI1A 1U58A 4LLUA 3MJ8B 4I2XA 1PLGL 4IRSD 4J8RA 4NKQB 3D1MC 3LRHA 4D9LH 3HC3H 3BPNC 2R0KL 7CGTA 5C0IB 1PX4A 3MYZA 2M26A 3NZ8B 2R1XA 1NEZG 4E41E 2IBGA 1KEGL 4DN3H 4OJFH 4BQBA 4MA7H 3BYYA 4LPXA 1HHJB 4IMLB 2D7OA 5F9AC 2G60H 4PRBB 2WIIB 1KPVB 3FZUD 1YMMD 3RTQA 4G9FB 3IS0X 3ZSTA 3KPPA 2VDLL 4DVRL 1BZ9B 4U1JA 3B9KD 4OF7A 5D7JB 1I3RA 1S7SB 1AH1A 3AREA 3MGOB 3LAFA 3MMEA 2DL9A 5DA4A 1BEYL 1CIDA 4OCRL 2PO6B 3ZTJG 3AU1B 3FQTB 1I7TB 3H3PL 4G6JL 4YWGL 1NMAL 1MIML 3FT3A 5FDWA 2M8XA 1AE6L 3BMWA 5BV7C 5FEBA 1Z6JT 1MRFL 1I4FA 4KQ3L 3DX6B 3FOLB 2BNRE 2WINA 5B22A 4CRPA 1PVHA 1OP5H 3SDCA 1XF2A 3P73B 3CSYA 3V7AG 4XHJC 4FXGB 5BMFL 4X99A 2HJFA 3X11A 3E1F1 4MNQA 4ODHH 1UZ6E 5DD5H 5E99L 2DQCH 4JFFB 4R0LC 4W4NA 3EYFA 4UV7L 3EZJB 1NMBH 1MHPH 1T1ZA 1NLDH 2R0WH 1IC1A 4P5KA 1N5YL 5T3ZL 4MJ5A 4XP4H 1KCRL 4QCIB 1HOCA 1U6AL 3OKDA 5EA0H 5TQ0L 5K9KB 3O3AB 4M61B 5EUOF 2YC1A 5J4MA 4QTIL 2EC8A 4U33A 1KJ2A 2AXGB 3LY6A 5EFIA 2QSQA 5E8DL 4MAYC 2LTQC 5K33A 2ICCA 5C7XL 3RPIB 3TO4B 3GI8L 4IRJA 3LKSA 2JCCE 4HULB 3K4AA 4U6TA 1JZ3A 4PRPD 1R3HA 3QUKA 3WNLA 4GG6F 5FV2A 3WIFB 4Q9BA 2DWDA 3A0OA 1EJ6A 2ZJSL 1ZLSL 3SQOL 3O41B 4G6ML 4CAGA 1ZT1B 3LS5H 5KVFH 3CFDA 3CPLA 3U0WH 1GL4B 3CXDH 4G9FE 3QQNA 2VISB 1CD1A 5CSGA 1FH5L 4XMLH 4HBQA 5HYJB 1S7WA 1NSNL 2EIDA 4Q9QL 1BFVH 1F02I 2IPUG 2NY0D 1NAMA 2IPUK 2MWCA 3QHZH 1VFBA 3SHSA 4OCYH 1TLKA 2P4AB 4G7VL 3ZHKA 1RIUH 1JNHB 4MDIA 4PFEA 1H0DA 3WXVL 3AS0A 5DHVH 4OIIL 5EO0A 2DQFA 3VD4A 1JN6B 4IEFB 4HUWA 3PDOA 1XCTB 2QKIB 1E4WL 1MEXH 1VFAA 4KDTA 5IFAH 1HH6B 4TSBH 1T7VA 4YDJB 3TN0B 1UT9A 4MJID 3TJHD 5C09A 3ZTJH 3G5ZA 3V4UH 3GUTB 5E6IC 4ZXBD 4N9GA 4HZAA 4S1SH 1CR9H 4YO0B 4CUCA 4LGSB 1DQMH 2COQA 3CVHA 3D85D 4FFYH 4HIHA 3QQ3A 4E0RA 4MZ2A 4IJ3C 4RGND 3SE8L 1KACB 3IS1X 3MBXL 4JFFE 4OM0L 1A9BA 3M45A 2P42B 4JFDD 1S5HB 5EOTA 4WI3A 3VXUA 4KK9C 2ZUSA 2P8LB 4KRLB 4L5FL 3SPVB 5D1ZA 5EU3A 3QFDA 1XT5A 3JVGC 4NRXA 3CLEH 3RWDB 1VGKA 3D39B 1QKZH 2EE2A 2LVCA 4WHTA 4R2GD 5F6HJ 2YEZB 2VZOA 3DRTA 3FOMA 5H2BB 4WWID 4P2OA 3MXVL 1MWAH 2GW5A 5DQ9A 5E2VL 3ZT5A 5I1EL 1WCQA 1C7SA 3S3JA 4X9IA 5DFWH 4MJ6A 4JVWA 2ADIB 5FKAB 1F11A 3Q2CA 3KPRB 3VRIA 5GGSA 3AS1A 2F53D 3D48R 2EDNA 4OB5H 5BS0A 2K7QA 3TFKC 3ZYIA 4KMQA 1CGYA 3K2UH 5HVFB 1QTYT 4UT6L 3TO2A 5DEFA 3MO1B 3ROLB 5I6XB 4ZO6A 4ZQKA 1ZSDA 5JPNA 3FT4A 3GJFH 1DUZB 5HYJE 1TJGH 4IIQA 1VEOA 3FTGA 3L3DB 1L9MA 4JCMA 3DHJA 3NMEA 3WUWG 2IGFL 1YZZA 3I6KA 4J4PC 1NGYB 2NY3C 4MYWB 4PGBB 3V6ZA 3ARFB 4TTGA 5CMAA 3PWUB 5GRVK 4WEUD 1JPGB 3R06A 3O3BB 1G1CA 3HMWH 1EO5A 1MCOL 3N9GH 3RZWA 4FQXA 4X4XB 3BWAB 3B9DA 5BOPA 5C08A 1LO0H 5T1KA 4PJ7A 4R6UA 4G43B 2VB5A 1M7DB 5EU6A 1WAAF 1RJZB 3S36L 2H2SD 4CVXB 1XH3B 4WUUA 5ECJE 2APVA 3HB3C 5CZVL 3CFIC 3UTTB 5C0RH 5I1GL 2V9RA 1RV6X 4D2NA 3D2UD 1A6TA 1XIWD 2IALA 1I8IB 3ULVH 4OGAD 4XCFL 1G9ML 4TNVF 4WEBL 3HKFA 4XNYL 4Z6AT 1JZ2A 3TZVD 1JZ8A 3MXWH 1IQDB 3L7EA 3CIQA 3CFCH 5HHPA 4Q0XH 3CDCA 1YC7A 3F62A 3H0TA 5IVXE 3TCXA 3SCMC 3BDYL 1U95A 1WT5A 2NXYC 2NW3A 2A73A 1BOYA 3D39E 3MCLL 3E0GA 4O2FA 2X4UA 2OSLA 5IIEA 2ZUVA 1H5BC 4RQQB 2EXYD 1H8NA 12E8L 4OD2A 1ZANL 2ID5A 4OGXL 2NY7L 1I9IL 5ISZA 4N8VG 3RPKA 5BZDA 5SWZD 5TE4H 3RI5F 3BUYA 3GSXB 3KPRE 1LK2B 4AT6B 1CXHA 4LLQB 1AGEB 3EOBB 1B4JH 1GHFL 4HKZA 1K5NA 3OBAA 5D8JL 2PW2A 5C0EA 4MJ2A 4OZIA 5HJ3B 3QDMB 5D93C 1URLA 4NT6B 1PZ5B 25C8H 3A6CH 4JY5L 1O5DT 2H3NA 1KJ3H 4NIKB 1NKOA 2HLAB 1MF2H 4BUHA 1U8OB 1I1YA 5IV2B 4G9DB 5FB8A 4AMKL 3MQIA 4LCUA 3MFFB 3MRHA 2P1YA 5HGBA 1A6PA 4YHML 3TIDB 2UV3A 4PJEB 5K9QI 4JDZA 3O8XD 9CGTA 4LPUA 1EV2E 1YN7B 1KTKE 1NBYB 4ALAL 1I85C 4Y2DB 3I9GL 3QJHA 4MXVE 1T21A 1U41A 3TVMC 4MS8D 1FL6A 3KNBB 2FIKA 3U9PL 4FTVA 3WFCL 3UTTE 5DMYA 2OR9L 4FQQB 2DLFH 4TPRH 1WZKA 4YXHL 2EDJA 4NM4H 4FXLA 4QXUH 1BFOB 2NX5B 1MCLA 5GS1A 4HIJB 2YPLA 3Q48A 2Y7QB 3QIBA 3BPNB 3IJHA 3MLZH 1KTDA 1WIOA 1A6ZA 5C92A 4MMZC 1A7OL 3P3YA 3VFPB 1FFPA 4H26B 4EUPA 2A83B 3P9MB 3QUMH 4MWFB 4F33B 3KPOB 2ENYA 4KZDH 4YGVA 1Q0XH 4LLYB 3MYJB 2DLEA 3REWB 4J6RH 4KJWD 4PREB 1LD9A 4WI9A 3NCCB 3HPLA 3T2QA 3M8OH 1MHCA 2R69L 1F4HA 4WI4A 3UTSD 4LHJB 4PLOB 1GC1C 4PGCB 1KUMA 4DTGH 2VXUH 1XGQB 4NQDB 32C2A 2ADFL 3QAZB 1V3LA 2DJUA 5D1QB 5DQJB 3QDME 2ED8A 4RMWA 1CLYL 3O6MH 3RGVC 4QNPF 4N68A 3RX8A 2ZKHL 1UQSA 1A7QH 1OL0A 2JE8A 3D18A 1S78D 4CW1A 1OGTB 5IB4B 1QQDA 2C9AA 1WFTA 4XXCA 3W9DB 4PJEE 4XNUL 5J9PB 1T04A 5GS0D 4IS6A 4BH8A 4S11A 1UCTA 2APTA 1H15A 1YYLL 5L2KB 4JE4B 4TTDC 5CHNA 1ZVHA 4FQJL 4D9QE 3SE9L 5KW9L 3DHMA 2ZUQB 5ADPH 3MLXH 5E4EB 3VWJD 2A74B 2MQ0A 2WWMC 1IGIL 3RVUD 1NFIA 1OAKL 3MUZ1 4FFVD 4HGKC 2C5DC 4XVSH 4MDJA 3TESA 3NFPA 5DJ6A 4EDWH 1AQKL 1FDLH 5GGRY 3EHBC 4HF5L 4XP9H 1MJJA 5D6CB 3EKCA 4ZTPH 1AXSB 2JK5B 5KS9A 5I66B 2E6QA 3TV3H 2YD2A 1G9NL 1NC4D 3FQXA 4Z7QE 1UC6A 2LTQB 3BW9A 1UACL 3ARBA 4M1CC 2KL6A 5CUSL 3IRPX 1I1CA 1KNOB 1T03L 1T2QH 4XNMB 3BX7C 3JUZA 2HT3D 5E8NB 5BOZG 4JR9L 5HGHA 4YXLL 2ARWA 5MEND 2R0LH 1T1YB 3CDGA 1FCGA 5J7CC 1YEKL 4PRHB 3HCVB 4DVBA 5JPMB 4K94H 1DZBA 1T22A 2Z8VC 1HHHB 3QDJA 4KV5F 1RK0A 3MUJA 2ZG2A 5LGHH 1SYSB 1PYWB 1V05A 4FQIL 3PQYD 2WLZA 2KZ1B 4LAJH 1CXFA 2DD8L 3A6OA 4NKDB 4JKMA 5HDBE 3K80A 4ODUA 2DQIH 3C8HA 5DYOB 3IF1A 4N8CH 1DDHB 3QCVL 4ZFFB 2VE6A 2VZVA 2JJSA 3WSQL 1WBYA 2VLRD 4NQDE 1RZIA 4KY1L 2E7BA 3ISWA 4U0RB 3RTQC 5C07A 4MXWL 4WO4A 3S96B 2A6JA 5AYUL 1KC5H 4R97B 4XCEA 1EFXB 3L3JB 3RWIB 43CAA 3GRWA 2E3VA </