3LRSA

Structure of pg16, an antibody with broad and potent neutralization of hiv-1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
221
Chain Sequence
QEQLVESGGGVVQPGGSLRLSCLASGFTFHKYGMHWVRQAPGKGLEWVALISDDGMRKYHSDSMWGRVTISRDNSKNTLYLQFSSLKVEDTAMFFCAREAGGPYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PG-16 Heavy Chain Fab
publication title Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively neutralize HIV-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 221
sequence length 237
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrsA01
4F7EA 1XZ0B 4JDTL 4QRTA 4XVSH 4DUWA 2D7QA 4NWUL 5F7EL 2FZ3A 5JR1H 3SY0B 4MCYA 3ROOA 2YD3A 4P5MB 1FV1A 1F2XK 5TDNB 1XT5A 5IFAL 2ESVB 5I8CA 4PJAF 3RZWA 4HKBA 1V05A 1U3HD 4PGBA 3RVWC 3R0MA 3N9GL 3IDMA 4O5LH 1LE5A 3V4PH 3BPCB 2CKBB 1PG7L 2JB6B 1CIDA 1V7NL 2R0KH 1X5YA 5L6YL 3CLEH 3C6LC 1MRFH 3IXAA 4OZGF 5JORB 1CDHA 4M62L 4Z7NE 4QXTB 5CJOL 2XICA 2A0LC 4KAQL 4XCYA 3KPRB 2A2QT 5K59F 5BZDA 4GRMA 3CXDH 3QI9B 4P23B 4UT6H 5L2KA 2NY4D 5IMMB 2W9DH 2NY2D 3MUGB 3O2DH 4Y4FA 3JVGA 4YEFA 1MRDL 1M4KA 3UTOA 4WFHE 2UYLA 3GSQA 1WFTA 5A1AA 1MVUB 3OKNB 1GHFH 4K9EH 1XMWA 4PJ5D 4EI6A 3G9VA 1U8IA 3DUSB 2PETA 3GKZA 4RMWA 2DQIH 1EO8H 2J5LB 3PWLA 3WLWC 1NEZB 4KRLB 3EJZD 4DFIA 3MC0A 2DQFB 4NQSA 1FL5B 1XGRA 1KEML 3FB7B 1Q0XH 3ZYOA 4L8CA 4LHUD 5C2BL 4ZUTA 1DBJL 1RZ8A 2BHUA 1U95A 3MXVL 1A6AB 1GC1L 1J87A 1EFXA 4OKVB 4K71C 2EE2A 4YFLI 3GMLB 4TSBL 2C1PB 4OCRL 4EI5A 1C5BH 2XKUA 3C09B 5GSVB 2OZ4L 2XY1A 5C0AA 2VQTA 1UCBH 2EDDA 4OLZH 5DJZA 2VDQL 5HYSB 5IB2B 2YRZA 1IGIH 1WZ1H 3BH8A 3VFPA 1YYMH 5E2UL 3P9LA 1H8OA 2NYYC 1T1WA 1H5BB 3CXHJ 3JV0A 4MD4B 2YPVL 2JIXD 1OSZB 5EN2B 4F9PA 1GXEA 4NO5B 4MA7L 3F7YB 1OGAA 4MJ5A 5DMIH 1JFQH 1TTGA 5IM7B 5GRVL 2VZSA 4JFFE 4XNYH 1X44A 2FHCA 2X4OA 2VE6A 1X5ZA 3TZVB 1S7XA 4OGZA 3E6HB 3G5XA 3P3YA 1JMXA 1IGTA 1C5CH 3SDCB 3VWKB 1TVDA 5FYKD 3IETB 3BZFA 1UJ3C 5BRZE 2UWEF 4PRBA 3ABZA 1CICD 2A6JB 1A1OA 3LQAL 5C0IA 1FLRL 1U8PB 4WUUD 1MLCB 1RURH 5GGTL 4BSVB 2UUDH 4KJYB 4CADB 4OGYL 1I1AD 4YDVB 1UKSA 5KTEH 4D9QE 5FUZL 3OQ3B 5IVXE 1UZ8B 3NMEA 3HI5H 3GB7B 5BV7B 2D9QB 5ICXB 3CFJB 4F2MB 3MZGB 3SCMD 4K7PL 4AT6B 4RAUA 5LAXB 2CIIB 3OG6B 3BH9A 4I48B 2Q7NA 1FIGL 5HYJE 4OZHF 1CR9L 3X3FL 3CIQA 4HW6A 1JRHL 5D4QA 4QF1A 3BHBB 1EEZA 3M07A 2BSSB 3SE9L 5DJXA 3QIWB 3O3EB 1J11A 3U7YH 2H2SC 1Q72H 1JPST 1AFVH 1NDGA 2C3WA 4HS3B 4LLWA 1RUQL 1KG0B 4F7MA 5LJYH 3KJ6L 4HIEA 4JFFB 3W2DH 3ARBC 1AJ7L 4HX1A 2FL5B 3QUYC 1EJ6A 1YDPB 4XH2A 4LSDA 2VUYA 4KI1A 4N1EA 3HAEB 3IYLW 4JY4A 1I75A 3AC0A 1MFCH 3ZTNL 4P48A 2XWTA 3IJYB 4ZSOE 3MRFA 4HKXB 4HS8L 4FMFA 2YZ1A 5BRZB 2HMIC 4JEGB 12E8L 4KMTL 5CSZA 4PBVC 5DRWB 3AB0B 3QZWB 4K8RL 2NW3A 3U9UB 5DURB 1EZVX 5TFSL 3FRUA 3AM8A 4Y0GA 4YC2B 4OCWL 5FYKE 3WNPA 4E0RB 2QKIB 5IVXB 3B9DA 4U6YA 5EZOH 5AUMB 1A7PH 3GJFA 3QDMA 3AXLB 2NY0C 3DETC 4YXLL 1T7VA 4LLVB 1RJYA 1JGUH 1FC1A 2P4AB 4QRUB 1XGYH 5ANME 4P3DB 4U7MA 1AR2A 4JM4H 1R3HB 1LK3L 4NQTA 3OGCA 4HUKB 5BO1H 4QRSB 3BOVA 1NKRA 3R06A 4KVCH 4XP6H 5HYJB 2XTLA 1UM6H 2YWYA 1NQBA 4PG9B 3T04D 2Q20A 5DEFA 4NT6A 1G9NH 1ES0B 4MQTB 5MERA 5DJAB 1E4XI 3C08H 2BDNH 5DJ8B 3MJ7A 5DD5L 1UA6L 1UM5H 1A5FL 2HT4C 3KJ4C 3HE6D 5FAAA 2FLRT 3T1FB 4DAGH 3UTQB 4C58B 5C0DB 2APWA 4QHNB 1YMHA 1SM3H 4MNHA 1QFWL 1IEBB 4Y7MA 4Y88A 3Q3GA 1IILE 4ZSOB 1A3RH 1TJHH 3KHQA 1OTTC 3MLZH 4PJEE 3RVWD 1V3LA 3WFCH 3MRNB 1CGXA 3MRJA 5DVMA 1JN6A 5F97E 4LSPL 4G7VH 1T1ZB 4KTDL 4XAWH 1EEYA 2X4TA 1L6ZA 3DECA 5DWUL 4LSRH 4ENEC 5IHBA 1YEJL 3KWWA 3JV4A 1XGTA 1JNHA 1JV5B 4XC3H 4YHOH 1HINH 1DFBL 5D70L 1LO2H 2DQHH 4OCSL 2DWDB 5ANMB 4JM2A 1BPVA 1BQUA 2FD6L 4RWYL 2PTUA 3DV6A 2KZWA 5E2VL 5I8OH 3QCTH 2YR3A 3QCVH 4IS6A 1BX2B 3BRGC 1HHJA 3HZMA 4L4VE 4NGHL 1MSPA 1NGXA 3KPLB 3OKEB 1D6VL 1WVZA 1A4JB 2OMBA 1U8OA 3Q5TA 2Y25A 4GT7A 2ZUQC 4R2GB 3GSUA 3P9WB 1YECH 3WLBB 3GSWB 4JFXA 3PNWB 3MJ6A 3TM6A 1WWAX 4XPGH 5DJDB 5MEQB 4PLKC 1AD9A 5HHPB 3AS2A 3THML 5C9JA 4PJEB 3WKMH 1QLRB 3U6RB 3MXWH 4Z7WA 3RAJH 3OXRB 5EBGA 1FH5L 2AV1A 5D9SB 4QRPA 2F54A 3NA9L 2ICWJ 5TDPA 1IC5H 3FAWA 5D7KE 1JCKA 5CILH 5EUOF 1KXTB 3BP7B 4S1QL 4OUUA 4PGCA 3NAAH 2AS5M 3QHFH 1QBML 2GUOB 2NYYD 4D9RD 1U8KB 1P1ZA 4RGMB 5CAYB 2CJUH 5DJ0B 3NA4A 1CGTA 1CXEA 5FO8B 2Y7QB 4BFIB 4OI7A 1JPFB 3K4ZA 1OM3H 4G6JH 4EDWH 4L4VB 1RUKL 5AYUL 4C57C 3ZDYF 3ULVF 4OB5L 1VERA 5KVDL 5MHSD 2RGSA 2EDOA 3RP1A 3MLTA 3K2UH 5AYQA 2IH3A 5MENE 3OF6D 3NFNB 5EBLA 1I7TA 5HHOE 4LVOB 4OJFL 5I76A 3BXNA 1E4WL 4QTIH 1A6ZB 4JQIH 4OCLC 4PJIA 4X99B 2ENSA 4ZNCD 1HH9B 5HHVL 1MCHA 4WEMB 5BS0A 3MGOB 3HR5A 1P69B 2Y36H 1N7ML 5EB9A 3JWNC 4L8BB 1S8DA 1BBDL 1HDMA 3L95A 4UIKL 3ARFA 3AU1A 4P2OC 4L5FL 2ICWA 1CQYA 3KNBB 1RUPL 2DLFH 5HVWA 5EOCJ 1XGPB 5F7FA 1FPTH 2W0PA 1CLOH 5FKPA 4LFHG 1T7YA 2IF7A 4PJFE 4A6YL 5LWYL 4JDTH 3LQZA 1IM3B 1CE6B 4K94L 3B8YA 4FTVA 4KI5C 4NWUH 1U3HA 5F7EH 3P4LA 3PHOB 3MFFB 4YNYA 1NAML 2R1WA 1KEGL 5IJKA 3TN0D 4RGOL 4MAYC 3H3PH 3C6LB 3TNNA 2AJ3B 1YN7A 4XNXL 2X4RA 1IAII 1GGIL 1RZJC 3A67L 3FOLB 4OZ4A 5KSVB 1M6OB 2FDBP 4MNQE 4X83A 3IVKB 3N9GH 5CBAB 5JOFB 2QQQA 3SJVA 5IHUL 2BY3A 1PG7H 3PUCA 1V7NH 3RIFF 5L6YH 3LN5A 3T3PF 5MENB 5HHOB 3ES6B 4ISVB 5CJOH 4WO4C 2VLRE 1INQA 4KAQH 4YDIH 1KACB 1Q0YL 4M5YL 2QV2A 4LSQL 4PJ5A 3MGTA 2FWOA 2CLVB 1ZHBA 3WUZA 4RQQA 3DTXB 2AJSH 3SKJL 5B39B 4HBQA 1WT5A 2VLKA 5EO0B 3EO0B 3LSOB 1JK8A 5IMLA 3ARRA 3F7PC 1QLFA 2VERN 4S1SL 2GTWA 5HVGB 4PJFB 1TZHB 3BUYA 2WANA 3CCHB 4LHUA 3VXUE 3LKSA 5I8EA 1KLFA 1E6JH 4QWWD 1CFNB 2G5BA 4EN3A 4OLXH 2R9HC 4K71B 2PYFB 4M8VA 1KEMH 5HHNA 5IVOA 3LKRB 1F6AA 1CG9A 1RZIA 2H32B 4RNRA 5E6IC 1GGTA 4R4NC 4OQTH 3UTZA 1DBJH 4NHUB 5ICYB 4MNQB 4WW1B 1LVEA 2EC9T 3MXVH 35C8L 1BJ1H 1TLKA 1T89C 5GIRB 2BOBB 2DLTA 4NN5C 4WENB 2EXYD 1MUJB 3X17A 3EDKA 3H7BB 4JVPA 1S9VB 4OCRH 4OF7A 3BDBA 3QDGD 5IKCB 4MVBD 1R5VB 4FG6D 4OSUH 5JDJA 4XRCB 4BSWA 2Z91A 4NJAL 2VLRB 1NCUA 3IU4L 1FFNB 3GHEL 5FCUL 3VXME 3BESR 2R2BA 3HZVB 2H2PC 1D6EA 4KKBC 4ODXB 4OLEA 4RAHA 1FZJB 2MJWA 3IDGB 1D5MA 2X1XR 5IEKB 2QQLL 2YPVH 2V9QA 4ONFL 1VEMA 1UJ3B 2ITDA 3VFTB 4JLRA 1FAIH 1LDPL 4MMZC 4MA7H 5DYOA 5DC4B 3PWVA 3VXQA 2WLYA 1DLHA 3BGMA 5I6XC 5L0QC 1CICA 5A16A 5SWQA 1L9NA 1MJUH 5CEYA 4WUUA 4F57L 3IJSB 1KGCE 2YOCA 3VXUB 1I1AA 1RAMA 5DUBB 5IF0B 2P1YA 4N0UA 3RWIA 1IEHA 4HIIB 4QHKJ 1FLRH 3JUYA 5HGGS 5FGBA 1MVFA 4ETQA 5AEAA 5FUOL 1NDMA 1XF4A 5GGTH 3SCMA 2VABB 4PJGA 4W4OC 4NQCD 3V5DB 1B2WL 5AWNL 3L3JB 4RFNC 2XNAB 4MDIA 5FUZH 2J1KA 2AEQL 3O3DB 1URLA 1WFOA 3LIZH 3DIFB 2P8MB 3FB8A 3CH1A 3ROLB 4TYUA 2VQ1A 4H26B 3HA0A 1KPVB 3D87B 3D2UA 4URTB 4JRYD 3RVTC 4GG6E 2G9HB 3WSQL 2ZCKL 2FJFB 4PBWD 1P7KA 4C83A 3HLAB 2QHRL 1FIGH 2O5ZL 3ARBB 2VXTH 3WDIA 5T1LB 2NCMA 3QUYB 4HH9B 3VXMB 3X3FH 1JRHH 4CBPA 4EBQL 1T1XB 4X98B 3SE9H 5D5MF 1K6QL 5MP6H 3R8QA 2CK0L 2ICCA 2X4QB 4FQCL 1OTUC 2PW2A 2O93L 3U2SA 1RUQH 4K9EC 5A2KH 3KJ6H 1AJ7H 1Y18A 4TPRH 4OT1L 1B90A 2P24B 3BDYL 5IMKB 2WUCH 2A6KA 3SQOL 3ZTNH 3VXRD 2Y5EA 2LTQC 4HS8H 3PWPE 1ERNA 2NY0B 3IDJB 4KMTH 1A1NB 3E6FB 2VL5A 4X7DC 3VD5A 1NLBL 4K8RH 3RUGF 4HG4J 4NRXA 2WK2A 1RMFL 1DN2A 5TFSH 2Z9TA 2IG2L 5LGHL 5D6DC 5HYEA 4OCWH 5DC0A 2Q8AL 5IB5A 5J1AB 3QWOB 1DBKL 2ZG3A 4G6ML 4TSCL 3TPKA 4KZDL 4YAQB 2EDWA 4YXLH 4POZD 2RJMA 4HZLA 1GAFL 3GJEA 1CLYH 4BK4A 2OQJB 1C08A 2EC9U 2EE3A 5A40E 2LAGB 3DGGB 4PY7B 1LK3H 1MAML 4LLYA 2DDQL 1DANT 3ESUF 3F7VB 3FO0L 2EDJA 3MRCB 4QYOB 3KPSE 4JO1L 3MLPA 3HE6A 5FOBA 3VI3E 3GMMB 1DJSA 4NQUA 1AGDB 4P3CL 4MZ2A 1FNHA 1A6WL 3MLRL 4JG0H 4DKDC 5I19L 3WNLA 3TWCL 2IGFL 2JTDA 4J4PC 5IVNA 2IBZY 3BUTA 5CJ5A 1CGSL 4R97C 1EMTL 3H9HB 5DD5H 4GG8B 1DN0A 2X1WL 4CRPA 4O2CA 3ZT7A 1Z0MA 4JDVB 2B1HL 3MNVB 4TUKL 1CE1L 1DQDL 1W0YT 4XI5D 1MJ8L 5HYFA 2P7TB 1PZ5B 3O8XD 4V1DE 1JVKA 4HJ0C 3TVMD 3NCYP 2BCKB 4PGEA 1MFBL 2C3XA 5CZKA 1RIHL 3PWPB 4DOHE 5I0ZA 1AD0B 4XCNA 5IMOB 1NFDA 4ZAKA 4O2FB 4LCUA 4YR6B 2RFXB 1ZWIA 2XPGA 5KVFL 1MI5D 5MEOA 4OAWB 5DWUH 4BM7A 4KKLD 2CDFA 3FZUD 1YPZA 4PJXE 3HC0A 3QJFB 3QB7C 4U1GC 4P5TA 3G5VB 4KHXL 4DEPC 3KPPA 1AGCA 1F02I 2DLGA 1FFOB 1DFBH 2DWEA 3EO9H 1GSMA 3IFNL 3GFUA 4OCSH 1HHIB 3RIAF 5HY9B 1KN2L 2A9ML 4BKLA 5FYLE 3PHSA 4PV8B 3PIQB 3ZO0A 4CJ1A 2ZUQB 2O61A 4D2NA 5EU3A 2FD6H 4W4NA 1BD2A 3RVUD 3KPSB 1J10A 5LGJA 4X6FB 5D2LA 1AQKL 5E2VH 2VIRA 3GM8A 1FYTE 1YNLL 3VE0B 3PWNB 1B6UA 4NKMB 5FYJH 4MJ4A 1FVEB 2GAZB 4G5ZL 4PJHF 1D6VH 1A0QH 4O2EA 2OL3B 1T2QL 1FORL 2IAND 3RKDC 4TUJB 4I18C 3OKMA 1G6RH 4ZS7L 1F4WL 2HYMA 3LH2L 4PRHE 3RPIA 3ZKNC 4Y8AA 5DMKA 4DVRH 2BVTA 5ICZB 3U0WH 2IPKA 2IH1B 1MJ7H 4V1DB 4PJCE 3LZFL 4OBRA 4KI5E 3THMH 1IL1B 4Q6IC 1WSST 4GLRI 6CGTA 4J3OC 4XMLL 3QNYB 1WITA 2ADFL 4FXLA 1F5WA 3PL6C 4XNZC 2X89D 2ZCHH 3NA9H 2I24N 2P5WD 2QR0A 4FZ8H 2WMPA 4PJXB 4TUOA 1S78C 2XA8L 4QO1A 3BMWA 4XP9L 3U0TB 4CMMA 4S1QH 4Y2DD 4L9LC 4KV5F 4JZOA 1QBMH 1N0XL 2FGZA 4LLMA 4OCXH 2YBRA 4IJ3C 4EDXA 1E4XL 1V3JA 3OF6A 3SE3A 2ICWI 3BZDA 3QEQE 2GYSA 4M7JL 4NM4L 1FYTB 3RBSA 1OOAA 1QFOA 3K8MA 4JGUA 3IS1X 4G9FE 4N8VB 1RUKH 1DANU 4FFYL 5AYUH 5BJTA 4OB5H 5KVDH 5JO5B 4RISL 1B4JL 1KCRL 3KYOB 4OJFH 3D0LA 4PRHB 4P2OB 4OD1L 1E4WH 3S4SB 4R4FL 1VEOA 1LEKA 1OL0A 5HHVH 2GJ6D 2JJTA 4PJCB 1V5JA 5C0BE 5IOPA 4LP4A 2K7QA 1BBDH 4Y19D 1DEEA 1U91A 4ELMA 4L5FH 1U36A 5F88B 1RUPH 3ZLQC 2YEZA 1UWXK 1FO0L 2VAAA 3TN0A 1GOHA 3RNQB 4FNLL 1E4KC 4JQXA 2W60B 3IF1A 3CC5A 1ZA6A 4NNYB 4LLQA 3UYRL 3KXFE 1NC4B 1FL6A 2DL2A 4IOIB 1XF5A 4M7LT 2AGJL 4NPYB 1KEGH 1UWGL 3BRDA 3EKCA 4RGOH 3RWFA 4UU9A 3FT3A 3PV6A 1YPZF 4UT7L 4O02H 4WO4B 1S9WB 3QEQB 3EJYC 3EOBB 4M4PA 1E6OL 3X12B 3MUJA 4G9FB 3PWUA 5A2JH 1A7OH 1ETZB 5IHUH 3LEXB 2YN5A 3IJHB 1J0ZA 1MCFA 5K9QI 1EVTC 2VN4A 4YGVA 4WFFE 1ORSA 2EXWC 2AW2A 5DHVB 4KKNA 2E8ZA 1G7PB 3LRSA 4TNWK 1ZHKA 4JANB 1IGML 4LSQH 4FHBD 3SE4C 2DQDL 5C0BB 1I7UA 3SKUD 3ARYA 3EDDA 3SKJH 1Z9LA 2BZDA 2ITCA 4HEME 2I07A 5K9JL 5F3HA 4F7TA 4LCCC 2HRPL 4U2ZA 1DTUA 2AQ2A 2OP4H 3SGDH 5E6IB 1OWWA 4S1SH 1MY5A 4NBYB 1N6QH 2J6EL 1WBXA 4PBXA 5B38B 2FEDD 1CFQB 3WS6C 3KXFB 4MX7A 3FQTA 5B22A 2IPTL 5TF1H 3B9KD 3VH8G 1PGRB 3BIBX 4NN5B 2VLLB 3KPNB 4QXUL 4EVNB 2D3VA 4NZRL 3MJ8A 5JW4R 2XTJD 5F3BA 3FQNB 1IAIM 3QDGA 4X5LA 1JZ3A 3HS0B 1FL3A 4GXVL 3O2WL 1TTUA 2FGWL 35C8H 4S0TD 3BIKA 1YEGL 3FRPA 3S6CA 4YO0A 1XGUA 1ZVHA 5EU5A 5HYQB 2E6QA 3MLWL 1WWCA 2UUDK 3NCFB 5CJ8A 2PUQT 2N1KA 5C0RL 3UYPA 3GNMH 5I71C 5L0QB 5IVZB 5I6XB 1TJGL 1BMGA 1U93B 2J8UA 3WUWA 3PGFL 1C7TA 5D7LA 3GHEH 2IADA 5DUML 2KQMA 4N1CA 3G5ZB 2QQLH 43CAA 15C8L 4ONFH 5DZOA 2P8PB 3VMNA 3Q2CA 5DRNA 4E5XA 4NQVB 1I1YB 4KVNH 2VLME 1SJXA 3LOWA 5CFHA 1F3DH 1FG2B 4R7NB 4M1DL 1TCRA 2BVOB 1OAZL 1ACZA 1P5UA 4NQCA 3HC3L 4RFNB 4ZYKB 2CLZB 1IAIL 3GK8L 2FECI 4ZXBD 4PRAA 4U0RC 3B43A 3ZYIA 3ECBA 3HUJE 4PIRF 4ODTL 5E99H 2ZCLH 1YMMD 3T3ME 4DN3L 3OAYH 4CKVX 4TNVF 1RIVL 2JCCF 4JRYA 2ADIB 3QUZD 5CZXC 1B2WH 4I0CC 5AWNH 2VH5L 2AEQH 4JRWA 3EZ8A 1NMAL 5FUCC 5D8JL 4OQ1A 4PJ8D 4PJ7A 4OZFA 1OP5H 5F71A 1TVBA 3UZVB 3CK0L 4X5XB 4QHKI 5SWSA 2G60H 1W72A 5C86A 3WSQH 5D1XA 2ZCKH 5KN5B 3D6GA 4M43L 1MLBB 1XCTA 2QHRH 2O5ZH 3C2AH 3S5LB 3UJJL 4JRXE 2GJZB 4EBQH 3WFHA 1ZEAL 2MMXA 3PWJB 1K6QH 1CDUA 3O81A 4R6UA 4HXAL 4TTGA 5GQBA 4FQCH 2LTQB 1I3GL 4JZJC 1JPSL 3VXRA 1MOEA 3K8KA 4M00A 3L3IA 4LARH 2Z31C 3MRBB 4H1LA 5TQ0L 2M2DA 2BMKB 4OT1H 3RTQC 3BDYH 5E5MB 3MGAA 4NM8L 4OFPA 4QNPE 3HUJB 3BX7C 1HEZA 2HN7B 1IZKA 2OSLA 3CSYA 1CYGA 4K3GA 4PG2A 2IG2H 1J1PL 5LGHH 5T3XH 5BQ7B 4TRPL 1YEDB 3SDYL 2Q8AH 4MXWL 2RCSL 1DBKH 4G6MH 4TSCH 3SE8L 3V7MA 4KZDH 5C08D 5J9PB 1EHLH 3U4BL 4OM1H 4HWNA 4DZ8B 3BJ91 4M03A 1FZKA 8CGTA 1AI1L 3WNMA 4OBSA 5KBNC 1M1SA 1MAMH 3EO1B 1GZPB 2DDQH 3V6ZB 1BQLL 3F6IA 4WU7B 1RV6X 1SEBB 4JO1H 3OKYA 3FHQA 1UB6B 4JRXB 2DBLH 3GUTA 4XBEH 5DO2D 2VXUL 4Z76B 5ITBL 3MLRH 3NPSC 4QOKA 5CWSA 3TWCH 3TIEA 3TVMA 4PJDA 1YN6B 1ITBB 1CGSH 3LVEA 3CU1A 3DSNA 1S7QB 1EHNA 2B1HH 1RY7B 3IDXL 4TUKH 1CE1H 2DQTL 2Y07L 4U1NB 2L7JA 1MI5A 2W0FB 3GIZL 1DBML 4PGDA 4AIZA 2ED9A 5EUKB 5A2IH 4IEFB 4U1GB 1T66C 3MROB 4DEPB 1RIHH 3UMTA 4NJ9L 4D9LL 2XXMB 2MTPA 1RHHA 4HUUB 4Y5XA 4WFGD 2IBGA 2Y9RT 3HRPA 2XKSA 3HTLX 5GS2H 4OIIL 4MQSB 5C0JB 8FABB 2V7HB 4OD3L 4MWFA 4Y4HA 1U8HA 1R3JA 4GAJH 5GS0L 4M7KL 3WNKA 3ARSA 1QG3A 4KHXH 4P4RA 2R2EA 1CI5A 4OUOA 4X6DF 3HPLB 4LK4A 4PR5A 4I0KA 2R29L 5F1NA 3IFNH 4P9ML 4N68A 3MV7D 4XCEB 2A9MH 5LBSL 1Z9OA 1KPRB 4I18B 2IANA 1HQRB 1KFAH 3TFKD 1AQKH 2XI9A 4WU5A 3WHE1 1F90L 5KOVC 1FAKT 3ULVL 2DQJH 4GAYA 2XQYG 5DHYA 5C7XH 2W59A 2B1AH 4G5ZH 4YBHA 1EX0A 3EFFA 5IIEA 1FORH 4Q6IB 2X7LB 4ZS7H 1F4WH 3LH2H 4GH7B 1WFNA 3CVHB 5K33A 2B0SH 1KIUA 4XNZB 4X4YB 4TTDC 5EPMA 1R3IH 4I0PD 2XT1B 2GIYA 4L4TD 4H0GA 3LZFH 1MHCB 2P5WA 1N8ZA 2APVA 2HTKC 3G5YB 4N0CC 4Z7VE 3TO4C 5T1KD 4XMLH 4YHLH 1I3RB 4UQ2A 1UG9A 2ADFH 1A2YA 4PV9B 2IMNA 3DO3A 4TVPL 5EA0L 4PRPE 1I85A 3D39D 4IJ3B 4HCRA 1U8QB 3ZHKA 5HGBB 3WN5A 1U8LA 5EC1A 4E9LA 1LEGB 4K3DL 3ARDD 2A6IB 3L7FA 4OF0A 2WV3A 2CUHA 2XQBL 2AJZA 3F7RA 4XP9H 4G9DA 3HR6A 3M45A 5GZOD 1MCBA 3CSBA 4RMQA 4WTXA 1CZ8L 4ZFZA 4G3YL 3HZKA 3T2QA 1WGOA 1NANI 4IIQC 5E8PB 3OR6A 3DX7B 3CFIC 5HJ3A 5FV1L 3JWDL 4ZUVB 1JGEB 3MV7E 4DKFL 4FFYH 1BHGA 1N5AB 4N9GA 4XPTH 4RISH 5CIPH 3NCEB 1PQZB 1B4JH 4LOUD 3MRRA 5F1OB 2Q6WA 3SDXE 5IG7A 1KTDB 3SGJC 3HG1A 3NVQA 1D9KC 2VDLH 4R4FH 5EU6E 4E41A 1MQKL 2E27L 5BOPA 2D7NA 4M9OA 3QA3B 2P45B 1WBZB 4YDLC 5ESVA 1HIML 1JGDB 1YUHB 2ZSWA 1NBYB 4ZODA 3LKQB 5IBLD 4ZUSB 5J7CC 2CUIA 4Z7VB 3DX9B 3FCTA 5IUSA 2FEEI 3WHXB 2W65A 1Z9SA 1NCWL 1QEWB 3ARGD 4LSTL 3AROA 1HSBA 1FC2D 1W8OA 4GRWF 4PRPB 4FNLH 5DDHB 5T1MB 2HH0L 2K3TA 5KW9H 5T5FH 1SHMA 3SY0A 3UYRH 3ARQA 2AGJH 2RR3A 3H3BC 4EIZC 5HXMA 1UWGH 2HLFC 5FO9A 5KSAD 1FVCB 2B2XH 5E00A 1T7ZA 4YPJA 1ZS8A 2A1WL 2R0ZH 1J8HD 3BKCL 4UIMB 2L4OA 3ARXA 3MPCA 2XXCB 1EA9C 1BOGB 3JTSB 3LN4A 3RY5A 5HPMB 4LFHD 4ZNEE 3VGBA 1E6OH 1UYWL 1MHEB 3KLAB 3MV7B 2HFGL 4WI9A 3EFDH 3RVVC 5DVLA 1WEJL 1YEIL 5FFLA 3QXDA 4LEXL 3CZJA 4G8FA 4P2QD 5JORA 5GGRB 1EV2E 4P5KB 4Z0BL 4Q97A 5JHDE 3SDXB 5EU6B 4LCCB 2YRPA 4KZEL 5DRZA 3WHE0 4YHML 4K3JL 5E0QA 5CEZL 3H0TA 1QHOA 4YPGB 2IAMC 3MUGA 5DGQA 3VFSB 2HJLB 3ZE0F 4MZ3A 1R3KB 5BXFB 3I6LE 3NCJL 4MD5B 5D1QC 3B9KA 2Q1EA 5DSCA 3NIDE 2HRPH 3U1SL 3VXTB 4XBPB 4F33B 4NRZA 1T5XB 1OTSC 2J6EH 2QADC 1JWSB 3FFCE 1J5OH 1PKQE 2DQEH 4NO3B 4Y5VA 5FUCE 3TO2B 2B7DT 2IPTH 1HZHL 1FL5A 1H0DB 2JELL 4NQDD 4MB4A 3VXNB 2A74B 3REWB 3BYTA 1JWUA 4NZRH 3CLFL 3ULUF 3QCUL 1Z3GH 4MS8D 5I71B 1RD6A 5CZVL 4GXVH 1RVFL 3SDDC 1ODAA 1UCTA 3GMNB 2FGWH 3VA2C 2I60H 1L4IA 3BPNC 2GCYA 2R1XB 3FB5B 1LP9F 2FR4B 3H9SE 3MLWH 2GITB 3LCYA 1T0MB 2BHZA 4QHUB 5JHDB 3Q1SH 5HYSA 5IB2A 4JFHE 4PJBA 1FZMA 4UDUB 3BO8B 3RWEA 3VGDA 5EOQL 5DUMH 1N2RA 4UOJA 1A7QL 5CMAB 1I1FB 2J2ZA 2NY7L 4Z77B 4U0RB 3RZCC 4HAFA 4WHTB 3U7WL 5IM7A 1IAKA 2YA1A 4A2LA 2P42B 4M8QB 4P46C 2OR8A 1YMMA 3TZVA 3E6HA 3QQ3B 2EDRA 5DJ6A 2Q7YB 5ALCH 4ZD3L 3BSZH 5EOCL 3TT3L 3FFCB 3QUZA 3VWKA 1PKQB 2R2CA 1IAIH 3IETA 2FB4L 4X4XB 1SMOA 4NFBA 3GHBH 4XP1L 3MQIA 4FFVC 1MLCA 3LB6D 1T2XA 5IB1B 1X5AA 4BSVA 4LDEB 1T5WB 4KJYA 3KLHD 4L3ED 1I4FB 5F7MC 3UO1L 2Z93B 4C56D 4RZCB 4CDGC 1NMAH 2H26A 2OTWB 3DMMC 3TIDB 4X6BA 3QRGL 2Y06L 2I9TA 3J8F7 2UV3A 5C92A 3CK0H 5J06A 5HD8C 3H9SB 4KTEL 5JQ6L 4NBXB 4N90D 3U79A 3QFJE 4JZJB 3DXAD 4OLWH 3NCMA 4OCNC 2LV4A 1BQSA 4WRLA 4UI2A 4K8RD 1MREH 5CEXB 3TO4D 2Z31B 3UJJH 32C2B 5DQDH 4LGRB 4G8GD 4LHJB 3VFGL 1VDGA 3O3EA 3RTQB 4P2QB 2W1NA 3H42H 4NZUL 5JPNB 4NSKB 3QJHB 4HXAH 4HC1A 4JE4B 3MRDB 3C60C 1I3GH 2F5AL 4HS3A 1C5DA 1WIOA 1JPSH 1RZKL 2H45A 2NW2B 1QSED 5FB8A 1YDPA 4JZNB 5TQ0H 2ICES 3KLDA 4GAFB 1TNMA 3ARED 1UXWB 4U0QB 2D0HA 3BKYL 5BRZA 1IGYA 1C1EL 2ATKB 4U49A 1J0IA 2VDKL 2NXYD 3ZKXC 1VGKA 1A6UL 1BECA 4JKKA 1KYOJ 2P5EE 4DQOH 1YEKH 1J1PH 4TRPH 3SDYH 2DIJA 5GGVL 2YD5A 4E0RA 5AUMA 4YUEL 1I8IB 3SE8H 3B9AA 1KTRL 4ZFOL 4NQDB 3OB8A 4LLVA 2QSQA 3RI5K 1CGVA 4M61B 3T65B 3NPSB 3QFJB 2DL9A 3QXAB 4F15C 4GMSL 4J2XA 4QRSA 3G6JF 3QWRD 3WDJA 4M93C 1FN4A 1NL0L 1F11B 3TGXA 5JMOC 3VWJA 3O0RL 1ES0A 3FO2A 3EIFA 5ITBH 5DJAA 1F8TH 1JYXA 4Z7NF 2VO5A 3QQ4B 2FBOJ 1MIML 2R69L 1TCMA 4JN2B 5DT1H 2BNQD 4Q7DA 2FECL 2BXYA 4MMXC 3O6LL 4M6OL 1FJ1A 4HBCH 3VFOB 3NCYS 4QHNA 2DQTH 4DW2H 4WW2A 2Y07H 3GSOA 1YEEL 1QFPA 4HT1L 1OAYL 3GIZH 1DBMH 4ZSOA 5FO7A 5H94B 1X5KA 5E8OB 3MRNA 2MFNA 1LEIA 4P9HH 4D9LH 5IFHL 3DRTB 3KPTA 5FK9A 1I8LA 3RVVD 1UC6A 5DMGC 5A3ID 3BQUD 5AZ2L 1OT2A 2ADJA 4OIIH 4NCDA 1EXUB 5GRZA 4OD3H 4YHPA 3DBXA 5EIVA 5GS0H 3TH2T 4M7KH 2IQ9L 5KOMC 1JV5A 3VRIB 1XFPA 4IDJL 1VGEL 4P9MH 1U6AL 4BH8B 5LBSH 4C56B 4PYHA 2I26N 4K7FB 3E3QC 2CKNA 4G42B 3VD9A 3GJFH 4FXGA 2WBJA 1F90H 5CP7B 3SKNB 1AP2A 3PHQA 3KPLA 3OKEA 4X7TB 1A4JA 4U6HB 1KPUA 1CFVL 1WISA 3MRPB 4L4TA 4ERSL 2AXJA 2WWMC 5D7SL 3UTPD 5J6GB 1G1YA 3TO4B 5I0DA 5T1KA 3MCKA 3KYKH 1SVCP 2RHEA 4HUXB 4FFZL 1QO3A 2Q86A 4LCWE 1KNOB 2D0GA 3D39A 3WJLA 5I1EL 1IM9B 1P4IH 3TH3T 3BZEB 5DRXB 4OZIA 1QSEB 4PJEA 3ARDA 1QLRA 2BNRE 4I1NB 3I3EA 4J23A 5DK3A 1G7QB 5B3NA 2WBKA 4NQEE 1MWAA 1IC4L 5EBMA 4UB0H 5D9SA 3P4NB 1N26A 5EA0H 5FECB 4UDTA 2FIRT 2OMNA 1BQHA 1HOCA 3T77A 3HB3D 1DQMH 4J6RH 4K3DH 4KDVA 4X5WB 4IIQB 5FYJE 4HK3N 3NIGE 3BP7A 4RCAA 4WI4A 5KS9A 5B4MD 5DVKA 2F9BT 4ZPVB 1L9MA 1U8KA 4Y4KC 2HT3D 2IFGA 4WWKD 4TULH 5F89B 4G3YH 2LU3A 5IVXF 5FO8A 4I9WE 2BOCB 1JPFA 1D9KB 3STBA 1JI2A 3JWDH 3OKLB 2VXVL 4C4KO 4L4VA 4YDLB 1TITA 4DKFH 2FX9L 1LE9B 2K7PA 3GMOB 1ULVA 3V7AG 1MIEH 4LU5H 4XTRC 1BVLB 3MJGX 4IMKA 4MJID 4NKOB 4PRDA 5CSBA 4B7LA 1K3ZA 4X99A 1I9IL 2E27H 2MPAL 2AXGA 2L7UA 4N0RA 3D25B 1HIMH 5ID0B 3EDEA 2HWZL 4LCWB 4PRNB 5LVEA 4CW1B 3BW9B 2YSSB 3DO7B 4L8BA 3H6JA 4DWHA 3QDJE 2ZUXA 1KIPA 3D18A 1RHFA 1ZVSB 2BNRB 4NUGL 4OCYL 5I1AA 3DMMD 5C0NC 1HKLL 2H8PB 5DQJB 5HGDA 3KNBA 4NQEB 2DQUL 1SY6A 5GS1C 1NCWH 4NKIL 1B4RA 4LSTH 4XVUD 4ONHA 5KSAA 4XVTL 1R5IB 2EYTA 3O6FC 4NKDB 2F8OA 2R1YB 1DP0A 1CD9B 1CE6A 1J8HA 2HH0H 3KYMB 4JKPL 2F8XC 1LO3L 2KUTA 2V2WB 4NO0A 3PHOA 3HI1A 2E9IA 2EECA 1CCZA 1HHGB 5JMRA 3BQUB 5JXEC 1G6RB 2AJ3A 5CJXC 5H35B 3O41B 3D0VB 1T1YA 3QFDA 1T21B 4FRWA 1U41A 5DD1L 1IFHL 4JQVC 5HI4D 5IV2B 5CBAA 1WQVT 3GSNL 1A6TB 3OPZL 3W0WD 1UYWH 2HFGH 3STLA 2D7OA 2FBJL 1CDCA 3LV3B 1DSFL 2IAMB 4GW4A 1WEJH 1YEIH 3BGAA 4LEXH 4Q2ZB 3ES6A 4F8TA 2EYRB 4Z0BH 4CVXB 3ARPA 5D1QB 1TZIA 3MYJA 1K5NB 2EE6A 5IROA 5C07E 4WUKL 4YHMH 1N59B 3M17B 4K3JH 1N64L 5CEZH 1MJJA 2QADB 3OKKB 4KUCD 2OZ4A 4ZOAA 4ODSL 3DTXA 3T08A 3DNKA 3QDJB 4OD2A 3WJJC 3LSOA 3NCJH 4JAMA 1CXFA 3U1SH 4U1HB 3NTCL 4M1CC 4HULB 1FFPB 3BN9C 3KR3L 4XPAL 3SDDB 3KAAA 2Z8VC 3UBXB 1HZHH 3S35L 3BPNB 1KJ2L 2PYFA 4KK5D 4HH8A 2JELH 3S3SA 4AM0A 3WMSA 1VFBB 5CD5D 2VITA 1RUAH 3CLFH 4RFEB 3QCUH 4LHUG 5IW6B 4ZDHB 5K9QG 5D1ZC 1QOKA 4MQ7B 4MNQA 2A73A 2RBLA 2NTSP 5MEPB 1ZGLM 5GIRA 2LVEA 5E2TL 4U1KA 5FGSA 1MUJA 2EIDA 2YA0A 2DMBA 3OAYK 3OTTA 1H3VA 4WWKB 1D5BA 4GW5A 3RVXC 3MO1A 1M71B 3RZCB 4LL9A 4M5ZL 4POUB 2AEPL 4KK9C 4P46B 4YXHL 1FFNA 2F53D 4WNQB 5C07B 1JNNL 2FEEL 5EOQH 5KSBE 3HZVA 1RZ7L 4CVZA 4PRID 1A7QH 2CLRA 2PO6C 4NDMB 1OP5K 4YX2H 4Y16D 3CFCH 1PYWB 1XF2B 5IEKA 2W92A 2VISB 2WWKT 4YHZL 1EZVY 4MJIB 4IRZL 4N5UA 4HWZA 3X14A 1R5WB 4ODWB 2NX5E 3DYPA 5BZWB 3TPUA 4CU6A 1GPOL 4UINL 1SYVB 3VD7A 5HDOA 1I9EA 4PPTA 1ADQL 3V6BR 1Y6NR 3NIFE 4ZD3H 3TT3H 5FA4B 3FOMB 5C0EB 2Q8BH 3DMMB 2FB4H 4IRJD 1CVRA 4F9LC 2R56L 3WL9B 4XP1H 5T5NF 5GZNC 2WNGA 1V8HA 5K9OA 3CFBB 4AEIL 2VABA 3P73B 3UCRA 4Z7QE 1GH7A 4BUGA 5HI5D 5IEHA 4NOFA 2XNAA 3DXAA 1BZ7B 3CVIL 5AD0A 3L5JA 2A83A 2EEBA 3C5JB 2IMMA 4D0BB 3V95A 4JKLA 5DQ9A 1OB1A 3QRGH 1IC1A 2Y06H 4LPTA 3RHWK 2Z92A 4G8GA 4MDJA 4KTEH 5JQ6H 1CF8L 2G9HA 3C60B 1UVQA 1BZ9A 4CAGA 1YEFH 4JO4L 1GCFA 3ARBA 1HI6B 5T1LA 2ZUWA 5TPWH 3K46A 1OCWH 3QUYA 2AXFB 5KSBB 1NFIB 3CDCA 3BWAB 5FHBL 2Y6SD 1A47A 2NZ9C 1PY9A 4KRNA 4NZUH 4U7KA 5HDQL 4K2UH 4NNXA 4FQXC 2F5AH 4EZMA 1RZKH 1RJLA 4GUPB 2NX5B 1VADA 5E4EC 3QO0B 1ZT7A 4AZ8A 5HGHA 3ZKXB 4O51A 4XPHH 1S5HA 4PB0L 2P24A 5ALBH 5IMKA 3DURB 3KPOA 3BKYH 4LIQL 3T8XA 1EAPB 3WCYA 1CU4L 3Q6FA 4LNRB 3AAZB 3OHXA 5E24E 3M8OL 2YD7A 3I75A 2VDKH 5EFIB 3QPQD 4NIKB 4ZUWA 4RDQG 4LF3B 1GL4B 4PJFF 1ZT1B 3RDTD 4F15B 2KDGA 1T80A 5J1AA 3E3QE 3W11C 4LKCB 1LO0L 3CMGA 4UV4L 3QXVA 4YAQA 4YUEH 5D7IE 1AGBA 4L3CA 4GBXC 4M6AA 5DFVC 1LNUB 43C9B 4GG6A 1WBYA 2X4PB 4X9GA 5HI3C 4GMSH 1NGWB 4HUVB 5ENWA 2ZUTA 3MRCA 3UTTD 4WFEE 3O6KL 5DJYA 5DJCB 2BNQA 4XZUA 2WAHA 4ORGB 5I1HH 3EYOB 5GS2D 1X7QA 3VH8B 3O0RH 5F8RC 5H2BB 4XAKE 5EC2B 2BSED 3QBTB 1MIMH 1HSAB 1CXKA 2R69H 3GDBA 4QRRD 4HDIB 3O6LH 4M6OH 4JDVA 1AHWA 4PRIB 2RB8A 1DQLL 5T3XE 1S5IL 2BSTB 4Y4FC 5HGAB 1U8MB 2P7TA 4ELKA 3IS0X 5C09E 3RU8H 1A9BB 4HT1H 4IHOB 3LD8C 4GQPH 2DLHA 1PDKA 3HRZB 1KOAA 1AD0A 1VSCA 4O2FA 2JK5A 5DS8B 4YR6A 2YK1L 4HXBH 3VJ6B 3STZA 5E9DD 4I4WA 3TJHC 4XXDB 4LSSL 5AZ2H 2G2RA 1KTLB 4ZO9A 5C6TL 5D7IB 1DQQA 2IQ9H 4N0FA 4IDJH 1FFOA 1XR8B 4D8PB 4H8WH 3ZKMD 4NN7C 3FQWA 1VGEH 5T33H 1QQDA 4PV8A 3CSGA 1FLTX 3F12B 4JFOA 3KPSA 5ESAB 2YMXL 3OJVC 2OR9L 3NN8B 3PWNA 4EI5C 3QHTC 4NKMA 3U30C 3QIUC 1FVEA 5IB3B 1MPAL 2GJJA 3DARA 2WW8A 3UTSE 2OL3A 3M1BB 3VFNB 4DVBB 4HGWA 4FP8L 1P4BH 3I3BA 4KMQA 4DKAA 4TUJA 5LKNA 5E4IA 3CMOL 2BXZA 3K1DA 3R1GH 3QIBD 2XKNB 1GRWA 3ME0A 3D3VE 1AGFA 2C1OB 1BVKB 3LKOB 1OAKL 1WCBA 1X9QA 2DQGL 2XQYK 4DKEL 2IH1A 2WUBL 5C09B 4FFZH 2BX5A 1OAUH 1M7IB 4JFDE 4YDKL 4XHQA 4RMRA 5GGUA 3GIVA 3MRIA 1VACB 5T3ZL 4LLDA 2H6PB 4MNGB 2YD1A 2F58L 5BW7C 1ED3B 4Y4KB 3PDDA 4KDTA 3MOBL 1XAUA 2AEIT 3KVQA 2YUWA 5ADPH 1JIBA 5HHQB 3T2NL 2HFEB 3F58L 1KB5L 2DB8A 2PR4H 1A6PA 3ISWA 4JGMA 2Y1VA 2NY5L 2NY6D 1ZXQA 3RWCB 1C16B 4RX4A 4X9IA 5I1LB 4A6YA 4M3KB 1FGVL 1JZ7A 4YJZL 5IJVA 3L3OB 3B2VL 1NAMA 5CS7A 1FGNH 1FYTA 3FJTA 4YFDB 1XH3B 4N8VA 3L1OL 2FX9H 1UWEL 4DUXA 2Z35B 3UTSB 3RX7A 5JOPD 5IK3B 1OWRM 5ITFA 1Q9KB 4P2OA 2HVKB 4OGXL 5I30L 1NLDH 5GS1B 3D3VB 3LS5H 1H3PL 2BVPB 4X7SH 1I9IH 1IEAB 2UVEA 3O6FB 4HWBA 5HHME 4HEPG 2HWZH 1RPQA 1QSZA 3K4DA 4JFDB 4U1MB 4LPVA 4P9HC 4NUGH 1PSKL 4OCYH 2DQUH 4MAYA 4UT9L 5KVMC 4ZPTA 3HPJB 2AK4D 1K8DA 3P11L 1K8IA 2VWEC 4XB7A 2W60A 1HHHB 4JKPH 1LO3H 2ZKHL 3AM8C 1NC2B 3GSRB 3TV3L 4M7LH 4YBQD 3SO5A 2AV7A 4JKMA 3EOAB 4NYLB 4HCRL 3ULUL 2DIAA 2YPLE 3DUHA 4R96A 4Z5RB 3MA7A 1WJ3A 4KK8D 3BAEL 1MF2L 5I73B 1S9WA 3QEQA 3ZTJG 3SPVA 4CU7A 4GKZB 1NUFA 1XEDA 1WTGT 3KDMB 4WY7L 5ACZB 2FBJH 1DSFH 4Z6AT 5I9QC 2EH8H 2NY1D 3OR7B 3RWDA 3VI3F 1KUMA 2IFFL 2ZOLB 4OF8A 5JPMB 5I17A 1N64H 3L3DA 1D7FA 5HHMB 1ZHLA 2LAAA 4JN1L 2K1MA 5I8KL 4ODSH 2V5SA 3S37X 1KT2B 3Q5YA 2MSPA 4PTTA 3CPLB 3IRZA 1AY1L 3WIFB 3TYFA 4KRMB 2ZZUT 1AQDB 3NTCH 2P43B 4X7FC 1CQKA 1ZLUK 5E94B 3TA3D 3K3QA 1XF3A 4HKJB 4LPWA 5DR5L 3VXSE 5TQ2L 3KR3H 3EYQC 1RI8A 3INUH 4FN0A 3FQXA 1NANH 3DYMA 5BOZG 2BSRA 3S35H 1F3RB 5I15L 5JZ7D 5ETUB 2VZOA 1IKNC 4PP1D 4XBGB 2YPLB 1S7RA 2D31B 1QP1A 1V3MA 3KPQB 2ZPKL 3ZTJH 1S9YA 2P47B 4PJXF 1JF5A 4ONGL 2X70B 5D2NA 4QHMB 5FHAL 1Z6JT 3BD4A 4JM2C 3UPRA 1JHLL 1CXIA 3IAPA 7FABL 5L2KD 4LHQB 2PO6B 4KGJA 4WDIA 5EBWA 3T4AA 3V9FA 3MRLA 4AENA 4KPHH 5L88L 3MUY1 4Y16A 3DLQR 4IOFD 3MNWA 2AEPH 5IVZA 4YXHH 2CKBL 2E7LC 2ZOKB 3FRPG 1OW0A 3CSPA 1CT8B 3OJDA 1RZ7H 4G7YH 1KLUB 3HC4L 4P2RE 1CN4A 5L2JB 2J5LC 4IRZH 4IRSD 3WEXA 2FJHB 5FA3B 1I1YA 4IRJA 4LAQL 3WUWG 3FONA 1AR1D 3L5XH 1OPGL 2X4UB 4HAGA 1NGYA 4R7NA 3EDFA 3DI2B 1T22A 3GKWL 3LKNA 4ZMAT 4PJCF 2DJUA 1ADQH 2ZWLT 3OB0H 3G04A 4Y1AE 3CAFA 4K3EL 4KI5F 4ZYKA 3VXSB 2CLZA 5DEGB 3HCVA 1EFXD 2AJYL 2FATL 4S2SB 1ACYL 2FSEB 4DGIL 5C9KA 5DD6B 4RFOL 2R56H 3MLSH 1OSPL 3VRJB 2AK4B 4GJTB 1U8JB 4RIRB 4S1DC 1BGXL 1I3VA 4HFWA 4DCQA 3C09C 4AEIH 1X6NA 2ADIA 3FFDB 4LEOB 1HWHB 4H25B 1GOFA 3CVIH 1WWBX 3WFEL 3L3GA 2YKLL 4Z7UA 1A1MB 5CGYD 4M7ZC 4LKXB 1HCFX 4FQ2H 2V7NB 3E0GA 1QRND 3QHZL 2OI9C 1OGAD 1CF8H 1JF6A 4JPIA 3DVNA 4FQXB 3UXFA 4AJ0A 4JO4H 4UQ3A 2MHAB 5E4EB 5MI0C 3S5LA 2RQ8A 5L2KE 4JPVL 4OZFG 2GJZA 1IQWH 3O9WD 3O2VL 4ZTPL 3WS3A 5JIPA 3FTGA 5FHBH 4P2RB 3W82A 1HILB 3P40A 2BY0A 1YC8A 1C8PA 2QLVB 2HT2D 4F7EB 4QRTB 2AAVA 4JFED 2GSGB 1NBVH 4MCYB 4PB0H 5D6DA 5E5MA 4X0KA 4Y1AB 3U4AA 3I9GL 1PG7X 1FV1B 1W2KT 4GKSB 1WUNT 4APQD 5DJ2B 3CXHK 1CU4H 3HUJA 5E1AA 3OGOE 1FNLA 5I8CB 4F3FA 4GBXB 3H9YA 4HKBB 1GGBL 1EFQA 3T1WA 1P7QB 4H1LG 2ARJA 7CGTA 2GY7B 3IDMB 1U3HC 3WIHL 5EDXA 1LE5B 5BQ7A 4HK0A 3EOTL 1YEDA 2VDNH 1NGZA 2CIKA 4UV4H 5IJKC 2P48B 2V6HA 4POYA 1ONQA 3IXAB 5J9PA 5IW1B 2R8SL 3NZ8A 3QR2A 1QNZL 3P77A 1TXKA 1YNTB 2ERJC 5C0AE 4DZ8A 3CDGB 1DDHA 3T0XA 5B21A 3B5HA 4J4PA 3P4OB 3DJ9A 2ZUYA 5BZDB 4GRMB 3VXOA 3V6ZA 4WU7A 5BV7L 4OZFH 3O6KH 3DVFA 2YUZA 1YC7A 5L2KB 4GAGL 4JRXA 1MELA 1RU9L 2NY4C 4Y4FB 2NY2C 1FBIH 4Z76A 1W72H 1H3TA 1RZFH 3GSQB 1HE7A 3N06B 3TH4T 3RKPA 3LD8B 1YN6A 5GS0D 1CL7H 4EI6B 4AEFA 1U8IB 3GJFK 4XGZA 2BVUA 1S7QA 4QRQA 5J56B 2K9UA 1DQLH 1MHPL 1S5IH 4U1NA 3JTTB 4GMTH 1WT5C 4KTYA 3PWLB 1M7DA 4HC1L 5D72H 1KELH 4NQSB 3H2WA 3QDMD 4WGVB 3EJZC 1XGRB 1NUGA 2UZIL 3P30L 4Q74A 2W9EL 4L8CB 4XNQA 2DYPD 3G6DL 3ULVD 4PJ9D 2JJUA 1YQVL 3DROA 4H1LH 4LRNH 3SDAD 4RSVA 3QUXD 4DK6A 4NN7B 1U95B 3BVNB 2NNAA 4LSSH 8FABA 1VFUA 2CDGA 4OLYH 4UBDD 5KVEH 1FRGL 2ILLA 4EI5B 2DM4A 3HPLA 3VMPA 3U30B 1MH5B 3QIUB 4LCIL 3IDUA 5C0AB 3ZE2F 4S10A 4OFYD 4TQEL 4XCEA 1ORQA 3BH8B 1KPRA 3KYNA 1L0YA 3EHBD 3P9LB 4I18A 1T1WB 1HQRA 2YMXH 1KLGA 2HVJA 4XHJD 4Z78B 3P0VL 2OR9H 1D5ZB 3QIBA 3RWJA 4TVPD 2WIIA 4YBLC 1ND0A 4PJAA 4M48L 5F7DA 1OGAB 4MJ5B 4R7DA 5IQ9A 1FG9C 1MPAH 4RRPA 3V5KB 5T1DL 5GJTL 1V7ML 2X4OB 2VE6B 3JWOC 1T03L 2C5DC 4FP8H 4Q6IA 1S7XB 3G5XB 1IGTB 3CMOH 5ISZD 4JO3L 3CVHA 1G9MC 2QSCL 4L29A 3PL6A 3B8SA 4UTAL 1OAKH 3BZFB 2DQGH 2VWEE 3IT8D 4PRBB 2WUBH 4KRPD 1A1OB 3FO9A 5C0IB 3OG4B 4AL8L 1CICC 1K4DB 3UEZA 4K7PX 4YDKH 1X5HA 1ZT4A 3G5YA 4H88L 2IJ0C 1SMAA 1I3RA 4L9LA 4ZG1A 1DBAL 1WAAF 4TSAL 3I6KA 1I1AC 4PV9A 1UH3A 1ZK9A 4GRWH 5C1MB 4G8EA 1X5LA 4TNWF 2B4CC 2COQA 3WV0A 1U8QA 5HGBA 1GOGA 1LEGA 3T2NH 4YZFE 4MAUL 3SCMC 3T0ED 2ZJSL 3T3MF 1FO0A 3BH9B 4R3SA 1H3WM 1BFVL 4H0HB 1FGVH 3DX8B 1J05B 4QF1B 2ED7A 1EEZB 5LCVH 4KJWD 4WHDA 5DJXB 3B2VH 4KC3B 5GHWL 5ID1A 1F13A 1XCQB 1QBAA 5KJRL 1NDGB 1G7HB 4YEEA 4JHZA 3G6AB 4FQ1L 4B41A 3BT2L 1UWEH 1BF2A 4XH2B 1FCGA 2EIEA 5LG1A 1LO5A 3ELAT 4JY4B 3Q6GH 4OGXH 1CLCA 5I30H 3QEHA 3KS0H 4QRPD 5CHNA 4LLUA 3X13A 1NBZA 1MCWM 4WTZA 3OWEA 1WBZA 3MV8D 1E4KA 5FM4A 1DQTA 1K4CB 5CSZB 5F1KC 2NW3B 4S1RH 3FRUB 3EJJX 2EZ0D 1KJ3L 2R0WL 4UT9H 5I1GL 2Z4QA 4PRPA 5BMFH 3GJFB 2KPNA 1RJYB 4HS6A 5T1MA 1B0RA 2X05A 4QNPF 2O5YL 4GSDL 4RGND 4QKXB 4RAVA 1QBLL 3UJIL 1MWAL 2ZKHH 4H8WC 1TPXC 2EICA 3QXTA 5CEZD 5HDBE 3TV3H 2C3VB 2PKDA 3OGCB 4HLZG 4OLUL 5DC9B 1FNAA 1FVCA 1AKJD 1N0LA 3I02A 3R06B 5DA0B 1A3QA 1L6XA 2A6DB 1WF5A 4XX1G 5I9QB 4HCRH 3ULUH 5J1SC 4UIMA 2UWEA 5DEFB 3BAEH 4PLNC 4NT6B 4GQ9H 1MF2H 2HJKB 3N1MC 1JPGB 3JTSA 5MERB 3IAQA 1EERB 3KLAA 3MREB 3MJ7B 1Y0LB 1NKOA 1BAFL 1QHPA 3EUUA 4AIOA 3HE6C 3ARFD 5E1HB 1VHPA 3CFEA 2VZ3A 1YMHB 3B2UD 3MLYL 4MNHB 4XCCL 1HH6A 4PREA 3Q3GB 4LCCA 3FAXA 4KHTH 5F9OL 2IFFH 1I1RA 3LPFA 2DJ4A 2DQCL 3GRWA 4J3TA 4FTVD 4NKQB 1JN6B 4Z7WE 2YWZA 3C87A 1IAMA 3EGSA 3TA3A 2HJLA 3G6JE 4OZHA 5I8KH 4PLJD 4X80L 1R3KA 2P8LA 2W07A 2Y5TA 2X4TB 2F54E 1CD1A 4MD5A 1I1CA 3KWWB 1GIGL 3JV4B 5IR1B 4F33A 1XGTB 1JNHB 3MUHL 3X11B 1L7TL 4WI6A 2J8HA 3F65A 4NO3A 1I9JL 2PCPB 5TQ2H 3SJVD 1HN1A 4JM2B 5EZIL 5JNYB 5EOTA 1SY6L 4HLZH 3EYUL 1T4KA 1P9MA 3V7AE 1H0DA 3KLSA 3DV6B 1AO7E 1P5VA 5I15H 2VAJA 2A74A 2EDTA 5I1JL 1ZLSL 2FRGP 3HZYA 2XN9D 1KSRA 3D85D 2ZPKH 1NGXB 4ONGH 1ZHNA 3NOIA 2HFFA 1MCPL 4XMKL 5FHAH 3TBSA 1JHLH 1U8OB 7FABH 2E3VA 1NGQL 5I75C 3W9DA 2FR4A 4MB5A 2VLKD 5L88H 3LS4L 1UM4L 5FF6B 3CUPA 2GFBA 3HKFA 1F4YL 5BS0E 1X5GA 4IRSA 2VTFA 3EZJB 1XIWD 5F96L 1CTOA 1AD9B 2XA3A 5C9JB 1AXTH 4J3XA 4OI9A 4U6VL 3HC4H 4KJPD 3EDJA 2D4FA 4Q9CA 1B3JA 4Z7WB 3WE6B 3G6JB 2HTLD 4EN3D 2AV1B 3C9NA 2EDBA 1OGTA 2F54B 5HYSG 2PYED 2IEPA 4LAQH 1HXMA 2F74A 2XRAH 1OPGH 5CKGA 1L0QA 2DOCA 3VD3A 4PUBL 5GRJL 4OUUB 3I50L 4PGCB 4Z0XA 4JJ5A 5I74C 3MRKA 4K3EH 1PKQA 1SVZA 1J0JA 4Z7VF 2FATH 1ACYH 3L5WB 4DGIH 4M7ZB 4RFOH 1KN4L 1OSPH 4MXVE 4ACPA 2NLJA 4W81A 2QSVA 1AO7B 5IB1A 1RUMH 1T6WA 2OI9B 2X42A 3UJTH 1QRNA 5F1IA 1T83C 4L1HA 5MI0B 3QUMB 1UQSA 2OTWA 3MNZB 3TIDA 4NFDA 2IH3B 1I9RL 1K2DA 1N4XH 5EBLB 1I7TB 2BP3A 5I76B 3O9WA 3BXNB 1CFSA 3SE3C 4AMKH 3QHZH 3L3HB 4JZJA 3UDWC 3DRQB 4NFCA 1FNEA 5BS0B 3PG2A 2DM2A 3HR5B 4PJ5E 5CEXA 2Z31A 2YN3A 4JPVH 4KKCD 4JFEA 1S8DB 1RULL 1HDMB 1LGVA 3L95B 3VI4F 2OK0L 3AU1B 4PLOB 1F4XH 2ICWB 2NY3D 4HPOH 5FDYA 5FKPB 3SDXF 4HJJL 2BVYA 4APQA 3UROR 5FOJA 3LQZB 3MBED 2XG4A 1U3HB 1FE8L 3W9EA 4YNYB 3B4NA 4I3SL 3I9GH 2Q76A 3HNSH 3TN0C 1YN7B 2F5BL 3D2UD 5D7JD 2X4RB 1NCNA 4OZ4B 1F6LL 2ERJB 1F00I 4PGZA 4CVUA 1IC7L 1QTYT 4N0YL 3EOTH 2XZQL 3MRHA 1KJMB 3JV5A 4HHAA 1I8IA 3LN5B 2NY4B 4MB3A 2AKRA 5I16A 2NY2B 2FX7L 1QNZH 3T65A 5CBEA 3QNZB 2QQKL 1MFEL 3QFJA 3BP4B 4HJGA 4JY6B 2C4FT 5EUOA 1BM3H 4PJ5B 3V6FA 5BV7H 3MGTB 4YH6A 1LWRA 2JB5L 2FWOB 4MXQD 1ZHBB 4GAGH 1QFWM 4RQQB 5EWIL 1TZGH 5TE6L 2APTA 2B8OT 1JK8B 2QQNH 4KK6D 1QLFB 4WUUE 3AFLA 5C6PB 2DYPA 2HJFA 4LHUB 4PJ9A 3SDAA 5I8EB 1MHPH 1MQ8A 3QUXA 4PP2A 1P84J 2UY6A 3QPXL 1BIIA 2EYSA 4HC1H 4QWWC 4N0UE 1YNKL 2UZIH 3P30H 5HHNB 1F6AB 1CG9B 1RZIB 5H94A 2W9EH 4RNRB 1EHXA 2D9CA 3S9DB 3G6DH 2GK0A 3NIDF 1YQVH 4NZTL 3PP3H 1NGPH 3UTZB 4HIXL 4H20L 1OLLA 4OFYA 2P5EA 2QJDA 5E7BA 3TBWA 1CDIA 4HQQL 3V5HA 3HI6L 5JW5A 2EXYC 1FRGH 4YBLB 1U8NA 4P0DA 2JIXB 3LEVL 4BSWB 2Z91B 2E5EA 3EYFB 4MVBC 4FG6C 1E0OB 4YK4C 3S34L 1RFDL 5ADOL 2UZYB 2R2BB 3HMXA 4G42A 4HG4K 1D5MB 5SX4H 4JPWL 1F3JB 3P0VH 5ISZA 5CP7A 3SKNA 3DWTA 5HSFA 2ITDB 2F19L 1Q9LB 4QT5B 2XZCH 4NNPH 4M48H 3PWVB 3VXQB 1DLHB 1CICB 3MRPA 4X9FA 5A16B 1V7MH 5SWQB 4WUUB 4ZAKD 1R3LB 3GBNL 4KH2A 1T03H 4JDZB 2VDPL 5DGRA 3S37H 3TP4A 3S36L 5GISL 4JO3H 3RNKA 1I1AB 2QSCH 3PGDA 3V4UL 4UTAH 1OHQA 2NY3B 4N0UB 4P5TD 3RWIB 1KNOA 2E9BA 2A9NL 1F42A 1JHTB 5I18L 3PE9A 5DRXA 4ODUA 1NDMB 3SCMB 4H88H 2YPKA 4X7EC 1G7QA 3BEWA 4LAJH 3T0EA 1DBAH 4HWUA 4TSAH 3T4YA 3VFMB 2GSIA 3MRQA 1T0NA 1BD2D 3VG0L 5KVGL 4NUJB 3CH1B 4YIQA 1U58A 3D2UB 4NOBA 2KBGA 3DV4B 1X4XA 4MAUH 3T0AA 3IDIA 2ZJSH 3O4OC 3OKOA 3PJSA 1AIFB 1P7KB 4BH7B 4C83B 2E6JA 4JB9L 3REVA 2YS4A 1BFVH 5DK2B 1Z9MA 2VLJD 1BQHG 5F89A 4KROD 4Y5YA 3MLUL 4YWGH 4P49A 3SGJA 5GHWH 2CSPA 1XF1A 2VSDA 4FQQA 2NPLX 2KKQA 4LP5A 5KJRH 1JZ8A 2C4FU 4O58H 2PW2B 4N5ED 4R90L 3U2SB 4FXKA 3NFPA 4EQ3A 3MV8A 4FQ1H 4EOWL 3BT2H 3FQRA 4CN1A 1Y18B 1JPTL 2R0LL 4LSUL 1BBJB 2A6KB 4UTBH 2X4SA 4G6KH 1N5YL 2JF1A 2PW1A 2OL3L 4G43A 3P4MB 2VL5B 1NFDE 1ZLVH 1RSFA 3VGEA 4NRXB 1A14L 1TPXB 3QAZC 3MBXL 2FJGB 1KJ3H 3ZHDA 5IB5B 1KCUL 5I1GH 1AKJA 4ORZC 1AH1A 4HZLB 4TVSa 2CUMA 3DVGA 4R0LA 4POZC 2O5YH 4WEBL 1C08B 2M8XA 1A6VL 1MWAH 4HGKC 1DVFD 1VCAA 3ZKQD 3TBYA 1HHGA 3HE7D 5C0FA 4G8IA 1PG7W 3AY4C 2I9LB 2XWBB 3HE6B 5IESL 3O41A 5FOBB 3LMJL 4P3WA 4OF3A 4GRLD 4NRYB 1HHKA 1A8JH 1IGJB 3RJQB 2J88L 3AGVA 1A22B 3F5WA 1A6TA 2PTTA 4WV1A 2PNDA 3FN0L 5FYLL 2GEEA 1DN0B 1MCSA 1BAFH 4O2CB 1MCQA 3TBTB 1Q9OA 4Q2ZA 5IFJA 3A6CL 1INEL 3MLYH 4KDWA 4XCCH 4XI5C 1K5NA 1JUFA 3P9MB 5E03A 5KAQG 5IFAH 3O8XC 1QYGL 3N1QC 4FQJL 3TVMC 3TNMB 5AZEL 3OZ9L 2ICEA 5E8EA 3EYVA 4XCNB 1UADC 1NFDB 3PQYD 3GBML 5JA9A 3IFPA 3SBWA 2XPGB 3LEYL 3QDJA 1L0XA 4X80H 5EIQA 5E8DL 4D9RE 5MEOB 3V6OC 5D5MA 2CDFB 4L8DA 4KKLC 4HWBL 4U1HA 3HC0B 1K3IA 3FZUC 3KPPB 4M62H 1AGCB 2DWEB 2XN9A 3D85A 5CJQL 4YHIB 1CDBA 1I9JH 4OFDA 1G7IA 3SDDA 4BKLB 4Y5XC 5EZIH 3MSPA 3UBXA 5MHSE 3V8CA 1SY6H 3G08A 5F7WC 3C5ZD 2O61B 3EYUH 5EU3B 5I75B 5SWZD 5LGJB 3DHMA 1C12B 2VIRB 1RZJL 3RVUC 1GJIA 4FABL 3OXSB 3QUKA 1MRDH 3B6SA 4JFQA 1KCVL 3OB0K 4MQ7A 1IMHC 5H37G 4Q0XL 1MCPH 1R24B 3RUGA 1G0YR 4U6XA 3MV11 4LPYA 1XIWA 3TT1L 3C8KA 1NGQH 3CDYA 3OKMB 4U1IA 1P6FA 3RPIB 3V0VB 1CD8A 1MCRA 1L7IL 3D69A 5DLML 3RWHA 3RZCA 1KCSL 2W91A 4OIBA 2DAVA 2X9YA 2IPKB 1F4YH 5E2WL 2AJXL 4P46A 1WTLA 2PYEA 4KUZL 5C07A 4XP5L 5F96H 4NWTL 1QR1B 5ESQA 1H15B 2AERT 2ZG2A 4NDMA 5C2BH 4AQOA 4ZO8A 1OQXA 5I74B 3VXPA 3RI5F 2HLAA 1GC1H 5GSRB 3BD3A 3KGRA 5BZWA 3RL2B 5FGRA 4BFEA 5JW4Q 4TUOB 4WHYG 4TSBH 4L3AA 2OZ4H 3QNXA 4PUBH 2VDQH 4JZOB 4Y2DC 1MNUL 2VDRL 5E2UH 4JGJA 4LLMB 4X7CC 3R0NA 2YBRB 1EDQA 1I85C 1KN4H 4EDXB 3WN5C 1NCDL 1DUYB 1QBBA 2C26A 5HYIA 1OARL 1OAXL 5H37H 3J7HA 5D7LD 3T0VA 2X6MA 5GRUL 3NIGF 1B0GA 4J3UA 4Z8FL 3D0LB 1VPOL 2BJML 5K93A 1LEKB 3QULB 2MWCA 1PX3A 5DK0B 3ET9F 3LQAH 4ZFOA 5JXAL 5AG9A 1HI6A 3VW3L 3W5MA 5IOPB 2APXA 5KSBA 2WM0A 4OGYH 3MBEA 1RULH 1U91B 3BWAA 2A38A 2R4SL 4ELMB 2OK0H 2DN7A 2YC1B 2YEZB 4YXKL 5INCA 3TN0B 4GUPA 4HJJH 1Z2KA 3W39A 1PEWA 3IF1B 3CC5B 3I85A 3RGVD 1ZA6B 4WHYH 4XVSL 5D7JA 5TGBB 4K7PH 2V2XB 4PJHA 4MLIA 5JR1L 4LLQB 1FL6B 4F58L 1XF5B 4I8DA 5F6IC 2BC4A 1CR9H 2XACC 4Y2OA 4YGAB 3RWFB 1ZA3A 4UU9B 4PGJA 2GT9A 2F5BH 5SWSD 2DTML 5I1DA 1BF8A 3PV6B 2EKJA 5J6HB 5EFIA 3QDGE 5D1XD 2LU4A 4LF3A 1BFOA 4JFPA 3GI8L 2XYCA 3V4PL 1IC7H 1UH2A 2AABL 1S7WA 3PWUB 2R0KL 5C8JB 3TYGL 2O5XL 3ILQD 4X8XA 4YGVB 5FYJU 2FX7H 3SGKC 1HYSD 1XGQA 2QQKH 43C9A 2OXGA 1JMZA 2J8UE 5FV2A 1UKTA 5D7LE 2OJZL 12E8H 1ZHKB 2HP4A 5HTSA 4HUVA 2VDML 4UT6L 2FNBA 5DJCA 3VU2A 3MTRA 2JLLA 1I7UB 2DTSA 4CL7A 4JG1L 2FHFA 4D0DB 2ITCB 4P4KA 5TE6H 4E42B 5H2BA 4F7TB 4CN6A 4K9EL 3FB6A 1HSAA 4DJMA 1WBXB 3ARWA 4NQCE 4ZUUA 1Q94A 3AS1A 3OAZH 3VDBA 2BSTA 2FEDC 4MX7B 3FQTB 1U2HA 3QPXH 4O00A 4NC1C 2PXYD 3B9KC 1I7ZA 1X5JA 1KIRB 3OKDA 1YNKH 4KWUA 3CFKA 3SKOA 2NTFA 5JA8B 2EDXA 4JRYE 1RJZA 3MJ8B 2CO6B 5F3BB 1U2CA 4NZTH 5DS8A 1UEYA 3QDGB 1FL3B 2XTJC 4Y5VC 4YK4B 4HIXH 5CLWA 4H20H 4PJ7E 1M05B 3WFZA 1UA6H 1A5FH 1SJHA 4U6TA 4YO0B 1XGUB 4UNVA 4HQQH 3MV9D 3ZDXF 5D7IA 1VEPA 3QH3A 4CJ0A 1C5BL 5I1IL 3V0WL 1QFWH 4ZFGL 4D8PA 1UXSA 4QOKD 1UCBL 3LEVH 1CK0L 3WUWB 2J8UB 3S34H 5D7LB 5IBTL 2IADB 1CFTA 2VB5A 3F12A 1YY9D 5T3ZD 4L1DA 3CJJA 4NZDA 3UX9B 4LSPH 2HA1A 2JJSA 3NN8A 3VGGA 4JPWH 43CAB 4KTDH 5E2JA 1DR9A 1S7VB 3VXRE 2F19H 5IB3A 5DMIL 4CDHA 4E5XB 2IALA 1YEJH 1VFOA 4ODVL 4XNYL 4N1HB 4DVBA 2WINA 2Z8WC 2X09A 5DTFA 4D0CA 3GBNH 5C0CD 1TCRB 2VDPH 3SO3C 5D70H 2VDOL 2XKNA 3LKPA 2BVQA 4NQCB 4G6AD 5GISH 5KSBF 3LKOA 4MD0A 3U7AA 3ECBB 4RWYH 4Y4HD 4ZXBC 5DD0L 5EZJA 2A9NH 2GTZB 3O4OB 4JRYB 4JPKL 4W6WB 3CFDA 4NGHH 2H6PA 3D1MC 3RWGA 3QUZC 4F7CA 1N6VA 4IOSD 3HI5L 3NIFF 4PJ7B 5E8NA 4OZFB 3VG0H 5KVGH 5C71A 2ZUVA 4PJ8C 1TVBB 3TEUA 4Z7OF 1O5DT 2VLJA 2HFEA 2HKHL 2OXHA 1W72B 4WGWB 1WC7A 3N0PB 1XCTB 2QHLA 4JB9H 4Z7QF 3WFHB 2W38A 3MLUH 4I3GA 4LQFL 3U7YL 1FH5H 1KIQB 1XH3A 1HXYA 1AFVL 4PJDE 3VXRB 3GBLA 5INDB 3E2HC 4G6FD 5B8CA 2Z35A 3UTSA 4ZQKA 5IK3A 3L3IB 3DX6A 4H1LB 3QAZB 1JPTH 3V6OE 3GSNA 1FNGA 3O4LD 3NH7L 2R0LH 4LSUH 2L0DA 4U1SA 1MI5E 3O3AB 4N8VG 3ULUD 5DFTA 1N5YH 5I1KL 3O6FA 2OL3H 1EO5A 1JWMA 5F7YC 1T20A 1PFCA 5CUSL 2OSLB 1G9NC 3CSYB 1BJ8A 2KH2B 4FS0A 3CVHL 3R4DA 3MBXH 4WJ5A 2BRRL 1DVFA 4BZ1L 4BFBD 4HKZA 1KJVB 5JXEA 3HE7A 5CJXA 5GGSA 3H8NA 1G7LB 1HHHA 1MFDL 1JGUL 1U92B 3OSKA 4PB9L 5EIIA 2LABA 4GRLA 3QO1A 4WEBH 4JM4L 1FZKB 3L7EA 3T09A 5FDWA 1J1OL 3GSRA 2ZSVA 4AIXA 5BO1L 3ULSA 2OTUA 2APBA 1N7MH 2IANE 1UM6L 1FVDA 3BMVA 4MCZA 1UFUA 3VGHA 5ERWB 4PD4J 3LMJH 5J3HD 3HG1D 4UIKH 4E41D 4YFEA 3LY6A 2YD8A 5D7IF 5DO2C 5L7XL 3O8XB 1KJ2A 1MCCA 4QOKB 1G6VK 1ZSDA 5CWSB 3TVMB 4PJDB 4AH2A 2JCCA 5LWYH 4A6YH 3FN0H 3IGAA 5IB4A 4DAGL 3ALXA 1DUZA 4K94H 3PQYA 2V5YA 3UBXI 1SM3L 1NAMH 1U3ZA 1INEH 5GJSL 3VWJC 4O4YL 1MI5B 4PGDB 4AIZB 2FO1A 2P5WE 1QYGH 4XNXH 5JPMA 3OL2A 4FQJH 3ZE1E 5AZEH 5HBBA 1GGIH 3A67H 3OZ9H 3GBMH 1UACL 4G7VL 2VXSL 1RHHB 3LDBC 3LEYH 4Y5XB 5E7FA 4WW2C 1X5XA 3KPMA 4LSRL 5E8DH 2MCG1 1DCLA 2ESVD 4XCFL 3C5ZA 4WI5A 4HWBH 2X4NA 4MWFB 5LQBL 1AQDA 2R15A 5SWZA 3T0BA 4XC3L 4P4RB 2R2EB 3GMRB 4PR5B 2CPCA 4H0IA 5D1ZA 4HKJA 1LO2L 1W0VB 3EW3B 1IQDA 2LFGA 4BUHA 4B53A 1Q0YH 4M5YH 3ZSTA 1D5XA 4JHBA 3ETBF 3N85L 2IANB 1ADQA 5JIKA 1JE6A 4WU5B 1RZJH 4UNTA 5CLTA 4FABH 2G75A 3TFKC 3QQ9D 3KPRD 1W0WA 2LVCA 3FO1B 2EIBA 5DZNA 1Z5LA 1VKXB 1KCVH 5DHYB 2X70A 1LD9B 3P0YL 4QHMA 4P23D 2GJ6E 1ZGLA 3JV6B 4Q0XH 5CD3A 3FT2B 3EFFB 2PO6A 2IQAA 5IHZB 4Y19E 3LPWA 5DVOA 1L7IH 3UAJD 2XWJA 5DLMH 1KCSH 1QR4A 3CGTA 3A0OA 2DKMA 2YD6A 5E2WH 4I0PC 3ZE2E 4XP5H 2P5WB 4NWTH 2WBWB 5FKAB 1FZOA 1N8ZB 3WKML 3MXWL 3BPOC 4XWOD 4UQ2B 5L2JA 5DHVH 1H3XA 4Y2DB 1A2YB 3O3UN 2AI0L 3MMEA 4F9LA 3U4EB 4MJ2A 2FJHA 4XX1E 5FA3A 4OGAD 1Q9WA 5EULV 2Q87A 1FSKC 1IC5L 3WN5B 3ZDZE 5EC1B 1O7VA 2X4UA 3GRWL 3L7FB 1RK0A 2C9AA 3CX5J 2C7UA 2AJZB 3ARDC 3SGDI 4NJAH 4WEUD 5DEGA 3IU4H 4NO2B 3IDNA 1X3DA 2VDRH 5FCUH 4ZFFA 2AP2A 5GZOC 3RX5A 5H8DA 4ZFZB 3WO3B 1QSFA 1U8JA 4MA3A 1NCDH 1F58L 3FQUA 2FX8L 3OR6B 1OM3L 2XFXA 5HJ3B 1KC5L 4G6JL 1LDPH 5DI8B 1OARH 1OAXH 3KG5A 4OFIA 4MJ6A 2GJ6B 5GRUH 4N9GB 1A1MA 1WAAE 4F57H 4MSWB 5TH2A 2FH6A 3MRRB 4Z8FH 2Q6WB 4LOUC 4Y19B 4Q58C 5IG7B 4WFHD 5I2IA 1VPOH 1YEHL 4XNMA 4FQXA 5F8QC 4X6DA 2Y36L 2ZSWB 3TZVD 3BEVA 5JXAH 4RBPH 1I3UA 3VW3H 5FUOH 2R23A 5DD3L 3RGVA 5JDSB 5IBLC 3SDCD 3VWKD 3TBVA 4YDJA 4NC1E 1OP3H 3FCTB 4IMKC 5F6IB 2W65B 4MQXD 3TJEL 2DLFL 3E8UL 1MAJA 1X4YA 1HSBB 3ARGC 3BP6A 4UOW1 1QVOB 3S5LG 3VCLA 2XTJE 2GSGA 3NACL 4F58H 1EGJA 4Y1AA 2EEDA 1G7MB 4GKSA 1V3KA 5FO9B 1H9VA 3H3PL 5DJ2A 5E00B 1E27A 3S97C 5KSAC 1ZS8B 4GBXA 2CK0H 2DTMH 1IJ9A 1P7QA 1G1CA 1JBJA 3LN4B 3VRLE 1VENA 3GI8H 3MZTA 2AABH 2WWKO 4F7PA 3TYGH 2O5XH 2RIKA 1IRAY 3QIWD 3QXDB 4G8FB 5BCAA 5IW1A 5IW3A 3VFVB 1YNTA 3PP3K 3CDGA 3SQOH 3ILPB 4LBEB 4YDIL 4PJBE 1UWXH 1A9EB 3P4OA 2X5PA 3JZ7A 4JFFD 5DRZB 2OJZH 4X4MA 4RA3A 3H0TB 1XR9A 1NLBH 2VDMH 4LASL 1WFUA 2AJSL 1RMFH 1CXLA 4JG1H 3VD4A 1GC1C 2VR5A 5BRZD 3B9KB 1A7NL 5DSCB 5IROC 2PXYA 1AC0A 1U9KA 3K0WA 1TFHA 4UMGA 1YMME 4GW1A 4XNUL 4ZS6D 4NRZB 1MCIA 5DURD 1GAFH 4RMSA 4EQ2A 3ZSSA 4HPYL 3Q48A 2XTJB 4P2CG 4Y5VB 1E6JL 4JY5L 5ACMA 3JTTA 3SKMA 4D9QD 4XT1C 3U0PB 3BP5A 5K9KB 4LCYA 3FO0H 4OLXL 1P2CA 1VFAB 3MV9A 1YYLL 1JWUB 3LN9A 4H5SA 4OQTL 4P3CH 1SQ2N 1A6WH 4QTHA 1DE4B 4BK5A 3FN9A 3AVEA 1BOYA 5I19H 2IGFH 4MS8C 4FQHA 5HYJD 3BVNA 4PTUA 1EMTH 4CNIA 3R8BB 1DQJA 5GS3A 2GCYB 3VWJD 1DQDH 5I1IH 1MJ8H 4L8SA 3V0WH 1MH5A 3QIUA 3SHSA 3S7GA 2R2HB 4OSUL 4ZFGH 1RQ5A 4U1JA 3SGEI 1JYNA 5EG6C 1CK0H 4PJBB 4KY1L 4DFHA 3LQAC 1MFBH 3V0AC 1ITCA 1FZMB 3PABB 3RWEB 3GSXA 4YE4L 5IBTH 1N2RB 1KB5A 4KJQD 3SO3B 5C0CA 2FIKA 1AXIB 1X4ZA 1KYOK 4Z78A 1D5ZA 5KVFH 3FN3A 3GMQA 3RY4A 4GKNB 1FAIL 5DMJB 1IAKB 4ZXBB 1TQCC 4LPXA 4ODVH 1QLEL 3V5KA 2CR6A 1MJUL 1YMMB 3RL1B 5DJ6B 4F8QA 2XY2A 3CZFB 2VDOH 3QUZB 3CDFA 1KN2H 5BW7A 1PY4A 2G5RA 4ZO7A 4X9HA 4RRPG 5C08E 4PJ8B 4WI3A 5DD0H 5EO9A 1GZQB 1K4DA 2RAMA 1CGUA 1YNLH 3OBAA 5ECJE 3LB6C 3JUZA 4JPKH 1MCLA 3KLHC 4UOW0 2H26B 3LIZL 1T2QH 2VZTA 1QPPA 2FHBA 2NR6D 4X6BB 2I9TB 1JI1A 2WBJD 2HKHH 1ZLVK 1BLNA 4XWGL 3VFWA 3LRGA 1EVUA 3QQNA 1CDYA 3E2HB 2X2YA 4R2GD 4JFYA 2VXTL 4IMLB 2EKSB 3DX8A 1J05A 4Z95L 4K8RC 1PEZA 5MP6L 1EBAA 1NJ9A 4LQFH 2X40A 1XCQA 1KCKA 3O4LA 4OF6A 4X8JA 1C5DB 1KULA 2AEWA 5LGKA 1G7HA 1T7XA 5L8KB 3G6AA 4X9BA 2MQ3A 3BKML 5E5RB 2XA8H 3C5SA 3HMXL 4YHKL 5FB8B 2W0LA 2OJEB 4TPRL 5ILTL 4EUPA 4HUWA 2VR4A 4WFGE 2WUCL 3NH7H 3IDYC 3C8HA 1N0XH 1LP9A 4KU1A 1N3NB 3AREC 4HIHB 5I1KH 1IGYB 1E4XH 1K4CA 1YA5A 5C08B 4P57A 3QRFM 3L6FA 5CUSH 1NCBL 1VGKB 4M7JH 4NM4H 2QEJA 2NXYC 1IE5A 3CVHH 3VFRB 1SJVA 2BRRH 3VI4E 4BZ1H 4WTZG 1KCRH 4RMUA 1AGEA 1MFDH 1S7SA 4OD1H 1CLYL 3O45A 1J18A 4PB9H 4L4VD 3MRMA 1U42A 2JE8A 2ED8A 5LXGL 4LVEA 3CU7A 1J1OH 2KZ1B 1QFHA 2C3VA 1R6VA 2V2TA 1A21A 2A6DA 3ALWA 1FQ9C 1FN4B 3GSVA 3QP3A 2E9JA 4KKAD 1S7TA 2HJKA 3VWJB 1S7UA 1JPGA 3FO2B 2M1KA 2CDEA 1I8KA 5L7XH 4JG0L 3AMLA 1FO0H 4L4TE 3MREA 1T0PB 2LU7A 1XZ0A 3HNVL 1Y0LA 3MJ9A 1QPXA 1FJ1B 3V52L 4LRIA 2DICA 3LDBB 1KB9J 2MQ0A 4WW2B 4P5MA 5GJSH 3I2CL 3GSOB 5TDNA 4O4YH 2ESVA 3D39E 4ZTOL 5FO7B 4OZIE 5D7KD 1MCOL 3O3BB 4UT7H 4NO0D 1LEIB 1AHWC 2VMFA 1UACH 4QXGL 2VXSH 2D7PA 2WP3T 3BPCA 5FK9B 2CKBA 2JB6A 3C6LD 1KF9B 2ADJB 4XCFH 5A3IC 1I8MB 3BQUC 3WDHA 5IR1A 4DZBB 4YHPB 1IKNA 3DBXB 4G80B 3ZYZA 5LQBH 4QXTA 2A0LD 3X11A 3EO9L 5KS9E 3KPRA 3VFUB 2PCPA 1HNFA 1E28B 3QEUB 3QI9A 3V2AR 1RK1B 5JNYA 4P23A 1IGMH 1IBGL 1J0YA 5IMMA 5MEND 3N85H 2DQDH 5HHOD 4IBLT 4B7IA 4FXGB 2VYRE 2WBJB 4Q9RL 1MHHB 5K9JH 5FYJL 1AP2B 3PHQB 5HVFB 2E7LA 1A0QL 1F6FB 1MVUA 3OKNA 3P0YH 4I0PB 1KPUB 4L4TB 4QCIB 2VL4A 3DUSA 1JP5A 1G6RL 2DLIA 4U7SA 1EUTA 3BPOB 3WLWD 1BFTA 5T1KB 1QD0A 3MCKB 5FF6A 1NEZA 4DVRL 4XXCA 1RJCA 3U0WL 1J0HA 2DQFA 5GRVK 1MJ7L 1QO3B 3FB7A 1FSKB 4QXUH 2Q86B 3D39B 4OZIB 3FMGL 3ARDB 3WKNA 5GRYA 3QXUA 1A6AA 5EBMB 1MWAB 3G6JA 3WE6A 3O2WH 2AI0H 1OY3B 2AQ3A 2CMRL 3GI9L 1O0VA 2ZCHL 3I6GB 4GS7C 4OKVA 1YEGH 4UDTB 4W68A 4FZ8L 1BQHB 1HOCB 3GMLA 3H9ZA 3T77B 1I7RB 1J8HE 4OM0L 2C1PA 3GRWH 3HB3C 5GSVA 1JZ6A 1EK3A 4MNQD 5C0RH 5KS9B 1TJGH 3PGFH 1S3KL 3C8DA 1ZV5A 5B4MC 3L5WA 4OCXL 4KDTC 1H5BA 4FQIL 3QXWA 4X6CE 2HT3C 1J88A 1AO7A 3L9RB 4MD4A 4P2QE 4WWKC 3IB4A 1OSZA 1F58H 5EN2A 4CVWA 2FX8H 15C8H 4NO5A 1KC5H 2VLRD 3F7YA 2DKSA 4YZFF 3VDAA 3QUMA 5CINL 3MNZA 4M1DH 1JYVA 4MYWB 1OAZH 3D9AL 4K94C 1R0AL 3HC3H 3SDCA 3WIHA 4PRDB 3MX0A 3NGBC 3L3HA 3GK8H 3DRQA 1YEHH 3UP1A 2A6JA 3ARGB 2AXGB 3QG7L 1U8PA 4ODTH 3QT2A 3RY6A 4DN3H 1MCJA 1RIVH 5DD3H 4CADA 2EH7L 3VXUD 1KIPB 3D18B 3LAFA 4YDVA 4D3CL 5I1AB 4B0MM 2V9TA 2VH5H 2WLZA 5HGDB 3TLRA 3TJEH 1UZ8A 5D8JH 5F7LB 3GB7A 5J11C 3E8UH 5ICXA 4NQDE 4ONHB 5KSAB 3CFJA 2EYTB 4F2MA 4XVUC 1PX4A 4AT6A