3LRSA

Structure of pg16, an antibody with broad and potent neutralization of hiv-1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
237
structure length
221
Chain Sequence
QEQLVESGGGVVQPGGSLRLSCLASGFTFHKYGMHWVRQAPGKGLEWVALISDDGMRKYHSDSMWGRVTISRDNSKNTLYLQFSSLKVEDTAMFFCAREAGGPYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PG16 and chimeric dissection with somatically related PG9: structure-function analysis of two quaternary-specific antibodies that effectively neutralize HIV-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords PG-16 Heavy Chain Fab
total genus 43
structure length 221
sequence length 237
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2010-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3lrsA01
3FCTB 4MA7H 4EVNA 2ZZUT 3RGVD 1F2XK 1YN6B 4P5TB 2WIIB 3BO8A 3NN8A 3NCJL 3QNZA 5EPMB 1AD0B 4RIRB 1M71B 1Z0NA 4MD0A 1OAQH 3EOAB 3HC0B 1CGYA 4TSCH 3BPCA 1UB5B 3LRGA 4JRYA 3IDMA 4AEEA 3PP4H 1LEKA 1TJHL 1J0HA 2UVEA 5DC9B 1JZ8A 2CPCA 3BP4A 3GM0A 3VXSE 1WFTA 1CDCA 1A4KB 1GSMA 2IMNA 4OZ4B 3KJ4C 3NA9H 1DQDH 2IJ0C 5BW7A 5F21B 4RZCA 2HKHH 1DSFL 2EYTA 3I9GL 4BH8B 3PGDB 4ERSL 2MKWA 5GISL 5B3JF 1LD9A 1X5LA 1ZXQA 3HPJA 5EA0L 1KPRA 5FYKL 2HKFH 4PJCB 4GRMA 5DMIL 4P9HH 2F58H 4DK6A 3SJVA 4WDIA 4WWKD 4ZNEE 4PG9B 4P46B 5I8OH 1CFTA 4JM2D 3WIIH 5C3LD 5LKNA 3MMEB 4CW1A 2YUXA 5IQ9A 3WNLA 4YR6A 2V2XA 3OAZK 1T21A 2DD8H 2GCYB 3UZQA 5C0JB 1QSVA 1WEJH 3IRZA 4OQTH 5HDLA 4Q9CA 1NL0L 1D9KA 2DBLL 2VZSA 3HNTL 3K1DA 1XF4A 1A6ZB 4JFEE 3HPLB 1DR9A 1R3KA 1CFSB 2FX9L 3GBLA 5EOCJ 3NCEB 2YUWA 3A6CH 4JE4B 2PXYB 3N9GL 3EFDL 4UTBH 1AQKL 2Y06L 2LFGA 3KPOB 4I2XA 1KCRL 2YK1L 2BSSA 4YZFE 4HCRL 3C5ZC 3TJHC 1OW0A 1VPOH 4HUVB 5CGMA 3WXWH 1K4CA 4WEBH 1KV3A 3CMGA 2IAMC 3AY4C 1T1XA 2XWJA 4B7IA 3JWDC 1SVCP 3DRQB 2BY0A 2ESVD 3KPMA 4X8JA 1KJVA 1GGCH 4WO4B 4Y4HA 2Q3AA 4GMTH 5FGBC 5J1AB 1DQTA 4ZO7A 4UIMB 5T1LA 3MTRA 1GL4B 5EB9A 2VKWA 1KN2H 5C2UB 5GS1A 3ARPA 1RUMH 3O2DA 1JYXA 3PGCA 1BJ1H 4B5EA 4Z76A 4U6YA 4PJEF 4NQEA 3LMJL 1T0NA 3ULUE 5DMIH 3QXDB 1JGLL 1MFEL 1TZGH 1IL1A 1Z5LB 2AEWA 2FEDC 1FN4B 4J4PA 5FGRA 1MQKL 3O4OB 1NJ9A 2AQ1A 3RUGE 2OXGA 1BPVA 4EQ2A 5I66B 4KKNA 4QTIH 1S5HA 2XKSA 1DLHB 4P4KC 1G7PB 3P0VL 5I71B 1WVZA 2EDLA 3LPGA 4J12A 1GPOL 1C5BL 5F89B 5HHMB 5TDOA 1MI5E 4D9LH 5HYFA 1N3NB 4I4WA 2V7NA 5KVEL 2QV2A 2NY1D 1U58B 2IH3A 3BGAA 5I74B 1PGRB 1GIGL 2QQKL 3ARQA 1G6VK 4NQUA 1YNKH 3MO1A 1RIUL 4Y88A 1KCLA 1C5CL 2DM3A 3E6FB 5JPMA 4HULB 1XF1A 5IW3A 4Y8DC 3NCBB 1N5AA 4NRYB 3QUKA 2Z31D 4R96B 2C5DC 4RFOL 3VG9B 1KB5B 1ERNA 4HW6A 1FFNB 5DRXB 2P1YA 3WJJA 3E8UL 4CL7A 5EFIB 4XGZA 2D7TL 1OCWL 3WSQH 3U9UB 1NGXB 2DQEL 5EU5A 5DEGA 2DRUA 1GGIL 2BNRD 3ESVF 3VWKC 1FNHA 1ZHBB 3BYYA 2A6IB 4X8XA 4F7EA 1I7RA 3QI9D 1P7KA 2ERJC 4XPBL 8CGTA 2PCPA 5FYKH 4UTAH 4BSVB 4JZOB 2FIKA 4NGHH 3ZZ1A 4NO2A 4NKDA 2COQA 2W0FA 1P9MA 1URLA 3REVB 4I2XE 12E8L 1KENH 1KNOA 2HJFB 1FL3A 2XA8L 2ZUQC 5D7IB 4P46D 3C5ZB 4YBQD 5FUCC 2A6IA 5FAAA 4F7EB 5DC0A 5J12C 5DEZA 4RDQF 1D6VH 4MGXA 2EC9U 3NFNA 5TJWK 3QXAB 3WXVH 1IBGL 2CRYA 5CP7A 2C3WA 3OJDA 1KBGL 4P4RA 1MWAH 2PW1A 5EC1B 2IG2H 3QJHB 1E4WL 1Z9LA 2P8MA 4GH7B 3U46A 1OAQL 4H88H 1U8PA 5BRZB 4TSAL 5FOJA 5I1CL 1HKFA 3WHE0 3V8CA 3WIFB 1X5JA 1XR8B 2O5ZH 2EECA 5IWLC 2VLKD 2LQRA 5I2IB 1JGDA 4ODHH 1BAFH 1NEUA 1VFAA 4APQA 2C3VA 4G43A 4YH6A 5IEHB 4M3KB 1UB5A 3BT2L 3X11B 4BH7B 1NCWL 4IDJL 3BZ4B 1S78D 2YWYA 1ZT1A 1OP3H 3BOVA 1MWAB 4KDTC 3HMWL 4FFYH 1JZ5A 1RUPL 4K71B 1ZT7A 5DRZA 1FGNH 4GRLB 3KYKH 1CG9B 3O3BB 4NWTL 1RZJC 2J12B 2OM5A 3VXUB 5C07D 3HNVH 4A6YA 3UC0L 4I18A 2XACC 4ETQB 1H3PL 4LPXA 1DE4A 4JZNB 1EO8H 2HT3D 1SMAA 4WY7L 4YO0B 4E41A 1BOYA 5TFSL 3QRFM 3VXSA 5DWUL 2YWZA 3EOBB 2BK8A 4N0FA 2HFGH 5DUBA 3C9NA 1MCSA 4K07A 5F9WB 3RY6C 4F37F 1P7QA 4YHKL 1J1PH 1BJMA 5I74C 1UM4H 4G6AD 2H9GA 1NANH 4EZMA 3E2HB 4D0BA 5T1DH 4I0PA 4DN3H 3FB8B 4O4YL 1DJSA 3MRHB 1T3FB 4BSWB 4BK4A 1A5FL 1N7ML 1Q9WB 2ZPKH 2VH5H 1ZMYA 5L2JB 5MI0B 3GIVA 1U8QB 1LEIB 4HIXH 3IETA 4O2FA 2XN9A 5IOPB 1NGPL 2OL3H 2Z31B 2LU7A 3T2OA 4KI5F 4NRXB 4JQVC 4NQDD 2DF3A 4L5FH 5H94B 2H8PA 4F37K 3D39E 4N0RA 3BWAA 3P0YL 4M7LH 2VXVH 2AEPL 2RAMA 1MIML 2ZP0T 1DQJB 4X4MA 25C8L 4GUPB 1HHHA 2EDYA 3FHAA 5I9QB 5IW6A 1I8LC 1I4FA 4AEIH 1I7TA 2XG4A 5FV2A 3LDBB 1ZHLB 1EUTA 1YNLL 3VE0B 3FT2B 2A6JB 2ICEA 1S9WA 4PGEA 1I1AA 3LCYA 3SCMB 4D8PB 1T80A 1VGKA 3FT4B 4OZGA 4DTGL 3LN9A 3BZ4A 3GRWA 4MJID 4S10A 5EO9A 1KENL 5AWNL 1MJ7L 2HLAA 4HZLA 3VFTB 4PGBA 3L3DA 4IRSD 3SDDD 4UMGA 2A6DB 4FQ2H 4RMSA 3WE6A 1QKZH 3MRFB 4XP6L 1RHHB 3HCVB 5E8OA 4DN4L 1AFVH 5F7KC 4QT5B 3P9LB 3PL6B 5EIVA 3VXTA 4X80H 3RWIB 3TBTA 3C08H 3PL6C 5DUML 4XP6H 3K80A 1PX3A 4Y5XB 3HI6L 3ELAT 3BN9D 1QFWI 4DKEH 3PHQA 3S3JA 2GUOA 1RJYA 3FRPA 4TTGA 3TBSB 5KVDH 4RMWA 1YY8B 3WEXA 4TSAH 1OPGL 2AXGA 2P5EB 5C0RH 2ZUSA 3VFGH 1EO7A 3D39B 4APQD 5EU4B 3QWRA 3BIAX 1EBPA 1I8MA 1UA6L 1ZANL 2J6EL 4X5LA 3V4VL 2HMIC 4LQFH 2XFXA 4LLYB 3MRMB 2OL3L 5A2JH 3H9HB 3CFKB 1G84A 1JFQL 3Q5OA 4LP5A 3MRPA 4X98A 3UJTL 2VIRA 3IS0X 2VMFA 4OT1H 4HF5H 4GBXA 1NLBL 1ZLVK 4AK1A 1A6ZA 4R2GD 4ZD3H 1A6UL 2DQDL 4HBQA 2BNQA 1FGNL 4WHCA 3FQUA 4URTB 4Y2DB 3BKJH 1A7PH 1MRFL 2ARJA 4MXVE 2HLAB 5T1KA 1LDPH 4Q6IB 1T7XA 2E8YA 4XWGL 1RU9L 1S78C 1DVFA 3FN0L 5CFHA 5D1QB 1EEYA 5L9DH 5KZCB 4TTDC 4M4RA 4O2CA 1I85C 4LDOB 4J3TA 5GRVL 3SDXB 2R23A 1HHHB 5E08H 3EUUA 2Y6SC 4JLRA 4R2GC 3K4AA 1EHAA 2EDTA 3KYOA 3TO2A 2PYFA 5AZEH 2VNCA 3RPKA 5E24E 4DN4H 4PYGA 4N1CA 4D0DA 5GXBB 6FABL 1FZMA 3PWLA 3ULUL 1IKFL 2EZ0C 4U7KA 1CXLA 1I9EA 5DURB 3SDAC 4IMLA 1VERA 5F7HA 4LIQH 2C9AA 4YNYB 2Z8SA 2PXYA 5E56A 4ZNCD 2ZCHH 2UWEF 4LVNC 3WNPA 3NIGF 5I1DA 4FP8L 4S11A 3S97C 5F93C 2WIIA 3BO8B 4MDIB 1NJ9B 3CJJA 3TYGH 1T89C 5F44A 4TOYH 2D9QB 2MMXA 4XCYB 2YRPA 4Y89A 4Z7VA 4LLMB 1BD2D 4XCCL 1XR9B 4U1HA 3QUZA 1JPFA 4EDXB 4R3SB 4PY8J 5HVFB 1S7UA 5C70A 4FQXA 2HH0H 4OSUL 1U8HA 4X9IA 3WLBA 2BVPB 5K33A 4M7KH 1CF8L 1OB1B 2X9XA 3FO9A 4M8QA 1NLBH 2B5IB 4QHMA 2WQ8A 3DV4A 4UNVA 2PYEE 3O8XD 5FYLD 1H15A 4JFYB 4KJPD 1K8DB 5DD0H 1BD2A 2NTFA 4HLJA 4DTGH 3C5JB 4XBPB 3DYPA 1NUGA 2R1WB 5DJ2B 4MQXD 1FZKB 3QEUA 2GFBA 1BQHG 3WV0A 4HCRA 4HUVA 4MDJA 5EBLA 3QCTL 3IDIB 3GGWA 3U0WL 3KPRD 1UM4L 1YEDA 1A14L 1U8PB 4FFZL 5BRZA 1QFWL 1JZ7A 1KB9J 4NKOA 4NQCE 3U0WH 1NCDH 3VH8B 4PRDB 4K9EH 4H1LH 1AHWC 1BECA 1QTYT 4C59B 3MRRB 1KEMH 1IEAA 1Q1JH 4G42B 5C0ND 3BQUD 2JIXA 4JHWL 3X3GL 5MEND 1N6QL 1NCAL 4G6FB 1I3GL 4RFNC 4DW2H 1XAUA 5EU3A 3D2UB 1MHEA 3LN4A 3DVNA 4WTXA 5BCAA 1FFQA 3W9DA 3AU1A 3D2UD 4JFZH 4K3HA 4E5XB 1Q94B 1NGYA 3N1GC 4XI5C 3PDDA 2R0ZL 4OLXL 4M62H 3GJEB 3Q3GA 1NMCB 3MA9L 1M6OB 5SX5K 3H0TA 2AQ2A 2V17H 3IU4H 3MA7B 4YHYB 5IJKA 1SEBA 4Q74A 1KELL 3TZVA 2NY4C 4AIOA 2Z8VC 3Q6FA 5K59F 3T3ME 1B0WA 1S5HB 3WE6B 5DHVB 5FFLA 3NA9L 5F7YC 5KJRL 8FABB 3HG1A 2W91A 3FQUB 1IM3A 2D2OA 1N2RA 3EKCA 3VU2A 1G9ML 1MI5D 2GY7B 1S7QA 1QSEB 1GZPA 1KIRA 3BD4A 5KOMC 3LKOB 4YAQA 4CAGA 5LG1A 3OAYK 1BZ7B 1FRGL 3TT3H 3Q48A 2IBBA 3V4PH 1AC6A 1FV1B 4LKXB 3OPZH 1JTOA 1CT8B 3QHTC 2UZXB 5KSAB 5JA9A 4Z7OF 1U42A 4BYHA 5KANI 4TNVF 5B38B 4ALAH 5IR1B 2NW3B 1CU4L 3NVQA 4MA3A 3P4NA 4ZDHB 3ROOB 3WNKA 1MLBB 4P23A 3O6ML 4HV8B 4JN2A 2IFFL 4N8VA 4YBQC 4N0UB 2YOCA 4NO0B 3QCTH 4G42A 1FO0H 2HG5A 4PJHF 2D31A 3RAJH 3HB3C 4K3GA 3PGDA 1MRCH 5FKPA 2BNQD 1A21A 1D5BA 1MCOL 1NFDA 4JQIH 1HWHB 2AGJH 5JUEL 1OPGH 4I48B 3O9WD 4YPGA 4RMRA 1HHKB 2APVA 3MJ9L 1QLRB 2KDGA 1YQVH 1HEZA 1S9KC 3H7BA 4P3CL 3S4SB 4TRPH 5HHNB 4P2QA 4DW2L 3X11A 1D5BB 4BH7A 3UTQB 5T3XE 3TWCH 2X4OA 2NY4D 1AJ7L 3L5HA 1FAIL 4JM2C 4POZC 5F1NB 2P5EA 1WC7A 4AY0A 4U6VL 3NFNB 3VW3L 3B9KC 1YEHL 4X7DC 1N6UA 1RZIA 2HKHL 4DVBB 2CLZA 4JY5H 4TUOA 4KV5F 5EC1A 1TJGH 3QZWG 5KS9E 4Y4HC 1WT5C 3D0VA 1OLZA 3EDFA 3GO1H 3QO1B 3HCVA 3RX5A 1I7ZA 3C60A 5DQDH 1RURH 1KLFA 4OV5A 2CLZB 4LU5L 3GSNA 5DHVA 5E2VH 3MV7B 3OGCA 5DFWH 4RZCB 2IADB 1FVDB 2FJHA 4QHUB 3QPXH 3EFFB 1CLZH 1R5VB 5HGHA 1KJVB 2DQJL 1DCLA 1FFNA 3VD3A 5IVZB 4N5ED 4E42A 3HZYB 3MACL 3NCJH 4JFOB 3EJZC 4DFIA 4LCYA 2HTKC 2ED7A 5EOTA 5IJKC 5C0CB 1T1YB 1MREL 5J6HB 1AIFB 4GKSA 3ARSA 4UOW1 4O02H 3P4MA 4MNGB 2XTLA 4CBPA 4TNWK 4FZEL 2J88L 3QEHA 3SDCC 5IJVB 1CGSH 2R0ZH 5IEKB 1LP9E 4CUCA 5D6DC 2VL5B 5D2LF 4KZEL 2XKNB 3HLAB 5SWSB 3TV3H 4KROD 3C5ZD 3GSUB 4WFHE 4U6VH 3TVMB 2ZUVA 4G9DA 2FB4H 1UJTA 4YK4B 1U3HA 5E8NA 1RJZB 1LNUB 4UT6L 1A1OA 5D7SH 4P4KD 4DZ8A 5E2UH 4NQSB 4D0BB 2AJXH 5F70A 3PWJB 3MLRH 2N7AA 3VRJA 2PN5A 3MGTA 1IM9B 5DRWB 2D7PA 3PDOA 1MAJA 1ZT1B 4X6BA 5K9QI 2JB6A 1UM6L 4YXKL 1LK3H 5DJ8B 5CGTA 2E27H 3IF1A 4EBQH 2WWMC 4JRWA 1HKLH 2D7OA 1CFQB 4MQ7B 1LK3L 3QQ4B 1GC1L 5EU6B 2XXMB 1RV6X 2BC4B 4NYLA 5B8CA 1ETZB 1VCAA 4HC1L 1TQBB 4EBQL 3T0EE 3MRNA 2KBGA 4U6TA 3VWKB 3RGVA 3ME0A 3PGCB 3R0NA 5IMOA 1QQDA 4L9LB 5C0NC 5IHLB 3O6LL 1PKQA 2WBWB 1S7WA 5KS9A 5TE7L 2AGJL 1J8HD 1YY9D 1RIUH 3QEQA 4PRID 4M43H 1TZHB 4AT6B 2FCBA 5EU4A 4DWHA 4NNPL 4NZRH 3TJHD 4D0CA 3P4LA 1KPUB 1BLNA 1S7RA 3RDTC 4RGMC 4RGNE 3P77B 4UQ2A 2ITDA 3T0EC 1JRHL 4IHOB 1KGCE 1F02I 3P73B 4N1HB 4K23H 1KTRL 2DQHL 3LS5H 3RKDD 1H3TA 2X4OB 4IS6A 2VDMH 4JDTL 1IFHL 3O6FB 5A40E 2BRRL 1JGVL 2FSEB 4ELMA 4MQXC 3WCYA 5HTSA 4L4JA 1S9XA 4LMQE 5DFTA 1T21B 4PPTA 3RL1A 2R8SH 4FQQA 4NUGH 4F3FA 4OD1H 1KN2L 5DUBB 1OL0A 5ESVB 2V9RA 3QJHA 5JIIA 4UB0H 3GMLA 1LO2H 4B53A 3RWCB 2HP4A 4LF3A 4NP4L 3QFDA 2CK0L 4X9HA 5D1QA 4L29B 2Z91A 5EBGA 4NN5B 2F5AL 3D25B 5IW1B 5D7IE 3PF2A 1ACYH 1RJCA 5HPMB 2YA2A 3IGAB 4HWZA 3TH3T 2DQGL 3CH1A 5I19H 5LXGH 1E0OB 5E6ID 2NXZD 2A6JA 1V3JA 5IVOA 3V2AR 4HUMB 1IEBA 5C07B 3DV6B 5IFJB 1TETL 3DI3B 5D7JD 3VMNA 3JV0A 3L1OL 5ALBL 4WDIB 3RAJL 2JE8A 2RR3A 4FXGA 2A9ML 1MCOH 4HKBB 5L0QB 1U2HA 4OM0L 4Y4KC 5L6YL 1MJJB 2R4RL 1AGBB 3KWWB 2OZ4H 1VFAB 1E27B 3FOMB 5BO1H 3GRWH 1X4ZA 3P4MB 2ED8A 1T04B 4O02L 3F12B 5KW9H 3PV6B 4R4BB 2D0FA 2W0KA 1D9KB 4WI5A 3KWWA 4NSKB 2J88H 3ARDB 4R0LB 4MX7B 1L9NA 2BSRA 1Z5LA 3T0XA 4V1DE 4I1NB 4HBCL 5FYJD 5T3ZH 3ULVC 2GITB 2Y36H 3KYAA 2VXSL 4QHUA 2F19L 1YEEH 3DX9A 3UTTD 2WMPA 5F89A 5FO9A 4JFFA 4GMTL 4DQOL 4KDVA 3DO3A 3X3FH 7FABH 4YLQT 1UH2A 3FONA 3L3IA 1JMZA 4LLWA 4KTYA 2FYYB 5DQDL 1U9KA 2R1XB 2QR0B 2LTQB 2WINB 1DTUA 3V5HA 1EO8L 4LK4A 1ACYL 4HZAA 3KS0J 4N0UE 4WW1A 3B9KD 3OX8B 2IPKB 3FQRA 3P0VH 1EVUA 1T22A 3S37X 4KQ4H 2APWA 4NUJA 1VHPA 5F7LB 4EI5C 2VAAB 3ZKMC 3D9AH 2BVUA 3F65A 5IB3A 3V9FA 5GZOC 5EFIA 3L7FA 5DD6A 4R2GB 2BERA 3MRKB 1YY9C 5C09B 3P3YA 4G8GE 4OZHE 3ULVH 3WLBB 5JDSB 4OIAA 3VFMA 4X6DA 4XNMB 1BQLH 4RGMB 4RX4D 1D3CA 3ES6A 4KXZI 1M4KA 4DKEL 4EN3C 4LVNB 4D0CB 1FFPA 4OIIL 4J4PD 2ZNXA 1J7VR 3BWAB 3ZDZE 2GCYA 4R90H 2Z8WC 2BSTA 3RX8A 1Q38A 2EDFA 2DQFB 2Z4QB 4JFHE 4LP4A 1KNOB 1A1NA 1UXSA 4MJIE 4ODVH 3I6KB 3LD8C 4RRPA 4XMPL 4NBZB 4JY4A 1UVQB 2GT9A 5DJ6B 4QCIA 3VWJC 5EU6A 3BUYB 5D7LD 4YXLL 1S9YA 1HH6B 2BMKA 3QFDB 3MSPA 5I30L 2VE6A 4X9GA 4NP4H 5GRJL 1YPZE 2GJZA 5J13C 3Q5TA 2GT9B 4IOFD 5E00A 5ACZB 5IVXB 4HFUH 3RA7H 1R3JA 1BJ1J 5F88B 4QRTA 3Q6GH 5E2TL 5C09D 1R5VA 5HGHB 4HIIA 1BFOB 3QT2A 4WHDA 3W0WB 1KLGB 2M8XA 4NGHL 3TFKC 3H9SE 3B9EA 1WAAE 4AENA 4Y1AD 5C0CD 3DX9B 1XGRA 3EJYD 1INDL 1JNLL 5JOFA 1NGXA 3FFDA 3VCLB 4JHAH 3CX2A 5MENB 4GG6F 1I7UA 4EUPA 3DXAD 3OB0H 5IG7B 3VXRD 3JV4B 5KSBF 3VI3E 5AYUH 4Z9KB 2Z92B 5CZVH 1EMTL 2OZ4A 1W72A 4KY1H 3MRNB 2IFGA 3F7YA 4RNRB 4M1CD 3VWKD 5EORH 1QFHA 3BXNB 3GJFA 5CKGA 3VFRB 4DOHB 4HPOH 1XGQB 5DYOA 3QDGB 5DK0B 2IBZY 5DZOA 1D5IH 3VXNB 1T83A 1A6WH 1N3NA 4V2BA 1OOAA 3P77A 5CILH 3WO4B 1QYGL 1YYML 4ODHL 2G9HB 5T3ZL 1VGEH 3P4NB 4ZDHA 5BOZG 3BXNA 3GJFB 2WBJA 5CIPH 3B5TA 2FWOB 3ILPA 4OKVA 1IRAY 1UCBH 4XVTL 4EUPG 1X3DA 3FO1B 3DVIA 4HJ0C 1NEZA 4KUZH 5L88L 1TVDA 1JNHB 2EIDA 1ZVSA 2EYRB 3FTGB 2DI7A 3QQ9D 4XVTH 4LLUA 3TVMD 3RNKB 1W0VA 4XNUL 4G8IA 3S7GA 2CR3A 1FDLL 4OCSH 3AS2A 2MHAB 3MFFA 4L29A 5E9DD 5IEKA 4OCWH 2VL4A 2YKLL 5EU5B 3AAZB 1NBZB 5LQBL 4LFHD 4QOKA 1XGYH 5CWSB 5DHXB 5DQJA 4GBXB 4H0HB 4J3VA 5DUMH 3QULB 2NXZB 3OKKA 3SOBL 3Q3GB 1UKSA 3HNSL 2KQNA 3H42L 3U4AA 2ZPKL 5A2IH 1WAAF 1YN7A 1S7SA 4M93B 1PG7X 2DTMH 4WV1A 4FXGB 5HI4C 5A3ID 3E6FA 1UB6B 2N7BA 4OJFH 3P9MA 1UENA 3GMOA 5BJTB 5I17B 2OTWB 1CZ8L 4JO1H 3VFNB 3TYGL 2AS5M 4P4RB 3G5ZB 3ARBC 2B0SL 3J7HA 4OLZL 2FHBA 4ZO9A 4LGRB 5L2JA 1W8OA 3R8QA 4IOIB 3VD4A 1F00I 2HT4C 4RFEB 1NCWH 3AVEA 5FYKE 3UJJL 1N8ZA 1W8NA 4NCC2 5IR1A 5FO8B 5KTEL 3KLDA 4K71C 1QRKA 2DLEA 3AB0B 3SE8L 1MFAL 4XNZC 4U33A 4E41E 1IEAB 3KJ6L 2MNUA 5MEPA 5C09A 5EU7C 1I9RH 5C0BE 1JF1A 5EZLA 4QLRA 1F4YL 3RI5F 3QFJD 1KC5H 4HWUA 4QXGH 1QSFB 4FHBD 4FQ2L 4OUOA 1IC7H 3MRBB 5CWSA 5DQJB 5FO9B 2FIRT 2HT2C 1KPRB 4J2XA 1ZHLA 1ONQA 4XBEH 1PDKA 4S1DC 3CMOH 2QSCL 2B1HH 4X6EB 3G6AB 1I7ZB 3BKYH 5HHNA 1CR9H 1Z9MA 4G6MH 2NTSP 3S34H 3O4LE 3PWUB 4JFYA 3ULVD 1CXFA 4K3EH 3D69B 1YMHB 3P2TA 2AJZA 1VFUA 3WFDL 1CBVL 4GOSA 4QT5A 2H1PH 3LKQB 4P59H 1H5BB 3RBSA 5SX5H 5I1CH 5DGRA 1FE8H 5KSAC 5HDBF 4UU9B 3MOBH 1HYSD 2CKBL 4I4WB 2X70B 4U1NA 4JO1L 4PRIE 2Z8RA 3ZDZF 4CVXB 3L3OB 3DNKA 5JW4Q 1J87A 3QIBD 4X4XB 1TIUA 1DP0A 1S7TB 2OI9B 1VADB 3WFEH 3O8XC 1SEQH 2GY5A 2CIKB 4XWOC 5HHOB 4KK9D 3O0RL 2E9BA 1SQ2N 3GSUA 3H9ZA 1K85A 1ZA3A 3BUYA 4DUXA 1DE4B 1RMFL 2VUOA 2UYLB 1ZHNB 3JWDH 4GAFB 3O45B 4JB9H 1RD6A 1SEBB 5CJBA 3JBG7 4ORZC 4O58L 1KCUH 2A77H 5AWNH 1RUAL 2HRPL 3A67H 1JRHI 2CSPA 3QA3B 4YE4L 1NCCH 2VLMD 4MNGE 5C0AD 3E3QC 1WBXB 4MZ3A 1QHPA 1CLZL 4UILH 3VMOA 5IGXH 5K93A 1IAII 5C0CE 5BW7C 1F97A 5C0AE 3WDJA 1MAML 2I9TA 1J0KA 1G7LA 4P99A 4WO4D 5IUSA 3WUWA 1C7TA 2X4QB 1J86A 4NKIL 5ECJE 3F5WB 3MODL 1L7TH 5JR1H 4F15B 5D1XA 3WFDH 3RDTB 4WENB 1A6AA 3OKEB 3WKMH 4PJXF 4D9QE 1ZGLP 4JFFD 1PEZA 4X4XA 2ZG1A 1A1MA 4J3XA 2I9TB 5TDPB 2VTFA 1P84K 5EO0B 2P8MB 4M1GH 3SPVB 4LSVH 4EOWL 4L5FL 43CAB 2K1MA 3B9VA 4K94L 5CJQL 2GAZB 3HKFA 3V5KB 1TQCB 5IKCA 2M26A 4JRYD 3ORJA 4UT9H 2D4DA 4MNHA 1IQWL 5FM5M 4JPWL 1XGUA 3T0EA 2PTVA 2BXYA 1G9MH 1RUQH 1BM3H 5JIPA 3ZL4L 2AJXL 2OL3A 2WUBL 4HIEB 2HH0L 5IIEA 2CH8A 2CLVB 3RHWF 3OKNB 4YQXL 1FDLH 4OCSL 4WJ5A 3FQRB 4YUEH 4LASH 5DRNB 1FN4A 3UAJD 1MY7A 3RVXC 1NMCC 4I9WE 7CGTA 5ITBH 1I3VA 3MV9A 3T04D 2OMBA 1CVSC 2X4PB 3OKNA 1J0YA 2WQRA 5HHQB 2Q8BH 3MLWL 4QRRE 3E1F1 3LKPB 1M7XA 4L8SC 1UM5H 4YE4H 4WI8A 3ZYIA 4PJFB 4KROC 4YDJA 5FHBH 2EDEA 4KMTH 3DUUA 1HI6B 4LLVA 3V6ZA 4EDXA 3VXMA 4HJ0D 1H5BA 2V5MA 1RK1B 3FQNB 1XMWA 1T5WB 4WW2A 4G7VH 5EPMA 4OF3A 1XGPA 3G5VA 4XMKL 2HRLA 2GI7A 4NHUA 4AENB 1N59A 3AC0A 5AYQA 4ZAKD 3OAZH 4M9PA 3MUY1 3BDBA 3U4BH 5K9KB 3G6DL 4AG4L 3GBML 1PKOA 3I3BA 2V2TA 2J8OA 5EWIH 1IGJA 3ZKSD 2VQ1A 3KPSA 5CJQH 4HV8A 1Y0LB 4JN2B 3KPPA 1CGWA 1NKRA 1YDPB 2CDGA 1OT2A 4M1CC 1A3LH 1BQHB 3PWVA 4GSDL 4NO3A 4JZNA 4LSQH 2YA1A 3EO0A 1CF8H 3L3KA 1F4YH 3VMPA 3ZE2E 3C8KB 2C1PA 5E2JA 1PQZA 3WN5A 4JZJC 4L8CA 5KSVB 4HK0B 1G0XA 4P9HL 3GJEA 5D93B 3TZVD 1QFOA 3VRLF 1A4JB 2FX8L 2OK0L 3QHFH 5FF6B 4C55A 2JB5L 3T0EB 1SJEB 3D6GA 2QQLH 4ZMAT 3S3PA 5T3XL 4P48A 1KIUA 5DJ0B 1RQ5A 1UACL 5EUOF 4QWWC 4WEMB 5I73B 1B4RA 1ZVSB 5ISZA 1ZHKA 2H2PC 2RIKA 3N1FC 1U8QA 1LEIA 2DBJA 3CVIL 3RWEB 4EN3B 4MA1C 2X4TA 4NM8L 2A9NL 2Y4SA 4XP5L 3MLVH 1AJ7H 3X3GH 1WF5A 1XH3B 4C56D 2GEEA 3BPOC 1GGUA 3IU3A 1Q9LA 4NPYA 5E99H 3ES6B 3D39D 5I1JH 3HRZB 2X2YA 3STBA 4CNIA 1UEYA 4H20L 3T8XB 2HJKA 4LSSL 1O7SA 3C6SB 4NOFA 3QULA 4WU7B 4Y1AE 4I8DA 3Q1SL 3WHE1 4OKDA 5JOFB 1RK0A 1XH3A 2X7LB 2IADA 2FEDD 5IMMB 5B38A 3QA3A 4PJ7F 3FO9B 4M8QB 5CINH 5C7XL 5F6HI 4FQPA 4EDWH 3BKJL 3HC4H 1VEOA 4M7ZC 1IEBB 4J4PC 4RGOH 3ZYZA 5IB2B 3U4EA 2Z92A 5F3HA 4N8VG 2NX5D 4GRLC 1DQJA 4NCDA 4I18B 4LSQL 3BKCH 2ADJB 4NO0D 1LO4L 4H1LA 1FFRA 1HSAA 1XGTB 1JI2A 4FZ8H 2XQYG 2R2CA 4R0LA 1H3UA 1JP5A 1TMCB 4JGUA 3ZKMD 1MCJA 4MJ4A 2EKJA 3MCKB 1BGXH 3EGSB 2HAZA 5E8DH 2PO6A 5TDNB 3U2SA 1FBIH 2E6PA 4X6DF 1IGTA 1D9KC 3QUML 4PJDE 5H35A 1FLTX 1U8KA 5DHVH 5EG6C 2FJFB 4PLJD 1IGFL 2A74B 2GJ6E 3FFCE 4WFFD 3VJ6A 5CD3A 4W6XB 1U8JB 4TUKH 3WNOA 4AL8L 2J7LA 3EYQD 4AH2A 2OXHA 1JMXA 3S5LA 5JUEH 5MEQA 2AK1H 3U1SH 2UWEA 5IB1A 2GW5A 1BVZA 3BJ91 5LGHH 1SYVA 4KKLC 5IOPA 1VPOL 3P40A 4BQ6A 1AKJD 3O2DH 1EAPA 4U1SB 3SGKC 4WVRA 4R96A 1F58L 2FL5A 5KVFH 2AJSH 3CDYA 3GSQA 4KKCD 1IQDA 2OQJA 4LSSH 1AI1L 2BNRE 1K5NB 1AGEA 1SJVA 1JHLH 2G2RB 5KVGH 2DJ4A 2EH8H 4Z7QF 1AKJA 1AO7B 4QHKI 2ERJB 4Z7WE 2VIRB 1T0NB 4JFEA 1A9EB 3LN5B 5J4MA 5CEZE 5GRXG 1LP9F 1A0QH 3HRPA 4JM4H 2LVCA 3VI4E 1NC2B 1NAMB 4XPHH 5I76A 4XAWH 2GK0A 4UDTB 3S88H 4OCYH 2MFNA 1E28A 2Z31C 3DGCR 1JTPA 2BNUA 1OSPH 3DSNA 3QDGA 1U93A 2VDNH 1VADA 5C1MB 5I1LB 4JGJA 5DT1H 3N1QC 3H7LA 2XKUA 5C92A 1VFBB 1NFKA 3QFJE 3U7YL 4F57H 3GSNL 4JHWH 4PLKC 5CLWA 3SKJL 1TLKA 3BAEH 3B5GA 4U7SA 5SX4H 1GGTA 3GMMA 4CKVX 3MV01 4JDTH 1T4KB 4Q2ZA 1CYGA 3IAPA 2Q7NA 1YA5A 5CJOH 3QUXA 3PIQA 2NY2B 5EUOB 1FAKT 3L9RB 4W6YB 5KS9B 4R26H 2XTJC 1K4CB 4QRPB 4OFDA 1PYWB 4OFYD 3OTTA 1G0DA 3I3EA 2BVQB 5HYJD 1NDMA 1F6FB 3MJ8A 3S35L 2UY6A 3LKRA 4M6ML 5C0FA 3QDJB 3BFOA 1F11A 1B90A 4M8VA 4S1QH 4KDWA 4NN7B 1U8NA 1INQB 5JW5B 3OKLA 1P9MC 4LPCA 1YEKL 2Q76B 1Y0LA 2F54D 3DSFL 2ZSWB 3C60B 4OD3L 3FRPG 4PJGE 2FL5B 4A6YB 3DV4B 1NEZG 5GZNC 2QADB 3D3VD 1FFOA 1UM6H 4YXKH 2Z0BA 1FNSH 4F33A 3BVNB 3VGAC 3OZ9H 2NY7L 4NIKB 4NQSA 3JVGA 5I15H 5IBTL 3DX7B 1P5VA 5LQBH 4L3CA 3E2HC 3GSWA 3WXVL 5J7CC 2HFGL 4BSWA 2FO4A 2P44B 3QNXA 4V2CB 1IAMA 1EHXA 3O11A 2DMBA 2C4XA 4Q9QL 4LCYB 1LK2B 4LPYA 3VJ6B 2ICWB 5GS0H 5DDHB 1HXMB 5BS0E 2A73A 4RAHA 5KW9L 4AL8H 2P5WA 2XN9B 4CADB 3OKEA 1DN0B 2VAJA 3S98A 3GSNH 2ZWLT 1DL7H 2HMID 3ZTNH 1MREH 1EXUA 5EIIB 3UYOD 3QDJD 1TPXC 1A5FH 1LE5B 3UXFA 4OAWA 1OARL 2G75A 3PHQB 1GOHA 2ICWA 4JO3H 4HIXL 1R6VA 2I5YH 4IRJB 3T2NH 3TM6A 3MRJA 2YR3A 2R9HC 1TPXB 4A6YH 4M5ZL 1MHEB 3NGBB 4YXHL 1YYMH 4ZUSB 4LLUB 2P8PB 4XMLH 5DHYB 4YHYC 1YMMA 1EEZB 4CMHC 1NGWB 3SDYH 2D7NA 2FH6A 2V5RA 5C07A 4LBEB 5IFJA 1AD0A 1Q0XL 2RHEA 1WWWX 4W68A 2Y36L 1A4JA 4KJYA 3IFNH 1FV1A 2VDPH 5SWSD 4YDVB 3KLSA 2WIMA 4FQIH 4IIQC 2Y25A 3VXSD 1A0QL 1T7WA 1A7RL 4NKDB 4OBSA 3CCHA 3RNQB 5B38G 3T0DA 1E4XI 4IRJC 3VFOB 4AIXA 1OGTB 2GFBB 1TFHA 3BDYH 2ED9A 4O5LH 1F11B 3BD3A 3T3MF 5EBMB 4QXUH 2Y5TB 3CDGA 1A6VH 1RZGB 4R4BA 5AG8A 2IQAB 4EN3A 1MCWM 5DK3A 1FSKB 4HMCA 3SHSA 5IBLC 4AMKH 2DQUL 3BP5B 4X6CF 2A9MH 1XGUB 1RUKH 1G7IA 4H5SB 3NZHH 4HLZG 4PB9H 3FJTA 1CXHA 4PJ5E 3JZ7A 4WGVB 5DD5H 1T6WA 1U8JA 4QGYA 4XVSL 2EIBA 5HHOE 2EDHA 3GMRB 4JFOA 5L8JB 2GJJA 4H5SA 4X6CB 1BFOA 3EO1A 4ONFH 2W0FB 2HT2D 5D8JL 1HCFX 3ZT6A 1AI1H 5DD6B 1FQ9C 4OZGF 4JM2B 3EJZD 5M7QA 3I02A 2Z93A 3UTTA 1MUJA 4N90E 5HDBE 2A1WL 3QZWB 5JHDA 3VDBA 5E2UL 5C9KA 3EOYG 1I8IB 3E8UH 5L8LB 4PGBB 4Z18A 1TVBA 3BGMA 3PP3K 5HGDB 1NCTA 4X99B 4YBLC 3GHBH 2FEEI 4PJGB 2A83A 3QDME 3ARGB 1A8JH 3I02B 3F6LA 3IFNL 4KFZC 4YDLB 3X13B 5BV7C 2YD9A 5K9JL 3MCG1 3MV7E 5GGTL 4KKBC 5ESQA 2FJHB 4MSWB 1HQ4B 4NKMB 2XWTB 1CQKA 4XXDB 1ZOXA 3VXOA 1RIHL 1KJMA 5E8EB 1MCQA 1LO5A 1OD7A 2FBJH 1S9YB 4OV5B 4OLYH 3IDUA 1YPZF 3LZFH 2W1NA 3TPKA 5D6CA 4X80L 3QSKB 5C8JA 3GHEH 5HI4D 1RJYB 2YD6A 3IDYB 5MEOA 1D7FA 3QDJA 2VH5L 4D9RE 2QQQA 4F7CA 2OJEA 5HHME 1WUNT 3ZTNL 2ZUUA 1AY1H 1LE5A 1NLDL 5EU3B 3NCYS 5C0BD 5CUSL 4TVPE 1NC4D 3NBNA 1FE8L 1KOAA 3DX6A 3FMGL 4R26L 4OGAD 3OAUH 3R06A 3C6SA 3RUGB 2JIXB 1HI6A 4LLVB 3C5SB 4X5WB 1CIDA 2NY6C 1ZS8B 4NQEE 5D2LA 3BP5A 1KJ2L 2YEZB 4LNVA 1T2QL 3DIFB 4HBCH 5H35B 2BCKB 2H2SD 5T3ZD 1H15B 2ADFL 5HGAA 4GQ9L 3CIQA 3GMQA 2AJZB 2ARWA 3EOBA 2Q7YB 5F6HJ 1PBYA 1JZ3A 3TPUA 5JHLL 5I1IL 4IDJH 2ZCKL 3HNVL 1ES0A 1RHFA 3QG7H 4YXLH 3CSGA 4OLUL 5ISZB 3FQTA 4P2OA 1XEDA 2ESVB 4OD3H 5E8NB 5T33H 3U36B 3QO1A 2RCSL 2FRGP 4PTUA 2Y9RT 2DKSA 2IC2A 4P46C 3U82B 1U93B 5IK3B 2XQYK 5HJ3A 1BOGA 4N8CL 4MZ2A 1J1XL 5F7DA 3GSRA 4V1DD 5C2BL 2X6MA 4G80B 3L7EA 1LO5B 2QTEA 5EO0A 4KHXH 1UQSA 1K3ZA 4LF3B 5GGQL 3SOBH 5BVPL 3ULSB 4G5ZH 2VLJD 2YPLB 3V7AG 1I3RA 3TA3A 2AXFB 3S36X 1P4BL 4NNYA 3UTTE 1TTGA 4MWFA 3GSVB 4RAVB 3KHOA 3IDXH 3QEGH 1YEGH 1HZHL 1V5JA 4L8DA 3AU1B 1RUKL 1W2KT 4UDUA 3WYRA 2JCCB 1R5IA 5EUOA 1HINL 2NY3D 3DX6B 3UDWC 5A2FA 3AS3A 2IG2L 1AGDA 3KPPB 3OF6A 3VXUE 2MJWA 3CDFA 5E0QA 1KJ2B 4ZS6D 5ID1A 2GJ6B 3FFCB 3F7RA 5IF0A 1P84J 3BPNB 5IJVA 5F3BB 4TOYL 2X44D 3MLYL 1U8LB 1AXSB 4F9LC 3C60D 5I17A 1YYLH 4L3EB 4OT1L 4ETQA 1EFXB 2FEEL 3HAEA 5FF6A 3VXPA 3DTXB 3V52H 1PSKH 1JPTL 3MRFA 4PJCE 1T03H 2P8LB 1DZBA 1A6PA 2FJFA 1RUML 3MLXL 3HZVA 3FZUC 5DK2A 2DYPD 5F88A 4UDTA 3UDWA 3KYKL 1TJIL 3ZDXF 4YQXH 4XWOD 4HC1A 3CMOL 4KGLA 3NTCH 1MFBL 3BKYL 4OF5A 3FQXA 4RWYH 2AJUH 1HH9A 2VQTA 5I8KL 2DS4A 4YHZL 3WN5C 4UU9A 1KC5L 4PJHB 1G7JA 3RIFK 3GM8A 3QB7C 5GGQH 2D7QA 4QRUB 5D7LE 1MJ7H 2FBJL 2KH2B 3MV9E 4WHTB 1LMKA 1YEJL 5C0FB 4F9LA 2WINA 3H9SD 2ICES 2OQJB 5E2WL 2QSCH 2F8VA 1CG9A 1QRNE 4KZDH 5IIEB 1KULA 4PB9L 1FO0L 1NAKH 2W9LA 2Z31A 4U05A 3BP4B 5GHWL 5C0RL 5FKPB 3L6FA 3D2UA 1SY6L 5C08E 3FO0L 3BMVA 1MF2L 2VKXA 4FQXC 2P49B 2YRZA 2VXUH 3UPAA 1QFUL 2R4SH 3PJSA 5FUOH 3C5SA 4X5WA 3ZDXE 3B6SB 4M5YL 3S37L 3KPRB 3OKMB 1LDSA 4MSWA 4JQXA 2AVGA 1WZKA 5A16A 1SMOA 4QNPF 1IQWH 4OLZH 4S1DD 4WI3A 4IJ3B 2R2EA 1PX4A 4JG1L 1BVKB 4JO2H 2BY2A 1QEWB 2DWDA 2FLRT 1MCPL 1R5WB 3HMXA 1ZHKB 2Q20A 5JXAL 3K4DA 3V52L 3OJDB 2Y6SD 3MV9D 4ZG1A 2AJYL 4JG1H 4OF7A 1EJOH 2JCCE 4LDLB 5DD0L 5HPMA 1FNEB 2FATL 4PJEB 4DOHE 2VLRB 1MCRA 3IVKB 1E4JA 4TTDD 2DLHA 4NFBA 4NRXA 2BFVL 4JFFB 5HHOA 3DURA 1R0AL 1NFDF 4KJWD 1SHMA 2YPLE 1KB5A 2IPTH 3L3GA 4ZFOA 3JV5A 3ULVF 5DGQA 4Z77A 3BSZL 1YMMB 5B22A 1N5AB 5E1HB 2BVQA 2XN9E 5F71A 5HHVH 4YHKH 3FQWB 3EO0B 3THMH 1NBYB 3IJSA 1RZJH 1NCCL 1HZHH 4Z5RA 1P69B 4PP2B 5F9OH 4BFGA 4QTHB 3R8BB 3GK8L 1U8NB 5ISZE 3O2VH 4IRZL 1FL5B 4UUJA 5CUSH 3BHBA 3QWQB 4NN5C 1A47A 4HUUA 3FMGH 4K7PY 1F4WH 2I9LA 4DKAA 1KT2A 5HYJB 4JREC 4ZPVB 2H1PL 1S7WB 2NY6D 1UWGL 1AGFA 3F7VA 1KN4L 4YZFF 3O3AA 1RULH 1P7HL 3PWUA 3BGFC 4NQVA 3A0OA 5FKAB 4AQOA 3I6GA 3S37H 4JPWH 1F2QA 2ADJA 3BN9C 5I6XB 4U2YA 3RZCB 4EI6A 1FZJB 1B0RA 3L3JB 3QG7L 5D9SB 3S9DB 4ODTH 5IMKB 3W82A 4U1IA 4XXCA 5DMKA 4CDHA 4MJ5B 4Y19A 2ZUYA 3STLA 2PO6D 5EOQL 2XA3A 3V4PL 2CIIA 1MRFH 4ZFZA 3RVUC 4EI6B 4WY7H 3S3SA 1ETZA 5DUPH 4OCWL 4DGYH 1SYSA 2B20A 5GJTH 1B0GB 1T1XB 2XWJB 5JOPE 1A7BA 5F72S 2ESVA 2H32H 1MRDH 3U7WL 4K3JL 5I71C 1VKXB 2DWDB 1TQBC 1X5AA 4BFEA 4N1EA 1QFPA 4GAJH 2GIYA 1MI5B 3JXAA 1X6LA 1VA9A 2WK2A 3LEYL 4NO5A 3QIUB 3ILQD 4HT1L 2OJEB 3AM8A 3RWFA 1QSFD 1G9MC 3WO4C 1MCNA 3RPIB 2DWEB 4PR5B 4FQLH 1Q9OB 4X6FB 4DAGH 3MA7A 2E7LC 1F3JA 4QRQB 1CDGA 2VDQH 1CVRA 1I7UB 2A9NH 3SY0B 4JFZL 3O11B 1VESA 1HEZB 1U6AL 2N1KA 3LKNB 3QEQB 1T1ZA 3U4BL 1CDBA 5FKAA 3NN8B 2JCCA 3NPSB 3RQ3A 4TNWF 3LQZB 4JPIA 32C2A 4KVCL 4OF8A 1B2WL 4WUKH 3KLHD 1MJ8H 4P3DA 1E4XL 5J12B 3RWHA 1KN4H 3L5JA 2D9CA 3LS4H 1CE1L 1KYOJ 1EUUA 4GRWF 4M1GL 4LGSB 4BSVA 1JL8A 1RHHA 1IAKB 5FGCE 4J1UB 3VXSB 1MJUL 4MA3B 4YHLL 1CGXA 4Y2DA 3NAAL 3NA4A 1KIQA 1NMAH 1P53A 1T1WB 3AREB 3FB8A 3L7EB 2P24A 5HY9A 3NCCB 3HMXH 3RNKA 4LSRH 4PJEE 1O7VA 3ARTA 3MJGX 2VDRL 5GQBA 4UAOB 1ITCA 5DA0B 2DJSA 3MRCB 3NFPA 4WHYH 1AXIB 1JTTA 1UT9A 1T20B 4P5MB 4NNYB 5GGTA 2R0LL 4D9RD 3TGXA 3Q0HA 1MVUA 4X7TA 3GMRA 1QKZL 3CSYA 1R3HA 3LV3B 3WJLC 1C12A 2NY5C 3R4DA 2HTLD 4IRJD 1QP1A 2H26B 2VDNL 3NFSH 1IGIH 3KLHC 5JDJA 1FVEB 1F4HA 5FM5O 2J5LC 4E0RA 1J11A 2B2XH 4N90D 4MCYA 4ZSOA 3FQTB 1G9NL 3ARZA 2YC1B 2O61A 2YRLA 4O2EB 4ZUWA 4NN7C 5HHXL 4P2RD 1V7NH 3LQAH 4OZ4A 1L7TL 1CE6B 4JG0L 2RQ8A 5HYJA 1MI5A 3B9DA 4ZAKA 4MDJB 4HX1A 1JRHH 4ELMB 1ZWIB 1V7NL 4ZSOB 1OARH 3K2MC 2YD1A 3ZDYE 4PJ8A 5JXEA 5DJ0A 4RMUA 3TNNB 1OW0C 3V6FA 4JVPA 2UV3A 5EO9B 5JNYA 4EDWL 5FCUH 4W4OC 1G7PA 2ADGB 2H6PB 6CGTA 4JLRB 3GMMB 1MCBA 3OGCB 4EIZC 5IMKA 1RZGA 2F53A 5F1OB 3DV6A 4OGXL 5IP4A 2NXYB 1W72H 3U0PA 1YJDC 4HS8L 4L8BA 4KJPC 4LLQA 2FATH 3MV8B 2OSLB 3DMMA 2R1WA 4WJ5B 5BS0D 4MNQA 1OF2A 4QHLB 4BZ2H 2H8PB 3G6AA 4LLWB 4X99A 2O5YL 3QIWD 3UBXI 5D72H 5IHZB 2DB8A 5F7NC 1QSFA 4Y5VB 3O4LA 4M6AA 3ROLA 5EIIA 4HIIB 4XGZB 3VFVB 1WICA 3OV6A 1YPZB 1NUFA 1GHFL 1T2XA 4OBRA 4DAGL 2WBJC 2W07A 1YN7B 5IFAH 1U8MA 2EH7H 3TBYB 3UJIH 4J3SA 1EX0A 3NPSC 4N0CC 4FZEH 3PQYB 3RVWD 1YNKL 1K8IA 3LS5L 4NBYB 3QIBC 1JZ6A 2XZCH 1AXTL 4UTBL 4Z7QE 1H5BC 2CDEB 4NZJA 5AAMA 1JF5A 1CN4A 3HR5B 5TDNA 4JFQA 5K9KA 4FQ1L 4YNYA 1BVLA 3SDXE 2XZQH 5EOCH 3WUWB 2AK1L 1F3RB 1CDYA 2X05A 4ELKA 1WBYA 2W92A 1GGBH 2DQFA 1DVFB 5E95B 2VZ3A 4KTEH 4Q9RH 3QUKB 2RB8A 5D8JH 1GOFA 2XZQL 5EOCL 1HIML 1C1EL 3EBAA 5JOEA 5KVFL 2LU3A 2OSLA 2BC4A 4G8GB 4OZHB 4BH8A 3SE9L 5KJRH 4MLSA 4YIQB 4P57B 1RZFL 3CXHJ 4Y2OA 1G9NC 3I6LD 4LLDB 3F58L 4XAWL 2DQCH 2G5RA 1G1YA 3LRSA 2VDPL 1F3JB 3LEVL 1NMBL 4R6UA 4LOUC 1DDHA 2DQTH 5ID0A 4GMSL 4U1IB 4YHOH 5F97E 3DO7A 1ZA3B 2NY5L 2BSED 4U6XA 3PIQB 5J1AA 4MA8H 2ITDB 4PS4L 4QXUL 4Y16B 4GW4A 3T65B 1Y18B 4XPAL 1CGUA 1SYSB 2FECL 1BVKA 3VDAA 4WI7A 5IT2L 1HKLL 3WKNA 1II4E 3V95A 3BH9B 3MJ7A 1U95B 2CRZA 3UTZA 3BQUC 4JPVL 3SKUD 1QNZL 4PRAB 1EEQA 4KI5D 1DLFH 4O2EA 2FNBA 4ZUVA 4X0KA 3VFPB 1J1OH 1A3QA 3HR5A 4XVUD 3HFML 3EAKA 1CFSA 3DGGA 3FOMA 5I1GL 4P2YA 1PLGH 1E28B 4MD0B 3BPNC 5CLTA 1J88A 4WV1B 4IDLA 4RBPK 3PHSA 3LS4L 4MNQE 1DUYA 4H20H 2YBRA 3O3DB 1XR8A 1NC2A 3O9WA 2M1KA 1TTFA 2E6JA 3INUL 5C0BA 1J5OL 4G6JH 2DDQL 4RMTA 1ZTXH 1YJDL 1OGAD 4LCCB 2OYPA 2GTZA 5AUMB 4UINL 2CD0A 1B0GA 3JWOH 2EEDA 4M6MH 4EI5A 4HAFA 1X5KA 4RFEA 5LXGL 4KUZL 2UYLA 4LNRB 4U6YB 3BKCL 5MP6L 4BZ2L 4KH2A 4NNXB 4HIJA 4ERSH 4OCNC 4L3AA 4FZ8L 1MCDA 2AXJA 1XIWB 4WUUE 4O2FB 5JZ7D 2FR4B 1RAMA 4OZGE 4XP4H 4OGAC 2VB5A 1BIIA 4KTDL 4EIGB 4LKCA 2AK4E 1Y6MR 5E5RB 1KCKA 4R7NA 3G6JB 3BX7C 3KXFD 4LCUA 1ZLUH 3V6FB 3VXMB 5DC4B 1AXSA 2NX5E 2C3VB 4L4VB 1U58A 3TBVB 1Z9SA 3LQAL 3A6CL 4NC1C 4Z7UE 2EDRA 3IFOB 3MLVL 3QPQC 2Q8AH 3BAEL 1EPFA 5DJYB 2PYEB 3PWPA 4AJ0A 3FT3B 4JKLA 1N0LA 5EZIH 5TF1L 1JGUH 5C09E 1UQSB 1HXMA 3K1KC 1D5IL 4L4VA 4ONFL 3TBVA 3I2CH 4K3DL 1U95A 4GXUM 4B0MM 1AE6L 2PW2A 3VW3H 4HCRH 3KNBA 1H8NA 1MFCL 3JTTA 2GJ6D 3FFCD 4WFFE 5EO1A 1FIGH 4JFXB 5GJSH 5DS8B 3B3IA 1G7JB 1JNHA 3F6IA 4RGOL 3ROLB 4UT7L 3E6HB 4U1KB 3KR3H 4NUGL 4QOKB 1CFVL 1J8HB 1JI1A 1RZFH 3X17A 3BWUC 2VQUA 5DEFB 2ADGA 1M7IB 1QHOA 3EYFB 1GC1C 4HDIA 4CVZA 1FHGA 4R4NC 3CZFB 4LCWB 5C08A 1IGYA 3S8WA 4ONGH 1A6VL 3MCLL 1TZIA 4H1LG 3I50L 4ZYKB 5EU6D 4KJWC 3U4EB 1GPOH 3O6FC 5JHDD 4XPAH 2G75B 1QUNA 2QBWA 4QRPD 4MXQC 4MD5B 3WFCH 3FB7A 4XP4L 1T04A 3DJ9A 3RWGA 2QJDA 3G04A 4JM2A 3D0LB 4KJYB 3KPQA 2HT4D 4GLRI 4LCCC 4PGCA 4HEME 3VA2C 5D9SA 1HQRA 1NFIB 5JA8B 3O9WC 1RI8A 2VZUA 4OJFL 4TYUA 4QHNB 1XGPB 5BV7B 3ZMRA 1LP9B 2YHGA 3UO1L 4G6KL 1MHCB 2AK4D 5CSZA 4YDKL 5C0DB 2I60L 4EVNB 2GSGA 4BUGA 1R24A 3OJMB 5ESQB 4F7MB 2H9GB 3UMTA 3L5XL 4GQ9H 1PY4A 2X1PA 1HCVA 2CDEA 1GZPB 1KIRB 2NX5B 3GB7A 2EYSA 2YD4A 1CFNA 4XRCB 3M45A 1DEEA 4NO5B 1Q9WA 2AV1B 4L8SA 3V0VA 1JPTH 3L3DB 2OJZL 4KK8C 3F58H 5EOTB 2H2SC 3PE9A 1Q0XH 3Q6GL 5E2TH 5LVEA 2J4WH 4BFIA 4PJAA 2NX5A 2ORBL 4JN1H 4DQOH 2RFXA 1LILA 4QRRA 3GHBL 4XAKE 3EO1B 2FIKB 5DSCB 4LLDA 1A9BB 1UC6A 5IQ9B 4EUPH 1XF2B 3IAGC 2A83B 4DJMA 2DM2A 1Y6KR 4IS6B 15C8L 4TSBH 5IFHL 1A02N 1TETH 1OAXL 5DFVC 1CD8A 4PJ5A 5E08L 3OKYA 5T3XD 1XR9A 4U1HB 4AM0A 5JW4R 1ZLWK 2EIZA 2P46B 1GZQB 3I6GB 1OAXH 3QIUC 4D94A 5DD3H 2P4AB 4LLQB 4O4YH 3TCXA 5DRXA 1NKOA 1UXSB 3T08A 1ZVYA 2MPAL 3NPZB 1NH6A 1X4YA 4RFNB 4X98B 3ILPB 5B4MC 3BH9A 3MJ7B 4D9QD 3PV6A 4OAWB 1HK6A 3WFHB 5DLML 1PFCA 3G5VB 4QXTA 1KIPB 1RZKC 2VLLB 1KB9K 1GYAA 4P0DA 4QRUA 3MOBL 1JGUL 5C0IB 1JPST 3VFSA 3V6ZB 2ZUQB 3EDDA 3QUZD 4DEPB 4NBXB 3GFUA 1MCKA 2FH8A 4E42B 2I24N 1F8TH 3AGVA 1HYRC 2IWGA 1P7QB 3MRKA 3VFVA 2WUCL 5SWZD 1T4KA 3HI5L 5C0GA 3RZWA 1QG3A 4I5BB 5L88H 1SVZA 1DBAH 3I9GH 3VXOB 1BBJB 5DMGC 3PDGA 3SDXA 4I77H 2IF7A 4XC3H 1NBQA 1EJOL 4UOJA 4HWEL 4PG9A 1PQZB 5C8JB 3VFOA 4NQEB 1AQDB 3LMJH 3D3VB 1ZGLA 3MROB 4NWUH 3O3AB 4O00A 3QDGE 5I15L 2E7MA 1P2CB 2MWCA 1J1PL 3SBWA 4U31A 2WWKO 4QNPE 5D1XB 1BMGA 1XCQB 1YZZA 5EULV 5IV2B 3WFCL 4U1JB 3QWOA 5D5ME 1FZJA 5E5MA 1YUHB 4FQHA 4I0CC 2CO6B 3MC0A 1ZS8A 4P4KB 4KHTL 5D1XC 4C83A 4D9LL 3HE7A 2K3TA 3RUGF 3QNYA 4HKJB 2VLLA 3HI1A 3ARED 4Y5YB 2IEPA 3JUZA 1I9JL 2XY2A 5JO5B 3ABZA 3HUJE 2BOBB 5A2KH 5SWSA 1AQKH 2Y06H 3G6JE 1G1CA 3MLYH 1NGZA 2J6EH 3U83A 4P2RE 1YYLL 2DLFH 2DI9A 1WGOA 1X5HA 4PJDB 3MV7D 1SM3H 3MRIB 2X89A 5KTEH 3T0ED 2H3NB 2J1KA 3QIUA 5INDA 1IZJA 4N8VB 1KXTB 3WS6C 1TCMA 4EQ3A 2NZ9C 2B7DT 2FGZA 5JPMB 5E6ZA 3LH2L 4U1GB 3N50A 1KLUB 4LFHG 1F6AA 4Y5YC 2UZYB 4P2QD 4OZIE 3VD7A 1BBDH 3S96A 4MB3A 4MWFB 1FFOB 4RWYL 3F8UB 1ADQH 1GAFL 4XNQA 2CO7B 2H41A 4PGEB 3MNVB 4PJ7E 4ZUTA 1I9RL 1MRDL 2QHRH 4QO1A 3OG6B 3SQOL 4IJ3C 2Q6WB 1I9IL 2G5BB 3WL9A 3VXPB 1JNLH 5BVPH 4WO4C 1X7QB 3V5HB 5KSUB 1UM5L 1FL6A 4LGPB 3VFPA 4NOBA 3TBWB 1IMHC 2YA0A 4XCFL 1U8LA 2DIJA 4JPIB 3O2VL 1INEH 2PKDA 2QQKH 1G7MB 1T5XA 5E2WH 1Q1JL 4G6ML 2XI9A 3K2UH 3GI8L 3DOSA 2F74B 1LHZA 5IB1B 4WU7A 4LQFL 3PG2A 3O6KL 4XP5H 5JDSA 3BP7A 1TITA 3EDKA 3CC5B 3V79C 1T5XB 1G6RH 2B8OT 3TLRA 2BP3A 5ERWA 1KLGA 4U1LB 2X1WL 1IT9L 2V5TA 3KYOB 4NFCA 3VWKA 1FAIH 3SKOB 2IPUK 4HK0A 1K3IA 4KXZH 1FYHB 3UTSB 2EE9A 1KF9B 1T83C 2X4UA 5D2NB 4M7KL 1UJ3C 3ARYA 3OX8A 4PRPB 1EHLH 4MMZC 3B9KA 4CU7A 3AXLB 2XZAL 4GKOA 1TZIB 5C7XH 3HE6B 3SBWC 2GYSA 4NNXA 4R8WH 2ORBH 4UNTA 3M17B 4HHAB 3B2VH 4OCLC 5TQ2L 1SEQL 1V3KA 3SCMC 1DANT 4QCIB 5GGTH 3VRIA 1NAMA 5I18L 1HN1A 4O51B 5HD8C 1ZA6A 3G5ZA 5DI8A 5A1AA 1BWWA 1TJIH 5L7XL 1QZ1A 3GMNA 4NFDA 3AS1A 4HJGB 3JV6B 3AXLA 4XTRC 5KBNC 1RURL 4H0GA 5TFSH 2OK0H 1T7VA 2UWEE 4H8WH 3CFEA 3CVHL 2R2EB 3MLWH 3QUZB 4XAKD 3ECBA 3ARBB 1KCUL 4UOW0 4GG6B 4AH2B 3MGOB 5HDQH 4MXVF 3A67L 4UV4L 4QHNA 3HE7D 4HXBH 3SPVA 5C6TL 2Y1VA 5CZXC 5CBAA 4NSKA 1EV2E 5DR5H 4F7TB 4DFHA 4K3EL 5DJ6A 1U6AH 5EZJA 5DJCB 1IKFH 4ZFOL 1FIEA 2JLLA 5TH2A 4WV1C 3VGHA 4ENEC 4MXWL 2J6EA 5MEOB 4WWKA 3VG9C 3D18B 5IB5B 5DJXA 3LSOA 3QUXB 1KEGH 4DCQA 3HG1E 4HGWB 4H8WC 2D03H 3LH2H 3LIZH 4G7YH 1HQRB 1M7IA 2XG5A 3EYFA 1MFAH 4OCRL 3EGSA 4AEHL 1MH5A 4P46A 5CEZD 1CCZA 1XF2A 5JXAH 2VZOA 5KVMC 5HHPA 4I5BA 1XGTA 3AMKA 1I1AB 4Y4FC 4WO4A 4XC1L 2BNQE 1A9EA 3LN5A 1WQVT 5F1NA 2W9DH 3S36L 3VRJB 1IKNA 5F7EL 3ARGA 4PB0H 5TE4L 2NNAA 4FFZH 1R5WA 3GDBA 5BS0A 5E1AB 3QIBB 4HUWB 3TF7C 4LASL 2CJUL 3GEWB 2WBJB 4JO4L 3FT4A 4OZGB 5FM8A 2YBRB 3IB4A 4HC1H 5DVOA 4GAGL 2PF6A 2DYPB 5C6TH 4KRPD 2DKMA 3P4OA 5IMLA 1U3YA 4PJIB 3CFDB 3R06B 5ELIA 3V5KA 5IKCB 4IRSB 5EU6E 1K5NA 4PRHD 2P42B 1RY7B 4JQVA 3MA9H 4TULH 1E6OH 3IXAB 4IRJA 4OUUA 1UA6H 1ZANH 2W65A 1OM3H 1GGBL 2PYEA 3PWPB 1Q9OA 2HFTA 5ACZA 1MIMH 1JPSH 4U2ZA 2VERN 3BHBB 3MUJA 3JWOC 1BD2E 3UJTH 1P1ZA 1IGCL 5E9DA 4Z0XA 5L2KA 5SWZA 1TJGL 3CXHK 2ZUWA 4NZUH 4LARL 1S7SB 1FNGB 4I13B 1FRGH 3TT3L 2DIBA 4JVWA 4XPGH 1LO0H 1ADQL 1GAFH 4F3FB 3OPZL 5J9PA 4ONOA 4S2SB 4MD4A 4NQCD 3O3BA 1BHGA 2APXA 3QWOB 3LKOA 3H3PH 4YAQB 2UZIH 4OI8A 4HWBH 1EGJA 3PWPE 4DK3A 1FO0A 3K3QA 4OKVB 3VXRE 3MNWA 3V4UL 1U3HB 5LWYL 3T1WA 5BZWB 1YEJH 3LKNA 5I8CB 4G6FD 3ARDD 2R15A 3MLTB 2NY3B 1RIVH 2AQ3A 4G80A 2NY7H 1GHFH 3S34L 3HC0A 1WZ1H 3V4UH 5LWYH 5FYKU 2JB5H 5I9QC 5FDWA 1CDIA 2NXYD 3U7AA 1WCQA 4TQEL 5ANME 4ZTPH 3QUYB 1LE9A 3RIAF 1L9MA 5FHBL 3ARGC 1FCCA 2ZCHL 3QCVL 4NNPH 4NZRL 3V0AC 1XFPA 3KXFB 4YBLB 2C1OA 1ZSDA 2D0HA 4OFPA 1F58H 3WMSA 4UQ3A 1E6JH 4XT1C 3WIHA 3PWNA 2I27N 5MENA 2YN3A 3R0MA 4KRMB 5T5FH 3G6JA 4HX1B 3VI4F 3O4LB 1QRNB 4QY8B 4KK8D 2OCFD 2NY6B 3UAJC 5AD0A 4WTWA 3ARRA 2EEAA 5IHBA 1KG0A 4UINH 5D7LB 2VXSH 1S3KL 4LBEA 5HPOA 4J3OC 3D3VA 1NMAL 4YHPA 1A3RL 4OIBA 3QUMB 3AROA 3V7MA 3QWRD 1QBLL 4MCZA 2J3SA 2NTFB 2R2HA 3D0VB 5D7JC 3O3UN 5LGKA 1BF2A 5B21A 5DRZB 1BX2B 3DVGB 3QPXL 5D7LA 4MA8L 2R0LH 1KJMB 2YS4A 4Z0XB 5L2KB 2DQJH 4K94C 1ZT4A 4JFQB 4A2LA 3PGFH 1IE5A 3MRLB 3V7AE 4NJAL 3T3PE 1R3KB 2BHZA 1K6QL 5BVJB 5E2VL 3H9SA 4OQTA 2GAZA 1VB9A 5E9DE 4Z7WF 5L2KE 2V7HA 3PWJA 5HVHC 4ORGB 2X4SA 2ZSVB 1ORSB 1R5IB 5HVHB 4S0TD 3QI9B 1JGDB 1MCEA 5DMGD 1AGEB 5I1GH 3OGOE 2O5XL 1NUNB 1YPZA 5CP3H 4Q2ZB 1CGSL 2EO9A 2DICA 4OCXH 5EN2A 2VLKA 2WP3T 4L4TE 3T09A 1X5XA 3GJFH 5DTFA 3SGDI 1JHTB 2X4QA 5CCKL 2XZCL 2OR7A 1FORL 4WCYH 3B83A 5I1JL 2BSTB 1K8IB 5EWIL 4LSPH 2D7TH 2MQCA 3OXRA 4UT7H 1NCBH 3RKPA 4ZXBC 1CLYL 5IQ7L 3SJVE 4PBXA 4ODSH 5EA0H 3IDYC 3OR7B 3MRQA 5KSVA 3DURB 3MRCA 2YPVH 4S2SA 5LBSH 4KK9C 1MNUL 3G04B 5CBEB 5D2NE 4PYHA 4PJBB 4Q6IA 2AABL 3VXQB 2WWMD 3CDGB 2VUYA 1YC8A 5E5UB 8FABA 4APQB 2AKRA 4N0YH 3NH7L 1W0YT 2R69L 5DVMA 5B39G 4X8JB 4BZYA 1BOGB 1AQDA 4UIKH 5FO8A 1BGXL 3VGEA 4FQLL 3BPLB 1P4LA 3CSBA 2V2TB 4NQDE 3RVWC 1XCTA 4JHAL 5E7FA 4L4VD 1J8HE 2V2WB 3RZCC 4ZOCA 2FHCA 4ETYA 2EKSA 3SCMD 3RGVB 4LAQH 1CL7H 4TQEH 1V3MA 4H25B 2EXWC 3LAFA 5JTWA 4KAQL 5LAXB 4K8RL 1TVHB 5GIRA 2BCKA 2IALA 2NYYC 4NO0A 3RGVC 3SDDB 5DLMH 1U2CA 4WUKL 4JY6A 1XIWD 4UQ3B 3HI1B 2DAVA 4ODXB 1ORQA 4GBXC 4ZUTB 3GBMH 4YFDB 2X1OA 3IU4L 3O4OC 3MRJB 4Q7DA 1ED3A 4LHUA 1FCGA 1Q9KB 2YMXH 3D0LA 2X4SB 1XGQA 3G9VA 1PAMA 1DBMH 4LVEA 3CFJB 5I0DA 5KAQF 2EZ0D 5TE6L 4NRZA 2CK0H 5E8PA 5HVGB 1WTGT 3RGHA 5T1MA 1S7QB 3AUVA 2OJZH 3QXUA 1CFQA 3IJYB 4WTZA 4LHUG 3SE3C 1JPGA 1OT1A 2A0LD 5JQ6H 1ZA6B 4ODSL 3DX8B 4WU5A 5HGGS 1LK2A 1P1ZB 2FYYA 4H1LB 2LU4A 3KPSB 1IAKA 4HWBL 4PJ5D 2CUMA 5T33L 3DBXB 3NIFF 4JY4B 5DMKB 2KQMA 1EHNA 3FTGA 2Y72A 2P48B 4FABL 1W0WA 4FXKA 4P57A 3K4ZA 4LVOC 1D6VL 4XHJD 5GGVL 4L8CB 1MCIA 3TH4T 2IAMB 5FGSA 3OZ9L 1DBJH 4JFDB 1I7RB 1C8PA 3TYFB 3L5WA 5TDPA 3VFMB 5IFAL 1NC4A 1G7IB 4RAVA 4DKFL 3D39A 3QO0B 3VXRB 1ZGLM 4G9FA 3G5XB 2VQ1B 5IBUG 3MXVL 3NIGE 1JHKH 4IEFB 3UYRL 4XZUB 3U1SL 2F5BH 2ICWI 3BEWA 4Z7WA 4XHJC 1ZLSH 1UB6A 4YFLI 1LE9B 4Y1AB 3QIBA 4HUWA 1K2DB 3G08A 4TUJA 3UTZB 3OKMA 1A6WL 1HSAB 1YQ2A 4WFEE 3SDYL 2F5BL 3KYMA 4PV8B 3PJSB 3P73A 3MX0A 4FQHB 1MEXL 5F9JA 2JIXD 1M71A 3SE4A 1QA9A 5CGYC 5EH1A 5GRJH 4HXAH 1SJEA 1XF3B 1ZLUK 1FG9C 2R1YB 3FQXB 3R1GH 2DMKA 3MLRL 1FO0B 1MHHB 1QRNA 1V8HA 1OWWA 3MCLH 4OF6A 1YEDB 3B3IB 4QRTB 3BEVB 5F9JB 1F3DJ 2AK4A 4NZTL 3CU7A 4O5LL 4XBGA 3BPOB 1OY3B 2NY2D 4HKZB 4N5UA 5E1AA 3ULUF 3QCUH 4RCAA 2PW2B 1PG7L 4DZ8B 4Y16A 5I8OL 4LCCA 1T66D 5T1MB 3L3HA 2CDGB 1N6VA 5E6IB 1JV5B 2YN5A 5E94A 2UUDK 3QXTA 1K6QH 5CEXB 1IGYB 3OSKA 4YHMH 3F12A 4KUCD 5IMMA 1BZ9B 1IC5H 4ZUWB 4EN3D 5ERWB 4HGKC 2HA1A 4CMMB 1QSEE 4JJ5B 1RJLA 2F8OA 4FS0A 3IAQA 1IILE 2M2DA 1E4KC 1N26A 1OGAB 2APBA 3HI6H 4E0RB 1FPTH 1KJ2A 1WK0A 2ITCB 5DS8A 4DKFH 1WIPA 5DD1H 5GIRB 2MCPL 1N8ZB 3VFRA 1DL7L 3HUJA 1B4JL 1JHKL 1FFPB 5DXWA 5CD3B 1Y6NR 2OBGA 4PJXA 2VN7A 2VL5A 3PNWB 1YN6A 4FRWA 4P5TA 5I1HL 1JYWA 4I0PC 3C2AL 1HYSC 4YX2H 3TV3L 4ZPVA 3V4VH 1OP9A 2ADFH 3GMNB 4R0LC 3QUXC 5KSUA 1DBAL 4EUPB 3QUZC 1HSBB 5D7KD 4Y7MA 3AM8C 3EYOA 1MEXH 4GFTB 1KIQB 4OGYL 4MA1B 1KGCD 3WD5H 1FGVH 1JPGB 3VFTA 4TVSa 5EZOL 3RWCA 3VG0L 5J6GB 1S9VB 4OTXH 3SGKA 4NT6B 3MLSL 1TDQA 2DQTL 2EYSB 2XA8H 4JZJB 4PTUB 5JORA 3HC3H 1JWSA 3VWJA 4P5MA 3M07A 5F1SA 5KSBE 4UBDD 2YPLD 5GGUA 5ESAA 2QEJA 4RWHA 5JW3L 2X9YA 1S9VA 1YC7A 2AV7A 5F7FA 3F7QA 3RIFF 4HS6A 3TT1H 1KLUA 4LRNL 3WUZA 3ZT5A 1JPFB 5H37H 5CZVL 2AXGB 2EDOA 5D2LB 2W59A 4H88L 3LSOB 1RZ8A 1YMME 3UTQA 4MAYB 5JW4M 3I6KA 1VDGA 4GRLA 3U0TB 1ZSDB 2MKLC 4F2MA 1H0DA 2YUZA 4PJXB 4AEFA 5F96L 1BFVL 5HYSB 3H9HA 2DQHH 5DZLA 4LPVA 2X7LA 5EBMA 1A22B 2FSEA 4NHCL 4JRYE 1FC1A 5DMJB 5CIPA 4KK6D 2B0SH 1S7XA 4PRHE 4P9MH 3QXDA 3C09B 2OP4L 3MR9A 4CMMA 4LDEB 3RY6A 4ZQKA 3KXFE 5I1IH 4L9DA 4FQJH 3QH3B 3TN0A 3HMWH 3H7BB 5E4EC 2HLFD 1F8TL 4DZBB 1OTTD 5K9OB 3ULSA 1J8HA 1OCWH 2XWTA 3RWEA 1QRND 3DECA 3HR6A 4KKAC 1NUDA 4KJQD 2F9BT 4QHLA 1GZQA 1IC7L 4MQTB 4XPBH 1T6VN 5HI3C 1VFMA 1FNGA 4P3WA 3L95B 4HIEA 4PD4K 4C56E 4F9PA 2G60H 4MLIA 1C12B 4MXQD 3SO5A 3EYOB 4Z7WB 4RRPG 5ID0B 4M3JA 1X5GA 4PRPA 3RDTA 3IDXL 5BRZE 4GRWE 4JFHD 4TSBL 3LKRB 3TA3D 5MEQB 1H8SA 1BQUA 1KCVL 2AJVH 4XX1E 5JORB 3BISA 5MEPB 5GHWH 2AEIT 4ODBD 5FYJU 3K2UL 4KU1A 1N2RB 4JFDD 3DLQR 2NXYC 4R4ND 3NZHL 1U91A 1I1AC 3HAEB 4Y4FB 4I3GA 5SWZB 3C6LD 2DLFL 4WW2F 1FYTE 3IDJB 5LGJA 4OFVA 2R29H 3KHQA 4PREA 5FYLE 2X4NA 1YECH 3JTSB 5J8OA 1TZHA 3P11H 1L0XA 2E7CA 1XT5A 2I60H 2P5WB 5IB4A 2QSVA 5CSGA 4PRIB 1CZ8H 3QAZC 4KVCH 4FNLL 3RIAK 4OLXH 4K94H 2NY0C 3MROA 1I85A 4AG4H 2A38A 1P4IL 3C6LA 3QQ3B 4WU5B 3P9LA 3PL6A 2WLZA 5HI5D 4EI5B 4UT9L 5FYJE 3FOLA 3WSQL 1CFVH 2EE3A 4BQ8A 3HE6D 2AJYH 4G3YL 4ORGA 4FFVC 3NABH 2XNAA 4FMKA 2Y07L 5D4QA 2QSTA 3RVVC 4I77L 1YUHA 1BREA 3MJ9A 3RPIA 4Y4KA 3H3KA 4LRIA 1UXWA 2VWEE 2IQ9H 1H3XA 3MLXH 2H32B 1YNLH 3QH3A 3TN0B 4PB0L 5SV4A 1OVZA 2JTDA 3U30C 2GHWB 4U6HB 1OD9A 2C7UB 1KFAL 2ZOKA 4HXBL 1CU4H 5ADOH 5IGXL 1T89A 3MRPB 1TENA 4RX4A 3WFBL 1MHPH 4N0CD 2IFFH 3FO0H 3IJHA 2IMMA 1EGJL 1I1AD 1QBBA 3FB6B 5D7IF 2R56L 2VXUL 3QEGL 1MWAA 3FT3A 3O4LD 1T1ZB 3OHXB 2WV3A 4JY6B 3BDXA 4HUUB 5F96H 4Y5XC 1AR1C 5CP7B 5JNYB 4Z8FL 1FYTD 4LEOA 3ZSTA 1YQVL 4KDTA 3T0AA 2VABB 4TRPL 4PJFA 1WBXA 5CILL 2IAMA 3AY4A 4YC2B 3HI5H 1IZKA 2XNAB 4ZFOB 4KJQC 3RWJA 5DQ9B 1OAUL 4Y4HD 3CDCA 1LDPL 3F5WA 1D5MB 3G5XA 5SWZE 2J4WL 1CFTB 4XWGH 3W5MA 4XVUC 3FL7A 3S36H 1ZGLB 3QZWA 5JHDB 1DEEB 1A6UH 1MIEH 2FO4B 1H3PH 4H8WL 1T0MB 1UFUA 1D5MA 3RDTD 3CVHB 4OLWL 1XF5A 4TVPH 1MIEL 5D1ZC 1NDGA 4ACPA 3DUHA 4JB9L 4YHZH 5I8KH 2LABA 4JFED 5TGBA 4QY8A 5DI8B 1R3IH 1MQ8A 4NN6C 3UTOA 1KFAH 3T77B 2VDQL 3HE7B 2LAAA 3BPLC 3ARDA 3T8XA 4LOUD 3FO2A 1IM9D 1EO5A 4KY1L 3ZTJG 4BM7A 4J3WA 2IANB 3BPCB 3HB3D 3STZA 5C6PB 4JKWA 3B5HA 1H3VA 3HE7C 5FK9A 3EYUH 4ESKA 2IQAA 4WW2C 3SN6N 3I75B 2BX5A 4IIQB 4BQCA 1AR1D 2FDBP 1CE1H 3O6KH 2ENSA 1RVFL 3VFWA 4M5YH 1OF2B 2BY1A 2HG5B 5D6CB 2XPGA 3RL2A 2IAND 1PSKL 3SE8H 4OLUH 1MLCB 4PRNB 4HWEH 3KJ6H 2BVOB 3GSNB 3HTLX 4Y4KD 2FD6L 2DWEA 4PR5A 4NM4L 1A9BA 1AHWB 1DUZA 1JGEA 3QUYD 5GJTL 3ALWA 2ILLA 3Q5YA 4G8IB 4I3SL 2VAAA 5I8EA 3V0WH 3CH8A 3LKSB 3V6OC 4P2QE 4RDQG 4J7RA 1HILA 3PWNB 3NCFB 5ALCL 4PJHE 2QQNH 3ZL4H 4ZO6A 1Z9OA 4FQCL 5L7XH 2IGFH 5JZ7C 2VN4A 1CDUA 4K2UH 5DRNA 3G08B 4HH8A 1TVBB 3BGMB 3TZVC 4KI1A 4QGTA 3QHZL 2QR0A 4PP1D 4J3UA 4H0IA 1A6AB 2I9LB 3GMQB 3Q6FB 4S0SD 4LLYA 3QI9C 1Q9KA 1BVLB 3EIFA 4D3CH 1XF3A 3BZFA 3OMZA 3MLZH 1LO3L 3MQIA 5IBLD 3BKML 2OTWA 4X4YB 3RZCA 2QADC 3W2DH 1QLEL 1AXTH 3ARBA 1RK1A 1OM3L 5MHSE 1E6JL 1LEGA 3P4OB 4FQ1H 3UBXG 1H3WM 2O93L 4JFPB 1QVOB 3RY4A 5TF0A 3NCYP 2ZG2A 3C9NB 3D85B 4PLOB 2Q87A 4CJ1A 1B88A 1CK0L 2BNRA 4AEIL 3TN0D 4GW1A 3IF1B 4BFBD 1VKXA 2ATPB 1FP5A 4OSUH 3C5ZA 1MCCA 4X83A 4GKZA 5TQ2H 1RMFH 5FA4B 3G5YB 1DQLL 5I18H 1S7TA 1UZ6F 2EDDA 5EBWB 5FXCH 2C1PB 2VLJE 4XPTH 3MOQA 3WN5B 3T1FA 4YBHA 3SQBA 1XF5B 4E5XA 2X9WA 3BH8B 5F7EH 1FBIL 5IHZA 1FNSL 4FQCH 4G9DB 2MHAA 1FJ1B 5HYQB 3HG1D 3VXME 2MSPA 4S1SH 4ONHB 4PLNC 4UV4H 4WFGE 1S5IH 2IH3B 2B5IC 3RVVD 4JPKH 4MAYD 2R56H 3KYMB 2I07A 1L0YA 1DLFL 3RUGA 4P3DB 1CL7L 1J18A 5DQ9A 4XNYL 1ACZA 1KG0B 3RWGB 4KAQH 1S9XB 1FL6B 1LP9A 1F4WL 1PLGL 4ZTPL 2KL6A 2IAMD 4BQBA 2FX9H 3MLUL 2XOTA 5GSRA 4ZQKB 4JG0H 2ITCA 3EFDH 5DF0A 3T4YA 4IMLB 4H26A 4M02A 1CFBA 3QUXD 1JK8B 4J6RH 4PRDA 2JELL 1EFQA 4ZS6C 5CINL 2XZZA 3EZ8A 1JHLL 3ESUF 3C6LC 1JWMA 3EDEA 4BA8A 3RRQA 3MNWB 2V6HA 4PRNA 1BEYL 4F7CB 4XPFH 3I6LE 3WIHH 4WI4A 4Z6AT 1AO7A 5FECB 4DUWA 1YEHH 1NFDB 2X42A 1F45A 3GUTB 4YHIB 1CICA 1AR2A 3IDNB 5D96B 4WFGD 4ELMF 3FKUS 3MRGA 4FG6C 3WIHL 1CXEA 1HILB 4L3EA 2DKUA 2QQNL 3VCLA 2VO5A 5HYQA 5D1QD 1CD9B 4TVPD 4QHMB 1IKNC 4K2UL 4Y19D 5F1KC 4LVHB 3UBXA 4OLVL 2PR4L 1JNJA 1I75A 3U48A 4OZFH 5DSCA 1E27A 1PZ5A 1WIUA 3QR2A 3H0TB 5F7UA 2QSQA 3UJIL 3HRZA 3WLWC 2IBGA 3QNYB 4HKJA 1C5BH 1CXKA 3OXRB 4M43L 2BSRB 2PO6C 4U0RC 4ZPTB 4N8PA 5C0AB 4MAYC 2JK5A 2P5WE 1HDMB 3Q2CA 3FQNA 3IYLW 3UYRH 2DQIL 5BQ7B 1VACB 3DX7A 3ULUC 2FJGB 3VFUB 3GB7B 3T3PF 2VLJA 4OB5L 4RISL 4PRIA 2W0LA 4X6CE 2AJSL 2GUOB 2HN7B 2OS7A 3L5IA 1KB5L 3HZKA 4F7TA 4PIRF 2JJSA 1KEGL 3TWCL 4CU8A 1YEIL 1J5OH 4HKXB 4XMPH 5GJSL 5FOBA 1T5WA 4OQ1A 3Q1SH 4LCIH 3QRGL 3FZUD 1Y18A 4GRWB 5GGSY 2F19H 5IWLA 3O3EA 1MPAL 4ZS7L 3BIKA 4OGXH 4U1GC 5KVGL 4HJGA 1NCBL 1CDHA 1CXIA 5JXEC 2DQGH 4JDVB 1M05A 1DQLH 2AI0L 4KKCC 1A7QL 2BVOA 5CEYB 1S8DA 1X5IA 2VDLH 2ARJB 3OR7A 5IBTH 1B6DA 1I4FB 3H3BC 1UWXK 1YNTA 3BD5A 5JW3H 3LEYH 3MRDB 4KQ4L 3ZSSA 2JJUA 1DBJL 4M61B 3TBSA 3QUMA 5L6YH 3C6LB 3QQ3A 3WFHA 4JFPA 5ICYB 4K9EL 5GS2H 1QLFB 4JR9L 1U41A 3LB6D 1G7MA 1R24B 4F7MA 3QUYA 4BQ9A 3KPOA 3MZGB 1CIUA 1V7ML 4WUUD 4G6AC 1AC0A 1O5DT 5DD1L 3V8OA 1ROWA 5D96C 5BZDB 5E8OB 4JRYB 3TIEA 5CD5D 2DJUA 4MNQD 4PJHA 1JBJA 3ZHLA 3IFPA 4NJ9H 3ZTJH 1EK3A 1I1YA 3UROR 4OFKA 4I0PD 1U91B 3T4YB 4KRNA 1AE6H 5BMFH 4PJXE 1EIBA 5C0IA 1ORSA 2IH1A 4X7TB 4C56A 1KB5H 5I73C 5CCKH 5GSVB 1YJDH 3LEXA 1HHKA 3ZYOA 1B9ZA 3GKZA 3OKKB 2PNDA 4KTEL 4GS7B 3REWB 2PYED 5GISH 4W70A 4JRXE 4KK5C 4LARH 5SWQB 1X9QA 4BFIB 2DL9A 4HWNA 4FQXD 3UZVB 3WD5L 1KJ3L 4XPGL 3HC4L 4PJ8D 4MS8C 3OG4B 4OZFA 4OTXL 3IDGB 2R8SL 1DQDL 5JOPD 1A7RH 4OD1L 1S8DB 4ONGL 4LCWA 4J1UA 3QCUL 4XNQB 2ID5A 4KVNH 4ELKB 1J10A 3IJYA 3OJ2C 2P43B 4W81A 3ZE0F 3CFEB 5T1LB 1RIHH 5T1LD 2VZVA 3TVMC 1NGWA 4N0YL 4G8GA 1WEJL 2XPGB 4OZHA 4LL9A 5AZ2L 1JE6A 1SJHB 4LRNH 2LV4A 1DVFC 2MTPA 5JO5A 4JPKL 5JIKA 1OSPL 2QLVB 5C0EA 3X12B 2NMSA 4NT6A 5D2NC 5CJXA 1U8MB 3QI9A 3L9RA 1T1WA 1KCVH 2A74A 3AREA 4NQED 3ULUD 5E7BA 5HHXH 3HS0A 3UPRA 3B2UD 3O6LH 4GG6E 1NFDE 5D6DA 5TF1H 4OM0H 4WI2A 3IU3B 4JRXD 3EDJA 4GBXD 4P3CH 4R90L 4DVRH 2UWEB 3HE6C 5F8QC 1L0QA 1PKQE 2O5ZL 3VH8G 3ARDC 3LEXB 1AGDB 1NC4B 3MRMA 2ZCLL 4QF1A 3T4AB 2V2WA 4P9ML 2F54E 1FORH 4WCYL 4XHQA 5CAYB 1QSZA 3FQWA 4Z7NF 2EE6A 2EC8A 4DGVH 4OZIF 1SM3L 4NC0B 3SY0A 4LSPL 4ZFZB 1HIMH 4N0UA 3QQ4A 3W81A 4W4NA 1CD1A 4OZFG 4IM8A 5IB2A 5BZDA 4JY5L 2BDNH 4P2OC 5D7SL 3QDHA 5CJXC 2AEPH 3JUYA 3ARFD 4XP9L 5DJAA 2CLRA 4NZTH 3W39A 1KJ3H 1JWMB 1QQDB 1ODAA 4L9LA 3PP3H 3JWOL 2BDNL 4HXAL 1WAAA