5EN2A

Molecular basis for antibody-mediated neutralization of new world hemorrhagic fever mammarenaviruses
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
219
Chain Sequence
b'EVKLQQSGAELARPGTSVKLSCKASGYTFTNYWMQWIKQRPGQGLEWIGAVYPGDGDTRFSQKFKGKATLTADKSSSTAYMQLSSLSSEDSAVYFCARRRVYYGSNYIYALDYWGQGTSVTVSAAKTTAPSVYPLAPVGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GD01 heavy chain
molecule tags Viral protein/immune system
source organism Mus musculus
publication title Molecular Basis for Antibody-Mediated Neutralization of New World Hemorrhagic Fever Mammarenaviruses.
pubmed doi rcsb
total genus 46
structure length 219
sequence length 224
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5en2A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5en2A02
3GBNL 4OZIF 3N0PB 1ZA3A 3UJIH 3GSRA 5B4MD 4FQLH 4OGXH 4Y19E 3CPLA 1H15A 2NX5D 4PRID 4DKAA 5DSCA 3OAUL 5F8QC 3CDGA 3PGDA 1G1YA 4WO4D 3W11D 4XVJH 4CVZB 3QUMA 2HAZA 1U3JA 3P4NB 1H5BC 3D2UD 4EXPX 2X2YA 4Y8AA 2UWEB 2VC2L 3A6CH 4N0CD 1YQVL 4LSUH 3W9EA 4MD4B 5FGBC 1RZFL 3O2VL 5EZLB 4NKOA 4RMQA 5F1NA 3QIBB 5TDNB 5E6IC 2VIRA 1NGWA 1U8IA 4I3RH 1FZKA 1RY7B 1QBLH 1JMZA 4IMLB 3GSVA 4QXGH 1CU4H 3MCLL 4MXWL 1TQCB 4ZD3H 5HHOA 1NFDE 4K7PY 4PJ9D 5JZ7C 3JZ7A 2NYYD 3QUYB 5BZDB 4NZJA 3FONB 3IDYC 3NCFB 2YA2A 4XBPB 4YHYB 3BT2H 4PJCE 3VXTA 1DQML 2NY5L 4D94A 4GRLA 3IDUA 4ZDHB 4HAFA 1BVLB 1JZ7A 2Q7YB 3GK8H 5DRWB 3VXNA 4PJFA 5DJZB 3VG9C 3FB5B 3WO4B 1JN6B 3TBWA 1P4IH 1R5IB 5J3HC 2DQFA 3UTPE 1QNZH 1O7SA 1TPXB 4WY7L 1SYVA 5IMKA 1RUKL 4Y5VA 5ANMB 1WWAX 2MCG1 1BP3B 1U8OB 4JKWA 1MHHB 4ZSOB 4KQ4H 4F8TA 2EIEA 1MNUH 4I1NB 1T6VN 1HQ4A 1I3UA 1FC2D 2CO7B 2C3XA 3DRTA 4NQDE 4GSDH 1YEGL 3D39D 1C7TA 3MRMA 2FEEL 4OUUA 5CIPH 4UTAH 4U1KA 5L88H 1YDPB 5CD5D 1EHNA 4FN0A 4Q9RL 5LJYH 2GT9A 5DK0A 4I4WA 2VZ3A 1DVFB 5SWQB 5F96H 1IKNA 3H9HA 5CSZB 3U83A 1YA5A 3BWUC 4JPVL 4X8JB 2OR9H 3D69B 1EFXA 4S1SL 3IFNL 4N90E 1JRHI 3D3VD 3K2UL 4NBZB 3O9WB 1E4KA 5KS9F 2ICWJ 1HSBB 4NRZA 4P9MH 4L1HA 4ELKA 2WWMC 2VITB 4LLUA 1DANT 5L6YH 1ZEAH 2XZQH 4H1LA 1JZ5A 1QRNB 3X3GL 5CEZH 3IGAB 5L2KE 1G1CA 4I8DA 5JQHC 2IANA 1RU9L 3A67H 3S35H 4QLRA 5IR1B 5A2FA 4K7FA 4OD1H 1NUNB 2WANA 4CDGC 1EEQA 3UBXI 3IDNA 1U58A 2AJSL 3DRQA 2IBZX 3RNQA 5KSUA 4AIZA 1PYWA 1ZT1A 3MLTB 4R2GC 2ED8A 1TTFA 4M6OH 5KBNC 5D72H 4YHLH 5IT2L 1JV5B 5T5NF 3S3PA 5GRZA 5I30L 2HMID 2JJSA 4HH9A 2AK4E 5DJ2B 2VAAA 1MPAL 3W39A 1WFUA 4OZHF 1B0RA 1IM3A 1F4WL 4NN6B 3CLEH 3QPXL 4TRPL 5EU7E 1A8JH 3C5ZC 2WM0A 4F7MA 4CU8A 5F3HB 4EN3C 4KRLB 5IJKC 1AHWB 1J11A 1DEDA 5L0QC 1FCCA 2AVGA 4OLVL 1I3RA 3RVWD 1BOGA 1C5BL 1A1MA 4NZTH 1QYGH 1OQXA 3ZTJH 3QZWG 1XGYH 5K59F 3OGCB 4GMSH 3KPNA 4ODUA 4K07A 1DQMH 2NY5H 4UIMB 4XVSH 3U30C 5D93C 5KS9A 2F8OA 1UZ6F 5D5ME 3VFNA 1FP5A 2YBRA 3ARZA 3C8KB 4G8IB 1MFAH 4YHZH 3QNZB 3LZFH 1M05A 1GIGH 3MLRL 5HI5D 4IEFB 3GM8A 2HFEA 1CLYL 2QQNL 1F6LL 43C9A 4LIQH 3G9AB 4XP1H 2W0FB 1N5YH 3REVA 1CXLA 3LH2H 1FVDA 1D9KC 2O61A 1AP2A 5IFHH 1KJVA 3MO1B 3QCVH 1IGJA 4Y19B 3E1F1 5ID0A 3IDJA 2R2BA 4IM8A 3WD5L 4I77H 5C0EA 2F74B 2IPUG 1NGPL 1IM9B 3O45B 3D25B 3RWGA 1CXHA 3TBVB 5FO8A 3VE0B 4PY8J 4PV8B 2HWZL 1ED3A 1FO0A 2FJHA 5J1TC 4F9PC 3L7EA 3RGVA 3WE6B 1MJ8L 1T03L 1AO7A 4IMKA 5DF0A 1J18A 3ISWA 3RWJB 5E4EB 5DFWH 2DLEA 4PJXA 1BAFH 5B8CC 1IEAA 5ACLA 2HFGH 1A5FL 4OI8A 1CICC 3MNWB 1DBAH 3PWPE 1QBMH 4PR5B 1ZGLB 1DQDH 1R0AH 1F11A 4OQTL 5GZNC 4JDVA 5JW4M 5CWSB 3MRGB 2YD6A 3RBGA 1LEKA 1DVFC 1OAKH 1PZ5B 1SJHA 3LS4H 4TVPE 4HK0A 3RWIB 1R24B 3MTRA 1JZ4A 5CD5C 1MCEA 1UWGL 1LHZA 1IQDA 4S2SB 3ARFC 4XBEL 2XIDA 1TZGL 2A6DB 3CX2A 4XMLL 2W9DH 2B4CC 3PL6D 5TQ2H 3ET9F 2ED9A 1XGRA 3SOBL 4M1CC 1AY1H 1IL1B 3HG1E 3JBG7 3AROA 1I9RL 5HDBE 4N5EC 1Z3GL 3I6GB 3MXWH 2CLVB 3VXOA 2EH7L 1UH2A 1JHKL 4DKFL 2VERN 1CICB 4KVCH 3RI5F 4C4KO 3FQXB 8FABB 1GPOH 3CLEL 3H9ZA 5EBWB 2ZOLA 1Q94A 2OJEA 2QSCH 3LV3B 3MROB 1CFQB 4PR5A 4YX2H 3FHAA 3PWLB 2VL5A 3G5XA 3BKJL 4N68A 3S5LA 3BKCH 3KS0J 3N9GL 3QJFA 1UB5B 2QADD 4MNQB 5AZEH 2IPTH 5KSBA 4CMHC 1KIQB 4G6MH 2BHUA 1T6WA 3NFSL 3VGAB 3FJTA 3MRCB 5CEYA 3RZWA 3HE7A 4JZJA 1XIWD 3QEUB 4RZCA 5F1SA 2OR7A 1QKZL 3OAYK 4PLOB 5HDQL 3PJSA 5IV2A 2X05A 4LCWB 3C5ZD 4QCIB 3ULUE 2ORBH 5I1CL 2BK8A 3TNMA 2DYPB 1LVEA 4KRPD 2DTML 3I2CL 2X4SB 2HT3C 1AXSB 3H3PL 4P23A 1Q9WA 3OG4B 1AQKH 1UJ3A 4PRPA 4L29B 1A1OA 3P73A 3ZKMD 4FFZH 5JXEC 3QQNA 2P1YA 4HF5H 3P40A 3SDCC 4ZUWB 4CMHB 1M05B 1WZMA 1U3ZA 5ENWB 4M62L 5I75B 3CSYA 3S36L 5EZOL 4LEXL 2OLDA 4NQXB 1EVUA 1L0YA 1MHCB 3BXNA 3QA3A 5IVXF 3UYRH 5GJTH 5I66A 4TTGA 4ONHA 4PGCA 1MUJB 1I7UB 2J12B 3RTQA 4WTWA 3TCLB 3KDMB 2W59A 3LKPA 1G6RA 4ORGB 1IAKB 5FYKH 3QQ3A 1PQZB 3NCMA 4K3JL 3I75B 4JZOB 4U7MA 1I1FA 3U79A 1A5FH 2FBJH 3WIFB 4Q58C 5INDA 1XF4B 4N9OB 1QFPA 1INEL 3RGVD 1R0AL 3VFVA 1HDMB 4HS6B 5TPWL 5J4MA 3IXTB 1UJ3C 3EJZC 1U8HB 1T0PB 4DAGH 5T3ZE 1RIHH 3DYOA 1C5DB 1UM4H 2ADGB 2QTEA 2EIDA 5CCKH 3S9DB 1J0KA 1JV5A 5CJBA 1YY9D 5SWSE 1NFDF 3HE6B 4OCNC 1KCUL 1U2HA 2P5WB 4KK6D 5BV7B 5KAQF 1TIUA 4ZQKB 3AVEA 4MJID 1P6AB 3MLXH 1C5BH 4NZTL 3VGDA 1JGEA 2NXYB 3MJ6A 1SBSL 4MA7H 3O3BA 3D85A 3FRPA 4UIKH 3V6ZB 3M8OH 3SDDD 3I02B 1FNGA 2E8ZA 1NCWL 2DBLH 3H9SE 4L8DB 3K2UH 4ODHL 2A9NH 1HXMA 4HT1H 1NMAH 3O0RH 5L2JA 3QB7C 3DX6A 1EFXB 3CFCH 2ILLA 5I76B 5EO0A 4U3HA 1CLYH 4LF3B 1VEMA 1NLBH 5EOCJ 2XPGA 3STZB 2ICES 3NIDE 2Y06H 3CVHB 3KPRA 3RWCB 5BRZA 1LD9B 4FXKB 4FP8H 5D6CA 1KJ3L 1VACA 1H5BA 1AXTH 3Q5YA 3KPPB 2BFVL 2WQ8A 4LBEA 2W0PA 4S1RH 5DC9B 2M2DA 4UB0H 4ZS6D 5JOFA 1G7MA 4UIMA 1HHKB 1XAUA 3MCKB 2FHFA 1WVZA 1LEIB 5DD5H 1F00I 5ISZE 4ELMA 3PHQA 3O8XD 1GL4B 5FAAA 5D7JC 5IT2H 1LEIA 3S37L 3GSUA 3G08A 5DEFB 4JAMA 4EJ1C 4KQ3H 4JPIA 2BC4A 1KLGB 4BSWB 5FHBL 3N06B 3LKRB 4ETQA 4B0MM 5AZ2H 2VKXA 3IFPB 2HVKB 1XF5B 4M5YH 2R0WL 5D1ZA 2H6PA 2R1YA 3DX8A 3F7YA 1JWUA 5KS9E 2CIIB 1BHGA 4I0CC 3W82A 4PJEE 1WFTA 2G60L 3BP5A 4LSPH 4LF3A 3O8XB 4OQTH 3TJEH 5EUOA 5EO0B 2QHLA 4KJPC 3HI5H 2PR4L 3N1FC 5BOZG 2CXKA 2H9GB 4WEUD 3ARBC 3WSQL 1QACA 5IVXA 4OF7A 3KXFB 2ICWI 2IMNA 4OLUL 5IB1B 3GBLA 5LQBL 1IAIL 1LILA 2R1WB 3EO1B 3L3IA 3WJLA 3V6OE 1OCWL 3NCCB 1R5VA 5JUEH 1DEEA 1IGIH 2NX5E 4PRIE 4HZLA 4H26B 1WWWX 2LU3A 4LSSH 1RZJC 5I17B 1EFXD 4F7EA 3H42H 4NNXA 2M1KA 4MDJB 3LZFL 3MGTA 2QLVB 2M26A 4LSVH 4UTBL 2NXZC 3ALWA 3BGFB 2Y4SA 1H3TA 1ZT7A 4JEGB 4O9HH 2FWOA 4JHBA 3TZVB 3O3EA 4GXVH 1OSPH 3PABA 4KJWD 3EYQD 4NN5B 2YKLL 3UJJL 2EDBA 4D8PA 1BJ8A 3DLQR 1Q9OB 3QG7L 4H8WH 1WCBA 3VU2A 4RRPG 4XP4H 1J5OH 1VFBB 4BK4A 1HILA 1MJJB 3U0PB 2X1XR 5E8PA 2A6JA 3QSKB 3VFVB 5IUSA 4L4TD 1P4BL 1NGPH 2C9AA 1WTGT 5C9JA 3OXRA 4RQQB 5FM8A 1YDPA 1GHFH 3SE4C 1NCDH 3O2DA 4GRLC 4OUOA 3VXSD 4MA7L 2Q76B 5D5MF 3MX0A 5HGDA 2DI8A 4OAWB 5I1LA 5C0GA 3WIHH 4PGCB 3N1MC 1NCWH 2DBLL 1FIGL 1BBDL 4O2FB 1QSED 3FN0H 3ES6A 4MNGE 3ZHLA 4QRTA 3IDGA 5JIKA 4PV9A 1LGVA 1PGRB 1U8QA 4LRIA 3SDAD 1K8DA 2IANE 1T20B 2BY0A 3FO9A 5FB8A 3QDJE 3O6FA 5AWNL 1N3NB 2D7OA 5GRVL 2CRMA 1JPSL 2D7MA 5DJAA 4XGZA 1K2DA 5J6GB 4PTUB 3S4SG 1AXTL 2NY5C 25C8L 1HKLH 2YMXL 1OHQA 1BQLL 4K9EC 3FO1B 1S7SB 1A6TB 5D2NA 4AT6B 4IRZL 3VFSA 5CSBA 1MFNA 5D7LB 1A9BA 3BPOB 4L3CB 3RTQD 1BFVH 2P5ED 2YK1H 2VQTA 2B2XH 1IEBA 4HXBH 5F21B 4XNUH 2EE9A 1SEBA 5KG9B 5EIVA 4HUUB 5EPMA 1J8KA 3CFDB 4X99A 3WHXB 3HS0A 4PPTA 5D7KD 1A7BA 1FG9C 1H0DB 4QXTA 1GOHA 1CFTA 1IBGH 1PDKA 1Q0YL 5A2LH 1Z2KA 1UYWH 5MENB 1GXEA 3GSNL 4JM2B 4G9FA 4CVXB 3OKOA 4MD0A 1QRKA 1K5NA 1ZLUH 1RZKH 4YC2C 3SJVD 1A02N 4YGAB 5E8OA 3R0NA 2BVEA 5DC4B 3V6OA 4QRTB 4TVSa 3BUYB 4MXQD 4A2LA 3T0ED 2RAMA 1HNGA 4OZFH 3NZHH 1CD0A 4JPKL 2I9LB 4NFCA 2BXZA 3SY0A 3ZYIA 3KYMB 3DUSA 4CVZA 4JZNB 1J9CT 4O2CA 1S7RA 5F9JA 1LE9B 3GHBH 5BMFL 2YD2A 4EUPB 1XGPB 5GIRB 2PTTA 3TNNB 4DTGL 4ZUVA 4JDTL 2LFGA 5IMLB 3MRKA 3DO7B 1EIBA 2VLLB 1BGXL 3BMVA 3GMRA 4LCCB 5BQ7A 4OB5H 1QBAA 1KB5L 1CGSH 3H0TA 1NCUA 4PJCA 4BKLB 4NN6C 5LG1A 3R8BB 2YC1B 5H2BB 3BYYA 2YZ1A 1BQHA 1YYMH 5DT1L 3BEWB 3UJJH 2DKMA 1J8HD 2K9UA 2CSPA 2IWGA 3MV01 3B3IA 4HT1L 1UXSB 3OKLA 3LKNA 3MRGA 3CFCL 5LBSH 2HJFA 3PV6B 4HZAA 4OFVA 2BOCB 4RGMC 3GBNH 3MRBB 2LU4A 2HKFL 2Y06L 4YBQC 2HLFD 1D5BB 3L3IB 5GHWH 5A43C 4GFTB 3TH2T 4GXUN 3OAUH 4K55A 3JTTB 4NGHL 2XTLA 4MZ3A 2NY2C 4XVJL 1AFVL 1RVFH 4KKBC 4MNGA 5E7BA 4HULB 1E6JL 5DHVB 3EKCA 1C1EL 4BYHA 1UWEH 4XPHL 3TBSA 3S34L 5IMMA 2GTZB 3TBVA 4GW1B 3PWUB 3WO4C 3C5JA 1MJUH 2AJUL 2DMCA 3KNBB 2QSQA 5BV7L 2AW2A 1RIHL 1NFDB 2CIIA 4I3RL 5LCVH 4M5YL 1XGUB 1G7QA 5CCKL 5CIPA 3GSUB 3LAFA 3U6RA 3ZKXB 3GIZH 4YAQA 1P69B 1REIA 4OZGA 5CS7A 1MFBL 5DGQA 1KCUH 4AQ1B 4S11A 2ESVE 2VDPL 4L8CB 5IVXE 5JXAH 4LVHC 4BH7B 1OSZB 1AKJB 2WBWB 2NQCA 3BIKA 1SBSH 1I8IB 1GGCH 1JI1A 2B39A 43CAA 1FLTX 4HWUA 1CYGA 4HXAH 3MV8E 4LL9A 1N7ML 1I1YA 1A7PH 1YNKH 4JN1L 1KIRA 1OF2B 1A4KB 4JN2B 3SDXA 4HIEA 3O6FB 3QDAA 4L8DA 4YFLF 4LASL 5D5MA 1XGQA 1NBQA 3VGHA 3LKSB 1T0MA 5D2LE 3G6JE 1HZHL 2VDOH 2ZNWA 3ES6B 3LRSB 2CKBL 5CGYC 4KKLC 3T09A 3O2DH 3HPLA 3BGMB 4JO1L 1FNGB 4DFIA 1GGIL 1BBJA 3DUUB 2X10A 3PG2A 3IDYB 4LGPB 4MAUL 4P0DA 3RDTA 5DJ2A 5HYIA 4IBLT 4F9PA 1OWWA 2C3VB 2OJZL 4HJ0D 4KZDH 3MBEB 1P4LA 3PWPD 1RUAH 1XT5A 3HE6D 3KHOA 1RUPL 3IKKA 3GUTB 3BN9D 4OFYD 2V5SA 2VXUL 3RKDC 1WITA 4N0UE 3KS0H 1F3JA 2A6JB 4MAYD 1N5AA 4TUKL 2HFTA 4KKAC 3RVVD 3BZDA 1QSEA 5LGJB 3BH9A 1D5MB 4X0KA 2G75B 4ONGL 3U7YL 1P84K 3P9MA 4BFBD 5INDB 3VXPB 4MWFA 1QSFE 3T4AA 1O5DT 4MCYA 2BDNL 2VDLH 1RJCA 3D18B 5IVNA 1KCVH 4DVBB 1NAKH 3JV4B 2IC2A 1MRDH 4BH8B 3WS6A 3LDBC 4ALAL 4JFFB 1RSFA 2F5BH 4ZUSB 5HJ3A 1UXWB 5FA3B 2DQIL 4P23C 4JKPH 4KHTL 1WT5A 5IG7A 2AJSH 3VXMA 2VLLA 3KJ4B 3WEXA 4ZAKA 4EVNB 2X70A 4J6RL 2EDNA 3EJYC 3MXVH 2Y1VA 3TIEA 3GBML 2AEQL 3SEPA 5DMKB 4XPHH 2ZUXA 1T7ZA 5DYOB 5KVDL 2NY7L 1MHCA 3UZVB 5KN5A 4PLNC 1MCBA 2AERT 1CE6A 3L3GA 4XXCA 4XNYL 2AXFA 4P2RB 4C58B 1KB5A 4JY6A 4YXKH 2IPKB 2Q86B 1F3DJ 4ZOAA 1FYTD 1QSFD 1S7VA 2EDHA 2X9YA 3RA7L 3V4PH 3GSWB 1OD9A 4PJEF 2ICEA 3KPLA 2FGWH 2I07A 4KRPB 3HRPA 2E7CA 4X7EC 1FZJA 3VDCA 1JFQL 5SX4H 3CFIC 4M3KB 1MHPH 4OLXH 5KOMC 1OTSC 3QIWD 3MJ9L 4HWZB 2YD4A 4NO2A 3KAAA 1JGDA 2BXYA 4ODTL 3LKQA 4V1DA 1FZMA 4NO2B 3MYJA 2Q7YA 1G7MB 3AMLA 1BVLA 1FNSL 4HC1A 5FYLD 2AEWA 4K7PH 2BVQA 3IF1A 4XP9L 2EYTB 3EFFA 3VRLE 5F7UA 1H5BB 1VGKB 3S4SA 4ZAKC 4CW1B 3T2NH 3RVUC 3QXWA 1FZJB 5DMGD 5GRUH 3RWDA 1O0VA 3QO0A 3V5HA 4JDTH 2D7TH 4HUMB 3OKMA 1XF1A 5J1AA 1QSEE 4Y4KB 5I1DA 5AG8A 4YHKH 2QQNH 3NACH 4KY1L 5SV4A 3BAEH 1FNEA 1S5IH 1YYML 1WAAE 5IQ7L 3LQZA 3SDAA 1F4HA 4UOW0 3BMWA 1EA9C 3DVIA 5ETUA 3LQAH 4PJ5B 3ZHDA 1GGIH 2N1KA 1FFPB 4D9RD 4WJ5B 3OAYH 2CJUH 3QDMA 1CICA 2HG5A 3TBYB 4FFWD 4MD4A 3OJDA 4POZD 3W9EB 3X3GH 5DI8A 4OI7A 3GJEA 4Y16C 5GHWL 4D9LL 3O2WH 5IB2B 5KSBE 2Q7NA 2RR3A 4ZUSA 3SGDI 1E27B 4NJ9H 1FGVL 1MREH 4F80A 5C71A 2BVQB 3IF1B 1E6JH 4GUPA 1ZLSL 3KVQA 1RUMH 5L7XH 2MFNA 4WFEE 1FZMB 4NHCH 2QSVA 3OB0K 2XN9D 4M6OL 3W2DH 5C0NC 3HC4H 2FZ3A 1EUUA 2Y36L 5ERWB 1D5MA 2OX5A 3IU4H 2AI0L 4G3YL 4X0KB 3RX7A 4ZTPL 1BWWA 4CL7A 4LMQE 2OL3B 3UC0H 3F12A 4BZ2L 4OD3H 3LS4L 3TO2A 3VGGA 1J05B 1L7IL 4HQQL 4H5SB 5DUBA 1NKRA 4D8PB 5I1HL 1BM3L 1CS6A 5FUCE 3KPLB 2BNQA 1PQZA 1W72A 1V3MA 5CZVL 3QDJA 3PHSA 4LDOB 1JF1B 1N64L 2N56A 2DL9A 2JIXB 4PJAB 4TSAL 2ZCKH 3TO4D 4KHXH 5B39G 4CDHA 3C08H 1YMMD 3HMWL 5IK3B 1DLFL 2DTSA 1ZLVK 1T1WB 5J56B 1MHEA 4DTGH 1TQBB 5ILTH 4L4VB 1EXUB 1U3HA 3PIQA 4P3CH 4AG4L 1FGNH 5DMKA 1BGXH 3HKFA 3TA3D 2GKIA 2XXCB 4KMTH 3LKSA 3QHZH 4QYOB 3VXMB 5LAXB 3IJSB 4U2YA 5ENWA 1I7RB 4YJZL 4B41A 5I6XB 4ZTOH 1I8KB 4W6YB 4Z7VB 3EYVA 4N8PA 3M45A 1ZTXL 4U6XA 1FJ1B 3DHMA 5I1AA 5JTWA 3PP4H 4X5XB 4F9LC 1VGEH 1GCFA 3EJYD 1DSFL 1M1SA 2C5DC 3ZSSA 5BVPL 4MDIB 5DUMH 5MP6L 4G8IA 2EO1A 3G5VA 1XF5A 2H32H 5ABDE 2X7LB 2A74B 1AQDB 2WWKT 3BH9B 4U1GC 4YNYA 1CGUA 1OP3H 1JF6A 3PWPA 1FAIL 3EHBD 3WFHA 3GI8H 2VJXA 3NN8A 2DYPD 3F65A 2QQLL 4XBGB 4Q9QH 1AC6A 1FL3A 1MCOL 2NMSA 1M7IB 4PRHE 2BVUA 5FUCC 2HT3D 2BMKA 1RFDL 2Q6WA 3JV0A 2X6MA 3MBEA 1UB5A 4MNQA 3ARVA 2IAMA 4NQDB 4LAQL 3WJJC 1OL0A 2JJVA 5E56A 5IQ7H 4QY8A 1E6OL 3FB6A 3S88L 4MCZA 3GHEL 2NTFB 5GS1A 3C09C 3MLTA 2DQTH 5F7KC 1DTUA 5JLZB 4ODXB 3ZKND 3MRRA 4X6BB 5DRXA 3RIFK 2MKWA 3T77B 2XTJD 3HI6H 2NY0C 5JDSA 1KULA 1PLGH 2DQIH 2FO1A 2C1OB 2B7DT 2R9HD 1FGVH 1MREL 2F53E 1S9XA 3T4YA 5E8DH 3VXSE 3PXJA 3PNWA 2A6DA 4PRPE 1NQBA 2R0LH 5HHMB 4X6CB 5DD0L 5IW6B 5ISZA 4MJ6A 3QEHB 1CE1L 1I1AA 1S3KH 5C70A 3LEVL 2FIKA 3ULSA 2GUOB 4JRXA 4NPYA 5JIPA 4CGTA 1U8LA 5EUKB 2O5ZH 4JFPB 2JELL 5GSVB 5IMLA 3DO7A 4WW2C 3MR9B 2IAND 4XZUB 4QHNA 4KDTA 2AJVH 2PO6B 3BPLB 1U8PB 5CSZA 1HE7A 1J0HA 3OXSB 1LE9A 4TSAH 1WK0A 5HPMA 3VFRB 5C0ND 4KVNL 2PKDA 4S1QH 1ZANL 3EFDH 1ZT4A 4FTVD 4Z7VF 3VFTB 1JGLH 1YEHH 4P3CL 1EGJL 1PJ9A 4H0IA 4M9OA 1Y6KR 1FRGL 2IFGA 5J11C 4YDJA 3FQRB 1LQSR 1IGJB 4G6AD 4O02L 1KJVB 3MZTA 3FN3A 3QFJE 5D2NC 3ILQC 4ODHH 4E5XA 1DUZA 4UV4L 3TBWB 1GGBL 5I8CA 3DVNA 3ARWA 1YEKL 2BDNH 2E3VA 4YGVB 3CK0L 3ZSTA 5I18L 4NUGH 3G6JF 2YD9A 1RZIA 4KY1H 3GZKA 4ZDHA 4HIEB 3CFDA 1U42A 5T5FH 2P8MB 2Y5TA 4OCMC 1FG2A 3LQAL 4FP8L 1VPOH 1EEZA 4IHOB 1JYXA 5E2WH 2D0GA 4JKPL 1EHAA 3PWNA 1EPFA 5DURB 2ED7A 4OGAC 4X9BA 4M7KH 2CLRB 2BSTA 3QH3A 2HRLA 3DTXA 3GBMH 5J6GA 3JUYA 3M07A 4ZOBA 3TCXA 3WS3B 3JWOC 5C3LD 4OT1H 4PJDA 3WUWG 1S7RB 5C0CE 5F9JB 4ZXBB 4RZCB 3ULVD 4IRSB 4NKOB 2H2PD 3U6RB 4OF5A 4ONFH 5CEYB 3UEZA 2FBJL 1G7QB 3TVMD 4FQ2L 1Q9KA 1UACH 4ZFGH 5TPWH 3C5ZA 1MHPL 3HB3D 4FS0A 4M61A 4BZYA 1WEJH 3C5JB 4WO4B 3QCTL 1IC7H 1B0WA 2VXQL 4R4ND 3ULVL 3SKUD 4CVXA 1J0IA 3FCTB 1FE8L 2YPLE 5DFVD 5F7LB 1I9IL 2LABA 5CKAA 4QHLB 1XF3A 2DQJH 3V0WH 3QZWB 3S6CA 1KXQE 2CLVA 4LK4A 2BOBA 1CDYA 2Z91A 4RAVB 5J9PB 4UQ3B 3QIBC 1RJZB 4JFZL 3VD7A 3IGAA 1QHOA 2D7TL 3S98A 3QO1B 1OOAA 4L4JA 2BSTB 3QH3B 4WFGD 1A6TA 1KJMB 3NACL 1J86A 4ZUTB 1G7PA 1BVKB 5E08H 1Z9OA 2NZIA 4QEGA 4KAQH 3MZGB 5K9QG 5JHDB 5C6PB 4TSBH 1XR8B 2I25N 4Z7WB 3C60D 5IFAL 5FK9B 4HC1L 1U8QB 2R56L 1MFEL 5J1SC 2ZCLH 3MRIA 4P2QB 4G7YL 5AYUL 1BJ1H 1KENL 3VGBA 4QRPB 4Z77B 1X3DA 2P5WD 3BPOC 3JV6A 4PJXB 3DMMA 4K3EH 5TE4L 3C60A 1NCAL 3P9WB 2MHAA 2OL3L 3VRLF 5IHZB 1B3JA 2Q3ZA 5DJDB 1IGTA 4HEME 3D9AL 2MQ0A 5JHDE 3VXRB 2IQAB 2HLAB 4NM8L 5DRZB 1ZLVH 3LIZL 3VE0A 3GMNA 1MJ7H 4OJFL 4QHKI 3BUYA 2FL5B 5F9OL 2EE2A 4Y5VB 1QR1B 1WAAF 3KYKH 3WKNA 4Y19A 2H1PH 1I3GL 5D6DC 3MO1A 3QXDB 4YE4H 1MJJA 3U0PA 4H25A 4EDWL 4XZUA 1FVDB 2BRRH 4JAMB 1RK0B 4HPYH 1VPOL 1RPQA 1E4XI 4JFPA 3SHSA 3TT1H 2GUOA 3RVTD 3U9UA 1L6XA 2FX8H 3HHRB 1I1AB 3I9GL 3QUKA 3ZT5A 2B1HH 3WMSA 2XY2A 4I48A 2BZDA 4JR9L 5I8KL 3VFNB 2DQEL 3VFSB 4XXDA 4G6KL 1W0WA 2OR8A 3P30L 1DBJL 4PJHE 4QOKA 5I76A 2YSSB 1ZXQA 2YPKB 4LGSB 3N85H 4G7VH 1W8OA 2HT2D 4N1EA 3QEQE 4G43B 5B3JE 5TDNA 6FABH 5CUSL 3PP4L 1T2QL 3ULVF 2H9GA 4DZBA 1IAOB 1CD9B 3VWJA 4O58L 3O3BB 4OF0A 2IADB 5GGRB 5HYEA 5I0ZA 4F7TA 1L0XA 1KN4H 5FCUL 3E2HC 1FE8H 4LRNL 1CTOA 2MTPA 3VWKA 2H6PB 1WUNT 5F97E 2UVEA 4BSVA 5DO2D 1JHLL 2Z8SA 4HKBB 1KLFA 4U1LB 4NQDD 1A22B 4AEIL 1I8MB 2QQLH 4G6JL 2KUTA 1SJEA 1XGYL 4LLAA 1YEHL 3SJVA 1QEWA 4IIQA 5F96L 3QDGD 1C5DA 2ADGA 5GJSL 4G9FE 2GY5A 5I16B 1QFHA 5E6IB 4HHAB 1G9MC 3MODH 4JRYA 4PJXF 1FIGH 1BJ1J 5I74C 2CDEA 3W0WA 2X7LA 3FN0L 1LD9A 1I1AC 1GIGL 3MLRH 2L4OA 3T65B 5CJQL 3QG6A 4LOUD 4E42B 4RMRA 4XCNB 1XFPA 1RHHB 3MACL 4HFWB 4UZGA 3TGXA 5F9AC 2D31A 2PNDA 4A6YB 5I1AB 5F7MC 1JE6A 1NCNA 3ARDC 1JPSH 4NNXB 4PB0L 4TYUA 4YFEA 3P3YA 1JPGA 3QCVL 1FFOB 3KPQB 1I7RA 3EBAA 5HI5C 2ZUQB 3LOWA 2EYSB 5J06A 3ZE1E 1KCRL 2VZUA 3WD5H 5EU4A 4C56A 3BYTA 2LU7A 1BFVL 1U92B 4YDIH 5TGBB 4APQC 2A83A 4JQVC 4L4VA 2XKNA 4RAHA 1MHEB 3GNML 4TVPD 4JGUA 1C12B 1S3KL 3RWEA 3EOBA 1T03H 2JIXA 4GQ9H 1AR1C 3LS5H 3HCVA 3WFCH 2K3TA 1A6ZB 3MJ7A 3CVHH 3QPXH 3ZYOA 2Z93A 2O5ZL 5GS0D 2ESVB 3QIWA 2MOVA 2BNQB 3QWQB 4TUJA 4XH2B 1D5ZB 4K7PX 4CNIB 4X4YA 1U8MA 5T1MA 5TDPB 3EDEA 1G9ML 3DBXB 2YUWA 4NWUH 5DR5H 5LKNA 3L3KA 1U8KA 3NCYS 2IH1A 3L5WB 3F12B 5DVLA 3L3HA 1LO2L 3SKMA 4XNQB 3NZHL 4PS4H 1RZJL 3DSNA 2XG4A 4KXZI 4JZOA 1FO0H 4JFHE 1N6QH 2C1PA 4XTRC 3TIDA 4BJLA 2GAZA 5E1AB 1DN2A 3R0MA 4PP1D 1IGFH 2CKNA 4S0SD 4XBPA 2XFXA 3JWOL 5GSVA 2YN3A 5AD0A 5C07E 1A7NL 3K81A 3ARGD 3GSQB 2ICWB 2YA0A 4U6YB 3QA3B 3E3QC 5MEOB 2R0KL 1QFOA 2X4OA 4NUGL 5EO1A 1OTUD 1FFNA 4MNHB 4JPVH 3R06A 3IB4A 5IW6A 1OARH 3DO3A 1MI5B 3IFNH 5A16B 3TLRA 2IMMA 4D3CH 3HC0B 1U8IB 1RI8A 4FZEL 3QJHA 1F4YL 4NO3B 1MCQA 4NCC2 4Y5YA 1VFOA 1JHLH 4Z5RB 2UWEF 1QLFB 2HFFA 4OCSL 4N1HB 1MRFH 1KEMH 3F7QA 1IL1A 3B5GA 5C9KA 5C7XL 5EOTB 1CR9L 1IT9L 4Z7VE 1ZEAL 3CXHK 3FT4A 1TVDA 3GO1H 4GOSA 3CIQA 3NAAH 4ZSOE 5HGHA 2C4FT 4W70A 5T1KB 2V7HA 4Q9CA 4PJFE 3U4EB 4GS7C 3EFFB 2H41A 5FM5M 3O41B 4PIRF 1TLKA 1SJHB 1BF8A 2FB4H 1N6VA 1EO8L 2FYYA 3U2SA 5DSCB 3U30B 4M02A 5D8JH 5JIIA 1UADC 2EE3A 4R4FL 4FFYH 4WV1A 5D72L 5L2KD 1LE5B 1CGWA 1BIHA 1YY8B 2Z31B 1OLZA 3WS6C 3EGSB 3RDTD 3RU8H 4B7IA 3H3PH 4X4MA 1HNFA 4KWUA 3QUXB 5CJQH 3Q48A 1V8HA 4U0QB 4N0FB 4QRRA 5CEXA 3QUXA 3K8MA 4XP6H 3QP3A 3DI3B 3TYGL 2LV4A 2LQRA 4LDEB 5T3XD 2GYSA 1R5WA 5FO8B 5IQ9B 3HUJA 3TT1L 3QPQC 4D0CB 3JWDC 4UDTA 2CLZA 5HI3D 4YHOH 3V7MA 1DANU 5HHPA 4M8VA 2J6EL 3B5HA 3DGCR 3DXAE 2IPUK 4XCCL 3VD4A 1NEZG 1NMCB 1X5FA 4P46A 5ICXA 1UC6A 1RIUH 1NGXA 1L9NA 1IVLA 4YUEL 3M17A 5HD8D 12E8H 4LLVB 2HJKB 2XXMB 2J8UE 3LS5L 1Z5LB 2HRPL 3LEYH 3X17A 3MA7B 4QKXB 4PB9L 4MXVF 4ZUWA 4G7VL 4HJGA 1F3RB 3QNYA 5HJ3B 2XA3A 4LPYA 1IQDB 3TYFB 4M1GH 2MKLC 4JFFD 3DROA 5E6YA 1YMHB 3FFCB 4MNHA 4CKVX 2LVCA 4YHML 2DKUA 1LEGA 5LVEA 4OLXL 1GAFL 4RNRB 1JCKA 3PIQB 3MJ9H 5E9DB 4YFDB 1KENH 2FHCA 4L8SC 1ZGLA 3TNMB 5DQJB 4ODTH 4MWFB 1MVUB 1RURL 2BCKB 2BVYA 3RUGA 4OI9A 3ZDYF 1QKZH 2AK4B 1FNSH 1WLHA 3HN3A 3HNTH 5F93C 2ZUWA 1VKXA 3BZFA 3LEXA 2C1PB 3TIDB 1ACZA 3FN9A 2Y7QA 2C7UB 3UCRA 3MLXL 4Z9KB 1KIPA 3NIFF 5JOEA 1W72L 4M3JA 5GJSH 3AM8A 3L95A 4IDJH 4CADA 1WBZB 5SWZD 4DGVH 2YPLD 1Q0XH 1OAYL 4YE4L 1G84A 3G5XB 3MODL 4PRNB 4WHYH 2EKSB 3U7YH 5HXMA 3C8HA 3PQYB 1Q94B 3FO2B 4CMMA 2OTPA 2E8YA 5EO9A 3DETD 2CJUL 4PJGB 2UV3A 2BJML 1IC4L 5E8NA 2J5LB 3LSOA 1IGCH 3NABH 5HYSB 4ALAH 4X7SH 4BA8A 4DOHE 2VDRH 4FXLA 3UYRL 4JN2A 4PB0H 4OZFB 5HYJD 2DQEH 3MGAA 1YPZB 5FCSH 5J7CC 3ME0A 4KK9D 4XNMA 2I5YL 1JMXA 2NXYC 3OSKA 43CAB 5KS9B 4PJ7A 5DD6A 2CDFB 1QQDB 2VLJE 1JPGB 4K2UH 3B9EA 5GZOD 2X4QB 3B9AA 3S37H 3B2VH 4FQXA 2GW5A 1INEH 5F7NC 1KPVA 3IJHB 4XNYH 1LEKB 4ZXBC 2YOCA 4YXKL 5ADOH 1PW3A 4JHAH 1YEJH 4GRMB 3H9HB 1KN4L 2HVJB 3JVGC 1EFQA 1SM3H 2V5YA 4M8QA 4WHCA 5DJCA 3LN5B 4QXGL 2OQJB 1CQKA 3PQYE 4LMQI 1RUQL 5DUPL 5HHOE 1I8LC 3EYSH 4JO4H 4W81A 1I9JH 4CJ0A 5B8CA 4FTVB 3MYZA 4LPUA 2CQVA 5KSAA 4IOIA 3ZE2F 4GG6B 1I85C 3OL2A 2VLME 1AD9A 5BZWB 1QVOA 2NCMA 2NY6D 4E0RA 4J3VA 4DGYH 3L5WA 1MCSA 4KTEL 3L3KB 4DK3A 5IOPA 1RIVH 4A6YL 1NGQL 4K7FB 3QQ9C 5B3JF 3I2CH 4NO0B 3ULVE 1LO5A 2NY4D 3ZZ1A 1DQJB 4Y4FA 3SDYH 4GG6E 3PHOA 5JQ6L 3EOBB 4KTYA 5FM4A 1V7NH 4XNXH 4I3SL 1CDIA 3HG1A 3HC0A 3HUJE 3TA3A 1EEYA 4PRHB 5CILH 2F9BT 4M62H 4JFDA 2EXWD 1C5CH 5D7LD 4PJ8B 2X4OB 3RUGF 2FH8A 1CFBA 4GMTL 5IG7B 1FFOA 1JUFA 2PO6C 4RMSA 1J1OL 5DFTA 1OGTB 3HFMH 1BQHG 1YYLL 5LGKA 1MFCL 4NCDA 4PTTB 1A1MB 3DVGB 4I48B 2PTTB 4PD4K 3TH4T 2X40A 1BZQK 4OUUB 4PJGF 4NN5C 4HCRH 5EFIB 1J1XH 4IDJL 4POUB 3DRTB 4PJXE 4U1IA 4HBQA 4JDZB 2YXFA 5A1AA 4K3JH 2F53B 2DQGH 2VDKH 1ZV5A 1YEFH 3TPKA 4JJ5A 1MHHA 4E41E 5E6IA 1K3IA 3RL1A 1MCPH 5BS0A 4RWYH 2UYLA 1QEWB 1INQA 4OGYL 5FO7A 3U36B 1Z9LA 2Z93B 1FV1B 1ES0B 3WIIL 1QLRB 3DXAB 3B6SB 3ECBA 5T3ZH 3WUWA 3ZE1F 3FMGH 4UUJA 3WHE0 4OM0L 1UJTA 4PJBE 1R3KA 3CDFA 2BHZA 1VFUA 5KVGH 2VZSA 5ESVA 4I9WE 1S9WA 2VE6A 3W9DB 4HUUA 4M93B 3FQUA 3V6FA 4YHLL 4Y2DC 3WNPA 3U7AA 3QIUB 2VKWA 3QDMD 3ARFD 1T5WB 1FGNL 3BP4A 1TVBA 3NTCH 3VI4F 1VENA 5M7QA 3I6LD 3RWFA 3LEVH 2GITA 4P5TD 3HZKA 5GXBB 2IH3A 2HT4D 1UYWL 2C26A 2YKLH 4BFIA 3QIUC 4FXGB 2K7QA 4IRSC 2YPKA 1SVCP 5DJAB 4P4RB 3D0VA 5C07D 4HWEL 3QG6B 4JQIL 4XMPL 4ODVL 3FO9B 4GKSB 3QIBA 1MLBB 3CNKA 2X4TB 1I8IA 4OLVH 4XPBH 3W0WB 1AKJD 1ZANH 4P4KA 4LSDA 1LWRA 1XCTB 4KQ4L 3TFKC 1KLUB 2D4FA 3U7WL 4OV5B 5MEQB 1WT5C 4YO0B 2VUYA 3OMZA 5DZLA 3OJ2C 5CJXA 1LP9A 4L8BB 4NP4H 3GI8L 3S3SA 3O6LL 3WXVH 2OSLA 3NH7L 3CDGB 3E6HA 1S9VA 1S7WB 1Q38A 4U2ZA 3SKNA 1BIIB 3FCTA 4UV4H 1SYSA 3GGWB 3O2VH 4LLMB 3TJHC 4GKZA 4HKBA 1KB5H 2ATKB 2ITCA 5E2VL 5CEZD 3REWA 2DRUA 4LAQH 2P5WE 1HILB 1VADA 4NM4H 3LPWA 3O4LE 4S1SH 2DI7A 1P2CB 2PYEB 4ZNEE 1PD6A 4DN4H 5DMGC 4W6XB 3CD4A 3BKYL 4OLZL 3OBAA 1NDMA 2XWBB 4U1NB 3TZVD 4M7KL 1EMTL 4HMEA 1TTGA 1WQVT 2VDRL 3UROR 4BELD 1FNHA 3PF2A 1B0GB 4O4YL 2ARWA 4XVTH 2EIZA 4Y4FD 3W0WE 5LGHH 1HK6A 5IJVB 1DUYB 1OB1A 1OGAB 2CLRA 3DV4A 4YUEH 3E6FB 1QA9A 12E8L 5EZIL 1VHPA 1DUYA 1OB1B 1OGAA 4N8CL 1ERNA 1OT2A 4QF1B 3T1FB 2VLJA 3RGHA 1Q0YH 1JNHA 3KYOA 3QDGE 4JFEE 1D6EB 2JCCF 3O3UN 4U1NA 2CPCA 3CSPA 5I1KH 2UVFA 2JTDA 5TH2A 2WP3T 5BV7H 1JI2A 1EDQA 3T04D 1OAQL 1M71A 4TRPH 2D03L 2VXVL 4GKZB 4X4ZA 3Q2CA 3T0AA 4WFED 3RPKA 2QSTA 4E5XB 1XZ0B 1MNUL 4EXKA 3N50A 4XP4L 2YZ8A 4OFYA 2JJTC 2OBGA 2IALA 4JZNA 4BFGA 3CH1A 2X89A 3FT3A 4MX7B 3HUJB 3E6HB 4MNQE 5GS0L 1KLUA 2YD7A 2ZZUT 4P4KC 2ITDB 3C6LC 3RJQB 1MY7A 2XRAH 5IHZA 3OXSA 1J12A 1LP9B 4L8BA 4YDLB 3BSZH 5IM7B 3QCUL 3VXUE 4MXVE 1HHHA 4J7RA 3UTQA 1HEZB 3X3FL 4L9LA 3S3JA 1BBDH 4PGZA 3WL9B 1CL7H 3CFEA 3O4OC 2Z31A 4J3WA 4P2QA 4KK8D 5I8OL 4Z8FH 1CFTB 4NNPH 4X9HA 3STZA 2DBJA 4K9EH 3U2SB 5F7EL 3ZKXC 3QHFH 2P8PB 5L2JB 3KJ4C 3WDJA 2HLFC 2P5EB 1KF9B 4NHUB 4BFIB 4YH6A 2FX9L 4DW2H 3QISA 3U7WH 2E9BA 3VFGL 3UTSE 4RFNC 5HYJB 4M00A 3OHXA 5HYQA 4LHUG 4XT1C 5C0BB 4O51B 4YPGB 4NT6A 5CP3A 3T0WA 2HT4C 1EBAA 5GRJH 1EX0A 3CFKB 4HLZG 3DMMD 5HHVL 2KDGA 3AC0A 3EIFA 4HLJA 4RDQF 4RMVA 1IGYA 2BOBB 2P42B 4X7TA 1YEIL 4TULL 2HN7A 1RULH 5F3BA 2QEJA 4UOW1 5IBUB 5DJ0A 2R69L 2EKJA 4TTDC 2BNRA 4HIXL 2CUIA 4JRXD 3HNVL 4PJIB 3MNVA 3AM8C 4WO4A 5AD0B 4ESKA 3JWDH 3D3VE 3F58L 4JGJA 4PRNA 3BKYH 4Q0XL 1QFWI 4UV7L 3I9GH 3GMPA 3MRQB 2H3NA 1WFNA 3V7AG 4OCXH 4RFOL 5FOBB 4O4YH 2RHEA 4XAWL 1LO0L 2VLMD 5JNYB 3IAPA 4G9DA 2H3NB 1NLDL 3DX7B 3FMGL 1EZVY 3G6DL 4YHPB 3QWRD 3Q3GB 1NUDA 3IFLH 4GAYB 1WCQA 4YLQT 5IWLA 4YXHL 1HXYB 4MNQD 4N0YH 3UO1H 3RVXC 3KDMA 5KVGL 4U1HB 2DWDA 3DBXA 4U1MB 1HWHB 4ONHB 5EUKA 4JHZA 1FIEA 2IFFH 1OP3K 4C83A 3VXUA 4J23A 3TZVA 4I18B 3MJ7B 2UZIH 4QRPD 3X14B 4S0TD 2YD8A 3UBXA 4LLWA 4UT9L 5D70H 1F4AA 4M43H 4O58H 2HN7B 1J88A 5JO5B 4KV5E 4X4XA 5HHME 1CLZL 4TNVF 4Y2OA 4TSBL 2WBJC 4U6HB 1OGAD 2OTUB 3J8F7 5E94B 1DEEB 1LP9F 5DVKA 4JQIH 4XMPH 3HZYB 2DM4A 1Z5LA 1F2XK 5DDHB 4Y4FB 4M7ZC 4DQOL 3F6IA 3O3AA 3QWOB 3SPVA 5HVWA 3EYFB 5AUMA 2DWEA 2GK0A 1UVQA 2XA8L 4JQVA 3DGGB 5T1LA 1A1NB 5D1QC 1M6OB 5DJYB 4FQXD 4IOIB 1WBXA 4LCWA 5HGGS 1ZSDA 2F19H 5EORH 5I0DA 5KVFL 4R4BA 2ZJSL 2NY6B 4NNYB 2OTWB 3WXVL 4TSCH 3T2NL 3Q1SL 3QHTC 4H1LH 4KKCC 2FHBA 4LLDB 4MVBC 2PETA 2KZWA 4JRYB 1HH6B 1J05A 4L4TB 4ZFFB 4YHKL 1OAKL 2YD5A 4UQ2A 4TNWK 3HC3L 1MRDL 1MY5A 2X9XA 1UGNA 3ROOA 3X11A 1E28A 3GIZL 4ZPVB 3RUGE 4DN4L 1SJEB 4MX7A 2Q8BL 4NOFA 4I0PD 3L6FA 3EYUH 3I3EA 5JW4N 2FR4A 1HSAA 3VXQB 4LU5H 5C0DB 3BESR 5C08D 4GQPH 5C6TH 2AJZB 1FDLL 3BP6B 4NC0B 4PJIF 2A6KB 3SDDA 5FO9B 2CDFA 5KVDH 1QBBA 1BD2E 4NIKB 4XPTH 3SCMC 5I1IH 2DDQH 2XQBL 3BGAA 4NJ9L 4OZHB 2EEBA 2A73B 4XB7A 2L7JA 1N7MH 1I8KA 1XH3B 3PDOB 4EOWL 4G6FB 5FGRA 4ZFZA 3QUZD 2FECI 1JRHL 1A47A 5ACMA 2G5BB 3T77A 3RJDA 3I02A 3BKJH 1JFQH 2EZ0C 2VLKA 3HMXA 4X6CF 2VLJB 3IDMB 4QOKB 1XGTA 5CD3B 1WBZA 4DAGL 3U4BL 1L7IH 4X98A 5KZCB 1MH5B 2EDJA 1URLA 4PJBF 5C1MB 4R90L 1CN4A 4NRYA 5LXGL 2P5WA 2EIBA 4HDIA 2WMPA 4FHBD 2VDQH 1S78C 4G8FA 4GLRI 4QXUH 1G6VK 2G2RB 2PXYC 2OP4H 3C6SA 4J3UA 1CDCA 3RVUD 1KBGL 1PAMA 2O26U 4X83A 1CGVA 4M5ZL 5D1ZD 1C7SA 4ZYKB 3CU1A 3VI4E 1RK0A 1KB9K 3UTSB 1YJDH 1IM9A 3O45A 1DQQB 2BVTA 2IH1B 2VB5A 4M6NL 5DJ6A 1EHXA 4UT9H 1QR1A 2P44B 1AQDA 4DKEH 1WF5A 1BZ7B 4Y19D 3B4NA 2AKRB 4I9WD 5HVHB 1S7WA 3U46A 4TPRL 1V3KA 1TJHH 1YNLH 1LEGB 1XH3A 2ENSA 3S36H 5E5MA 3UTZB 4PJBA 2DLHA 5IEKB 4N0RA 4EBQH 5FYJH 4DQOH 1NAKL 5KJRL 3BDBA 3GSOA 2MSPA 4U0RB 3MSPA 5D7LE 1JHTB 1FHGA 4Z7UB 3MRLB 1TJIL 1VB9A 2P8LB 2FH6A 1XCTA 4LSQH 1DQLL 4PLKC 4NZUL 5A40E 5DD1L 3W11C 3TBYA 4YZFF 1TZIA 2GJZA 2FDBP 2RIKA 2JCCB 4M1DH 2A0LC 2RCSL 4XPAH 2B1AH 2E7LC 2NY7H 4CN4A 4FQIH 1QUNA 4O5LL 3OPZL 5I1JL 3KPOB 1HI6B 3FB8B 2HYMA 1XIWC 1I3RB 1U93B 4E41D 1UZ8A 4QGYA 4Z7UE 5IQ9A 2GITB 2GJ6D 1AXSA 3ARGB 5HGAA 1HH6A 1TVBB 3OKDA 5IBLD 1WV7T 3UYOD 4GW4B 3QIUA 4H5SA 2FSEB 4YDVB 4LCWD 5L8LB 4WV1B 3KJ6L 1U3HC 5B38A 1JZ8A 2OL3A 5CJOH 2Z91B 2RFXA 4FNLL 1NCCH 3L3OB 1X5HA 3RIAK 5DQDH 4TUOA 4NQVB 3P4OB 4POZC 3CVIH 4O2EB 1MF2H 4PFEA 1PLGL 4GUPB 5FDWA 4CUCA 4UAOC 5I1IL 3VWKC 3O3AB 3LMJL 4NQEB 1YNTB 5INCB 3ZKNC 5GS2H 2HTKD 3KLHD 4FFVD 1SEQH 4JFEA 2BNQD 3MRPA 5DHYB 3PWLA 3IYLW 1TTUA 5C0RL 2X44D 9CGTA 1WISA 2G9HB 1Q72H 5EU5B 4WUUB 3O6ML 1CE1H 2HG5B 4P2QD 5MEPA 2UZIL 2DI9A 4GH7B 5C2BH 3VXOB 4PJHB 1PEWA 5D70L 1ZHKB 3K46A 5EC1B 1TMCB 1NC4B 4R97C 4JPKH 3PDOA 4HUKB 2ICWA 1CLZH 3OX8B 1MI5D 1ROWA 3G04B 2YSSA 4LKCA 2Y25A 3VFWB 1HN1A 1U8JA 4LVNC 3CUPA 4Z7WF 4RMUA 2GSGB 3LHPH 1TQCC 5B39A 2NPLX 1NFIB 3D1MC 5KVFH 3B9KB 2V7NB 1EGJH 1W72H 4L5FL 4WFFE 4XNQA 3OAZH 1FRGH 2CIKA 1VFAB 3T2PA 3V6BR 1JNLL 2MJWA 3P4MA 1U8KB 4XC1L 2DLTA 4TSCL 4H8WC 1LO5B 2YPLB 5CKGA 1T5XA 5IW3A 3OV6A 2IBZY 2XACC 4PJ7E 5ITFA 2SEBB 3JWDL 1K4CB 4V2BA 4WFHE 4I5BB 4GBXC 4KUZH 1T89C 1W2KT 1E0OB 3HZVA 3HC3H 5F3BB 4OKVA 5T5FL 3CZFB 4XP6L 4RFOH 3D6GA 1MQKL 3VG0H 1IM9D 3EOYG 4PRAB 1OM3H 1JTOA 3BFOA 1LO0H 3FQTA 4XI5D 2GQHA 1KTLA 1U8NB 1FNLA 1IGTB 3BN3B 4YXHH 5IIEA 2F8VA 2W0LA 4KPHL 2APWA 5E9DD 5HYJA 2APXA 1N2RB 3H2WA 3MLSH 5EULV 3ZDXE 3B9KD 1SMOA 3MR9A 4YHNA 2IFFL 4M8QB 2X70B 2PUQT 1FZOB 3AAZA 1V7ML 1WIUA 4OZ4A 1A14L 3VJ6B 1RHHA 5D96C 4UNUA 5GGSA 1WICA 3LKNB 2R8SL 4QRPE 1GVIA 3RQ3A 3B3IB 2JELH 3FO0H 4G8EA 1IZKA 1UKSA 3GSVB 5EBGA 2UZYB 4ZTOL 4RWHA 3BEWA 2C3WA 3MV8B 3VFPB 5F7HA 3UTQB 1BQHB 2YC1A 5H2BA 3D18A 2ZSWB 1KJMA 2IG2L 4D9RE 2AEPL 2ATPB 1GAFH 3T4AB 2V17L 4LHUD 5EZLA 3IAGC 3BIAX 2V2WA 1SMAA 3F5WB 4GKNB 2IBGA 3RY4A 1L9MA 3LRHA 5J9PA 2KQNA 3B9DA 3MOQA 3KR3H 4EUPA 1ZVYA 1FLRL 4GRWB 1OTTC 3HNTL 2XZAH 4WI5A 5JNYA 5JPNB 3AGVA 5JORA 1QO3A 3BZEB 3SQBA 3L5XL 4WFFD 1MCOH 4NWTL 4CMMB 1BWMA 5L88L 2I9LA 3SY0B 4L4VE 3RWHB 2DLFH 3DUHA 1AJ7H 1A6VL 1IQWL 4F7TB 3GSRB 2NY0D 3NGBB 5IMOB 3BDYH 3UTTA 3O6KH 5FKAB 3GMQA 4JLRA 5IMOA 1T7YA 1ZK9A 1BEYH 4ZXBD 4YBLB 1YEDB 2E6JA 2WBKA 5K9JL 3W5MA 2BNRB 4IMKC 1MCFA 4KJWC 3VI3F 5JW3L 2I24N 4WV1C 3C6LA 4RFEA 1QLEH 5TFSH 2KL6A 1XGQB 5ESAA 2YD3A 3OZ9H 4NYLB 5SWSD 5C09A 1FYTB 3V0VA 3NFNA 5HGBA 1NH6A 4M7ZB 3PGCA 3QI9B 4LPXA 5F88A 3WKML 1AGFB 4Y2DB 3WNMA 2EECA 4HKJB 4OBRA 5T3XH 3CGTA 3RP1A 5HHQA 5EN2B 4H20L 2HJFB 3PV6A 3SGKC 5HYQB 1G6RL 1CVSC 3DYPA 2BNRE 1CFSB 4PGEB 4Y4HB 4PJDF 1A3LL 3G5YB 1NBYB 4G8EB 3QXAA 5DD0H 2P8MA 1JPTL 3INUL 4YBHA 1F6AA 3QXDA 4OTXH 4JFYA 2H1PL 1F4WH 4R0LC 1XF2B 2PW1B 3K2MC 4OD2A 4EDWH 3SDCD 1NBZA 2DD8H 1HEZA 3NPZB 5F6HI 4N5ED 5E7FA 1NJ9A 2BSSB 3ILQD 2GTWB 3GKWL 3Q6GH 2VZVA 2AJVL 2OSLB 5CZXD 5KOVC 4AY0A 3KNBA 4FNLH 3VH8A 5DJDA 4ISVB 4HUXB 3ARUA 3STLA 4I13B 3JUZA 3ZHKA 4KPHH 4LSTL 5IFJB 4DKDC 1VCAA 2EDLA 2AEQH 1UH3A 2COQA 4JR9H 3OKKA 4RX4D 2W92A 3ZYZA 3NTCL 3OR7B 3SGEI 2EXYC 2AV7B 4N0FA 4QRRB 2I9TB 3OF6D 5IMKB 4IJ3C 1K4CA 1V5JA 4JO2H 2ZKHH 1KSRA 4WUKH 3BX7C 1TVHB 5GSRB 4DKEL 1A7PL 3FT2A 1CBVH 1T3FA 4PJAF 4X6CE 5CMAA 1TJHL 2WLYA 4JFYB 5TH2B 3P4MB 3O6MH 2X5PA 2IH3B 1S7UB 5C0IB 1F6AB 3SCMD 3ULSB 5FYJL 1XR8A 5KJRH 3MV8D 4FQHB 5HD8C 1X4YA 2RB8A 3DV6B 2FO4A 4JRWA 1DBKH 3U82B 4MZ2A 5T1KA 4JO1H 3CC5A 4MHHG 2Z4QA 3CUPB 2VE6B 4X80H 2DLIA 1U8JB 3A0OA 2PTVA 3OJDB 5EOTA 4LHUA 1S9XB 1TETL 4WW2F 1XF3B 1C08B 5I1CH 4P2OD 1YECL 3T0EC 1FZKB 2V2XB 3O4LB 4RAVA 5D93B 1A6VH 3QIBD 3MJ8B 1B6DA 1AQKL 3TBTA 4P9HL 1FL6B 3BAEL 1P7QB 3RZCB 4ZFOB 2GCYB 1KJ2B 1YN6B 3KXFE 3PV7A 1KNOA 3Q6FB 4WI3A 4IOFC 2GCYA 5E8EA 4KJYB 3FB6B 2EDTA 1UFUA 1QSVA 3QDGB 4JFDE 1T0NB 4XCEB 4ZFGL 1P7HL 3WNLA 2C4XA 4OLZH 5EZOH 4RAUB 1V3JA 3MACH 2GAZB 2B1HL 4OLEA 4U1GB 3B2UD 5ICYA 5MHSE 3O2WL 1MQKH 3VG0L 3CVIL 1WJ3A 2NLJB 5KANG 5T3ZL 2XN9B 4YZFE 4LHUB 4OM0H 3WHXA 1GC1H 1PG7H 4J6RH 4WI4A 4EUPG 4F7PA 4GAGH 3F5WA 4P2OB 4YNYB 4Z7QE 3MRNB 5E6ZA 1Y6NR 1EEYB 4FXKA 4R2GD 5D6CB 3OJMB 4BUHA 2QHRH 1KN2H 4Q6IC 3ARBA 4ENED 5GGQL 4TQEH 3AS3A 2HMIC 1S7VB 3E0GA 1D7FA 3RZCC 3WN5A 5I8EA 3D0VB 1I7ZA 1HI6A 3KPOA 3CVHL 4MHHI 2VXVH 3UBXG 2NW2A 3V4PL 3EYVB 4KAQL 1ZHBB 1FSKB 5CFHA 3BHBB 1L4IA 4H26A 3BKCL 2F54E 1FN4B 1JVKA 4PJ9A 5EA0H 3RHWF 2BVOA 3VJ6A 4ODVH 3EYOB 1AXIB 2P4AB 5E2TH 3GMOB 3NFSH 3I6LE 5GGVY 3UMTA 3RVTC 1XEDA 1WAAA 2LTQC 4G6JH 5AYUH 4AL8H 3MRLA 2NTSP 1AHWC 3DX9A 3TM6A 3W9DA 5DHXB 4ZO6A 1UXWA 4YK4C 5FA3A 1KG0B 2AS5M 5D7JB 3GSOB 5IK3A 4YDJB 3SKOB 1NCAH 1IFHH 1U8NA 5HVFB 1JNLH 3S35X 2OCFD 5DMYA 3B6SA 3L5JA 1EHLL 5GGRY 4RMWA 5JA9A 1KXVC 3SDXE 4EQ2A 3U36A 4J12A 1Y18B 5FO7B 4JM2C 1BZ7A 1MJ7L 4ZS7H 5KW9L 3ARDA 3MLYH 1XF2A 2G75A 1UCTA 4G8GB 1M4KA 2APFA 3MV11 2KKQA 3GSXB 5DLML 4Y4KC 5FYLE 3MUGA 2FIKB 2J88H 1F3JB 5ITFB 1T22A 3TPUA 5ERWA 2HP4A 3OAZK 4HPYL 1G0XA 1U95A 3PHQB 1G9NH 3P77A 1P7KA 2AJXL 3K80A 1EAPB 1CDUA 3HNSH 3QEQD 4JRXB 4NPYB 2GJ6B 4K94C 1MCCA 4R7DA 3OB0H 3P11H 2EDQA 3PDGA 4CJ1A 3T4YB 3N1QC 1Q1JL 3PGCB 4MDJA 1ACYH 4BSVB 2EDWA 4Y4HD 4UOJA 3PNWB 1KG0A 3NA4A 5I8KH 4JJHA 1NAML 1XR9B 4KDTC 5ESAB 5ESQA 3O9WD 4YFLI 4PRHA 2F58L 2YUVA 3U0TB 5ID1B 1T04A 1VEOA 4PJ7F 3S88H 1KYOK 3LB6C 5C0AD 3SDXB 1T04B 1ZHBA 5TE6L 1OF2A 3KLAA 1NSNH 2WBJA 3INUH 4MJ4A 3U0TA 5K9OB 5JIHA 4MQSB 1G9NC 5IVZA 4OSUH 4MJ5B 3SQOL 1QR4A 1IJ9A 5IBUG 3JVGA 2OZ4H 3SDCA 2IAMB 2ZNXA 4UV7H 5GS1B 3ZO0A 3F8UB 1BZ9B 3ILPB 2G9HA 5EC2A 5CP7B 2I26N 3TN0A 4HUVA 4OZGF 4ZQKA 1XIWA 4XAKE 4DEPC 4XTRD 5DTFB 4EIGB 4JPIB 3BZFB 4PY7A 2DQUL 2N4IA 5CHNA 3IJYA 2APVA 4TUOB 4YAQB 1MVUA 3T8XA 1ADQH 2VH5L 5A2JH 3VDBA 4P57A 1HHKA 1TQBC 4RSVA 1V3LA 3VXSA 4Y16B 3AXLB 3MV9A 4DCQA 2HTLD 3QJFB 2ZKHL 5ACZA 3EO9L 4CU6A 1MCRA 3FFCA 1YMHA 1NCTA 3ARDB 3GB7B 2WIIB 5K9JH 1Y18A 4D3CL 3CU7A 2FATL 5JW3H 4XNZC 2WWKO 1WIOA 5IMMB 2X42A 4Q9BA 1F4YH 1YN6A 4NNPL 4WO4C 5D1XA 4QTIL 3MV9D 4YHIB 4QOKD 3VRIA 1G6RB 1BFOA 1R3JB 4HG4J 2APTA 1WBYA 1ZVSB 3CLFL 4EEEA 3QUYD 4S1QL 5B4MC 4XC3H 3NAAL 1OAXH 1JGLL 3O6FD 2APBA 5ALCH 4HUNB 1T1WA 4XNMB 4X80L 2WLZA 5FYJE 4X6DF 5HHPB 2F19L 4JKKA 1KTLB 2OZ4A 2GHWB 5L9DH 2OTUA 1TETH 3NZ8B 4NKDA 5E94A 3FQTB 3C60C 3ARTA 1RZGA 1UXSA 1ORSB 2Z4QB 3WFEL 2XQYK 5JO5A 3CC5B 2A2QT 1FBIL 4OM1H 3TO4B 5TQ0L 5I18H 5C07A 4M03A 4WFHD 3HE6A 1W0VB 4DOHB 3BH8B 5T1DL 5IEHB 3KPSD 1ULVA 3BO8A 2VN7A 3VI3E 5D9SA 3RRQA 1S7QB 2DD8L 3HNVH 4NQED 1LE5A 2IBBA 4F7PB 1NFKA 2Q8BH 2C3HA 4OIIL 4I0PC 4P46C 5D2NE 5IV2B 5HVHC 4J8RB 4LVNB 4X5LA 5I71C 3EJJX 1A7OH 1RJLB 5KVMC 3KPMA 4KJQD 5FF6A 4L3EB 3RTQC 3U4EA 2B2XL 3UX9B 3A6BL 3WNOA 3SGJA 3S96A 2NNAA 1K6QL 1SHMA 4OD1L 5DXWA 2NY2D 1LNUA 3IFLL 4ZPTB 3DSFH 1E27A 1IGIL 5ID0B 1T7XA 3QEQA 1KJ2A 2L0DA 3VGFA 2QQKH 1QNZL 4LEOA 4FQ2H 3REVB 3V7AE 3FQXA 2W0FA 1MWAA 2MMXA 5FGCE 4YHMH 1I1CA 1BFOB 4C56E 1OPGH 4LEOB 2G5BA 3L3JB 1IC1A 3HS0B 4GXVL 4U3XA 3ZE0F 4I2XE 4HEPG 4U1JA 4U6VL 1H8OA 3A6OA 4Y4KA 4WENB 3IDIA 1FNEB 2B5IB 3DTXB 4RA0C 4Y1AE 3UPCA 4K3DH 4OCSH 1JZ3A 1XGRB 1NGXB 1CR9H 3IKCB 2X4SA 4CRPA 3RVWC 4NFBA 4UTAL 3RWDB 3WXWL 4ODUB 1H3PL 1A0QH 3CAFA 5CHNB 5D7IA 3PJSB 1JK8A 5C0IA 1B88A 4JANA 1EO8H 1S7TA 2VR4A 3LRGA 4PJAE 2FSEA 1QRNE 4NC2B 1YN7A 2ADJB 5I8CB 3A6CL 1X4ZA 1A7QH 5DQ9A 4ODWA 1SBBA 3QUZC 3QIWB 4MMXC 2ZCHH 3BH8A 2BVPA 5IEHA 3WE6A 2DQTL 1HKFA 5I1LB 3V52L 3FQRA 3QDME 3OKKB 1X5YA 5FYLL 1CE6B 2R2EA 2FJGB 4BQCA 1OAXL 2AV1A 4DGIH 2R4SL 4RIRB 4TVPL 1B9ZA 2FEDC 4L1DA 1F8TH 3D25A 3TBSB 4G8GE 5MERB 3X12B 2AJYH 3OQ3B 1WBXB 2VUOA 5E8PB 3GFUA 3JTTA 1XR9A 1CLOL 2V5RA 3QI9C 5TDOB 3NA9L 5CJXC 3TN0C 4PRPD 1PEZA 4PBXA 1D5BA 2VSCA 1UT9A 5BJTA 4J3SA 3QUZB 4JQXA 5I1GH 3L9RA 3QNZA 4MA8H 3CFBA 5CSGA 1L7TL 3C87A 4GO6B 5J11B 3G5YA 5IHUH 4P5MA 5EU6E 4DCQB 1J10A 3L9RB 4OIIH 5I17A 4EN3D 5D7KE 2EDFA 2Q20A 4KU1A 4K8RC 4UINH 5J57B 4RGNB 2H2PC 1DZBA 1B0GA 1R3IH 1PY4A 5J3HD 3UP1A 4M6ML 1GGCL 5LXGH 3H9SB 1IFHL 3VWKD 3L7EB 1I8MA 4NDMA 4D2NA 4Z7QF 1PX3A 4M7JH 2DQUH 5C0FA 3O8XA 4HUVB 4PJCF 1JGVL 4GG8A 3GUTA 4YR6B 2GIYA 3HPLB 5GGTA 1IM3B 3REWB 2EH7H 3GDBA 3HZVB 2GSIA 2Z31C 4MJ5A 1Z9MA 1PSKH 3BOVA 4PRBB 1D5ZA 2WSKA 5GPRA 3QAZC 3SKNB 5HHXL 2ESVA 3QDJD 2BMKB 5BW7C 5DQ9B 1A6ZA 1X5IA 4U49A 4HWEH 3J7HA 1C5CL 4HIJB 3HAEG 4BM7A 1S5HA 3IDNB 5ITBL 4EBQL 4MLIA 1VFAA 1ONQA 4P5TC 4AEIH 1HQRB 5HHOD 2CR6A 1AIFA 3ARBB 4XXDB 2VABB 2YBRB 5C08A 4ZNCD 3QUML 1UH4A 3SE8L 5C0BA 3QUKB 2YN5A 3QFJB 4TUKH 3KPQA 3OHXB 5BXFB 5IB4B 2VSDA 4PRDA 3SDXF 4L8CA 4OFDA 3D9AH 5BVJA 3VFWA 3OGCA 4QNPE 4MA3B 2ZUSA 3WFEH 3HLAA 5FXCH 4RBPK 4Z76B 4U1JB 4J2XA 5F9OH 5L0QB 4I18C 4DUXA 3GJFA 4OZ4B 1MCPL 5T1DH 4RAUA 4OZGB 2H2SD 3VWJC 4HF5L 1CF8L 4WUUA 3FQUB 2WNGA 1CG9B 5FIEA 1HHHB 4NNYA 3IT8D 3P4NA 1J0YA 4OAWA 3BD5A 3EYSL 3ARSA 4LEXH 5DHVA 1WWCA 4NDMB 2FX8L 2A1WH 4KMLB 4JFOB 1RQ5A 2GK2A 3MXVL 5I2IB 1P9MC 3VFOB 3DX9B 1ADQL 1CIUA 3GMOA 1MAKA 4LLYA 2BSED 5AAWA 1U58B 3DRQB 2QADC 3L3OA 1AI1L 1M7DB 1GPOL 4QHKJ 4JJ5B 1AGBB 4M7LT 1EK3A 2PCPB 3FQNB 5SWZA 2NYYC 4PG9A 3CFJB 4RGND 5HHNB 1S7QA 3VXNB 2N7AA 6FABL 2XYCA 1Y0LA 1BQSA 2CIKB 2IPTL 4I18A 1W0VA 1V7NL 4HC1H 4Q6YA 5HDOA 5BRZE 4KFZC 3O9WC 3B9KA 1U93A 4OZGE 5D71L 4OZIE 1OY3B 1JWMB 4U1MA 4U1HA 4M48H 3FT2B 1IAII 5FYKE 2OL3H 4GAYA 5HHOB 5HDQH 3Q3GA 5BQ7B 4TNWF 3PL6C 5GGUA 4I77L 3QZWA 4N5UA 4HX1B 2D9CA 5CGYD 4Q74A 5K59E 4WHDA 3FL7A 1MAJA 5ICYB 3GIVA 2ERJB 3MRQA 2QJDA 4DK6A 1DDHA 3SDAB 2VXUH 1Q8MA 1J7VR 1JYVA 2J4WH 4FQJL 1N0XH 1R3JA 4LARL 4NUJA 1PSKL 3DECA 3CSGA 1JPST 1FVEB 1KYOJ 3P0YL 3UTZA 1JZ6A 5EUOB 4JPWH 5C92A 4KZEL 3ARXA 1YPZF 3MNVB 4Y16D 1SY6L 1NC2D 3NPSC 3JWNC 2AQ1A 4WDIA 5JPMA 5DRNB 5LWYH 4WTZA 2HJLA 2M8XA 2B5IC 4J3OC 4FQCL 1U0QA 4NQEA 5INCA 1ZE3C 4ZXBA 2FL5A 4NBXB 2UZXB 1TCMA 3GJFB 1DR9A 3MJ8A 1H0DA 4FFWC 2DQFB 4K94L 4QXTB 4XHQA 4JQXC 3E3QE 3GMNB 1TJGL 2V6HA 4WWKD 2VXSH 1ZA3B 4L3AA 3SE8H 3WLBB 2CXGA 3ROLA 4KHTH 1CXEA 4G6KH 4Z0BL 1AY1L 3D39E 4PY7B 2J8OA 3FO1A 1I4FA 3T1WA 1OTTD 1GGUA 3FFCD 4KTDL 2VL5B 4IHOA 3R8QA 3CCHB 2ZUUA 1Z3GH 1JNNH 3NCJL 3DV6A 4DKFH 1N3NA 1FPTL 4GKSA 2P43B 2Y6SC 4MB3A 4O00A 4QHUA 5E2UL 3QEGH 5F89A 3QXTA 3MGOB 3KWWB 2A6IB 3LN4B 3STBA 4AMKH 1A2YB 4XPGH 5I15L 1NL0H 4X6EA 4FRWA 1HYRC 2IAMC 3WFBL 1LK2B 4JM4L 2VLRA 4KROB 3WEXB 4OLWH 3V6ZA 5GISL 4OZHA 4YK4B 4WFGE 4OZFA 5I71B 1IMHC 5ESVB 3FT3B 2WUBH 5EZJA 3CH1B 3MUZ1 3LSOB 5LQBH 4HUXA 4APQB 4KROC 1E4XH 2X4PA 2OM5A 2H26B 2H2SC 3CMOL 3VWJD 5F9DC 5HPMB 4KMTL 4HG4K 4PG2A 5HI4D 4N0UA 3TVMA 3L6FB 2PO6A 2GJ6A 1F11B 1ZLWH 2CGRL 5TF1L 1TZHA 2PW1A 1M71B 4OD2B 4Z8FL 5CZKA 5KTEL 4JO3H 4NOBA 4O9HL 3T0BA 5IF0A 5DA4A 4IRJD 5DD3H 1G0DA 4HWBH 4LOUC 4OCYL 1H3GA 1VERA 5JR1L 3CJJA 2QADB 3VA6A 4WTXA 5JW4Q 3SO3B 1DLHA 4EI6B 5GRWA 1X5KA 2GFBB 2NZ9C 1ORQB 4C57C 2AJYL 2V2TA 4PJEA 1QLEL 5TFSL 4HBCH 1IAKA 3NZ8A 1A3RH 5F88B 4PJ8D 4JY4B 4X98B 2P48B 3SGJC 3QDHA 3L7FA 4LCYB 3ULUF 1T0MB 3SBWC 1QG3A 2XWTA 4LAJH 4QWWC 1Q0XL 3EYOA 5H94A 3WFCL 3TYFA 5JLZA 4MD5B 2E6PA 2WW8A 4ELME 4F7CA 4PJ9B 1A3LH 1A4JA 4B5EA 3HE6C 1YQVH 5IVXB 4RIRA 5CGMA 4Y1AB 1QHPA 5D1QD 3BPNB 5H8DA 3DX8B 3F58H 4HKXB 1G9MH 1IC5L 3K8LA 4GW5A 4RISL 4L29A 2CRZA 4BZ2H 1VA9A 3SDAC 1IC4H 2CUHA 5I75C 3H9YA 2QL1A 1TCRA 1CDJA 3KGRA 3Q5OA 4XAWH 4R9HA 3ZTJG 4D9QD 1HKLL 2BNQE 2YMXH 1S7TB 3D2UA 5GRYA 5E8DL 4N0YL 3EHBC 1K4DB 3D2UB 4LCCC 4LBEB 1AD9B 1UZ6E 3H42L 2CKBA 4XCCH 3OKYA 2AXGB 5DC0A 1DN0A 4HXBL 3T3MF 4OKDA 1XGUA 5D7JD 3MUHL 4Y0GA 2NX5A 4P23D 4PRIA 1UA6L 3IU3B 1H8NA 1T89A 4HD9A 1NPUA 1FVCB 1N8ZB 3FOMB 4PJ9C 5JZ7D 1KPRB 4NCC1 2VAAB 3O81A 4P4RA 3FQWB 3MCG1 5HY9B 1CBVL 5BRZB 4PB9H 2WBJB 3IDIB 2H8PA 4YIQA 3WUZA 2ZWLT 3ZKSD 1CD8A 5GGTH 1AGDB 3GSNA 1G7HA 3WN5C 3RZCA 5LAXA 1P4BH 4BSJA 3QEHA 3H8NA 2DQHH 1S9YB 5MEPB 3WJJA 1NKOA 2W60A 2DQCL 2XA8H 1OTSD 4BFEA 4QHMA 5J89A 4AJ0A 3LQAC 3KPSE 4ONOA 1UEMA 3MLZL 5A2KH 1U91B 4UT7H 1HHIA 2VDML 1FAIH 1R3KB 4H1LB 3QULB 4CVUA 1U91A 1VFMA 4ZMAT 4GSDL 1VDGA 4Q9QL 3QDJB 4Q2ZB 3NFPB 3RVXD 2AGJL 3BQUA 1JYNA 4X7DC 1RZKC 1MCWM 3UBXB 4JO3L 1YEIH 2G5RA 2ZSVA 4TULH 1T1XA 3D69A 1Y6MR 4PJGA 4X8JA 5DD3L 1EBPA 3VXUB 3P0YH 2R69H 4KI5D 3GSQA 5DMIH 3BWAA 4R26H 4G8GA 3MFFB 3FQWA 5JMOC 1QBLL 2CMRL 3RNKA 3HRZA 2VLRE 3FRUA 4KRPC 5F9WC 1TVHA 5GSRA 4ETYA 5FA4A 1EEUA 3BO8B 2DJUA 2AV7A 4G8GD 2V7NA 3TCLA 2P5EE 1M7IA 2J5LC 5MENE 1YMMA 2Y7QB 4BQ9A 4HS8L 4WUUE 2QR0B 1OGTA 3QQ3B 1N0LA 2ERJC 2I60L 3N1PC 5KSVA 4FABL 4ORGA 2JE8A 4KH2A 5HDBF 5EU7C 2BY3A 1X5XA 3U0WL 4PJ8A 3I6KA 1JWSA 1X7QB 1I7UA 4H88L 2CD0A 1LK2A 1PZUB 4M1DL 5I73C 2GTWA 4XH2A 3VD5A 3G5VB 2DQGL 2VDKL 1OQOA 5DJXB 1BJMA 2FX7L 5I30H 2BSRA 4WW1A 3H6JA 5M94B 4PJHA 3SQOH 3MGOA 2DJ4A 1S8DA 1F45A 1RZ7H 4RWYL 3OJVC 1DQJA 2Z92A 1DBBL 5IKCA 5GZOC 3WIIH 3QO0B 3V5HB 5I15H 1CK0L 2YA1A 3WFBH 1A9BB 3HPJB 4NT6B 3T1FA 1FCGA 5CJOL 3MA9L 3AXLA 3AS1A 5BO1H 3GRWA 5IBLC 4R2GB 3HAEH 5FUOH 3V5KB 2P8PA 2WUBL 3OGOE 1ETZA 3C6SB 2HH0H 2NY2B 1NUGA 3G6AA 4GAJH 1E4XL 3TV3L 1NGWB 3WCYA 1T20A 1K85A 1AHWA 1K8DB 5F7DB 4HWNA 4NQTA 5DTFA 3MMEA 2DQDL 4L3ED 2EDOA 5F72S 1YMME 1P2CA 1N59B 5CP7A 3BRFA 5E9DE 3TWCH 5JQ6H 5IFAH 3BQUC 4CN6A 2R56H 8FABA 2XOTA 1YY8A 4OF3A 2VLKB 1BX2A 1CFQA 1U2CA 2EICA 5ALCL 3CPLB 2B8OT 3QRGH 4M1CD 3RFZC 1T2JA 3JTSB 1ODAA 2BY1A 2OJZH 4L9DA 3O6LH 4MQTB 3I6GA 3HA0A 3AMKA 4PGDA 3NH7H 5IWLC 1RUPH 2X1PA 1F58H 4PGDB 2QKIB 4O5LH 3B2VL 1FBIH 3BKML 3VDAA 1K8IA 4DZBB 2DB8A 5TQ0H 2CR3A 3JV4A 1CZ8H 5E2VH 4FQHA 3O3EB 1YPZE 2GY7B 2Y9RT 4XCYA 1YEJL 1MCJA 3MJ9A 3MV8A 3AS0A 4MJ2A 4HH8A 1TDQA 2DL2A 1KCLA 4PLJD 4MCYB 1P7KB 3P77B 5TE6H 4PG9B 2VQ1A 2Y5EA 1PZ5A 2O93L 1AGBA 4JM4H 4YBLC 3QIWC 1LK3H 4Z6AT 3PQYD 1P53A 4LCUB 3Q5TA 2O5YL 2I9TA 1N59A 3GSXA 4ZOCA 3FB7B 4AM0A 2Z8RA 2PXYA 4LNRB 3ARDD 4OGYH 1AC0A 5GJTL 3I50L 2EYTA 1T83A 1I9IH 4XWOC 4DGYL 3LQMA 3M1BA 4JREB 5TQ2L 3MV9E 1P4LB 1MAML 3P30H 1FO0B 1NANH 2FJHB 3ROLB 1ZSDB 1RIVL 1JL8A 1TXKA 1NEZA 3MLVL 4LVOB 1R3HA 1BD2B 1Q72L 1VADB 5E1HB 1I75A 1UVQB 1T1YA 4AENA 5KTEH 3QUXC 1XGTB 2AJ3A 3LKRA 5J13B 4LLMA 3EO9H 3RA7H 3D39A 3NIDF 2FGWL 1YEEL 4LRNH 4D0BA 2Z92B 4XX1E 1FVEA 4MMZC 2A0LD 3VFUA 4MA3A 3N9GH 3WDHA 3AB0C 4MAYC 2ZUQC 2VISA 1MRCH 1JF5A 4DJMA 4HWBA 1LO3H 3HFML 2JB6A 3ORJA 4HKJA 3QI9A 1VACB 5DURD 2A6KA 5FO9A 3SDDB 4KJQC 2AJZA 2DM2A 2FNBA 5HBBA 2F54B 4M93C 2QQQA 1QFWH 5DD1H 1D5IL 1AFVH 1G7IB 1EO5A 3TF7C 4XP9H 2QR0A 4JG1L 4HGMA 4N0CC 3STLB 3NIGF 1UWEL 1MQ8A 3R1GH 5EBMA 3HAEA 5I1EL 4UT6H 2DTMH 2H32B 2ZUYA 3OPZH 5I1JH 5EC1A 4TOYL 3QQ4A 2IEPA 1KCSH 4ZS6C 3V9FA 4AEEA 5E6ID 2FBOJ 2NY4C 2Y23A 1OTUC 2ADIB 1DVFD 1WSST 1I3GH 1DBML 5F7EH 3D87B 3HRZB 2A9ML 4JB9L 4R4NC 5EIQA 4UQ3A 3T0EE 3MNZB 2E27L 5C2UB 3WFDH 4F15B 4MQ7A 3EOTL 3KJ6H 1I3VA 3ARPA 1MFBH 2BRQA 5C0FB 4HKZB 4AEFA 1L6ZA 4IIQB 3EOAB 4MNGB 3NGBC 5EBLB 1A1NA 2EDEA 1FH5L 1MIMH 2PO6D 1QVOB 3OTTA 2GK0B 3SGKA 1I9RH 1INQB 5GGVL 4HIHB 3QWOA 2IANB 3BZ4B 1MFDH 4OF8A 1HHJB 1OAUL 5E2JA 2H45A 4ELMF 3BUTA 1G6RH 4O51A 3CDYA 4K71B 3NPSB 5L8JB 3MNZA 4P5TA 4E41B 1YNKL 2HKHH 3LN5A 4YDVA 1CWVA 2CDGB 4ZO7A 2ADIA 3GI9H 2FO4B 1A6UH 3GSNB 5GZND 5EWIL 1P6FA 1F90L 2AABH 2F54D 3HLAB 4P9HC 4NQUA 1YC8A 1FZOA 4OCXL 5E00A 1DP0A 1Z9SA 1H8SA 4ZO8A 5DEGB 2ARJB 4R7NB 4L9LB 3G6DH 5TJWK 1MAMH 1T2XA 2BHYA 4NSKA 4JCMA 1I7TA 2VAJA 3WNNA 4UI2A 3TA3B 3T3ME 3X12A 2VABA 5IROC 1AIFB 3MLUL 5KVEH 1K4DA 3DNKA 4NKIL 5HYSA 3B9KC 4WHTA 5C6WH 4Z95L 3O6KL 1UQSB 3PHOB 3BVNA 1U9KA 1HQ4B 3QHZL 4WUKL 3RL2B 1LDPL 5SV3A 4P23B 1AO7D 2BERA 2XWJB 3KPSA 1ZGLP 3RBSA 4LDLB 4RCAA 5CINL 1NFDA 4G9FB 5IOPB 3RL2A 2WWMD 2VDLL 5DJ0B 3PUCA 6CGTA 2OMBA 3FHQA 4LHJB 5DRWA 1WTLA 4K9EL 5DK2B 3T0EA 1EV2E 1RJYB 4WI8A 4X7TB 4HIIA 4I2XA 1EZVX 1GHFL 1JN6A 5J13C 4MSWB 3MBEC 5DRZA 1I9EA 3MJGX 4PUBH 1IEBB 2IF7A 3HE7B 3NVQA 3QUMH 5B39B 3CZJA 3V4VH 3JV5A 4NSKB 1VKXB 2FJFA 4AM0B 4QHNB 1S7SA 1X6LA 2OQJA 2PF6A 4QRUA 4NRYB 2MQCA 2BCKA 2X4RA 1YECH 3HE7C 1F58L 4ZAKD 2DN7A 2FX7H 4JFED 4JY4A 3RU8L 3TFKD 3O6FC 5FK9A 1RULL 3EW3B 1A14H 1AO7E 4V2CB 3P0GB 1P5VA 2YPVH 3IDMA 5AZ2L 4L9LC 2CRIA 1WZKA 4HQQH 2D03H 1CF8H 4J4PA 4NKMA 5I1HH 1NC4D 1L7TH 3QNYB 3GHEH 2QKIA 3B8YA 2VO5A 4URTB 4O2FA 4ERSH 3QUZA 4MQXD 3MCLH 5BJTB 5ICZA 3HI5L 1BQLH 1N64H 2WQRA 4NC1E 2AEPH 2HJKA 4IRZH 4J4PD 4D9QE 3JTSA 4OCRH 5TDOA 3GGWA 2YK1L 4XHJC 2E9JA 2XY1A 3BT2L 5EBLA 4XPTL 4M6MH 3BP6A 3AUVA 4ZUUB 4S2SA 3TV3H 3TA3C 3M8OL 2JB5L 4ZUUA 4NZDA 3QCUH 4MAYA 4V1DD 1IBGL 4HCRA 4G9FD 3FO2A 4GAGL 3RI5K 3PWVA 1BREA 4YO0A 1IAMA 2AV1B 4JRYD 2W0KA 3HR5A 2IADA 1Q9OA 1P4IL 5GGRA 4DZ8A 2A9NL 1BMGA 1AJ7L 1CDHA 1RZKL 3TWCL 1VGEL 4DUVA 1CT8B 1RUKH 3L95B 2ATPA 5J12B 1NUFA 1DSFH 4WU5A 1UZ8B 1BEYL 3BN9C 4FFVC 5FYKU 5MENA 3MGTB 3V5KA 4FZEH 3VFGH 4JANB 2FLBT 1JP5A 4NKQB 5FKPA 1G7IA 4BQ8A 4NKDB 4HJJL 3IETA 4U6TA 1SEBB 1MCIA 3CCHA 2IQ9H 3BJLA 5IB1A 5E9DA 1N2RA 3WKMH 3EZJB 3SCMB 1ZAGA 4GLRH 5FUZH 1H3UA 3MUY1 1B4JH 1NANI 1KUMA 1AR1D 3BP7B 5FHBH 4YHIA 2XTJC 2VC2H 1C16B 4IJ3B 5DJXA 5F1IB 4YPJA 5C8JA 1RZFH 2DIAA 3NCYP 4FQCH 1RZIB 4FQXC 4P9ML 3AB0B 3X14A 2Q8AL 2LAAA 4R3SA 4XMKL 2VQUA 2EXYD 1IAIM 1SYSB 4F57H 2BC4B 4I5BA 2XKUA 3HTLX 2A9MH 4FQ1L 1GGTA 1BM3H 2X9WA 1NGZB 5IW1A 1IILE 4PUBL 3IJYB 5H37H 4MXWH 3V4VL 3FKUS 4LVHB 2MHAB 4Z0XB 3M1BB 3P11L 4RDQG 32C2B 3UXFA 3GMMB 1YUHA 4HDIB 3FOLA 1SY6A 4N90D 1NBVH 2B1AL 5FF6B 2R0LL 1NFIA 1DJSA 5CBAB 2MCPH 3SKMB 1QFUL 1E4WH 3QEGL 5CD3A 1J0JA 3IVKB 1INDL 3TT3L 5KAQG 5D2LF 3BD4A