5EN2A

Molecular basis for antibody-mediated neutralization of new world hemorrhagic fever mammarenaviruses
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
219
Chain Sequence
EVKLQQSGAELARPGTSVKLSCKASGYTFTNYWMQWIKQRPGQGLEWIGAVYPGDGDTRFSQKFKGKATLTADKSSSTAYMQLSSLSSEDSAVYFCARRRVYYGSNYIYALDYWGQGTSVTVSAAKTTAPSVYPLAPVGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GD01 heavy chain
publication title Molecular Basis for Antibody-Mediated Neutralization of New World Hemorrhagic Fever Mammarenaviruses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Viral protein/immune system
total genus 46
structure length 219
sequence length 224
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5en2A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5en2A02
2R15A 2A6JB 1KYOJ 3TPUA 5JHLH 1A8JH 3PXJA 4QOKB 3NCMA 5E00A 1EBPA 4NUGH 4EI5C 1SJEA 3V5KB 4LEXH 4KU1A 3O45B 5EPMA 1FO0A 1JPST 5ADPH 1BHGA 4JFQA 1IZKA 4GKZA 4XNZB 1JPTH 1E4KC 1TQCB 3P73B 3EYQD 5IBTH 3WIFB 4X8JB 1RFDH 4HIHB 4JY5H 4WJ5A 1FZMB 5TE6L 1KN2H 2CUHA 3X3FL 4P99A 4MJ2A 2MFNA 5FB8A 4YXLH 1NCBL 5MEPA 1TTUA 2FD6H 1I9RL 1MQKL 1I1AD 5FM5M 1WQVT 3AMLA 4U31A 5TE7H 3MBEC 5BRZE 5TF0A 3CMOH 2X4NA 4OQTA 1MVUB 5KJRL 3O4LB 4LAQH 5CGYC 4TNWF 5F44A 1HDMB 1UWGH 2BC4B 2X4TA 3K1KC 4LSTH 4NBYB 1OL0A 3FB8A 5BVPL 3S4SG 3OKNA 3EJZD 2FR4A 1DQQB 1IILE 3BYYA 1R5IB 2AEPH 2K7PA 4U7MA 5E94B 2NZ9D 4XPBH 1E4WL 1J05B 5F1IB 4NP4L 4OFKA 2WINA 4WI5A 1C08A 4KQ4H 5FOBB 3MV11 5IVZB 4BELD 2D0GA 1NSNL 4URTB 3LMJL 1BZQK 2C26A 3SDDB 4QRRE 3VD4A 1XGTA 4LVOB 5TE4H 1T0NB 3ARBC 2D03H 5T1DH 5MI0C 3MREB 2NXYC 2A83B 5FHBL 3VXNB 1NFDA 5IM7A 1NGYB 4PJ5E 1X6NA 4ODVL 3KPOB 3MRJA 5AZEL 1TPXB 5EO1B 4KRNA 3BRDA 2CLRB 1BEYH 4HXAH 3OL2A 1G0XA 3JWDH 5L9DL 2CLZA 3B2VH 5DC0A 1LQSR 3QULB 4WUKH 3MCKA 3WBDA 5JNYB 4LIQE 4X9GA 5EB9A 3X12B 4NZDA 5D6CA 2YPVH 2I5YH 4EDXA 1DQDH 2FX9H 4X6EA 3DJ9A 2J6EL 2HLAB 4R96B 4BK4A 4L9DA 4JRXA 1ULVA 1KLFA 4NZJA 3RWHA 3EFFA 3QUMH 2X70A 2IANE 4ONHB 2VO5A 1CWVA 1BBJA 3EYOB 3HZVA 3MRIB 5CUSL 5F7MC 4QOKD 3ULVE 3CVIL 5EOCL 3RUGA 1J1XH 4XVUC 3IDUA 4ZAKB 3EBAA 3GRWL 5LBSL 2MMXA 3HAEH 4FHBD 4Z7NE 5F70A 1U93A 4YPJA 1I3GL 4TRPL 1U3HA 1M7IA 3QCTH 2DL9A 4OLZL 1T2XA 3PABA 1PYWA 4MDJB 4RNRB 2IC2A 3L7FA 3LRSB 1ZVSA 4OUOA 3LS4L 2P24A 1KTRL 5IOPA 4OZIA 1QFPA 4RWHA 3X14B 12E8H 2FDBP 4K71C 1H3UA 2Y5EA 1D9KC 2OZ4L 5I1LA 1ZSDB 3QT2A 2DMKA 2ID5A 1NAMA 2GJZB 4FQ2H 2ADGB 4JFEA 2FYYB 4GBXA 1GOFA 4P4RB 4Z95L 4E42B 4N8CL 3ZL4L 4KY1H 1M7XA 4NWTL 1JZ2A 1S7VA 1VADB 2EYTB 2NTFB 4M5YH 3N85H 3QA3B 5C0IA 1N0XL 3MLUH 4OLYH 2PO6C 3MLSH 5IBUG 1P4LB 4M7KH 3V6ZA 3NZ8B 1DJSA 1U8QA 3OKEA 5IFAL 1A7QH 2V7HA 3FT3B 3O2DL 5FYJE 4HIXH 43C9B 2FSEA 1M7DA 4X4ME 5D4QA 4LHJB 3TPUB 3JWOH 1L0YA 3DOSA 5E00B 1SJEB 3MYJB 1TJIH 4XCCH 1HIML 5KVGL 3MOBH 5EPMB 1FO0B 5K59E 3MCLH 3HMWH 3OR6A 3KPMA 4JFQB 4GKZB 3SDDD 3U7YL 3ROLB 5JHDA 4HWBL 1YEDA 4P2OA 1K6QL 4K3HA 4OFVA 4WJ5B 3IJHA 4GOSA 5HYFA 1QSVA 4OLEA 5D5MF 5DD3H 5TQ2L 4GKNB 2X89D 5FB8B 5T3ZD 5MEPB 4OGAC 1OW0C 3RKDC 3QDHA 2BMKA 3M8OL 2IPTH 2X4NB 5FGSA 4RMVA 1D5IH 2FB4L 2MJWA 2CJUL 2XKSA 3BXNA 3EUUA 3T4AA 4OFIA 4OIIH 4PRNB 3CFKB 3FB8B 2B7DT 2RFXB 4GSDL 3OKNB 4KK8D 3T65A 1IKFH 2DQEL 3WSQL 1RU9L 3BPCA 3DX6B 3KPQB 2FR4B 3UJIH 1ND0A 3C5ZD 1EO8H 4YK4C 2EC9U 1QVOA 1C1EH 5CSZA 1HYRC 4R0LA 4JFDA 5JOEA 1NEUA 2WINB 1C08B 1RIHH 4YPGA 1V3KA 1RY7B 2Y23A 4E41E 5GGTA 5D6DC 1XGTB 4MNQA 2BVOB 5DHXB 4K55A 4KH2A 3ZYZA 1NFDB 5IM7B 2C1PA 3MRJB 3SGKA 5IFJA 3LPWA 3CSGA 3LVEA 3HI6L 3WFCH 1XF3A 3IAPA 3MCKB 3LQZA 4GG6E 3QDGA 1DR9A 4PP1C 3IF1A 4ODTH 5ITBL 1DBBH 3OG6B 4BKLA 4EDXB 4X6EB 1QRKA 5D7KE 5MP6H 1JHKL 4JRXB 3RWHB 3EFFB 3MNZA 2X70B 5HGDB 1FE8L 1BBJB 3HZVB 2HTLD 3U83A 2DIAA 4XPTH 1T04A 4NKIL 5EOQL 4WV1C 3RUGB 3VWKA 1R5VA 3N9GL 3TPKA 5INDA 1U93B 1CF8H 1U3HB 4MQSB 1M7IB 2AJUL 2VZ1A 4OLXH 3Q6FB 3BDYL 3MRFB 3PABB 1JVKA 1FFRA 1CICB 1PYWB 3L7FB 1BAFL 3WS6C 3QQNA 5JOPD 2DM7A 4GW5A 4OZIB 4JRYA 1D5ZB 2VRAA 1CXFA 5I1LB 1OM3H 3W9DA 1NAMB 1EA9C 3ARGC 3W81A 4JFEB 4GBXB 4LLUA 4QT5A 4Z76A 1K5NB 2Y36L 4LOUD 3LZFL 1HSBA 1S7VB 4Y89A 5GRZA 5EWIL 3SKMA 5C0IB 2XZZA 3MLYH 4NQDA 3V6ZB 2J8UA 3V79C 1U8QB 1WUNT 3OKEB 4X6DA 2V7HB 5AG9A 5SWZA 4LSVL 2V6HA 1RZKC 2R4SH 4UTBH 4FFWC 2FSEB 1M7DB 3FQWA 4EVNA 5I76A 1TCMA 1Z3GL 1DVFC 4OV5A 1RUAL 3TJHC 1GGBL 3OR6B 3KPMB 5E6IC 4LRNH 1YEDB 2EEAA 1CD9B 1NCDL 2ZKHH 4P2OB 3IJHB 4DCQA 1DN2A 5DVMA 4JG1H 1R6VA 3BGFC 1JNNH 4WI7A 3K81A 1ZT7A 4XPHH 1KELL 1MCJA 1FNHA 3HS0A 5CWSA 1FLTX 2HKFH 2BMKB 1W2KT 4Z7UF 4W6YB 3IDNA 3VFRB 3RHWK 1EJOL 4OTXL 5ICYA 4GAGH 4JRXD 2ZPKL 3FKUS 3VE0A 3T4AB 2AJXH 4NN7C 5ALCH 1IAMA 4F9LC 4MSWA 4WFHE 1S7RA 3UPAA 2BFVL 4KZEH 3BPCB 4XBEH 1ND0B 4ODXA 2LE9A 4XCFH 5DUBA 1QVOB 4DJMA 1U3HD 5CSZB 4R0LB 3ZKMD 1MFCH 4JFDB 2CK0H 3EOYG 1X44A 3A67H 1CIUA 1YY9D 4YPGB 2P45B 3MV7E 2LFGA 1FV1A 2E9WA 1EUTA 4RGNE 3FRUB 1KN4H 1DL7L 4FQQA 4MA1B 5DD5L 4MNQB 3F7VB 1T21A 35C8H 2BX5A 3F65A 4L9LC 2J3SA 3GKZA 4GBXD 1BQHA 4XAWL 3U0TB 1LO3H 2C1PB 4XNXH 1CCZA 1I7RA 1OCWH 5IFJB 4JM2D 5E9DE 1ITCA 3R06A 1VSCA 3S9DB 1JZ7A 2DQJL 4Y2OA 3CFEB 1EGJH 4J8RA 3QDGB 5C0EA 2BY2A 2UUDK 2FGZA 3IF1B 4DGYH 3QB7C 4BKLB 5EA0L 1MAML 3ZT5A 3MNZB 1MNUL 1WWWX 4CMMA 1Q1JL 4BSVB 3ZSTA 3T2QA 1T04B 5EDXA 5DGRA 3MNVA 1ROWA 5ECJE 3VWKB 1R5VB 1FGVL 1WFUA 2ZZUT 3OWEA 5CJ5A 1CZ8H 5INDB 5HVWA 2F54D 5JHDD 1BFVH 4I0KA 4P2OD 2JLLA 4JQXC 2O5XL 2NY7L 1NUFA 4GW5B 1KNOA 4JRYB 4N8VG 5BQ7A 1ZLSH 2DF3A 2W9EH 1NFKA 1VFMA 3FL7A 3NGBC 3W9DB 2OR8A 4Y19E 3VXSD 1BGXH 4LLUB 4YBQC 4QT5B 3QUYC 4DUWA 4AK1A 2VLMD 4Z76B 4F57L 1HSBB 1RZGA 5ESAA 4HXBL 4NDMA 5AZ2L 1MLBB 4IS6A 2XQBH 1MH5A 2DKMA 4ODUA 3SKMB 3ARXA 3AS0A 4NQDB 1EVTC 3D1MC 3ILPA 4BFGA 3GSQA 2J8UB 1N4XL 4TUOB 3RZCC 2H8PA 3S36X 2KKQA 4X6DB 5SWZB 1FVEA 4JFDD 2NX5E 2ZG2A 3KHQA 5GXBB 3FQWB 4EVNB 4KI5E 2A77H 1J12A 5DXWA 5I76B 1WV7T 4OV5B 2BHUA 3K46A 1T83C 4FRWA 3CDCA 4PJDE 4OCXL 3ULUC 5D7SL 4G9DA 4MNQD 3R1GH 3SDXB 5HDQH 4OGXL 2P43B 4DCQB 4KDTC 1NFIA 1OAUL 4KDWA 4QGTA 1KCVH 1ZT7B 1MREH 3UO1H 1LWRA 1P84J 4JKPH 4NN6C 1J0JA 3HS0B 5CWSB 1EHLL 3OG4B 2ZCKL 5DK2B 4G6JH 4YHLH 4ESKA 4YHPB 3IDNB 3QDGD 5A3ID 1YJDL 2JJVA 2W59A 2DAVA 5ICYB 3IXAA 4FQXC 4PD4J 5IVXB 3R0NA 3VE0B 3NVQA 3C08L 2HRPL 2O5ZH 5E6YA 2GCYA 4MSWB 1ZT1A 3CSYA 3H8NA 1S7RB 2QQLH 2EDOA 4RRPA 1Y0LA 5K9JH 2NCMA 4ODXB 2IPKA 2ICCA 2LVEA 3FT2A 1T66C 4LCYA 3DLQR 3LKNB 4QF1A 4JFHE 5E2WL 1OGTA 5L8KB 5EU7C 4H1LG 3JWDC 1LNUA 3ZYIA 2B0SH 4ZODA 5EU6A 1CVSC 5JIIA 2VZUA 1Z9SA 1KGCD 4BFEA 4OGYH 4FQQB 5DD0H 5FYLD 2HKHL 2W0FA 4WU5A 1T21B 3D5OF 3BDBA 3WNKA 4TYUA 1BQHB 4JHWL 1QFOA 3HMXH 5KZCD 3QEGH 1I7RB 2F53A 1ZANH 1J7VR 2APVA 2OBGA 1G7JA 1YEGH 4X9FA 5T5NF 4UQ2A 4PJAA 5EBMA 1W72A 5TDOA 3FHQA 4AEFA 4J8RB 3AROA 5C0EB 5J56B 3CZFA 4ERSH 5SWZD 4LLMB 1KB5A 4WWKA 2PUQT 4RFOL 4CMMB 4K2UH 3M07A 1AFVH 1FJ1A 1CGVA 4NIKB 1MWAA 4XC1L 4MS8C 2Q8BH 4MCYA 2OYPA 2W0PA 2NY1D 4LVHB 2DLTA 1KTDA 4X5XB 2FJFB 2OQJA 5T5FH 5F6HJ 3RWIA 2GY7B 5E8DH 1SQ2N 2OSLA 1JFQH 4JY5L 3TEUA 4Y5YB 1KN2L 4LCWE 3CMGA 1KNOB 2DI9A 5BQ7B 4YEFA 5CCKH 4JCMA 3D39A 1F2QA 3SDCC 2APBA 2YXMA 3CXDH 5GZND 1JGDA 4YHNA 4NO0D 4JQVA 4HGWA 1GGIH 4WI3A 3AU1A 3CMOL 3JWOC 3TN0A 1CN4A 3T3PF 1AGCA 1RZGB 4PJBA 4NDMB 4P2RE 1MCFA 4LAQL 4IS6B 4JO4H 1MH5B 4ODUB 4M7LH 1K3ZA 2IBGA 5DUPH 3W0WA 3GSQB 4ETQA 4WUUE 5HI4D 2ZOLA 2H8PB 3D25B 4S11A 4JFXB 4I1NB 5E95B 3P3YA 3VRIA 4XB8A 1FVEB 5KVEH 4ZTOH 1S5HA 3OSKA 4PLOB 1MFDL 3BESR 4O4YH 2EDJA 4IRSD 2ARJA 1CR9H 1WBXA 4YDIH 1HZHH 3GI8L 2H2PD 1QSZA 4G9DB 5T3XH 5JA8B 4G8GA 5IHUH 3PWVA 1BVZA 3VW3H 4MAUH 3SO3C 3UYPA 2EC8A 4OD2A 3VFGL 2ZCHH 5DZNA 2FEDD 3QXAA 5DJ6A 4YDLB 4I2XE 4PS4H 3BSZL 4UB0L 1G84A 3H7BA 4HPYL 1RZJH 3QPQC 5CMAA 2FX8H 2PCPA 1BEYL 4HXAL 3GJFK 3MMEA 3BKYH 4I9WD 5MHSE 2Z31A 4PGBA 3W5MA 3IXAB 4AQ1B 4NNYA 1XF2A 2KQMA 2F8XC 5DK3A 4OQTH 1YYMH 1ZT1B 5CBEA 3CSYB 2C3VA 4KXZI 4PJ5A 5HYJA 4POUB 1Y0LB 1F97A 5BJTA 2D7PA 1HNGA 4UIKL 4WTZA 5JW4N 4CNIA 2IPKB 3BI9X 3FT2B 2WP3O 3H9SD 1D6EB 3W2DH 2JCCF 1QEWA 4LCYB 3G6DH 4QF1B 2XT1B 1R3JA 1OGTB 2DKUA 3GSVA 2CK2A 1LNUB 1QBBA 5EU6B 5EIIA 3REWA 5IB5A 2AJVH 1U95A 4LSPL 2RBLA 2GIYA 3L9RA 3UJJL 4G7YL 2B39A 1MIEL 4DN4H 1NBZA 4WU5B 4GLRH 2FZ3A 2EDLA 2A0LD 2GTZB 3BPLC 3CSBA 1MCWW 3TBWA 2VTFA 2F53B 3HAEG 1P4BL 4LHUG 1G7JB 4LLVA 4OZHA 4KY1L 3U6RB 4UQ2B 4WFFD 3GNMH 4PJAB 5EBMB 5FECA 1W72B 3FQNB 5DRWA 2HT2C 3QCVL 1C5BH 5TDOB 3CD4A 3ZE0F 4UZGA 4CMHB 3MLTA 3CZFB 3PGCB 1KB5B 2X42A 5IFHL 3MLZL 4WWKB 4WIQA 3TVMC 5L0QB 1JIBA 3HHRB 1A7QL 4JREC 2YMXL 4UT6H 1FJ1B 3N06B 1R5WB 2YKLH 4MCYB 1EXUA 3S37X 4Z7VA 4R4FL 4OFYA 2GJ6E 1TJIL 3PP3K 3MOBL 1KTDB 2GSIA 3MCLL 5DQDH 1G9ML 4JN1H 5JXEC 5HVFB 3DYOA 4N1HB 2OQJB 3RWIB 4RCAA 3OBAA 2OSLB 4IDJH 3LQAH 4FP8H 3UTSE 1XGRA 3N1MC 4RSVA 3EO0B 5T33L 3HE6D 3D39B 4XNYH 2Z4QA 2YD1A 1EERB 2DI8A 2WBKA 4YHNB 4KHXH 1I3UA 5F7EL 4HGWB 4WI8A 3RWFA 3AU1B 4ONOA 3TN0B 2IALA 5LGJA 2XWBA 1F45A 1AGCB 4PJBB 1NAMH 5B38A 4JM2F 1WCQA 3HG1D 4BA8A 4Y8AA 4XMLL 1KFAH 4HWEL 1NC2A 5AG8A 3W0WB 4ETQB 4MX7A 4MNGA 2ZOLB 3IYLW 1D5MB 3CCHA 2YA2A 1X5XA 4QXGH 4NZUH 3VRIB 4BK5A 2EDRA 5HHME 1EO8L 4JO3H 1C1EL 5SX4I 4LARL 2APFA 3ARYA 3IFPA 3PQYA 5EU6D 4H0IA 3DVNA 2ARJB 1WBXB 2HT3C 2YD8A 3T0BA 4QXUH 2V9TA 1CDGA 1RQ5A 2VLJE 4G8GB 5C6WH 4HCRA 5DZOA 5CD3B 4HF5H 5FF6A 1NQBA 5D70L 2Z93A 3CDFA 1EVUA 2MCG1 1DN0A 3A0OA 3VG0H 1BBDL 5E8EA 3MRNB 3GJEA 2F53D 3QXAB 5DJ6B 1IC5H 2NW2A 2E9BA 3O3EA 1HCFX 5C0BE 3S88H 4C57C 5CMAB 4LPUA 1T3FA 2PCPB 4R8WH 2W0KA 3MMEB 1IAOA 1NGZA 5A2LH 3AAZA 2R0KH 2Z31B 4PGBB 5GGQL 2OLDA 5CEZE 4NNYB 4WWKD 1XF2B 1X7QA 4ODTL 1H0DA 4K8RL 5GISH 4FFVD 3SPVA 5MP6L 5CBEB 2NY3B 3RAJH 1WAAF 4PJ5B 5JIHA 4J3UA 5HYJB 1RK1A 2PYFB 3O0RH 3VFOA 4J23A 1C8PA 5F6IB 4CNIB 5JDJA 4R3SA 5I1IH 3PHSA 1T7XA 3EYQC 3RX8A 5HHVL 4D9RD 1QEWB 1E6OH 5ERWA 1IQDA 4P2CG 3GSVB 1AKJA 2J4WH 3ARZA 3VXQA 5EIIB 5IB5B 4F9PC 5TDPA 1DTUA 2DQIL 1U95B 2BOCA 4RMTA 1BVKA 3Q2CA 3BHBA 4CU7A 2IANB 3DWTA 3L9RB 5C07D 4POZD 4GXVH 3D39D 3WD5L 4ZOEA 1F3RB 1I1AC 1WT5A 2FZ3B 5J1SC 5GGTH 2W0LA 2YD5A 2VMFA 3TN0D 1TENA 3SE3C 3TBWB 4F37K 3FOMA 4K94L 5DQ9A 4LLVB 1FYTE 3DVGA 2PF6A 4NJAH 4OZHB 3B43A 4UI2A 5JIKA 5FECB 4P5MA 3V6FA 4XXCA 4F2MA 3W0WD 2CGRH 3B5TA 3MLTB 1G7IA 4P2QD 5JA9A 3B4NA 5GS0L 3HTLX 1T6WA 3J8F7 5JMOC 1JPGA 2VIRA 1JGEA 3VCLA 2E8YA 3DHMA 5FUCC 2ZUSA 2R4SL 2ZG3A 2VUOA 1GJIA 4PJIE 4J3WA 3I02A 3T0AA 1EXUB 3KYOA 5INCA 1HN1A 1MIML 4PJ7E 1AD9A 3QAZB 1S78C 2OL3B 4OCRL 4G8GD 2GSIB 3QZWG 3T0VA 2IFFL 1IRAY 1MJ7L 3C5JA 3NCCB 5GGRY 2LU7A 3S36H 4N0FA 3DMMC 4KUZH 3KXFE 5C0DA 3CLFH 1XGRB 3MOQA 2XZAL 4JG1L 3UDWA 3B9AA 1JNNL 4KMLB 3PG2A 4HX1A 4NBZB 4U1SA 1A7NL 2XICA 2Z4QB 3NA4A 5TDNB 1UKSA 1D3CA 3MXVL 4U1JB 3TYFA 3BGAA 4MAYB 3HNVL 3RWFB 4AEHH 5FYLH 4JG0L 1XF4A 3KPNB 2AXGA 2IALB 2NY2C 3K8MA 5LGJB 1BJ8A 4XNQA 4HT1L 5B38B 3FAWA 2NY3D 4FQCH 4PUBL 4A6YL 4QRQA 5HYJD 1N5AA 4R97B 1Y18A 4G5ZL 1S9YA 1NC2B 2Y7QA 4MX7B 4MNGB 5JXAL 1JNLL 3CCHB 4XNZC 5CZXD 1TQCC 4OZGE 2VDQL 4YBLB 4XBEL 15C8L 2R2CA 4J4PA 3L1OH 1F6AA 5C3TA 2OTUA 5JTWA 2W60A 2AK1H 3MXWH 4ZQKA 3LPFA 3MROA 1SY6H 3DVNB 1U58A 5CJOH 1UZ6E 5AAMA 2AXFA 2EDHA 5JIPA 4G3YH 3G5ZA 1MCCA 4HG4K 1KN4L 5L2KE 2BSTA 5FF6B 1DN0B 5KVDH 5HGHA 4MHHG 3CU1A 2HJLA 5IVNA 5E8EB 1TXKA 2IPUK 3GJEB 4PJ8B 3ECBA 4NQVA 3O3EB 3B8SA 2JB6A 3ULUF 1OCWL 3I2CH 3SGDI 1X5HA 1IAOB 1NGZB 2AK4A 5ID0A 1D6VH 2JJUA 3AAZB 5LWYH 3RTQC 2DOCA 3MLPA 4KQ3H 3QG6A 1X7QB 1H0DB 3SPVB 2ZWLT 4Z8FL 3UBXA 1RK1B 4LKCB 1MI5E 3VFOB 4PG2C 1TFHA 4OFYD 3BMWA 3EKCA 4R3SB 3SDDC 4YUEH 1NANH 1CK0L 4XVTH 1OAXH 5D7IA 1CBVH 4GG6B 4N9OB 5ERWB 1IQDB 4ZD3H 5K9KA 1X5ZA 1AKJB 1VDGA 3VXQB 3GHEH 1OSZA 3T4YA 1VFOA 1TPXC 1BVKB 3BHBB 1GAFL 4CKVX 4ZUUB 1YQVH 5SV4A 5F7HA 5CILH 1ZLWK 3IJYA 2W9EL 4KK9D 3DXAE 4W70A 2XPGA 1Z9LA 4KROB 1A7PL 4MYWB 3FOMB 2VAAB 5J8OA 2H41A 1KULA 5DQ9B 1UM5L 1CLOH 3DVGB 1DQLL 3E0GA 4P5MB 3V6FB 4JJ5A 4F2MB 5H94A 4LDLB 4KVNH 4GH7B 4YQXH 4ZAKC 3VI3F 1JWSA 3C60D 4DQOH 1JGVH 4FMFA 1G7IB 1CFSA 3D69A 1JPGB 1JGEB 3VCLB 5B3JE 3PQYD 4CU8A 2IAMD 3I02B 2DIBA 4Q0XH 3KYOB 1AGBA 5INCB 5C09D 1TVHA 1AD9B 1N64H 5DSCA 5I15L 2R8SH 3BDXA 5CEXA 4Z78A 1A1NA 2HFGH 3HB3C 3EFDH 3C5JB 1NUDA 4FZEH 3WNOA 3R1GL 3MBXL 3VRLF 3ESUF 5C0DB 5HVHB 1E27A 5EORH 5F8QC 4J3SA 1KCVL 1RUQL 1RZ7L 2BDNH 4P59H 3MYZA 4TTDD 2ADFH 3L3DA 1GOGA 4U1SB 1ZKAA 2E27L 4L1DA 4LLDA 4NYLA 3TYFB 4S0SD 4G6JL 1WJ3A 1XF4B 4AZ8A 4C54A 3RVWC 1A6VH 2AXGB 4XNQB 4Z9KB 5FA4A 4XPAL 1F4YL 2AEWA 1NUGA 4MD4A 4QRQB 1N5AB 1F02I 1Y18B 2FH6A 1S9YB 1Z6JT 2Y7QB 3JTSA 5HJ3B 3QJFB 1NCNA 4FQPA 3UPRA 4MZ3A 1F6AB 3LS5H 2OTUB 2QHRH 1F58H 4KTEH 1AKJD 2W60B 5F9DC 4ZQKB 5HHNA 3IFLL 3MROB 1RZJC 3VU2A 4DK3A 5GGUA 1ORSA 2DDQH 2AXFB 2B0SL 3G5ZB 3ARFA 1Q9KA 5M7QA 4U1GB 5F7YC 3L3KA 1UACH 3SN6N 5DD0L 2FL5A 4OF7A 4O51B 5HGHB 3P11L 4HFWA 3C2SA 3ECBB 3CLEH 4NQVB 1TVDA 1UH3A 2I07A 3QQ9C 2JB6B 3HR5B 3OR7B 5I1EL 3QUZB 5J9PA 2Y07L 3QHZH 4RGNB 1YEGL 3WL9A 4PJFE 2ZCLH 3BE1H 3HR6A 2AK4B 4H0HB 5ID0B 3LKQA 3UCRA 1KCSL 1XGYH 1HYSC 5SWSE 3WCYA 4G7VH 4B53A 3QG6B 1YNKH 5DWUL 5T3ZL 3WO4C 1UZ8A 4HFUL 4XPGH 5D9SA 3RFZC 3UBXB 1FVDA 4LBEB 4OZFA 1WZMA 1AFVL 5GRJL 1HWGB 4XNUL 3LD8B 4O02H 3VFWA 4PTUA 1OP5H 5D7IB 1URLA 2HP4A 4I3RL 4PB0H 5K9KB 1AD0A 1GGYA 2E7BA 2GSGA 5KG9A 4RGOH 4JQIH 1OSZB 3T4YB 3D18B 4Z7WF 2QHLA 4M9OA 3UX9B 3TBTA 3WEXA 3C9NA 3S37H 1DFBH 3IJYB 5I6XB 2N7BA 2FATH 4P46D 5CCKL 1GC1C 5KW9H 2IQ9H 1NC4A 1AXTH 1E6JL 3RVTD 2XPGB 1MCBA 1YQ2A 4PJCE 2I9LA 2UWEF 3ZE1F 4MXVE 3T1FA 5C7XH 3HN3A 3NABH 2NYYC 3QCUH 1K2DA 3AXLA 4YXHH 3MUGB 4JJ5B 1IGIH 5H94B 2QQNL 4U1LA 4GRLC 1JWSB 3PGFL 1JE6A 1CFSB 4HMDA 3WFZA 1W72H 3D69B 4NNPH 4MJ5B 4ZFGH 4YR6A 5KVEL 4ZTOL 5J1AB 1CLYH 1YY9C 2WZPD 1KB5H 1CICC 1P7KA 2Y6SC 1AGBB 1U6AL 5I1JL 1TVHB 3EO1A 3Q0HA 2EIZA 4O4YL 4ODBD 4Q2ZB 5DSCB 4YDKH 4ZPVA 1MWAH 5CEXB 4Z78B 1A1NB 1AGDA 2WANA 4H5SA 4YDIL 3HC3H 2V7NA 1EEYB 3JWNC 1VACA 4XBGA 5IHUL 4V1DE 3VW3L 4MAUL 4GBXC 1JHLL 4CVXA 4LASL 3NFNA 2VXTH 1L7TH 1T7YA 3T0WA 3MODL 1RURH 3L3DB 1P9MA 3SDYH 4LSDA 4LVNB 2R2HA 2AK4D 4LLDB 4NYLB 4PJDB 5DMKA 4GQ9L 2QTEA 5ACZA 1JZ4A 4GRWF 3BKJH 5BOPA 3NH7H 5FA4B 4JGJA 4I4WA 4MD4B 3V4VH 2G75B 2MPAL 2VH5L 4CUCA 4OQTL 1PKQA 5AYUH 3JTSB 3VGEA 3KPRE 1UWEH 1IAIM 3V6BR 25C8H 1IGYA 1BJ1J 3FQUA 4P2OC 3UPRB 5E2TH 4ALAH 3P4OA 5E8PB 4PBWD 3W2DL 3DV6A 3IDMA 1F90H 3FO1B 2J7LA 2F19L 3QUXA 5GGUB 1ORSB 5I0DA 3WFEH 1PJ9A 2AJVL 3GMRA 5AWNL 3L3KB 1FLRH 2EH7H 4LKXA 4M1CC 2FL5B 1QHOA 5EC1A 1IGCL 1MHEB 3RIFK 4G8IA 4JFYA 4KJPD 1NMBH 4TNVF 4M6NL 3JV5A 4QHKJ 4HFWB 4LGSB 5GJTH 1IM9A 1J8HA 2F15A 2I07B 2J6EA 1CFQB 4OF0A 3OX8A 3UTTE 3O81A 1N6UA 3WL9B 2D9QB 4CW1B 3P0GB 3LKQB 3T04D 1C5BL 1OTTD 1IGFH 4RBPH 5IT2H 2AJSH 1JV5A 4R0LC 3C2AH 3OAUL 3GRWA 3CFBA 3TA3A 1T5WA 1UZ8B 3DIFA 1RVFH 2KDGA 2OCFD 2GI7A 5D9SB 3MZGB 1BX2A 1HKLH 4OZFB 3WFDH 4UT6L 4OLWH 3RVUC 3VFWB 1JNJA 4MA1C 4PTUB 4EN3A 4NC1E 4PRBA 3FO9A 4D0CA 4Q9BA 4PTTA 2BNQA 1AD0B 4N9GA 4AEIH 2GSGB 1UKQA 2OXHA 5ETUB 5KG9B 2OZ4A 2CLVB 5FYKL 3UPCA 5LGKA 4KRLB 4ELME 2B1AH 3TBTB 3QXUA 3WEXB 6FABH 3C9NB 1WF5A 2MNUA 3H9HA 4PJGF 3W11C 3OV6A 1XIWD 5DVNA 1QPPA 5A3IC 4XNYL 3UYOD 3MOAH 1U8MA 2F5BH 1GPOH 3S97C 2I9LB 3T1FB 2C7UA 4EI6A 4MD5A 4O5LL 2Y1VA 3HKFA 1K2DB 3AXLB 3ISWA 1KFAL 4P5TA 3VWKC 2X7LA 5DLMH 4WW1A 2NY6B 5EBLA 5IJKA 3FB7A 4PB9H 2ZJSH 4X99A 4YFLF 4YR6B 3CFDA 4HWBA 5HXMA 4EQ3A 4WDIA 3BFOA 3PHQA 1P7KB 4HKJA 3EO1B 3ARFD 1QLEH 2EIZB 4Y0GA 3AB0B 2XTJC 1SBBA 5EUOA 1AGDB 3HRPA 1FFQA 4H5SB 2V7NB 4WNQA 1VACB 3QQ4A 4XBGB 5KSBF 3OB0H 3O6FD 4EBQH 5E2VH 3HA0A 3CC5A 4JHAH 4CVXB 4HQQH 4MA7H 1J1PL 2P49B 4DK6A 2J88H 2E6PA 1HHKB 5KS9A 1T6VN 3MZTA 4RQQA 4FQIL 4PRPE 5FYJH 1YN7A 2R2HB 2NY5H 2VLKA 5DMKB 4FQ1L 5ACZB 5BVJA 4I4WB 2OX5A 2WUCL 5J0BA 1KJ2L 4APQA 5MENA 4X7FC 3ARVA 4JVWA 4S1SL 5CZKA 2IQAA 1GGTA 3O0RL 4JVUA 1IGYB 3UTOA 2G60L 3FQUB 2GQHA 4MJ6A 5GSVA 2NY0B 2RB8A 3P4OB 4Y1AE 3DV6B 3IDMB 1E6OL 4P23D 3ALPA 5F7LB 2BZDA 4ACPA 3TIDB 2J4WL 1RV6X 1RMFH 2ADIB 3GSRA 5E03A 3GMRB 1JZ8A 4LMQE 4F8QA 1X6LA 3IXTB 1QHPA 5JW4R 3DYMA 4LKXB 4GXVL 1FZJB 4U2ZA 4FXGB 1NC4D 4G8IB 4JFYB 4EIZC 2BVQA 4HEME 3I3EA 2F74A 3GSOA 2ICWA 1YEKH 4HCRH 4I0PC 4Y16C 5GGTL 5HDBF 2JIXA 4UMGA 4FTVA 1IM9B 1J8HB 1BPVA 4MB3A 4HUVA 2FIKA 3QRGH 4ZDHA 1EK3A 4L8DA 3UEZA 2NY6D 4FG6D 3GGWA 4OCMC 3GI9H 1JV5B 2CGRL 1M1SA 3TLRA 5F7NC 1P6AB 4DEPB 3O6LL 3CFBB 3TA3B 1T5WB 4E9LA 3PV7A 4RAHA 5F97E 1HHIA 3MLRL 1BX2B 3AFLA 3L3OA 1CI5A 4BZ2H 2H32A 4EN3B 2ILLA 2ORBL 4PRBB 3FO9B 4D0CB 1HXMA 2LAAA 3AMKA 3ZDZF 4QWWD 2BNQB 1N6VA 3R4DA 1I9IH 2V5RA 2FEDC 3S34H 2KZ1B 2B4CC 2XZCL 5HI3D 3O6MH 1HEZB 2VNCA 3V4PH 3H9HB 1CDHA 4BH7A 1UCTA 1IARB 2GJ6B 2F8OA 1U8MB 1QFUH 2ZSVB 3IGAA 2VZSA 5C0CE 5FYLL 4RGMB 1KPRA 2C7UB 4EI6B 3V6OE 1RZFH 3CK0H 3KXFA 1Q9WA 1AJ7L 3BIAX 4MD5B 2C4FT 3N0PB 4HUWB 4Y7MA 3G6JE 5B8CA 5JW3H 3EYUH 4P5TB 1Z2KA 2V17H 4U3HA 1MRCL 2X7LB 1M6OB 2WV3A 3K8KA 4WW1B 4LVHC 4PBVC 1A9BA 1Q8MA 2H2SC 1YC7A 3IKKA 5EBLB 2AJYL 5KBNC 3FB7B 3NMEA 4NQEA 5SWQA 2AAVA 4UDUA 4X99B 5DDHA 5GPRA 1AC6A 3CFDB 3BD5A 3H0TA 4XWOC 3QUXD 4WDIB 5C0ND 3EJJX 4Y5YC 4OB5L 3PHQB 3Q3GA 3QO1A 4HKJB 3D0VA 1SY6L 1CE1L 4DAGH 2WBWB 2GJJA 4WNQB 2R1XA 3QDME 3QQ4B 4J6RH 1QFWI 2DQTH 2PNDA 2VKXA 3CC5B 3T2NH 3UC0H 3UZEA 5I73B 5L7XH 1YPZE 5KVDL 4CVWA 1QKZH 1U2HA 1EO7A 4RIRA 4HSQA 3RDTB 1VB9A 2PW1A 4RQQB 4J7RA 5IMMA 5FA3A 1OD7A 4B5EA 4S0TD 5EH1A 3GKWH 4XMKH 5BCAA 4PFEA 3A6CL 2D7OA 5BVJB 3TA3D 5LWYL 3ULUL 5F72S 4F80A 1XGUB 3LN9A 2FO4A 4APQB 5MENB 2NPLX 3FB5A 4P3DA 4LSRH 1MSPA 5IMOA 2DQGH 3LSOA 5D93B 2IQAB 1S7WB 1NDGA 1Q72L 4EN3D 4XP4H 4WO4B 3CPLA 1JMZA 4MJ6B 5GSVB 1F4XH 5D1QD 2BP3A 4FQHA 1OAXL 4QNPE 1PLGL 4KJWC 5JQ6H 4JHBA 4LPYA 1MRDL 3CGTA 3KDMA 5KTEH 5C08A 4YDLC 4O9HL 3GSRB 1A6AA 3QDAA 4X9IA 2VXVL 4KVCL 5TQ0H 1F00I 1ZVHA 5I8KH 5I8OL 1NL0H 5CJQH 3T0ED 4PRDA 4MA3A 2F74B 2ICWB 3GSOB 1ETZA 2EDKA 5ABDE 3HUJF 1WZ1L 2DBLL 4PY8I 2JIXB 1JPSH 3BZFA 3BKCH 4FTVB 1X5YA 3K4AA 3BRFA 1DCLA 3B5HA 4BQCA 2UVFA 1ZV5A 4GAFB 3SGEH 4BZ1H 4HUVB 3TBVA 3K0WA 4JY6A 1JTPA 3ME0A 2FIKB 4P5TD 1QR4A 2WBJA 4JKMA 4ZDHB 4CU6A 2I26N 4L8DB 1TZHA 3C6SA 3GGWB 4OF5A 4YQXL 4KVNL 5J57B 2IBBA 1XGQA 3MV9A 3NCBB 2Q8AL 2EDXA 1HHIB 3TO2A 1I1YA 3NZHH 4KC3B 3L3OB 4HJ0C 5FXCH 2IMMA 3L5HA 4PGZA 2QSTA 1KJ3H 4KK5C 1BQHG 1HXMB 2R8SL 2HFGL 5D2NE 1F4WL 1IC7H 4HJJL 4F58L 1OY3B 4M3JA 4YGVA 4KZDH 4W6WB 2IMNA 2J5LC 2K7QA 4PJIB 4DFIA 3EYFA 2YD9A 4P59L 3KYAA 1JF1A 4BH7B 2VLKD 3P30H 1ZTXH 3OPZH 4CMHC 3WIIH 5DFVD 4QOKE 2FCBA 2HTKC 3FN0H 4G6AD 1TJGH 2P5WD 1BZ9B 4M6OH 5L0QC 4OT1H 4ETYA 1FVCA 1KPRB 2LQRA 3KXFB 4APQD 1Q9WB 5MEND 5D72H 3VWJD 1R0AH 3BN9D 1NBVL 4AQOA 5B8CB 4JEGB 3X17A 4KJQC 1KCUH 2PW2A 1V7NH 1A9BB 1NCAL 1RIVH 4PJEF 4NQEB 5SWQB 5DDHB 5FOJA 3H0TB 1PFCA 5E4IA 4P57A 3ZO0A 3Q3GB 3QO1B 4HH9A 1ZVYA 3OKLA 4KTEL 4LQFH 4H8WH 3NIGF 4ZNEA 2R4RH 2OTWA 3D0VB 4TTGA 3MJ9L 3O8XA 3OZ9H 3NCJL 4MVBC 1MLCA 2R1XB 3ZKQD 3WHXA 1BF2A 4U6VL 5DMGD 4MQXC 3H3BC 3TN0C 2OTPA 2JIXD 5DJ8A 4FTVD 3QPXL 3O9WA 4RIRB 1ZEAL 3QQ3A 2PW1B 1G0YR 5EZIL 5IMMB 1UEMA 3SBWA 4XWGL 5FA3B 2VABA 1FHGA 1IAIL 2E7MA 2XG5A 1OVZA 3BEWA 1MCRA 4Q58C 1CU4L 2JTDA 5ID1A 3L5XH 4C4KT 4HDIA 3QIUA 3QDJD 1MRFL 2HFEA 4G7VL 2DN7A 2FO4B 4UNTA 1YEEH 1E4XI 4XPGL 3LSOB 4BQ9A 4L29A 1WWBX 3C6LA 1E28B 1NDGB 5DA4A 1RJCA 3CPLB 5D2LF 5D71L 5GRYA 4H20H 1NLDL 4AL8H 1OWRM 4L1HA 1KF9B 2C9AA 1LK3H 4FQHB 4XP5L 3JUYA 3SQOL 2YR3A 3E6HA 3P0YL 3FJTA 2AQ1A 3KDMB 5C08B 4RGOL 4AT6A 3WUWA 3TCXA 4KRPC 4JQIL 3MQIA 1A6AB 1ZHNA 2EDNA 4L8SC 3SOBH 4XI5D 3F7QA 1H3PL 2R56H 4RAUB 1I7TA 2BCKA 3QI9A 4HWZA 5TJWK 1CXEA 1DFBL 1Q0XL 2Z31C 3G5YA 4MA3B 4PRDB 3U7AA 1ETZB 5IR1B 3BZFB 3TJEL 4GMSL 1EV2E 5J89A 1VHPA 4RRPG 2NY3C 4XP9H 4R2GD 4R26H 1EFXA 3AREC 4ZTPH 5C7XL 3TBVB 2Z8VC 3THMH 1BFOA 5LVEA 3QCUL 4JZJA 2VUYA 1TZHB 2VDRL 2HWZL 5H2BA 5CIPA 3SDAB 4NQED 1XGQB 1NGWB 3MV9B 3O2WH 1I85C 2Z8WC 1TJHL 2XFXA 3VXUD 4NNPL 1QO3A 4QLRA 3RI5K 3TO2B 4ZFGL 1I1YB 4ZFOL 4XHJD 4OCYH 1RUMH 3KYMA 4MLSA 3EOTH 4P9HC 1RJZA 3VFMA 3ULVC 2Z91B 4OZFH 1PSKL 4WW2C 1W0VA 4E5XA 4YDKL 4KHTL 1MWAL 3TO4B 4XB7A 4CVUA 3BUYA 1INQA 1BFSA 3HC3L 4Q97A 4V2BA 3ZT6A 4FXKA 1HK6A 4IHOA 3FFDA 4YGVB 3UYRH 5F9WB 1L7TL 2NY4B 1JK8A 4KMTL 3EYFB 5JO5B 5DK0A 5I75C 3BP6A 4ENED 5I8EA 4MZ2A 1FAKT 5GHWL 2BSRA 3ZKND 1GOHA 4KJYA 4QO1A 1FVCB 5DD1H 2KPNA 5M95B 3U82B 3BKJL 1A9EA 3NH7L 1KEGH 1S5IL 4Q9QH 4Z7OF 3AM8C 4YHZH 3ZMRA 3LDBB 3QAZC 1IEHA 2PW2B 3WKMH 3VMPA 1AR1D 4PJXF 4TOYL 4YNYA 5JOPE 3DV4A 1NCCH 1QBAA 4IRZL 4ALAL 4I3SH 3OKLB 5C08D 5DO2D 3LEXA 3STLA 1RSFA 2YWYA 2MCPL 3O8XB 4NM4H 4YZFF 3J7HA 1B3JA 1SMAA 3X3FH 2WAHA 3WHXB 5HYEA 3WLBA 4MAYC 4M6AA 1K8DA 3ZZ1A 1NCBH 4N0YL 5DJ8B 4CVZB 3SQBA 1I9RH 1MQKH 1XR9A 3O9WB 5DEFA 5B39A 4HGKC 3GBNL 4I13B 1QPXA 3QQ3B 4XP1H 5KSAC 5GJTL 1BFTA 1O5DT 2WBJD 5KJRH 2VABB 5F7DB 1UYWH 1LEIA 3KPPA 4AY0A 1U41A 1RZ8A 4QRRD 5ID1B 2ATKA 5C8JA 3QNXB 3MV9D 4YBLC 3ARUA 3GMMA 4HDIB 3QIUB 5BVPH 4LCCA 2VAJA 3L5WA 3FOLA 2EZ0D 1RVFL 2BOBA 1B6DA 1ZGLA 3U1SL 3U4EA 4XZUA 4L29B 3C6LB 1E4WH 4NP4H 4QHMA 1NFDE 4ZS6D 5DC9B 1I1FB 4S1DC 4HG4J 1IEAA 2D31A 3QR2A 2XN9A 4Y2DC 1NSNH 3FMGL 4ZS7L 5JORA 1FPTH 1EPFA 3E6HB 4Z77A 4AEIL 1HHHA 4PJ8C 4HS6B 1ED3A 4R90L 4AT6B 1NBQA 3WUWB 4UT7L 1ZHNB 2NY4D 2EXWC 1CDBA 5FHBH 3SDXF 3DNKA 4JRXE 2BCKB 3QI9B 5A2IH 1KENH 1IGTA 2A74A 4HWZB 5AZEH 5GZOD 3SHSA 5I19L 5L9DH 2I60L 3RUGE 3Q5OA 3MRBA 1P53A 1GPOL 1EFXB 2V2WB 4ELMA 1UG9A 1CLZL 1MHHA 2P8LA 1ZGLP 1BFOB 4NQXA 2J6EH 4AEEA 4JZJB 3JV0A 1P2CA 1SJXA 5CIPB 3V52H 1U8NA 5IVXF 5DLML 4XMPL 1L6XA 3CVIH 1YUHA 4OZIE 1FAIL 2XFXB 3WN5C 1QO3B 5E4EB 4PJCB 3GRWH 5LBSH 4RFEA 3RL2A 5LQBH 2EO1A 3PWPA 2IGFH 3KYMB 3LIZH 1I3GH 4TRPH 1RJZB 3O8XD 3VFMB 5IW6A 4OLZH 3N1QC 1SBSL 2X10A 1W0VB 3IDJA 4E5XB 1WT5C 5HHXL 1YEIH 3KYKH 1INQB 4MDIB 3TZVB 1U8PA 4KROC 3LS4H 4FXKB 3HZMA 3FFCA 4IHOB 1J1OH 4OCSL 4EBQL 7FABL 4MNHA 2BY3A 5IF0A 5DRNA 3B5GA 3O9WD 4JHAL 1NH6A 3U4BL 3DTXA 2OZ4H 4L4VA 4MA7L 1JK8B 3U46A 3PIQA 4QHUA 2J88L 5DK0B 3SE9L 4XXCC 2WWKT 1NMAL 2VISA 3BP6B 1RUPL 4N8CH 5CLWA 5I8EB 4XT1C 1JPFA 4NWTH 2EXYC 2HT4D 3Q48A 2BSRB 2YZ8A 4KJYB 5D1XA 3RHWF 4M62L 1N0XH 2Q7NA 4V1DB 4WEMB 3NIDF 3RVXD 1A9EB 1UQSA 3SE8L 5JHDE 5C0FA 3HZYB 4EUPA 1UJTA 2EDEA 2QKIA 5IFAH 2C5DC 1MPAH 3C6LD 4Z0XA 1XMWA 3F12B 1T22B 3EJYD 1NCWL 3KLHC 4YNYB 4TULL 3DV4B 1HIMH 5KVGH 2XXMB 2CDFB 1I9EA 5I8CB 3ZTNL 5HVHC 3U7YH 5SX5H 5E1AA 3UDWC 4HWBH 3STLB 2JJSA 1FRGL 2YRZA 5L8JB 1GZPA 4HZAA 5DGQA 4H26A 2LTQB 4ZSOA 3WLBB 5TQ2H 1K8DB 5B38G 4LSSL 3FTGA 4I5BB 4NO3A 1U92A 2ZUVA 4HHAB 2PXYA 1XR9B 5DEFB 2Y06L 4DN3L 5B39B 5C3LD 2EH8L 1NLBL 3M8OH 1HH9A 1EFXD 4Y8DC 5HPMA 5JDSA 4UV4L 5F3BA 1BMGA 4Z6AT 4JFDE 2FB4H 4IRJA 1DANU 4LPXA 3P40A 2NXZC 4E41D 1LEIB 2CJUH 2DLGA 3KPPB 3OKKA 4NHCH 3RZWA 2G9HA 3EYVA 1RZ8B 5HI5D 2ATKB 1OARL 2AGJL 4J4PC 2HYMA 3GMMB 2XYCA 3GI9L 1QQDA 4GSDH 4LCCB 5DR5L 2DQEH 3WSQH 3L5WB 3HAEB 3VA2C 2A1WL 3FOLB 4MNQE 2BOBB 3E1F1 1ZGLB 4LNVA 4F7PB 4YX2L 2CR3A 3U4EB 4XZUB 3LKPA 2AJ3A 4NOBA 4GT7A 5EU3A 4U1GC 3WFHA 3LRGA 2VLLB 1IEAB 2D31B 2XN9B 5JORB 3DSNA 2JKXA 3A6BL 4Z77B 4I77L 1HHHB 2CUMA 4TUJA 1A7RL 1ED3B 1M05A 3WJLC 2N56A 3QDGE 2VITB 3QHFH 3QUZC 5LXGL 2EDBA 3CJJA 4NRYA 4RGNC 3S34L 3FZUD 4IMKA 4H25A 1C16B 4BZYA 1IGTB 2A74B 3L3IA 1H15A 1VEPA 1NMCB 1OAKL 4YHOH 3RWGA 4JN2B 4GXUM 1WBYA 3MRBB 2D0FA 5L88H 1MY7A 1ODAA 1PY4A 4KMQA 4ELMB 1F42A 1MHHB 1TNMA 4NQXB 3LD8C 1JHKH 1ZXQA 1P2CB 4XH2A 3ZLQC 1FE8H 2V17L 5I74B 3OMZA 3HPJA 1A6UH 1YC8A 1YUHB 4JRYE 5EOQH 5D7LA 3N9GH 4HZLA 5GRVL 5FYLE 3BT2L 3VXMA 5FV1L 4RFEB 3RL2B 4GKSB 4M5ZL 3PWPB 4KUCF 3GM8A 1CD0A 1F6FB 4HUUA 1Z9OA 3NACH 1WICA 4N5UA 3BDYH 4LCIL 3IDJB 4X7SL 3V5HA 5I6XC 2A9ML 1S7SA 1SMOA 1BAFH 1GZQA 2H32H 1U8PB 4XCYB 3HZMB 3FFCB 3HC4L 2PYEA 4MNHB 3PHOA 5DRNB 4H0GA 4NQDE 3UC0L 3RNKA 4LPTA 4L4VB 2J8UE 1N8ZA 1JZ3A 3U46B 1XF5A 2CDGA 3PIQB 4QHUB 4X6DE 2QSQA 2LU4A 5SWZE 4Z7UA 2IH1A 1U8KB 2VISB 3HE7B 4A6YA 3IS0X 1F6LL 2R0WH 2Y36H 3LZFH 1J86A 5F89A 2DQCL 3B9KD 3QDMA 4PPTA 4ZYKB 3QIBB 5H37H 4S10A 4G6FB 1UQSB 5DD6B 5C0FB 4JE4B 4EUPB 3KLDA 2QKIB 4NQSA 2JELL 4X9HA 1R24A 2FNBA 3ZE2E 3RJDA 1HE7A 3ARPA 4LSRL 2A9NL 4LVEA 3G08B 1KJVA 3DURB 1Z3GH 3GMOA 3MRRA 4X98A 4XP4L 2D7TL 1RUAH 2XN9D 4RX4A 4M8QA 1I7UB 32C2A 4TVPL 1F4XL 5LJYH 5E1AB 2X09A 3WJJC 2FGWL 3KLSA 5GQBA 1OP3H 3Q6GL 1GZPB 4H26B 4LVNC 5FFLA 4ZOCA 2A73A 2P5EA 4KKBD 4ZSOB 5BW7A 4R6UA 3BYTA 3F7PC 2FEEL 5K9QG 1KELH 3BGMA 5C0RH 1A1MA 5J06A 3FTGB 4NO3B 1U92B 5AUMB 2PXYB 4HLZH 2HLFD 3ET9F 1KIRA 3MV7D 5JDSB 1EJOH 1NEZA 3I50L 4OTXH 4IRJB 1ZE3C 5F9JA 3OKKB 3BIBX 4BZ1L 2G9HB 3PWJB 5F1NB 5H8DA 2VXUH 5EOCJ 3LB6D 3AY4C 3O41A 4GRMA 2QADB 1QQDB 2BSSA 3KR3L 5E2JA 2WQ8A 4LFHD 1YECL 5GS2D 2PTTA 3MRHA 5J7CC 3LKPB 3QFJA 2VDMH 5EU3B 2X1OA 4FQLH 3QH3B 4PV8A 3WFHB 3FCTA 1LP9E 5CZVL 3U79A 2EEDA 1J88A 1INEL 1C5CL 2R1WA 3FFCD 3I75A 1DL7H 4D94A 4HUXA 4TUJB 3WO3B 3GUTA 3V7MA 5DD5H 1M05B 2D0HA 4L4VD 3MV01 4I9WE 5FGCB 5L6YL 4G6KL 4OBRA 1JN6A 1NAKL 4NRYB 4XAWH 4H25B 1GXEA 3L3IB 2GT9A 1H15B 5CGMA 2EKJA 2VR5A 2VDNH 3RWGB 3P30L 4NC0B 5D1XD 1V05A 3UBXG 4XPFL 1WBYB 4U1KA 5DEGA 4G6FD 2GK0B 3U48A 4M6OL 2B5IB 3DO7A 3GHBH 5EA0H 1MAMH 1U36A 3ZDYE 4XH2B 1UB5A 4JFFA 1Q1JH 1J0IA 2RCSL 3HPJB 2VXSL 5GS1C 2P8MA 1CLCA 4Y19D 1RIVL 5C2BL 3AVEA 5D7LB 1FGVH 4HZLB 1RIUL 1KEMH 3AUVA 4K7PL 3TWCL 3VXMB 1GC1L 1QRND 2IPUG 3FQXA 4FS0A 1GHFL 4HUUB 3QO0A 4NO2A 2R4RL 5I18H 4HS3A 3EGSA 3V5HB 5FK9A 3KPSA 1S7SB 2NLJA 2UY6A 1CQKA 1GZQB 3F6LA 1H8NA 2CIKA 1DUYA 2PYEB 4WFFE 2R0LL 3BJLA 3RNKB 4KI5D 1N8ZB 3ULVF 2DLIA 1XF5B 2CDGB 4WW2F 1B90A 4IRJD 1QSFA 4P3WA 4Z7UB 5DA0B 4A6YB 4WHTA 4F57H 3GEWB 2DQDH 4HXBH 4WI4A 5F89B 5AZ2H 4Z7NF 5C6TL 4WTWA 2I9TB 3QDMB 3T08A 4NC2B 4R4ND 4JZOB 1N4XH 1YPZB 4NQSB 4C56A 5IQ9B 1R24B 2CRZA 3MBEA 1YEEL 1C5DA 3AB0C 4EIGB 1WIOA 5E99L 4KTDL 2JB5L 4XVSH 1KJVB 3VI4E 1J5OH 3MRRB 4X98B 4QWWC 3REVA 4M8QB 32C2B 1NKRA 5HYSA 3ZYOA 4OCXH 4FFZL 5KANI 5AEAA 2L7UA 3K80A 3GO1L 3OJMB 2X5PA 4OGXH 3GBML 3MSPA 1P9MC 2HJKA 4NRXA 3FONA 1OAUH 1C7TA 1U3JA 3UAJC 2P5EB 5DFWH 1CS6A 5AYQA 4G8EA 4ZXBA 3HG1E 4CL7A 2PR4L 2R56L 1A1MB 4OQ1A 4UNVA 2YRPA 3CX5J 1EHLH 1YEHH 2ZCKH 5CJ8A 5GS0D 2X89A 1KIRB 4N5EC 2FX7L 1YJDH 1NEZB 5K59F 5F9JB 4R26L 3ARBA 3C08H 2HRPH 5EU5A 1UVQA 3O41B 5EU6E 4GRMB 1A14H 2NY0C 4IIQA 5EIQA 2BSSB 5D7LD 3JTTA 4L5FH 3O2WL 4I0CC 4LLYA 1MJUL 3MRHB 3WLWD 5BZDB 1W8NA 5I17A 3PXHA 3QFJB 3C5ZA 4OCYL 4PV8B 5E2WH 1Q9OA 4Y5XC 3FCTB 2JK5A 1JBJA 1FC2D 3U0PB 2F53E 4NHUA 3BP5A 1G1YA 3FN3A 5I71B 1WEJL 2PYED 4PJAE 4HUXB 4U6HA 3GUTB 1KPVA 2HKHH 1CL7I 2XY1A 1PAMA 3DPBA 5EBGA 2E9IA 4KFZC 1JN6B 3DUHA 1QBMH 4JHWH 5T1LD 2AW2A 2GT9B 5FYJU 2XA3A 4QRPA 3BJ91 5DF0A 4U1KB 5DEGB 4OZFG 3NAAH 4J3VA 4LCWD 2LAGB 3DO7B 1D9KA 1KEGL 4Q9QL 4P4KA 2R1YA 2IG2H 3VJ6A 3LN5B 4YHZL 4RFOH 4EN3C 4JFFB 3A6OA 3NFSH 3O2VL 2GTWB 1MF2L 4OJFL 4RX4D 4XC1H 2P8MB 1FDLL 2YXFA 4X4ZA 4X4YA 2EYSA 4QXTA 5CIPH 5C07E 3D39E 3TNNA 4QYOA 4LRIC 2V9QA 1NCCL 4UUJB 1FNEA 2EE3A 4I3SL 3QO0B 1VGEL 4NO2B 5GGSA 4HS3B 1BREA 2P5ED 1YNLL 3KPSB 5FK9B 3PP4H 4NM4L 1HNFA 4PJBE 4PRIA 4GG6F 2NLJB 3ALWA 4MQ7A 2LVCA 1JTOA 2CIKB 1A6PA 1DUYB 3ES6B 3PF2A 3EZ8A 4RGMC 2QL1A 1G7QA 3W0WE 5LCVL 3CAFA 2P48B 2WUBH 5DTFA 5DVLA 1UWXH 2DWDA 4E0RA 2F5AL 4P5TC 5EOTA 4XP1L 4M48L 3OKMA 3O6KL 2VR9A 2QQKH 1UYWL 2NR6D 3CDGA 4ONGL 1MHPL 1B0GA 1CGWA 1T1ZA 1WBZA 1VA9A 4G8GE 4MXQD 4LCUB 3VXTA 1T03H 4C56B 3NIFE 3MBEB 3T3ME 1FFPA 2XNAB 3QFJD 2VQ1A 4IJ3C 1C5DB 3M17B 2ED8A 5CEYB 3DHJA 3MGAA 1MFDH 1VGKA 2JCCA 4HEPG 5I1KH 4YHML 3VDCA 3REVB 3F5WA 5HYSB 3KLAA 3GI8H 5I73C 5CJXA 3SCMC 1FPTL 4DGIL 2DD8L 4EEEA 3PUCA 2HJKB 3RDTC 1S3KL 3FONB 1QZ1A 3PL6A 2KZWA 3GMNA 1A02N 3VFGH 4I48A 4G8EB 4ZXBB 3NOIA 4RWYH 3BSZH 4UB0H 3L7EA 1YEJL 1KENL 5HYJE 4KI1A 4HPYH 3ARQA 4G6AC 2CMRL 2C3HA 2J8HA 4F37F 2BXZA 4APQC 5D6DA 3BN9C 2RAMA 1FP5A 5D93C 2AS5M 4U1IB 5EU5B 1UVQB 4WO4C 4JFFD 3MRKA 4IIQB 1T7ZA 3V52L 1T89A 4X83A 4LLYB 2EDTA 3JV6A 2MTPA 4UIKH 2CH8A 5IBLC 2YS4A 4ORZC 5I17B 3O4OB 5LQBL 2XOTA 5F1OB 3C5ZB 2BXYA 2IGFL 3LIZL 1L4IA 3KPSD 1Q9OB 2JK5B 1B6UA 4NHUB 2EDWA 3BP5B 4LSPH 5HBBA 4OZHE 4DGVH 1YEIL 1L9NA 2ZP0T 3KYKL 2OM5A 3BD4A 5E1HB 3UJJH 2DM4A 3V0VA 4EI5D 4U6HB 4G7YH 5JW4Q 1MIEH 1DLHA 4YH6A 2BNUA 1J1OL 4BFIA 3EO9L 3O3AA 4JANA 1QSFD 3N1FC 3LQMA 4MWFB 1OAZL 5IB2A 4X80L 4QRPB 3MRMA 1KUMA 1P4BH 3DX7A 1QTYT 4Z7VE 2MSPA 4JM2A 3QCVH 3LKRB 2BVPA 1KSRA 4GUPA 1T4KA 1JTTA 2DMBA 3IRZA 4JFZH 4C56D 2GUOA 3MBED 4TSBH 1D9KB 3TYGH 4G6MH 4P4KB 5IFHH 2R1YB 3MLZH 3VJ6B 2BHYA 3ARGA 5J11B 3FQRA 3VFSA 1MPAL 2YMXH 4JFOA 4KV5E 5CGYD 3D3VD 4DFHA 1II4E 2OXGA 2B4CL 4K9EL 3U30C 4X4YB 4QXTB 4HS8H 1N7ML 4QYOB 4R4FH 3TCLA 1FNEB 2Y5TA 5JLZA 1G9MH 4PGEA 1DBKL 4YDVA 3WS3A 4K7FA 2F54A 4WGVB 5L8LB 1UEYA 4BJLA 3ZSSA 4PRIB 4ZXBD 4MQ7B 4JDTH 3SKOA 5T33H 5HHMD 3UP1A 5DYOA 2FHFA 4MNGE 1MCIA 4HW6A 2VXQL 5E6IA 5DTFB 5F7EH 2DWDB 3RGHA 2D2OA 1KJ2A 1EDQA 3ARBD 5EOTB 3OKMB 1AQDA 5IK3A 3VXSA 1S7XA 3PQYE 4V2CB 4PY8J 4XMLH 3CDGB 2UZXB 2Y4SA 3MV8D 4NHCL 1B0GB 5B3NA 1T1ZB 4KKAC 4OV6F 2X4TB 4HWEH 1WBZB 3V8CA 1WAAA 3VXTB 3R8QA 4XHJC 4OD1L 4RMUA 2H6PA 4KTYA 3TGXA 3MCG1 5BS0A 1Z0MA 4LARH 4EUPH 4MJ4A 2W9DL 1VGKB 2JCCB 2Q86A 3F5WB 5ANMA 4NZRL 3RWCA 1X5GA 4FZ8L 1A3RL 4XVUD 4NWUL 1X5FA 3DUSA 3RY4A 5D70H 3PL6B 5FGBC 4TSCL 3FB6A 3QHFL 1BBDH 3MA7A 4I48B 4PJHE 1U8JA 4QRPD 4B0MM 2ESVA 4UNUA 2K9UA 3L7EB 1ZGLM 3NN8A 3Q1SH 4LF3A 3ZKNC 1AQKH 3IU3A 4YHOL 4NQTA 5ISZA 4ZUVA 4KI5F 2CLZB 1JHTA 2ARWA 1C7SA 4OBSA 2E6QA 3UTQA 1V3JA 3LEVH 1D9KD 5GGQH 5L88L 4R9HA 4P4KD 5D6CB 4PJDF 2VZ3A 4K8RH 3MRKB 1JRHL 1YYLL 1QLRA 3QXTA 3JV6B 4HULB 4XCNA 1A6UL 3BX7C 5TFSH 2PO6D 2VLRA 5E56A 5HHVH 1CFNA 1AGFA 3BPOB 3SGDH 1EEQA 3NACL 1XCTA 4PRID 2DQIH 3TT1L 5EIVA 3F58L 3IRPX 1MHCA 4JGUA 3V0VB 5IW1A 2QSCL 3WD5H 5I30H 1ZVSB 4QHKI 1KC5L 2P24B 2BNUB 5IOPB 1A5FL 3T2PA 4BFIB 3O3AB 1DLFL 4JANB 4U1MA 1IT9L 3I3DA 4Q6YA 3RGVC 1MCHA 5IB2B 4K94H 2FLBT 3MRMB 3SDAC 3SKJL 5HD8C 2R0WL 3DX7B 3C8DA 4JM2B 4WY7L 4XHQA 2BVPB 4XTRD 2XI9A 4A2MA 4AG4L 4YHYC 4OGAD 3RKDD 4JRWA 5EZLA 2GUOB 1R3KA 5GS0H 3QYCA 1OTUC 3KGRA 3ARGB 1RUKL 3FQRB 4M03A 3VFSB 3QUYA 1SY6A 4JFOB 1ZK9A 2Q6WA 3TO4C 5GRWA 5HSFA 2R2BA 1MIMH 4WU7A 4NKOA 4ONFH 4OCRH 5GRUL 5GGVL 3TCLB 2Y5TB 5JLZB 2IFFH 5F9WC 1MJ7H 5F7WC 4YDVB 3WS3B 4K7FB 2F54B 5JHDB 3RZCA 3PL6D 4PRHA 4WFED 5H37G 3GMLA 1GGCL 1H5BA 1AE6L 2XZAH 2Q3ZA 3SKOB 1SYVA 4WGWB 5DYOB 1A7NH 1IKNC 5C0RL 1FORL 2V5SA 2WWMD 3H42L 2O61A 3MXVH 5E6IB 4YBHA 4ZNCD 1W8OA 3HNVH 3WV0A 3MX0A 4JG0H 2VR4A 1KJ2B 3LDBC 4RA3A 1AQDB 4NO0A 5IK3B 4HT1H 3VXSB 1S7XB 2GW5A 3BXNB 5L2KD 4PUBH 4A6YH 2XACC 2ZUUA 2VXUL 1AO7A 4G5ZH 1B0RA 1I8MA 5IKCA 2WIMA 3HNSH 3HLAA 5JXAH 3VFNA 1JNLH 2YUZA 3T65B 1OAYL 5FYKD 5KOMC 1FL5A 2VDQH 1Q0YH 15C8H 3GSXA 4PP1D 1DBAL 1KCLA 2APWA 4HLZG 1E4JA 4FQXA 2VDML 3P4NA 2Q86B 4FQLL 5ILTL 3CSPA 3H7LA 5ANMB 3CFJA 1YJDC 4IRSA 3RWCB 1BLNA 3MJGX 5B4MC 2ZNXA 3O9WC 2AK4E 3RL1A 2DTSA 1JRHI 1DQJA 3DUSB 5BV7H 1WVZA 2BSED 3SBWC 3MLXL 1OHQA 3MA7B 3UTPD 1U8JB 5KAQG 3QXWA 2X1PA 2ESVB 3NN8B 3OHXA 5A1AA 4LF3B 1LP9A 3EDDA 1QG3A 4HV8A 3QIUC 1G6RH 2VDNL 4ZFFA 3DETC 5ISZB 4ZUVB 4WCYH 3RVXC 2R9HC 1IC4H 4OZ4A 1QNZH 1XF3B 1QOKA 5DMJB 4MXWL 5D7IE 3UTQB 3LQZB 3C6LC 3K4ZA 3ARGD 4NN5B 3GHBL 4YLQT 2FBJL 1QLRB 2BJMH 3OKYA 5DJYA 4U33A 1FC1A 4IOSD 4Z8FH 3RPKA 4NBXB 1CK0H 2VLRB 1KEML 5M94B 2YK1H 1CFNB 1AGFB 4XAKD 5LG1A 4DVRL 5I1AA 5HDOA 3H9SA 2M26A 1XCTB 3I6KA 1YMHA 1TTGA 2HAZA 3QI9C 5F88A 5I18L 3MA9L 3VXRA 2WIIA 1GAFH 5DC4B 1O0VA 1MHCB 5IW1B 3TJHD 1LEKA 5DHYA 1ZS8A 3GBLA 5MEQA 3RVVD 3ESVF 1IM3A 2IH3A 3F7RA 5E6ID 3MLWL 4LIQL 4M7JL 4U1MB 1B2WL 2ZSWA 1BIHA 1OB1A 4PJEE 2C3GA 1A7PH 2VL4A 4JZJC 4Z18A 2ZUYA 1TNNA 1MCDA 5HI5C 1UM5H 5F9OL 5KZCB 4P9HL 5KSUA 2DQDL 1DQLH 1IBGL 1W0YT 1E0OB 4DZBA 5E4EC 1J10A 5EZLB 1R3KB 2YA0A 2VDPH 3MJ8A 3W82A 3MRPA 5BS0D 5FCUL 2Q6WB 3MJ9A 2R2BB 4XVSL 1OP5K 1MVFA 4W4NA 1J5OL 4O2FA 3TZVC 4WU7B 5B22A 4JPWH 4NKOB 5I15H 2HMIC 4OCLC 4HC1A 4D3CL 4D9QE 4DKFL 2NY1B 4I18A 3RZCB 2YZ1A 3MBXH 4PRHB 4OLVL 1T20A 1H5BB 1DEDA 1NGPL 1BJMA 5A43C 2ESVD 1RUQH 1RZ7H 3EOAA 3RIFF 1I1RA 2X6MA 5ISZD 5JR1H 2NQCA 3VH8A 4BH8A 2E27H 1LE5A 1YEHL 3HE6A 1HI6A 4HAGA 1MUJA 1AR2A 3HCVA 5FDWA 4NO0B 1MFAL 2F58L 4XPAH 5KOVC 5ALBL 3S5LA 1P84K 1F4YH 1BD2A 4JO2L 3CXHK 1L7IL 3HG1A 1I8MB 1A14L 4NN6B 3CFCL 3HLAB 3LAFA 3VFNB 4D2NA 2CO6B 1V7ML 2VLRD 1UJ3A 1FL5B 4L5FL 3GSXB 3ILQC 1K8IA 1P4IL 2BVTA 5DJ2A 5DUBB 1XAUA 3IDYC 1UA6L 3IFLH 1A64A 5CD5C 2FO1A 2QSVA 3CFJB 3BD3A 3WFBL 3DBXA 1FV1B 4Z7WA 4IRSB 1BLNB 3RL1B 2D4FA 1DQJB 1KOAA 5IQ7L 2OK0L 1YDPA 3FO0L 3P11H 2D7NA 3DX9A 4X8XA 1BM3L 1QBML 1N3NA 4HKZA 2JJWA 3OHXB 5I1EH 1LP9B 1HILA 1HQ4A 2UWEA 4QY8A 2Y07H 4IOFC 4ZFFB 2WMPA 3R06B 2CKBA 3IFNL 1MFBL 3BO8A 1KCSH 4BQ8A 1CXKA 3NAAL 3X3GL 1TETL 2G5BA 4NGHL 5DWUH 5F21B 5T3ZH 1IVLA 4ZFOA 4YBQD 2DMCA 3ROOA 3QUYD 4HFUH 3CNKA 4L3ED 4YDJA 5DJYB 3EHBC 2DYPA 2IG2L 4S1QL 3D87B 4U6XA 3NFSL 5GRJH 5DMYA 1ADQL 3K1DA 4XNUH 3WUWG 5IJVA 3MNVB 2R39A 8CGTA 3F7YA 4JY4A 2XG4A 4I3RH 4X6FA 3RZCD 1G1CA 3L3JA 4PRHD 3KPLA 5I1AB 3ABZA 3H9SB 3I6KB 1YMHB 4KKBC 5I66A 5F88B 1P5UA 3VXRB 1NMCC 3PP4L 2WIIB 4NC1C 2HFFA 3U7WL 1LEKB 5DHYB 5D96C 1ZS8B 5MEQB 1IM3B 2IH3B 5C07A 2HLFC 3ULUD 5DMIL 4M4RA 1E6JH 2ZSWB 2B8OT 5DVKA 4TNVK 2WUBL 4MQTB 1NUNB 3BAEL 4XRCA 3QG7L 5I74C 2Z35A 2XA8L 5IMKA 4HH8A 5ESAB 5KSUB 4RBPK 1AO7D 1MCPH 3MJ7A 5DJAA 2QQKL 1G9MC 2QQNH 5ICZA 4DZBB 4JKWA 3S3JA 3PGFH 4G9FD 1G7PA 4BSWA 3W5NA 3MJ8B 1VPOH 3ILPB 2J1KA 1AIFA 3MRPB 5FIEA 2VOTA 1T03L 5BZWA 3DVIA 4P2QA 1KB9J 4FQXD 1NPUA 2DTML 5C1MB 2C4XA 1U6AH 2ZUWA 4U1HA 4O2FB 3OGOE 3KS0H 4WTXA 5I1KL 5I1JH 2BRRL 3V8OA 4NSKA 2Q7YA 2ENSA 5IESL 4I18B 5C0AA 2VSDA 1T66D 2XXCB 1JHLH 3HE7C 4LASH 4L8BA 1NFIB 4L3CA 1CDCA 4KKLC 2AI0L 4Q74A 3EOAB 3MODH 4NCC1 4AH2A 4RWYL 1PKQE 3CUPA 3QIBC 1FBIL 1EEUA 2WSKA 3VH8B 4BH8B 3QXDA 1LE5B 3HE6B 1XF1A 1HI6B 4PJIF 1A3LL 1KBGL 1MUJB 3T77A 1YMMD 4GQ9H 4UBDC 1CDIA 2KBGA 3HCVB 4PJ7F 4WEBL 4KKCC 4OLUL 3SEPA 3IFOA 3S5LB 5IEHA 1BD2B 2MPAH 2VH5H 2QLVB 2GCYB 3HG1B 2UZIL 5J3HD 3OJ2C 4LHUD 1UJ3B 2AXHA 1K8IB 5DJ2B 3UTTD 5L2JA 4O00A 2F19H 3N1GC 2JJTA 4JFPA 1J8HE 4QCIA 2H45A 3VXRD 1F3DH 4PJ9A 4CGTA 2XQYG 2BY0A 5B39G 3OB0K 4MS8D 3DBXB 2YUWA 5AWNH 1SYSA 1HQRA 2PXYC 4DGVL 1IGCH 3L6FA 5DQJA 4K8RC 2W0FB 1YDPB 1CTNA 1FNSH 1YA5A 1FH5H 4PJGA 4IRJC 4M6NH 3DX9B 5CJBA 2IJ0C 1RI8A 1T1WA 5CFHA 1N3NB 2YPLA 4DKAA 4HKZB 3TP4A 2VDOL 4OZGF 1LO4H 1HILB 1HQ4B 2UWEB 4QY8B 2QADC 4M93C 1CXIA 4AMKL 2PN5A 3HC0A 2CKBB 3BO8B 3SDCD 1GH7A 1UZ6F 5C6PB 3V0WL 1WIUA 2BNQE 2G5BB 3OAUH 4L4TA 3ZDXE 4JFZL 4ZFOB 3ROOB 4TSBL 3OJDA 3TYGL 4P2YA 4DW2L 4YDJB 4G6ML 4B41A 2AV7A 3SE3A 2DYPB 2WLYA 1F13A 4U6XB 2X4RA 1MWAB 4I3GA 1WLHA 2Q87A 3GK8H 3T0XA 4JY4B 4HS8L 2VDLL 5LKNA 2EDYA 4X6FB 3L3JB 3QISA 1IE5A 2ERJB 4K94C 4Q9RL 3KPLB 3CH8A 4M4PA 1S7UA 5FYKH 4RA0C 5KSBA 2SEBA 1CGSL 5K33A 1KCRH 2HFFB 3D6GA 2ZUQB 3HNTL 4JDTL 3FHAA 2NW3A 4NCDA 1REIA 5GS0C 5C07B 2A2QT 4OCWL 2L4OA 1L0XA 4CADA 1FG2A 3NA9H 5FUZL 1JGDB 3MLVH 2B5IC 1OLZA 5I1HL 3RWJA 5FO7A 2PTUA 5CINH 1PX3A 4XRCB 3GZKA 3DMMA 3LCYA 3OAYH 2Z35B 1BD2D 5IMKB 1UKTA 4GRWB 1JWUA 3FQTA 4O5LH 2UZYB 5DJAB 2DLFH 3JV4A 5ICZB 3QPQD 4Y88A 5EUOE 4O2EA 2GYSA 4XP6L 1J0ZA 2AP2A 4ZO6A 4BSWB 1AIFB 2ARJQ 3C60A 3E2HC 3V6OC 4KK6C 4PG9A 4NRZA 4PRPD 5IROA 4P2QB 1S5HB 1EH9A 4N90D 1ACYL 1U91A 4U1HB 1PEZA 3UXFA 1H3XA 5KS9E 3WMSA 2IAMA 4NSKB 3O3DA 2Q7YB 4UV7L 5C09A 2VLKE 5C0AB 2O26U 4WI6A 4MMZC 3UJTL 3PWVB 3VXOA 4NFBA 1OGAD 4L8BB 4HIHA 4L3CB 3TFKD 4U0RB 4EKXA 5HGAA 1J1PH 4OD2B 1DBML 4AH2B 5MENE 3C09B 4FQIH 1TZGL 4DTGL 4Y1AD 5IWLC 4JPKL 2UYLA 1RULL 3Q1SL 4K3JL 4EUPG 1VEMA 3H7BB 5B3JF 5K9QI 1AQKL 3E3QE 2L7JA 4FQ1H 1FIEA 1ZMYA 3IFOB 3LEVL 4N0CC 4X7TA 1MELA 2DYPD 2WUCH 3O4LA 1KJ2H 4UT9H 4PJHA 3EZJB 4S1SH 3VDAA 3SY0A 1HCVA 2BNRA 2C3VB 4JLRA 2HT2D 3TT3L 5BJTB 2G60H 1CFTA 3NPZB 1QUNA 4JAMA 1FNFA 5TFSL 1AGEA 3RTQA 3DVFA 4N8PA 1ZOXA 4TUKL 5BW7C 1R3JB 5E94A 3TVMD 4FTVE 4JFPB 4QCIB 4PJ9B 4D9LH 3REWB 1SYSB 1JYXA 4PG2A 4JPVL 1ZHLA 5I30L 3L6FB 5DQJB 1NBZB 1G9EA 4YO0A 1ZT4A 5E8NA 5JXED 1T0NA 1T1WB 5C0JA 3WE6A 3QDJE 2OMNA 2YPLB 4F7MA 1IAKA 4YEEA 4OF6A 3BZDA 4WHCA 3KPOA 2DJUA 5EO1A 1UC6A 2K1MA 2CLRA 3P77A 3HC0B 3MRDA 4NQCA 5DRWB 2DI7A 2C3WA 3UBXI 4B7LA 4M8VA 3BIKA 4WWID 3H3KA 3O6LH 3EJZC 4L4TB 4F8TA 2VKWA 3CVHA 3OJDB 2AV7B 3U2SA 3MLRH 4KKNA 4U49A 1U42A 2NZ9C 3B2UD 1OPGH 2APXA 4NM8L 4Z7QF 2AV1A 1ZHBA 2X4RB 5I71C 3N50A 3VGAB 1UCBL 4Z7VB 2YOCA 2ORBH 4ONFL 4ZAKA 5C0AD 1CYGA 4TSAH 2W1NA 1FGNL 3R8BB 1S7UB 4U7KA 4PJFF 5KSBB 2NZIA 2X40A 4RDQG 2SEBB 1U8HA 4WHDA 1WFNA 4YC2C 1LO2L 2NW3B 2XZCH 1OSPL 5D2NC 2HT3D 1CG9A 2R69L 3OKDA 1G9NL 4CADB 1LDPL 1WZKA 3BPNB 4NQEE 4P46A 4XCEA 5FO7B 1ZSDA 4U4BA 2LU3A 5HY9A 2ADGA 2YC1A 2AJZA 3VXUE 3EYSL 1EAPA 2XWBB 4U05A 3EIFA 1JWUB 1AJ7H 3FQTB 1VADA 5A2KH 4W4OC 2CXGA 1MRCH 4O2EB 2AJYH 4X6CE 3HNSL 3C60B 5FKPA 3V95A 2YPKA 4PG9B 5GJSL 1Q0YL 2NY2B 3K2MC 4OB5H 2P46B 1INDH 1HOCA 3MACL 43C9A 1U91B 4UU9A 4PJ9D 3IFPB 3PQYB 4P9ML 2C3XA 2IAMB 3GSNL 1CE1H 1QFWM 3O3DB 4PJCF 5E08L 3LOWA 3MYJA 4MXVF 5C09B 3ROLA 4UTAL 3VXOB 4FABL 4M61A 5BV7L 3RY6A 3DO3A 4FFYH 2Z93B 1WCBA 1MJJA 5DS8A 2YPLD 3H3PL 4M1GL 5HGAB 3HUJA 2EYRA 1LE9A 2NW2B 1DQML 4YXKH 2UYLB 4GKNA 3SJVD 3DX8A 1T3FB 2YD3A 1G6RL 4PLJD 4WCYL 2DWEA 3A6CH 1IC4L 1P69B 1QNZL 4GMTL 4L4TD 1TZIA 3ULUH 2EC9T 1EZVX 1A6TA 4X7TB 3S35H 1TIUA 5C08E 1MCEA 1TCRA 4PJHB 4NFCA 3RNQA 2BJML 4PRNA 3CFKA 3SY0B 2BNRB 4JLRB 2E7LC 1Q72H 2RFXA 3RA7L 4QTIL 1A3QA 3BN3B 1CFTB 3DX6A 3RI5F 3KPQA 4JAMB 1AGEB 3RTQB 4KWUA 4LVOC 2YK1L 1PLGH 1TQBB 5EG6C 4JHZA 3HFML 1MRDH 2KL6A 4ZXBC 1T7WA 4O9HH 4M9PA 2Y25A 5TDPB 2VXVH 2BOCB 4KVCH 5E2UL 3L95A 1S78D 4LGRB 1NEZG 1EJ6A 1ZHLB 2COQA 1PVHA 5I8OH 1E4XH 1GSMA 4PV9A 4YO0B 1ZT4B 5E8NB 3MV9E 5LGHL 3QHTC 5TF1H 5C0JB 3WE6B 1WZ1H 2BVOA 2DBLH 4F7MB 3DMMD 1DZBA 1IAKB 4EDWH 3JSSA 4ODHL 1MFEH 1J87A 4IIQC 1WSST 3P77B 3MRDB 4NQCB 4RMSA 2MKLC 2DQHL 3TBSA 4GAJH 4MB5A 4KK8C 1OAQH 1EZVY 3BIKB 5A16A 3O4OC 4LSQL 3DRQA 1JMXA 1IFHL 3C5ZC 1MAKA 3CVHB 4DKEL 2VDPL 2Q8AH 2NY2D 4PJEA 3U2SB 2D9CA 2DS4A 2VIRB 5HGDA 2AV1B 1ZHBB 2J8OA 1K85A 1BIIA 5FM4A 2Z8SA 4IBLT 3RBSA 4JPWL 4GRLA 5I1CL 2PKDA 2E7HA 5AAWA 1F4WH 2JE8A 5CKAA 1FNGA 3WKNA 3D2UA 2DM3A 4HJJH 4F58H 3NBNA 4N0FB 3Q6FA 4YE4H 3MRGA 3RU8L 4U3CA 2EEBA 3MRFA 4WENB 1U8HB 2ATPA 1CICA 2EE2A 1DEEA 1G7LA 3IAQA 1CG9B 3OKDB 4HX1B 3K4DA 1D5ZA 1U3YA 4KGJA 5JR1L 4P46B 4XCEB 4XVJL 4P4KC 1XIWA 1DP0A 4LLQA 3D85A 1RPQA 3MFFA 4HKXA 4TPRH 5HY9B 1M4KA 2YC1B 5J11C 4OD3H 2AJZB 5CBAA 3O4LD 1EAPB 3LRHA 5J1TC 4ZNEE 1K5NA 3QUKA 1QYGL 1NBVH 2BNRD 1U8OA 2HTLC 4LU5H 3RKPA 4ELMF 1CFVH 1XT5A 1NCAH 5JQHC 5FKPB 3IDXL 3RTQD 2YPKB 1QBLL 1OOAA 5BXFA 5D2LA 4HBCL 3P4LA 5EZOL 3U0WL 1PG7L 4LLWA 1HOCB 3OF6D 4UU9B 4N0UA 4S1RL 1U58B 2Z9TA 4ODSL 2H26A 3MJ9H 3QIWA 4F33A 2J2ZA 3NCJH 2V5MA 2NMSA 4U6VH 4M61B 2BSTB 4HC1H 1WCBB 1MJJB 5DS8B 3O6FA 4MCZA 4CN1A 3QPXH 2X4QA 2HJLB 1GIGL 3I85A 3HUJB 2EYRB 1ZEAH 1LE9B 4LOUC 4KRMB 5EZIH 1NGXA 3H6JA 4NQCD 4XWGH 4XTRC 3DX8B 1IAIH 2B2XH 3DARA 3HI5H 5EU4A 1CU4H 2DWEB 5C0GA 3EDJA 1X3DA 1BF8A 1TZIB 3VFRA 2EIBA 1A6TB 1MRFH 2R29L 2R23A 5HYSG 4J3TA 4M6ML 1TCRB 1KXQE 3I6LE 2E5EA 4YHKL 3RNQB 4LPCA 5CJXC 2W38A 5D71H 4ZAKD 1UGNA 1NLDH 3L3GA 4FNLH 3KJ6H 2CDEA 1PDKA 2X41A 3PL6C 4XP5H 3SQOH 4RISL 3P0YH 1D5BA 2B1HH 3WO4B 2CO7B 1WISA 4P23A 1CGTA 1MEXL 3L95B 5T5NG 3FRUA 1H3PH 1LGVA 4GJTB 2WWMC 1DE4A 1JYVA 5MEOA 3HB3D 2N4IA 4PV9B 1Q0XH 2RHEA 3F7VA 1ES0A 5CEZL 3QXVA 4NCC2 2GAZA 3U0TA 3TJEH 4GMSH 4B50A 1BZ7A 1T89C 1KACB 2AABL 3O3BA 1MCPL 4TVPD 2VDRH 3TBSB 3CFEA 2HWZH 5A16B 1SJHA 4Z5RA 2X9WA 3DRQB 4MJIA 2CKBH 1JP5A 3LQAC 1VPOL 1TJHH 3BPOC 3RVWD 1U3HC 4PJXA 4PJEB 4LDEB 3ZKMC 2MOVA 4LSUL 4OM0L 4BSVA 1BIIB 1CGUA 5T3XD 1KXVC 1V5JA 2OP4H 1UM6H 4P0DA 1AXIB 2C1OA 1PSKH 1S8DA 4GRLB 4KHTH 1J11A 1FNGB 2I25N 3D2UB 3QEHA 1N59A 3MRGB 2ATPB 4WEUD 1E27B 1B0WA 4KMTH 1DEEB 1G7MA 1G7LB 4JM2C 1T1XA 2EO9A 5GHWH 4K7PX 1XIWB 4LLQB 3D85B 3MFFB 4HKXB 3EW3B 5CBAB 2VZVA 1S5IH 4RDQF 3QUKB 3QQ9D 4R7NA 1MLBA 1U8OB 2CRIA 2IADA 5JW5A 1WTGT 4DOHB 2RQ8A 4GRWH 1HYSD 3CU7A 4TUOA 5BXFB 4TOYH 1IL1A 4Z0BH 5D2LB 4AYFA 1EEZA 4QRTA 4IRZH 4RAVA 4ZUTA 2VJXA 4LLWB 3OKOA 4N0UB 1I8LA 4N0RA 5HHNB 5E70A 4OSUH 2H26B 2MCPH 3QIWB 4F33B 3ARFB 5IB1A 4X6BA 3RVVC 1I3VA 1Q9KB 5IVOA 4N1EA 4XGZA 1S9KC 4K3DH 4XC3H 3G6JF 5IGXL 2P44B 3SDXA 4FA8A 1JYNA 1ACZA 5F1KC 4N0YH 3O6FB 2O5YL 2XWTA 2DB8A 4MCZB 1FNSL 1FH5L 1OQXA 1HH6A 2X4QB 5E5RB 4NT6A 4JPIA 4UINH 3GBNH 4JM4L 4ZFZA 3OJVC 1N5YL 4PREA 4NJ9L 1NGXB 1LO4L 1ZLUH 1KTKE 5J9PB 3W9EA 4K7PY 2K3TA 5DK2A 2P4AB 5EU4B 5C0GB 2OJZL 3MC0A 2WQRA 4GG8A 4YHPA 2XN9E 2WLZA 4I0PA 4MB4A 2R23B 2GHWB 4QRSA 4Y16A 5IVXA 2XIDA 3U1SH 2DRUA 1X4ZA 4NZTH 1FVDB 2NYYD 1FZOA 5TGBA 1YPZF 5J12B 1T0MA 4GRLD 3GK8L 3L3GB 5SX5K 2CDEB 4ZS7H 2HRLA 3FMGH 7CGTA 3D2UD 1CD1A 3EAKA 3LKNA 2XKUA 1D5BB 5D1QA 1SEQL 1VEOA 3C5SA 4R90H 1AXSA 3BP4A 4UT7H 3VFPA 4P23B 1CICD 3SGKC 2Y6SD 3LKOA 1N6QL 2ICWI 2VL5A 1VFUA 1KCRL 2DBJA 5E0QA 1PKOA 1DE4B 5MEOB 2RIKA 3D9AL 2VB5A 4UDTA 5I19H 1ES0B 3D85D 3NA9L 1NC4B 2I60H 3T0EA 2GAZB 3F62A 2X4OA 3MLVL 4JFED 4NN5C 1G6VK 2IEPA 4R4BA 5CINL 1V8HA 3PWPE 1BZ7B 1CLZH 1Q94A 4QNPF 1X4YA 3O3BB 2ZNWA 4F15B 3INUL 5KSVA 3M45A 2DLFL 1SJHB 4U1LB 5F96L 4Z5RB 1AH1A 4MJIB 4XMPH 1H9VA 2MQ0A 1DDHA 5D8JH 5D5ME 4D0BA 3FFCE 4PJXB 1FAIH 4LLMA 3UZVB 4BUHA 4L4VE 1RD6A 4LGPB