5EN2A

Molecular basis for antibody-mediated neutralization of new world hemorrhagic fever mammarenaviruses
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
219
Chain Sequence
EVKLQQSGAELARPGTSVKLSCKASGYTFTNYWMQWIKQRPGQGLEWIGAVYPGDGDTRFSQKFKGKATLTADKSSSTAYMQLSSLSSEDSAVYFCARRRVYYGSNYIYALDYWGQGTSVTVSAAKTTAPSVYPLAPVGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for Antibody-Mediated Neutralization of New World Hemorrhagic Fever Mammarenaviruses.
pubmed doi rcsb
source organism Mus musculus
molecule tags Viral protein/immune system
molecule keywords GD01 heavy chain
total genus 46
structure length 219
sequence length 224
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5en2A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5en2A02
3ZT7A 1OPGH 4U1KB 1I7RB 4QNPE 4KI5D 3AU1B 1JHLH 1OAZL 3SKOB 3C2SA 4OZHA 5F3HA 3RWCB 1VACB 3MODL 4XCYA 4HF5L 5J1AA 4XP4H 4Y4KB 4PRPA 3G6DH 4OZIE 1XF3B 3GKWL 3LKRA 5T1LA 3QA3B 4S2SB 3CDYA 3FT4A 5T1DL 5E2WL 5GS0H 3C5ZC 1O5DT 3E6FA 4MSWA 2X05A 1L0XA 3DVIA 4Q9RL 2A83B 2K1MA 4HC1A 4KTYA 4XTRC 4LLYB 5ISZE 3QQ3B 3I6GA 4YHIA 1U8PB 3F7YA 1U36A 3MLSH 4KK9D 1J86A 1EO8L 1MVFA 1PBYA 2C3VA 3BWAB 4Z0XA 3ZTJG 1KIPA 4Z7UE 1J5OL 3GRWL 2V2WA 1INQB 2JKXA 1GOFA 2ESVB 4JY5L 1R3JB 1G9MH 2Y6SD 1U6AH 4U1SA 3TFKC 1RULH 4YPGB 1NL0H 4GAFB 4QY8A 4WO4C 1A6VH 4NZRH 4TTGA 3LAFA 1NUDA 2KQNA 3MRJA 3FQRA 4Z7VB 2F58H 3MNWA 3FQUB 3AROA 4UNVA 3BJLA 4CUCA 1GRWA 3KPSA 1O7VA 5A40E 1NJ9B 4P5TB 3V6OC 3OKMA 1MAMH 3QBTB 4Y4FA 4I0CC 5EU6B 1T2QL 4LVHC 4N5ED 3RDTD 1TDQA 5IF0B 2ATKB 1SVZA 3IKKA 1ZVSB 2A6JB 3OAUH 3DBXA 3QQ9D 4FQ1L 4ZSOA 5EC2B 4BZ2H 4PD4J 5JPMB 5ESQA 2Q86A 1YMMD 3I50L 4PP1D 3BUYA 1TQBC 2OTWA 2QSCL 1UVQA 4NPYB 2DBJA 2PYEB 5SX4H 1T0NA 2AJVH 1EIBA 1P1ZB 3D85B 1R24A 2B0SL 4MA3B 5D7KD 1F13A 4OGAD 2IQAB 4HIJB 3S5LG 3E6HB 3PL6D 4KUZL 3VDBA 4DKFL 3H9SE 1FGNL 3QNYB 2VDPL 5E08H 2DIJA 5LXGH 3RVXD 1QA9A 3AS2A 3WJLA 1JGUL 3M45A 3QUZB 5DJDA 5IVXA 1KIQA 2YXFA 3G9AB 4XMPL 1QFUL 4O00A 2BRQA 4Z7VE 1J88A 4KI1A 1JWUA 3EO9L 1NUGA 1CGUA 3MV7D 3OGCB 4JN1H 2VB5A 4E41A 2OJEA 3QULA 3WE6B 2AK4B 4YH6A 5KVFL 43CAA 3GHBH 4G8IB 5GGTH 3ZYJA 4DZ8A 5EORH 3QPXL 4PGBB 3RJQB 3MJ8B 4MNGA 1FLTX 3IDYC 5H94B 3RBGA 3O3DB 5KSAA 5JNYB 4EDXB 1PZ5B 1X5GA 3KPLB 3UDWA 4HKXB 3BEWA 1QNZL 1ZHNB 4N90E 1MCNA 5FGRA 1XF4A 4K7FA 2AXFB 1GGUA 4X80H 3OKDA 4GW5B 3PWPE 3VMNA 4QRPE 1K6QL 1I7TB 4IDLA 4OLEA 3F7RA 1CE6B 4PLKD 2RJMA 4UB0H 1Z5LA 1T1WA 1GC1C 2V9RA 4DZBA 4EEEA 4PJDA 1HNGA 2Q7NA 5BS0D 1UXWA 2NY7L 3HC3H 3HG1D 4N5UA 4ZUTB 1DEEA 3RTQA 3TESA 1KTDA 3IDGB 1KB9J 2AABH 4OSUH 4OZGB 4GMSH 4WVRA 1HEZA 4WFGE 3EO1A 4ZPTA 3HPLA 3RWFB 4LVNB 5EOCJ 4D8PA 1D3CA 1ZLUK 2OZ4L 4QWWD 1P7QA 3D3VA 1JGEA 4TPRH 1JI2A 2C3GA 4FXKB 4H0IA 4Q0XH 4C58B 3KXFE 4KK6C 3RX7A 3MV8E 4U6VH 1H0DA 4WWID 1PLGL 3WXWH 4HC1L 1UGNA 1RIHH 1UFUA 1WT5A 2R15A 1P4IL 5C6TL 2QHRL 5D6DC 5E1HB 1G7PA 2YK1L 2UY6A 1ES0A 4PG9A 4G42B 2I5YL 5EULV 5KVGH 3QFJA 4AK1A 4YHLL 1U8OA 1A6ZB 4N0FB 3DV4B 3IFLH 4G3YL 1FVDA 1JCKA 4OF7A 1HHHB 4JFEB 2J6EL 3ARGB 3FN0H 3G5VA 3KLHC 3GMLA 2XKSA 1N64L 1OAQL 4KKBC 2OSLB 1QQDB 3P9WB 3QH3B 5HHOE 3S35H 4CN1A 4J23A 4ZFFA 3PL6B 2K9UA 4TRPH 4DGIH 3EYQD 3S3PA 2R56H 3FZUD 4RFNC 1FNFA 3O8XA 3O6LH 5KSBE 2DMKA 3T0BA 2APFA 1Y0LA 3MLRH 3JV6B 1H3GA 2E3VA 2XY2A 4UDUB 5TJWK 2NY5C 2AW2A 2FIRT 3UJJH 2VWEE 4ZG1A 1WCQA 5H35A 4QRRA 4X5XA 1V7NH 2PF6A 3MV7E 5CMAA 3GMPA 4YHKH 1D9KA 2CKNA 5IG7B 3ARWA 3VRJB 3QUMA 5FCUH 3TBVB 4P46B 3SKNA 4XP9H 4Y5XC 1EMTL 2HJKB 4LSQH 2RBLA 5JLZB 2AJUH 5BZWB 3O45A 3KYMA 3MCG1 3O6LL 4JY4B 2R56L 1XCTA 4X6EA 4HWBA 1C16A 4G6JH 3BN9D 1NMCC 3Q1SH 5IFAL 1RHFA 2YWZA 4X4XA 1DBMH 4A2MA 4OD2B 1SBBA 4ZO8A 1QACA 1ZWIA 3N9GH 4GAJL 4U4BA 1X7QB 3ALWA 4TUJA 3O3BB 3B43A 4KHTH 1ZS8B 4RWYL 3RI5K 1IKFH 1QPXA 1ODAA 4MAYD 2YD4A 3CX2A 2XNAB 1NLDH 4LF3A 4U1KA 4ZMAT 4I3SL 1RMFL 1K5NB 3SKJH 3OXSA 3VDCA 3T04D 1F3JA 2BSTB 3Q2CA 4G8FB 4I0PA 3KLAA 3S3SA 1CU4H 5D6CA 1AGDB 3D0VB 4U6VL 2Q8BH 3EYOA 1CDCA 1CL7I 4G8GB 3F65A 3UAJC 1FC2D 1RK0A 4AENB 3NZHH 2E7LC 3PDOA 1FZKB 2GJJA 2CDFA 3V52L 2OZ4H 3H9ZA 2P46B 5I8EB 5D1QD 3I6GB 1B9ZA 5C0IA 3L1OL 4F7CB 1VFAA 2N7AA 2UWEA 4HIHA 5F6HI 3BP6A 5IESL 3HC3L 2QQKL 3ZKNC 1KENH 4TSAL 1CF8H 3WSQL 5F1NA 4Y2DD 2VDOL 5J0BA 4PGDA 2GHWB 4X7TA 5EZIH 3ZKXB 4J3WA 3KVQA 4FQXB 5JW4R 3VGEA 2EIZB 4NQCD 5HBBA 4JDTH 5IBUB 4NC2B 5DRZB 1JTPA 3PJSB 4LCCA 1OB1B 4Z7WE 1T4KB 4XWGL 4FFVC 3INUL 5LGJA 1KFAH 5JO5B 3C2AL 4I3RH 2P5ED 2R1YA 3B6SA 4FNLL 3SDDA 2Q7YB 3S96A 1E4KA 1KTKE 4KKCD 4LGSB 5FECB 3IAQA 3S3JA 4M48L 1N8ZA 1S9XA 2EDJA 1B0RA 5JR1H 4PRNB 4L3EA 1BLNB 5TQ2H 5I1JL 3TZVD 5KZCB 4P9HL 3LEYL 1JHTA 2BVEA 2VDQH 1A47A 3KYKL 5KSVB 3DETC 3LVEA 2HT3C 1K4CB 2PTTA 4D9RE 3EO9H 2YRLA 3JWDL 3DX6B 2WMPA 4I9WE 1AHWC 2AP2A 1LE9A 4PJ7F 3NPSB 4YX2H 3CH8A 2OTWB 1VADA 1TIUA 2W38A 2XXMB 3O4LB 5ISZA 5F1SA 5CLWA 6FABH 4YXKH 1U3YA 3EOAB 4MDJA 5E6IB 4O2CA 3ORJA 1JTOA 4ZQKA 1OP5H 2VRAA 4G7VH 1D5MA 1ZLVK 2LU7A 4D9LL 1YEHL 3EFDL 3V2AR 3GMMB 1A7OH 1I1FB 4IMKA 2V7HA 3TO4C 4PJXF 2YMXH 1RUKL 4WUKL 2BNRE 3VWKB 3U2SB 2P8MA 1A7RH 5DEFB 1LP9E 3WHXB 3P77B 4W4OC 1Q72L 5D93B 3DIFB 4OGXL 1KG0A 3C60C 1LGVA 4MNQE 5CIPB 1J1XH 5FCSH 5T3ZD 3KPSE 4E41B 4CVWA 2ZUUA 4OLYL 4LCIL 4K8RH 2DQDL 1XGPA 4O2EA 4K2UH 2NY3D 3DYMA 2H8PA 3K3QA 3JTSA 5EO9A 1DBKL 1XF1A 5EFIA 2XZCH 2P49B 4OF3A 2YR3A 1G6RB 2H2PC 4F7MA 3EZ8A 1RZKL 3MCKA 3MXVL 3ULUE 4IDJH 4S1SH 3HR6A 3SDCC 1F3DJ 4NZRL 3NBNA 3ZKQD 3MRQA 4TSCL 3QUKA 1T7ZA 5KSUA 1BJ8A 4XBGA 4U6YA 3UP1A 2G60L 1G9ML 1KOAA 4RGMC 2C3VB 5IHBA 4DVRH 3U0WL 3H9SA 5DJAA 5MENB 1RUQH 4A6YA 1GYAA 3RTQB 4YDLC 2WAHA 3ULUH 1GGBL 3GB7A 1I8IB 1BQHB 1AI1H 1R3JA 3K1DA 1JHKL 5FHBL 2XT1B 4UU9B 5HYIA 5IOPA 3VRLF 2IFFL 4TVPL 3VXRE 4L8DB 1AQDB 4RAHA 4EN3A 3EDKA 3VGAB 3H3KA 2XN9D 1H15A 5EUKA 5JTWA 4Q6IC 1OT1A 3VXQA 5KJRL 4ODWA 4RAVA 2AEQL 4PJFA 5DJ6B 1MNUL 5FKAA 4Z0BH 4KK6D 3AM8A 3BW9A 4NQEE 4E41E 3EDFA 3G6DL 3B3IA 4U7KA 3UBXA 2W9LA 4XP4L 1E27A 2P24B 5D72H 1YN7B 5TF1H 4YC2C 4BH8B 1EDQA 3AGVA 1JTTA 3LKNB 4CU7A 1I4FB 3TBYB 2ICWA 1I9IL 5I74B 2EH8L 1F58H 3WFEL 1SYSB 1F3RB 3QDGA 1ORSA 1ZHLA 4JFQB 1A2YB 5T1MB 4UT6H 5KANI 2HFGH 3P4OB 3S6CA 3QEUA 5GGQL 3B9VA 3SCMC 2VLME 3T3MF 5BXFB 3AAZA 3BUYB 2EIDA 4PGEB 4QRPA 2VZ3A 1HDMA 2EXWC 2X1OA 1EEZB 4WENB 2GT9A 3WDHA 3BRFA 1WEJL 1KYOK 5IHUH 5IMKB 1J18A 3ETBF 2ZSVB 3C8KA 1LO5B 2OI9B 4ZUSA 5D7LB 3VRIB 2UWEF 1J0YA 3TN0A 3U7YH 4LHJB 1GJIA 2P7TA 1QRNA 4YGAB 1DUYB 5GGUA 3WLWC 1NBVL 3D3VE 2BSRA 3IXTB 4JFXA 3V4VL 3VXOB 1TTUA 4R96A 3E3QC 2XZAL 3CC5B 2HJKA 1HYSD 4NQDB 1YEKL 4G6FB 1TVDA 4LHUA 3GSWB 2FH8A 1AP2B 1K3IA 3QDMD 3KXFA 2WUCL 3NAAH 4KVNH 5T3ZL 2FJHA 4ZFZB 4A2LA 5L8LB 3NGBB 1ETZA 1ZA3B 2D3VA 5IMMA 5GJSH 5AG8A 2NR6C 3MV01 3FTGB 3CPLA 4GG6E 3BN9C 5KVEL 3SKMB 2CJUH 2DTML 1F4YL 4AEFA 1MF2H 1T83A 3SGJA 1F6LL 2VZSA 2JCCA 3LS5H 3VD5A 2OP4H 3RIFK 5CCKL 1I8KB 3RDTA 1HHKB 3UTQB 4LSUL 3HNVH 3BP7B 3LS4L 3KPLA 3V0WL 4M3JA 1CR9L 4JE4B 2J7LA 4X7EC 1WF5A 1YN6B 3BPOC 2CRYA 1IZKA 4F33B 3P4NB 4OF0A 2W9EH 3AREB 2QQNH 3G5YB 4H20H 3WN5B 5HHOB 1Y18B 3GMOB 1MAJA 5GS1A 3Q0HA 1GAFL 4HQQL 3IDIB 1I7TA 1SEQL 4JGMA 4ZFOA 3QI9A 2XICA 1XGTA 4MXVE 2LU4A 1YQVH 2Z8VC 1IZJA 4YE4L 3UTZA 4H25B 3WUWG 1J12A 4QRRE 1UEMA 4HT1L 1S7SA 3D2UD 2DQIH 4PPTA 3R06A 4KKLD 1RZJC 1JZ5A 3FQNB 2ED8A 4ZPTB 5FA4B 4LSPL 2N1KA 4HIEB 2APVA 3TBSB 3N1MC 2SEBB 3KWWA 1F2XK 5IJVA 1RZ7L 2GYSA 4Y2DC 4ZAKA 2QR0B 5CP7A 5GRUH 3RY5A 4MQ7A 3STZA 4QTIH 1R3HA 4QRRD 3AU1A 4B50A 1GXEA 5DJZB 3N1QC 2COQA 5KG9A 4PRPD 4XCYB 3KPOB 5E56A 5CEZE 5C0NC 3IRZA 3IJYA 4R4BB 3N1FC 3PXJA 5HGAA 5ENWA 3NABL 4ZUWB 1IAKA 2K7PA 1EERB 1VCAA 3QNZB 4WRLA 3FO0L 4NDMA 3SBWC 4JPIA 3UTSA 3F58H 4NRXA 1S8DA 2PKDA 3QUZC 2PW2B 3DURB 2YD3A 1CGSH 2E9IA 1U58A 4KTDH 5FUCC 1CDYA 4XPTL 3KHQA 1U8PA 3F7YB 3PWPA 4ETYA 4PRHE 5E9DB 5IW1A 3DETD 2D4FA 2UYLA 3B5TA 4BH7A 4JB9L 4I3GA 2P43B 3CCHA 3KPQA 4P4RB 4K3EH 1T03L 2EYRB 3DWTA 4JKLA 4FQJH 2GAZA 2CH8A 1C5CL 2BY1A 2OMNA 3EOAA 4Q7DA 3QUMB 4P99A 4G9FA 5CEXA 3VFGL 3VJ6B 3QEQB 4E5XB 5C71A 2X42A 1P7QD 2I07B 3QZWG 4HCRA 3BGMA 4GOSA 3H7BB 5FK9A 5F7EH 3OXRA 2JJSA 3KYMB 3RNQB 3U0PB 4HPYL 5CJXC 2D7TL 4G7YH 1MH5A 5E99H 3LRGA 4E0RB 2BDNL 4FA8A 4YHZL 5TQ0H 4Z7WB 1WTGT 4HV8A 1C1EL 4CNIA 3BGFB 4JRXD 4LEXH 1JYVA 1JNNH 1PQZA 5JPMA 3LOWA 4FQ2H 4LGRB 1TJIL 3CFEA 1ZS8A 3CH1B 2R2CA 2Z4QA 1Q9LA 1F90H 1WLHA 4GMTH 1CXLA 1BECA 1QBMH 3O2DA 3ROOB 1SY6L 4ODXA 3H9HB 4PRAA 4XAKE 2VAAB 2W60A 2KQMA 5DK0A 5FO7A 3U9UA 1NC4D 2RHEA 3BP4B 1A3QA 4W6WB 5LGHL 2DKMA 1QA9B 4DK6A 5IB4B 3U46A 2FGWH 2AXGA 4L3AA 1B4JH 3MV7A 3ILQD 4K9EC 4XH2A 2VIRA 2FX8H 1ZA6B 4RGOL 5I1GL 2P5EA 4C83A 3HI1A 2EH7L 1M6OA 5SWQB 5FYJE 1AGCB 1BZ7A 4HUMB 3QJFB 2OJZL 2R0LL 4QO1A 2ZOLB 2AK4A 4WI6A 3TJHC 3O2WH 5MEPA 4LP5A 1BQHA 2QL1A 4RFOL 4JHAH 5EZJA 1NFIB 4MCYB 1WZ1L 3L3GA 5IBTH 4QRQB 2BNRB 5E4EB 4YDJB 2VDRL 3V6BR 2EYSA 4IHOB 4L1HA 1CZ8H 1GOHA 5D7JD 1PG7X 5T5FH 5C9KA 5DTFB 4X4YB 1NBQA 5ADOH 2YOCA 4ZNCD 1FAKT 2R69L 4S2SA 3CVIL 3D18B 5C08A 3DRTA 2IJ0C 3B6SB 3SDDB 1AXTH 3C9NA 5J3HD 3VI3F 4JANB 2FEEL 1H3VA 2Z31C 5I1AB 5LCVL 3JBG7 4MDIB 3FOMB 3JWOL 5HI3D 3PHQA 1T04A 1KB9K 4MMZC 4HKZA 1BJ1H 4OZFB 4V1DD 4Z7UF 3LRSB 3P11H 4OZIB 2X6MA 3QXUA 3QEUB 3Q48A 1CICC 4UV7L 1HINL 2V5YA 1QLRB 1NGXB 4QHMA 4Z5RA 1WCBA 3I6LD 4LPTA 4K71C 3VGBA 1W0VB 5EBLA 4EXPX 4LCWA 5HDQH 4BSWA 2GITB 3L7EB 3CFKB 1G7LB 3QCUL 1A4KA 4MAUH 2YRZA 3MGOA 1HILA 1CYGA 4HPOL 4KTEH 4WDIB 1KJ2B 1MRDL 5IWLA 2VDLL 3SO3C 1MIEH 3QUZA 5JMRA 5C0AE 2ARWA 2G9HB 2BVTA 1KPUB 4Y16A 5DEFA 1QFWI 3QQ4B 3I02B 4KJYB 4M4RA 1U41A 1NCWL 3IFNL 3QJHB 3DX8B 4APQC 5F7UA 3C8HA 1XFPA 3SE8L 4PRID 5I0ZA 1GGIH 1HHHA 3FKUS 5IMMB 4ENEC 2VDRH 2VN4A 4OQTA 1K3ZA 1DL7L 1HOCB 1UACL 1UC6A 4GW1A 2FNBA 1FZOA 4GAGL 2R0LH 3TA3D 1DVFD 3CK0L 2AI0L 1Q9WB 3LN4B 3A67L 1J0IA 1JPFB 3NCJL 4ZS6C 3UPRB 4EDXA 1NGZA 5AZEL 3V6FA 1T1ZA 3PQYD 4M8QA 2W59A 1VEOA 2IQAA 1XR8A 4WI7A 2FGWL 3MFFA 3NIGE 1Y6KR 3P4NA 4PGCA 2NY1B 4WW1A 3F6LA 5J6GA 1XZ0B 4IS6A 4MSWB 4PJ8C 1N4XL 1A1OB 4TOYL 3C6LC 3QB7C 1XR9A 4PP2A 3CX5K 3QWOA 2BSED 1CG9B 4P4KB 1IKNC 1KXVC 2BNQA 4X6DB 3JUYA 4C54A 3D6GA 2CXKA 1WQVT 2RGSA 4BFEA 3QFJD 3T0VA 3ZYIA 4GKZA 1MELA 1XCTB 3SJVE 2V2WB 4FHBD 3PWJB 2AJYH 4LQFH 3C09C 3O6FD 3D3VB 4P2RE 3QPQD 1X7QA 1DANT 2SEBA 2W9DH 4XNYL 4DFHA 2ZPKH 4JFFB 4YHZH 2Z35B 4DN4L 1FNEB 1WAAF 5C6WH 2C3XA 4HKXA 1ZHNA 5HHMB 4ZD3L 3VFUB 5IEHB 4GG6A 4PV8A 1HCVA 2R39A 5DJZA 2EDHA 4HWZB 1IGTB 4WHYH 4RISL 1CGTA 4G42A 4ZD3H 2B8OT 2DQEL 4ZFOL 4U7MA 4V1DB 5E6IC 3VXUA 8FABA 3TEUA 1CFQA 1KLGB 2EYTA 3DV4A 3WIHH 2XTJC 5D9SB 1TZIA 4MX7A 4NDMB 1VGKA 3MOBL 4V2BA 4DZBB 1A2YA 4KH2A 2IG2H 2Q8AH 4KXZI 5DHVA 4O4YH 1MIMH 3HB3D 4MZ3A 5D1ZB 2LV4A 4K3EL 4C56D 4K9EL 3BISA 2VTFA 1M4KA 4JB9H 4PV9B 4LBEB 1FPTH 5DJXA 3I3DA 4WI3A 2DDQH 3RY6C 5JQ6L 4NQDD 1DTUA 4KK5D 1FE8H 5T3XE 2VDNH 1N6UA 5F97E 5KSAD 5TE7L 4MD0A 5CHNB 1FIGH 5C1MB 5IMKA 4OF8A 1KPRB 2HLFC 3E6HA 3GJEA 4EUPB 2VITA 4PYGA 3OSKA 3N1PC 1WZLA 3V5HB 3OB8A 5DMJB 1WWCA 1VSCA 4RQQA 5MP6L 4M43H 5IT2L 1WWBX 3CC5A 3QZWB 4MD5B 4YDKL 5C70A 3MA9L 1DFBH 3KS0J 3V0VB 2YSSA 1G1YA 4XAWH 3LQZA 4N8CL 5CBEB 4GAGH 2OJEB 4XVUD 3C5ZA 1WC7A 3PWNB 1UACH 4RRPG 4OZHE 4FZEL 4JY6B 1RZ7H 1KT2A 2BVOB 3GSRB 2KKQA 5KSVA 3PL6A 3ZMRA 3OZ9L 2A1WL 2IGFH 2NNAA 2NLJA 3CFIC 3RL2A 4Y4FC 1KCLA 1UEYA 4YR6A 4X7CC 5E2VL 1AKJA 4CN6A 5C0DB 3LKOA 4J3XA 4ZXBD 3WL9B 3QG6B 2GY7B 4AEHH 3VH8A 2ARJQ 3VD3A 4LEOA 4LRIA 1YQVL 1BX2B 3BPCB 3MNZA 5ERWB 1CE1H 3BRDA 1D5MB 1I3UA 4MQXC 2J8UA 4KMTH 2AJZA 5IHZA 2NY0C 2VDNL 4M5ZH 4PJDB 4OZ4A 3MV9B 4GRLC 5IB3A 5JQ6H 5KS9A 4XCNA 2OXGA 5E1AA 2PO6D 2FWOB 3F7VB 3HNVL 3DROB 4OAWA 4HIHB 1HHGB 1HINH 3R0MA 5DDHB 2YRPA 4LK4A 3MJ9A 3JV4B 4HIIA 4CMMA 2DTMH 3D69A 4ETQA 3I75A 1U8LA 3SCMB 5DQJB 1RPQA 5F9OH 2Q6WB 1YYML 4O58L 4JVUA 5JW4M 1YUHA 2HWZL 2QLVB 3DSFH 5F3HB 1JRHI 4PBXA 3MRHA 3CVIH 4CJ0A 4GJTB 5DHYA 5E9DD 4MLSA 2DLHA 1J1OH 4LLMA 3ARYA 2ZPKL 1CBVH 2GEEA 3RPIB 1QR1A 5DFVC 3U7YL 1PYWA 1YECH 2PNDA 2E9WA 3K4AA 3SDYH 1FJ1A 1WZ1H 2E7MA 3EDJA 1ZT7B 3LD8C 1QQDA 2VABA 1QFHA 2ZWLT 5IHUL 4O5LH 1ZV5A 4W4OA 1YEGH 2JJUA 3BWAA 2AJYL 3GUTA 2O5XL 2A2QT 3GMNB 3V9FA 4D9QD 4QGYA 4YQXH 1B2WL 3FB6A 4BH7B 3FB8B 4OBSA 5IJKA 4NN5C 5I1LA 1GHFL 5LGKA 3ZSSA 5C0CE 1QKZL 3CFKA 2IAMD 5E8EA 1DE4B 3QAZB 1YNTA 5E6IA 4LAQH 4E42A 4AG4H 4NQED 4EJ1C 3FOLB 3CU1A 3E8UH 4GO6B 1MCWW 4HXAH 1BM3L 1AO7A 1RY7B 1N2RB 4F15C 4Y4FB 3OXRB 1N6QH 1ITBB 2NZIA 3U2SA 1CT8B 1VENA 4JRYD 5IR1A 3RI5F 4P3DB 4MB4A 4E0RA 2ATKA 2UV3A 3PQYE 35C8L 1JF1B 3IB4A 4BM7A 2PXYC 5CIPH 5CKAA 5CJBA 1JNNL 2YEZB 5EBWB 4JO1H 4CL7A 5C0JA 4HUVB 1Q0XH 1SYVA 4JGJA 5DA4A 3SE8H 1DUZA 1JHKH 5FHBH 5FYLH 5E4IA 2R4RL 3IFNH 3ULUL 2YPLB 1FZOB 5E99L 4A6YL 2NCMA 4W70A 4Y19E 4HX1B 4DGVL 4NO3B 2FO4B 5F7DA 4PTTB 3ARDC 3RTQD 3RZCB 5IM7B 1MIEL 1PFCA 1T7WA 4AQ1B 4G8FA 4I0PB 1S7TA 1DQQA 2XA3A 4J3TA 4TSCH 4FN0A 4NRYA 5C09D 1UB5B 1D5IH 4XPAH 1FNAA 2ADIB 4JQXC 2X4TB 1FCGA 2HTKC 3TPUA 2MKLC 4OZGF 5J6GB 1VKXB 1S9KC 2YHGA 3QCVH 4GRLD 1BD2D 1X4YA 1RZKH 2HJLB 4JLRA 4Y5VC 2B4CL 1T03H 4FTVD 5E7BA 2F9BT 3BPLC 4DUXA 3K74B 4Q97A 3IFOB 2W65A 4AM0A 5DRXA 3OX8A 3L6FA 5MENA 5IVZA 2DQJH 3FTGA 4X98B 2XACC 2CK0H 1CTOA 3PG2A 4XPTH 1EK3A 3FAXA 1EBAA 4LPVA 3QFJE 2FHFA 3SKOA 3TVMD 5IB2A 4E41D 5BV7B 4LLQA 2E27H 2VR4A 1WZKA 1PZ5A 4W6XB 1QLEL 1P6FA 4MNQB 4H1LG 5IB1B 3S37X 5LGJB 5JO5A 4NRZB 3F5WB 1RZ8B 5FECA 4S11A 4H1LB 1XEDA 2RQ8A 3VA6A 2APBA 2OTPA 3LKQA 1JZ2A 3TJEL 1HN1A 1KTLB 1T1WB 1NFDF 3BHBB 3MRGB 4X8XA 1F4HA 3GIVA 4Q9QH 4QCIB 1YPZB 4JAMB 4NUGH 5DS8B 4XWOC 3SE9H 4RX4A 3GB7B 4RGOH 5L7XL 1UZ6F 3GBNL 5E8DL 4B7IA 3JWDH 3L3HA 1B4JL 2C5DC 4XNMA 3BFOA 4DAGL 4BKLB 1JIBA 2Q1EA 1MPAL 4WUUE 5A16A 1MFEL 2OQJA 3FO2B 2VDQL 5HHNB 2IBBA 2WBKA 5LGHH 4PRIB 5JR1L 3STZB 1GAFH 3KR3L 1NAML 2DICA 2PW1B 4GBXB 3W39B 4NZUH 3X3FL 4DQOH 2Y7QB 2V7HB 3E2HC 1KNOA 2HJFA 4QHLB 4QXTB 4I3RL 3IDXL 2BZDA 1QBML 4Y16B 4PJCB 3VW3L 1MCPH 4P2RB 4R96B 4F9PA 5HGAB 5IW3A 4MD5A 1URLA 4RA3A 2XWBB 1EA9C 5I1EL 4L4TA 4U05A 5FUCE 4ZFZA 4JPIB 4FQ2L 3P4OA 1MHHA 4PJEF 5BVPH 4YXLL 4FTVE 5I0DA 1F4YH 1WT5C 2BNRD 4MZ2A 5DSCB 2HN7B 4RA0C 2J3SA 3O3AB 2QQKH 5SWZD 4JQVC 2E8ZA 5IESH 1IQDB 1HHKA 3UTQA 4DKEL 1M7XA 4CRPA 3CX5J 4BQ9A 4MCZB 1KN4L 1ERNA 3V52H 5J12B 2VXVH 4N1CA 2YUXA 1M05B 2AJ3B 1CGWA 3NZHL 3GI8L 5J06A 4PGCB 4WW1B 4Y19D 4BK4A 1G9NL 1FNSH 1P84K 5AZ2L 4OKVA 4KKAC 1NAMB 2HMID 3HMXA 4I9WD 1MHPL 1XF5B 4OUUB 4NO2B 1P4BL 3LZFL 3W11D 3GSWA 4HDIB 3A6CH 1BMGA 3RVXC 4H25A 1JNLH 4X6CF 4X5WB 3H9SB 5DJAB 4W4NA 2PO6A 1NLDL 2VR5A 1PEZA 2X4UA 3TVMB 3EYFB 3BKJL 3OB0H 4MVBD 3H42L 3DSNA 4UDTB 5I66B 2XKNB 5BQ7A 1MRCL 3MRLB 4XMLL 2NZ9C 3MBEB 3ZE1F 3F58L 2FBOJ 3JV4A 1ZHBB 1L4IA 2B39A 4UT6L 4D0BA 3BIBX 2QADB 3Q1SL 5IFAH 1S9WA 2EH8H 5FA3B 1XF4B 3RVUD 4XVSL 4YAQA 3K2UH 1Z2KA 1F3JB 4HK0B 2W0PA 3EGSB 4EUPH 3PABB 2W0KA 2XWTA 1IRAY 3VXUB 4ZUWA 5K9OA 3OKNA 3MPCA 1BPVA 2VXSH 2Y25A 4O9HH 1U3HD 4LDOB 4JVWA 4J8RA 1V7NL 3A6OA 3EO1B 5HYSG 2Z0BA 4PLNC 3GUTB 5I9QB 4HT1H 4DGIL 2IFGA 1LK2A 1T1YA 3FB5A 4AL8H 43C9B 4YE4H 3ET9F 5D7JB 4N0YH 3CSBA 4LPYA 3KNBA 2ZSVA 3C8KB 4JREB 1T5XB 1LO5A 4MA7H 3VGGA 2D2OA 1GZPA 1D5XB 4LPXA 5IP4A 1RVFL 4P2CG 4D9QE 3SDXB 4I0KA 1TQCB 4NN7C 2NXZC 3X3GH 3VJ6A 5CD5D 2LTQB 3WXVH 1EFXA 5BO1H 1WK0A 1T0PB 1CR9H 1A64A 4Z77A 4U6TA 3V0WH 4HG4J 4N0FA 3CIQA 2DI8A 3SGEH 4LSUH 2C3HA 3MYJB 5I8CA 2ZKHL 3W0WA 1C5BL 3GSUB 5CCKH 1JK8B 3PWLB 5GGVY 1UKSA 1MOEA 1XCQA 2IAMB 3PHOA 4LKXB 4XBPB 1YMMB 1F4XL 3FFCA 4OIAA 3KYOA 3ULVD 1D7FA 1MF2L 4Q0XL 4LOUD 1RZIA 2OLDA 5LAXB 4BUGA 3MOAL 4PJBE 2VE6A 1A6UH 4X7FC 1P9MC 3BVNA 3VXUE 1PQZB 2ITDB 3RWIB 1J1XL 3ZE2E 3RDTB 1FVCB 4NFCA 4OGXH 3QHZH 4GMSL 1NFDA 1OLLA 4JFEE 2XZAH 3MZGB 1MLCA 1MFAH 1MI5A 3GSXB 2V2TA 2WLZA 2DWEA 3H9HA 3HC0B 3RPKA 1MJJA 1G7HB 2VKXA 2XZZA 4CDGC 2VOTA 5HHPA 3KYNB 3CFDB 4LMQI 4ZFOB 2IBZY 3O6FA 1S7RA 1FORL 5JLZA 4KKLC 5HHOD 4JRYA 4R97C 1CD8A 3NFNA 3HRPA 3FJTA 4CGTA 3LKPB 3DYOA 1U8HB 5CGMA 5I16A 3IJHA 4OCMC 4QXWA 1T20A 3MUGA 2Z92B 1M7DA 4ELKA 2Q76B 4NQEA 2HFGL 3GDBA 1FO0B 5EORL 5F21B 1TVBB 4UUJA 3MRIA 4MYWB 4P9HH 3D69B 1CFBA 3G5ZB 3SCMA 4QRQA 3HE7C 1RK1A 4PR5A 1LK3L 1KB5L 4ZOAA 4YBQD 4TNWK 3OWEA 3I6KA 2CSPA 1ZANH 1BJMA 2H8PB 3MFGB 5DD6B 5DMIH 4U2YA 3MBEC 3PQYA 2XZQL 3QDGE 3PWVA 4PLKC 2YN3A 1E4JA 4R4BA 4UIMB 2CDEB 4ZUVA 3AVEA 1K8IB 3H3BC 1FLRL 3MACH 3D0LA 1CDJA 1LO3H 3IDJB 4TNVF 3FOMA 2AERT 5I8EA 4C56E 2VIRB 1KTLA 1ZA6A 1AI1L 1KENL 4TSAH 1ZLVH 4JPVL 4EBQL 1I1AA 1MFAL 5F1OB 5E5MB 2AQ3A 1CTNA 1AD9B 2QSCH 3MRRB 3UPCA 1QRNE 5ECJE 5D1QC 4MHHI 4NO5B 2CD0A 4PJIA 3ZKND 1OWWA 4OCWL 5E2JA 1IT9H 3S37L 3OAUL 4OI9A 4G80A 1BVKA 1S9VB 5BJTB 1GZQA 1OB1A 1IILE 1T4KA 5JMOC 4S1SL 2EKSB 1F4XH 2B5IC 4Q6IB 3FOLA 1EV2E 2HFFA 5CJ8A 1CN4A 4M1DL 2VZOA 3VFUA 3VH8G 5IEHA 2ZKHH 5GZOC 4U1IA 3SY0B 3MROA 1DBKH 1RMFH 3OG6B 2FO1A 4I3SH 4J1UB 4WFHE 5J6HB 5BO1L 2E7CA 5IR1B 2EC9T 3P9LA 3PP3K 3DGCR 4FQQA 1MHEB 1WIOA 2APTA 1A14L 3TA3B 3VWJD 5T1MA 3EYVB 1A6VL 3I84A 1BVLA 1KJMB 2WIMA 4RAUB 3X17A 1FYTB 2ADJB 1BQHG 1CFVH 4RMVA 5EBLB 4N0YL 3DMMC 3WD5L 1CICD 1UJ3C 4LLWB 5C08D 4AL8L 1RI8A 3GRWH 5CSZB 1J1PL 4WTZA 4M6NL 4KRMB 4WU7A 5IM7A 2BXYA 3TGXA 5FOBB 4POZD 1GGTA 1U8JB 1B6UA 4OCSL 1FLRH 3MACL 3ARZA 3DO7A 5FGBC 2VXSL 1DUYA 5GGUB 4HSQA 4YXKL 4IS6B 1A1OA 3Q5TA 1S7QA 2AXGB 4OQTL 5F6IB 4P23C 4P2QE 3QQ4A 1W0WB 4WUUA 3VXPA 3B4NA 3TO4D 4HF5H 2BVQB 4JM2D 5GRWA 3PGDB 3IJSB 2ICES 4LVOC 5DMIL 5HHQA 1ZANL 4PRIE 4GKZB 2MQ0A 2Z91B 5F9JA 1NEZG 1T83C 1LK3H 2X4UB 2V9TA 5DGQA 3TVMA 2Y23A 4F2MB 4OV5B 1X5JA 1XGPB 2A77L 5I1JH 4MCYA 2JB6A 3KG5A 4Q6YA 4UOJA 2CKBB 2EDNA 3RL2B 4G9DA 5EO1A 4BQBA 1ND0B 5IW6A 3MR9A 2EE2A 3UTSE 3PIQB 2CLZB 3V4UL 4YHLH 1KB5B 2X7LA 5I76A 3DTXA 3MRFB 1N3NB 1UWEL 4LLUB 4PLOB 4FTVA 4LEOB 3ULUD 1NKRA 2QHRH 4ESKA 1TNNA 4K8RC 1FYTD 1QBLH 1BWMA 1IGFH 4MJ5A 4PJ8A 1YYLL 3CMOH 1G9NH 1CL7H 4IOFD 4RFEA 3WSQH 1IKNA 3WFHB 2ZUYA 4J8RB 4WI9A 4TPRL 4ZFGH 2G2RB 5GS2D 2FZ3A 2B2XH 4H8WC 4WW2F 4MS8D 5E1AB 3PWJA 1KTRL 2EIBA 4R3SB 3FQNA 3QHZL 4JO3L 4G9FE 4BSVB 2B2XL 4KU1A 2J88L 1T22A 4Z7QF 3FAWA 3MOAH 1J10A 2CLRA 4HIIB 1CFTB 4HUKB 3B9KA 3NCCB 1OP3K 5C07D 5CP7B 4FMFA 3JSSA 3RWJB 4PGJA 3GJEB 4EUPA 5MENE 1CU4L 3H9YA 1K6QH 5SV4A 5MHSD 1FAIH 3LRHA 3T4YB 4NQUA 1RAMA 3VCLB 5I1EH 2OR9H 1NCTA 4U1NA 4KI5F 3SKJL 2BOCB 2BNUB 5FV1L 5CP3A 5IWLC 5CKGA 1GOGA 3V7AE 2CUHA 4KKNA 3WXVL 4RGND 2X4RB 1IKFL 1ORSB 4PJGE 5BW7C 3V0VA 2FD6L 1QOKA 4KHTL 1WFUA 1NAMH 3KR3H 5E6ID 4KC3B 4MQTB 2X4NA 3TA3C 3QPXH 3V95A 4MA7L 5JIKA 2CIIB 5JXAL 1U8IB 3GHBL 3HE7A 5D1XC 3VE0A 3HMWL 4OLXH 4G6JL 2VZVA 4Y4KD 3ARTA 3SO5A 1TTGA 1Z0NA 4NJAH 1OSZB 5FXCH 3GBNH 5E8DH 3HCVB 3RWDB 4P4RA 1EJOL 5D7LA 2V2XB 3FO9B 5AYQA 3NCMA 3WL9A 3DV6A 4OQTH 4XAKD 3CVHL 4KHXH 3MXWH 3MRKB 4QKXB 1Q9KB 4JFOB 4AIZA 3VFPB 4I48A 3TJEH 3DUSA 3D39A 1JWMB 1QYGH 4MJID 5ACLA 1F3DH 5D96C 1JN6B 1OW0A 1AO7B 3DVGA 1G7QA 5FK9B 3MLRL 4M93B 4HDIA 1DJSA 3MQIA 2L0DA 3K2UL 3T4AA 2VLKB 2GSIA 4JFPB 2WM0A 1MCLA 4FFZL 4D0DA 3WD5H 3VXTA 1IEHA 3ARFC 4LQ1A 4FQCL 1HYSC 5C8JA 1N64H 1OAQH 2EDLA 4CNIB 2NR6D 2JTDA 1T7XA 2PN5A 4PJAF 3C60A 4JKKA 2Z92A 4FQ1H 2NNAB 3PHSA 5LQBH 4RNRB 1W8OA 3TBTB 3BKML 3T0XA 3RVWD 1U8QA 3IVKA 4YR6B 4NQTA 5JA9A 1YN6A 1YUHB 1JF5A 1T2QH 4GG6B 3HZYA 5FM5O 2YK1H 4OZHB 3RWCA 5IB5A 2O61B 2ATPB 5FFLA 3UZEA 3GBLA 5C6TH 5JZ7D 2B4CH 5I71C 1MHPH 4PRPB 3WXWL 4Z7UB 5IQ9A 4M6OL 2KUTA 1EXUA 1KLGA 4ZUVB 5I75B 3VG9C 4WHYG 3VFNA 3UTZB 2PCPB 3O9WC 5IB3B 4EDWL 4Y2DA 4ZAKC 1HWHB 3IXAA 4OGZA 3R06B 1T5WA 1U42A 4IRJC 2IANA 4DKEH 1XH3B 3QDMA 4M7LL 4JY5H 4J4PC 4OSUL 2AABL 3GSNB 4Z0XB 5IUSA 1HSAA 4P5KB 5GQBA 5ICXB 4EBQH 3GHEH 3S34H 2ESVA 5D7JA 3V5KB 3MLSL 1PEWA 5L8JB 1ZHKA 2DMCA 2HA1A 2C1PB 3MMEB 1IEAB 1C7SA 4JRYE 2OL3A 4JFDA 1DCLA 5IMOB 1R3KB 3JTTA 4X9BA 3EJYD 2YPKA 1B0GB 2FHCA 1IAOB 4XP1H 1QSEB 3WLBB 5I2IA 4G80B 3VWKC 35C8H 7FABH 3RRQA 3MA7B 5BJTA 5GS0L 3FQRB 3ZDXE 2FBJL 1J0JA 5T1DH 3M8OL 1FL3A 3GKWH 2V17L 2AQ1A 4H5SB 3W2DH 4JDZA 3MUY1 1ZLWK 2DI9A 1Q8MA 2EDFA 1JNHB 2XZQH 4QRPD 5A43C 5SX5H 1U8MB 1U0QA 1BM3H 4HXAL 3ZYZA 5FAAA 3MLTA 1N5YL 2UZXB 1JV5A 1KB5H 1EEYA 4NZDA 3QQ9C 1QP1A 2XG4A 5DK3A 3KYOB 3UTTE 4OFIA 3S35X 4ZNEE 5KVFH 5BCAA 2NW3B 3QDGD 4PRPE 1NC4A 4OZIA 1MFNA 4GQPH 4P59L 3PGFL 2I27N 3ZE0E 5C0DA 3SE9L 4XRCB 3WJLC 2RCSH 3WDJA 5JA8B 1I9EA 5KW9L 4PTTA 4NM8H 4C56A 4FG6D 3WHE0 3BD5A 1G0YR 5HDBF 3TCLA 5ILTH 3MLUL 3IKCA 5E95B 4JFED 1QHPA 5HHPB 3BT2H 1KF9B 1YY8A 3VWJB 1TCRB 1QD0A 4G8EB 1YECL 1D9KD 3EOBB 4OQ1A 2AEPL 2F53A 3UX9B 3JV0A 3MRCB 2R4SL 1CS6A 5D7LD 2VDKH 4CJ1A 3SE3C 1MH5B 2YZ8A 4P2RA 2XY1A 3JWNC 3H9SD 3O8XD 1GSMA 4KJWD 4F8QA 3OMZA 3O41A 3DROA 1HHGA 1U2CA 4JM2C 3LB6C 4BZ2L 3WFZA 4EI5D 4FQHA 4ERSL 1YYMH 4O58H 3LV3B 4X98A 5D1ZD 2NMSA 2CK0L 5EIVA 5GSVA 1JZ4A 3UJIL 4LLVB 4BK5A 2DQJL 1HH9A 2BJML 3I6KB 5IB2B 1OGAE 4ODXB 5M94B 1MAML 3NGBC 1CFNB 1G7MB 1YEJL 5ALCH 1FN4A 4WHTB 2QSTA 1PVHA 1QFWH 4IOSD 4MAYC 5DHYB 3RZWA 1AGEB 4ORGB 2NY4B 4NKIL 5EO0B 2GK2A 3TF7C 2F58L 1FNLA 2N7BA 3DRQB 2A6DA 5HJ3B 3PDGA 5FF6B 5GJTL 4XPAL 1AGBA 2FJFB 1CE1L 1DQLH 2YUVA 4N90D 2A83A 2VLMD 1G6RL 1VFMA 1ZT7A 1CLCA 2CRIA 4PJ8B 4WFED 2GTZA 3AB0C 1JVKA 4K94H 5DJYB 4IOFC 1J7VR 1K2DA 2O5YL 4DGVH 4S1QL 4ZUTA 4N0RA 5E03A 2Y4SA 1RV6X 1I9JH 5C0RH 5FM8A 2F8XC 5FYLL 1EO8H 4XB8A 3EJYC 3QP3A 1Q0XL 5D5MA 3RWFA 4NO5A 4WIQA 4I18C 3MBEA 4JO1L 3OZ9H 4IIQB 2MCG1 2E8YA 5CZKA 4E42B 1WZMA 2DIAA 8CGTA 2EO1A 3ARFB 4M61A 5FO8B 3AC0A 4BUHA 3F5WA 4H26A 1SVCP 2BY2A 4HWZA 2H26B 5HVGB 3ME0A 3VFMB 3WUWB 4H1LA 3QUZD 3E8UL 2E6QA 4JFFD 3T2OA 4AMKH 3LPFA 3NACH 4WCYL 4AG4L 1KACB 3U30B 1R5VB 2YA0A 1AXSA 2FJGA 5TH2A 3DMMD 4DTGH 1F8TL 4QHMB 1WCBB 3FRUA 4L3CB 1IAII 3ARDD 4NKQB 3RTQC 5TE7H 3BKJH 1B2WH 2O5XH 5IMLA 1T1YB 3FB5B 1ZEAH 3QEHA 4IMKC 1T2XA 2DDQL 3CMGA 1FSKC 4UOW1 3TO4A 4UIKH 4MD0B 5CHNA 4WUUD 1DBJL 4LFHG 1IM9A 2W07A 3RL1B 3V8CA 5I73B 4YEEA 1OARL 5KTEL 4ZS7H 2ADIA 2NY1D 4UQ2B 3X14A 1D5BA 2FLRT 2G5BA 4OKVB 1L0YA 3LN5B 1BQLH 2WANA 4LSRH 1NEZA 1F11A 4PYHA 4FQXC 2WK2A 2PXYB 3DX8A 1TJHH 1WV7T 3IF1B 1IBGL 5JW5A 1QFOA 4Y5VA 4LIQE 3ARPA 2EEDA 3W9EA 1AJ7L 1XCQB 1BEYL 1SM3H 4N68A 4IOIA 1XMWA 1MJUL 3G04B 1WC7B 4X4XB 1HHIA 1HOCA 2WBWB 1IGMH 5T33H 4KZDL 1OCWL 5BVPL 3PNWB 1RIVL 4YGVB 5DJCB 3RWIA 3DARA 5BZDA 4EIZC 5F88B 3BZDA 5EOQH 3BQUB 2X70A 4DN3L 4IJ3C 5TDPA 4LQFL 1NQBA 4PY8I 4LF3B 1T66D 3ULUF 3QG6A 3VW3H 4XXCA 1CLZL 4V2CB 4CAGA 3MNVA 5EUOF 2EC9U 2WWKO 4WTWA 4XP6L 2ZNXA 4KMTL 5FM4A 4DQOL 3GSOB 3X3FH 4X9FA 5DUPL 4J6RL 1OTSD 3GI9H 3UO1H 4UNUA 4B7LA 2YD1A 1XF5A 1REIA 5DD5H 4PJ7B 3D0VA 2LE9A 5JW4Q 5J7CC 4TUOB 5DZLA 2ERJC 4L8SB 4OZ4B 4AEHL 1MPAH 4KJQC 2VL4A 4OM1H 3O9WD 5C0CA 4WNQA 3OAZK 5L7XH 3RVVD 4UT9L 5DT1H 2UZIH 3QIBA 2HRLA 1LEKA 1AHWB 4P2QA 2A1WH 2IGFL 5E8OA 2R2EA 43C9A 4U1MA 3O3EA 1JGEB 1G7JA 1FO0A 4GKOA 4OFPA 4CADB 3V5KA 1LWRA 4OZFG 1T5XA 3Q6GH 4P2OC 1ROWA 4PREB 1AFVH 1I7RA 1NMAL 4N8CH 4NSKA 5E8NA 1EO5A 2BVUA 1G1CA 4JO2H 4WTZG 2WBJA 4BZ1L 2BNUA 3IRPX 4M43L 1BOYA 2XWTB 1F4AA 5INCB 2R1YB 2X4RA 5GRZA 5D9SA 5D1XD 3U7WL 1U8MA 3TO2A 4QTHA 1YMHB 4LDLB 1FFNA 2CDGB 1FVEB 4Q9BA 5C92A 5IFHH 4Q2ZB 4GRWE 3ZL4L 1Z9SA 5DD0H 1RUAH 1MCQA 2AGJL 2HTLC 3P4MA 5DK2A 1WBXA 5CFHA 1VFBB 5K9JL 3O3AA 1EEQA 3VD7A 3F12A 4UV4L 4JRXE 4S0SD 2R0WL 1MLCB 4O4YL 4PJIB 4Z78A 4WFHD 2IG2L 2JELH 4KQ4H 2Q8AL 5DI8A 1F5WA 1BGXH 5LG1A 4Y5YA 2XA8L 3EHBD 1D5IL 3QXAA 2VISA 2XQYG 4NO2A 3EOBA 4Z77B 2X4OA 3DVGB 1N2RA 1DLFH 3NIDE 5FYKE 1AXTL 2AJSH 5CZVH 4H8WH 3W9DA 3GSUA 4ENED 5EU6A 1DBBH 5SWSA 5J13C 2HFTA 3HG1A 3BQUD 1QSEE 2FIKA 2R4RH 4HH9A 4GH7B 5EZLA 3SDXE 4XNYH 2IQ9L 5C8JB 4KJWC 3BI9X 4N0CC 4WV1B 3RDTC 4ZSOB 5CWSB 3ZE2F 5BRZD 5DUMH 2VERN 2ZCKL 4R2GD 5DR5H 4WI4A 4NUJA 5F1IA 4MQSB 3LEVH 1A1MA 1LO2L 5D1QB 5JZ7C 4PP1C 3C6LA 3HZMB 2VN7A 4M62H 3NFPB 1AE6L 4OKDA 5EB9A 5C0CD 5EO9B 3GSQB 2OMBA 4ZNEA 5J9PB 1NUFA 3BPCA 5I1GH 2J8OA 4WHTA 4WEBL 3DUHA 2Z8WC 2CR6A 3QT2A 4NRYB 3PF2A 1CDUA 1T3FA 1TETL 2LU3A 5GSRA 1TJGH 1M71A 2EDDA 2GFBB 5K9OB 1CK0H 4I13B 3HNSL 1X5YA 1PKOA 5CUSL 5E7FA 4I0PC 5CEZD 1YY9D 4XVJL 4UILH 4UNTA 4Y1AB 4WEUD 5A2IH 2W91A 5A3IC 1GHFH 2J6EA 1FYHB 2BOBA 2OBGA 1A6WL 4YHIB 5AZEH 1HQRB 5DWUL 2GTZB 3NCJH 1AE6H 3OKLA 2UWEB 5DDHA 3BP6B 3FFDB 3CK0H 4GMTL 4DOHE 2C4FU 3UBXG 2ZUXA 5F1NB 5T1KB 3HI5H 4HWEL 3W5MA 4PLJC 4U1SB 3KPRB 1TJIH 5D5MB 1LEIA 3ULSA 5B4MD 3HI6H 4JFDD 4LEXL 3ZLQC 1C1EH 2R0KH 3ZT5A 1CBVL 3VXQB 1J1OL 4L4TE 4BQ8A 4P57A 2MSPA 1FL3B 4UT7L 4H8WL 5FYLD 4N5EC 4HUWB 1DLFL 2ICWJ 5EPMA 5FIEA 5EU7C 2BHYA 4IRJB 1K8DB 2XA8H 4KV5F 4LLYA 2EDKA 3CLEL 5F9OL 4OJFL 4FQQB 1BLNA 1PAMA 2O93L 4P5MB 5JPNB 1YA5A 2JELL 4KQ4L 3FONA 1K4DA 4OV6F 2PTTB 4FQJL 5ADPH 3GSVB 4OZGA 1FH5H 3D2UB 1BIHA 5CZXD 4D8PB 3IDUA 2DL2A 4ODHL 3ARDA 4UV4H 4PJDF 5EIIB 4PUBH 5HDLA 5K9JH 1T0MB 4KFZC 4M5ZL 3QDJB 3VGDA 1BVKB 4NQDE 5DD0L 4YEFA 1AD0B 1FC1A 2GTWB 3S36X 3JUZA 4PIRF 3TN0B 3ARED 4LASH 2H32B 5HYEA 2YZ1A 1D5BB 2DQHH 2IAMC 5D5ME 3OV6A 3U0TA 4QHLA 4JFDE 1QHOA 4QLRA 1HE7A 5ADOL 4GSDL 4EI5C 3DIFA 5T5FL 5D8JL 1IGYA 5F89A 4QTIL 5DRNA 1TQCC 5FGCB 1DANU 1AFVL 1F6FB 5HY9B 3WE6A 2HLAA 1QO3B 5IBTL 4R2GC 5GRUL 1YJDL 4RFOH 4LIQH 1JZ8A 3B9EA 1RK1B 3A6BL 3QRFM 3B2UC 3MCLH 3PNWA 3IU3B 3OR6A 2FO4A 4G9DB 5EO1B 4LSVH 1DFBL 5LVEA 2FX8L 3X11B 4GXUM 1FN4B 2DQIL 5EA0H 3EBAA 2NY6D 2V2XA 3FO9A 3OAYH 3OAZH 5HVHC 2P8PB 4BFIA 3EDEA 3GSOA 3E6FB 2XIDA 3DUUA 2WWMC 1TVHB 1OTSC 2R9HD 1E4KC 1JI1A 2AQ2A 3VXPB 3UTPE 3QUMH 5C7XL 4WO4A 1KIPB 4Q9CA 2H2SD 2JF1A 1KXQE 3K80A 2WQRA 1KCSL 3BDBA 4XPGL 5F93C 2F53E 1T1XA 2A38A 1HEZB 2NY2C 1ACYH 4JVPA 1YC7A 2XKNA 5BQ7B 3RVVC 1MIML 1AHWA 5T3XD 5DD1L 1OY3B 4IIQA 3B9KD 2E7HA 5TQ0L 4KZDH 1P2CA 3H7LA 2CJUL 4X4ZA 1T21A 3O2VL 3GBML 4EOWH 3P9MA 4RISH 4U1NB 2UUDH 1IFHH 2IPUG 2O61A 5GGTA 2JCCE 4JHZA 4PRHB 2X9WA 3GM0A 3SEPA 3WUWA 4CVXA 3TIDB 3LKQB 5BRZB 1GIGL 1U9KA 1G9NC 3SOBH 3P9LB 1S7XA 4BQ6A 5D2LB 2JJWA 4NQXA 2NY3B 3QNZA 1TFHA 2BX5A 3GK8L 5IFJB 1C5CH 2V5TA 1WFTA 3HFMH 3LHPL 2CDFB 4JFEA 4X9GA 4AH2A 1MI5E 2CIIA 2DB8A 1SQ2N 4UIKL 4WGWB 2HTLD 5KVDH 1FL5B 1BBJA 1YEDA 1MQ8A 2E9JA 1FRGL 1S9YB 1TZHA 1S7WA 3BD4A 4XI5D 3VGHA 2GJ6B 2R23A 3L7FB 1CGSL 3Q6FB 3T65B 3DV6B 3TBWB 4F58L 4FZ8L 1N4XH 4TOYH 1KN2H 3T4YA 3FO0H 2FEDC 4FQXD 4ZTPH 2Y7QA 4M1CC 1DP0A 3NACL 3NABH 1CI5A 1I9IH 3L3OB 1NEZB 1NGYA 4P5TD 5DVOA 4X9HA 1JN6A 1QLFA 4HKJB 4ELME 2GK0B 4LHUG 3O4LD 4XX1G 3BGMB 4Z6AT 4LLDA 3T4AB 2FJHB 2GSIB 4L9DA 4G43A 5SWSB 3OGCA 3N06B 3VXRD 4QHUB 4L8CA 4Z0BL 1CDGA 1UZ8B 4RRPA 5CINL 3EUUA 4X4ME 3B2UD 1EZVX 1SMAA 4JZNA 4GXVH 2ESVD 1GGIL 5IVNA 5H94A 4R7DB 5GS0D 1Y6NR 2MCPH 2D0GA 3CFEB 4XNQA 1FVCA 1HZHL 5D7SL 5HGHB 5C0RL 1IL1A 1I9JL 4J3OC 1NCWH 3RWDA 2IAND 3SN6N 4K8RD 5HHXL 5HGGS 3U0WH 2O5YH 3C6LB 3MRKA 4IMLB 4MAYB 5DO2C 2WIIA 4HEPG 2VAAA 3QUXC 5JOEA 4ZS6D 1Y18A 3KLAB 1G6RH 5L88L 1NDMA 2DWDA 1LEGA 5F70A 4HQQH 2J8HA 4JRXB 1XGTB 5TFSL 1WTLA 4PJXE 3ZYOA 4L8SA 4NKIH 4X5WA 2UZYB 3IDGA 4KK8C 4D0DB 2XYCA 3LS4H 4R0LC 2XZCL 4HS3A 4QF1A 1VFAB 1KG0B 3B5GA 1BZ7B 3MUGB 1HSAB 1YEIH 5D70H 3TT3L 3BE1H 1QRKA 4M5YH 1TVBA 3C60D 3T8XB 4CADA 4P46D 1FV1B 2F19H 4K8RL 5KVEH 1I8MA 2MOVA 4M7JH 5SWSE 1DN2A 3MLVH 4XBEL 3RP1A 1QEWB 1QSEA 5DVNA 2HG5B 1NBYB 2V7NA 5T3ZH 1MUJA 3MLWL 1FFQA 5CGYC 3KPNA 3CSYB 3BXNB 5DTFA 1YEKH 4X4YA 3PWVB 3KPOA 1Q72H 1EO7A 4XXDB 1I1AD 5IV2B 1A3LH 1NCAH 1A7RL 3VFOA 1AGDA 1NBVH 2DBLH 3OKNB 1IAKB 1RD6A 2R4SH 3VFTB 3EFDH 4X7SL 2AEPH 1WBYB 1FZKA 5K9QI 1G7IA 3HPJB 5FB8A 4G7VL 2X9XA 4OCRH 5ALBH 2P47B 1T04B 1P9MA 3QQNA 5EU4A 2BMKA 3O2WL 1BFTA 4N1EA 4R4ND 1NDGA 3FONB 5HDOA 3SQBA 2VDML 2B1HH 1LNUA 1NGWB 2BC4A 5FM5M 3FQXA 4PJXB 4TN9A 1AH1A 1FQ9C 3QHFH 4XNZB 3CCHB 3R8BB 1VGEL 1S7UB 4EN3B 3NCYS 1KEGH 4BSWB 3W5NA 4G8GD 1HXMB 1RJZB 3KYKH 4TYUA 2AEWA 2VWEC 2P5EE 3RIAF 3LEYH 2E6PA 1D6VL 3AFLA 3OPZL 4QXUL 1N5YH 1N7ML 5L9DH 4M48H 4H5SA 1H3XA 3B3IB 2LAAA 5TF1L 2NTSP 3SY0A 2J4WL 1RSFA 4JKPL 3LEXB 1UH2A 4FNLH 3U0TB 3U79A 4ZYKB 3KJ4C 3W2DL 2V17H 1SJVA 1KFAL 4S1DD 3INUH 3DMMB 3M8OH 1F90L 4XWGH 4ZOCA 3L3DA 2FBJH 3CUPA 3CU7A 5KJRH 1GCFA 3OAYK 4XP1L 4JDTL 2NYYC 5F89B 5SX4I 3WBDA 4XCEA 5C08E 5I18L 3EJJX 1JFQL 5DUBB 2IFFH 3TBTA 3EO0B 1U8QB 3U1SH 5JW4N 2VDOH 3VD9A 2BDNH 3ULVC 2R2HA 1FFRA 1YDPB 4NN5B 4B5EA 4YHYB 3UXFA 5DO2D 4WU7B 1Q9WA 2P5WA 5CJOL 4MA3A 5GGSB 2BSTA 1BQSA 3QG7H 3QWRA 3VFGH 5ACZB 3N85L 1OGAD 4IDJL 4XC1L 4KK8D 2DLTA 5HI4D 5JIPA 1FZMA 4NQDA 1I7UA 4MA8L 1HQRA 3PGDA 3CZJA 1MCOL 1VPOH 4NNPL 3QPQC 1M6OB 2FATL 4XCFH 5SWQA 3DXAB 4TQEH 4M7ZC 5T5NF 5B4MC 1A7NL 2ZOLA 3LN9A 4YC2B 2PO6C 1P5UA 2DQDH 4NO0A 4UU9A 4GRLA 2KDGA 4RWYH 1EAJA 5LQBL 4O2EB 1CDIA 5EU6E 3REVB 4KTDL 4R0LB 4ODUB 3RKPA 3PP3H 2HH0L 4GG8A 5B8CC 4YDJA 5EUKB 3DHJA 3JTSB 3RAJH 3ZO0A 4LNVA 1RU9H 2JCCF 4UIMA 2AXFA 3UBXB 2YMXL 4WUKH 3P9MB 1LE5B 4UBDC 2AJUL 4X0KB 2D0FA 4OD1H 3VFMA 4BH8A 4D9LH 3EDDA 1G6VK 2XTJE 5I19H 1K8DA 4JN2B 4LPUA 1OM3H 4RGMB 5FCUL 4F9LC 5EUOA 3WFHA 4P5MA 3MXWL 4OFKA 4FQLL 4U3CA 1H5BA 5FKPB 5D7LE 1ZGLM 3UJJL 3UMTA 2DQFB 1I8LA 1EJOH 4LSPH 4QRTA 1YNKH 4HIXL 3LIZL 4R97B 1DBAL 2A73A 5GIRA 4OFYD 5KAQG 5EG6C 4WO4D 3NMEA 4NJAL 3D39E 3F7QA 2DQTH 2VXUH 4TRPL 4LCWB 2R2EB 3BMVA 4AY0A 3O3EB 1FL5A 5DEGB 3HMWH 3O11A 1A4KB 1OTUC 5JXAH 1YY8B 3VWJA 3WKNA 5FO8A 2D7NA 1SEQH 3SGKC 1Z9MA 1VEMA 2FX7H 2EKJA 4DCQB 2FD6H 3OKMB 3IFLL 2JK5B 4G3YH 4PG9B 3RHWF 1IC5H 5J1TC 2BSRB 3MV8D 1RQ5A 5KVGL 3WHXA 1NGYB 2NXYC 2HVJA 4TTDC 2ICEB 2CO7B 2YSSB 1FAIL 1EHAA 1RIHL 2DJSA 4L4VA 4D0CA 1XIWC 2PW2A 2D9QB 2VQ1A 4CMHC 5EZIL 5F9DC 3OKKB 3QO1A 3IDNA 3P4MB 3OL2A 4NPYA 3R1GL 5IW1B 4H88H 5FYJU 3MTRA 3O4OB 4LGPB 1A6AB 4KVNL 2PTUA 4XNQB 1FFOA 4YO0A 3U9PL 3BZEA 3RKDD 1UKTA 4L9LA 4U1LB 2HT4C 3FZUC 3A0OA 1E0OB 4CBPA 5ESAA 2EYRA 1NH6A 2NY7H 1QSED 4ZFGL 4OZGE 5FUOL 2EDWA 3K8MA 3MNVB 5DI8B 5H2BB 3VXSE 2WIIB 4UB0L 3QDME 2DQUL 5FYKD 1MQKL 1S7QB 3STLB 5I1CL 3QXAB 1QBLL 3ARRA 3S4SG 1OP3H 5KSUB 1AR1C 2CUMA 4MXQC 2AKRB 2BVQA 4GT7A 4KDTA 1WEJH 4X80L 3BZFA 1ETZB 2NX5D 4Y4HD 5C0EB 1A9EB 3BESR 4HZAA 4PJHE 3F7VA 4ZOBA 5GPRA 3VXMA 4PGBA 3TBSA 1LVEA 5ELIA 5CAYB 3FT3A 5F1KC 4YFEA 4GAJH 2WSKA 2BVPB 1RZGA 2XOTA 3N9GL 5GGQH 4Z7OF 1CD1B 3SDCB 4ELMB 2A77H 3O3DA 2ADFL 3CH1A 2EC8A 4YIQB 3BP7A 2V5MA 4PREA 4YNYA 1GGYA 4F33A 4NJ9H 3AS3A 3GSQA 3UTTA 3H8NA 4GW5A 3T2QA 3UYRH 5D72L 5KVMC 4QXGL 1JYNA 3RFZC 5HGBA 4I8DA 1QFUH 3VXNA 4XP9L 1IM3A 3G6JE 1CLOL 2CIKB 2XFXA 1MNUH 5E8PB 3FMGL 1JGUH 1PY4A 4YHKL 4XZUA 3VU2A 3UTSB 2EICA 4P9MH 1Z3GH 1ORQB 2VDPH 5E08L 4P49A 4OB5H 1PYWB 3S8WA 1NCNA 2BOBB 3S9DB 1UM4H 2ADGA 5BXFA 4FP8H 5HD8C 1XH3A 1EUTA 4H0HB 4NHUB 1CD9B 1J1PH 2X40A 2BSSB 1MWAB 1RUQL 3FFDA 3OTTA 1LD9B 4DVRL 4XWOD 2DLFH 3S35L 3QSKB 2HVKA 2G60H 5T1KA 1MCEA 3K0WA 4BSJA 2R2BA 3I50H 4P3CH 2FEDD 2GQHA 1KPRA 5I1IH 3QIWD 2F54A 5DHXB 3TFKD 2EDQA 4KJPD 5E8NB 3CDGA 4TVPE 4U0RB 4Z7WF 3VGFA 2BOCA 3MXVH 3V0AC 1Z9OA 5DMKB 1LILA 2MJWA 3DVNB 1HI6B 3EW3B 5DYOB 1XGYH 2I07A 1LMKA 3MBXL 2KPNA 1W8NA 5IBLC 5HYSA 3BH9A 1X5ZA 4PJEE 5EPMB 1P4IH 4M1DH 1PLGH 5FEBA 4K2UL 4CVUA 5CD3A 4KKCC 1U8IA 5DD3L 1HHIB 1OGAA 3CUPB 3OF6A 4R8WL 4HKZB 1QSFE 4LCIH 2NW3A 4OLYH 1YQ2A 3ALXA 4XT1C 4FMKA 1IT9L 1TENA 4EZMA 4HUVA 4Y16C 4PJ5D 5B3JF 3CXDH 1NBZB 2VLKD 3KPQB 2FECI 4PB0L 4DFIA 2BXZA 1A1MB 4JPVH 4X8JB 1HK6A 2KZ1B 1A7OL 3IKCB 2CMRL 1DLHB 4MNQD 3VFPA 3NZ8A 1NPUA 1DQDH 2GTWA 3P40A 1YEHH 2JJTC 4P23D 2DLGA 4X99B 1AR1D 1LO3L 5BOZG 4F9LA 2GFBA 4MGXA 3H7BA 1HIML 1VKXA 5F8QC 5HYJA 2OK0L 2DYPB 3LCYA 1S7SB 2PYFA 1ZGLB 2X09A 3VXTB 3RZCA 5HPMB 4YX2L 3D25A 4YUEH 3MO1A 4JQXA 2VXQL 1KIRA 2W65B 4AM0B 4HV8B 5DRXB 1ED3B 2QV2A 5JW3L 1ZLWH 4HS8H 3TP4A 4DUWA 4TUJB 1AO7E 3KWWB 4TULL 3I85A 5IROA 3ZE1E 3AM8C 3T0AA 5GGTL 4X6BA 3WNPA 4CMMB 3BKYH 3IVKB 3MJ7B 1EAPA 3VXMD 2DJUA 4NZJA 4IHOA 5EN2A 4KGJA 1K5NA 3SQOL 5GHWH 1C5DB 1JPFA 4Y4HA 5HTSA 1QSFB 1G7MA 4X4MA 4RBPH 5HPOA 5J3HC 3IJYB 1YPZE 1JGVL 1AGEA 3VFOB 3GSNL 3AMLA 5HI3C 3MRDB 3GJFA 4HG4K 3QXTA 2W0FB 3RPIA 2PCPA 3MUHL 4HH8A 5K9QG 1FGNH 4Y19A 3S4SB 1U58B 3O2DH 4LP4A 3T1FB 4TUKH 4DVBA 2A9NL 4R26L 2AVGA 1O0VA 3T3ME 2EDEA 2IALB 4HGWB 1CF8L 1OL0A 5E9DA 3OKLB 1AGCA 1SEBB 2AJVL 2XV6B 3GMNA 1JZ6A 1DVFB 3J8F7 3L1OH 3O9WA 3I2CH 4PJXA 1ZHKB 2DM4A 1BJ1J 4L8DA 5EWIH 4CKVX 3OKOB 3ULSB 5TPWL 3WHE1 1X5AA 1LP9B 3QNXA 5B38A 3IU4L 5DJ0A 4K94C 4QWWC 1DDHB 4L4VD 3ROLA 4JQIH 4ZTOH 2Q8BL 2JIXD 1OQOA 5AWNH 1T21B 1MFDL 5FHAL 1KCUH 1C5BH 5IBLD 4OUOA 1CDBA 4L8BA 3RGVC 3C87A 4APQD 1VA9A 4RFNB 4WGVB 3VWKD 3HZVB 3WNLA 3B5HA 3L5IA 1G0XA 3J7HA 5E94B 8FABB 4G6MH 1FBIH 4MJ6B 4XGZB 4ZPVA 2D31A 3U4BH 5C0BA 3TWCH 4XPBL 4XCCL 1F2QA 1RVFH 5EU5B 5KANG 1J8KA 3PV6A 2XQBL 4HULB 1JPGB 3FO1B 3WFBH 2HLAB 1RULL 1MREH 2AV1B 4U6XA 2C7UA 1UWXK 5CJXA 1DBML 1KCVH 5M7QA 2D4DA 1RUPH 4KQ3L 3ARQA 3QIUA 3FQTA 3KXFD 4HWBL 3VG0H 1A4JA 4NO3A 4OM0L 4R90L 3U83A 2W60B 4NWUL 2VUYA 2OXHA 4LSQL 1QVOA 4QGTA 2BHUA 3T65A 2H6PA 5GSRB 4Q9RH 3HA0A 3MFFB 5T3XH 4P9HC 5ACZA 3QIWB 3WIHA 3MRCA 5D5MF 3P3YA 1I1FA 3K8LA 3OHXA 3U46B 2VLLA 2G9HA 3MSPA 3R0NA 2AK4D 4ONFL 3UROR 2CKBH 4JFXB 4WHCA 3QUYC 2HFEB 1MJ8L 1UM6L 1IAIH 4OTXL 1I7UB 2EDTA 1T7VA 4PLJD 4LKCA 2BRRH 5T5NG 3LD8B 5DVLA 1OPGL 3NFSH 2DKUA 4DEPB 2G75B 3BAEH 2B5IB 3L5XH 3O8XC 2Y07H 1SMOA 5I66A 2IPUK 4QOKE 3BZ4B 3FN0L 3LB6D 4YXHH 3IU3A 4XMLH 5F88A 2RFXB 1MRCH 3ARUA 1ZHBA 4D0BB 5F7NC 1CFNA 3H2WA 1HQ4A 1UQSB 3KYAA 4UBDD 4YIQA 1HHJA 4JHWL 3BMWA 1MLBA 2I5YH 5DMGD 4D94A 1DQJA 1RZFH 3A6CL 3O4OC 1RZ8A 3WN5A 2D03L 2ITCA 1YPZF 3GMOA 1F4WL 3LZFH 5GS1B 1P4BH 3PP4H 4XTRD 5HGBB 1XR9B 4HC1H 3QWOB 4P4KA 4LCUA 2BVYA 5ANMB 2Z8SA 4KK9C 4JRXA 2VMFA 3SDAC 1JZ3A 5D96B 3GI8H 4QHNB 5E00A 1WBZA 5L2KB 1KN4H 3D5OF 2ILLA 4PV9A 5INDB 1E4XL 4HBCL 3VFWB 5B8CA 1U8NA 4KDWA 3G5XA 1OAKH 3BIKA 3AY4A 4G6KH 4AIOA 5EIIA 4MXWL 5FO9B 3OG4B 5DVKA 2DKSA 1FHGA 5CD5C 3VD4A 1AD0A 1MHCB 4OGYH 5F8RC 2Q6WA 1LO0H 5IJKC 1OSPL 1JPTL 3SE4A 3HG1E 1E27B 4KJPC 3SDXA 1HH6B 4ODVL 2BY0A 5F9WC 3B2VL 4NNYA 3QUXB 4OLZL 5I1KL 2GK0A 3KJ4B 3WNNA 4PB9H 4HZLA 5GGRY 1UYWL 4JG0H 2WINA 5IQ7H 3D87B 4DGYL 4NZUL 4J3UA 4HK3J 3W0WB 2Q20A 1I85A 4PJ9C 3EAKA 2EEBA 1TQBB 5DRNB 4AYFA 4E9LA 5CBEA 4AH2B 1FJ1B 3NH7H 5D1ZA 1EZVY 5FDYA 4Q2ZA 5D71L 4HXBH 3FRUB 2WP3T 2Q87A 1ZT4A 3WJJC 4P4KC 1BQUA 4QRPB 2EXWD 5J1SC 3ZTJH 3TT1H 5IGXL 5IMLB 4YBLC 3LN4A 5AYUL 3CFBA 1BBJB 2GSGA 1R6VA 3BZEB 1IM9B 1R3LB 5KSBF 1CXKA 5D7KE 3LKOB 5L2KE 5I1LB 3SDAB 1V8HA 4NUGL 5FGBA 5TDOB 1JE6A 1MI5B 2YD5A 1OAXH 4XMPH 1WFNA 1QZ1A 1M05A 2ZOKA 3FL7A 4Q9QL 1HXMA 1UCTA 2HYMA 3QDAA 1R0AL 2R0ZL 5ERWA 2IPTH 1TVHA 4DKFH 1MWAL 4HHAB 4PJIF 3HR5B 1JGDA 4HUXB 5IVOA 2VZTA 2XKUA 5ISZD 4Y5XB 2B0SH 3P73A 2XN9E 2F54E 2Y06L 4YDIL 1Q9OB 1I9RH 4XCNB 3NTCL 4UINH 3TH4T 2YC1A 4P3DA 4L8CB 3WUZA 1QLEH 25C8L 2XRAL 3PWNA 5EZLB 4XVTL 4QF1B 5FYKU 1Q94B 1RJYA 3P2TA 5JIHA 4S10A 3FT3B 4NT6A 4JFHE 3P0VL 3MGTA 1KBGH 1I8KA 1SYVB 4HD9A 3TV3H 12E8H 1V3JA 1MCWM 3MRIB 1KCRH 2YKLL 3T0WA 3W0WE 4KZEL 4FABH 4KAQL 3RJDA 1VHPA 5I1KH 4L4VE 1YDPA 3PUCA 4C57C 1Z6JT 3QO0B 4NIKB 3V8OA 3FFCE 2D0HA 2V7NB 1IGTA 5JUEL 4PJBA 1FNHA 1RJLB 3TIDA 2GKIA 3E2HB 2EE6A 3WO4C 2CDEA 4I5BA 3OJDB 1NAKH 3C09B 1NFDE 4G5ZL 5SWZE 2QQQA 1F97A 3T1FA 4DVBB 1U6AL 5DZOA 4C83B 4HMDA 5ESVB 3I3BA 1I7ZB 1KYOJ 2YBRA 3GMQB 1IC4H 3FQWB 4A6YH 2YD7A 1INQA 1NGWA 2DMBA 2EDYA 5J8OA 5HVFB 5L0QB 5IJVB 4TNVK 4I2XB 1A7QH 3I75B 2Y6SC 2R1WB 3L3GB 3T0ED 1S7UA 1N6VA 4F15B 2UY7A 2V5SA 3QNXB 1QEWA 4LLAA 1II4E 2D03H 3MRJB 4P2OD 3VXME 5GZOD 1IQWH 4OD3L 4NFBA 3UZQA 4G6FD 2X89A 2P1YA 4HJJH 3TM6A 1N6QL 1L7TL 3MODH 3C9NB 3MYJA 1OAZH 2ZCLL 1CT8A 3RIFF 2F5BL 3LQZB 5JHLH 1E4WL 1H3UA 3DMMA 2VL5A 3PHQB 5HI5C 1V3LA 4X6FB 2D31B 1MHEA 1E6OL 1X5LA 2B20A 4O2FA 4CU8A 5GZNC 1QKZH 3S36L 2YEZA 5EBWA 1MCIA 2BRRL 2YD8A 1JUFA 2LAGB 3G6JA 4Z5RB 3RZCD 1HKLH 3BKCH 4APQB 1MJ8H 3HC4H 4F57H 3LQMA 3MUZ1 3C5SA 4GBXD 1U2HA 4LAJH 1U91A 1KELL 4DJMA 2ERJB 4HX1A 4POZC 1WJ3A 4OCYH 4JZOA 1RJCA 1YEGL 1DQMH 1QBBA 3DJ9A 1G7HA 3CSGA 4BJLA 4RMTA 1CGXA 1UCBL 4Z18A 5T3XL 3SDYL 1KCKA 2WBJC 5D6DA 1CFSB 1PKQB 3EFFB 4EN3D 2J8UB 4JGUA 2AJZB 2XWJB 4WY7L 3L95B 3WCYA 1EGJH 3RNQA 3U0PA 4PJIE 2J1KA 4CMHB 1OGTB 5GS3A 1NLBL 2DYPD 3L5HA 3CNKA 1W0WA 1UA6H 2FECL 3EHBC 4KMQA 5GRJH 1RUPL 4KQ3H 1L0QA 5A2LH 4ONGL 2XWBA 5CILL 1JF1A 3DSFL 1U3ZA 2EXYD 4IJ3B 4PJFF 2ZUSA 3IJHB 3BQUC 2HWZH 4EQ3A 3KPMB 3L3KA 4XCCH 3LSOA 4RZCB 1IARB 3U4BL 5JDSA 4UQ3B 5CEZH 2HN7A 4PBVC 1EAPB 1T66C 5H37G 3WO3B 2VAJA 3O6MH 4PRDB 1CQKA 3C5JA 3MJ8A 4MNGB 1MCJA 3K81A 4U3XA 1AXIB 5BV7H 5C0BE 5DF0A 1C5DA 4PJ9B 4Y4HB 1ACZA 1DSFL 5JNYA 1T1ZB 2K7QA 3HTLX 5IB1A 5IV2A 5ABDE 2WUBH 5FHAH 2CLZA 4XNUL 4OLUH 1M71B 4XB7A 1MRFH 2R1XA 3FT4B 1JGLH 4JR9L 5F9WB 3NN8B 4I4WA 4PP2B 1G7IB 3HPJA 5FB8B 1H3TA 3UTSD 5ID0A 3MLPA 1IVLA 5EWIL 2AKRA 1L9MA 1W2KT 4J3VA 1F00I 3OX8B 2W92A 1YY9C 4M03A 1GVIA 3RWGA 3FB6B 4LSDA 4P2OB 3ARBD 5E2VH 1DVFA 3TNMB 4Y1AE 2EZ0C 4UTAH 5HYJE 1NFIA 3X13A 3FHAA 4UMGA 1CVSC 4AEIH 5C09B 4ALAH 3SDCA 1YEEH 4ELMA 1PW3A 3LQAH 1CWVA 1YNTB 4LLQB 4FZEH 3B9KB 4HFWA 3UPAA 1FNEA 3O6FC 3BYYA 4PRIA 3FQUA 2MNUA 3THMH 1MAKA 3IT8D 4DCQA 1PGRB 3DX9A 1CLYL 3LMJH 1NMCB 4OIIH 2DIBA 3REWA 4YDKH 4EIGB 3VI4F 4NKOA 2B1AH 15C8L 1OF2B 1TCMA 4PG2A 4ZO9A 3FT2A 4EI6B 4PS4H 4MJ6A 4XGZA 1A6ZA 3BGFC 1X5IA 4OZFA 3E1F1 4LRIC 5GGSY 1MCRA 3HKFA 1J8HA 4OCXL 4Z95L 2FR4B 5DUBA 4NHCL 3VFRA 4QRTB 3UJTL 4LCWD 2FLBT 3MJ6A 4I18B 3WS3A 3VE0B 2PR4H 3C8DA 1FE8L 4NHUA 1RZJH 1UVQB 3QXWA 1OAUH 3VXSD 4K7PX 1BF2A 4BKLA 4IRSC 1A6AA 3PL6C 5ANME 1R24B 2D7QA 3O11B 4X6DF 3WIIH 1A7BA 5I1HL 1ZGLP 1NGQH 3TZVB 5KZCD 1UB5A 4GLRI 1GZPB 3BO8A 4M1GL 5GGRA 5CMAB 1FDLL 3V5HA 3VRJA 3WIHL 1MY7A 3SE3A 1BFVH 3C6SA 1KNOB 2HJFB 3D39B 4OF5A 2DQEH 1NCCL 4OUUA 1INEH 1JGDB 4HUXA 5F6HJ 3WFCH 4MVBC 4BFGA 5MI0B 3MRMB 1CICA 3MV8B 1UJTA 1JK8A 3CXHJ 5EOCL 5HHME 4MB5A 4KY1L 1MHHB 4YHOL 2R29H 3QULB 2HRPH 4TTDD 1I3RB 1I1CA 1RUMH 4LRNL 4OI8A 1TZGH 3HHRB 4GG8B 3LQAC 5J11C 1IM9D 3ZDZE 5A2FA 4PJGA 3UPRA 4N1HB 1RFDL 1HKFA 2QJDA 1J05A 1X5FA 5DQ9B 5IHLB 4KDVA 4Y4FD 2H9GB 4IBLT 1SJHB 4M3KB 2YD2A 4YAQB 3GSXA 4ZXBB 4HLZG 2APXA 2YD6A 5C6PB 4IMLA 4KRLB 4MAYA 2YXMA 3G6JF 1VESA 3MOQA 3OBAA 4BFIB 2OTUA 2NY6C 4JFYB 1V3MA 4JN2A 4F7TB 4YK4C 4P3CL 4FFYL 5JORB 2DLFL 1O7SA 1OTTC 4X83A 3EKCA 1H5BB 1YC8A 4Y0GA 3G6AB 5DS8A 2PO6B 3GNMH 2VLRE 3MV9D 2NY0D 4JG1L 3LDBC 4JPKH 2M26A 1U8NB 3A67H 3QDMB 2UUDK 4JJ5A 1PDKA 1LHZA 2QADD 1RZGB 2Q76A 1Z3GL 5K33A 2CLRB 2AAVA 2Z35A 2ZG3A 1J9CT 2XN9A 1CLOH 4OCNC 3GM8A 3MJ9H 3B9KC 5TGBA 4YHMH 4DK3A 4PV8B 2NY6B 5DD6A 4PJHB 2HKFH 2DS4A 3MA7A 4NOFA 2NXYD 3VGAC 4RMUA 5D7JC 3GJFK 4PJCA 3PABA 2Y72A 4LSSH 1UXSB 4WU5A 3L3IB 4ODSH 5DURB 3VI4E 4ISVB 3QWQB 4L5FH 4PBWD 4KKBD 1QR1B 5HGDA 2RB8A 3SCMD 2W0FA 4L4VB 4OI7A 4K71B 5F96L 2OR7A 3EOTL 4L3EB 3EYQC 4MAUL 2P5WE 1PSKH 2X2YA 1OWRM 3QCUH 1ZE3C 5BRZE 5HHVH 1AD9A 3AS1A 3CFBB 1JRHH 5HD8D 4WWKB 3FQXB 1SJEB 4G8GE 4CVZB 1LE9B 4UDUA 2F8OA 3VFSB 5HYJD 3PWPD 4UV7H 4YFDB 3QFDA 3P30L 5HHMD 1MQKH 4BQCA 3P11L 5DJ0B 5E2TL 3SKUD 1BWWA 5FYLE 3RGHA 4XNXH 4EI5A 3KYNA 3JWOH 3STLA 3CFDA 1HI6A 2KH2B 3D3VD 5E6ZA 3S88L 3T3PF 4M1CD 4JEGB 2XWJA 1P5VA 2ZSWA 4LVHB 5I8CB 4P2RD 2H1PL 3EYUH 1J11A 3QCTL 2DYPA 4XP5H 2VLKA 4JFPA 2R69H 5DFWH 3RQ3A 1NCDL 2I9LA 5L2JA 2WNGA 2EDBA 1UH3A 3L3DB 5EOTA 1UZ8A 1KT2B 2BVOA 3GSRA 4JFZL 3VXMB 4KVCL 4KWUA 3NA4A 1C7TA 3VA2C 1FYTA 3I3EA 5I8OL 1SHMA 4JHAL 2HAZA 3MJ7A 1I8LC 4U7SA 1EPFA 1MCSA 2VXTH 2OJZH 5HYFA 1T0NB 2G5RA 2Y5EA 4GW4B 2OL3L 1IC5L 3IFPB 2EH7H 3E0GA 1Q38A 1XIWB 3CXHK 3HLAB 5EUOE 4Y8AA 1S7TB 4WEMB 3DYPA 3VXNB 1INDH 2X4SA 2L4OA 4IRZH 3O6FB 2X4TA 3MRDA 2Y9RT 2H2SC 3MLXH 1N0XL 5FF6A 4LHQB 4NCC1 1RURL 3QEGL 2Z9TA 1IGIL 3WEXB 2H3NB 3IFOA 1DBAH 3SDDD 2IWGA 4RSVA 4F7CA 1SY6H 2ZCHL 2EE9A 2DM2A 4GS7B 1V7MH 1PKQE 3DECA 2G75A 4P2OA 4RGNE 1U95A 4X6BB 4YHNB 3VMPA 2C1PA 3FHQA 1F02I 3MMEA 4K23H 2EZ0D 1EHLH 4Y89A 3AB0B 2F74B 3WLBA 5I2IB 4OD1L 3RY6A 1BZ9B 1MJ7H 5I8KL 2J2ZA 4AT6A 1QR4A 4KI5C 4UTBH 3KAAA 1MLBB 2O5ZH 1LE5A 2P24A 1I75A 1KIUA 5EBMB 3REWB 3TZVC 1A3RL 3PWLA 2X1WL 2YPLE 5E94A 2HT3D 3HE6B 5CD3B 3I6LE 4PRNA 3SJVD 4EI6A 4MJ5B 1X6LA 1P6AB 1Z5LB 4JQVA 3M17A 1A7NH 3BVNB 1I1YB 5EC2A 2DQFA 2AV1A 4XCFL 2FATH 2DM3A 1QSFD 1OVZA 3DX6A 1AIFA 3FB8A 3MLZL 4R4NC 4RMSA 2NX5A 3VXSA 3IAPA 4APQA 1S7VA 5HVHB 3FQTB 3BYTA 3B8SA 5T3ZE 1ZAGA 3QEHB 4OBRA 4KK5C 1J8HD 4MDJB 4Y2OA 2X4QB 3V7AG 1R5WA 2VH5L 1C08A 2A9ML 1TCRA 3H0TA 2C3WA 3KJ6L 5KOVC 3SJVB 3AS0A 2MFNA 2VC2L 4KRPD 2Y36L 1I85C 4LSTH 1S7RB 4YWGL 4KI5E 4UQ2A 2JK5A 4NC1C 3LEXA 1A5FH 5CJOH 2X1PA 2ZJSL 1I3GH 5ID1A 3CVHB 1KIQB 3HZVA 2MPAL 2O5ZL 1F11B 4UTBL 5EIQA 2HFEA 5C09E 1LP9F 1UM5H 4Y5YC 1H9VA 4WV1C 4ZO7A 5I8KH 3HRZA 4Y5VB 2PXYD 4O51B 5DJ2A 5C86A 1JFQH 2RR3A 3SDXF 1T6WA 5F9JB 1M7DB 4ELKB 1N26A 4NQEB 3FO1A 4ZDHA 4K23L 3EO0A 1B90A 1ADQH 4CW1A 3D9AH 1KLUB 1PD6A 4DZ8B 2QQLL 4NQSA 3TIEA 1P7KB 4ZFFB 3BZ4A 1DN0A 2FYYA 1H8SA 2PYEA 4JJHA 5JXEA 4GAYB 2F5AL 3ZKMD 3H3PL 3BDXA 1A9BB 4YO0B 4LU5H 5IW6B 1R3LA 4D3CH 5I6XB 1J8HE 3BEWB 4HBQA 3LKRB 3OPZH 5MEOB 1CXIA 3MLXL 3BPOB 5D2NB 3WIFA 4GKSB 3TBVA 3DRQA 5CLTA 4QYOA 1NAMA 2ORBH 4M4PA 1KEGL 1CE6A 1INDL 3IDJA 4KJQD 2P44B 3ZKXC 1A22B 4U6YB 2P8LB 3ARBC 2W9EL 3IJSA 5LWYH 1K2DB 2B1HL 3DXAA 1WBZB 2VDMH 1OTTD 4KUCD 2KL6A 3L6FB 5K93A 3V4PH 3RX8A 4X6CE 1UB6B 3RWGB 5BMFH 2BFVL 1E28A 1PZUB 1EVTC 5EC1A 3GJFH 5IOPB 5L2KD 2QKIB 2JB6B 5SX5K 1IGCH 1H15B 3QEQD 4KVCH 1S9VA 4ORZC 4X7SH 5CGYD 4ZAKB 5FKAB 1ZTXH 4PJEA 1NGPL 1HHJB