5EN2A

Molecular basis for antibody-mediated neutralization of new world hemorrhagic fever mammarenaviruses
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
219
Chain Sequence
EVKLQQSGAELARPGTSVKLSCKASGYTFTNYWMQWIKQRPGQGLEWIGAVYPGDGDTRFSQKFKGKATLTADKSSSTAYMQLSSLSSEDSAVYFCARRRVYYGSNYIYALDYWGQGTSVTVSAAKTTAPSVYPLAPVGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords GD01 heavy chain
publication title Molecular Basis for Antibody-Mediated Neutralization of New World Hemorrhagic Fever Mammarenaviruses.
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 219
sequence length 224
ec nomenclature
pdb deposition date 2015-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5en2A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5en2A02
4NPYB 4P46C 3HG1D 1IGIL 1HCFX 5EU3B 1OAQH 4KUZL 1T1XA 4QHNB 4G9FA 5L7XH 4JHWL 1CS6A 1K4CB 3SKOA 1KTKE 3AMLA 4O2FA 3I02B 2DQIL 5MI0B 2DI7A 4DGIH 4DW2L 3GI9L 1WZMA 4OT1H 5DRWB 1EEQA 5IG7B 3SBWA 2R23A 3KLHC 4JLRA 1FZMB 3H0TB 3CFBB 5I1HH 1NLDH 3TFKD 3IFLL 2PETA 4KKNA 4DKDC 1YYLL 2AQ1A 1XCTB 1V3MA 1ZA6B 4KRPB 1NGPH 1NC4D 3PP4H 1K4DB 4LCIH 4JN2A 1JTPA 2ERJB 4XPHL 2GAZB 5T1MB 4KDTA 5IMKB 3I50H 1A7NH 1CGSH 4HPYH 4LGRB 4WDIB 2NX5B 1PSKH 4IJ3B 3VFPA 1GC1C 2DRUA 4LRIC 3MLVH 3NGBB 5JIKA 2NNAB 3BPOB 2BSSB 3NFPA 3HR5A 4J1UA 4JRYB 4U1KA 3VMPA 3S36X 3O2WH 2Y5EA 2EEAA 4R97C 5IEHA 1CDYA 1P7QA 1I3GL 2ARWA 4PRAB 3R1GL 4E41D 2DQCH 1CDGA 1L7IH 4X6DE 4GW1A 3NFNB 1B9ZA 1S7XA 4NO5A 3H8NA 4DN3H 1BOGA 3QA3A 1OPGL 2DM2A 1D6EA 5D72H 1G7JA 3E6HB 4ZAKA 3TFKC 1HWHB 1IEHA 2H26A 4Y1AD 3C5ZB 1J7VR 3ZSSA 5C2BH 2ATPB 3MLUH 5D9SA 1FZJB 2OTUB 4P9HC 3GMOA 2ZCLL 3RUGE 2Z92A 4OI8A 3EYSH 4W6XB 4EXKA 1CT8A 3QQ4B 3QEHA 4C54A 1DANT 3AM8C 4KKBD 4K7PX 3DBXA 3QFDB 2UZIL 4N0RA 4P3DB 3MLSH 3GM0A 2I25N 3LPFA 1T04A 1FC2D 3ZYIA 1FVDB 2Y36L 3G9VA 2ZZUT 3G6JE 4OF7A 3C5JB 3SJVE 1RZKL 5B3JF 1L7TL 3T2OA 1N4XH 3VD4A 3N50A 2BMKA 4G6MH 1S7QB 1KPRB 4ZO6A 2XN9E 5BW7C 5C0GA 3UTQB 3L3IB 3RDTB 4ETQA 1FCGA 4S1SH 5DFVC 1MF2L 2V2XA 2B2XH 4KKBC 5KVGH 2ESVA 3FT2B 5DRXB 1J0IA 4OF3A 5CJ8A 3RWFA 3BXNB 2GITB 1DR9A 3VWJA 4ENEC 1F3DH 1G84A 2Y9RT 4KWUA 4CRPA 1NCCL 1VPOL 4MA1C 4X5LA 2YMXH 2AP2A 3CLEL 3MRQA 4HFUH 2PF6A 4KJQD 3RJQB 3TYFB 3L7EB 3Q5OA 4MCZB 4XMKL 2VE6A 4JM2A 4WFGD 4MDJA 2ZNWA 2QR0B 4NM8L 4QHKJ 4L3ED 4OCMC 4LKXB 4PYHA 4Z6AT 3HMWL 4K94C 1C16B 5JQHC 2J8UF 5KG9B 5E5MB 1JGVH 1KC5H 2X89D 5FO8B 4HS3A 3FT3B 4PREA 1M6OB 1DN2A 2EDYA 2HJLB 1FPTH 2Y07L 5LWYH 1T7YA 2H9GB 4HK0B 3SCMD 5C0BB 4M03A 2Q8BL 43C9A 4L8BB 5D1QC 4AG4L 3KPLA 4LSDA 2ZCHH 3FMGL 1D5BB 4RAHA 1RHHA 3PDDA 1P69B 4RZCB 5MP6L 1BQHB 3ZYJA 3RUGB 1Y18B 4KJQC 3ULSB 1XF4A 3O4OB 4YNYA 3VFOA 4JO1L 3ME0A 3KNBA 4WTWA 2CXKA 3U1SL 5FECB 4B41A 2IBGA 4OIIL 1GOHA 5HY9A 1BJ8A 1J0JA 1QYGL 4MD0B 4U1IB 3KPRB 3ROLB 3WFCH 1NGQH 1Q9WB 1YNKH 4JG0H 4PJGE 1HKFA 3QDMD 3EO0A 1TETL 5IF0B 2R1WA 1MCPH 3RP1A 1SBSL 3Q2CA 4S1RH 1GVIA 5CUSH 2BNRD 4P2RA 3M45A 3K7UA 2V7NA 3WKMH 3CDGB 5T5NF 4IRZL 3SCMC 4ELKA 4IRSA 1XGYL 5BMFL 1A1MB 1OD7A 3BGFB 4PJHE 5ICXB 1N5YH 2YD1A 3O9WA 2YD9A 1N6QH 1DFBH 2YPLE 1UVQB 4WCYL 4KTEH 1T66D 1HHKB 3BP7A 1V7NH 4YHKH 3I2CH 3PWLB 1KN4L 1J18A 3FHQA 4ELMB 2CKBB 2PO6D 3PWPD 4GBXB 2E7BA 1SY6H 4AM0B 1AO7A 3LEYH 4PJ5E 2NY1B 4XMLL 4NDMB 5DR5L 1Q1JL 1D9KB 2JJWA 3IFPB 3Q5TA 5FHAH 3MLXH 3PJSB 2IQAB 3LKNB 1WZKA 2VN7A 3ARBA 1FFQA 1VERA 3I75B 2DLFL 3MV01 5CD5D 1S7RB 5D8JL 2AJZA 3AS2A 1VFAA 1JN6B 1X7QA 4J3TA 2O5XH 1MPAH 1T66C 5FKAB 5JMRA 5D7JA 5CS7A 3V4UH 5EORH 5F1NA 1A5FH 3D0VA 1CGXA 4H20H 3R06B 4KGLA 2B1HH 3C60D 4MNGB 3DO3A 5DURD 5JOFB 1OAYL 1UWEH 4Q6YA 4LIQH 1XGRB 3TA3B 2Z8RA 3B9KB 5EO0B 2PO6C 3CU7A 2VDOH 1CTNA 3IDGA 4HK3N 2AXHA 4OSUL 4WHTA 3F12A 1Q94B 2Z31C 3QUML 2AQ2A 3C08H 4UUJB 1BQUA 5IVXE 2BJMH 2JJSA 2EDEA 3C6LB 1KJVB 5I8OL 4JDVB 1P2CB 2NTSP 2ZUWA 4S2SA 5I71B 1J0ZA 1HH6B 2AK4E 1GIGL 1RJCA 1IILE 3UTPD 4LCWE 2L0DA 5CD5C 5HHOD 1HHGB 3SE3C 5DHVH 3RTQA 3OWEA 4MJ5B 1EAPB 1QLRA 2DWDB 5FA3B 1ORSB 5J56B 5E8NA 1KB5B 2UWEA 5BZWB 1UACL 1MJ8H 5GGTL 5CD3B 4LSTH 5LGJA 2ZUTA 5FGCB 5DRNA 1J0YA 2A9NH 4TULH 1EBPA 1A7BA 4GMSL 4M6ML 1QSFE 2HRLA 1H5BB 1DBJL 4KUZH 4DEPB 4QRRD 1U8JA 4JHWH 3D2UA 1I3VA 1I1AA 4XPBL 1KLUB 2DQIH 4OZGB 3G5VB 3KPTA 4XNMB 3O45A 4M9OA 3IAQA 5K33A 2OMNA 5H8DA 3OTTA 2R1XA 1HK6A 5JOPE 2YSSB 3P40A 1FP5A 2NY2D 4PLOB 1SY6A 4PJ5B 3T0ED 3HAEH 3TO4A 3V0VA 3U46B 1YYLH 4PRIE 1FYTB 5DQJB 3RWEA 4MAYD 1LMKA 4XNQB 4YXLL 3QULB 2VLRD 3D85D 2DJUA 4NQVA 1JV5B 1X5AA 3WUZA 3MA7B 3W2DL 2QEJA 1WICA 1F2QA 3MUJA 2WINB 3MRGB 4YQXL 1BJMA 1S9XB 2VLKE 3VFSB 3DTXB 4GRLB 1I3GH 2HTLD 5AAWA 4O4YL 3A67L 2HFTA 1BX2A 3D3VA 3ZKND 5CIPB 1GCFA 5F7LB 3EO1B 1OPGH 1EH9A 4RFEA 5DUBA 5HDQH 2NY2C 4AIXA 3EYFA 2W60B 3X11B 1RJYA 3EJZC 3UTSE 3D18B 1W0YT 3PNWB 4MAYC 3Q1SL 1DEEB 4C56A 3UCRA 5IK3A 2QQKH 3P0YL 3FO0L 1K5NA 1LO3L 2ZCLH 3WNLA 2BY3A 1LEIB 5I16B 3HZMB 1T0PB 3GBML 4OM1H 3VJ6A 4DJMA 2X4RB 2LFGA 3VRJA 1VADB 3PGFL 2YUXA 3ARYA 3IDMA 4R96A 3MZTA 1JZ2A 1DQTA 1ONQA 3K80A 2Z4QB 4KK9D 5IB5B 2QHLA 5DVOA 4DTGH 4KMLB 4PJ8B 3FB6B 1P7KB 2VDKL 4IOSD 4J3WA 4N0YL 5B8CB 4OCLC 5HVGB 2Y36H 3ESVF 4ORZC 3ZKNC 5I1JH 1NGWB 1DANU 3OR7A 4V2CB 1PW3A 3QNZB 5IB4A 3C09B 3TH2T 1RZKH 1L7TH 4RWHA 3P4LA 1TPXB 3IJSB 5DQDL 5LQBL 2MFNA 4BQ6A 5IJKC 4C55A 1KYOK 3FB5A 1Q72H 1MF2H 4OCYL 3TNNA 3D69B 3R8QA 1FFPA 4U6TA 2NXYB 3V5HB 1JZ6A 4I77L 5D7LE 4MJ2A 3LKOA 4P5TA 4LPUA 4Z0BH 2AJ3A 2EC9T 1GPOH 1NCCH 1VPOH 1EHLL 3CLEH 1EK3A 3L7FB 4XMKH 2NR6D 3CH8A 4LEOA 1B0GB 1YUHA 2V5RA 2VLKB 4ZS7L 2KBGA 4NM8H 4M1GL 1S7VA 5T3XD 3UTZA 5JPNB 5F7DB 3OJ2C 4UTBL 3HMWH 4PG2A 4X4ME 5DJYB 5LCVL 4ODSL 2IBZX 2ICEB 1HSBB 3DYOA 2A6IB 2DYPB 5TPWL 4J4PD 3KPSE 2D31A 4KK6D 3TBVB 5CEXA 2ORBL 2Y07H 3BMWA 4N8CL 4N8VB 5E00B 4GAJL 2Q8BH 4J6RL 1KGCE 5EUKA 1XZ0B 4OQTL 1A1NA 4AG4H 1I8MA 3FMGH 4MB5A 5MP6H 5F7YC 3VWKC 4PJFE 4Z7WE 3MODL 4HJ0D 5D7KD 2NR6C 5FO7B 1MH5A 4LCUB 2DTSA 5D2NC 4XT1C 1QG3A 1RMFL 4YHPB 3T0BA 1DEDA 2CO6B 3V52H 1B4RA 2R56L 2BDNL 5E2UL 3VXRD 3GSQA 2JK5B 4Z7OF 2D9QB 3ULUD 1G7IA 2VISB 1QEWB 2WAHA 2YWYA 2VAAA 4G8GA 5CJXA 4NWTL 2X4UA 2CKNA 1NLBL 3KPOB 1ZHBA 4IS6A 2VXQL 3SGKC 2VQUA 4IRZH 3VCLB 5BMFH 1XGYH 5EIIA 4Z0XA 5IW6B 3ET9F 5HYSB 4ESKA 3HG1E 3EKCA 4EOWL 1T89A 3DRQB 2DIBA 3LCYA 4DWHA 5ERWA 4WCYH 4HJ0C 4O02L 1KNOB 4NO2B 5EBLB 4NQXA 1NDMA 5GRXG 5J7CC 1CLYH 1CU4L 2H2PC 2WWKT 4P5KB 3SE4C 5C8JA 1KN4H 4E42A 4JM2F 4OB5L 4PJDE 3UYOD 1U93B 3BUYA 2VKXA 4YHNA 4ZUUA 4YDJA 3OG6B 2YPKB 3IKKA 1AXTL 1MFBH 3GSNA 3IRZA 3ULUC 5IMOA 1IKFH 1Q1JH 2A73A 4LBEA 4A2LA 2DLFH 1IEAA 4NQCE 4R4ND 1MIEH 1BEYL 4WY7L 1VB9A 4L4VA 1AKJA 5D8JH 2BVQB 3MV8D 1YEDA 1ZK9A 4XTRD 4XCNA 5DD5L 1R24B 1QLFA 4MJIA 5DK2B 3TO2B 2EC8A 1A0QL 3BWAA 4XNXL 2DF3A 4P2QA 1AR1D 4P4RA 1MCBA 4M4RA 1R3KA 2HA1A 1FRGL 2NY6D 4NFDA 2QADB 3QIUD 4JHAH 4HZAA 4MAUL 4JPVL 3ARGA 1OAYH 1KFAL 1U8IB 1SMAA 4HGWB 3TBYA 5I19H 4P46B 4OGXH 4AENB 1UM4L 4OSUH 2F8VA 2VDNL 3QUMH 2VITB 3CFIC 1DQML 2CLVA 4GRWE 5I8OH 1WT5A 5I66B 3FO1A 1MHCB 5E9DB 2OL3B 3RIAK 4R4NC 1R5IB 4U1NB 5DA0B 3OKYA 3QO1A 4PP1D 4X4YB 4JFQA 5JXEC 3F7YB 1TCRA 4I2XA 3WUWA 3ZKQD 3JV6A 1F02I 2E7MA 4XTRC 3MRHB 4ZMAT 1NEUA 3AAZA 4XMPL 5TQ0L 3IT8D 4JFDD 3TBTA 3TM6A 5H37H 2BNQA 1SYVA 4YHOL 3DMMC 3L95B 3MO1A 1AR1C 4OF5A 4URTB 1UACH 3P73B 2NY6C 4J23A 5GGTH 4NFBA 1C5BL 3L3JA 3QIUC 5IB1B 3QCTL 1B0RB 3RNQB 5EG6C 1PFCA 2ZUYA 1JL8A 1G7QB 2VLLB 4GMSH 2NZ9D 5SV3A 4M6MH 2YWZA 4LKCA 5EZOL 3HG1B 1C08B 2OTPA 2R0KH 2N4IA 5IBLD 2FEEI 4LSPL 3ZDYE 1DBJH 4WW1B 4J8RB 3JWDL 5BRZB 4K55A 4GG6A 4R97B 1MCDA 1EIBA 4XPBH 2FDBP 2B5IC 3MV9D 4ZOBA 2A74A 1JYVA 2HVKB 4PP1C 1KEML 4AL8L 5IW1A 1ULVA 4HG4J 1VDGA 4QHMB 3VA6A 3NCYP 4TVPL 4WO4B 3UXFA 1T3FB 2JIXA 3VXSD 5GS2D 4JDZB 5A2LH 4Z7NE 3IAGC 3GGWA 4NFCA 2PYFA 1OTTD 2ED9A 3VFUA 1NC4B 5KSVA 5B3NA 4YWGL 4EKXA 4IRJA 1MCNA 5KANG 2EDXA 3ZHLA 5FB8B 3IXTB 2GTZA 2UY7A 8CGTA 2AXGA 4HJGB 3VFTA 3W2DH 4AIZB 1IL1A 3O11A 5IBLC 4YQXH 3U4EB 4WFGE 3S34L 4XP6L 2FGWL 3BAEL 2X70B 3FN0H 4L3EE 4E41B 4O4YH 2G75A 3VXQA 1I9JL 1LEGB 1IC4L 1HKLL 5INDA 4I0PA 1X5XA 3AU1B 4PGDA 3TVMA 1B0WA 4HJJL 2DKMA 1E27A 4X6BA 1WCBA 4Y1AB 1OTTC 5H94B 1P1ZA 2XKNA 3QPQC 1MJJB 3LV3B 4DZ8B 2VDRL 3FFCD 4PG9A 2UWEF 3FO0H 3O4LD 1LO3H 1TVBB 1VACB 5A43C 4YHLH 5J6GB 3GBMH 3HI6H 1UKSA 3I6KA 3IKCA 5F7EH 4HKJB 4HUVB 4ISVB 5F9WC 3MACL 4MLSA 4KKLD 2VDKH 1A9BB 4N0YH 2WP3O 4TOYL 3MRKB 1FNGB 1LE9A 3BIKA 4MA1B 3MLPA 3QDME 2XY1A 4FNLL 3MFFB 2O26U 4D8PA 2Q86A 3DXAB 3PV7A 3OKEB 2B4CC 4YFDB 1HE7A 2XQYK 5E1AB 4S10A 2OR7A 3PGDA 5DQDH 5HGDA 1KPUA 4KRLB 1CFNB 4EI5A 2FWOB 1KCVL 1ADQL 3WNOA 4I8DA 1VKXB 4U1MA 5K9KB 2HG5A 4X6EB 5D5MF 1KEGL 5T3ZL 3EHBC 2AVGA 3CFDA 4OCSH 4TSAL 1I8LA 4NNYA 4QRQA 2ICWB 1WF5A 2GTWA 3S4SA 4QHLA 3RY4A 4X8JA 4HS8L 2FL5A 4KKLC 4N90D 3PWPE 4UAOC 1CI5A 4G9FD 1N3NA 3N1FC 5D1QB 3PV6A 1FCCA 5CGYD 2VO5A 3V8CA 4OLEA 3V6BR 1QR1A 3BVNA 4NZUH 1CL7H 4P5MA 3QEQD 1E4KA 5FYJE 3SE8L 4YGVA 4LNRA 3SDCD 3HLAB 3SKUD 4M1GH 3RWIA 2M1KA 4XXDB 3MA9H 5E5RB 5IB3A 1J8HA 3H9HA 3RWDA 3OGCB 4APQA 3BKJL 4PTUB 5LCVH 4ODSH 1QVOA 5JIHA 4LP5A 4XCEB 5TPWH 4TSCL 5CCKL 1ZANL 5C0JB 5EFIB 3UPRB 3A6BL 2HJKB 2ORBH 1PAMA 2IPUG 3SCMB 3EYOB 4NQSB 4GAJH 1G7HB 3FB8B 4OQTH 5CGYC 5JPMA 1EFXA 3RIFK 1FJ1B 3VFMA 1IAKB 3AS1A 4PTTB 3MODH 4Y2DA 2VL4A 4L5FL 1RZJL 3B4NA 2P48B 3R0NA 3V95A 4EVNB 5ID0B 3SDCC 2EDJA 4BZYA 3HE6A 1RMFH 5LBSL 3B3IB 4IOFD 1OGTB 2BDNH 5E2UH 5GJSL 3VMOA 4CNIA 2Z8VC 3CFKB 4DN4H 3QDMB 4G80B 5D2LA 1IGTA 2PKDA 3OQ3B 4HW6A 5BS0D 1KSRA 3O6LL 4JZNB 4NWTH 4WEBL 2BNRB 5KSBA 5D6CA 3K2UH 2VXQH 1YEHL 1CVRA 3FRPG 4C59B 3B9EA 1FDLH 2G9HA 4ZFGL 3HUJE 3GJFH 3HI5H 1S9YB 1TNMA 5ENWA 2Z9TA 1JP5A 2QKIA 4X7FC 3T3PF 4EOWH 4JFYB 2P5WD 1CU4H 3FZUD 3MRNA 3RNKB 1DVFD 5DJZB 5B38G 3IETA 1K3ZA 4DQOL 4OB5H 3F62A 2PO6B 3OHXA 1OD9A 3O0RL 3Q3GA 2CLZA 4RFNB 2Z31B 5KVDH 1AXTH 2UY6A 2BZDA 3T0EE 4P4KD 3MRDB 3CK0L 3IXAB 4Y5VC 3K4DA 3PDOB 2VLRE 3T8XA 4K2UH 1LHZA 2D7TL 5LAXB 3SY0A 5KZCD 4WWKC 5D7IA 5GGRY 4WY7H 1J1OH 1ITCA 1OB1B 3W81A 2B0SL 5DD5H 2HLAA 1AD9A 4F7CA 4TNVF 3CFCL 3P0GB 4XP5L 3RHWK 1KPVA 1JWUB 1HYRC 1A0QH 2R1YA 4XNXH 3VWJD 5DJ8A 3BT2L 1FRGH 1DVFC 1A4KA 1MY7A 4XGZA 1JNJA 3VRLF 3I9GH 3QUYA 5DURB 4MAUH 4JPVH 1KFAH 1T2QL 1HXYA 3GMLB 4WU5A 4YFEA 3OB8A 1A14H 4LLYB 1UM4H 1W72L 2VDNH 5I30L 1ZA3B 3DV4B 4NRXB 4P4KC 3V5KB 1DQMH 2C9AA 3L5HA 4X8XA 1BWWA 5B39B 5ADOH 5ALCH 4LSRL 1O7SA 4PRHA 2DM3A 3WXVL 1N2RB 1U0QA 2CIKA 5HHOB 3MJ8A 1OSZB 1SEBB 3HA0A 3U7AA 4HWEH 4PGEA 5C09A 5HHME 2VN4A 5EC2A 4XMPH 1N0XH 5TQ0H 4BZ2L 3RZCA 4R3SA 1U8OA 4LLMA 1KJMB 4WUUA 4YEFA 1C5BH 3QCTH 1HXMB 1NAML 5EU5A 2DQUH 4QRPA 4D0CA 5I1LB 5DGRA 3B9VA 4YPGA 4Z5RB 2WW8A 5TGBA 4LSPH 4QRRB 2CH8A 1ZSDA 3RWGB 4IBLT 2VDQH 5DD6A 1MIML 4AL8H 1KEMH 1U92A 5KJRL 1RJZA 2YOCA 4X4ZA 3DX6B 1DE4A 5SX5H 3GJFK 4P2RD 4TVPH 4GW4A 4AH2A 3RY6A 4JM4H 2NY2B 4BK4A 2XKUA 2AS5M 4IRSD 3F6IA 4HIIB 2J2ZA 2OSLA 4NSKA 2EZ0D 4YWGH 1NC2A 5FFLA 2VLRB 5D6DA 3GRWA 2CMRL 3BO8A 4MA7H 4XBGA 4PRPA 5LJYH 1Q9OA 1OW0C 3CU1A 2RJMA 1S7TB 5B3JE 3VMNA 4NQDA 3S34H 4A6YL 3VGBA 5D2NE 2FGWH 2VLJA 1MVFA 3FFDB 4PGCB 4F3FB 1P4IL 4GXUM 3OJDA 4Y4FA 1ZT7A 3G08A 3RFZC 3I84A 4H1LB 4F7MB 2AK1L 5I1DA 4RAUA 2AKRA 1IC4H 3ARBD 4JPIB 2EIZB 5EPMA 1EA9C 4D3CL 2X7LA 4HJJH 4ZODA 3CC5B 2EZ0C 3KDMA 5DWUH 4KHTL 1CD8A 4NN5C 3PWVB 5IKCA 3BP6A 2JF1A 5D7JD 5EULV 5T33H 5TE4H 4OQ1A 1V3JA 5HDBF 4FQLH 3Q6FA 5D7KE 5I9QC 4RIRA 4KROD 4JAMB 4RRPG 2EYRB 4QEGA 4MNHA 3T04D 3MACH 4KDWA 4RISL 5INCA 4GG6F 3TT1L 3VXRE 4TOYH 3PHOA 3LZFL 2D4DA 5E8EA 2KL6A 2J8UE 4BH7B 4FNLH 1UT9A 2ID5A 4DUWA 1NGYB 2C7UB 2HT2D 1YMHA 4JN1L 3OR6B 5JORA 4N0FB 2CDEB 1MI5A 3HCVA 4LDEB 3W0WD 4PJCA 3GI8L 1ADQH 2YXMA 1U8NA 3QWRD 4LCCA 3OBAA 4JFEA 2Q6WA 3AS0A 1SM3H 5T3ZH 4CBPA 1NGZA 3RBSA 4EEEA 1YA5A 4R6UA 2F5AL 3E0GA 5J8OA 1NBQA 1VFUA 3X12B 4GFTB 1KJ2B 4HS8H 5FYLD 3B8SA 5MEQA 3UBXG 4FMKA 5IBTH 3L1OL 3S5LB 1S7WB 3V5DB 4UT7L 1I1AD 4KXZI 5DEFA 1QFUL 2HN7B 3VWKB 4XVSL 5SX5K 5IFAL 3MR9A 3IF1A 1KELL 3SE8H 1PKQE 2HT2C 2WBKA 3BHBB 3CSYA 1QFWL 3K4AA 4LSQH 4ZPTA 3MV8E 3PL6D 3TO4D 3FQWA 1R3IL 2VXUH 2AI0L 1T6VN 1FZOA 2R2HB 3VD3A 5DUPL 3W11D 2EDRA 2XPGB 2I24N 2WWMD 4FXKA 4HV8A 3DI2B 4U2ZA 1E6OL 1ZANH 4D0DB 5FV2A 5KW9L 3O3AA 4IHOA 1YY9C 5A1AA 3ZDZF 3NIFF 1A1OA 3M1BA 3MRFB 4YDVB 1RULL 1WWCA 1WJ3A 3FOMB 3RGHA 4ERSL 4PIRF 4NQTA 1CK0L 5F6HJ 4HFWA 4L5FH 5FA4B 2RFXB 1RZJH 4QY8A 3QI9A 3TNMA 4LLUB 2HH0H 3HHRB 4X6FB 5LBSH 4HKZB 3RY5A 2V7HB 4NHUA 1CGWA 3PL6C 3KS0J 3H3BC 4JFDE 5GJSH 2CUMA 3MTRA 4PLNC 3W11C 2J8UB 3F7PC 5CLWA 2WWMC 4KUCF 4ONFL 3O6LH 4ODHL 4LARL 1S3KL 1EZVY 1Q9KB 3G5ZB 1YEHH 2NY3D 1M05B 4ZFGH 1KN2L 1SJHB 3BD4A 4ONHA 1OHQA 3GSNL 3ARRA 5ILTL 2BSTA 1OT2A 4X83A 1T83A 5IQ9B 3MV9E 1X4YA 1M71B 3O2DA 4PRBA 5ADPL 4YIQB 5J89A 3QH3A 1J87A 4WV1A 3SE9H 3BIAX 4G43A 3O0RH 3S35H 1YEFL 3VXSE 3PWNA 4O2CB 5IEKB 4HS6A 3DROA 3CK0H 2CLRA 5D71H 3ZLQC 4DGVH 4HT1L 3RIFF 3BD5A 4ZUSA 2D7TH 4ZDHA 2NY3C 5ANMA 2WK2A 4OUUA 1D5XB 2J88H 5EC1A 3OKDA 1T22A 4NBXB 1I7UB 2B0SH 3S37L 1MEXL 4U6HA 4XP5H 3DMMB 4F33A 3N06B 4JRWA 5FYKU 2PCPB 2YC1A 3QIUB 1S5IL 1NUDA 4G8EB 5TDPB 3VXOB 4PJXA 4NPYA 3QPXL 4NOFA 5EU3A 3O6ML 4GOSA 3RVVC 1W72H 3HZVB 5I30H 4QHNA 3JWNC 3MRMB 3LQZB 3TJHC 1K4CA 2D03L 2VJXA 3NCEB 1D5ZB 3I02A 5HJ3B 2X5PA 3C5SB 2B5IB 4PJ9D 1JYNA 1JNHB 5D2LF 3F6LA 2E27H 4OLVL 3FFCE 4WHCA 5DRWA 3WXVH 5IG7A 3O4LE 1FZMA 3EDDA 3H0TA 3VG0H 5KSBF 3CFBA 1UKTA 4GKSB 4JFDB 3QG7H 4PJ7B 2P42B 4BZ2H 1ZAGA 3FB7B 1EGJL 5C0CD 1XCTA 1ZA6A 1RY7B 1AGDB 1K4DA 5F44A 5IMKA 5T1MA 5E6ID 2GAZA 3DIFB 4WDIA 2NX5A 1NAMH 4JFFD 4JFHD 5IR1B 2PR4L 2NNAA 4TTDD 1WWWX 2BSSA 3ALWA 4JRYA 2VSCA 2VOTA 2EEDA 4FRWA 3LIZL 5F1OB 5H35B 1L0QA 4Z7UB 3L5XH 3MV9B 4A2MA 4PJ9C 4PRAA 3RHWF 4BSWB 3CZJA 3NFNA 2EDDA 5HYJD 5KJRH 1KTDB 4G8GD 4FHBD 2AEQL 5HHVL 1M7DB 3LEVL 5L9DL 4JKLA 2H41A 3E6HA 1QLEH 5FGBA 5LG1A 5D7IF 4L4TB 3CMGA 4G6AD 1F3JB 3C5ZA 4WFHD 4DKAA 2ATPA 2IANB 3S96B 5E6IC 4M6NH 4N90E 1FZJA 4G9FE 2OTUA 4I48B 1LNUB 2CMRH 2OZ4A 3QZWB 1DQDL 4LDOB 4TTDC 3MRBB 3QQ4A 4F8TA 3QEQE 3QFDA 4A6YH 1RUAL 1ZOXA 2OMBA 2A1WL 4P3DA 4GJTB 5F9WB 1X44A 2DOCA 1P4IH 3DVIA 1FVDA 1P5VA 4JFPB 3RKDD 2AK1H 1LK3H 3LHPL 4CMHC 5E8DL 4NM4L 3RQ3A 3TBSB 1RZKC 3C5JA 4RGMC 4D3CH 2A6KB 4QF1B 4L4VD 2PTUA 1UC6A 1S7QA 1KPRA 4KHTH 2R0ZH 2AV7A 3FFCB 3JTTA 3MROB 1DLFL 2P1YA 4MD4B 4P2QD 1A6TB 3L3IA 3RDTA 1WBZB 1NEZG 1GGYA 3FT2A 5DRXA 4E5XB 1BVZA 2VABA 2ARJQ 3BXNA 2GITA 3WJLA 2MQCA 4RISH 2V17H 3NTCH 4UAOB 1FIGL 3RKDC 3TT1H 3GMPB 5DFTA 5KOVC 2FBJL 1Z6JT 1QBAA 3TYFA 3LZFH 3L7EA 1QBBA 4JB9H 3DETD 3C2AL 4MCZA 4MS8C 1NKRA 2KZWA 1U58B 4YE4H 1I9RL 2QR0A 1YQVL 3G9AB 4JN1H 4JGUA 2NZIA 5EU6D 2BNQD 5FM5M 3H9SB 1U42A 1C16A 2H1PH 3RI5K 3ZL4H 2VZOA 5E5MA 5KG9A 2P5WE 4JGMA 4B7LA 2Y06L 1T0NB 5FO8A 3FT3A 3O3BB 1M6OA 2HJLA 5DQ9B 4LHJB 3UJJH 2H9GA 2F5AH 4HK0A 5C0BA 1QNZL 5ID1B 1P5UA 4L8BA 4EUPB 3L1OH 1D5BA 4RZCA 5HPMB 1BQHA 3RUGA 1Y18A 2DLHA 3ULSA 4Z7OE 3VE0B 3DETC 4XVSH 2GKIA 3WJJC 3ZHDA 35C8H 2F54D 4FZEL 3QEQB 3OSKA 3QEUB 1KELH 2E3VA 4TQEL 5FCUH 3SDCB 2EDHA 5EBWB 3T77B 5FECA 2YUWA 3B6SB 1B6UA 1TVHB 4HPOL 4MD0A 4U1IA 3CXDH 3BSZL 3KPRA 3ROLA 2DICA 1Q9WA 1R3IH 3FRUB 3U79A 5IF0A 5DUPH 4BELD 3NFSL 1J1XH 5E7BA 4ZXBC 5I75C 5BVJB 2DLEA 1NMCC 3CDGA 1HILB 3P77A 1CDCA 4RMUA 1A1MA 5ICXA 5C3TA 5KW9H 2JJTC 3QUXD 2IBBA 1A02N 1RFDL 2OI9C 1UVQA 1RULH 1HHKA 4RDQF 4HLZG 4ERSH 4FP8L 1ITBB 1CK0H 3MUHL 1H3WM 4U6YB 4HZLB 3PWLA 1QR4A 2FJFB 3BKYL 2HFGL 2CKBA 4GBXA 4RMSA 2BK8A 4POZD 1NDGB 4AM0A 1NFIB 1XAUA 2C1PB 4NDMA 1D9KA 3KPMB 1I7TB 3PJSA 5E6ZA 2IQAA 3LKNA 2IFFL 5BS0B 4LK4A 3I75A 4Y5VB 4PJCF 4ETYA 5CBAB 3MGTB 4ONFH 1NCAH 5DUML 3PWJB 4LARH 5SWQB 3H2WA 1S3KH 1C12A 1B88A 2BXYA 5F9JB 4WWKB 5C6TL 1S7RA 1JN6A 3QUXC 1AHWC 4OJFL 5ILTH 5JW5B 1CXLA 1MCIA 2P5WB 3R06A 2VAJA 1MWAB 4MNGA 5JOFA 1BQLH 5KSAD 1JYXA 5CIPH 1XGRA 3TA3A 2AW2A 3B9KA 5EO0A 4KQ4L 3GIZH 1LO2L 5C0EB 2L7JA 4HIJB 4POZC 4P2RE 1Q94A 1F4WL 4UUJA 3C6LA 1KJVA 4JDVA 4P4KB 2C3VB 4OD3H 1P2CA 4MVBD 1HH6A 1OLZA 4KUCD 1T1YA 1PQZB 4KVNL 3V6FB 1HHGA 4HEPG 3SO3C 5HYQB 4OGAD 4HF5L 4MJ5A 1EAPA 2VQ1B 2DWDA 5FA3A 1ORSA 4EBQL 1A6ZB 4EI6B 1KB5A 4OLYL 4PS4L 5BZWA 3MLTA 4HIXL 4ZFOL 1YEGL 5I1KL 2DL9A 5CD3A 2LU7A 3X14B 5KSAC 1S5IH 1Q8MA 2DQJL 2NY5L 4TYUA 3QPXH 4JKPL 1ORQB 1H5BA 1A2YA 3MXWH 1OAUH 3DNKA 1UEMA 4U0QB 1CVSC 1I8KB 4HH8A 2JJUA 1ZMYA 2D03H 4MVBC 1KLUA 5C0RL 4MNQD 4OZGA 4HBQA 3G5VA 3SGJA 1U8MB 4XNMA 1MCJA 2RQ8A 3MGOB 3ES6B 1NFDB 4OLVH 1B90A 4OGAC 4XAKD 3RVWD 5E95B 2J3SA 4X9GA 5I15L 1JFQL 5L8LB 3MCKB 3VD9A 4YPJA 1FL3B 2YSSA 3RBGA 4DUXA 1I8LC 5HGBB 4PJ5A 5SWZB 3U46A 1EGJH 3QHFL 5DQJA 3E8UH 4XNQA 3U2SB 5C3LD 3QULA 2HMID 3A6CL 1JV5A 2PNDA 3BUTA 1JMZA 4HIEA 3MA7A 2PR4H 1IGFH 4ONGH 3GBLA 4W6YB 2WINA 4WW2C 5TDNB 1QFWI 1YQ2A 3MRGA 3P0VH 4M3KB 1S9XA 1T7ZA 3GMMB 3VFSA 2FRGP 3DTXA 4GRLA 5TE6H 3C8HA 4WTZA 4NC0B 5IROC 5MEND 3UZVB 1NCDH 4ZUVB 3ZE0F 1NUGA 4P49A 2UWEE 2QQQA 3RVWC 4YFLI 1FYHB 2AEQH 5HHVH 3EO1A 2MKWA 4UNVA 5L9DH 2WZPD 1RVFL 3THML 2W60A 1OVZA 3D18A 3U6RA 3PNWA 1DEEA 2QL1A 1K8IB 1IC7L 1QPPA 2HMIC 1TZHB 5FYLE 4LCWA 2I60L 4NN5B 5F88B 2DQGL 1LEIA 1DQDH 5M7QA 5I16A 3UAJD 1HI6B 3O3DB 2X4RA 5I9QB 1VADA 5T1LD 4PJXF 5EA0L 3WLBB 2Z4QA 5IB5A 1RUAH 3AY4C 4XNZC 4YGAB 4PJ8A 3FB6A 1P7KA 1NMAL 2BOCB 5B8CA 4Q58C 1XGUB 1PJ9A 3T4YB 5CEZL 3MX0A 1NGWA 4Q74A 3LHPH 5CWSB 5D93C 1F5WA 5E8DH 3QNZA 1DBBL 5D5ME 1T5WB 5L2JB 3L6FB 4PB0L 4GUPA 3IJSA 4FXGB 5HGAB 4MJ4A 1AGCB 3TZVB 2W0LA 3V0WL 4U6XB 1H0DB 5CJQL 3TH4T 1DLFH 4Z95L 3UAJC 1PGRB 1OT1A 3JV4B 1RZGB 1QHPA 3D69A 1BM3L 4QCIB 2EE6A 3D3VE 3V5HA 1OWRM 4KDVA 4PJBB 2WIIB 1TJGH 5F6IC 2E7HA 1ED3A 3KPNB 2A2QT 1KT2B 2IADB 2FBJH 2FBOJ 5ISZD 2M26A 2CPCA 3ZKMD 3KLAB 3C2AH 4C56E 1MAML 4YAQB 4YBQD 1B0GA 1O5DT 4YHMH 2VLKA 1IKNA 1JTTA 1I9RH 1YQVH 3QHTC 5C09D 5JPNA 2APXA 5F7DA 3RZCD 1F6FB 4YJZL 1K9TA 3W0WB 1RK0B 1ZVSB 5DJYA 5C6PB 2OS7A 2ICEA 1HSBA 1UFUA 3IDXL 4Y5YC 2A6IA 2DYPA 3L5IA 2Y06H 3UTSA 4QRPD 5GS3A 5IVZB 4N8VA 5E00A 5F8QC 1EERB 1IQWL 1QNZH 1H3GA 1XZ0A 4R0LC 1N6UA 1MRDH 1MVUB 2PW1B 4UT9H 4ZNEA 2XV6B 3ZKMC 4F2MB 1FNSH 1FH5H 2WBWB 2E7LA 1NKOA 5FO7A 4YBQC 5JXAL 4FZEH 4LCUA 1LWRA 4TQEH 2J4WL 4OLZH 4OLUL 3WIIH 4YHPA 4H0IA 4HPOH 1MFAH 2FHCA 3BSZH 1F00I 2JK5A 3U48A 1Q0XL 2VISA 1QEWA 2V5TA 3NFSH 2P5ED 1LP9B 5D5MB 3T0VA 2XZZA 3KPOA 5DS8B 4LMQI 3DURB 5SX4H 1GC1H 1AJ7L 4PRPD 3VCLA 4RGNE 5IW6A 5HHPB 3O6KL 4WI5A 5DFWH 5HYSA 3LPGA 1IE5A 3DRQA 1RFDH 2VLJD 2E9WA 2IGFH 3P30L 5EBLA 1KNOA 4NO2A 1Q9LA 2FLRT 3HPJB 1XF1A 5GJTH 3RX5A 4OBRA 4P5KA 5L2KB 4L1HA 4L8DB 3E1F1 3U30C 3RI5F 1GZQB 3TH3T 3BKYH 2HFGH 2R4RH 1U93A 4HSQA 4M1CD 2YPKA 1VENA 5HTSA 1ZVHA 5C0CE 3CDFA 3ZZ1A 1TZGL 2P8PB 5HHQA 1LDSA 1HQRB 5DUMH 3VRLE 4K8RD 5DHVB 4JFFE 2NY3B 5EIVA 1CR9L 4JFHE 4L8CB 4XC1L 2BVQA 4HQQL 4M6OL 4LLVB 1R24A 5CSZA 5DK2A 3JVGA 3TO2A 3V8OA 2YD7A 2P7TB 2WUCL 4OJFH 4H8WH 2F53D 2RIKA 3RUGF 1Y6KR 4M7KL 4UV7L 1U8IA 3WYRA 1K85A 1RURL 4P23D 4HGWA 2DL2A 4KQ4H 3WIFB 4N9GB 4G8GE 4P46A 1LO2H 4AENA 4M1CC 1S9VB 3H7BB 4PV8B 1F4WH 5F3HB 2DD8H 2VITA 2VR9A 2VXTH 4WFHE 5I66A 2ADIB 3B5HA 1MI5D 1MHCA 5ITBL 5E9DA 2OL3A 5IOPB 3VXPB 2VYRE 4U1NA 3ZSTA 3ARDC 1WLHA 3CPLB 4KVNH 4X4YA 4LVOC 3F7YA 4JFED 3MRRB 4TVPD 4HF5H 3MRHA 1Z3GL 3BEWB 3G5YB 1XGQB 4XI5D 4Y5XC 3HAEB 3GIVB 3L95A 1ZLVH 4QHUB 4OLYH 5FUOL 4B53A 4HIXH 3P73A 1YEGH 1OGAB 2GJ6B 1B0RA 3RNQA 3CDYA 3CUPB 4HKXB 1SJEA 3QIWD 4P23C 2DQJH 2VLLA 5F70A 4LRIA 5FYKL 3HG1A 2AJUH 4JKPH 1WAAA 3PGCB 1C08A 3VFNB 5T5NG 4MA8L 4WW1A 4ELMF 3BW9B 4J8RA 5C2UB 5BRZA 3NIDF 4K3DL 4L4VE 2X6MA 5DD0L 2Y1VA 4MJIE 2JE8A 5C0RH 4PJ9B 2HVKA 1UH2A 4QLRA 4G3YH 4S11A 2YKLL 3QWOB 4QHMA 4P2QE 4QOKB 1W0WB 1BD2B 4WO4A 5I15H 1JFQH 2BNUB 1A7RL 4XI5C 4B5EA 4JDZA 2V6HA 4OI9A 4JDTL 2W9EL 5C0CB 2DKSA 2O5YL 1NC4A 1JZ3A 4O5LH 5E6IB 5FB8A 3IXTA 5I8KL 3U0PB 3GMNB 3QIWC 4OZFG 4JFFB 1UYWL 4HJGA 4AIZA 3QQ3B 4HC1L 2MTPA 4L4JA 3PQYD 3U4EA 5IV2B 3AM8A 4I2XE 4OKVB 2X70A 2EECA 3NH7L 4E41A 2P43B 2BNQE 3SDAB 5HYJB 1LEGA 1KV3A 2X1QA 5E8OB 4CMHB 3AU1A 3T0XA 5HDBE 4KC3B 3THMH 3ULVF 1T03L 5E2TL 1MAKA 3TJEL 4RGMB 4Y1AA 1QRND 5H94A 4XVTL 4XH2B 3MGAA 1G7PB 4FQXD 1MJJA 1NBZB 1IC7H 3LDBC 2FECI 4DZ8A 5CZVL 2I60H 5BW7A 4GG6E 2ZKHL 4LPVA 1TVBA 1VACA 5J6GA 4IIQC 2YD6A 2F54E 5EA0H 4C4KO 4HKJA 4HUVA 1OCWH 4ISVA 2DI8A 2YHGA 2MWCA 3KS0H 1A9BA 1EO5A 5DJ0B 1U95B 3MRKA 1FNGA 3CD4A 1XF3B 1TJHL 4OZGF 4LFHD 3QIBC 4ZPVB 3MFFA 3DXAA 3WE6B 1DBBH 2CDFB 3OKEA 3BKCL 2EH8L 1MNUH 3FJTA 3HI1B 1T4KB 4PB0H 5E1AA 1ZLVK 1EXUB 3ESUF 2ZJSH 3LSOB 4FQXC 1MJUL 3SQOL 6CGTA 1CFNA 2FWOA 3V0WH 1DDHB 2DIAA 1RUKL 4OFKA 1VKXA 5K9KA 4WFED 1CGTA 5K9JL 1S7UB 4X6EA 3NZ8B 1MOEA 2D2OA 1BM3H 5CSBA 1QSEB 4FQIL 2ICWA 4KHXL 3ZYOA 2C3GA 3RKPA 2XT1B 2EH7L 1GH7A 5D1QA 2JCCB 2BY2A 4M61B 2IH3B 1I1RA 2YR3A 1MAMH 3FQRB 4K23L 3FQXB 1ZT1B 1MAJA 4JR9L 5F7FA 1PZ5B 4ZO9A 3HLAA 4RWYH 5E5UB 4XXDA 1X5FA 1QO3B 2LV4A 1I1FB 5EU6B 3OGCA 3ZDZE 3NIFE 3WSQL 4PTUA 2MCG1 3IDXH 2X89A 2FX8L 4XCEA 4DVRL 4ZXBB 5I75B 5MEOB 2XTJD 1NMCB 5C0JA 3UPRA 4LHUB 2HJKA 2CRZA 1DQLL 2Z8WC 3SCMA 2VIRB 3EYOA 4JRYD 4NQSA 1IQWH 1G7HA 3X3GL 4NN7C 3FB8A 3SDXF 5JDSB 3DX7B 3CIQA 4I18C 3QO0A 4B0MM 1MHEB 2Y72A 1FJ1A 1H3XA 1IAKA 5EZIL 3Q6GH 5CBEB 1RZJC 2EO1A 2F54B 3QBTB 5JXAH 4JO4L 2IAMD 4EVNA 4O51B 2HRPH 5ID0A 2NY0D 4UILL 4OLUH 2Q3ZA 3WNMA 3B3IA 5AD0B 1OGTA 3NN8B 1GOFA 1KCRH 4YX2L 1HSAB 3CFKA 3QDMA 4G80A 3PXHA 2ERJC 5ITFB 1NANH 4M9PA 4JZNA 2BNRA 2XTJC 5GRZA 4PGJA 3CAFA 5A3ID 1AJ7H 4OKDA 1CYGA 5ACZB 1S9YA 1M7XA 4X9BA 3QB7C 3K1DA 5IMLB 3QUXB 1AHWB 1JGUL 4JFYA 2DQDL 3HB3D 3P30H 1GRWA 3NCBB 4Z9KB 4MNQE 1J8HE 3RNKA 3A0OA 2IAMC 4IEFB 5DJZA 2NY0C 4O9HL 5GSVB 5DI8B 2PO6A 4XPTL 3MOQA 4FOMA 4QRTB 3QUMB 2Z31A 4FFZL 4G8IB 4GG8B 2DMCA 2NLJA 3MRDA 4CU7A 3DO7B 4OV5A 5JW4R 1NH6A 1U8QB 3VXMD 3PDOA 1QACA 5F6HI 5HSFA 1TNNA 4CDHA 5LAXA 4XHJD 2FNBA 3RDTD 5A3IC 5JTWA 3LQAL 3SE3A 2EYSB 5FUZH 1CR9H 1EVTC 3SO3B 1IEBB 1OB1A 4XC1H 4F58L 4HQQH 4M6OH 5TF1L 2F5BL 1JWUA 3HB3C 1RJLA 2WUCH 4NNPL 2YUVA 2H8PB 4GSDL 1U3HC 2XWTB 2AXJA 2QQNL 3IDJB 2XKSA 3LKSB 4M7KH 5MENE 4U1SA 5KSAB 3WHE1 3GMLA 1AR2A 4NCDA 1S8DB 4LLYA 1C5DB 5KSBE 3SOBH 1HIMH 4ZUTB 1ZA3A 3ARXA 3DV4A 4NRXA 1MCSA 3V5KA 4EJ1C 3Q0HA 5ITBH 5B39A 1I85C 1CICC 2OK0H 3U4BL 4XHJC 2IFGA 5JW3L 1FHGA 1N2RA 5HHOA 2W65B 4AZ8A 1OSZA 1SEBA 1WWAX 4YXHL 1MJ7H 1Z3GH 2WLYA 1DLHB 1BZQK 1GGCH 2LU3A 4LQFL 1KJMA 3OAZH 2VXSL 4TUOB 4DAGL 1DL7L 3KPQB 2ICCA 4HCRL 1N26A 5I1LA 1G6VK 1LVEA 3P9MA 4Z5RA 4WW2B 3LPWA 4QRRA 3RWGA 5D7IE 5GRJL 3D25B 1AGFB 4KZDL 4MNQB 3KPRD 1U36A 2FD6H 5C0DB 3EYVB 1H8SA 1V3KA 3BPCB 3FL7A 2FATH 3WO4C 2YKLH 3DX6A 1GJIA 3W5NA 5D70L 3MJ9L 1A7RH 2XY2A 2BVOB 2W9EH 4HIIA 2DS4A 1J0KA 2O5YH 4MAYA 1RQ5A 2VLRA 4EDWL 5T1KB 2D7MA 5I8KH 3O4OC 2BCKB 1UYWH 4MD5B 3FKUS 1UZ8B 5ISZE 4HC1H 4GAGL 1S7TA 2VC2L 5DJXB 5GGSY 3M8OL 4PGCA 5C09E 4XNZB 5KAQF 1JUFB 4F3FA 4HUUB 5CJBA 5DMGD 2NY1D 5MENB 1NANI 1RZIB 4H1LA 4XHQA 4F7MA 3KWWB 3S9DB 3DARA 4JPIA 2IJ0C 4WUUE 5D93B 2EIZA 4DK6A 1QP1A 4ZSOB 3S6CA 2COQA 3AFLA 1T03H 3MLZL 1X5JA 4QRPE 2N1KA 1TDQA 4XPGL 3CC5A 4XVTH 2RB8A 3EO9L 2CD0A 5DZOA 5IJKA 3QFJD 3W39B 5CZVH 4ZTOL 3LS5L 4Y89A 2ZKHH 2DQHL 4RNRB 3DV6B 5DLML 1FO0L 4KJWC 4UTAH 4NKIH 5T1LB 1JWMB 3B9KD 4JAMA 1Y0LB 4Q2ZA 4FABH 2EYRA 1WAAF 3LKRB 5I1CL 1AI1L 3HMXH 1XF2B 4UOW0 5DMGC 3ZO0A 5F6IB 1F2XK 3F5WB 3FAWA 3OAUL 5CZKA 3JTSB 1A3RL 1TJHH 2BVYA 1J05A 4BH7A 5J6HB 4J3VA 5GRUL 3ZTJG 1ZVYA 3BKCH 2EH8H 1NGYA 3RVTC 2C7UA 3TN0D 3MSPA 1E4JA 4KK5D 3ZTNL 3OR6A 1PLGL 4PRPE 3OAZK 1MJUH 1B3JA 2ICES 4JFZL 4N0FA 4XAWL 2CDEA 3SQOH 5JHDD 1BAFL 4RQQB 1WEJL 3GJEB 4NQDE 5AEAA 1RUKH 3OJMB 2VLJE 2AERT 2K7PA 1EAJA 3B2UC 5CGTA 4BQBA 5GHWL 5K9JH 2BHZA 1D5MA 1YJDL 2NY7L 4FQIH 1NAKL 1BIIB 1RI8A 4KHXH 3X12A 1KJ2A 3MBED 1MRFL 4HK3J 3EFDL 1BF8A 2EH7H 3S5LA 3HNVL 3V5DA 4JPKL 4R0LB 3VFVB 1A6WL 2HN7A 3VWKA 2Z91B 5GS0L 4NO0B 4DFHA 5KSUB 2VDPL 5IFJB 3FTGB 3TN0C 1V5JA 4JQXC 1R5WB 3LKPB 5D2NA 4KK5C 3BHBA 1FSKC 1T20B 1CXFA 1E4WH 1FYTD 3D87B 1BBJB 1G9ML 5I17B 4IDLA 2R2HA 2BVPB 1YMMD 1SEQH 2XPGA 2FX7L 3IFOA 2F53E 5DYOB 1N64L 2F19H 4QNPE 1LQSR 1JZ5A 3V6ZB 5FGRA 4D0DA 3SGKA 1DQLH 3GJFB 3MBEC 2ADJA 3CXHJ 3X3GH 5E99H 4OLWL 5EUOB 3ROOB 5HHXL 4O00A 3MRFA 4YDVA 1F6AB 4GRLD 3FOMA 2NY4D 5EZIH 3BD3A 2C4FT 4NYLB 1MI5E 4PJCE 5FA4A 2RFXA 3SE4A 1HH9B 4LLUA 2D9CA 3ORJA 2FH8A 4JFEE 4QRSB 4X6CB 4X6FA 4XVUD 4HKZA 3SN6N 4BSVB 2V7HA 3CSBA 2RCSL 3SGDH 1A9EB 1SBBA 1DBKH 4DKFH 2J8UA 1JZ7A 2F8OA 1OQXA 2P5EB 2R2EB 1MCKA 2HKFL 1Q9KA 3G5ZA 5IHUH 4W4NA 1M05A 4MXWL 1ZE3C 3LS4L 2MQ3A 3UMTA 1SJHA 3DGGB 1JGUH 2APWA 1RD6A 2BY0A 1OTUC 2NY4C 5IJVB 4MHHI 1CE6B 4H88L 2H32H 1ES0B 1ZGLB 3WHE0 5IIEA 1M71A 4YIQA 1KJ3L 3TGXA 4O9HH 3V7MA 3DX9B 5E8PB 2E8YA 3BKML 4M7LL 4XPTH 1YEKH 1DCLA 3SPVB 3TWCL 1WC7A 4O2CA 5IEKA 5DRZA 5AZEL 3QR2A 4MMZC 1E6JL 3AREB 2JJVA 2IPUK 3QCUH 3ARDB 4P2OD 5SWSB 1H3PL 4PD4K 3LQAH 5JXEA 4LVOB 1D5XA 2APTA 3IDUA 1I7UA 3K1KC 4F58H 2GSGB 2ZUVA 2HLFD 2NXYD 3V79C 5ICYB 4Y5XB 2EDKA 5F96L 1H3TA 4PV9B 3DMMA 4LQ1A 4NNPH 4LPTA 4NZTL 5BOPA 2QQNH 2PCPA 3Q48A 3QIUA 1QSZA 3MYJB 1EO7A 4G8EA 2R23B 5TDPA 3VXOA 4P23B 3F65A 2J12B 3FHAA 1WSST 2D4FA 3MRMA 3LQZA 1CBVL 4U3XA 1QRNE 2BFVL 1D5ZA 2XQBL 5HJ3A 3U83A 3C5SA 1JNHA 1T7VA 3U4BH 4P2OC 5JW3H 4OLXL 4M7LT 4AT6B 4YXHH 2QLVB 3B8YA 1F11B 4GKSA 5KS9E 4JFDA 1A6AB 3EDFA 3D48R 4PJ7A 2YN3A 1AGEB 2YS4A 4OIAA 3FB7A 5GRVL 3MRIB 4YUEH 3P4NB 4LQFH 1L0YA 1AGDA 1INDL 4DAGH 4K3JL 4GW1B 4LRNL 3DIFA 4HCRH 1AIFB 3QIWB 3ZE0E 5IR1A 1XH3B 4LLDB 1L0XA 4I3RL 4GH7B 2P8LB 1YYML 5H35A 3G6DL 1X3DA 4Z7UA 4ZNCD 1KB9J 5ANME 3VH8B 4WI9A 5GRJH 1FC1A 4FA8A 3OKKB 3MV9A 3EOBB 1NPUA 4EDXB 5C0ND 1CGVA 4BSWA 3HC3L 5FO9B 5F1IB 3RX8A 1MQ8A 1M7DA 3U7YL 4WFEE 1BLNB 3FQUB 5D70H 1ACZA 3MJ9H 1FAIH 4L4TA 5EN2B 4UT6L 1F3JA 4MX7B 2JLLA 4PJXE 2EO9A 2IANA 3S96A 3BESR 1ZV5A 2R8SL 3LDBB 2AEWA 4EDWH 4I48A 1EBAA 1QBLL 2XZQL 4LHQB 4XZUB 3QZWA 4Y19D 5CFHA 1MQKL 4M43L 2KZ1B 2X4NB 4TTGA 4IIQB 3PQYB 4GAGH 3RA7L 2GJJA 1VEPA 2EE2A 1DQJB 2G60L 2VC2H 1YNLH 3M8OH 5BJTB 2YK1L 1WFOA 5C0NC 1UKQA 2H3NB 4JFPA 1EZVX 5GZND 2IC2A 3TYGL 3QIBB 1CQKA 4PRNB 3TBSA 4X9HA 2P47B 1XIWC 2A6KA 4OCXL 4QF1A 2XTJE 1QRNB 2WUBL 4GKOA 3RWFB 5JR1L 1FNFA 4Z8FH 3MJ7B 4JRYE 1AE6L 2MHAB 1U91B 3V0AC 2FLBT 2GUOA 2YD2A 3GSVB 4ZTOH 3FFCA 3LS5H 1BREA 2DTML 3MROA 4MD4A 1A6TA 2DQHH 1WBZA 1FO0H 2ZNXA 1S78D 5KS9B 2KDGA 1NCBL 4B7IA 4MDJB 4E5XA 4MB3A 4P46D 4LP4A 2A9ML 4U0RC 1OM3L 5I1CH 3HNSL 3BZDA 3EZJB 1PY9A 3LRGA 3OV6A 5GZNC 3GMPA 3OAUH 2K3TA 1A3RH 5BQ7B 3QDGD 5GRUH 1DP0A 4NP4L 1IC1A 5IBUG 1U58A 2VXVL 4YHZH 4XBPB 4ZQKB 3ZTNH 1PLGH 1G7MB 1BAFH 4JY5H 1WEJH 2B1AL 4HWBA 1UQSB 1T1ZB 1S78C 2NW3B 2VSDA 4WI3A 1T0NA 5GHWH 3O3BA 4RFOL 2P8MB 1YJDH 2Z93B 2XIDA 3QQNA 1U2HA 5DQ9A 1NAKH 3E3QE 2YD3A 5FCSH 5ID1A 1MRFH 4NN7B 3EFDH 4I18B 4EUPA 5BRZD 5HPMA 4JPKH 2AJYH 2AQ3A 4ORGB 3RWHB 1A6WH 3VE0A 4Y4HD 5M95B 5GS0H 2EDTA 4LL9A 2VDPH 1FVCB 3QEQA 5F7HA 3QEUA 5EOTB 2E9IA 4H5SB 3U4AA 3SDCA 4WO4D 3T77A 5EBWA 3B6SA 1TVHA 4UNTA 3KYMB 2FH6A 4EN3D 3FRUA 3UJIL 5GS1C 1YY8B 1G9MH 1NL0L 3L3DB 3J8F7 2YEZB 2FX7H 1N64H 1O0VA 5BVJA 5B4MD 4UINL 5KN5B 2XTJB 1HILA 3FQNB 4DGYL 1S9KC 3PP3H 3WUWG 2IF7A 4OLWH 2BRQA 2CIIB 5F1KC 5HHXH 3BQUD 4X7SL 4Y4HC 3MZGB 3KLDA 2YRZA 5I6XC 4OV6F 5I2IB 5F72S 1U8LB 5CLTA 4U6YA 4GLRH 1VA9A 4HZLA 4X98B 2FJFA 2IAMB 4JRXD 2NY0B 4WO4C 1IM3B 3PXJA 2C3HA 1NDGA 2BP3A 2FIKB 3IJYB 4EN3C 2C1PA 4G6KL 2RCSH 4Z7QF 2A6DB 3GZKA 3KPMA 1I7TA 4X7EC 5C0BE 4N8PA 5BS0A 4Y5VA 4PYGA 5CBAA 5B4MC 3MGTA 3DI3B 1R6VA 2BOBB 2OX5A 2ADGA 4UZGA 3EOYG 5SWQA 3GHEH 2HKFH 3V4VL 5F9JA 3MMEB 3IDGB 4WWKA 3GHBH 4U1JB 5DFVD 1G7LB 1ZHLB 2Q76B 4Y4KD 4MXWH 4D2NA 1LE5B 4I0CC 3BQUC 4R8WL 4WGWB 4H8WC 5JW5A 2P5WA 3BIBX 2MCPL 4ENED 5FYJL 1MWAA 3KPRE 1U3HB 2X10A 5L6YL 4J3UA 1DVFA 5JOEA 2VZ1A 4C83B 2OQJB 1KJ3H 3DXAD 5C0EA 4M5ZL 4HIJA 4M7LH 4TUJB 1W72B 3TWCH 1N8ZB 4P4KA 2C3VA 1KXTB 2AV1B 3PG2A 5AZEH 2X09A 1E6JH 4ZFFB 3VXMB 2N56A 2XWJB 1G1YA 1PQZA 1CICB 4MQXD 3V6FA 1H3PH 5HYQA 3JZ7A 3UBXI 4Y4KC 2VQ1A 4JFXB 1H8NA 1A6ZA 4EI6A 4ELME 2OR9L 1JPGB 4S1QL 5A16B 5EU7E 3NIDE 2NYYD 3GBNL 4KRMB 1X5HA 2KQNA 5D1QD 5FUCC 4CVXA 3P9LB 4HXBH 3S3JA 1NAMB 3NACL 2M2DA 5AG8A 1JPFB 1MCOL 1SJVA 1PYWB 5I8CB 2P46B 1ORQA 1U8PB 3CJJA 3K46A 1I8KA 2FEEL 3EDEA 1WCQA 2BFVH 2XQYG 2XQBH 4N1HB 2NTFB 1U8MA 4X5WB 3I6LE 4OM0L 3ULUF 4MQXC 3ES6A 1NFDA 3WO4B 4NIKB 4OLXH 4NOBA 4ZD3L 2V9QA 3D0LB 3MCKA 1TTGA 3BPLC 5C9JB 1FL3A 3HZYB 3PP3K 4GMTH 4MNGE 5HGBA 5SWZA 2C1OB 3FN9A 1GXEA 1TTFA 3REWB 5ACLA 2NYYC 2Z0BA 3U2SA 4LAJH 3VGDA 1IAIL 4K3JH 1RZFH 4LRNH 1FE8H 4NQED 4HUWB 1FFNB 3RVUD 3EOAB 4BUGA 4OFVA 3BP5B 4XVJH 2Q3AA 4I3RH 5A2FA 5TDNA 2X42A 3IDYC 2Q7YB 1OW0A 3ULVE 3G6DH 4ZFZB 3QNYB 3GMMA 4A6YB 3IDNB 4M1DL 3S4SG 4P2CG 4TRPL 1RUPH 1MFDL 1BP3B 3I3EA 4HULB 4ZUVA 3KJ4C 1KIQA 1UM5L 4U49A 1UXWB 3MJ6A 5FGCE 4UDUB 1Z0MA 2OBGA 1Z2KA 4QXGH 4UT6H 4XBEL 5KOMC 1K8IA 4UV4L 5ESQB 5LXGH 2R8SH 1TZHA 1L9MA 1NCWL 4GLRI 5F88A 1QBLH 2XZQH 5ESVB 3RVUC 4IMKC 4XX1E 1HI6A 3O3DA 4OZGE 1MQKH 2ENSA 1H9VA 2DMKA 1EDQA 2DBLL 3WLBA 4GRWH 5HI3C 3RA7H 3TBWB 3P4MB 2G60H 2G2RB 2UYLB 5GRWA 4JJHA 4OBSA 2Z31D 2BOCA 4N0UE 5C1MB 1AQDB 4JFOB 1XGUA 3T4YA 1G6RL 1FYTE 5CWSA 4D94A 4UU9B 3TYGH 2GW5A 1OQOA 1WV7T 5FF6B 1YMME 1FFOB 4ZOEA 1T5WA 1ACYL 5L2JA 3L6FA 3F7VB 1F90L 2WUBH 4FXGA 5HGAA 5JR1H 5DTFB 4FQHB 4PJ7F 1AGCA 1AE6H 4CN4A 3QFJB 4U6XA 1H0DA 2DBJA 2YPVH 2DTMH 2GJZB 2H45A 1EFQA 2LVCA 5DXWA 3JV4A 3PWUB 1RZGA 4QCIA 1WBXB 1IARB 1UENA 2W0FB 4RX4D 1EUUA 2A9MH 2ZUUA 4PJBA 4RFNC 2WIIA 1OM3H 5J4MA 1MHHB 3GKZA 3HNSH 4J3SA 1PBYA 3QXWA 4Z7UF 5FKPB 3P4OB 4LSUH 1RPQA 1KT2A 2IADA 1CQYA 3CNKA 1YEIL 5JZ7C 4YAQA 4NP4H 4NZRL 4QTIL 3TN0B 4NKQB 1IGYB 4GXVL 3FQTB 2VXVH 8FABA 3GKWL 1FSKB 3ECBA 5J0BA 1QQDB 3SDXE 5JHDB 3MQIA 3W0WA 1ZVSA 2XA3A 1MRCL 4HDIB 3QWRA 4F7TB 2PXYC 3QAZC 4RFOH 1DBAH 2IG2H 3PIQB 5I1GL 2IH1B 4HKBB 3SKMB 3R0MA 1IGIH 3MBEB 2ARJB 4H25B 1NGXA 4HLZH 5KVFL 4V1DD 1MVUA 2CK0L 1LD9B 2PW1A 4CL7A 3QUKA 4DCQB 2XXMB 4F2MA 3D39D 4DW2H 3GI9H 3BYYA 5CINL 2V2WB 5E56A 3MV7D 5IVOA 1FV1B 4CDGC 4N0UB 5A2JH 3IFLH 4F7EB 5TDOB 3PL6A 3EJZD 3SKNA 4Q7DA 1E4XI 4Z76B 1NL0H 2PYED 2F74B 4NQUA 1YMMB 4XPHH 1LP9A 3QXAB 5D5MA 1T1WB 5DS8A 2LTQC 1J12A 1KTRL 3P3YA 1ND0B 4UINH 5BXFB 5FAAA 3DURA 3MLYL 3EUUA 5J9PA 1F6LL 4RMQA 5HHPA 2DI9A 3WIHL 4FQPA 2X05A 4JY6B 4X7SH 1G9EA 3GSWB 4RGOL 4FZ8L 2NY4B 2I9TB 3R1GH 3WHXB 3HPJA 2E6QA 5I76B 3TCXA 5M94B 4L8DA 1CFSB 4NC1C 4KVCL 1GZQA 1RIHL 3GUTA 2CXGA 1XGTB 1AKJB 5HYEA 3VGAC 5C0AD 4HGKC 1FG9C 3MOAL 5DVNA 2X4OB 1IZKA 1AXIB 1DSFL 4G6KH 2NMSA 5ACMA 3MPCA 1GHFL 5HI4C 1U3YA 3ZDXF 2LU4A 3QUZD 4LVEA 1BFSA 5J12C 2P8PA 4ZNEE 3MCLL 1HQRA 5E2VL 5FGSA 5F3BB 3V4VH 1CF8L 5DHVA 3SDDD 3KYNB 4LPYA 1M7IB 3EGSB 4LLVA 4Q6IC 3SDXB 2CRIA 1GAFL 2UZIH 1A6UL 4R8WH 2P7TA 1UCTA 4GRMB 5DMKB 1TQBB 3LN5B 1CIUA 5D7SL 1L9NA 5GXBB 5FYJH 1BBDL 5L6YH 4U1LB 4PR5B 3H9YA 3DGCR 4GAFB 3FO2B 3WIFA 4N9GA 5DEZA 1J11A 3IS0X 4YXKL 4M5ZH 1S9VA 3H7BA 4PV8A 3HS0B 3BH8B 3O81A 4F8QA 5F3HA 5HYIA 1T80A 2KH2B 4JEGB 2ADIA 3QUZC 3L3JB 5IOPA 1SVCP 5EH1A 2R2CA 3VXPA 4OZ4B 3DVNB 3CPLA 4P2OB 3SDDC 3MRRA 3BEWA 3G5YA 3IVKB 1MFEL 1XGQA 1OL0A 3HAEA 4OCRL 3GIVA 2P44B 4QHUA 2OR9H 5TH2B 3GBNH 4CJ0A 1OGAA 2EDOA 2GJ6A 4HUKB 3OKLA 4OZHF 3CUPA 2BSED 4HKXA 3V6OC 3VWKD 3CVHL 5TJWK 4LU5L 3PGCA 3WCYA 1ZEAL 3H6JA 5HHNB 3BW9A 4OAWB 3GO1L 2OR8A 5GRYA 2W9DL 4HXAL 1CZ8L 1K8DB 4PJ9A 1MCLA 2WP3T 1PX3A 4RDQG 4OM0H 2VZSA 3QWOA 2XOTA 3KXFB 4QOKA 3UDWC 1W0WA 1IL1B 4ZD3H 1BD2A 2BNUA 3NCJL 1JGDA 5C0CA 3IJHB 4BFBD 1U9KA 5E6IA 4OZIE 1KOAA 4YDLC 3U0PA 3GMNA 4GW5B 4JFFA 2CR3A 1FLTX 4P0DA 1YECL 3MRJB 2K7QA 2H2PD 4J7RA 5E9DE 4JO1H 1S5HB 2VLME 3U1SH 5IV2A 1LDPL 4OKVA 1GGIL 4OIIH 1QYGH 4M1DH 4TRPH 1XGPB 4WU7B 1C1EL 3SDAA 1I9IL 3EJJX 5HYJA 1MFDH 1TETH 3OKNB 3PHSA 1SBSH 3WEXB 1UM5H 5E8OA 2V5SA 5CJOL 1VCAA 5F21B 2DWEB 4HUXA 1XIWB 2W1NA 4P3CL 4LASL 4XH2A 4XBEH 4NWUL 3GK8L 1G7PA 1WAAE 1NBZA 3O3EB 4HLJA 4HWZB 2O93L 2J6EL 1LE9B 1HINL 1IMHC 1NCWH 2FCBA 5BRZE 4FTVD 4IM8A 4Y19B 3UTTD 4R7DB 5J1AB 4X0KB 1DZBA 2UUDH 1B4JL 1BIHA 5DVMA 4ZUWB 2R2BB 5C07B 2DBLH 5C08B 3OB0H 4OFYD 4U0RB 4XMLH 5DJ0A 5DR5H 1U95A 5ELIA 5IT2L 4DGIL 1G6RH 1XF3A 1QBML 4XNUL 4HAFA 4ZPVA 5TFSL 4YR6B 4KU1A 3WE6A 3CFDB 2CDFA 1NFDF 1V05A 1A4JB 3HI1A 1T4KA 4QRQB 5JXED 2EKSB 1F90H 4PFEA 3IGAA 2DAVA 4G42B 3LSOA 5F93C 4X4XB 2H2SD 5E2WL 1DDHA 3DMMD 7FABL 1S7UA 2JELL 3NZ8A 2Y5TB 4E41E 5CAYB 5I1EL 4TNWK 4FQQB 2X4TB 3O3UN 1JNLL 1TQCC 5DJCB 4OZIB 5JW4N 3RWDB 5IWLC 4Y1AE 4ALAL 2BRRL 2JCCA 1PDKA 1IJ9A 2XA8L 4M61A 2F58L 3H42L 3U9PL 2IH3A 1YEIH 3QDGB 1GIGH 3SJVD 3WJJA 3FQRA 2DQTL 1ZT1A 4Z77B 1PZ5A 2VRAA 4ZG1A 5EZLB 1HHIB 2XN9D 2DB8A 1QO3A 3GKWH 1I1FA 5EU6A 1OLLA 1BVKB 4I4WB 2H2SC 5GGRB 2BVUA 1WGOA 3L5JA 4TVSa 3U0WL 3VFMB 1MRCH 5GS1B 4KTDL 3O2VL 3TIDB 1YC8A 1FN4B 4ZXBA 4PBXA 5MEOA 3HNTL 4LHUA 3HE6B 1I8IB 2EKJA 3QDJB 2VIRA 3N9GL 1RSFA 3DXAE 5JDSA 3DX7A 1UGNA 1WIOA 1V7ML 2JJTA 5KVFH 1MHEA 2CK0H 5JUEL 1F4AA 3E2HC 5IQ7L 1R5VB 4WNQB 4Y4HB 5I6XB 1LEKB 3QXDB 5CBEA 2F54A 4PJEF 2HYMA 5CINH 4O51A 1VSCA 4S1DD 1CGYA 1RAMA 2L7UA 5AAMA 5AD0A 5ENWB 3NN8A 1F97A 4L4TD 5IW3A 3NCMA 1HSAA 4EN3B 1IAII 2IAND 5K93A 3U0TA 3VXTB 3QPQD 4YXLH 3KYOB 1D3CA 1RZ7L 4PJAF 2UUDK 4MQSB 3B2VL 4OGYL 5ACZA 2OM5A 3Q3GB 2MSPA 4HUNB 4MQ7B 1CDUA 5JIPA 3WIHH 5IMLA 3QUXA 1AHWA 3BQUB 4PJBF 4Q97A 4HWUA 1YNTB 3L3GB 5IHBA 1TZIB 3A67H 3MBXL 1YPZB 3SY0B 2D7PA 4JRXB 4S1DC 5GSVA 1QZ1A 1RIHH 2QSCL 5DI8A 1JK8B 4QRTA 3QUMA 1BQSA 4BM7A 1DSFH 4Q9BA 4G8IA 4GG8A 1GGTA 3Q1SH 1GHFH 3LB6C 5EOQL 1IT9L 2WLZA 1U8QA 3QT2A 3V2AR 2CUHA 2W38A 1A7OL 3P0YH 1R0AL 3LQAC 4CVUA 5E2VH 1CF8H 2EYSA 4NQEE 1IEBA 3GMQB 4Y4KB 1OAQL 4KY1L 3EHBD 5J1TC 4XPAL 3PGFH 5ALBL 1TIUA 1GAFH 2FJGB 2IPKB 1A6UH 3TPKA 1P9MC 2H8PA 4X7DC 4ZFOB 4LOUC 5GGTA 1XR9B 2XWTA 3IDJA 1BBDH 4OT1L 3LKSA 2B7DT 4QWWD 4I3SL 5KSAA 5A2IH 4EZMA 5JW4Q 2CDGB 4AK1A 4MHHG 1S8DA 4BQ9A 3QXTA 1C5DA 4YXKH 2BNRE 2UV3A 3QG6B 1C8PA 4HIHB 4ZUTA 5ICZB 1U8OB 5BZDB 1UJ3C 5LQBH 4W4OC 2F9BT 3GSOB 3H9SD 3BGMB 3S8WA 2A77L 4Z78B 1KULA 2W65A 1LP9F 4YBLC 4PRDB 43CAA 4OCYH 3M07A 5HI5D 2FSEA 3BPLB 1MFEH 1DLHA 3L9RB 1QRKA 3UP1A 5DJDB 5F9DC 3RGVD 4OF8A 4OCRH 4I77H 5B22A 4OZFH 2C3XA 4FFVD 2DQCL 4TUOA 1G9NL 1U92B 2XNAB 4QWWC 3KPQA 1EHLH 3JBG7 1DE4B 3CVHH 5JLZB 1HHHB 5CMAB 3T2PA 4LU5H 1I9EA 1P84K 3WO3B 3HR6A 4WW2A 2QV2A 4ZS7H 1ZEAH 3IDYB 3GO1H 1BVLB 2EC9U 3MLUL 1AGFA 2W9DH 1CFQB 4MNQA 4HXAH 4NUJB 4UTBH 5C0DA 3EYVA 3BPCA 4JVWA 5IROA 5CP7B 3EZ8A 3KJ4B 3EYSL 1FQ9C 4L1DA 2HP4A 4PJIB 4JQVC 5HI5C 2FO1A 1KIRB 4M8QB 2BVOA 3T4AB 3NCJH 3KLSA 3RGVC 3FT4B 1KB9K 4JVUA 4N8CH 5FOBB 3MLSL 3KVQA 4FFVC 4J6RH 4L3CA 3DX8B 3STZB 1ZLWH 5T1KA 5DJ6B 1JRHL 1QSFD 2AKRB 4NQEB 1ZWIB 1GOGA 2BCKA 4MD5A 5EBGA 1YECH 1UZ8A 1JPSL 4XWOD 3UTPE 1HHJB 3R4DA 5HHOE 1LO4L 1CG9B 4U3HA 1LDPH 1GGIH 4G6ML 2R56H 5DJXA 4BA8A 3AY4A 1JUFA 4MZ3A 3UX9B 3X3FL 5MENA 1C1EH 1RZIA 1I9IH 3KWWA 4OD1L 1JHTB 1BQHG 1LGVA 1NLBH 4WIQA 4RIRB 5CJOH 4ZSOA 2GSIB 1GZPB 1JVKA 3ABZA 4WWKD 1CFBA 4P3CH 3K81A 1OTSD 4MNHB 4JHZA 4NWUH 1J86A 1MELA 1I7ZB 3GK8H 1VFOA 2PUQT 3W39A 4AEEA 2J6EH 4QRRE 2YMXL 1HINH 4V1DE 1J9CT 1R3HB 4O02H 4RNRA 3DV6A 4WWID 1ZLUH 2X4SA 4G6FB 4XWOC 4YO0B 3E6FB 5T1LA 1JWMA 1Y0LA 3LKRA 3EW3B 3CLFL 1GGUA 5IT2H 1AP2B 3BDBA 3F5WA 4KFZC 4U7MA 3JTSA 5TF0A 4MDIB 1QBMH 4P9ML 2OP4L 5GS0D 5J6HA 5TFSH 2X4PB 4L9LC 2FX9L 5CKAA 1NJ9B 1HOCB 1BEYH 2J8OA 5LWYL 1OTSC 3QRFM 3BZEB 5FOJA 1YEJL 3UZQA 4Y8DC 4YH6A 1PX4A 4RQQA 4YDKL 3TPUB 4NKDB 2ZUQB 3GJEA 2LAAA 5E2WH 7FABH 5DDHB 5D1XD 3VW3L 4Y5YA 3DYPA 1YJDC 2YBRB 1S7SB 2PXYB 5I1EH 3VXUB 3QAZB 4N1EA 4TN9A 2J5LC 1BIIA 4G6JL 3PUCA 4IMLB 1JNLH 1NSNL 5C0AE 1CCZA 4OQTA 1YNKL 4JG0L 4U33A 4R0LA 1FZOB 4RBPH 1F13A 3EYQD 4LLWB 3VFVA 4POYA 1MCPL 2BRRH 2DLIA 5ISZA 5GS0C 2Z91A 5KSUA 2F58H 3H42H 4NO0A 4UDTB 3U9PH 3VI3F 4CN1A 1NBYB 4KXZH 4HV8B 2DQTH 2JB6B 5IFJA 3FTGA 3WKML 3LQMA 1R5WA 3LKPA 4NRZB 2I07B 1CIDA 5FYLL 3K0WA 4M7ZC 5SWZD 1T20A 1N6QL 3H7LA 1ZLWK 4YHOH 3O41B 1G9MC 4KTEL 1BBJA 5I17A 4XNYL 3U0WH 5D1XC 1HDMB 1KACB 2BVPA 3UROR 3VGFA 4KTDH 3I2CL 3O2VH 5DYOA 2LTQB 3HNTH 3V6ZA 4JGJA 4GAYA 1U8HB 3GJFA 5EZOH 3VI4F 3N9GH 1SY6L 5EUOA 3ROOA 3JWDH 4KMQA 4V1DB 3EYQC 1F6AA 5T1DL 3S98A 3WN5C 5JUEH 5IQ7H 3L5WB 4Z7QE 4EQ2A 4ACPA 1BFVL 4NYLA 1N7ML 3D39B 4XRCB 4P99A 1HH9A 3JWOL 2WBJC 3BPNC 1FZKB 3MV7B 1KTLB 3GSRB 1SMOA 4QRSA 4X6CA 3VGAB 4BSVA 1TVDA 2YXFA 5DSCB 2O5XL 3REVB 1A9EA 4F9LC 1A5FL 2PYEB 2X44D 4JREC 2P5EA 2R2EA 1AD0B 3KPSD 5F7MC 1UWEL 4XX1G 5J12B 3MUGB 3B2VH 1KGCD 3RIAF 3FO9B 4J3OC 1ZGLM 2G5RA 3C08L 4Q6IB 3DGGA 5IESL 1CD0A 2BJML 4JJ5B 3P2TA 4XP6H 3BAEH 3DROB 5ETUB 5T3XE 5IJVA 3NIGF 1CE6A 1ES0A 4W70A 1ZGLA 1FNEB 2JCCF 4I5BB 3MBXH 3PDGA 1I9JH 1HKLH 3RL2B 3DX9A 3BWUC 2QSCH 5C0AB 5GGQL 5E7FA 3SPVA 1QPXA 2ZOLB 3AUVA 5DMIL 5FV1L 1MJ8L 3TZVD 3BZ4B 4UOJA 5EOQH 1IT9H 3AREA 2VDRH 4UI2A 3QUZB 1A7OH 1OSPL 4WTZG 4G7YL 4TULL 5EWIL 3ARDA 4JO2L 5JO5B 5SWSA 3UEZA 2GY7B 1CDIA 3ILQD 5HGHA 1MLBB 3SDDB 1UXSB 4MXQC 2YUZA 4KY1H 4M5YL 4XPAH 5ALBH 1DTUA 1NMBL 2GSGA 3LAFA 3RVXD 5ICYA 4RBPK 4Y5XA 3OF6D 4PV9A 4JZJC 5DC0A 2F53A 4BKLB 1ZHNB 3D6GA 1P4BL 3MYJA 4I3SH 3ULUE 3KPPB 4P23A 4NRYB 2NXZD 2IALB 4WHYG 4GKNB 4AMKL 5E0QA 1SVZA 1BFOB 3TZVC 3VD7A 3V7AE 1WBYB 4NQCD 4WI7A 1KCVH 5IMMB 2A77H 5E08L 4I9WD 4X7CC 4X7TA 3ILQC 4JZOB 1QKZL 4AT6A 2W07A 4FTVE 1KEGH 3UTTE 1F11A 4TSAH 3RVXC 1A6AA 1AGEA 1JZ4A 1A21A 1K6QL 3MRIA 2FYYA 3P4NA 1YY9D 1G9NH 5E6YA 1LO5B 3QHZL 1M4KA 3CSPA 2BVEA 3VXNB 4YDLB 1AIFA 3ARUA 3QIWA 1A6PA 3QCVL 1XH3A 4JKWA 2NXZC 4LLDA 5HDQL 1C7TA 3IU3B 1E28B 2P8LA 1FL6B 5DGQA 5I8EB 1T7XA 2O5ZL 3VH8A 4MCYB 4G9DB 3OKKA 1WWBX 3EOBA 3J7HA 4EDXA 2QQKL 1EMTL 5FO9A 5F1IA 2OCFD 1BWMA 3BKJH 1BECA 1UB5B 4X5XB 4OM1L 2F8XC 3CDCA 4K3GA 1BLNA 3FQUA 2AJXL 4TSCH 4O2EB 3VFGL 5CCKH 1I4FB 5HVHC 3K2MC 1OAZL 3A6BH 5EN2A 4MX7A 4DTGL 1EEUA 3LKQB 1JRHH 4OFIA 5DMJB 5I1JL 4XZUA 5DA4A 4QTHB 3AROA 5D1ZD 1JPSH 1LO0L 5L2KD 2G5BA 5FM4A 1G0DA 2X4NA 4IIQA 3PQYA 5F7UA 1XEDA 1LO4H 1DQJA 5D96C 4OF6A 4KJYB 5BJTA 4N8VG 4F9PC 3WS6C 4PJ7E 2AV7B 3JTTB 1Q72L 2H3NA 3X3FH 3ZTJH 3MOBL 4HMCA 4OD1H 3QIBA 4WEBH 4PRNA 5E03A 2CGRL 2GCYB 1QRNA 4OFPA 2VABB 3W9DB 3MJ7A 2MHAA 2CQVA 4FQXA 1U91A 4Z0BL 5CILL 1GPOL 3GSVA 1K3IA 1ADQA 4XB8A 4Z7UE 1UZ6F 4GO6B 4FTVB 1DQQB 5D1ZC 3UTTB 1MUJB 2FJHB 2R0LL 4KGJA 5KS9A 4AY0A 32C2A 5HPOA 4WTXA 4KZEL 4JO3L 4DQOH 5MHSD 1OF2B 4C58B 3TESA 4WW2F 4R9HA 4X6DB 3RVVD 1TQCB 1IM9B 4RAVB 3CLFH 4L4TE 3QYCA 5HYSG 2XG4A 3TJHD 1XCQA 3UPAA 1F4YL 4RSVA 4R90L 2EYTB 2IANE 2CRMA 5BQ7A 4P9MH 2OP4H 4CN6A 2FX9H 4OFDA 3CH1B 5AG9A 5EO9B 3QXVA 3DYMA 3KG5A 3O6FD 1YEJH 4XBPA 4ZQKA 3VG9C 4UMGA 2GI7A 1G7MA 2D0HA 4KKAD 3CFCH 3LN9A 4YDKH 1UQSA 4F15C 3BT2H 1URLA 1T1ZA 1OGAD 2GJ6D 2NW3A 3VW3H 1YN7B 3ZYZA 2P8MA 3MRPB 4LDLB 2Z93A 4JQIL 1T2QH 4MXVF 5F9AC 4G6JH 4JG1L 5DHYB 3V52L 1NSNH 5ABDE 2YD5A 4I18A 4UNUA 2PW2B 3OXSB 4ORGA 5I1AB 4FQ1L 1EEYB 3RWHA 3E2HB 3WDJA 3G6JB 3MNVB 3SJVB 3I3DA 5B38B 4HAGA 4LSRH 1FVCA 3MUY1 3P77B 5EOTA 4QOKD 4H5SA 1BD2D 3O6FC 4JHBA 3KYKL 1X5GA 2XN9B 5FYLH 2YRLA 4KKAC 3KYMA 5ESAB 1YY8A 4XNYH 3M17B 5KAQG 4CU8A 2W0KA 3L3DA 1CLYL 1BHGA 2YEZA 5SV4A 1HNFA 5KN5A 2V5YA 4GT7A 3VDAA 5BOZG 1IGJB 5LGKA 3C9NB 3FQNA 4N0CD 1S9WB 5BV7L 4FN0A 5GSRB 1MFBL 3TF7C 2CIIA 2E9JA 1IKFL 1MREL 5T1DH 4HH9B 2H32B 1KXQE 5I2IA 2DLGA 1BFVH 3SDAD 3H9SE 1U8LA 5FYJD 4KI5F 3ZDXE 1MIEL 1MIMH 1N7MH 2IMMA 2VH5L 3CFJB 5MEPB 4X98A 1C12B 2IAMA 3JWOH 1WZ1L 1IM3A 4WRLA 1XR8B 2C3WA 4JANB 2FIKA 3IJYA 5KVEL 2VR5A 4M62L 1X5YA 2BXZA 3X13B 3S88L 3W5MA 2NW2B 2A6DA 1JRHI 2HJFB 3PF2A 1BGXL 5D4QA 4JHAL 3PHQB 2KPNA 3FONB 2BOBA 4PY7B 3MMEA 1HQ4B 3GSXB 4N0CC 4U1JA 5I19L 1G7LA 4OGXL 1ZHLA 2Q76A 2ITCB 3FCTB 1LE5A 5IESH 3G5XB 3O8XD 4E0RB 1YEEL 3GSUB 3SDAC 2GT9B 1H8OA 1AGBB 1T1YB 1U3HA 1P4LB 5IB2B 4C83A 2OQJA 3MXVL 1QOKA 1UM6L 4MS8D 5FK9B 2GQHA 4TUJA 1AY1L 5GGQH 1W72A 4PJGB 1DUYB 5E4IA 2DKUA 1N8ZA 1IGML 1UJ3B 3MLTB 2O61B 2AV1A 5DMIH 3C60C 4ZFFA 3C2SA 3VXMA 2XWJA 1I85A 3UTQA 1CICA 3G6AB 1OSPH 1EHXA 1H15B 2GY5A 4G7YH 4OZHE 5EWIH 4JO2H 5ECJE 4PJHB 2R0KL 4CVZB 4YBLB 1A2YB 2YPLB 1QSED 4JFXA 2MJWA 4M5YH 4QXWA 1NMBH 3QRGL 3MRCB 1JPGA 3O8XC 1IGCL 2ZG2A 4DVBB 5A16A 1ZHKB 2LAGB 3H3PL 4W6WB 1WIPA 5EUOF 1W8NA 1EVUA 1I3RB 3P9LA 1NAMA 1P4BH 1MSPA 1W0VB 1CLCA 1JPFA 1P6FA 2P4AB 5BS0E 1PYWA 5I8CA 2CJUL 2EIDA 3OX8B 1U8PA 3F7QA 4AMKH 4X6CF 1FVEB 3CFEB 5EB9A 3VD5A 2N7AA 3SEPA 4LKXA 3DUSB 2C5DC 4DZBB 1DN0B 1MCQA 4R7NB 2NTFA 3VFWB 3GI8H 5DK0B 4BH8B 2YA0A 4X5WA 4W81A 4WI8A 2MNUA 5E08H 4HIEB 5LVEA 4NO3B 1QKZH 4K71C 3D0LA 4ZXBD 5IP4A 5C9JA 3HZYA 4KAQL 4LHUD 1NUNB 2C1OA 3RGVB 3REWA 3FN0L 4MB4A 1K6QH 2WM0A 3P9WB 5I18L 3K74B 3QHZH 3T3MF 4UT7H 3S97C 3B5TA 1QFUH 4HUWA 2FB4L 1FFNA 5IFAH 3QCVH 3EOAA 3CX5J 3OG4B 2V2TB 3BP5A 5IVXB 3T0EC 1A7QL 2Q7YA 3AXLB 3U6RB 4ZFZA 2O5ZH 3QNYA 4A6YA 3IDNA 1QFWH 4AQOA 4FMFA 1CD9B 2AK4B 2AEIT 1X9QA 2GHWB 4LCWB 1EMTH 2AI0H 2AXFB 4OTXL 4BFIB 4YHLL 5IM7B 2GYSA 4ONOA 5HHMD 3HI6L 2AJXH 1UXWA 3W9EB 4KMTL 3VFGH 5F7EL 1E6OH 4UDUA 1OAZH 1HWGB 1J88A 3MNZB 1FG2B 2HT3D 2HTLC 3HN3A 5ESQA 4ZOAA 4OZHB 2ZSWB 2YRPA 4KI1A 1QSFB 5EOCJ 2FECL 5ESVA 4QNPF 3RJDA 3VGGA 1FO0B 1LO0H 3OJVC 4TPRL 4X99B 4GUPB 4ELMA 1NFDE 3HFML 3N1PC 3EFFB 3UBXB 2CSPA 3TBWA 4Z7VE 3P4MA 2OTWB 2UYLA 2G2RA 4N5UA 4PBVC 2EICA 4LAQL 3BRFA 1KIPB 5DJAB 3PABB 1AQDA 2ED7A 3ARPA 4JFOA