3ETSA

Crystal structure of a bacterial arylsulfate sulfotransferase catalytic intermediate with 4-methylumbelliferone bound in the active site
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
571
structure length
562
Chain Sequence
AGFKPAPPAGQLGAVIVDPYGNAPLTALVDLDSHVISDVKVTVHGKGEKGVEISYPVGQESLKTYDGVPIFGLYQKFANKVTVEWKENGKVMKDDYVVHTSAIVNNYMDNRSISDLQQTKVIKVAPGFEDRLYLVNTHTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWWLDQDTFYDGRDRDINKRGYLMGIRETPRGTFTAVQGQHWYEFDMMGQVLEDHKLPRGFADATHESIETPNGTVLLRVGKSNYRRDDGVHVTTIRDHILEVDKSGRVVDVWDLTKILDPKRDALLGALDAGAHAGQQAKLEPDTPFGDALGVGPGRNWAHVNSIAYDAKDDSIILSSRHQGVVKIGRDKQVKWILAPSKGWEKPLASKLLKPVDANGKPITCNENGLCENSDFDFTYTQTAWISSKGTLTIFDNGDGRHLEQPALPTMKYSRFVEYKIDEKKGTVQQVWEYGKERGYDFYSPITSIIEYQADRNTMFGFGGSIHLFDVGQPTVGKLNEIDYKTKEVKVEIDVLSDKPNQTHYRALLVRPQQMFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A structural and biochemical basis for PAPS-independent sulfuryl transfer by aryl sulfotransferase from uropathogenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Arylsulfate sulfotransferase
total genus 166
structure length 562
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.8.2.22: Aryl-sulfate sulfotransferase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05935 Arylsulfotrans Arylsulfotransferase (ASST)
A PF17425 Arylsulfotran_N Arylsulfotransferase Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3etsA01
4P07A 3ELQA 4P04A 3ETSA 4P06A 3ETTA 4P05A
chains in the Genus database with same CATH superfamily
2G2PA 4H8VA 1NGXA 2X10A 2XXCB 4L4TD 4AITA 1IZKA 4E42A 1OSPL 3PWPE 5T5FL 5E70A 3FU9A 3KPMA 2OSXA 1VA9A 1H9VA 1XCQB 4NP9A 4PP2B 3FO1B 4PJEE 3P0VH 2AI0H 3IT8D 4FFZA 4LCIL 2DRUA 4P2AA 1AZUA 4TQEH 3RWJB 4N0CD 3W39A 4H0GA 1HN1A 4XWGL 1YNTA 1KEGL 3IJ7A 1A7OL 2XVLA 1UQSB 1G7IA 5E6IC 3W81A 3R06B 1BFSA 5A40E 4AZ8A 1FLRH 1MIMH 1QAWA 3ATEA 4RFEA 1FL6A 2VDRL 3K2IA 1FO0L 2A73A 1T0NB 3BYYA 3NN8A 5E1GA 3ZZ1A 1SNRA 2XACC 3U0PB 2AK1L 4XNBA 4ODUA 5C08A 4AGMA 3DJ9A 4GXUN 1KBPA 5E8OB 3UEQA 1JGUL 1ZA3A 2L8AA 1KXTA 1K4DB 3UAEA 4AQAA 4PWIA 4ONFL 5HI5C 3GTNA 4HJIA 4JFPA 3KBEA 2MCAA 3DBXA 3DC0A 1FLTX 1NEZA 2HFEA 1A6PA 3PWNB 5I82A 1SQMA 2YEVB 4LCVA 1YMHB 1KF9B 1GSKA 2AK4B 3OAZH 4K3JH 1SM3H 2VW6A 1ZLVK 2X2UA 4Z3TA 4BFOA 5E24E 3FT1A 5ID0B 5KWYC 3GRWL 4KQ4H 2UXVA 4QHMA 3I85A 4RA3A 1WA0X 1G7QB 1UACL 2CGYA 2GJRA 1HSBB 4TM9A 3K0WA 4PTTB 1R24B 2EADA 4M7KH 1VFMA 1AZCA 3HN5A 2A6DA 3KEHA 3V7MA 4WNQA 2ATAA 3JWNE 1S78C 4YSQA 3WLBB 1URIA 4LMQE 4F7PA 2C34A 3WMSA 4YX2L 3ZU8A 3ULUF 3STZA 3G5VA 1A6ZB 5F8QC 5IJDC 1YAIA 3RAJL 2NW3B 4OZFB 4L4VD 2VW7A 2VC2B 1TJMA 4NUJB 1CZ8H 3AXLB 3CLEL 3H42L 1HXYA 2E6QA 4DKDC 3QIUB 2BVUA 4AGOA 3PL6A 5TQ0L 2VJXA 4NQXA 4H5SA 4U1SB 2D7MA 5MP6L 5D1QD 3AXHA 4M7LT 4XI5C 3FU6A 1T2XA 3IFNL 3ZYOA 4AQEA 4NN7B 5DRXA 4PBXA 3X11A 1A7PH 1FNGA 4ZPTA 3FB5A 5HDLA 3SZKC 1DQML 5DD5H 2P5WE 4XBMA 1PIFA 4H8UA 2CD0A 3WFZA 4KO9A 1QI3A 1RK1B 1XCTB 2WIIA 4MCZA 4PRBB 1BAFH 3N3EA 2VM3A 5F7FA 1CF1A 2Y5TB 3ZT7A 3SIKA 2PCFA 1OAZL 1UJ3C 3FK3A 1A0QL 3KWUA 5TDNA 5BPPA 2ARJA 3QAQA 3PP3H 4LNRA 4RVBA 3PNWB 2YKLH 2FQGA 5BVPL 3C6EA 1YMMA 3W37A 4P2QB 4MYWB 2WNKA 4Z7AA 1CL7I 2DQJL 1XGPA 4LEXL 2EE3A 5CD3B 3W0WB 4MJIA 1KCWA 4TS6A 4AJ0A 4Q9QL 3LKOB 4KKCD 4AJYV 5EOTA 2FYVA 1XAKA 3IU4L 1WZKA 4V1DB 5SWZE 3QZNA 4ZRGA 1TQBC 3MHZA 3PY9A 3UJTL 1Q0EA 3WMPA 1JV2B 1UWXK 1PX3A 2FCBA 5FYJD 3VXPA 1KCRH 1KEGH 2AFNA 2FATL 5FF6B 5KVGL 2R59A 4LIQH 2K78A 4XP9H 2VITB 2XFXB 5D70L 2X4QA 3V9EA 3CZJA 2ZX8A 3FQRB 1SXAA 3QJRB 3WFEL 2BW5A 5J3HD 3V8CA 4YIQA 1VFOA 3HRPA 4UAHA 1P7HL 1IM3A 2X28A 3WJMB 2OV0A 5K5YA 1D6EB 1SN2A 1DUYB 3G6JF 3GMRA 2G75B 4Z7UB 3EDDA 1IQDA 1O7VA 3EJPA 5E1AA 2F15A 3FQ2A 1IE4A 2ADGB 1KCRL 5I19L 4F5CE 1CICC 3FF8A 4ES8A 1YZZA 4PS7A 4OTXL 3TBSA 2VSMB 1NCBH 2OAAA 3GZOA 2APVA 5F72S 1I9RH 1F18A 3CDZB 1DE4B 2AJ3A 3PWLB 4WHCA 1HIMH 5I73B 5K59F 4KX7A 1PQZB 4D2NA 3IJEB 5JOEA 1CDJA 3DO4A 4LQFL 1AKPA 2CPUA 2HT4C 2XV0A 1QSFD 4FKKA 1SUHA 2V7NA 3RWEB 3CMOL 4K9EL 1CFNA 2IH1A 1KJ2B 3LN4B 5BVJA 5B38A 1CDYA 4E41B 1R3HA 1LNUA 1YUKB 3C75A 1V3MA 2DS4A 1QLFA 3QWQB 1CF8H 4UT9L 3B2MA 3GI8L 4MQ7A 1CFSB 2X2YA 1NLDL 3L5XL 3VWKC 1K5WA 2PW1A 1JXKA 1EGJL 4R96A 1JK9A 1BVZA 1OAYH 4IDJL 4TRPH 3INUL 2J4WL 1FQ9C 3F6IA 4OZGE 2YUVA 1X5HA 3SCMD 4OZFG 3HC3H 4D0DA 5HHQA 4WK4B 3IRZA 3C8DA 2KPNA 3GYRA 1WUZA 2J20A 3TV3L 2QSTA 4JHVA 5EEZA 5JHLA 3MCYA 3V5DA 3H3KA 2WBJB 4G83A 1O6TA 5MHSE 4MB5A 3NTCH 3VXQB 4HG4K 3WFCH 3HC2A 3D0LB 3VFTB 4PRPB 5IKCA 1R9FA 4X8CA 5L2JA 1EH9A 2VAAA 5C0BA 4QXGL 5DWPA 1IGCH 4TSBH 1NC2B 4LAJH 4RDBA 4DW2H 3G6JE 4LSPL 1ZLUK 1HKFA 4F92B 4BH8A 3B7YA 3G7TA 4OZ4B 1X44A 1T66D 1N19A 3GEFA 3S48A 1S9KC 2Y7OA 2ZPKL 2IWKA 5AW5B 1MLCB 3LH2L 2K7PA 4PJ7A 4UINL 5ABZA 3C2AL 1UD3A 2Y24A 4EBQL 1VZHA 2JKLA 4F57H 4MNHA 5KOMC 3F6LA 2YXMA 4P59L 2EDXA 3MRRA 3ARBA 5HGGS 1KXHA 3L1OL 1GY1A 4FABL 2H3NA 4QRRD 1KGJA 3BSHA 35C8H 4QXGH 4R0LC 2EXWC 1AZRA 3E6HA 3EG9B 1DN0B 3FRPB 4UV4L 4L5FL 4HIXH 5CAYB 3B5HA 3BHBB 3ZGIA 4W4OC 1KLFB 1U3NA 3UBXI 4F15C 1E4WH 4FFVD 3ZXAC 3KYMA 3I75B 3MGTA 5D7KE 3OZLA 1YQVH 3JYBA 4UDTB 1F4WH 3QORC 4LLWA 4LHUB 1RZ8B 4QAWA 3HZKB 4OD2B 2VLJA 3LSOA 1DQTA 1KIRB 4A55A 3GSNH 1AFVH 1T5XA 4M4RB 1EZLA 2CXGA 1ILSA 2FGZA 2OSLB 2QVFB 4I0CC 1XH3A 2Z93A 2B5IC 5D55A 1D5BA 2X05A 3U6XA 1KB5B 4HS3B 4F37K 2YZ1A 4NZRL 1A14L 1NCUA 5ID1B 3DURA 3FSWA 2HJFB 3VXSA 1TITA 3BAYA 5BZWA 5AKSA 1JZ6A 1T0MA 4HUKB 1KENH 3L3OA 1H3VA 4JG0L 1PNCA 2WXGA 5I1JL 2UVFA 4DEUA 2OMYB 1XT5A 4BDVA 1VRSA 4YNYA 2IPKA 1NCNA 3MBWB 3QW9A 1GCYA 4M6MH 3E8VA 4FQQB 3HR5B 3G5VB 4ALAH 5F3BB 5LBSA 4Y5XC 2B39A 2KC0A 2VERN 2YQ2A 4NN6C 4XBGA 1MFAH 4R2GB 4B7IA 5FOJA 3KPLB 4BWWA 1NMCC 1P2CA 1Q1JL 3VRJA 2BERA 4ZMOA 4N9OB 1JZ7A 3D3VD 1I7UA 1WZMA 1T80A 4Y4KD 3P4OA 1QVOA 5I8CB 2GPZA 1KV7A 4OBSA 3SY6A 3D18B 3MXWL 1CT8B 5IFAL 3Q9QA 1AQHA 3GSNL 2AJVH 1SYSA 3GS7A 2CIKB 3CVHL 3MODL 1O6VA 4HHWA 2QTEA 4PM1A 3I9GL 5AOMA 1I8MA 1TJXA 3HAEA 4E68A 3BPOC 2Q6WB 5CLYA 2E7BA 2ITDB 4XPBL 3MRKA 1MHEA 3STBA 4YIQB 3BKYH 2OMNA 2MRYA 4RAVA 2B8OT 1MCRA 4JPKH 2C4FT 1E4XL 4PJHF 3FQNA 3BPNB 4WTWA 4X6EB 5ACZA 2QMJA 1UC6A 2EH8H 4HKZB 4MCNA 4DN3H 3G6JA 1V54B 3ZL2A 1G9EA 1HI6B 1CB4A 1WC7B 4JW3A 4KY1L 3FBKA 5L4FA 5KVEE 1ZJBA 4X9FA 2OX5B 4HUWA 4HWUA 5L88H 5E6SB 3SYPA 3GMLA 3KYOB 5KVDL 4F8OA 1I8UA 2EVFA 4XCCH 3MGOA 1X6LA 1OW0A 4ZUVA 1CXEA 1XEUA 4EOWH 3RZCA 4PJ8D 2A0LC 4FQXC 1SOKA 4K73A 2P46B 1IKFH 4LPUA 1AD0A 4XTRC 4PJIA 1R5WA 2VDPB 2LQRA 1RJYA 5E56A 1A7QL 4RSYA 1XF5B 3EOAA 1CLOL 1X5GA 5IBTH 4OJCA 4NIKB 3BDBA 3BSGA 2FX8L 4UIKL 4AZUA 3RX7A 3ISWA 3VFRA 4G9FA 2XQ0A 2JI2A 4W9DC 1CQKA 5HYSA 2O61B 5I76A 1IGIH 2XU9A 4AYMC 1E6OH 2J5WA 5E08L 2CM6A 5K9JH 1M7DA 3C5JA 1UJTA 5FWRA 3O3BA 1XGZA 3U1PA 4WI0A 2F8VA 4R7NA 2ZYSA 2VOTA 5ABAA 1TFHA 1O0VA 2G3NA 3TN0B 3WAJA 2C8NA 2A9ML 4OCMC 3FT3B 4HUUB 1TJIL 2BNRA 4PVLA 2H0PA 3PIQB 2EDYA 2BNUA 1UM6H 3MRFA 2IC2A 5B4MC 4QXWA 1CDIA 2XOTA 3KXFA 4GRLD 3RILA 3GNMH 2LFGA 3CFEA 4FQPA 5GGRY 3U7AA 4IRSB 3FOMB 1TZHB 1MAJA 4NCDA 2XBZA 5ABDE 5MHSD 3SDDC 3GJEA 4HPYH 1LNUB 3CK0H 2CA3A 1KBGL 1E7VA 4NPJA 3PAVA 3SPVA 2TSAA 2DM3A 2WSDA 3D34A 4QXVA 4Z7WA 1EAJA 1X5IA 1E42A 1JF5A 1TJIH 3VM7A 1H3PH 1SJHA 4FKEA 2ZXEB 3PP4L 4LCUB 3QULB 4NBZB 5KVDE 1LO2H 4RRPG 1C16A 3ULSA 3T5WA 3PJNA 43CAB 4YHNB 4AXWA 3CDZA 3FB7A 4KC3B 4GI6A 4I18B 4N87A 4XN5A 3IU3A 4KK5C 3C8KA 1MH5B 4JJOA 3JV0A 2B1AH 1SVBA 1KCBA 1CG9A 2KHAA 4G1MB 2BS9A 5BZXA 3X12A 3IJ8A 1AZNA 4X6DE 1U91B 3TASA 3ARED 3MYZA 2AJZB 1KCVL 3ISRA 1TEGA 2P8LA 4AVIA 2G5UA 4N0FA 4D9QE 5E0QA 2Z1KA 4I85A 3RIAF 4KKLC 3ZBMA 4FHBD 4PJAB 4POZC 3MNZB 2CDEA 3KNBB 4N1EA 1H6TA 2ICCA 4LVOB 1J1OH 2F58L 4TTGA 4XZUA 3ATFA 3NA9L 1OK0A 3WJJA 4R96B 2GEQA 4NDMB 3V6FB 3L9YA 3HHSA 3SE9H 3RA7H 3RVUC 3NSXA 3CUPB 2XZCH 2H2SD 3NIDF 5FYLD 1PW3A 2YARA 5DJ2A 4ZMZA 3QDJE 5ECGA 1Z1WA 5EZJB 2XSKA 4ZQKA 1MWAL 4HV8B 5E8DL 2YZ8A 5I74B 5J13B 3BCFA 5C08D 4GRLC 4L8CA 5TDPB 5IJKA 3LPPA 2MNWA 4I2XA 1XCWA 3IAGC 3GMOB 4XP6H 3AAZB 2DJSA 1KBWA 1L5GB 1CFMA 1N8ZB 1SFHA 3QJVB 1GTNA 1JWMA 1XDTT 4C4KO 3VI3F 4CUCA 1JXJA 3OC5A 5G4NA 3K4AA 3NT0A 4XC1L 5AW0B 3ZDYB 4YPJA 2E56A 3QB7C 4OI9A 3JVGA 4N0YH 4GUPB 2DPKA 4IM8A 4U0RB 1RMFH 3VFMA 4F9PC 1OOWA 3QXDA 2VISA 4Z7QB 1JV5A 3ARFC 3L2LA 4ZAKC 4HWBH 5E2UH 1VACB 5CSZB 5DUBA 1V7NL 1G1YA 3UJJL 3I74A 2IXQB 3VFNB 2TRYA 4NLAA 4NQXB 4GMSL 3KJ6H 4Y16D 1D9KD 2Y5QA 3FU0A 1NBVH 4HFWA 4EDWL 3BI9X 5DS8B 5KYUA 5C0CA 4KPHH 2KBGA 2OZ4A 3AS2A 5CJQL 1PZAA 1GS8A 2QSCL 5DCCA 5MENA 7CGTA 4P5SA 1I3RB 2FX7L 4R97B 2APSA 1CVSC 5KN5B 4M3KB 2J8HA 4P5TB 1MCJA 2BJML 3SE3C 4EAEA 1ACCA 1ORQA 3HFML 3NSDA 2ZKWA 3V4PA 5A2AA 4GSUA 2R2EA 3VXRB 2HWZL 5H37H 4N8VB 5C09B 1QKZH 3V7AG 3UIZA 1ESOA 5HD8D 3WO3B 2G60L 3TJHD 1BD2A 3AREA 3FPXA 4HUXA 1YN6A 3ILDA 1ZWIB 3MOBH 2ZX9A 3DJSA 3U4KA 3W56A 4KZ0A 1NM9A 1TTUA 4N28A 3BLPX 3H56A 5DVMA 3SDCA 3LNEA 4G3YL 2WZPA 3TNMA 4EEEA 1R5VB 2DLGA 3KPOA 3SYQA 4ZMXA 1HJBC 4KH2A 3JTSA 1A6UH 4F8LA 2E7CA 5LWYH 5D72L 2JVUA 5IR1A 1ZE3C 2WXPA 1QWHA 2CAKA 2EABA 3KPQA 4N0RA 4Q0XH 4UANA 1NBYA 4YO0A 1N4XH 1ZCRA 2JKWA 3AUWB 5F9JA 9CGTA 2NLJB 1T2JA 2OMWB 2YBRA 3PWPA 3QRLA 2FX9L 2YAEA 4QF1B 4OGYL 1E27B 5HBBA 1BBJB 3WIFB 5D7LA 3BVNB 5IBLD 2E4TA 5JMOC 3OKOA 3JBG7 3ARFD 2CO7A 5DRWB 1UCBH 1OALA 2Q5BA 1CE1H 5GRWA 1XX9C 1KGUA 1P5UC 4JFOA 4ABUA 3OJ2C 4PWKA 4ORZC 3CDGB 1DUZB 3FTYA 3WAKA 4LPTA 1JCKA 4Z3JA 1FAIL 4HWEL 3QPXL 3QFJB 5T3XD 4DFIA 4Y19B 3KXFD 4KH9A 2D7QA 2X4RB 5FYJH 2EQDA 3ZOAA 4DZBA 5HYJD 5BMFH 3FNKA 1A7OH 2XVKA 1I4FB 5IESL 5IMLB 4XP9L 4NCC2 3WIAA 2WO2B 1J18A 4WKZB 3F7VB 3IS1X 1JNLL 2MCPH 2MFNA 2CXKA 2VC2H 3F64A 5I0XA 4A7SA 3KYKL 1ADQA 1E5AA 3W9DB 1HXMB 1N9PA 2I5YH 2RACA 4YHPA 1D2OA 3O6KH 4ETYA 3GSNB 4NSKB 1EVUA 3TP4A 4BKTC 2Z4QA 4JGJA 2PO6D 1K3ZA 1G9ML 3CVHB 4HKXA 4HWBA 4NNXB 3TIDA 2CJSA 4EZJA 1FL5B 1LWRA 3EOBB 1KBVA 2PN5A 1Z2KA 4DKFL 3BRGC 2P5PA 3JTTB 1XF5A 5E8OA 3THMH 3ECWA 1BHGA 3ZL1A 4GMSH 3U1QA 4P23A 4H13C 1JGUH 3O6FB 3ZKXC 3GJFK 4ERSH 2NRDA 5D6CA 1PGRB 2QPSA 5GGRB 4MWFB 3IFLL 4C83B 3VW3L 3ZUNC 5JPNA 3V6OE 2CCWA 2XRAL 4PRAB 5I75B 4LLDB 4K8RL 5F7MC 2K9UA 5D7JA 1QA9B 2GI7A 1AO7B 3HZVB 5E4AA 5HPMA 2VE6B 3T6VA 1BYOA 3MBEB 1VFAB 1U3ZA 3HHSB 3PPSA 1WQVT 4JLRA 4UT9H 5G55A 1GMEA 2VN7A 5KVEH 4OZIF 1JHKL 5FUOH 1E9PA 1PAMA 2E9JA 2ZTBA 1RD6A 3CPLA 4XMZA 5IB1A 3V6OC 1ZJAA 2V17H 2CLZA 4M1CC 3ZKMD 1AIFB 5JIHA 1QFHA 3U7YL 3LNDA 4L1HA 3P54A 2NXYC 3ZTJG 2W9LA 2MQGA 3A23A 1XZ0B 4QRRE 3MLPA 2N4IA 2VDML 4DETA 2YK1H 5FO9A 3RWIB 3ORJA 2OMBA 2QV4A 5J1AA 5F7AA 3ZL4H 5E8NA 1NIAA 2VGLM 5EA0H 3RPKA 5DURD 1FNHA 3CDYA 2I25N 4I13B 4J3UA 4PRID 4MDIB 2F74B 4YBLC 4G6FB 2A6IB 3RB5A 4Z7WB 2BY1A 5BNXD 3JYCA 2DYSB 4UQ2B 2YD6A 4TRPL 4NPYB 3EF4A 2PXYB 1YNTF 3DMMD 1JYWA 2DIBA 3GM0A 1W0VA 3ZSTA 5B1JA 2NUPA 4EVNB 5BVPH 4WNSA 3FCGA 1R75A 5I6XB 2XWCA 1ZS2A 3M1BA 3DROB 5AW2B 2BSSB 3TTYA 3FSZA 2R0ZH 3O3AB 1LDSA 3HKFA 5DRZB 3L54A 1IGJB 1IARB 1GZPA 1A8JH 2EEXA 5EZOL 2BHYA 1PDKB 4I18C 3IMWA 1T89C 2DQFB 4Z7OF 5C0ND 3RL1A 4PJAE 1GAFL 2BNUB 2GK2A 2X3BA 3EBIA 3MRFB 4Y2OB 5CIPB 1RUMH 5I30H 5K9QI 3D7PA 1RUQL 5E8EB 3TPUB 3Q43A 1LYQA 4H2CA 3DDFA 2VXVH 1G5AA 4X2UA 2KLSA 1RLBA 2OJZL 3ZKQD 1U58A 5IFJA 1FC1A 4N2GA 3F65A 4IHOB 1UA6L 3WTYA 1JGVL 3TJEL 2W0KA 2OPCA 1X4YA 2Y9RT 5IHHA 4GYBA 4ACTA 3IFPB 5I15H 4OD2A 1NIBA 3BH9A 2OMZB 5GZND 2ZCKL 3TVMC 3OGCA 3GMNB 4ODHL 4B5ZA 4M43L 3F7PC 4XH2A 1MAMH 3DGDA 3MGOB 4UINH 1GMIA 2NY3C 3RU8H 1NCDL 5C07B 1PG7W 4Q89A 5I5JA 1OQOA 2IMMA 3ARBD 3FTGB 2VSKB 1A22B 3TH2T 4RESB 3AUVA 1P4IL 2FGWL 3DUUB 4MBOA 2J56A 2E6PA 3DVNB 3UAJD 3LZPA 1AOZA 1K8IA 4AUUA 1MEXL 3BPLC 1IFRA 4LAQL 1F3JB 1ZT4A 1NFKA 1F58H 3SKOA 5JW4M 3N43B 2QPUA 1CC3A 4P4KA 3L5JA 4KRLB 1WFMA 1MRDH 2V8LA 2NW2A 3MXWH 2YGVA 1IM9A 3GXUB 1MWAB 2QADB 5EO1B 2HLEB 1CK0H 1MW1A 1EGJH 1MDTA 1J8HB 1XD1A 4N86A 4XMPH 2J5LC 3KYAA 4E36A 1TQSA 4KY1H 5DD3L 3QG7L 1NL0L 4KJPD 4OJYA 4N2DA 5TDOB 4AM0Q 2FLMA 5TQ2H 2CJUL 2J6EH 3RUGF 1AO7E 1MEXH 4PJIF 4YWGH 5I8CA 1UB6A 4G11A 4HXAH 5FO7B 1JBJA 5T1LA 2UXGA 3GSQB 4P8QA 4EOWL 3IXAB 3TBWA 5EEXA 3GSOB 1FIGH 3Q6GH 2R1YA 1JJUA 5GZNA 1AHMA 3WNPA 4A7QA 3F00A 4I88A 1ZXKA 1ETZA 3HN8A 3VXME 3QISA 3GJEB 2OULB 4ZX3A 3PWJA 4IRJA 1SY6L 2F8IA 1UD5A 4KRPB 2WP3O 3HG4A 3HMXL 3SOBL 2VLRB 1VCAA 2H45A 4LPWA 5E94B 1VCBC 3PIQA 5K9OA 2OL3L 1VADA 2RR3A 1DFXA 5I6PA 1IGTA 4QCIB 3GMPB 3QCVL 3PWUA 4X7TA 4BYHA 2ZXCA 4KFMA 1KACB 1ZK9A 4J3SA 3H9ZA 3RJDA 2HRLA 4L8DA 2BZCA 2DQDL 2BDNL 2IQ9L 3B56A 5AVWB 5SWSA 2I9TB 1E9OB 1KIUA 3VD1A 1UVQA 3MLTB 3BD5A 2WXKA 1ZT7B 3FAXA 1T1XA 2ZXQA 4JPWL 4H40A 3MLRL 4MD4B 3GPEA 2WTPA 3VXMA 2HAZA 3F85A 1YYLH 4JBSA 43C9A 2AAVA 1Q0YH 1MVUB 3EOAB 4DGYH 3QFGA 4PJ9D 4Q74A 2ENQA 5EU4B 2MKLC 2H32A 3DX8A 2IEPA 4L23A 3OJDA 3HMXA 1AGFA 2NY4D 1XIWB 2H3XC 3O4LA 1J8HD 4ANKA 2P42B 4I8DA 2J8UE 4P46C 1B88A 3OR7A 2ADJB 5TGBB 2BC4B 1DVZA 4PRIA 2VITA 2X4UB 4ADGA 5CS7A 5FF6A 2WJ7A 4FGMA 4TXVB 2A77H 3VFVB 3VI3E 4EI6B 4G8GE 1YYMH 1IC5L 1V7MH 2K9FB 2PWGA 3QRGL 5LWYL 1KGYE 1MOEA 5ADOH 5T1MB 3HCVB 5EU6E 4UNUA 1MCFA 3T6XA 4YSEA 4ETQB 3NJKA 2VDQL 2EDTA 4MNHB 3F7QA 4G7VL 4F24A 1MFAL 1IAII 5LLIC 5I8OL 3LAFA 4KROB 4M9PA 3ZE1B 2WXLA 1SF3A 3VQMA 3HJEA 5I1DB 1NWPA 2V7HA 2AJXL 3NCWA 4L8SA 4FZEL 4RNRA 4AENB 4DVRL 3O6LH 1FFOB 2PTTB 2VABA 3GM8A 4N20A 1FVEA 4QXUL 4BSWB 1AGDA 4CSSA 5H94A 4J1UB 5ISZE 3MOAL 4HH8A 5HHOA 1C5DB 1EGJA 4IRZA 1S7XA 2E7MA 4W81A 3OXRA 3UPAA 3UYRH 4PRPA 2HRHA 2N59A 5DSCA 1M53A 4PJ8B 4FXKC 1A6AB 1N70A 4WI9A 4G8EB 4MA1C 2JJWA 3PL6D 3H0TB 5DLML 2Q87A 1XGUB 3H9HA 5GXBB 4R26H 1QBLH 4MS6A 3IGAB 2AJXH 2H9GA 3QS3A 2AXWA 2F2HA 4JO3H 3UTZA 5DWUH 4LHJB 4NM4L 2X7LA 3U83A 1I7TA 2F53B 4O2CA 3REVB 1P53A 2AZAA 2X9XA 4KU1A 3LXCA 2NW3A 4IKKA 5I5MA 2AJUL 3AU1A 4CNIA 3MPCA 2F1EA 1FGNL 4RZKA 1IAKB 2DQGH 3WNIA 4F7PB 2VDQH 4UAOC 2VKWA 5TK2A 1DYZA 4F9PA 2NY4C 2VRQA 1KJVB 5H35B 1JI1A 1PEWA 4PRNA 1CVRA 2C9VA 3LEYH 3N41B 2ADGA 3U0WL 3SPIA 1YEIL 2ETWA 4N8UA 4WFEE 2EP6A 2VR7A 3RWIA 4JAMB 5FO9B 5TTRA 3PWLA 1ZVHA 3UYRL 4B5EA 1R3IH 2ZCZA 5CJXC 1W0WA 5GJTH 1TQUA 2APWA 3F7VA 2VRAA 1HHGA 4F20A 3X3GH 2AGJH 5DFAA 1I3UA 3TXAA 1IQDB 1I7ZB 1FJ1A 4GSXA 4NO2B 3GMQA 4OAWB 3FQTB 4POYA 1IM3B 5E99L 4NZDA 3ZE2F 3W2DH 1U8NA 3D9AH 4QUOA 5HGBB 2F19H 3SPCA 4LSTL 2O1AA 4KZEH 1LO4L 4IRSD 4X6CE 5D1QB 4CC1A 3ZJAA 2O5ZL 4EZKA 1DQLH 1E5ZA 3L9EA 4JHWL 3Q05A 5B22A 1XF2A 4HCGA 1HOCB 3FN3A 1CLOH 3FT9A 4OZHA 4I0PA 3LQZA 4HH9A 1SF5A 2Z7YA 4DN4H 3D50A 5E5MB 3V4PL 3LMJL 4JDTL 2A83B 4XXDB 1NCGA 3SO5A 3QO1B 3EGDA 5D4QA 1XL6A 5C07A 1AQKL 2Q76A 5EOTB 3HHRB 2D3LA 3F7LA 5LCVA 5IJCC 3IJSB 3BZFB 5CD3A 4BA0A 2NY1D 1ZT1A 1BGXL 1MF2L 4FYTA 2P5WB 4PSPA 4PJFF 5ESAA 4K94L 4M5YH 1XH2A 4M62H 1F2XK 5CHNA 1YDPA 4DGIH 4WU7B 3QI9A 4M7KL 4L0ZA 1JZHA 3H42H 3RNQA 4RGND 3QDGE 3BH8B 4X8XA 2FJGA 4IHBA 4EPSA 1V55B 3V52L 2XDHA 2Y3AA 3OQ3B 3QFDB 4ZMNA 3B43A 3G5XA 1IBDA 3ATAA 4TSAL 2E7LC 1CXHA 3GSNA 4NC1C 1ZDQA 2BCMA 5JLZA 2EILB 5C09A 2DIJA 3RVWD 3AWEA 3PHQA 4BHUA 1AKJD 4NENA 4PLKD 5JPMC 2JKJA 1I1CA 3FZUD 1Y0LA 3QUYD 1D5MA 5HHMD 4H4NA 4YK4C 2DBLH 4AV0A 5EN3A 1SYVB 2KUTA 1CGTA 5FM8A 4HVBA 4MNQA 4Z23A 1DBAH 2B59A 3AWFA 5IGXH 2FX9H 4YGVB 3T3PB 2IG2H 3NCYS 4FG0A 4CVZA 1EXUA 3HNVL 2JTDA 3O2DA 5D9SA 5MP6H 3CPUA 5HJBA 2B3IA 2BZ7A 5CEZD 2HB0A 5IEHA 2GABA 1EEZA 2Q86A 3OB0H 4E41D 4M93B 4RRPM 3ULUD 5DD5L 2W65B 2BMKB 3T08A 3FF7A 4ODVL 5EBGA 1JPST 3FDWA 4YZFE 1EZVY 1BAFL 3RAJH 1MI5D 1U8OB 5IMKA 3UJTH 5DVPA 5JPNC 4QRSB 4IBWA 2PP8A 4P5KB 4YDJB 5I1CH 1C8PA 1AOHA 2EUVA 4Q14A 1S7SB 4HJJL 5FO7A 4H26A 5DZJA 4C8XA 4EE2A 3HA0A 1T83A 3HNVH 5I0VA 5C7ZA 1QTPA 5I8EB 3PABA 1CJYA 1SXBA 4XPGL 1OSYA 4PJFE 1C08B 1YO4A 1U8IA 4NX0A 3E0GA 5HHVL 2Z9TA 4TQIA 4HWNA 4ZNEE 1CLYH 4GB9A 3TZVD 3VFWB 1CD0A 4P2RB 3PAUA 4CVXA 3GWJA 3UZQB 2YJQA 3FUEA 1BJMA 1JDAA 1A1OB 2NZ1A 3ULVE 2Q8AH 5TF1L 3ABZA 3RGVB 4PP1D 2YUXA 3D85B 1A21A 3SZ6A 5ALBL 1YSOA 4P48A 4QO1A 4YAQB 1OF2B 1DBML 1RZJL 3NEXA 2EDMA 2YRLA 2GTZA 4XRCB 1HHIA 4XE0A 3H7LA 1JHLH 1U4EA 4L1BA 4MD5A 4F7CB 1BVNP 1ZEAL 4L8BB 5HHVH 4OZHB 2XX0A 3BE1H 3EH3B 3HG1E 4UU9B 4Z7VA 1NC4A 2IDTA 4B50A 1MCEA 4LSSH 3OKMB 3ZDYF 5FV1L 5FFLA 4L37A 1FO0A 2VDNH 4ZG1A 4FMFA 2NY1B 2Y22A 2AITA 4WV1C 1AZZC 1VFBB 2JTYA 5FW7A 1FLRL 1PMYA 2VZ3A 1GGTA 4RFNB 3GDCA 3HFMH 4ZX4A 3DX7B 3HE7B 1KG0A 3QQ3B 4HT1H 4JY4A 5DHEA 2YMXL 4M3HA 1X7TA 1P1ZA 3VSUA 1OAYL 4QOKE 3V0IA 1NAKL 2OL3B 1LXMA 3C5XA 1L9OA 2R7EB 2ZJSH 4NO0D 3D33A 3KLDA 3PJLA 1W2KT 3PABB 3B2DC 5FW6A 2PTVA 4TOYH 4PRPD 2NMSA 3MNVB 5HGAA 2D8KA 3GXFA 3SEPA 4UQCA 1INDH 1JWMB 4HCRL 1I7RB 3OG6B 4TUUA 4AIEA 4JCLA 2CMRL 3AGWA 5JHMA 3SE8H 5MEQB 1PKQA 3ZMEA 4WI4A 5J6HA 1MHCB 3S2CA 4GRLA 3O4OB 5AD0A 3MUJA 4OF3A 1I9JH 1Q9OB 4HT1L 1NA8A 5C9JA 3DVGA 3FUNA 2ZCHH 3GXIA 5C0IA 4FF9A 4DEWA 3INUH 4TNWF 4F80A 2ZWYA 2A99A 3NCCB 5JHLH 4WWKA 2BIHA 2QGDA 4G8FB 1OM9A 2EDDA 4IOIA 2VUKA 1T20B 2LFEA 5TH2B 2Y06H 2FT6A 1WUNT 4RGMC 4F7CA 2Y1ZA 3KVQA 3MX0B 5ICXA 2XKSA 3HZMB 5JMRA 3L9RB 4HDIB 3ZLQC 3NTCL 5KJRH 4F15B 1WFUA 5E6IA 4D3CH 4ZJ9A 3VYOA 5CGTA 1NGYA 2PYED 3VGBA 1FHGA 2P8PA 3BH4A 3O8XD 4PY7A 5EIQA 1PKOA 1FRGH 2ATPA 1ND0B 4YSOA 3O4LD 4NRXB 2R1WB 4OKVB 1UURA 1M6OA 1USQA 2D7TH 1N4XL 3BN3B 4Z0XA 3VQ2C 1TIUA 4HC1L 2JCCF 5BRZB 5JORA 1MWOA 3R1GL 5HYSB 1PZ5B 2O61A 4RAUA 4PJEB 5D5MA 1NBQA 3NSFA 1RUAL 4JY6A 3S4SG 3IU3B 2IDCA 4R4NC 1MFEL 2P8LB 2QPFA 3MNDA 3P77B 2PO6B 4GW5A 1UWYA 2CGRH 2N7BA 3FRUA 3UEZA 1LMIA 5KSUA 2FIKA 4A7VA 2D73A 4ZOAA 3HAEG 3TJEH 4XMKL 1HL5A 4MRCA 1MHHA 5J57B 3MRMB 5T3ZL 1JPGA 3ZMRA 1N6QH 2PYEE 1UA7A 1WHOA 2HN7A 1F3DJ 1OSZB 1HC1A 3H2WA 3OKLA 2N1KA 3R06A 4DAGH 2ADFH 1BZ7B 1MELA 5AZ2L 4HQQH 3ZDWA 2ARWA 1A5FL 3WUWG 3ZDZE 2A74C 2W0PA 5D70H 5K9QG 4JL2A 1I3RA 2CBTA 4UAOB 4DKFH 3BP5A 4R3SB 2VN6A 1Z3GH 4WWNA 5EIVA 1DQDH 2O26U 3VMNA 1MCKA 2ADJA 3AB0B 5ACZB 2IV9A 4DOHE 4HJGA 2XTJE 1ITBB 3TBVB 1IL1A 4WI6A 4OU3A 2XXFA 3RQ3A 3AY4A 1K5NA 1SYVA 1VIWA 3ZHFA 5BZDB 1RI8A 2B20A 1XH1A 4X6CF 3VFPB 3NSYA 2X6AA 1WS8A 3TIEA 2LTQB 4P05A 4HHAA 5T1LD 5IQ7L 3VFMB 3QR1A 1PEZA 1OCOB 3VXOA 3VWKA 2C9AA 3D12B 2CBPA 2N01B 1GIGL 4JRXB 3UYPB 4PJ7F 1C5DA 4MMXA 4H1LG 2YLKA 1IRAY 1ZS8A 1ECZA 1AGEA 5FHBL 1FVEB 3M8OL 3TN0D 1U6AL 3TF7C 1BLIA 1JDCA 3GO1L 4FCAA 2HSIA 4U0QB 3VG9B 1YUHB 3DA0A 4XPFH 1HWWA 4LOVA 1RJYB 1AP2B 4FXGA 3VD7A 4B96A 5JHDB 4AEIL 1VENA 5B4MD 2YXWA 3CSBA 1MAML 3LRSA 1EK3A 2ESVB 2DYPB 1ZT1B 4NHCH 5HYQB 4P4KD 1TXKA 3K2UL 2JI1A 4ZQKB 5E2TL 3BZFA 5F7UA 1TMQA 5C8JA 3QRFM 3LS5H 5T1MA 3QAZC 4U7KA 4J8RA 4E5XA 4F8TA 4M1CD 3ZKMC 2ZCHL 1NPNA 4WEBH 4H7VA 4JKKA 2A74B 4JHUA 4X6DF 3QO0B 4NQDE 3O3EB 5CZXD 5D7IE 5FLUA 4LCCA 3M8OH 3RDTD 2X1PA 1HI6A 3ETSA 4C58B 3P3TA 4MXQC 1E5CA 2WLIB 1J5IA 1F1DA 3W38A 1ET8A 2VZUA 3MV7A 4DGUA 1YRKA 4R7DB 3GGWB 3SOBH 5HGHB 5EZIL 3H54A 1C5BL 1LO0L 5IQ7H 4G42A 1QSFE 2QQLL 2FLRT 3DHUA 3S8GB 3MC0A 1WC7A 3L8QA 3TC9A 2O6PA 1KT2B 3QXWA 3SHSA 4FQXD 2Y07H 4L4JA 3D1MC 3K80A 3KLAA 4N8CH 3VXNA 4D7BA 3G08B 1AVAA 1TVHA 3ULUL 2J4WH 4XNUL 5DK0B 2OR9H 3N1GC 4L1DA 4I3RH 5T5NG 5CCKL 4JY6B 3IK2A 2QZ5A 4S11A 3ESOA 5I8EA 4HKJA 2OJEA 4NIYE 4QLRA 3AY2A 3H9YA 4FA8A 1MJJA 4HMDA 4XC3H 1MI5E 5D1ZA 3P11H 3VXRE 4PJ7E 1H5BC 3BKYL 3VG9C 4G9DB 1M05B 5ENWA 2Z8RA 1A7RH 2ITCA 3BAEL 3BUYB 4GAYA 5C0EB 1DLFH 2Y6SC 3WIHH 1JE6A 3EO1A 1U93A 5CP3A 5EBWB 1K4CA 5HI3D 4FDWA 4Z76A 2XZQL 5KG9A 4I3SL 4HQQL 2XG5B 5F1IA 5CKAA 4XMXA 2JNZA 5IB4A 3FC8A 4HISA 3RTQB 3BIKB 3IKCA 4GI9A 1JZJA 3EOTL 4ZT1A 3O0RH 4UZGA 1LEGB 1SZNA 2ZYRA 1RV6X 4HKBA 2DMCA 2YRBA 3A6OA 5CIPH 4YDIH 5FYJU 3D0VA 5C70A 1B4RA 3MNMA 4QT5A 2A3TA 2JCCB 1HNGA 2FGWH 4DPBX 3IFPA 3O2DL 1DJXA 2MH4A 4L0YA 4PJEF 1D5MB 2WBJA 5IVZB 3MBEC 4YHML 1T66C 4ZW5A 1CDUA 2WN2A 3CC1A 4U1LB 3O3BB 4A2HA 3GNML 1FFTB 3IJ9A 3CFIC 2IGFL 4MAYB 4C56A 1A65A 3U82B 2P49B 4CBZA 1ADWA 1HILB 4PV9A 2VAJA 4XVJL 3BIAX 1DJSA 3CHQA 5E6UB 2Z91B 3HHMA 3APDA 3JV4A 4K4KA 5D96C 4JRYD 4LOUD 4UDTA 5C2UB 1RIUH 4RNRB 3DUSA 4AENA 4JFFA 4FA7B 4N22A 1GZPB 1IGJA 2ENYA 4OV6F 3VNYA 1KPUA 1IILE 1XGQB 1YY8B 1V27A 2CJ3A 3FB8B 1HE8A 1KEMH 2PYFA 4JDZA 4OZGB 3MQIA 3UDWC 2P5ED 3LEYL 1A9VA 2RBLA 1EX0A 5DZNA 3SGEH 3QXAA 3FFOA 4PG2A 1DDTA 1KLFA 2HUEA 1U2YA 3FO9B 2A83A 4XXDA 5DEGA 1YG9A 4WV1B 1RP8A 3DXAE 4WSJA 2AJYL 1CK0L 1OK8A 3QEUB 4AGQA 4AVHA 4UDUB 3TA3B 5ADOL 2GVYA 4P2OB 4M8UA 5SWZD 5MI0C 5DVKA 3RFRA 4UT7L 3ZRFC 4PRPE 4QKTA 1QEWB 3MRIB 4RFNC 4GAGL 5ICZA 1LP9F 1JYNA 4RMWA 5IROC 2UV3A 4NM8L 3AXIA 3VRLF 5EEWA 1SMDA 4Q6IB 5CCGE 4DP5X 3FQ1A 2WXJA 4KRNA 1ICTA 2WK2A 3DMMB 1QBAA 5FCSH 1F3RB 2PO6A 4M8VA 5IB3A 3ERXA 3GSWA 5DFVD 2DQUL 1HCYA 1UM4L 1TCMA 5EU5B 2LAGB 5DFTA 5JO5A 1G43A 3SOTA 3WEBA 3G9VA 4QHNB 2XA8H 3SKNB 3DI2B 3ZT5A 3ECQA 3II3A 1AQKH 4Z8FH 3EFDH 3A6CH 1IEHA 1XBDA 2Y25A 1LJMA 3OSKA 2G5BB 4JX0A 1S8DA 2J8UA 4DGVL 4PLOB 4TVUA 2B0SL 1IKFL 1FF5A 1NCIA 4JFYA 4UZUA 4N2CA 3RVVD 1XXFC 2OP4L 2BDNH 1KDJA 3CC5B 5C0AD 3IYLW 4KKQA 4QRRB 3KDPB 4AQ1C 3SE9L 4IKLA 1N0LA 4JFFE 4JM2A 1LK3H 1A3RL 5IB4B 2V9RA 2VB5A 1Z9MA 4DPAX 2YMOA 4L5FE 4HK0A 2CNZA 4IJ3B 4NM8H 1KJ2A 3J8F7 1G6RH 3IB4A 2WOBA 1BIHA 4Y5VA 4LGRB 3BESR 4F2EA 1QFPA 4Z7WE 3QHFL 3LH9A 4LHUD 3RVUD 4OFPA 1IEAA 3FUJA 4JZNB 3T3PF 5AOIA 1DANU 1K85A 2F53D 3BD3A 4GSDH 2F7IA 4NZTH 1IT9L 1JRHL 5BV7C 1BVLB 2X6CA 1NBVL 4QJ3B 2HT3C 2BVOA 2P5EB 2QVTA 2ZQKA 4CDGC 3W1ZA 3PGCA 4OCWL 4E9YA 3TPUA 5LDSA 4WCYL 4Y5YC 3O6FC 3CZUB 3ZKXB 3QIUA 2FX7H 2JELL 3GBEA 3VXTB 1PG7H 1ZXQA 4TNFA 2QPDB 1A4BA 4B9JA 2X4RA 2BM3A 1BZOA 1S7RB 1E7UA 1K5NB 2IBGA 4Y19E 1NGPH 3Q1SL 4O5LH 5TPWH 4DCQA 3G04A 4ZTOL 3U48A 1QBLL 4ZOEA 1ZOXA 2Q1EA 2IG2L 5F3HA 3BQUA 5GRVL 2H26B 2QKIC 3QA3B 3X1FA 4OCRH 3DGCR 2Z7WA 4NGHH 1WDAA 3QNZB 5F0LB 4JNXA 4OCYL 2Y0SA 1CO1A 1ZTMA 3M17A 5C86A 2AQSA 2DEYX 1QPKA 1M05A 4ODVH 1Z9PA 3GINA 3CFJA 1U42A 3OJDB 5I1AA 2K8QA 1CDHA 5GISL 1MHHB 4AGNA 1NQBA 2J1XA 1O75A 2NQCA 4D7PA 5FYLL 4ADIA 3RX9A 4ZS7H 1DBJL 3MRKB 3D0LA 4ES9A 5IKCB 2Z92A 3LHPH 4X98A 4D0BA 3T1FA 2WGNB 4WTXA 3HE7D 2B5IB 5IM7B 4K7FB 3B2PA 4LP5A 3ZHDA 3ELAT 2R0WH 5CBEB 1RK1A 4PRBA 5BRZA 4Z3FA 3TT1H 1YMME 3IDYB 3N91A 5B7MA 5FYKD 1TO4A 3BLBA 4U1LA 4PR5B 3D18A 4WW1B 3S5ZA 1EFQA 3QHTC 5K33A 5T5NF 3K8LA 3P4OB 4G6FD 3WIHA 5IVZA 4ATTA 1OL0A 3B5TA 1TSHA 1AMYA 1INEL 3EJYD 5GGQL 5IFHH 2XTSA 4IMKA 3O2VH 1QSFB 3FONA 1LE5A 2Z8SA 3DROA 1HXYB 3A4DA 1EERB 4LZKA 2F8OA 1J1OL 4G6KH 1LEGA 1G7HB 1N0LB 4L18A 5LDUA 3T77A 4BHUI 2HLFC 1JTOA 5JDSA 1CXLA 2JKNA 4MAZA 4NPYA 5HHPA 1A3RH 4G70B 4I9WD 5EU6D 1IBFA 5DS2A 1Q9OA 2HPOA 3SQRA 4KK8C 4BKLB 2VUOA 1DE4A 2AJ3B 4HCRA 3QDAA 3DYOA 3TO4D 4DO4A 3CH8A 1QO3A 1LO5B 2DI9A 4L3FA 1A6TA 4YXHH 5T33H 2NOYA 4H20H 4NLHA 1BEXA 1KB5A 3CFTA 3HG2A 3VUAA 1I1AB 2EYTA 3ZTNH 5DQ9B 1DBMH 1NKRA 2BSBA 4XZ4A 3KJ6L 1DEEA 1N68A 1PAZA 5K1JA 4PJDA 1XEDA 4JRXA 4YFEA 4DK6A 4J2XA 2XQYK 1KIRA 4ACPA 3LKRA 4GW1B 1BVOA 3U6XS 1AIFA 1DVTA 2MTPA 2BNQD 5BW7C 4XNMB 2AK4D 3LMJH 4JDTH 2HTKD 1XFPA 3RI5F 4XWGH 3ROLB 1EEYB 1MIEL 3EJZD 2EDNA 1P5VB 4HS8H 4EI5C 4X83A 3LN9A 4OKVA 3I9PA 1ES0B 3MO1A 1NUGA 2GUOB 3L5WB 4BE5A 1RVFH 3TWCL 4RSVA 4LSRH 3IDNA 5FUOL 4MCMA 3AG4B 1FYHB 2A4ZA 4O5LL 1AZVA 2EE6A 4IOFC 3HUJA 5A2LH 3PS6A 3IE4A 4MDRA 2BVYA 2H26A 2E59A 3HI1B 3K71A 5FYKU 2N0KA 2ZE0A 2LR4A 2UZXA 5A2BA 4AIZB 3QXAB 4XBPA 4WJKB 4OD3H 1ILUA 1SN5A 4BWUA 1KGWA 5C0IB 5GSVB 4WFGD 5HGBA 1PF3A 4BH8B 4F3FB 1AG6A 1S7RA 3LZOA 4J3WA 2VKXA 2VDRH 3U30B 4BFFA 4MFHA 5IQMA 4MAYC 5T3XL 3II2A 1RZPA 1KPUB 2L04A 4UBDD 2NY6D 1YUHA 2ZJSL 2AK1H 2V17L 1N2RA 3UBXB 4HLJA 5IGXL 1RSYA 1NGXB 3GDBA 4NS0A 1BYNA 5MENE 4LRNL 3N43F 3FB7B 1M57B 4GBXB 2UZIL 4KPHL 3VSVA 1INDL 1HOEA 1RL1A 1UWGH 3OF6A 4QKXB 4ELMA 1TQWA 2VXTL 3CBRA 5E8EA 5EBLB 1PKQE 1HL4A 5F7EH 3QDJB 3BP6B 3ULVC 2R1WA 3B3BA 3T0XA 4KJYA 2NNXA 4G9FD 4Q56A 5EBMB 4Q58C 4YSCA 4L3EB 2P43B 4HHAB 1TFPA 5LN8A 1YC8A 2LHAA 1SHXA 1GGBL 2P24A 3CSTA 5CP7A 3VGGA 3SDDB 1KZYA 3LDBC 5K9OB 3BEWB 2R4SL 5FYJL 2VLRA 5TF1H 4MXVF 2R69H 5MERB 3MN8A 1CS6A 1PFOA 4BQCA 5ISZB 3KBFA 4HIJB 2VSCA 3EYUL 5K93A 2PTUA 3X2QB 4K23L 2WP3T 5E00A 3PWJB 1U9KA 5DHVH 3RTQA 3GMMA 3U1SL 4JFYB 4G1EA 3UTZB 1LMKA 5FYLE 1KFAL 1UT9A 3V6ZA 2M1KA 4YX2H 2VJ0A 3W82A 1FAIH 4HWEH 1FNLA 3DMMC 3Q13A 1ONQB 3UC0H 3BWSA 4XAWL 4I2XE 4X5PA 1PL3A 5GGSA 4X5LA 5DF0A 1S3RA 1DVFB 2F53E 2ZPKH 1JPFA 2H2PC 3SGEI 2XZAL 3R4DA 4IIQA 1OO2A 3ZQXA 4B0MM 3ARGA 4FRWA 4MQSB 3CFBA 5FYKE 1W8NA 3TCTA 3GHEL 1B0GB 1FBIL 1BP3B 3IDJB 5CGMA 5MEOB 3EKCA 4FJZA 4U6HA 5CZRA 4KVPA 5JW4R 3IU4H 3VX0A 4AK2A 1NEPA 4PJIB 4Z7IA 3I2CL 2EUWA 1JF1A 3QPXH 3RDTC 2HZHA 3VJ6B 3BGAA 5GRJH 3SKUD 4LCWD 3RWHB 3FB6A 2FJFA 2F9BT 5AB1A 1X9RA 1AGBB 5CMAB 3UGUA 5PCYA 1PCXA 2N3JA 5E4IA 5IESH 1I8IA 2IH9A 3OAWA 3VFGH 4M02A 4OY9A 4HS6B 3WE1A 3M46A 2Z8VC 1WAEA 2VC2L 3DTXB 1RZKC 4IQHA 2ZX6A 3FO9A 3CTTA 5DHYB 4IOSD 4GY4A 4WO4B 2YA0A 2R15A 4RETB 1AO7D 5D4IA 2WN3A 4EF3A 5TGBA 3L4ZA 4PS8A 4YAQA 2YJLA 1U2CA 4KQ3L 5EUKA 2FH8A 5CJ8A 2CRMA 5FHBH 5CCKH 2XZZA 2AHIA 1EFXD 1IEBB 2B14A 4K9EH 5L8JB 4JQVC 5EZIH 3KE0A 4FYQA 1KZQA 3ZYIA 4GO6B 5I18H 3WTXA 2GIYA 1XV8A 2XZAH 5A6MA 3VXSD 5ITFA 3C5ZA 3QPQD 1CG9B 3A4AA 4MA3B 5E9NA 1T2QH 5KS9E 3QYNA 2Y3NA 3S3PA 5JLZB 1EJ6A 1TCRB 3ARFB 1EBPA 2CM5A 3NJNA 3V6BR 1ADQH 1PY0A 3IF1A 1ZVYA 3NZ8B 4HBCH 2CKBB 2VYRE 3S5LG 2GJ6A 4PRIE 2CO4A 5IREA 4K5LA 1EEUA 3WJLC 4GG8B 4LCUA 5CLZA 2XRAH 1T1YA 1Z66A 1XMWA 2UZPA 4G6ML 3PP3K 4IS6B 4Y5VB 3UTSA 4HZAA 4XR8C 5CINH 2EEBA 2BMKA 2DMGA 4U6VH 1K6QH 4DW2L 3QDGB 4QY8A 1AQDB 3BMWA 3CUPA 1X4ZA 4PJGE 5IHUH 3WLBA 4GG6F 1SHWA 3MODH 4XP1H 4QRRA 1DL7L 1SVCP 5GSRB 1RJLA 3KXFB 2XTJC 4YHLH 4DP8X 2H32H 4G9FE 2ALAA 1N7ML 2WQUA 3TT3H 4XB8A 3PUCA 1CD9B 4HJ0C 2W9EL 3D69A 3T4YA 2NZ9D 2EKSA 1UT1A 1E50A 4J12A 3AS1A 2R9HD 4FQ2L 4NO2A 3FQ4A 3QJFB 2Y2YA 5F6IC 3T3PE 1QLEH 1FUNA 3CWGA 1W6WA 1I7ZA 4P23C 4FL4B 4LPYA 1AR2A 4V2CB 2IOOA 4YUEL 4XNMA 3RU8L 3HAEH 3GXPA 3L3IB 4XCEB 2R51A 1DQQA 2ATKB 3P0YH 4QWWC 1RZGA 3VTAA 4A67A 5JORB 3HG5A 2Y7QB 5C08B 3KPNA 2Q8BL 1YAZA 3BAKA 5I26A 4NZFA 1MNNA 1JZDC 4FEIA 3T0WA 3TEXA 1U8LA 5IROA 3CFJB 2PCPA 1Q9WB 3MA9H 3U9PH 3BLKA 1AO7A 3HZVA 4FZEH 1OPOA 1TTCA 2Q76B 4JO8A 2BOCA 2X6UA 4W9HC 1JUFA 4FE9A 2YLHA 1BBDL 3LZQA 2V2TA 1MRDL 4CBPA 3GBNH 3GSRA 1X6NA 3D25A 4K3HA 2AERT 4K9EC 2X1OA 1HH9B 2IPTL 4FNTA 5IEHB 3NIGE 4OJAA 1L9NA 3FSVA 3REVA 1YPZB 5D1ZI 1N3NA 5C9KA 4XH2B 1TZIA 2H47C 3DSNA 1EXUB 3K1KC 5JIQA 4JDZB 4X80H 5ISZA 5MERA 3QHZL 2UUDK 1WGVA 2NT0A 4OFQA 3HC0B 1NBCA 2VQ4A 4HUUA 5JIDA 1A4CA 4WGKA 1RK0A 1QACA 2DM7A 3KLHC 4QRUB 4Y4FD 4NT6A 3U7WL 4HU2A 1XH3B 2Z93B 4M6AA 4GJTB 4QXUH 4Y2DC 3VRLE 2NY0B 1OHQA 2BVQB 3Q6GL 5B1JC 2A9AA 5EB9A 1JZ3A 3UPRA 1IC7H 3ARBC 4JFEB 3TBCA 2Q8BH 3A22A 4UTBL 1A2YB 1JNHB 3EJCA 4IK7A 1KTLB 2EYTB 4ENZA 5IM7A 5HDBF 4JCWA 4N90E 2SODB 5F7BA 3AQYA 3GMOA 2C5DC 3P3RA 5FKAB 2CHZA 3RWGB 1OQXA 4ANUA 1A6VL 1XHHA 2R69A 3QNXA 1W9XA 4OFVA 4K7PH 3IDGA 1W0VB 2J1KA 3OWRA 1MXGA 4NC0B 2AEPL 2Y07L 4N8CL 3IFOB 2V3DA 5C6TH 2VLRD 1DBBL 2OI9B 2JIXD 2E86A 3QHZH 3S4SA 4D9RE 1HINL 4AT6A 2DQGL 2FT7A 4R0LA 5E51A 5AB0A 3FT0A 4N4YB 2R1YB 4G72B 4WNJA 1YECL 1HHIB 3MLRH 2V2WB 1JRHI 4PJBF 1YMMD 2F74A 4OZ4A 3SBPA 1FVDB 2IAMD 1RUKL 3G04B 1D6VL 3LOWA 1UD2A 2DM2A 4FTVE 5IWLA 4BINA 3DNKA 4Q4EA 2EDEA 5GRZA 1KB5L 3VWJA 1LWHA 4FN0A 4PJGB 1FIGL 2Q6WA 4CGTA 1Z9OA 2K1MA 3VH8G 5HDOA 4O2FB 5HYJE 1E8XA 1T1ZA 4BK4A 3ARWA 2VLKE 3KXFE 4RAUB 4DK3A 4ZMPA 1JPTL 1OCWH 1RZ8A 3LKRB 5J9PA 2KL6A 2J43A 4WI5A 3TFKD 2X4QB 3AREB 2P3YA 3QIWC 4HUXB 2YPVL 4Z0XB 3QQ9C 4YZWA 1LDPL 2D0HA 4AG4H 1KXVA 1UG9A 2GBUA 4YHOH 1S7SA 5IB2A 3QIBB 3Q1EA 3OX8A 4D8PB 1DQVA 4JFHE 3RVWC 1JHTA 2YMTA 3DO3A 1NJ9B 4XX1E 1DHKA 1I53A 1A7QH 3V4PB 1UWFA 3N42F 2CLRA 2O5ZH 4C56E 1EO5A 4Q52A 4L9LC 1BF5A 3LNIA 1BQHG 4UIKH 3CZEA 4DN3L 3ATDA 3SJVA 1NOFA 3MXVL 4DWHA 2C9PA 2H3KA 2B4CC 1QFWI 5F9WC 4U7SA 3T77B 1UOWA 1OTSD 4LKCB 3S5LA 1IC4H 4OIIH 4E9WA 2OI9C 3QDGA 1RJCA 4KMLB 4NOFA 4LHUG 4M3JA 1V3JA 3EHBD 5ESVB 1PZDA 2VXQL 1CIDA 2EVHA 4OW6A 2VMEA 1E4HA 1VDGA 3NZSA 2IFGA 2O6EA 4X6BB 3TBSB 3EBAA 5B7EA 1C7SA 3V0JA 1N59B 1UT2A 4LGSB 1ACZA 4M6NL 4AQEB 4U1MA 2AS5M 2P9RA 3RL2A 1ZS8B 2EO7A 1P7QB 4PIRF 4NNYA 3IXTA 4J4PC 3C5SB 4JN2A 2IANA 2ICWJ 4M1DH 3LJ3A 3ZE1F 1E40A 4X7EC 4AG4L 2C26A 1CE1L 3TT1L 1JK9B 1KBGH 3FQRA 1S7WB 3EYQD 4OCYH 2VMJA 3BSZL 2VABB 5GZOC 2X2IA 4AYDC 3DRQA 5TPWL 4P4KB 2EE9A 4ODSL 2X53A 1VLXA 3P3YA 1A6ZA 4PREB 4ZTPH 1MJ7H 3KWTA 4AYSA 5LUMA 3CLWA 3TCLB 2WLKA 4U3CA 3MRLA 2FD6H 3DO7A 4MX7A 3B1TA 4WEUD 3T6WA 3TEYA 2ICEB 2W07A 3CSPA 2LU5A 3LKOA 2AEIT 4YLCA 1OPGH 3S36H 1MW0A 3ETBJ 4KRPD 1B3JA 1IAMA 2NY1C 3BP5B 4R3SA 4QOKB 2IMNA 1EJ8A 2GTZB 4XRCA 3SJVB 4TVPL 4G3YH 4UQ3A 4KKBD 1MLBB 1J1XH 2IH3A 5FGBA 4NERA 1JWUB 1HINH 3WEXB 5I28A 3IXAA 2VL5A 3EFOB 2PCPB 1H15A 2XZCL 3R4RA 2ESVE 3D4YA 2OMZA 4WWOA 1BZ9B 3DJZA 3WO4C 4BQ9A 5IJVB 1RUKH 5L9DL 1MCWW 1PZ2A 2G75A 2VM4A 1MZZA 2Q3AA 3AT9A 4HJSA 4P3CL 5I1HH 2DDQL 1DQQB 3H6AA 4A6YL 4UI2A 3ZDXB 2WUBH 4NQDB 1DCLA 1VGEH 1DQLL 2NY6C 1VEMA 4N0CC 2BFGA 2WSPA 4B41A 2FNWA 1MWAA 3RE0A 1EQWA 3IDIA 2HVKB 1NWOA 3O8XB 5IF0A 1MRFL 1INQB 1LM8V 2NQ3A 5I0YA 4JAMA 1OP3H 5A2JH 5E2WL 5K1NA 4KWUA 5FA3B 4NKMA 3SDXA 4TLKA 3ZE1E 5I5IA 1LHZA 2CKBL 3G5YB 3LXAA 5D7JB 3LIZA 4LK4A 5J1SC 3T4YB 3PHOA 3H9SB 4K7PX 2F7PA 2JMRA 2A4EA 1KJVA 1Z9NA 2GBTA 4FXLA 4C83A 2VLKB 3TBTA 3VFSB 2IH1B 4ZSOB 5DHVB 4UDUA 4HKBB 3TA3A 5DJXA 3O9WA 4EIZC 4KK6C 4WHYG 3BE1L 5FGBC 4PV8B 5DURB 4D9LL 1LQBC 5DQJA 4J8RB 3BRDA 4PMFA 3IDGB 4AC2A 1MI5B 4BRVA 5E4EC 4ZMWA 4NRYB 4OCRL 1KTDB 5CP7B 1SBSH 4AV4A 1NAMB 5JA9A 1KB9K 3KPPA 3QNXB 3WFDH 2I27N 2EIKB 5BZWB 2HVBA 3MZGB 3SCMB 2P80A 3SD2A 2BVQA 1CPUA 1WAAA 3D09A 1XGUA 3QIUD 5GRUH 5HGAB 3JZ7A 5CZXC 1JNHA 1UEMA 2KT6A 5IZ7A 1FYTA 1W91A 2FEJA 3LVEA 3UZVB 4QHNA 1GZHA 5BVJB 1BZ8A 1QSEB 2WXRA 3BFWA 2O5XH 3FT4B 3N5AA 3MJ9A 1MG2C 4LRNH 1A4JA 4LASL 3A6BL 5IVOA 4LEEA 4LHUA 4R2GC 1Q9KB 4Y9BA 1BFVL 3A3YB 2CLVB 1F42A 2BCKA 3QUYC 2DYPD 3MCKA 4KRMB 2DWXA 4F91B 2X1QA 3VWJB 5CILL 1G0YR 3KR3H 1R5WB 5E2JA 3GSRB 3HE6C 4QT5B 4OQTA 3EGXA 1N64L 1X9UA 3KPSA 4MZRA 1E5BA 2ZKYA 1RIVH 2PW2B 1TZIB 4LVEA 4AQ8A 3EDEA 2H3NB 1BQ5A 1O5DT 3A4EA 1YEEH 3QUXC 3DPBB 4TNEA 1AC6A 4LCCB 4XB7A 2P8MB 15C8L 2GC4C 5EO0A 5L2KA 1T21B 2W81C 2VZSA 4G6KL 2ZX5A 4JRXE 4LT7A 3ZZQA 4EQ2A 1WBYA 4WO4D 1HYSC 2QVIA 4XPHL 4DKAA 2OMXA 2IAMA 4LBAA 3X1GA 1U3YA 1AGBA 1T5WA 2HRGA 3T0DA 3CZLA 5IUCA 2DQHH 1RPKA 3WY4A 2X41A 1MJJB 5D1ZB 3RWGA 2ICWB 5FKAA 2K8MA 3HG3A 2OJEB 3S97C 4ZFOA 3ULVD 5IFHL 2AKRB 1MH5A 4J3OC 3A6BH 4MA1B 3LD8C 5GGUB 5BV7B 1IX2A 4MKTA 4PUBL 5D7EA 1L0YA 3QUHA 1EUUA 1E0OB 1QUNB 3PHAA 3NJIA 1CD1B 1CLYL 4FNLL 1E9OA 3ME0B 2CA4A 4N90D 4MDJA 5DZLA 3ZO9A 1WP6A 5GS0D 3H6JA 1LP9A 2ZUSA 4KJQC 2Y23A 5KAQG 2Y6SD 2ZP0T 3ESPA 1NAMH 3K8KA 2YFOA 3LCYA 2D4FA 3PREA 3SDYH 2W65A 1BM3H 2WVTA 4LIQL 3T9WA 3DOHA 1WT5C 3LH2H 3QFJA 4UQAA 4CGUB 1FHNA 2ZAHA 2J12B 5TQ0H 2EIZB 4K2UH 3GBDA 2F7QA 4BFEA 5C71A 3BIBX 3KPMB 1FZOA 2H0EA 3QQXA 4JFQB 5E5RB 1AC0A 1T1YB 3EO9H 3JWDC 1UA6H 3KYNA 4X4ZA 1UA3A 4ODBD 2AEQH 1DO5A 4FQ1L 4DEPB 4MMYB 4POUB 5T1DH 1S3KH 2BNRB 5C6PB 4JO4H 4XNZC 3APCA 4PGEA 4G43A 4G71B 2ZKHL 2RTTA 3HN3A 4HJ0D 4JRYA 4R7LA 1LO0H 1CICA 3NQIA 3RJOA 1JCVA 5ID1A 3GUTB 1UJ3A 2JK5B 2OM5A 4CN4A 3F7YA 4NP4L 5D7LE 5DSCB 1KB9J 2HFTA 4K94C 1PD6A 3CHSA 4FFZH 4OCSL 5I66B 3UL4A 1YEFL 1NLDH 2A5UA 1UZ6F 1NANH 3T4AC 1CWVA 1M3JA 2GTWB 3V0AC 4YHYB 4JREC 1JFQL 1UXSB 1AXSB 1DZBA 4NKIH 3O41B 1UYWL 1KXTB 2BVPB 1WSST 4GLRH 4XNXH 1Q1PA 2IQAB 2WAHA 2BSEA 1B0IA 2PTTA 5IROD 4X50A 1U4FA 1YDPB 2E8ZA 2WMPB 3HRZA 3T71A 2QBWA 2TSBA 3QJFA 3T0ED 3UP1A 2ZZUT 4LLQB 3QEHB 4KUZL 4ZXBA 4HZ1A 5EU3B 4MD0B 4FFZL 3ALWA 4I89A 1GW0A 1K6QL 4LLDA 4K3GA 1T6VN 2B3RA 2C1PA 2OX5A 3HPLB 2A6KB 4R7DA 4XNUH 1FCGA 4E9VA 3EO9L 3NFNA 4F33A 2QADC 3ZIYA 1ZKAA 3MJWA 3NJLA 3R1GH 3SGJA 3ZIMA 2KERA 4NO5A 1WK0A 2YK1L 3QPQC 2BOBB 4U1GB 3ZX1A 4YSSA 3MRJB 4OB5L 5L7XH 4YXLH 1S9WB 1BF8A 4K7PY 2Z31D 4L4VB 4YQXH 5D1ZD 1OP4A 3KCPB 4DQOH 3NA4A 4QWWD 4U6TA 5FYKL 1FRGL 2PXYD 1A1OA 2MOQA 3BVDB 3Q01A 3UTQA 4XAKD 3WIHL 3ZE0B 4A63A 4U6VL 2D7TL 2KLTA 1TPXB 3ARSA 2XZQH 3U9WA 5IW1A 4FLSA 3SBWC 4XPTH 2V0AA 2FQDA 1QHQA 4U05A 2NX5A 3R8QA 3PGCB 3OKDA 4KO6A 5CUSH 2F08A 5C0JA 3Q06A 3MLZL 4PGJA 1GYUA 1SY6H 1Z32X 1W72B 3MRQA 4OB5H 4UOW0 5AFAA 3P0YL 4UQ9A 1KTJA 2AC0A 3SJVE 4PHZA 3S34L 2A6JA 3FQUA 5AVYB 4P06A 2XT1B 4G7YH 2VR9A 3VX1A 1SDYA 3K2MC 4AL8C 1VADB 5DTFA 2GJ6E 4KVCL 1B0RB 4M9OA 2CDGA 5J12B 2ADFL 1W72H 1NICA 2HKHH 3HR6A 5DJCA 4NN5B 1GW6A 1S7TA 4GEIA 3TBYB 4Z3IA 3REWB 5T1KB 5L7XL 3GHEH 3GXDA 2X7LB 4XCCL 3RY6A 4UNVA 3X3FL 3US0A 4Z7QE 4HLZG 4XZUB 4YSPA 3UZEA 1FL3A 6PCYA 4PTTA 2VL4A 2R2BB 3T6ZA 4URKA 1KIPB 4QHUA 2XETA 4HIPA 5D7SH 3ZTEA 1DQKA 3TN0A 2X44D 2WO3B 5KTEH 5FA3A 3DIVA 3QC5X 5MEQA 3MJGX 3UBXA 3PHQB 2DIEA 4ODHH 2CK0L 4IOSA 1PYWB 3U7WH 4NHCL 2NX5D 5DEJA 5DA4A 4G1MA 4PWEA 3OHXC 3RGHA 2I7OA 3GXMA 3T2NL 3UTTB 1TPXC 4LQ1A 3W0WE 3QJXA 3GSWB 2FSEB 4OJFL 1J48A 1E8YA 1ET7A 1P4IH 2V5RA 4JO5A 3R8BB 1FGNH 4V1DE 4U1KB 3RB7A 4ZFOB 1SLWA 2WY3B 2P5WD 1RPUA 5HI3C 1FE8L 1OV8A 2ZWZA 5AZUA 5IB1B 3MFFA 3DBSA 4F2MB 3NPSB 1BFOA 1ULVA 2RJMA 5CFHA 5FDWB 4M7JL 4YBQC 1KXVC 3N04A 5CD5C 1YEIH 1I1FB 3M17B 4DGVH 4K7PL 1WTGT 3RKPA 1VSCA 1G4MA 5I71C 4S1SL 3L1GA 3MLUH 2A1WH 4YH6A 4IGBC 3RGBA 1JP5A 2GUOA 3L5WA 1D5IL 3ROOA 4LCWE 3RJQB 5J56B 1L7TL 2ALWA 2JQMA 1HOCA 2FLBT 4N2LA 5IMOA 2XWBA 2V2XA 1JFHA 4ZDHB 1DJYA 1RZ7H 4ANWA 5DMYA 4DK5A 2UWEF 4C55A 4CU8A 5CZVL 5A16B 3N1MC 1KN2H 5FHAH 5IHWA 2DZEA 4JO3L 2CLVA 3GIVB 4HWZB 3ZYZA 3P73A 1R34A 3J07A 4L3EA 3ISYA 1UFUA 2CHXA 3VGDA 1A7RL 3BAEH 3TJPA 3QXDB 3H3BC 5L0QC 2ZSWA 3MMEA 3WS3B 2WLJA 2IPUK 5EOCL 3X13B 4UTBH 1LO5A 1BG1A 1ZHKA 4D0DB 4M7LL 1EPFA 3QUYB 3PFUA 4O51B 3RHWK 3WTUA 5KSAB 3PL6B 4E41E 4NQVA 2IVFC 1N59A 3TYGH 2NY4B 5GIRB 5CJ5A 2UX7A 5CHNB 1B4JL 4X5WA 1NMAH 3ZE0E 4NOBA 4DZBB 5GZOD 4JHBA 4S1SH 2FHCA 4BFGA 2PPDA 5T3ZD 4PV1C 1OIOA 3TTSA 2QGEA 3B9EA 1ZIAA 4DTGL 2WLYA 3VFOB 4FI7A 4X4YB 1M9SA 2KKQA 5IOKA 4JFOB 1FNFA 4I7ZC 1SEQH 2WXMA 1TU2B 1U3HB 4MMZC 4NUGL 3L45A 4JKPH 3S3DB 1XR8B 5INCB 3L48A 1SMOA 4M8QA 5F3FA 4LARH 5E7FA 5H2BA 3OAYK 4XVSH 5DHVA 5FUZL 2DQIH 1FFNA 25C8H 5CM1A 3HVDA 4KOCA 4DNLA 3OD3A 1R24A 2CLRB 3G5WA 4S1RH 4HAFA 5DZOA 2IH8A 5JHDE 4YBHA 3I6GB 3PFQA 3BCDA 1BECA 1KB5H 3D85A 1H5BA 2AABL 1SFDA 4H8HA 3KDMA 3OPZL 1SVZA 4PCSA 5ICUA 4ZPVB 2VDNB 3V95A 3WBDA 1ES0A 3V0EA 5BUPA 5EF2A 3FTXA 4BFIB 1SEQL 4NO0A 3JTSB 3BSZA 3EBHA 2V8MA 5EC2B 2C7UA 2OQJB 2HVKA 2YPKA 4YR6B 3V4PH 5JXAH 3E3QC 3OLGA 4K3EH 5CF3A 4AE1A 2I9LA 4NZ8A 4GFXA 4OFYA 5ACLA 3EJZC 2RA1A 2R39A 1QLEB 2XWZA 3QRGH 4RQQA 5HGDA 3D0AA 1OAQL 3L3JA 2EE2A 4NYLA 2ZP9A 1KCUH 1G84A 2FWOB 5FM5O 1BOGA 2Z7UA 1VFAA 4JLRB 3PUUA 4R84A 4J39A 1OD9A 4ZTPL 1HH6B 1G9NL 3MV8B 1ZA6B 4HJJH 1KEML 1R46A 1S5HA 2PW2A 3O2VL 3S35L 3UTTE 5GGRA 1V10A 1GHFH 1KNOB 4MAUL 4YC2C 4ZYKA 4N2HA 2G3XA 4P9ML 4ZW8A 3VGAC 3WV0A 1FZMA 2MCMA 3J7HA 2OJ1A 1QQDB 1VGEL 3KPSD 4LRIA 3LKPA 4WW2C 1QHOA 3WL9B 2B1AL 2WB1A 3P4MB 4AW7A 4F2ME 1OGAE 1ET5A 4KI5D 3VB9A 4MX7B 2O5NA 1MQKH 2DYPA 4CN6A 1NC2A 1RIUL 5DC2A 5BS0E 1LE5B 2FJHA 2QHLA 3QCTL 1I1AC 5GRVK 3VGEA 1U92A 2YD4A 3CFCH 4K5NA 3ECBA 4G5ZL 4NSKA 2GJPA 1R3JA 1VZGA 2COVD 4GP4B 2XWTB 4KDTA 3QC6X 4GXVL 4YFLF 4JL1A 2ROXA 1J0HA 1H8NA 1QOKA 1LD9B 2QKIA 3FFCE 1Z0MA 1FVCB 4PV9B 2HX7A 1E8ZA 2EXYC 3GRWA 2DQEH 1OGPA 5LAXA 1UVQB 3MLTA 3B9DA 2J2ZB 1J05B 4IU2B 3KPPB 3NK4A 3LTVA 4TYUA 5DA0B 3LNGA 2EO9A 2XA8L 3UPCA 2I60H 1SLUA 2JCCE 2V37A 2R23A 3L4VA 5JR1H 4QJ4B 1CYWA 1SOSA 2AQTA 4Y1AE 1FGVH 1R17A 2AF2A 2HTKC 2EEFA 2WNWA 4E41A 4PJBB 5GJSH 2HJKB 4ZAKA 1MKFA 2QELA 1NMAL 1HQ4B 3FFCA 1DEDA 3FO2B 1UKSA 2ZICA 5HHNB 1LO4H 2V7NB 3B8YA 1J0ZA 4KX9A 2NUPB 3P40A 5I17B 1U8HB 4N3TA 3T0EE 1ETA1 1RURL 4OV5A 3EJYC 2NXYD 3DSFH 4NKMB 1M7XA 4ZYKB 5CBAA 4JANB 3VFVA 5E4OA 4FXKA 4R7VA 1RULL 4YN3A 5C3TA 3AM8A 3L3OB 3KL0A 5D1XC 3EO1B 5EBWA 6CGTA 2DAVA 2X4OB 4UMGA 1FNSH 1WEJH 4XVSL 4P2YA 1IC4L 2QTVA 1OSZA 2EH7H 2WNGA 3Q6FB 3OKKA 1IBBA 3OB0K 1THCA 3GF8A 1CGUA 1XCXA 3V0FA 1DJIA 4L1LA 4UIMA 5ANMA 4B3EA 4GSDL 4FD0A 1TYRA 3CSGA 1U8MA 3NA9H 2NDGA 2XQBH 3V5HA 1QNZL 3BP7B 4J3VA 5C7XH 1IFHH 2FVNA 5LCVH 2GYSA 1F6AB 1YEEL 1DBKH 4I1RA 4R4FH 5LNGA 4L3CB 4OI7A 1I1YA 3O3DA 3RWFA 2VJ8A 3ZQ9A 1SXSA 2VXTH 5F7EL 4DT2A 4OIIL 2YA2A 1EHLL 1BVKA 3FCTA 2BOLA 1BPVA 3K81A 5C07D 1EJOH 1A02N 2DQHL 1NSNH 5HGHA 5GS0L 2CR3A 1QFWM 3V7AE 2C9UA 1H3TA 2IANE 3KM1A 2YD0A 3WJJC 4P2OA 1IJNA 4GH7B 1EDYA 4S10A 5GSRA 2A74A 2QQKL 4Y19D 3RVTC 4P9HC 2G0KA 4QHKI 1P7KB 4IRSA 5KSBA 3DUSB 5C08E 3AS0A 1CGXA 3PRZA 1PQZA 1NFIB 4IRZL 2IIJA 5AYQA 3D51A 1WGOA 4XMKH 2X2JA 3RVXC 2H32B 1AH1A 4PJIE 2IADB 3TBWB 1NSNL 3JUYA 3KR3L 1JGLL 2WNXA 4ZTEA 3X13A 1UZ8A 1DDHA 4HS3A 4B6ZA 4RGNC 5DGQA 1HTYA 1OAZH 4AUYA 1YHPA 4E9SA 1TZGH 4OT1H 3U2JA 3NZ8A 3LKSA 3B7UX 2WLHA 5AVSB 4MXWL 4M00A 4ZD3L 1E90A 1QW8A 5JHDD 2BXZA 3D0VB 5DYFA 2BVEA 4LCWB 3WTTA 3QZLA 5IEKB 4HIIA 4O02H 1LEIA 1YPZA 2ZXGA 4KO7A 1KCSH 3IKCB 5GS0H 2NY5H 3PWUB 4X7TB 2W38A 2B9BA 4ZS6C 3L3HB 2XG5A 3FUMA 5F1IB 2PCYA 3KLSA 1NINA 1A64A 1U95B 4OFYD 3EG9A 4JO2L 1F3JA 3PAZA 1B6DA 3NAAH 3EGSA 3ECUA 3QI9C 4P2OC 1ZHLB 4WO4C 4Q6YA 5DZPA 4IRJB 1C7TA 5F1OB 4PGBA 3C6LC 1UKQA 1WFIA 5IQOA 4CU7A 4BIKA 1JPSL 4OCSH 1HH9A 3QJUB 5HDQL 3SSGA 4MJ5A 5LVEA 2JH2A 4I1NB 1RU9L 2ZSVB 4LU5L 5DEGB 5J8OA 2OXHA 1F00I 1N5AA 5JW5A 4PRIB 4LBEB 2GT9A 4ODXA 1Q0XH 2ITCB 5T1DL 3HI6L 4N0FB 1O9VA 1XIWA 4C59B 4GIPD 4Z7VE 1JPGB 3F05A 2I7SA 2BWQA 4LNVA 4HETA 3CLEH 5AUMB 3NGBB 3CXHJ 3KLLA 3L4YA 3SB3A 8FABB 3WEOA 3LS5L 5JHAA 4GQQA 2FWSA 4WWPA 5TDOA 3L81A 4K2UL 2C3VA 2Z35B 3KDMB 2DQTL 2A2QT 4URTB 1ADQL 1UOVA 3NRFA 5FA4A 5FO8A 5GZOA 1KYUA 3MTRA 2I07A 2LU7A 2V9QA 2NT1A 5F93C 4JFFD 4U1JB 4F7EB 5AB2A 1C12A 5SX4H 1HJCA 4JRFA 1RZQA 2UXTA 4O58L 2A9NL 2LOEA 1BM3L 2L4OA 4DESA 4F1ZA 1NCDH 2D9QB 2K4AA 1FPTL 4DHLA 3BJLA 4HCIA 5EDXA 1FL3B 1GGYA 2ZONA 3T2PA 4JFWA 4JVPA 2C1OA 3QJOA 5BJTB 3IAPA 2QL1A 1YEJL 1CLZL 3CSYB 5D71L 5T1KA 1J8KA 2WWOA 3HFFA 2QPEB 1U8QA 1UACH 4HP5A 4L3ED 5DS8A 5BRQA 2WBJD 1UYWH 1U6AH 4YE0A 1ZVSB 4JRYE 4MNQB 3TV3H 4CC4A 5DC0A 4G7SB 1G5GA 4JHZA 4JY5H 1MHPH 1QWNA 4XPHH 5I18L 2BHFA 5I8KL 2Y4SA 5FAAA 2IPUG 1MY7A 2FAUA 1DLFL 3QQ4A 2UUDH 3TPKA 1OWWA 2H2SC 2Z8WC 1CLZH 5D71H 2G2RB 3RWCB 2OTWA 4GSQA 4XNXL 1R3JB 3QWNA 4DJMA 1CZ8L 3EYVA 4U3HA 4Y5XB 4Y4FA 2J6EL 1ZGLA 2QFPA 3Q8BA 3SN6N 4ISVB 3OG4B 2X87A 1X5KA 3ZHLA 4WU5B 2BSTA 4X9BA 4P59H 1YPZE 4A2GA 4HC1A 3D39B 3VH8A 4AEEA 5TDPA 3NFSH 5DI8A 3OKEB 4OZIE 1KYFA 2P5WA 3KYMB 4FNUA 4X9HA 1GC1L 5LAPA 3MUUA 4R5XA 4OIAA 5BUGA 3TN0C 2OTUA 2W80C 4LEOB 4CDHA 3DX6A 5AL0A 3TM6A 3QO1A 3CFMA 3KEDA 2IFFL 4PS3A 3VO0A 5BOJA 4RZCB 3I84A 3DGGA 5FFGA 1RIHL 1AE6L 4OCLC 3MR9A 1MRCH 5JW3H 4TNGA 5IP4A 3P30H 5CWSA 2VXVL 2H8PB 2UZIH 1S9XA 2GITA 4U3XA 4CC0A 5H8DA 1N7MH 4XXWC 3R0MA 2DBJA 4NCC1 2JB6B 3WUZA 1DVSA 1QYGL 2JJTA 4ZXBC 1U8NB 5D2LE 3OHMB 4AI7A 5FLVA 5FIEA 1IIKA 1T3FA 4JDEB 1M71B 3RDTA 2PPAA 3C9NB 4NRZA 5IY5B 3UBXG 3V6OA 2IFFH 3VVWA 2YQBA 3BKJL 3SY0A 2HXAA 3OLIA 4GW4A 4I3SH 2DWYA 2EAEA 4KXZH 1NDTA 2PR9A 1EV2E 4PJHB 4Y4FC 4C54A 4JG0H 1E4XI 5EUOE 5F9WB 4V1DD 1BG9A 2EDOA 4K23H 3WIIH 3NDYE 2E7HA 3T0EB 1H8SA 3T4AA 3RDJA 2MQ3A 1C16B 1USZA 2CHDA 5A2FA 3NCYP 4W6WB 1WWCA 4N6RB 3ULVF 1KTBA 2AVFA 1D5RA 4W9FC 3VXRA 4KTEH 4M8QB 2ORBH 5H2BB 2AV1A 4GAAA 1VHPA 1BAWA 4WWKC 1HHKB 2DJUA 2ZXBA 4UNIA 4E5XG 2WKOF 3C6SA 3IDMA 5ETUB 1LILA 3Q48A 3RHWF 3E2HC 3PYCA 2XBTA 4KJPC 1GPOL 1LK2A 5MENB 4OTXH 1TJHL 1MUJB 2ZWNA 1ROCA 1PKQB 4G8FA 1UD6A 4HIIB 1LEIB 5JXEC 4XMUA 2PXYA 2L7UA 4MDJB 3F6JA 4LCCC 4N8VG 2YR3A 3U6RA 4Y4KC 1AYRA 1H6EA 1NM4A 1UH3A 2OSYA 4B9KC 3IDUA 4KKZA 4DZ8A 4ZFGH 5F9JB 3WKYA 5CZVH 1TKWB 4HPOL 4XPBH 4LFHD 3JZYA 2GJ6D 3S3JA 4ZSOE 5I74C 5JYLA 4FTDA 3QZOA 5EO9B 2OCCB 4GUPA 2UWEE 3C6LA 2DH3A 3MRNB 2FUQA 2IADA 3PU7A 1K8DB 3MV9D 3RLSA 1IC7L 1MSPA 4AQ1A 1U8JB 4HBCL 4IU3B 4UQDA 4ZXBD 3EDKA 5GSVA 1I3VA 4RGOH 4R5TA 2HMIC 4FFTA 3CHXA 3K6IA 5FUZH 4WGVB 3U0PA 4B60A 3Q5YA 4XPFL 2G3MA 1IBGL 3MRDA 4IGBD 4XBEL 4YXLL 2XPGB 3BWAB 4O2EB 5ES4B 3WEMA 2BSED 2GAZB 3OBAA 1HNYA 2VQTA 4N0UB 1F41A 3N1QC 1M7IB 4ZQTA 1IGCL 3DX6B 1YYCA 3ZE0F 2EIMB 3HZMA 4P5MB 1U95A 1ETB1 1MY5A 1SN0A 3ATBA 3V0VA 3DPBA 1H8LA 4M7LH 4X4XB 1SDDA 2OR7A 2WLZA 3CGTA 1AAJA 1BX2B 2H5UA 3I9AA 4TVPD 3MROB 3EOTH 4XO3A 3V8OA 3IDIB 4LCWA 3JTTA 4MA8L 3RKDC 4ONGH 5E6ID 3WJLA 1XO8A 4GG6B 2HFFA 1Z6JT 3EOBA 5KYXB 2DD8H 4XVTL 3FQTA 5KYNA 3ZKSD 1YN7A 2V5YA 2JCWA 2B1HH 4Y7OC 1I1AA 1NDGB 4AYID 4MHHI 1R3IL 3L3GA 3SDCB 1KTKE 3DI3B 3WTSA 2R83A 1BZ9A 4TULH 4UTBA 3X11B 4JZOA 5FGCE 1X5FA 4YDJA 3QFJD 1IGYB 4YBLB 1QSEA 3AZUA 2C3XA 2FO4A 4KBPA 4J5VA 1V7ML 4JN1H 4X6FA 1AD9A 3UAAA 3HC4L 2CCVA 3TT3L 4E0RB 4CJ1A 4X7SH 3UP6A 2V3EA 5DQJB 4X9IA 1E3XA 4RWHA 5ESQB 3WNJA 2OMVB 2ZOOA 3S3SA 3KWVA 1MJ7L 1NAMA 2O6CA 4X99B 5F1NB 1E4KC 2VLKA 3TBTB 4IYKA 4QOKD 4Z77B 4R26L 1ZV9A 2EDKA 1EEZB 2VR5A 3CDGA 4ZUWA 3LIUA 1FO0B 1MJUL 3FH8A 5F2FA 3L6FB 2DQIL 5DWUL 5C0CB 5FGSA 4Z7NF 4MTMA 1ETZB 4N25A 2A1WL 2DQEL 4R5VA 2HT2D 3WN5A 3CCHB 4M5ZH 4QF1A 1VPOH 1Q4NX 5GHWL 3S96B 2R0LH 3DX0A 1MQKL 5FA4B 4XPAL 4EMZA 2MPAH 1URZA 1F6AA 3RZWA 3SKJH 1WA1X 3CU7A 1Y0LB 3V79C 4XODA 4ZO7A 4G5ZH 3WNLA 1FGVL 5E1AB 3SYCA 2D7PA 1U8MB 1QUPA 1U3HD 5DVOA 4NAMA 3L3DA 2ZNWA 1D6EA 1L9QA 3GJFB 2XWEA 1Q72L 4CSTA 1GHFL 4MAUH 5G4MA 4ZMLA 3IETA 4TL4A 2IDQA 1JXFA 4JN1L 5LG6A 4DERA 5DC9B 1MCWM 4RGMB 3ASOB 2AJYH 2N56A 1O7DC 3TH3T 3U4BH 4P3DA 3MUHL 4YHIB 3L7EB 4Z95L 4AGLA 2XFXA 3GI9H 1B0WA 1I3GL 2UYLA 4POZD 4TUKL 4LOEA 1HK6A 4RWYL 1T21A 2RCSH 1BA9A 4HGWA 5CNHA 1T0NA 5EORH 4ZFQA 5I2IB 4UTAA 3Q8AA 4LVHC 3CFCL 4JB9H 3CQPA 4Y88A 1KYAA 2BWDA 1XF3B 2UWEB 1I9EA 4APQD 2R2HA 1TENA 4P3CH 5I1HL 1K9TA 4GXVH 1T4WA 4WUUB 1LVEA 1HQRB 3S2AA 5B39B 4W1TA 5INDB 1L9SA 3TJHC 2X9YA 2YA1A 5KVDH 3PWPD 2X4UA 1QLRA 4XC1H 4HPHA 2Q9OA 2NSQA 3HLAB 2C3GA 3U4AA 1J1XL 3P0VL 1IGFH 4FTVA 4IBTA 1MCSA 4PJAA 3QRBA 5CCHE 4ISVA 1F97A 5ECJE 1NEZG 4JFDA 2YAPA 1AIZA 3BGMB 2EYSA 3A6CL 1R5IA 3D39E 1P7QD 2EXTA 2YFNA 5IVXA 4J27A 4Y9FA 1NUDA 4L29B 4I5BB 4PQXA 2NY5C 1FO0H 2B0SH 2BO0A 4LPCA 3MRHA 2Q3XA 1G7LA <