3ETSA

Crystal structure of a bacterial arylsulfate sulfotransferase catalytic intermediate with 4-methylumbelliferone bound in the active site
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
571
structure length
562
Chain Sequence
AGFKPAPPAGQLGAVIVDPYGNAPLTALVDLDSHVISDVKVTVHGKGEKGVEISYPVGQESLKTYDGVPIFGLYQKFANKVTVEWKENGKVMKDDYVVHTSAIVNNYMDNRSISDLQQTKVIKVAPGFEDRLYLVNTHTFTAQGSDLHWHGEKDKNAGILDAGPATGALPFDIAPFTFIVDTEGEYRWWLDQDTFYDGRDRDINKRGYLMGIRETPRGTFTAVQGQHWYEFDMMGQVLEDHKLPRGFADATHESIETPNGTVLLRVGKSNYRRDDGVHVTTIRDHILEVDKSGRVVDVWDLTKILDPKRDALLGALDAGAHAGQQAKLEPDTPFGDALGVGPGRNWAHVNSIAYDAKDDSIILSSRHQGVVKIGRDKQVKWILAPSKGWEKPLASKLLKPVDANGKPITCNENGLCENSDFDFTYTQTAWISSKGTLTIFDNGDGRHLEQPALPTMKYSRFVEYKIDEKKGTVQQVWEYGKERGYDFYSPITSIIEYQADRNTMFGFGGSIHLFDVGQPTVGKLNEIDYKTKEVKVEIDVLSDKPNQTHYRALLVRPQQMFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Arylsulfate sulfotransferase
publication title A structural and biochemical basis for PAPS-independent sulfuryl transfer by aryl sulfotransferase from uropathogenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 166
structure length 562
sequence length 571
chains with identical sequence B
ec nomenclature ec 2.8.2.22: Aryl-sulfate sulfotransferase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05935 Arylsulfotrans Arylsulfotransferase (ASST)
A PF17425 Arylsulfotran_N Arylsulfotransferase Ig-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3100 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3etsA01
4P04A 3ETSA 4P06A 4P07A 4P05A 3ELQA 3ETTA
chains in the Genus database with same CATH superfamily
2DWYA 5HJ3A 4BH7A 4EO5A 4EUPH 1IAIH 1MIEH 2BFVL 1UJ3A 1L9MA 2WUCH 1UXMA 2UYLB 4XOAA 2E9JA 2AV7B 2WYTA 2X4UA 3G5VB 4BKSC 1BFVL 4IRSB 4PQXA 3SYPA 2ZF8A 3KXFD 2WP3O 2Q3AA 1RIUL 2AJYL 3RLSA 2YRLA 4UILH 4KMTH 5FPIA 4P59L 2GTWB 2WQAA 3Q2NA 4PRPB 2E7HA 1O7VA 4EKJA 4Y4FC 3NA9H 4NJ9H 2XJLA 2WV3A 4S1QL 3SN6N 3TT1L 3MLTA 4TQIA 1IGCL 4KX8A 1Z9NA 1WJ3A 1RK0A 1XVSA 3ZTEA 1RZJL 43C9B 3D30A 5L4IA 3SPVA 5KSBE 2H6PA 2W0FA 1M2VA 4MNHB 4LKXB 4NUMA 4MA8H 4OUOA 3H8NA 5C0AD 3L3GB 4RRPA 5L6YL 4G9FD 5GGRB 1TVHA 5L9DH 4KVNH 3HBZA 2XXGA 4MJ2A 4F7EA 3GMLA 3IDYC 3QUYB 3KPRB 1A6TB 1M05A 4MASA 4XO9A 2ALWA 3VG0L 1P53A 4RZCB 2YRPA 3G08A 3P69A 3CFCL 2PWGA 1G7LA 4H20L 4U1IB 1J1OL 1YECH 3D25A 3BT2L 3HRZB 2XTJD 1BVNP 3RL2B 3M17A 5B3JF 1QFWI 5C0BB 5C8JB 4UT6A 1HXYB 2YARA 1ACZA 2AANA 2AKRB 4JFTA 3H9SA 4Y2NA 1I1YA 2R9HC 3PIQA 5C7XL 1V3JA 3LPFA 4HCFA 4PBDA 1DBJL 4I8DA 1IBHA 5FFOA 1PZ3A 1KJ2B 2HVJA 1ZIBA 3UJJL 2FEDC 4RBPK 4LCWD 2X6BA 2V9QA 4HXAH 5GRJH 4TUUA 3CPLA 3GDCA 1DQQB 4FYTA 2GEEA 3IDXH 1XGPA 4MAZA 2N7SA 2VAAA 1AFVH 1XD1A 4ABQA 5JHDA 4NQEB 5AOIA 3LCYA 2R4RL 3NJIA 4U4BA 1UWXH 3CBKB 4WU7B 5DD5L 2J20A 4GSDH 5FYJL 2WOYA 4BD4A 3QT2A 1WISA 3KPSA 4OI9A 4GKSA 1THCA 2WVUA 4H0IA 4M00A 3MRPA 5DK0A 3BMVA 3MBWA 2VDOL 5AOMA 3VWJB 2QELA 2QTEA 4HOZA 4TUJB 4R2GD 1CGWA 4PJGB 4DP4X 3INOA 3GKWL 3ZDZF 4Y9EA 1E7UA 4KJWC 4LVEA 1KPUA 4JLRB 4PP2A 1CXLA 4HWNA 1KJVB 2HMIC 2CBTA 5IEKB 1H5BA 4OTXH 5D71H 5EFIB 4GRWB 2WB1A 4TRPL 4PWEA 1C12B 5AQ0A 1MCCA 1KLFA 1D5XB 5GJSH 1UH2A 4IMLB 5ABDE 5I1CL 1K5WA 2ADFL 5KUMA 2PO6D 5D7LD 2Q0ZX 2YGNA 2XOTA 8CGTA 3RWCB 1U8JB 2IFFH 5I1LA 1JZ3A 2VM9A 2VDPB 4G8EB 3RE0A 5E6ZA 4UDUB 1N68A 2EUXA 2Q5BA 4OF8A 3CVIH 3ZYZA 2A2QT 2VZSA 3KPPA 1M56B 4DETA 3FHQA 5I5RA 4P2RE 4N8UA 5KBMA 2CJSA 3J7HA 1O6TA 1EBPA 1ZS8B 4LASH 5EN3A 5K9QI 1XH1A 1IL1A 2Z0UA 4LRIA 2A1WL 4IRJD 5TDPA 5ITBH 2KLTA 3NDZE 5I74B 3KGSA 1E3ZA 2GTZB 2BNUA 3TZVD 3BO8B 3MNMA 4LHQB 2CUHA 5HDQH 4ZUTB 4L5FE 5DJXA 1R0AL 1RZQA 1EZVY 5A2KH 3WJJC 3WTSA 5T1JA 3TN0D 1S7TA 4TNGA 1IC4L 3F84A 3WEAA 4UB0H 1L4IA 3KBHE 4YEFA 4LCYB 1MZYA 3HC2A 4R5VA 1TCRA 4X9FA 4ZPVA 1DBBH 4UNVA 2O5XL 1HCVA 2I69A 2WKLA 4PJIA 5BRZE 2XN9A 3RUGE 4ZNEA 3CCHB 3E38A 4D0DB 3F64A 1TTAA 4GLRH 4PUBL 4PU2A 3VFRA 3L81A 3EYUL 3NJJA 2G60L 5A7EA 4AQ1A 2YPLD 3JYBA 3R4DA 1AP2A 5D2NB 2MPVA 3L1OH 5AVTB 4ZUVB 2F5AL 2W60B 1D9KC 5B1CA 5I17A 3HMXH 2IPKB 4XP4H 1FF5A 4OFKA 1XZWA 1H0DB 1QLRA 4H8WL 3CHXA 4N5UA 1SGKA 3RNQB 2ZOKB 1JJUA 3NSJA 2O26U 4DHLA 5HHMD 3C5SA 2E9BA 4XXWC 4ZUSA 1EZUA 1WLHA 4FFZA 5EBMB 5IMOB 4LSUH 2PCYA 1AGEA 5GGRY 1A9EA 3A24A 4X7FC 2WBJB 1AIFB 3SKJH 1HHHA 2MTPA 2X89A 1FSKC 1G4RA 4Z7VF 1HOCA 3ME0B 4QXTA 4OI7A 4MJ5B 4OZGA 4BQBA 5DO2D 1MWAA 1R5VA 3N85L 3PRZA 5CSBA 3EJZC 2OMYA 4O51A 1FG9C 4QXGH 4PJ9A 4BKLA 4LFHG 5I5IA 1UB5A 1OANA 3V0WL 3PV6A 2J8UB 5MEQA 3T3ME 1G84A 2YAEA 1HHGB 4DW2L 2QADB 4JKMA 1MAKA 4R7NB 4G8GD 1KV7A 2BP0B 5DT1H 4MJID 2OSWA 2C26A 1K8DB 3OLEA 2P5ED 4GYBA 4NI3A 4N25A 4XZUA 5CSGA 3FCSB 1UZ8B 2G2RA 4HS6A 5FR3A 4E9TA 4YXHL 2R2BB 1TU2B 2HLFC 1W9XA 4LL4A 4IDLA 4PYHA 1S9VB 1XQ4A 3EFDL 3FZUC 4JHAL 4QRQB 3VVWA 1RJYA 3QPKA 2CBOA 1YN6B 2HJFB 4UTBA 5DS1A 5J06A 1NAML 4OF7A 3TTSA 3UERA 3A6CL 1SF5A 1MCPL 4G6FD 1F6AA 3D39A 3UBHA 3C60C 4PJGF 4WI9A 3FT9A 2ZWLT 3ZQXA 4JQIL 5AL8A 4HK3J 3ZKQD 5DS8B 3V10A 2DMGA 2CO7A 5AW3B 2QSVA 1U6AH 4GQ9H 2Z91A 5MHSD 3U79A 3D8MA 3HN3A 4XE0A 5C97A 3O45A 4WEUD 5TK4A 1FZJA 3BCFA 4HFWB 1IAIL 1MIEL 1P0SE 3QIUB 2WUCL 5ICXB 3EH1A 4I89A 2X4PB 1PG7X 3EOAB 3K72A 4LDEB 3IJ7A 4U6YB 5KSUA 3CN3A 5CJQH 5IK3A 3V5KA 5ESQB 3Q7JA 3TH2T 5KVFE 4LF3B 1KT2B 5A2AA 3BSZA 4UILL 4KMTL 2YAHA 1F11B 3WLWC 2AJUH 3DTXA 3NA9L 1CWVA 4NJ9L 4UYQA 3EHBD 4CVZB 1ID5I 1U8HB 1IMHC 1UM4H 3LRGA 5IBLC 5CFAA 3M1CA 4RMQA 2FWLB 3DDFA 4K23H 2VXVH 4KDWA 4UTAA 5EZLB 7FABH 4L3AA 4GW5B 4PRDA 2VLKD 4LU5H 3K6SA 3RTLA 1TQUA 2EECA 4MA8L 5CBEB 4K94C 3ZTCC 4JM2C 3AXHA 1JIBA 1EHAA 3MCLH 5L9DL 2VUYA 1W72B 1Z1WA 4FHBD 4KVNL 4WGKA 4XNAA 1AQKH 5IB3A 1F18A 2IBZX 1BX2A 4N87A 4HX1B 3KJ4B 2GJRA 1MVFA 1AS8A 5ESVB 3X17A 2OTWB 4HJIA 1YYMH 1LP9B 3AMKA 2ZTBA 2HN7B 3IFNH 4M8RA 4Y1SA 3TVMD 3WMSA 4QJ4B 1JNLH 1N2RA 1PCSA 3EYFB 2ODHA 5FO8B 4PLJD 2C4FU 3NZHH 1GGYA 5B7MA 4PRIA 1SNRA 1SHSA 2CO3A 3S37X 4HS8H 5LCVH 1C08A 1YECL 3E6HA 4EIGB 4LLAA 1TTCA 2W92A 3K4AA 4PS7A 1MHEB 2LLLA 4JNXA 1R3LA 5E5LA 3QQ9C 2H45A 2IWFA 2YEVB 3ROOB 2F7IA 2BSTB 2VM3A 2CSPA 32C2B 4W6YB 1ETA1 3AU1B 4APQA 4XWOC 3KEDA 2FAUA 3NCBB 3BP5A 4HUKB 3DURB 5D4QA 5KVGE 2A6IA 1CFMA 1MN4A 4HXAL 5GRJL 4I87A 1N4XH 3EGSB 3N5AA 4JE0A 4XMLH 1XDTT 3IDXL 1AFVL 3WTWA 3GJFH 3LZLA 5CSZB 2AV7A 1AD0B 3G5VA 3HHSB 2A4EA 4GSDL 1I7ZB 3OB8A 5D7KE 4IRSA 4WHYG 3TYFB 1C8PA 3P9MB 4L4VD 2YLHA 2YBRB 4XBPB 4PRPA 4JRXA 4AGMA 1F02I 1I8KB 1FNEB 43C9A 2P4AB 3TF7C 5CILH 3TO4A 3L13A 3QIBC 4RESB 4MAYC 4LKXA 3HJ0A 1KBWA 4Q56A 5D71L 4CSSA 4KOCA 1WC7B 3PQYE 3L3GA 4P46D 3BN9D 1I8IB 5DTFB 3UJIH 2FJFB 3ZT7A 1CDCA 5EOQH 3Q1EA 5DGRA 1O9WA 4G7SB 3QUYA 5GJSL 3KPRA 1H6TA 1A6TA 1A7PH 3ARBB 4U1HB 4D9RE 2OMVB 2D3LA 1DSWA 3DMMC 1OWWA 3HE7A 5HDLA 2FJGB 2DWEB 3LRSB 1IBGH 4BSVA 1KTLB 2WWMD 1FFRA 2IFFL 4Q2ZB 4RZCA 4C54A 3DUUB 4U1IA 5IQNA 3UCQA 5B7EA 2QFPA 3CVIL 3HRZA 3RL2A 1W16A 5C09D 4A7QA 4YJZL 4ZMPA 5C8JA 4JPQA 3X12B 1BLNB 1LMIA 3B7YA 3MJ6A 2AKRA 3BP6B 4LASL 2D73A 4PHZA 1L7TH 3UO8B 4E41B 1ZT1B 5BW7C 2NZIA 1TYRA 2CO6B 1TZHB 2XU9A 4G7YH 3MI6A 1JNNH 3KGRA 3GLEA 3GMRB 5ITBL 5EH1A 4Y4KC 5T5FA 2ADJB 4JUSA 5HDQL 3VD1A 4UQCA 2AJ3B 3D4YA 1VKXB 1Y6KR 1OAUH 1QI5A 1TDQA 3BWZA 4TNFA 1MSPA 1MY5A 1DQQA 4PMFA 4UB0L 4KRNA 2XPZA 3KGUA 4ZX6A 3WHXB 4TTDD 4NQEA 5JW4N 4K3HA 1DBBL 2EKSB 1Q94B 4WU7A 4FNQA 4WY7H 4XP1H 1JZ7A 2NR6C 3BQUC 1AYRA 4X5XB 1LWRA 2BW5A 4MXQD 8FABA 1T7VA 2A0LC 1HI6A 4L0YA 2V9RA 2CHNA 3OZLA 2PCPB 2QGEA 3UTSD 3CUPA 3L1OL 3HG1D 3VWJA 3HMXL 4N0RA 4XP4L 3EJQA 4TUJA 4PJGA 4ANUA 2CDGB 3OF6D 2QKIB 4JLRA 1ETB1 3DHMA 3Q8BA 1WS8A 3QJRB 2MFNA 1L5GB 5IEKA 1QZNA 3B4NA 4KZCA 5EFIA 4LSUL 4LBEA 1BAWA 1G7JB 1JF5A 3SKJL 5SWZD 1C12A 1O75A 4M8VA 1D5XA 5HHPB 4O2FB 4BFNA 5HVHB 4YSOA 2XC8A 1QR1B 3AY4C 4LEEA 3DX9B 4UNIA 2G5RA 3PJNA 2AAVA 4QXGL 3RWCA 1U8JA 3SZ6A 4G8EA 1VFAB 3O4OC 1IGIH 4JHBA 4UDUA 3ARXA 1NTDA 2AXWA 3FFOA 4MCYB 4WO4D 4OCWH 4NKMB 1NLBH 2P28B 3PL6D 1M3IA 1VFOA 4RETB 5DT1L 3ZUNC 4GBXC 4MQ7B 2EIKB 3PWPE 4L3ED 1ZS8A 5T1KB 1VEPA 2H0JA 1WWBX 3V6ZA 1JZ6A 2RQEA 3H53A 3DBSA 1TEGA 3ZRFC 3L5HA 3MTRA 3JWDC 1RXLA 2GTZA 2MCPH 3BO8A 3RVVC 3WUZA 3VXNB 4JFFB 2K8QA 4ZUTA 2X2YA 1DVQA 2W1NA 2X10A 2V5SA 2BMKA 1RVFH 1UKQA 1NOLA 3BEWB 4UQ3B 1KXTA 4BIKA 2OCJA 4LCYA 3B8YA 2YPVA 2GG1A 3FB8A 3C8KB 1YRKA 4WU5B 5DC0A 1CLYH 1SOKA 2WWKT 5D1ZA 1U6AL 4GQ9L 3GSXA 3CCHA 4U6VH 4D0DA 3SEPA 3RRQA 1F4WH 5MENE 4ELME 2B9AA 5C86A 2E7LC 3BUQA 2WCPA 2X3CA 4FFVD 1H15B 2CXKA 5ICZA 2X4RA 3MOBH 3UTTE 4EZMA 3Q6GH 1L9QA 1RJLB 1QASA 3GF8A 4WAFA 5A7BA 4V11A 2IPKA 2IBBA 3HN5A 4OQTH 2NY3B 5KVMC 3TBWA 2O1AA 5CJQL 3RNQA 2ZOKA 2W07B 2J7LA 2EDOA 1QFUH 1WV7T 3HS0B 4KROD 3IXTB 4K5PA 4ODBD 5EBMA 3OM3B 1XO8A 2AJUL 1OTUD 2AW2A 4UIMB 4W4OA 1AIFA 3IK2A 1UM4L 3HC0A 3IDMB 5K39B 1LQSR 3W9EA 4KFMA 5BRPA 3ME0A 4HSCX 4MJ5A 3A4AA 1NEZB 2X0WA 4K23L 1BZ7B 2VXVL 4O2EB 7FABL 5L4FA 1IFGA 4LU5L 3I6LE 3WNMA 1JV2A 4X0KB 4B53A 3MU3A 3ISYA 4FYSA 2BSEA 3MCLL 3MSPA 2XWTB 5EOCH 2J8UA 1AQKL 2DMKA 1HHGA 3WLBB 1GOHA 4F1ZA 4P4KC 4PJCB 4OVUA 1SYSB 4R7NA 1GZQB 4W9CC 2BP0A 4EI5B 4AV0A 5HP5A 1K8DA 1YYML 3WAKA 3SKOB 3IFNL 3R0MA 1MWOA 1UZ8A 1JNLL 3K2KA 3ZE0F 4U7SA 3NZHL 4BZ1A 3HJEA 2TRHA 4HS8L 4GO9A 4MXVE 1N9PA 1S9VA 5D5MB 2DMHA 1SLWA 5LCVL 3RWDB 4WWOA 4B50A 4QRQA 4CU8A 4RNRB 5JZ7D 1YN6A 2HJFA 2VLRE 4PJXB 4PS8A 5EU6E 3CN1A 1ZLVH 1TJHH 2WYHA 3W5MA 1JNJA 3BP7A 3NRQA 3GSOB 3QC5X 2HPTA 3WD5H 5J57B 2AK4D 3AQZA 1YPZF 3DARA 1VSCA 2FH6A 3X1BA 5DS8A 3UAFA 4EN3C 4PP1D 1S7QB 4X98B 1DJGA 4PPTA 4DOHB 1SY6A 2A5UA 3SDXE 4OJAA 1DN0B 4X6CE 2W9DH 1KF9B 4W9HC 4XMLL 1N4XL 1E90A 4XN1A 3NJNA 3QIUA 1WD8A 5ICXA 4AKOA 3O41B 3X1EA 2X4PA 3EOAA 1NFKA 3T0EB 4Y2DB 3GZQA 5ESQA 3FBQA 2UX6A 2K4AA 1XSJA 3FOLA 1KT2A 1IAKA 4LF3A 3BX7C 1F11A 1OPOA 4CVZA 1HJCA 3ZOAA 1U8HA 5D7HA 3GIVA 3WJMB 2LFEA 3FU8A 4PWKA 3Q2LA 4KDTC 5DMYA 5I1DB 2DEXX 4KXAA 2FIKB 1G1KA 5EZLA 5CILL 4XVUD 4GW5A 3ILPB 3VTMA 2QVMA 5AW5B 4BQ6A 5CBEA 1XWVA 3I74A 3QDHA 3Q8CA 3MPCA 4LSTH 2HB0A 3UJIL 4RMUA 1W72A 5EOQL 1PIFA 3D87B 5AZEH 2R23B 4M3JA 3QUMB 5F7YC 1A7PL 4HX1A 5GISH 5LGHH 3U1QA 1ZVNA 3HB3B 3MV01 4UUJB 5ESVA 2OTWA 3LD8C 4BRVA 4PGDB 4D8OA 5B8CB 1LP9A 2F7RA 3ES6A 2C9UA 1IBGL 4PREB 2E0PA 2D3NA 2DMBA 5FO8A 3MJ9H 2PMZA 4ZYKB 2VR7A 2NYZA 2AZAA 3P77B 2ZKWA 5K9OA 3GRBA 4YWGH 4PJEE 4IGBD 3LNIA 4WWID 4Y1AB 1MHEA 1FC1A 1YJDC 2PCFA 2VDMB 3EJJX 4JRYA 5FO2A 1XR9B 2C9AA 2X6AA 2RA1A 3BDXA 3EUUA 2CRIA 1ET7A 4IOFD 4PRHD 1L7TL 3O6KH 2CKNA 3GSNH 3LOWA 4KNQA 2WLKA 3P4MB 1RSYA 1YC7A 3ROOA 1LM8V 1WGVA 1VADB 4G7YL 5ES4B 2OPCA 1JNNL 1OK8A 3AWFA 2WQRA 2YLKA 1H3WM 32C2A 3AITA 3TEZA 1T3FB 3DIDA 5DC9B 3AVEA 3AU1A 1CE6B 3TBVB 2TSBA 3DURA 2J1KA 1OAUL 2P46B 3JWDH 4U1GB 4JZJB 4U1KB 1F4HA 4GY4A 5AB0A 3EGSA 3OB0K 3OKMB 2H2SC 2UX7A 1ASQA 1CJYA 3AREB 5SV3A 5CSZA 4HHWA 4PJBE 3GLAA 1AD0A 1GKEA 4WY7L 2XKNB 1FJ1A 3HHSA 1SQMA 3L95B 4XP1L 3WO4B 1I7ZA 3TYFA 3P9MA 2WLMA 4B96A 1QRNE 2YBRA 3VFNB 4XBPA 4JFPB 4PJCF 4LCUB 1CL7H 3QEQA 5GGSY 3BLBA 2P80D 3RY6C 2DM7A 3RVUC 2NY1C 5ETUB 4Z1PA 4K15A 3DROB 1YY9C 3WNPA 4Z7WF 4QT5B 1I8KA 1O6SB 4C58B 2XJKA 3CVHH 5D5MF 3RJDA 4Q9BA 5JO5B 4KKBD 3OAUH 4F33A 4HJJH 3NFNB 4PJXF 5FDWB 4YPGB 1WC7A 5DTFA 1I8IA 1ND0B 5D7SH 5C0DB 1FFNB 4U0QB 3TX4A 5CD5D 5DMKA 2QGCA 5I8CB 3ARBA 4U1HA 3QCVH 2OMVA 2XVKA 3VXRA 1LO5B 5K9KB 5DLMH 2FJGA 2DWEA 3LRSA 4LOVA 5AVUB 4BFOA 2K78A 4GP8B 1KTLA 4ZO8A 1MCLA 4XPAH 4Y9CA 1IGIL 4PRBA 3DUUA 4P04A 1SXBA 4N2IA 5I0WA 2VR9A 2ADIB 2H6OA 2IGLA 3R0NA 2DW5A 3ARPA 3NA4A 4FMVA 4OCWL 3UP6A 1NFIB 1NLBL 3RFRA 1V10A 1QNIA 4WWKD 3BPOC 1SOXA 4G9FB 1A22B 3X12A 2V2TB 1UH3A 1KCVH 3BP6A 3MGOB 2YKLH 4PVLA 3QULA 3BFQG 2FD6H 3V5DB 4E41A 1BA9A 1ZT1A 4PW9A 2GK0B 2CO6A 1TZHA 1XD0A 2QPDB 2XHNA 4AGPA 1LK2B 2Z0BA 3KWUA 3GMRA 3Q44A 2X0UA 2MCPL 2AEPH 1UB6B 4G6MH 2ADJA 2XY1A 4PWIA 4DTGH 4YSQA 1N3NB 2HCZX 2AJ3A 4N9GA 1EHKB 4XHJD 1VKXA 3N0PB 2XTJB 4NQDD 3O6FA 1RVFL 5IZ7A 1VFBB 4WFHD 2Y5TA 3MREB 4H7VA 4M8QA 3X1NA 2NXYC 2YD8A 3WHXA 2AJZA 2A38A 1P7QD 2EKSA 3BIAX 1Q94A 1CLYL 3B9KC 4HG4J 2FX7H 4X5XA 4U6VL 4YBLC 1F4WL 1J8HD 5E8EB 3TA3D 2EADA 4BFFA 5EF1A 5FYKD 1QFWH 4QRRD 3MOBL 4JANB 3T2QA 3Q6GL 4LCWB 2DYPD 2DBJA 4OQTL 5DZNA 4AYSA 4FFYA 3FW6A 4WEBH 3IMBA 1YPZA 2JWYA 4HISA 2CDGA 4K2UH 2QKIA 4HWEH 1HQRA 2EDYA 3S3PA 1L5GA 1XFPA 1QFUL 3V0AC 3SE4C 1G7JA 2VXTH 4HOMA 3IDUA 3D2UD 1XZ0B 3FL7A 5HHPA 2OSXA 4O2FA 1T83C 4I7ZC 4KKZA 4BK5C 1CE1H 1B88A 4UQAA 4MRCA 3DJTA 1NEZG 3G04B 3DX9A 4R2GB 4PS4H 4O02H 4M6AA 4ZX4A 3T09A 3A6OA 2X5PA 1VFAA 4Z78B 2CWRA 5EOCL 4MCYA 4BJLA 4NKMA 1BYOA 1EEQA 1JVOA 5C0CA 3UZEA 4J3OF 1QO3B 4MQ7A 3D0AA 2MCG1 5T5NF 3FCUB 5T1KA 4UNUA 4LSVH 1Q90A 1PG7W 2LE9A 4JPSA 3QHTC 4X7CC 1RZFH 3QPQD 2VL5B 3W3BA 3ISWA 1AG0A 2J6WA 2PO6B 5D7LB 1KWKA 3BPCB 4TLTA 1K5NB 2Z93B 3RFZA 1AANA 4KI5E 4WNQA 2IBGA 5GGVY 3VXNA 4LK4A 5K1VA 1TJHL 4H1LH 1FFQA 1L9RA 4U0RB 3O0RH 3WD5L 2YZ8A 1YJDH 4P2QA 3BEWA 4UQ3A 2AEWA 1F1GA 3LXCA 4AC4A 5CJXA 5TDNA 4W9KC 4QAWA 3EJTA 4ELKB 5GPRA 3C8KA 4WU5A 2BWDA 3KL3A 5F89A 3POHA 4AJYV 2CHXA 4HIXH 5FC9A 1PYWB 5TE4H 5DHMC 1DQMH 3VX1A 2W9DL 1U8MA 3TZVB 3VI4F 2CDFB 1MFDH 1H15A 4QD2E 3N44F 3PHSA 3TN0B 1IZJA 1T2JA 3T04D 2QSTA 5CU9A 1T7ZA 1FN4B 2VSCA 4EIUA 4OT1H 4NEHB 4LCCB 2F54E 3B3IB 4YXLH 3IXTA 4V2CB 4EMZA 2BJMH 4MNGE 1I53A 3EH4B 1BJ1J 1QWUA 4LPWA 1XGZA 5K39A 3GSWB 5AW6B 1E8WA 3T9WA 2ICES 3FU9A 4UCFA 2UZYB 1CT8B 4UINH 1BZ7A 5HVGB 5KS9E 2ENPA 3VXOB 5F2FA 4B5EA 4KJQC 3H7LA 2G4GA 4LSTL 2YRBA 5JOPE 1WUNT 4CW1A 3AQXA 2FZ3B 2XWTA 5T3XE 5AZEL 1TZGH 1OKEA 4P06A 3ZR5A 2A74C 3WLBA 4R7XA 4PJCA 5GISL 5LGHL 1T03H 3ABGA 4NO2B 1GZQA 4F5CE 5I9QC 4ONHB 1GHFH 3SKOA 2DIJA 2GUOA 1HILA 2DI9A 3FQTA 2VN3A 2WQWA 3MJ9L 4FLRA 4S0TD 2FYYB 2W59A 2YD0A 5A16B 5D5MA 4IBUA 4YWGL 3RWDA 3JZYA 4RNRA 4Y19A 4MJ4A 3UTOA 4PJXA 4RVBA 4FRWA 3IMRA 2NY6B 1GY1A 3IVKB 5HGAB 4PTTB 3O6KL 3GSOA 2QGDA 3GSNL 4HIEA 5CJ8A 4G8GB 2VXUH 1T5XB 3DYMA 4MJIB 2P5EB 1MI5E 2KDYA 3M46A 4GRLD 3PXLA 1S7QA 2X40A 4X98A 5EC2B 4PRAB 2DLHA 2WXFA 4GFTB 1RULH 1W80A 4HA1A 5F0PB 2VR4A 5EUOE 3ATFA 4OM0H 4EE2A 3JWDL 2VUOA 2VC2B 2EINB 3IGFA 2YGQA 4WTWA 4M9OA 2AQSA 1G6RH 2P48B 3BZEB 3WV0A 4G6FB 4KVCH 3O41A 3VFPB 3V55A 3P54A 5CWSB 1LK3H 1IT9H 5JHLH 5GXBB 4Y2DA 3DX8B 2EDJA 3UTQA 3NFPB 3QW9A 4ZS6C 3QRBA 4G6KH 1CL7L 3O9WC 3K7UA 4POUB 5D1XE 4M56A 5IHUH 2RD0A 3WJMA 1GGBH 5IB5B 5I1DA 1X4YA 1EIBA 3CVHL 1ZT4A 1D7BA 2VR6A 2XXMB 2FIKA 3C5ZD 3CN4A 5E6ID 5JIIA 3PPSA 4PY7B 3B2DC 3ILPA 4XMPH 3OAUL 2APBA 2EDBA 4HJJL 4MA1B 5D93B 3PDDA 3U4EB 3PWJA 4H0GA 2VO5A 5D7SL 1SHWA 3PP3K 4KH9A 4EJ1C 4Z7VE 2XPYA 4KY2A 3QCVL 4D9QE 4PSPA 3EHBB 4PBXA 4PGDA 5B8CA 4JFUA 5DLML 3ULVD 4KXDA 4PREA 3ALPA 4A2GA 4L48A 1VEOA 5PCYA 1AHWA 1M6OB 4XPAL 4DKFH 3P77A 4WTQA 1DQDH 4KO6A 1I1AD 5EO0B 2WXLA 2VLKB 1QSFE 3GD1C 5JHMA 4Y1AA 1RLBA 4Y5XC 3A22A 1XR9A 1PBYA 1KCVL 2E56A 2CKBH 4L8SC 1TYJA 2YKLL 3WFBH 1JCKA 2FD6L 2VSMB 3P4MA 4LIQH 3SCMC 1CGVA 4XO4A 2J21A 4HMDA 1LD9B 4P5TD 5C7ZA 3RVWD 2HTKC 4ELDA 4K0OA 2AEPL 4HUUB 1T3FA 4G6ML 4YBQD 4EZJA 2XVBA 4DTGL 3TBVA 2I26N 3MNWB 5B1BB 4U1KA 4X9BA 4JZJA 1GKOA 5E70A 1SM3H 3C2AH 5FUCC 1BQHB 2X1QA 2JKSA 5DK2B 3E7JA 1AGFB 1PG7H 5IM7B 3SJVB 3WS6A 3AREA 5M7QA 3Q2VA 2ARWA 5D4HA 1AGDB 1P7KA 2YZ1A 2XKNA 5ILTH 3L95A 5LWYH 2FX7L 1G7IB 1O5DT 1U58B 3C2SA 3X3FH 5F6IC 4JFPA 2ETWA 2HT4C 4HWBH 1QFWL 3MRDB 2A9NH 1RJZB 2UUDK 5ACLA 4HZAA 5ETUA 3BZ4B 2Z8WC 2ZKYA 2E59A 3DROA 4AYID 3MZTA 3TFKD 4QHUB 2OJEB 3JWNG 3MLWH 4QT5A 4WEBL 5KJ4A 3ZHNA 4K2UL 1PKQB 2FO1A 2B14A 4HWEL 4L4TB 4I9WE 5JO5A 1T0NB 2V5TA 1DDTA 5JORB 3GRWH 3NFNA 3ZT5A 4D0CA 3T71A 5FDWA 4YPGA 3O4LD 1X5YA 1JSYA 4XP5H 4L4VB 3WFEH 3ZMRA 2VXTL 3KXFA 1ND0A 1OP9A 5HYJE 2WO4A 5MI0C 4GINA 5C0DA 1FFNA 4Z7AA 4FA8A 3BD5A 2B1AH 5I8CA 1WF5A 1D2OA 4M43H 1RJCA 4ICWA 4PLNC 1CE1L 1LO5A 3W56A 1L0XA 4O02L 4PS4L 1E8YA 3ZW3A 5CJXC 4LP4A 2ADIA 4WEMB 1UOKA 2F74A 4H26B 5HPOA 1TJXA 1NFIA 3OAZH 5C0AA 2ZYSA 4P46B 1EFQA 4G9FA 2V2TA 4PLKD 4FP8H 2G75B 2BCKB 4DP2X 5LJYH 1JOIA 1KV3A 3MGOA 3TBCA 3ZE2B 4CADA 2C4FT 4LSVL 1IE4A 4YL4A 4AMXA 1JPSH 3KYKH 4BELD 1NCDH 1RZFL 2GK0A 4FXKA 3ELAT 1U91B 3HE6D 1LK2A 3QQDB 3FOMB 3P11H 4IIQB 4ATTA 1M7UA 2DRUA 1UB6A 4KKLD 1VFUA 3OGCA 1E28B 5LG6A 3EXLA 3ARGC 3AGVA 5IV2A 3O0RL 5C09B 3VGAB 1VFBA 1YJDL 1EX0A 3Q0HA 3MREA 5DURB 2J71A 1X6LA 3AG1B 1KYAA 2CLRA 2NTSP 5GIRB 2M1KA 3BUYB 3LVTA 3NJVA 4GB9A 3N9GH 3RZWA 2NY2B 1QLEB 2HLAA 1CYWA 4UBDC 3D12B 4XNXH 4HIXL 3MAWA 5TE4L 3P3SA 5E8EA 1DQML 4FXTA 4HHGA 4FNUA 1SFDA 1MFDL 3DHUA 3TWYA 4JANA 1IJNA 1DJSA 3HRPA 4LCWA 5DZJA 4BKTC 3QUXD 4Z3IA 2AZUA 1GJIA 4RZKA 4XE5B 1BYNA 1SEQH 1PDKB 4FQCH 4JL2A 4PGEB 3NUKA 3C6LD 3HNSH 1JMXA 1XT5A 4OT1L 1CMOA 3ECQA 1UWXK 4YXLL 3H85A 4LEBA 1JTPA 2BJML 3KE0A 5CJ5A 1DQLH 4E9LA 4B0MM 3O3BB 2GYSA 3KS0J 4JVUA 5D7IB 1EO8H 4YHIB 1XZ0A 4LGSB 4ZUUB 4JO4H 2JI3A 2NYYD 4LMQE 2X2HA 4UINL 1F3RB 3C6EA 1PKOA 3H4HA 5ITFB 2N1KA 1VENA 1Z5LB 1MEXH 4Z78A 4N0UE 3VX0A 1F1AA 2H0EA 3H3BC 4FYQA 1RZIA 3CU1A 1TZGL 2N3JA 4JJOA 3QZWA 1T03L 2VWEE 1CDGA 4IDJH 5SWZB 3SPJA 1QO3A 1GHFL 3CFUA 1QSEE 2BX5A 3WE6B 2VL5A 2WO2B 2PO6A 5D7LA 3BPCA 5IESH 2BLFA 1OAZH 1ZHLA 3QI9C 2N4IA 3AQYA 3BDBA 4DN3H 2AP2A 3CH1A 5J13C 2CO2A 3CFJA 4WO4B 1ETJA 3LIZH 3GXIA 5AYQA 3L3HB 1OHQA 3GGWB 1FVCB 3D5OF 3FB6B 2VXUL 4G71B 1DVSA 3TTYA 2PETA 2BP8B 4L3EB 2AEOA 2XZZA 2PW2A 3FRPA 1YEFH 4R7LA 4ELKA 1E67A 1P1ZB 2QVIA 2XV3A 5I6LA 5ISZD 3QIWC 1RULL 3BXNB 4IBTA 1KXHA 4XMKH 4M7KH 3ARWA 1PYWA 3SYQA 4OM0L 3VXME 1Z9SA 5BOZG 1WT5A 1H6FA 4F24A 3WI9A 4R7DB 3TZVA 1IM3D 1RIHH 4OFYD 4L23A 3MBXH 1G6RL 1WTGT 1E5CA 1K6QH 3H1ZA 4KVCL 5E1AA 4NLHA 3TN0A 2F08A 2VXSH 1EUTA 1LQBC 5DMGD 5DJ0B 5JHLL 1LK3L 1IT9L 2NCEA 1FN4A 5BVPH 4LCCA 3A6BH 1HS6A 4J3SA 4NQXB 4G6KL 5EIIG 3OLDA 1S78D 4PIRF 5IHUL 3ZE2F 4G7VH 4L4JA 3GSWA 5CKGA 2NXZC 1GGBL 2B8OT 2YPLA 2KL6A 1MRFH 1QNZH 5J3HD 2YA0A 3RVTD 3RURA 4K07A 3UCRA 3VXOA 4XN5A 4HJSA 1EZSA 4NQTA 2C3HA 2R1XB 4XMPL 4E68A 1YSOA 3GS4A 1KTCA 3NN8B 5A2IH 3WO3B 1OCOB 4P2AA 4K71B 2FZ3A 4HPYH 5IKCB 2FX9H 1PD1A 4OZFG 4KROB 3U4KA 1PL3A 2EZ0D 1OE1A 4MMYB 2XQBH 3FTSA 4Z3HA 3GBLA 4JFDB 1LEKB 1D3CA 1BM7A 4Z7QE 3RVXD 2QQKH 1U3YA 4HLZH 1FL6B 2IDSA 5IQLA 4DKFL 4BSWB 4L3FA 1DQDL 1JHLH 5A16A 4HK0B 3V0EA 3ZL1A 1MQ8A 2ORBH 3KEHA 2Y23A 4KKNA 4X5RA 4NHUB 5I23A 1MFAH 3HUJE 1UJ3C 1U2YA 2NQ3A 2CCLA 2CKBL 3IVKA 4HHAB 3WFBL 2KQMA 4PTTA 3VJ6B 4LIQL 1BECA 1INEH 4G8GA 3TCLB 4NSKB 4MJIA 2P5EA 4P23D 2CLZB 5C9KA 4JN2B 4BWTA 5EO9B 1NKOA 2BVYA 1BVKB 2N7BA 3KLHD 2NT1A 5C0EB 2XV2A 5D7IF 4WKZA 5L8KB 1XR8B 4ZSOE 1SM3L 2XWJB 3C2AL 1SJEB 5KVEH 1PG7L 4QJ3B 3VYOA 4M5YH 4F27A 3BZEA 1BQHG 2PWDA 3IS0X 3QJVB 3CXHJ 4FXGB 4MD5B 3JSSA 2AK4B 3CDZB 2YOCA 3VFPA 5ILTL 2ZCHH 4GI9A 5LWYL 4D0BA 3O2VH 4ILDA 4I77H 1UGKA 1MJ8H 1X3DA 2D9CA 2DL9A 2RALA 3OKDA 3X3FL 3ZO0A 3CG8A 2GJPA 4HWBL 1IO4C 2A9NL 3OVUB 1F90H 3GBDA 2CIKB 1QMUA 3FTUA 2F1AA 1PZBA 2HFEB 3VGGA 4EUPG 1QHOA 3MLWL 5IB5A 2R8SH 5ANMB 5E00A 3Q9QA 4HU8A 1YEHH 4ODHH 5F3BB 4PY7A 3EFOB 4Z77A 5A6MA 3FCTB 3L2MA 4LO9A 4NKDB 3GRWL 4MB1A 2VLLB 3KL0A 3U4EA 5B22A 3NJGA 4XP5L 4IBZA 2DTSA 4ZTOH 3WFEL 1IBYA 3EYSH 2EH7H 2J55A 1DQVA 4YZFE 2B1AL 4M43L 3UIZA 2W0LA 3KPQB 3VGHA 4CKVX 1HX0A 4ODXB 2QDVA 2DZEA 2BS71 1QI4A 2VZTA 2VRAA 4XPBH 4GKLA 5ICUA 4BQ9A 5D2LB 1M6OA 3RWGB 2EAEA 2Y4SA 5KSAD 35C8H 2VLKA 5LKNA 4M7ZB 1J0ZA 3RWJB 3QJUB 4FP8L 3GM0A 4P2RD 1QAWA 2HTLC 3IJSB 4MSWA 5FYJU 5A2FA 3IBOA 1JPSL 1YY8B 2XWZA 4MB3A 3KYKL 2WSPA 3ZE0E 3SDCD 4ZMQA 1NCDL 4OCXH 3OBAA 2CGYA 4LGRB 3FAXA 3TVMA 3P11L 2XWDA 2AJXH 3W38A 1Z3GH 4X7DC 4HUUA 1YEGH 1ZVHA 1Y0LA 3KL5A 3MNWA 4IGBB 5DVKA 3L3IB 3LRMA 5DZLA 3APFA 3O6LH 5C1MB 3VDAA 2J4WH 4ANVA 1DUYB 1J48A 3L4UA 5DK2A 2HJKB 1AGFA 2IAMC 1HNGA 3I3BA 1M7IB 5IM7A 4P48A 2IV8A 2X6VA 1CBJA 1C16B 5FGCB 4PRHB 5AAMA 3OMZA 1H5BC 3N9GL 1AGDA 4WI6A 4DN4H 5BRZD 5F71A 4XNXL 5BQDA 4F7KA 1J88A 1G7IA 3FQNB 2IPTH 3GHBH 2WLLB 1U58A 3LX9A 1CICC 4AUUA 4IKJA 4L05A 3WIHH 3MRDA 1X6NA 1RJZA 4K7PX 1TR7A 2ZKXA 4YSDA 5HY9B 1YDPA 3ZBMA 2ZWNA 1NGQH 4HIJB 2BZ7A 4P3DB 3V7AG 1SEQL 2OJEA 4QHUA 3VACA 4FQCL 1OSZB 5F7MC 1F6LL 3HNSL 1PKQA 3GJFK 2R69H 4IKIA 2MCMA 4LVOC 1L3NA 3KLKA 5JORA 4HMCA 1KGXA 2EDNA 2X09A 1HYSC 1DQLL 1ZHNB 4L4VA 3NCCB 4AZ8B 1EO8L 2O5YH 1RK1B 3DHPA 4WWNA 3RTQD 2EVIA 4PTUA 4NC1C 2CDEB 4JO4L 3WNLA 4OGAD 3BGMB 4LRIC 5JQHC 4TNWF 4P07A 1LILA 2R1YB 4ONOA 3I50H 2PWHA 5AW1B 1MEXL 4ZNCD 2NPLX 2OSLB 4LSPH 5I18H 3JUZA 4H26A 2EDMA 2YA2A 4NRXB 3LKPB 4HEME 4P46A 4YBHA 4JPWH 4IDJL 3IS1X 2G75A 2BCKA 3ZTJH 2E4FA 3DV6B 3ML9A 2FBJH 2YR3A 1R5IA 3IWUA 4ODVH 3LNDA 1XCWA 3EYVB 4F37K 1U91A 2F5BH 1OCCB 3QQDA 5IESL 3T6ZA 1JERA 3FOMA 4IIQA 1OAZL 1IC5H 2KPWA 1KBVA 4ZO9A 2DOCA 1FP5A 3HBGA 3HCVB 5HGBB 2VDRH 4DN3L 2YPKB 1E28A 2WGXA 2P24B 3OPUA 3LIZL 5EO1B 3MJ7A 1OT4A 4ZT1A 3RPKA 3JT0A 4JFVA 1M71B 5C09A 2H26B 4I0PD 1WZAA 3LKSB 2PP8A 4FQXD 4UQEA 4WWKB 4G3YH 3HZKA 5HI4C 2EXYD 4GIPD 1C5BH 4L8BB 1W0WB 3BUYA 3DGGB 1YEFL 1H3VA 1RQ5A 5FUCE 1T66D 4XMKL 4M7KL 1CIDA 1BVNT 4X4MA 3NZUA 4DK6A 1ZAGA 3F05A 3EH3B 3QFGA 5BO0D 1NPNA 4A37A 3T77B 1RIHL 1CF1A 3CAFA 4WJKB 3MBXL 3RGVD 2E27H 4BXVA 1DVFB 1K6QL 1E27B 3RWIB 3MA7A 4NQDB 2BNRE 2HX7A 4PJ9C 2VXSL 1PDKA 4PGEA 1WE5A 4PH8A 5BVPL 1SMDA 2R7EB 1A4JB 1X5AA 1P7QB 1OARH 3A6BL 4XCYB 5DHVB 1T4WA 1WCBB 2FGWH 4B5ZA 5B38A 1BZEA 5DZVA 3KH4A 3SPIA 5LUMA 4BXSV 4G7VL 3EDFA 5D7IA 5HGDB 3RG1C 3TA3B 4YHIA 3UTSA 4ZUUA 4QRRB 1AC0A 1MRFL 1QNZL 4OLYH 1ZA3B 4QRUB 3HG1A 3NJLA 3FH7A 4PV8B 4BFRA 4Q6IB 2DYPB 3CQPA 2W9EH 1OGPA 3ABMB 5ITFA 1Z5LA 4FJZA 4NBXB 1UD3A 3TEXA 3OF6A 1A0QH 1EERB 4MB4A 4HPYL 2N59A 2FX9L 5I71C 1G7QA 4N8VB 3MLVH 5FM4A 4UT6H 3LN5B 3GXNA 5JDSB 4AVHA 3NESA 2XQBL 5SWZA 4ZQKB 2GBTA 3Q48A 4J12A 1XGYH 3C08H 3D2UB 1SVCP 4E9RA 5LN8A 3CSTA 2QQKL 4I18B 3DPBA 4Z7UB 1U92B 2KLRA 3CZGA 1JHLL 2W91A 3CSPA 2Q6WB 2OR8A 5ID1B 1AR1C 2K6WA 3I9GH 4AENA 3BI9X 1S7UB 2ORBL 4X83A 4QRTB 4HJUA 1MFAL 4HPOH 1NBZB 4L1TA 4WO4A 1TNNA 2UVFA 3L3HA 3GGWA 1A3RH 3PL6A 1FVCA 4V1DE 4YFLF 4ZMYA 4NZ8A 1INEL 1LE9B 3OJMB 2OAAA 4URTB 3MBEC 4XPHH 4L3EA 5JYLA 1QPKA 3E3QE 1NC2D 4C8XA 2F7QA 5BXFB 2EDXA 1FO0B 4FI7A 3OLGA 1EHNA 3NSCA 3KR3H 4HV8B 1XMWA 4YLCA 3BXNA 3K5SA 4FZEH 2PXYB 1NLDH 5A3ID 1ZTXE 3QDJD 2QFRA 4R7DA 4L9LB 4HC1A 2LU7A 5KVEL 4YGAB 3BVXA 3RWFB 4M5YL 5IB1B 2MTAA 1AXSB 5DJ0A 2ZCHL 1BVZA 1JFQH 2YN5A 3B7SA 4ZBJA 3O2VL 5D7KD 4I77L 3EBIA 1MJ8L 3MHZA 2R56H 2ICCA 1GL4B 1LO3H 5PAZA 1F90L 1MJ7H 1RP8A 1TQWA 4Y7OC 1HIMH 3IGLA 1KIUB 3VO0A 3ZKXB 2R8SL 1YEHL 1ZT7B 4ODHL 4OCYH 4X80H 3G6JE 2B1HH 2R1XA 4HEPG 4JFEB 3JV4A 3NN8A 4ZTOL 3PQYD 3DO7B 5IKCA 3EYSL 2EH7L 1QTSA 4BZ2A 3ISRA 3NOIA 1BYPA 1F00I 3SE3C 1VHPA 5I5MA 1CYGA 3LZOA 3A0OA 4D9RD 4CGTA 4HUWB 5KG9B 2YUXA 1CFTA 3E8UH 4JFDA 4X4KA 1LEKA 4XPBL 2OKMA 2FR4A 4APQC 1GIGH 4JMNA 3VU1A 1FL6A 5HDWA 4AYGA 4BSWA 1A7OH 4QF1B 4AX3A 5LXVA 1GXEA 4NZFA 2YMXH 35C8L 1PPIA 4IJTA 5BUPA 4EQ2A 2X1PA 3FQWB 3KCPB 4NHUA 4AY0A 3GB7B 1YNKH 4HHAA 4ZFZA 4BH8B 3JQOB 1A1NB 5DJZB 1WCQA 1X5HA 1P5UB 3VJ6A 4QLWA 3MGAA 4XNUH 3TCLA 4P57B 4NSKA 4IRSC 4OCXL 4BEIA 1AOHA 5F88B 4CU7A 2CPUA 2CLZA 4NKIH 5EO9A 2AJXL 1Z3GL 2DQUH 4OZHB 1YEGL 1BVKA 1PZSA 4HH9A 5C0EA 3J07A 4QY8B 1QX1A 3QRGH 1OGTB 1P6AB 3ASWA 2VQTA 1G7MB 5EEXA 3O6LL 2ZZUT 2J4WL 2XWJA 3STZB 3CZUB 1SJEA 3F7QA 1ZLVK 1G0XA 4FXGA 4MD5A 2AK4A 3CDZA 3WTUA 1TLKA 3FO2B 4DN4L 3K6FA 2YSSB 3OKOB 2IPTL 3GHBL 4GRLB 1HFUA 3GEWB 4NKQB 3QUYC 4FFZH 3VFTA 3WIHL 1BCIA 1UXSA 1VGKB 3GMPB 3K8MA 4X42A 1CD9B 2HPOA 4Y9FA 2WCSA 4NJAH 4ODWB 4X6BB 1NGQL 4HYTB 5CLZA 4LVHB 2HFEA 1MWAH 4PJFE 4QCIB 4Z7UF 3RU8H 1F3JB 5ANMA 2K6YA 2Q86B 2R69L 3B83A 4WHDA 5E99H 3EFOA 3HRZC 2RACA 2VR8A 3FCTA 4NKDA 1KPRB 4M6NH 4CDHA 1MCDA 2H7WA 1AZCA 1DLFH 2O5YL 4NENB 1UGNA 4XGZB 4XAKE 3WUWG 1F4AA 2ODIA 1B0IA 3KPQA 3UJTH 1ZJBA 1G1YA 4ODXA 5A6LA 1TVBB 2ATPB 2OZ4H 4FF9A 1WZMA 1OIOA 4MNQB 3I50L 4TS6A 1KGJA 1DJXA 5D2LA 3RWGA 3RJQB 5E6IB 3C5ZB 2Y2WA 3EOBB 4LSPL 4X4YB 1CUOA 5I18L 4HBQA 3FTZA 2KI6A 3CHSA 4UTBH 1IARB 4XP6H 2A7BA 4P5SA 1X44A 4S10A 2NZ1A 4JPWL 2TSAA 2FRGP 3IJSA 4Z7NF 3DX7B 1LEIB 2ILLA 2ALAA 3PWPD 2EJ1A 1VRSA 3H2PA 1YY8A 2FBJL 1KNOB 3PGDB 1LWHA 4ODVL 3QZOA 1OE2A 4K3GA 4FKKA 2F5BL 1QUNB 2B7DT 5CS7A 1XF3B 3ZY7A 3WENA 3LRHA 4MBOA 4PCKA 5E9NA 1IC5L 1XEUA 4AYBA 2HX9A 3R8BB 5G5DB 5B4MC 3F8UB 2VDRL 2IWGA 3QISA 1I1AB 2FJUB 2OCFD 3VWJC 1KGUA 4IGBA 1RI8A 3L3IA 4QO1B 3KDPB 1DUYA 3EUDA 4IEFB 2HJKA 4G3YL 3GSNB 4FERA 1C5BL 1GAFH 1I3UA 5SWSE 2O5NA 4PRHA 2DKMA 3GBMH 1GS6X 4M93B 3CV5A 3RPIA 4P5TB 2CJTA 3OWRA 1ZKAA 4FTDA 3DA0A 3FQNA 3RX8A 3BSZH 3LN4A 4NWTH 2WLLA 4QDGA 3MRCB 1LGVA 3CFEB 1UZGA 3L4XA 1URIA 4KNSA 2E27L 1DJWA 5DJCB 4WJ5B 3UTTD 5HY9A 4AM0Q 4KAQH 4HIJA 1NCUA 1CDIA 3U1SH 5CD3B 3KAAA 4N2KA 4UTAH 1OARL 3GTNA 4AQEB 2YGVA 1MXGA 4D8PB 2FGWL 3FO1B 3CDFA 1QACA 3EYOB 4LEOB 3KBEA 2IH3B 3O3DA 2Y7LA 2YXWA 5FIEA 1RK1A 5FCSH 2CDEA 2P80A 4OLYL 3BGMA 3BGAA 3F5WB 3CVHB 1P2CB 5I74C 5TJWK 2W9EL 4OZHF 4FLQA 3N42F 4LLQA 2WPGA 3I6LD 2OSLA 4HBCH 1A0QL 4CC4A 3U6RB 3QO0A 4GP5B 4A39A 3TP4A 3B7UX 1EWHA 3MLVL 4NRXA 4UT6L 1PQZB 3LKPA 3O4LB 5DYFA 1HE7A 3MMEB 1J9SA 2UWEB 1INQB 2Z64C 1XGYL 4MD4B 4PJ7B 3C08L 4BCZA 2J57A 5FGRA 4FXLA 2GIMA 3DV6A 3RDTD 4MS8D 5T1LD 3LRKA 4DEPB 3AGWA 3FULA 3FQ4A 4JFZH 3SE6A 1IEAB 5IVOA 2Y3NA 1NICA 2OZNA 2BSDA 3I9GL 2ZUUA 3N1MC 3HCVA 5D2NC 2WBXA 5IT2H 5JA9A 4HPOL 4N20A 5EU6D 2VLRD 2P24A 5D8JH 3UPCA 5IJDC 1Q1PA 1A3RL 1M71A 2KUTA 1OD9A 2H26A 2BNQB 4WWKA 5E9AA 2Y07H 4XPHL 2XX1A 4GQQA 3GPSA 4L8BA 1W0WA 4NXKA 5DWUH 1Q9OB 3DGGA 4Y4HD 4E9SA 5J6GB 3KR3L 4W4OC 2WBJC 2QSCH 4FZEL 1NLDL 3HE6B 4DERA 1XSKA 2W5PA 4K9EC 3QS3A 4DUXA 4R5TA 4QTIH 3ZDYE 3T77A 1A7BA 1DVFA 5E7BA 3P0VH 1E27A 3RWIA 3GMMB 1YVLA 1VFMA 1OTSD 2ZWZA 4NQDA 5IFJA 1XBRA 1PLBA 4HETA 3BH9B 1LDPH 3DVIA 1JFQL 2H9GB 4M1GH 2VDNB 4POYA 3FO0H 2R7EA 1A4JA 1P7QA 3MC0A 2O61B 4XCYA 2R56L 5DHVA 2QADC 1GGTA 5AL0A 3EJYD 4G6AD 1LO3L 3LPPA 2YBGA 1MJ7L 3F7KA 1NGWB 4OD1H 3VRLF 2Q7YB 1J8HA 5FM5O 1NM4A 2B15A 5HGDA 3TA3A 1IEBB 1HIML 3LYRA 2WXPA 4QRRA 4QRUA 4KGJA 3ULVF 1KIPA 4ZMTA 2HYMA 4PV8A 4OCYL 4X80L 2DYPA 2GC4C 3QUXB 3QJXA 5DVOA 4DKAA 2B1HL 3RL1B 2BVEA 1I8MB 3C6LB 4OJYA 3CLEH 3I84A 1M4KA 2CGRH 1PF3A 4N8VA 3VSTA 1LDSA 5JDSA 4U33A 4ZQKA 1V8HA 3BLPX 2EE2A 5CGBA 3E8UL 3D2UA 2WNGA 2EIEA 3ARSA 1GIGL 4I18A 2MKWA 4YHMH 2AQTA 1A7OL 1NMAH 1U92A 4Z7UA 5BOJA 4YH6A 4IHOB 1A02N 2YMXL 2Q6WA 1C7TA 3V0DA 1ZE3C 3SSGA 5ID1A 5T5FH 4KWUA 3IM1A 4KRPD 1S7UA 3X1GA 3QIUC 1YNKL 4BDVB 1NBZA 3GUFA 5D96B 3LPGA 2HRLA 3AB0B 3LVEA 4XNUL 5MP6H 2HKAA 1LE9A 1AR2A 4UOZA 4N2MA 2NOYA 4KRLB 3LQZA 1R3KB 3TT3H 3Q9PA 5BXFA 4NKIL 1FO0A 1I1RA 5DCCA 2DQUL 1QPPA 1H8LA 2D4DA 4LBAA 4HV8A 4V33A 4H8UA 4P99A 3QRGL 1OW0A 3HEIB 5I8OH 5FK9B 4L9LA 1DQTA 3FTWA 1UA7A 1FZMB 4ENZA 4E0RB 1L3WA 3ZMNA 5IB1A 3EAKA 1BEXA 3IJ8A 5FXCH 1ODUA 1AXSA 3NIDB 1NFAA 1MOEA 1PLCA 2P5WE 2WOBA 3FSZA 4JHZA 4PM1A 1P5VB 1GSKA 1CTMA 1FNLA 2ITDB 3FC8A 3LPWA 1ZY9A 3N3EA 2MEJB 3TH4T 4FFZL 1QRND 25C8H 4FFTA 3KJ4C 5JW4R 1HQ4A 1EAJA 4AJ0A 2UWEF 4FLOA 4WEEA 3QJOA 5CEZH 4NJAL 5IHLB 1FAKT 4OLXH 1IM3B 1KIUA 1MWAL 3DV4A 4FEMA 2NZ9D 5G4OA 3RU8L 6TAAA 2F19H 5JIDA 1KEGH 2A6DB 1ZT7A 1UA3A 3EYQD 3PFUA 3SY0B 5E99L 3DI3B 6CGTA 5AUMB 1X9RA 3LSOB 2VDPH 4M6NL 5KAQF 2GI7A 2HVKA 5HYEA 2A83B 4HPHA 5K69A 5KSVB 2FEEI 3FU5A 1RLWA 5IFAH 2CALA 1MH5B 1DLFL 4QRAA 3DO7A 1G9MC 4NN7B 4WSGA 4X7TB 1Q9KB 3CFTA 4I5BB 1Z32X 3UJTL 4CMMB 4HUWA 5KG9A 3SDAD 2FUTA 1JDCA 4JM2D 2OZ4L 1XBDA 2WJ7A 3ECBA 1BVOA 2WAQA 3FH5A 3K6DA 3SGKC 3UMNA 3JTSB 4RAUA 2ED8A 4JG1H 4ICXA 3QWNA 2X70B 4UTBL 3FQWA 4XP6L 2DQDH 3CLFH 3GB7A 3AROA 3U7YH 4BH8A 1A1NA 5IW1A 3NIGF 5DJZA 4CN6A 4NZTH 1IILE 1Y7VA 4NM8H 3T2LA 2YPVH 4P57A 2HA1A 1AO7E 5F88A 1VERA 1UWFA 1PY4A 3ET9F 4X9GA 4OZHA 2EEAA 2XIBA 4GUPB 4RDBA 3QQ9D 5IF0A 1PIGA 1LL1A 2OXHA 4QY8A 5H94B 4JKWA 2OBGA 1OGTA 5EWIH 5L7XH 1G7MA 2CAKA 4UU9B 3RB5A 2C9VA 2GIXA 3LXBA 4WNSA 5F8RC 4CVWA 1GAFL 1T1WA 1MKFA 4TNVF 3CDGA 1BZOA 3GBML 4C56E 1RZPA 1OT2A 2RHEA 1GYAA 4BHUA 3FO2A 3BH8B 3LN9A 4I1RA 3II3A 5HVWA 2YSSA 2A6KB 3OKOA 4P23B 4WHTB 3UYPA 3BSZL 4GRLA 4NWTL 4H2CA 1KGWA 3ARBC 1L9SA 3VQ2C 5HBBA 3GMPA 4Q9QH 1XGRA 3OHXA 1ZIAA 4K9EH 1G6RB 3BMWA 5B3SB 2FVNA 4KAQL 1TTFA 4GO8A 4X6BA 5HXMA 1ZANH 4QCIA 3U1SL 1JGVH 1F3JA 4IBSA 5F1IB 4UTAL 2Q86A 3S36H 3N50A 1NCBH 2AAAA 3PUUA 1ROCA 1KPRA 2ITEA 1IGFH 4G43A 3ZVVA 4UOQA 4NENA 4XGZA 2OXGB 1JZEA 3GXMA 1KYUA 1RP9A 3ZTDC 5JTWA 3IRCA 2IVFC 5I66B 3S0PA 1TVBA 4GAYB 3BFWA 3MRFB 3RHWK 2FBOJ 3W5NA 4BZ1H 4HIIB 1UWEH 5HYSB 4HBCL 5E6IA 1A6ZB 5INCB 3C5ZA 3EOBA 4UDTA 4X4YA 2EVGA 1MCIA 2JTYA 1BJ1H 4DKDC 1AMYA 4APXB 5SX5H 4F2MA 3MYJB 3RKDC 4ZW3A 5CN2A 2E3VA 3DX4A 1ZVYA 1KB9K 4KV5F 5DXWA 1LEIA 3DX7A 5E94B 3BW9B 1EEYB 3O2DA 3PAVA 3BJ91 4AUJA 1KNOA 3OJDA 4FQPA 4KK6C 4OF3A 4ZG1A 4JFZL 3BAXA 1QUNA 4LSSH 1T6WA 1XF3A 2FT6A 3KVQA 1SY6H 4KI5D 5G5DA 2GCYB 4Z6AT 5IT2L 2APXA 1WWWX 5KSAB 1I1AA 5D8JL 3PJLA 1QG3A 1YYLH 2CKBB 4QO1A 5FS5A 2Y25A 1EV2E 2K7PA 4S1DD 2QMJA 4IEFA 4Y4KD 1NC4D 2Y07L 2QKIC 4P2RB 4WZ9A 1EVUA 5GRYA 5DWUL 4Q7DA 2DS4A 5CLWA 5KEZA 4P5TA 2QSCL 2ZYHA 5TE7H 4B9ZA 4LHUD 2BP3A 4OBSA 1LEGB 4G8FB 2ATKB 2AXGB 4NP4H 3DKHA 3MRCA 4QTIL 5HVHC 2EILB 3CFEA 2VH5H 5DJCA 1WIPA 3P0VL 4PD4K 3ZZLA 4WJ5A 3FTYA 1LDPL 4XNYH 3CMGA 4KFZC 3TASA 2R2CA 4M1GL 3WEMA 3FO0L 5KSBF 4OD3H 1A21A 2PCXA 3EJPA 3HZYA 4AQEA 4D8PA 1WBYA 2W95A 4LLDB 2F54D 2XLLA 5BRZB 4CILA 3FO1A 4OD1L 3FSOA 3UZEC 3EYOA 4LEOA 3RUGB 1W72H 2IH3A 1PY9A 4CC0A 2V37A 4MMZA 1O7DC 2Y1ZA 4M5SA 4J5VA 3PWUA 3BZ5A 1ERNA 5DHYB 5C0BE 1AOZA 3F5WA 2AMGA 2P44B 3WHE0 1P2CA 1DFXA 3RFZC 2NSQA 4ENED 5FWRA 3NJKA 3QCTH 4PBVC 2NDGA 6PAZA 1YN7B 3CLEL 3V9FA 5JOPD 1RHFA 3U6RA 4NN5B 4YNYB 4PJHE 2CGRL 1VJSA 5T3XD 2BC4B 1PQZA 3GZPA 3O4LA 4QWWD 1NFDE 1WAAE 1IAII 4WJG3 1FNAA 1R33A 2UWEA 2ZAGA 1INQA 3MMEA 4MD4A 4PJ7A 5CU5A 1G9MH 3RTQB 3SPGA 2Z35B 3MX0B 4HUVB 1NBYB 3DTDA 1A3QA 2A9MH 2JJSA 3PWVB 4YHML 1NMAL 4DFHA 1IEAA 1R5WB 4OGZA 3ZE1B 4Z0BH 5T5FL 1CXKA 2KQNA 1DQJB 4JN1H 4LL1A 4JPIA 1H3TA 2VE6B 2C1PA 4MDIB 1CC3A 4K5OA 3T3MB 2NY3C 3OAZK 2P8PB 5EEZA 5MP6L 3ASOB 1PNCA 4LOUD 3TT3L 2H3XC 2Y69B 3GIZH 1JZ8A 1Q9OA 3D06A 5LVEA 1MI5D 5J6GA 1OE3A 1ZLWH 3HS0C 4QGTA 2ZXWB 3BUTA 2ISDA 2K70A 4JGNA 5KYNA 5CGYC 1LWJA 3GXUB 3HE6A 5EZJB 5I8OL 2ID5A 1HWHB 2BPBA 4NOBA 3MFFB 4GRWE 4KI1A 2Z1PA 4AEFA 5F21B 3RI5F 3GMMA 2JIXB 2ZX8A 1NGZA 1WK0A 4GXFA 4I0PB 3BH9A 4FQXB 3SDCB 2BY2A 4U1NB 5IP4A 1XF2B 3FQXA 2XG5B 2H9GA 3WTXA 1XGQB 3SDYH 2X9WA 4L37B 4HKJB 2RJMA 1NGYB 4JGUA 4PR5B 4GIOA 2O61A 25C8L 1S8DB 2ICEB 2J3SA 5IIEB 3Q06A 5DFVC 1I1FB 4X4XB 1NGWA 4EI5C 1E6JH 2Q7YA 2J5LB 4OJFH 5CEZL 1HL4A 4ACPA 2WKOF 4GI8A 1IEBA 4OLXL 5D1XD 2YJLA 2VZUA 4BINA 1KEGL 2F19L 1WGOA 1RUKH 4IK6A 3FYEB 3WEBA 3QUXA 5T3ZH 3B2UC 4XMTA 2DQ6A 5K9QG 1FIGH 3KBPA 5GZOD 2VDPL 3WELA 1I8MA 2Z7WA 4AK2A 3C6LA 2X53A 3L9EA 1I75A 1NCNA 2KERA 3OR7A 1BAFH 1WFTA 5IFAL 1NDGB 3S9DB 4O00A 3V52H 4JEGB 3VFVB 1ZD6A 2OJ1A 5MEOB 4D9QD 4XX1E 5BUAA 3CIQA 1KACB 3D09A 3HC3H 4I85A 4RA3A 5IQOA 2NY4D 2WQ8A 2RCSH 3K6OA 3W9DB 4P4KD 4JG1L 4IHOA 4PB9H 4W9EC 3D34A 2GK2A 1QSFD 4LPTA 4LDLB 1PFOA 4PJ5D 3W0WE 2DQDL 5A1AA 3CLFL 3FONB 1TQCB 5JMRA 5I28A 5JQIB 3BEVB 4BDVA 1WHPA 3QJTB 2D2OA 2AI0H 1EFXD 4WTZG 3U7YL 1ACXA 2Q20A 2A9BA 4YFEA 4NZTL 3VI3B 4YL9A 3L48A 4NM8L 3F7VB 2YPVL 3T0EC 3L45A 4Y2DC 3ZU8A 5D2NE 1R3KA 4RGNE 4XRCB 1M3JA 1S5HB 2VDKH 1BG1A 2ZOUA 4NDMB 1OALA 1HNYA 1ZHKB 1BFSA 5EWIL 5HDRA 5FK9A 15C8H 1TZIB 5L7XL 5EDXA 1XB8A 1JYNA 3CC1A 1XIWD 3N41F 4J8RB 4PCSA 5JW3H 4E0RA 3AWEA 4J4PD 4FFYH 5I6KA 3ULUC 2H2PC 3I6SA 1AXIB 3WIFB 1FNHA 1P5VA 2ITDA 3REWA 1NC2B 2A9AA 3I75B 2HRGA 4OBRA 3G5ZB 3DJZA 3QJZA 5ISZA 1NIAA 5CEZD 4NQVA 3WMPA 3HB3C 1ZSHA 4Q9QL 4AL8H 5B8CC 3KPTA 3QDJB 1JZHA 1JD7A 1OF2B 4K9EL 4MKTA 5EEYA 1IM3A 1DDHB 2ZUWA 5AB9A 2IDQA 1ZANL 1ZGLM 4PYGA 4DEUA 4OFYA 1CQKA 1JGVL 3DPDA 2A6DA 3SPCA 3S36L 1NCBL 2LHAA 3SY0A 4TVPH 3IDJA 5AUMA 4I9WD 5JR1H 2FCBA 2A83A 2O6FA 3EJRA 5KSVA 2BOLA 1IGFL 1MH5A 3FQUB 1AZNA 2IPUK 2GSIA 4GOSA 3T3MF 5HYJD 5KYYB 4MRBA 4ONGH 4X7TA 2MJWA 1Q9KA 3MUGB 4I5BA 2GY5A 4TMPA 4CMMA 3ZGIA 4JZNA 4M5ZH 3BCDA 1ZK5A 4B9KC 2LTQB 4BZ1L 4J23A 1RMFH 1UWEL 2DLIA 1JPGB 1B9KA 1SEBB 3T0BA 3KS0H 3VFGH 4U1GC 4B9PA 4JZJC 5KSBA 1TTRA 5HPMB 4UOW0 4LAJH 3E9TA 2X70A 4B3EA 4WTZA 4OCNC 1REIA 4U2YA 3WS6C 3PQYB 4BA0A 3AREC 1NGXB 1PNDA 3PHQB 4S2SB 3V6OC 3MRLB 4P2OD 1NMBH 3WO4C 2ED9A 3P3UA 1IX2A 3UADA 4LSSL 2ZNWA 3QK0A 4WRLA 2WP3T 1SY6L 2MQGA 3H2QA 4FQQA 3S4SB 4DZBB 4GUPA 2QPUA 1TMQA 5H94A 4FQIH 3ECWA 1XAUA 1E4WH 5F1OB 5F7LB 4UU9A 1YYLL 4AIXA 3DK0A 4H0LC 3T0WA 3VTTA 5CEXB 2F1EA 4TLKA 5JHAA 1OB1B 1ZXKA 4TQPA 1A1MB 1RHHB 4JY6B 1ASPA 3BH8A 4F7TB 5TE7L 2A6KA 4P23A 4WHTA 5IMKB 4NP4L 3UBXA 1ML0A 5I1KH 5JPMB 2VH5L 5IY5B 5EG6C 2H32B 3K1DA 1SJMA 4H8VA 4XNYL 3L9RB 5F1IA 3OSVA 4BM7A 4OD3L 3UABA 1MHHB 2EKJA 5TPWH 4POZD 3V5HB 1UASA 1DP0A 3DVGA 1GW0A 4F2MB 2BW4A 1W72L 3IJHA 4HSAC 4FG2A 2CQVA 2JI2A 1LTXA 1SBBA 3IAPA 2W65B 3ILQC 2V33A 3MLYH 4QNPE 1KC5H 4NCDA 3CZFB 4GAYA 4QHLA 1BFOB 1C8QA 1VIWA 1LJMA 2W80C 1UCTA 3QCTL 4HIIA 5HYSA 1A6ZA 5INCA 4LSQH 2O93L 2CA3A 1HDMB 2C8NA 2XTJC 4APXA 2X12A 4ZO6A 4AGLA 3AXLA 1FDLH 3ZHKA 3WE1A 5E1GA 4ZXBB 4F9PA 4NN6B 1AZBA 1G9ML 3PE9A 4XTRD 2ZAIA 2DJ4A 3QR0A 1J7VR 3ZDWA 5C0FB 2WKOA 5E94A 3BW9A 1EEYA 2A9ML 1QSED 2EO7A 4OFQA 1E5BA 2L3BA 4OLVH 4Y5YB 4Z0BL 3MV8E 2YAFA 3K0WA 3HR5B 4JN1L 2JCWA 2GCYA 5F72S 1IM9D 5KSAA 3JWNC 1PZAA 4TVSa 1GZHC 2FQEA 1X9QA 3T6QC 2QBWA 1BQ5A 1IAOB 3RY5A 4P2RA 2DWSA 3ESMA 1OSEA 3HFMH 3QA3A 3GIZL 3PWPB 1K4DB 3QNXB 4GRMB 1FFPB 1JUFB 4F20A 3II2A 5IW3A 5CIPB 4M9PA 3RP1A 3ARZA 1XXDC 4PVMA 2IH1B 2OLDA 4X5PA 4FE9A 1LEGA 2DJUA 2ZWSA 4JRWA 3OG4B 4G8FA 3VXMD 2ATKA 1VZGA 2AXGA 1TKWB 1HZLA 1S3RA 4MS6A 2KDGA 3B9KD 4B9JA 1TSHA 1IRAY 2CNZA 2AFNA 4R2GC 2WQSA 3B7RL 2V5YA 2G4EA 1MFVA 3VB9A 3SDYL 2BFGA 3GBNH 2YAOA 3FT4B 1J18A 3FPXA 2CRYA 4LLDA 2G2PA 5BRZA 4BQ8A 4HKZB 4Q58C 4FQJH 3RUGA 1E6JL 4FJYA 1U8IB 4OJFL 4ELMB 1U8KB 4Y88A 4DP0X 3VGFA 5DHYA 2PO6C 1RUKL 3M88A 4GI6A 5T3ZL 4DGYH 1FGNH 1FIGL 3CN2A 1E42A 2VQ1B 3GBEA 3KDMB 2RMNA 1RUMH 3IDGB 4O4YH 1BAFL 1YN7A 2WQVA 3R8QA 1JYVA 4WCYH 3NGBB 4U0RC 1U42A 4HJGB 4YNYA 2JFCA 2M83A 3V52L 1CGSH 5J89A 1N6VA 3WY4A 3IAQA 4OZ4B 3RTQA 4RX4D 5H2BB 2Z35A 3MX0A 1EO5A 3HC3L 4NFDA 1MUJB 2WWOA 4OCSH 4PGZA 3PWVA 5C71A 5HYFA 4N6QA 5E8OB 2RCSL 3B9DA 4PB9L 3D3VB 3I9AA 1WT5C 1QVOB 1R5WA 4NZUH 4A55A 5TQ0H 3TZVC 4YSRA 2X28A 1DQJA 3LKNB 5GGVH 5AWNH 2VE6A 4MDIA 2AI0L 4MVBD 1UHVA 3TN0C 4Z7NE 1JXGA 2P8PA 1AGCB 1WWAX 3GMQA 1JZ5A 3HHMA 3COOA 1A6AB 1EDHA 1WS7A 4J3OH 5F44A 2BOBB 2XG4B 2OMWB 4LCCC 2W94A 4IBYA 3RDTB 3CHRA 4KTYA 5CZXD 3UL4A 2VDKL 3R19A 4F8QA 4W81A 2BOCA 3B5GA 5TTRA 5EZJA 15C8L 1CVSC 3MO1A 2VZ3A 3MFFA 3A47A 2JQAA 4X6DE 2YS4A 2VLRB 3MJGX 5JW3L 3VFMB 3I6KB 1WA0X 1EH9A 3HG4A 1XV8A 3K80A 4FFYL 4I0PA 3SDCA 2Z92B 1DJHA 4FQXA 5ALCH 4U1NA 1XF2A 5KYWB 4U6TA 2MOQA 5GGQH 4X6FA 2XG5A 3UGEA 1XGQA 3CIAA 3GSUB 4JG9A 4L37A 3ZYIA 4B7LA 1T4KB 4HKJA 4Y4HB 3JBG7 2WTOA 1S8DA 1X5ZA 5TF1H 5IIEA 1IEHA 2Q7NA 3SDXB 1I1FA 1TG8A 4X4XA 1JMZA 2QQNH 1CTNA 3KYAA 5ESAB 4AL8L 1HJBC 4C47A 1HESA 4X6CB 5DO2C 1A47A 1CYXA 4OY9A 5AW9B 5JXED 3RGVA 1DEDA 2P43B 4TQ8A 4KK5D 2XZAH 3SPVB 4TVPL 5EA0H 2H6PB 4Z3JA 2PWFA 1I3RB 1O7DE 3CVDA 5JR1L 2P7TB 1F3DJ 2NY6C 3GINA 2IPUG 1TVHB 2CR3A 1NDGA 4U3XA 4F80A 3GMLB 4ONGL 2DEWX 3PWLB 1KBGH 4JFFE 1EJ8A 1DANU 5MEOA 3VXSE 2GT9B 5DA0B 1EQWA 4M5ZL 1D5ZB 2LGNA 3V4UH 1RMFL 4OKVB 1E2VA 5BZZA 3G08B 4B60A 5IJCC 5E8PB 3VFGL 1G7LB 4WFGE 4MJ6B 4XBEH 1NIEA 2GBUA 3QJSB 3FONA 1X5GA 2EE9A 3B2PA 4JE4B 3BEVA 1Q1JH 1MW0A 1WA1X 2WZ6A 3WDHA 3Q43A 4CMHB 1I82A 1NMBL 2YQBA 3H9SB 3O3AB 3F7VA 4F8TA 3N40F 5I0XA 3ZIYA 2KZ1B 2VSDA 4IMKA 2D3VA 4XRCA 4HLZG 1S5HA 4NDMA 3LQMA 5DF0A 1DQKA 2HVJB 3BKCH 1ZEAH 1E65A 1ZHKA 4FQIL 4Q89A 4DCQB 1BV8A 2K4WA 1E4WL 1BBJB 3T6XA 4AEEA 4ELMF 5CLYA 5E24E 4KRPB 4PJEB 4U6XA 2EEFA 3O0LA 1R3JB 1AG6A 3QUGA 4ADJA 2WXNA 1XGPB 3QJHA 2VAAB 2CBPA 3APDA 2GVYA 2YRZA 5I1GH 1UD6A 4YHPB 5D93C 4LLUA 4ADIA 1U8LB 3WIFA 1HWGB 1KXVA 1NC2A 5BNXD 5DZPA 3S8WA 3G5ZA 3KPSB 4JG5A 3GZOA 2ENYA 3QB7C 2BVOB 5HGGS 3GUTB 5I1KL 3EHBC 3MRPB 4MCNA 5DMIH 4NNYB 3QDJA 3CQQA 1OF2A 4YZWA 4QRFA 1HL5A 1Q9LA 3FUEA 1CR9H 2X2UA 1HSAB 2GKIA 3CJJA 5TPWL 4OB5H 3NRFA 5FA3B 1SQ2N 1ZS2A 3FQUA 2FHCA 5KYYA 2X7LB 1QRNB 2FT8A 3GWJA 1KLFB 3VXUE 3ARFD 4PG2A 3MUGA 3NZ8A 3MLYL 5F7NC 2JJTA 2ZG1A 1KC5L 3EO1B 4FI6A 4CBPA 5JIKA 1EGJA 3CDCA 4XCEB 4PLJC 1BJMA 5DC4B 2TAAA 2GIYA 1KUMA 4J3TA 1JPGA 4KRMB 1SEBA 2V9UA 3KWXA 4LSQL 4MXVF 1TOXA 1FV1B 1WG3A 4XO8A 4N2NA 5DJYB 3Q5YA 5HPMA 1X4ZA 2YAMA 5FCUH 1BP3B 3KPPB 4A04A 1FDLL 2ZYRA 3IKKA 3PQYA 3UPAA 2FLBT 2ZSWB 3W2DH 1NGXA 1SDYA 1PX4A 3CZEA 4S2SA 4EAEA 3DX2A 3C09B 1EK3A 3FKUS 4DNLA 2AQPA 4UZSA 2AABH 3QH3B 3SDAB 5DHXB 1ZSDB 4OLVL 4N5EC 1ULVA 1OP5H 1O9VA 4HSQA 3WXWH 4YMPA 4GXUM 3RNKB 5JW5A 3S4SA 4DZBA 1EAQA 3AAZB 3DX6A 3SDXF 4BV1A 3VSQA 3RWHB 2EDRA 3T0EE 1E5UI 5EMYA 4X6CF 3VG9B 2OYMA 1JBJA 2DLEA 5CEXA 5I0ZA 4P8QA 1OB1A 3HFML 3TYGH 1TCRB 1ZJAA 1A1MA 3DJSA 3P4NB 4DO5A 1X7QB 1RHHA 4JY6A 4PJIB 4F7TA 1FLRH 1XF5B 1OPGH 2VR3A 1D7DA 3NCYS 5J6HB 3F6IA 3ULUE 1KCSH 1K3IA 4ONFH 3QXWA 4AQ1B 5JPMA 3B2XA 2HKFH 5I17B 1TITA 4I4WB 2H32A 4KK9C 2BNRD 2ZP9A 4GKOA 1I8LA 3L9RA 1CI3M 1JL8A 4KITB 3GBNL 1MHHA 3BVVA 3V5HA 3CU7A 2R83A 4R4BB 4LRNH 4P46C 3BN9C 1J8RA 1ZCRA 4FQJL 4NQSB 1HHHB 3O11A 1UOLA 2V0AA 3G3LA 4PGCB 1HOCB 3PNRB 2W65A 3FXIC 4DK3A 4HOXA 2WK2A 1MWAB 1R3IH 4YDKH 3CZFA 2WWMC 4IIQC 4DGYL 2CUAA 1FGNL 1BD2E 1BFOA 1AAJA 5DEFB 1FWXA 2OMYB 3QWQB 3UAEA 1F8TH 4BHUI 2IADA 2V3FA 3QXUA 3Q2CA 1RUML 1WFMA 4O4YL 1J05A 2V6HA 4ECNA 1MCSA 3MUHL 4WCYL 1EJOH 4PJEF 1OM3H 5F7HA 5MEQB 3VGAC 2OYLA 1E4HA 2ZUSA 3GXTA 1CGSL 1Q8MA 3T6VA 3N06B 3V9EA 3IRPX 3IMWA 1E6OH 1E5ZA 2XNAA 5DHEA 2JVUA 2APWA 2W8CA 3HG2A 2G2RB 2NY2C 4HS6B 4OCSL 5EIQA 4Z3TA 1NCOA 1ZK9A 2A3TA 4QXVA 1FPTH 1I4FB 4Y5YA 3IB4A 4NZUL 2FNWA 5TQ0L 4I0KA 4JKLA 3PDOA 3HR5A 2JJUA 3V6OE 5KBDA 1T7YA 5GGVL 4WUUD 5AWNL 3NCJH 3US9A 1PD0A 5E8NB 3VWKD 2VC2H 1URLA 4R96B 3F83A 1ET5A 3D39B 4ZOAA 1W6WA 4V1DD 1ONQB 5E6YA 1IAOA 2IH8A 4TTDC 1ZLUH 3TEWA 1H9DA 3ZTJG 5GS0D 1EA9C 5C3LD 3PWPA 1K4DA 2NLJB 3QNXA 1JUFA 4PJBF 2ZOOA 3D9AH 5CIPA 1WH0A 4MXQC 4DESA 2Z91B 2IH1A 4CBZA 4QEGA 5KBKA 5IQ7H 2Z4TA 3O45B 1RERA 1Y18B 2AQRA 3E2HB 4CJ0A 3JZ7A 4UBDD 3QO1B 2WGNB 2BDNH 3ZYOA 1QPXA 5ALCL 5DJ6B 5GGQL 1MVUA 1NC4B 3MROB 4PCTA 5DFAA 3QQ4B 5IK3B 3FQYA 5F7KC 3VRJB 1JVLA 4J28A 4X8GA 1G6VK 2L7QA 5TF1L 2DTMH 4GS7B 4HKZA 5IFHH 1DJIA 2QQNL 1U8IA 3G7TA 1OTTC 4ELMA 1U8KA 4AGOA 4AVIA 2JKNA 2XI9A 3QDGE 4AIZB 4FKEA 4D9LH 2PP9A 2CK0H 4DO4A 5JA8B 4JM2F 5JLZB 2ZUTA 2VXQA 2GB2A 2ZOLB 3UTTA 2XZAL 4LL9A 2LLGA 3ECUA 3EJCA 5EA0L 3K6SB 1TIUA 3EDJA 5AEAA 3L1EA 4YSEA 3QZMA 3IDGA 4WO4C 2EXWC 2Z7YA 4HJGA 2F54B 3CFNA 2VO8A 5FW7A 3PYCA 2VZOA 3IFLH 1KBGL 1JN6B 1J1XH 2W9LA 1I85A 3LXUX 4MNGB 4OZ4A 2AJSH 5FYLE 2OL3B 5H2BA 4B9IA 2LOEA 1MUJA 1N2RB 2ZONA 3V4UL 1P6FA 5LGJB 5I6PA 3ZDZB 5KS9B 4WENB 2XKUA 3GPEA 4GAGH 1QVOA 1C08B 3E6HB 4XBEL 3SBRA 5D6CB 3LKNA 1RIVH 1XB6A 2BY0A 1HKFA 1Q1JL 4PBWD 1YNTB 2WXIA 1TXKA 4NOFA 4HT1H 3ZQWA 3QI9D 1A6AA 2VOTA 1PEZA 2OMWA 2JLLA 3JWNE 4BQCA 1G5AA 3RDTA 5T1LA 4IW4C 3BKCL 3AY2A 1ZEAL 3DOIA 3VU2A 3V4LA 3ETSA 2A6IB 1RV6X 3DLQR 4FFVC 1ZTMA 1CI5A 1EANA 3KH3A 1OP4A 2VLRA 3QIWD 5EU6A 4NYLB 5AVRB 3I6KA 3VFMA 5D7EA 4KKPA 3CD4A 4NP9A 4U6HB 3V8CA 5I1GL 2WVVB 2Z92A 3P30H 5KYWA 4AGQA 2DI8A 2NW3B 1BEYH 2LV4A 4K71C 1MLBB 3GSUA 1T4KA 4Y4HA 1MI5B 3VGDA 4C4KT 4KROC 2BVUA 1NUDA 1KDJA 1OTUC 3C8DA 3FUKA 3CNKA 3RPBA 3SDXA 3WKMH 4JRXB 5DMIL 5ESAA 5EUOB 3NK4A 4ZPTB 5DD1H 4X6CA 1B2WH 4DVRH 1G7PB 4MZ3A 1HN1A 5AB2A 1QFPA 5E8DH 4Y5VB 2E86A 1IC7H 2JH2A 3T8VA 3RX5A 3LNHA 1CR9L 3TO4B 1I3RA 4C4UA 4OB5L 4L0ZA 4E5XB 5AW7B 4BUHA 2P7TA 1S4IA 2W81C 3ARDD 2IANE 3E1ZA 1EAPB 4XAKD 4HAFA 1IC1A 1QFWM 3BFOA 4OLZH 3PWLA 1NGPH 2F53E 2DQGH 2UXFA 1KFGA 2GT9A 2PF6A 3DWTA 5D1XB 3HE7B 4J3BA 1CFBA 1ORQA 4BSVB 3SHSA 1D5ZA 4YR6B 1KFAH 2YN3A 4OKVA 4JJ5B 2B77A 1BQUA 2WLZA 5E8PA 5J5EA 4MJ6A 5EU7C 3ZKMD 5JZ7C 4KI5F 5FCUL 4KK8D 2CJ3A 2QHRH 1NAKH 1KLGB 4L9DA 3W2DL 4FXGC 4RDQF 4F1SA 2FEJA 4ORGB 4Z7VB 3O3AA 2AABL 1P84J 3FFCE 3RBSA 43CAB 4PP1C 3WXWL 3JTTB 1QLEH 3K81A 2NY4B 5D1QE 4E2OA 2FEEL 5FFGA 2CG9X 2CIIB 4DCQA 3IEAA 4QHNA 1BBJA 4K3DH 4KKCC 3J8F7 5FYJE 1M7DB 5IMOA 4PJEA 4U1MB 4PJ5B 4CN1A 1OB0A 1R3JA 2B2XH 4OLEA 4FG6C 2ZCLH 3GEFA 1EFXB 3MNVB 1OT1A 1GRWA 4XH2A 1M1XB 3TYGL 5SWSD 4YHPA 4KXCA 3WDJA 5LDSA 1U8LA 2P5PA 1FLRL 3H56A 5EBLA 1OPGL 1E4XI 8FABB 1HI6B 1QRKA 1RPUA 1NCWH 4J6RH 5EEWA 1KCSL 2BVOA 4Y8DC 3L3JB 4R90H 3JV5A 4ONFL 4DZ8B 3GUTA 1MFCH 4NNYA 3CUPB 2HKFL 4H8PA 3N1QC 1TYEB 2YD3A 1URZA 2N7AA 2VT0A 1XIWB 5KS9F 4LPYA 2L4OA 4MMXB 1ZDSA 4XVUC 5E1IA 4BE5A 5EEUA 1AZVA 2V5RA 4M7ZC 1HSAA 4LRNL 5AAPA 4IRZA 1U3HD 5FA3A 4S0SD 4LBEB 1VGEH 1YNTF 4IBLT 4A67A 2X7LA 1QRNA 4ZX3A 2VN5A 3WIAA 1KYOJ 1UENA 3GT6A 3EO1A 4OGXH 1R3IL 4YDKL 2ZX5A 1OQXA 3MCG1 3RBGA 4XCEA 1F8TL 2E7MA 4HG4K 4AGNA 2W88A 5FKPB 1FV1A 2WLIB 1E0OB 2ZUYA 1EJOL 3MKKA 4IGBC 4RGMB 5DJYA 1OM3L 4EVNB 2O5ZH 3PAUA 3UACA 5BV7B 1USZA 3WSQH 2ZSWA 1E6OL 4IOFC 4YHOH 2NY7H 4RBPH 3V6ZB 2XN0A 1YHPA 3LEXB 3DO3A 4FHKA 3QH3A 4JM2A 3SDAA 1ZSDA 1FPTL 2JKLA 3Q5TA 4N2BA 1MY7A 3I85A 1CXIA 1UA6L 4YPJA 3RNKA 1J12A 1U8QB 2HFGH 3JYCA 1E9PB 3AAZA 1J86A 2Z34A 5EUOF 3RWHA 3NCJL 3FT1A 2VC2L 3DOSB 4HC1H 4NUJB 3MNZB 2BMKB 2OMBA 4OW6A 2XN1A 1GJWA 3D33A 1KXTB 5DD6B 4AH2B 5AG8A 4OIAA 3FB8B 3D69B 3P4NA 3ATEA 4P2OB 1X7QA 4OZIF 3D9AL 1VEMA 3PU7A 5D1ZB 3NK3A 3VA2C 3GSXB 1JXKA 1XF5A 3VH8B 2IAMD 3WHE1 1R17A 5IQ7L 3ZX1A 5J6HA 3QDAA 5LB1A 4I1NB 2BERA 5ICZB 2X4RB 4YDLB 5IOPB 1O0VA 4I4WA 2FSEB 4G82A 2N0MA 1I9IH 2BDNL 4N3UA 1T5KA 3FFDB 4GSQA 5CP3A 3TBWB 1FH5H 4CC4C 1CICD 3L2NA 1UT9A 5AKSA 3OXRA 4UNTA 5K1NA 5AG9A 1N8ZB 4R4BA 3CSYB 4PIBA 2DTML 1SF3A 3C9NB 1NBVH 2FBRA 4NQSA 5IFHL 4FKHA 4BZ2H 2X9XA 3HC0B 3W9EB 4PGCA 1MRDH 2E4TA 4XZ4A 3MVSA 3ZN6A 1H8SA 4D9LL 1PTZA 1UFGA 2CK0L 1UKTA 2EEBA 4FNRA 4MJJA 1WAPA 2PYEE 5DEFA 5ADPH 4IYKA 5I8KH 1JV2B 5GRUH 1N26A 1NWOA 5HHNA 1P9MA 4UMGA 4JY5H 4Z7OE 4WWKC 4WNJA 1CXHA 2X1OA 3IFLL 1BMGA 3LKQB 1J1XL 1W8EA 4BFIB 3NP4A 2OMUB 1KY6A 2AJSL 1GYCA 4IIZA 3DOHA