3C6SA

Crystal structure of fab f22-4 in complex with a shigella flexneri 2a o-ag pentadecasaccharide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
DIVMTQAAFSNPVTLGTSASISCRSSKSLLHSDGITYLYWYLQKPGQSPHLLIYHLSNLASGVPDRFSSSGSGTDFTLRISRVEAEDVGIYYCAHNVELPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab F22-4 light chain
publication title Structures of synthetic O-antigen fragments from serotype 2a Shigella flexneri in complex with a protective monoclonal antibody
pubmed doi rcsb
molecule tags Immune system
total genus 48
structure length 216
sequence length 216
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6sA01
5JZ7D 1M6OA 2DIAA 3GHEL 3LN5B 4WV1B 4HS6A 4HWEH 4QHNB 2OBGA 2AJ3B 4YHYC 4AH2B 3CX5K 3ULVC 1EFXB 3EZ8A 1Z9OA 3E1F1 5DVOA 1IFHL 4PGBB 5FOBA 1CQYA 3X12A 5DHVB 3DIFB 1GPOH 4JGMA 4P9HC 4YPJA 1R3JB 2LTQC 1A3LL 3MA9L 3KGRA 3NA9L 3G08B 1B0RB 4M5YH 3MRRB 1MHEA 2IMNA 3W11D 1XF2A 4MB3A 5E1AA 4EDXB 5EOQH 1BFVL 4F58H 2A6DB 5I16A 1Q72L 4M1DH 4TNWF 5GJTH 3W0WD 1BBJB 5BRZB 4QOKE 5EORH 1B4RA 2XG5A 1A4KA 2P24A 2PTTA 4KQ3H 4LPWA 3WE6A 3T3MF 5IGXH 2ED9A 1UCTA 4JG1H 3ZYIA 3X11B 5JR1H 1WVZA 4Q9RH 4WW2B 4J23A 3WNKA 5HGHA 4L3EA 1Z5LB 4LSSH 1T83C 3U6RA 5DMIH 1LE5A 5AYUH 1OHQA 1ZGLB 2CK0H 2VLME 1UVQB 2VDQL 4MCZA 3MV8A 5I1CL 3MRHB 4NC2B 3GSVA 4PD4J 1W8NA 5DTFA 3B3IA 1S5IH 1NANI 3DVFA 4S2SA 1A7OL 1IGMH 1YUHB 2XTJB 4XX1G 3IDGB 4KHTH 1HZHL 1BZ7B 1FFPA 1RURH 4OZIB 3S37H 4F3FA 1DEEA 3QUKB 1HHKA 1ND0B 2AV7A 1IGJB 5HHPB 3T2QA 3TA3C 1E0OB 2PCPB 1XZ0A 4HGMA 4MA3B 4HPOH 4YXLH 3RVWD 3UAJC 3PQYE 3RWDB 3GMOA 4R7DA 1UJ3B 4DFIA 2I9TA 3ZDYF 5SV3A 1MFBL 4J3UA 5DXWA 4LAQL 3BUTA 1TQBC 3FZUC 2XA8L 3O9WC 3K2MC 1EVTC 3VFOB 4Y16C 3HI6L 5C0AB 5I1HL 4DVRH 4R2GD 4PJ8A 5CHNB 1S78D 1XIWB 1NPUA 1J8HE 5C6PB 3MRBB 1T7WA 1XAUA 3QO0B 3B9KA 5ISZD 1YJDC 3QDME 1U92A 4PJGE 5HVFB 5K9OA 1U42A 5EU6E 5FCUH 2MHAB 2Z4QA 2H6PB 2VDRH 3PWPD 3WNMA 1EBPA 1F4WL 5IB2A 3V6OE 43CAA 2CLRA 2X4PB 4QOKA 4G6FD 2ZG3A 5IK3A 5ID1B 2P5ED 1F2QA 4YPGB 3WJLA 1UACL 3C8KA 2JJUA 3WNNA 1QFUL 1G7PA 4YK4B 1Q9LA 3MNVA 4HS3A 4K2UH 3MRGA 2V7NB 5ICYA 3EYFB 5F7UA 3HNSL 3L9RB 4I5BB 4KK6C 4FQIL 4AG4H 1H15B 3NIGE 4LBEA 1KEGL 1HOCA 4XCYA 4WHYG 1P7KA 2C3GA 3QISA 4U1KA 4JO4H 1KCVL 1JMXA 4UU9B 5T3XL 4WI9A 3THMH 3VFPA 1A7NH 3O6FD 1NCDH 3MJ9L 1KCRL 3R06B 1FIEA 2X40A 3VXME 1WBYA 4PY7B 4FQJL 5GGUB 1OD9A 2QSQA 1I7UB 3NGBB 2HH0L 3QT2A 3VDCA 2UUDH 1H3WM 2DKMA 3PQYA 1U3YA 3NZHL 4X4YA 3IJHB 3GMPA 3HC0B 5B38B 4M6OH 3SE9H 1JHKL 1MCWW 2BOCA 1OAUH 4C56E 1T3FA 1QEWA 3S5LA 1HEZB 1U3JA 4XXDB 1R6VA 3Q6FA 3ULVL 2FCBA 2APBA 2EDHA 3RNQA 5DRNB 1F58L 5FYJL 2JELL 1R5IA 2VITA 1ZHKB 3WHXA 2BNRB 4TUJB 1D9KD 1J8HA 3RJDA 1JGDA 1CLCA 4NO5A 4UDUA 4G6JH 2UZYB 3RDTA 3QDMA 1KTKE 4NGHH 4L8SA 4PJGA 5IQ9B 3KPRE 4IDLA 3ARDD 5AWNL 2JJSA 5EU6A 2P47B 5JUEL 5MEQA 5DMYA 1AJ7L 3H9ZA 3KHQA 4HKZA 1JGLH 3V6OA 5J6HB 1W0VB 2FHBA 4D9RE 1HK6A 1OGTA 3C60C 4LRIA 1AGBA 2DYPB 4G6MH 3VU2A 2EE6A 2NTFA 5TE4L 3TN0B 4EUPG 2CIKA 3V7AG 2I60L 4MJ5B 1PAMA 4KJQD 5EFIB 5DUML 3SDAB 5D96C 1BPVA 4XBEL 3O6LL 1GL4B 3KLHD 4X7SH 4HUUB 2OR7A 1D5ZA 1H3PH 1FAIH 2MSPA 4L8BB 3MLYH 2CDEA 3UTZB 4GOSA 1BGXL 3PF2A 4JFPB 1I7RB 2B8OT 3PP4L 4Z95H 5IIEA 1I3GH 4NC1C 4RZCB 4XC1H 3V52H 3QPQC 1OAKH 1HHJB 4LVNB 1GC1C 2PETA 2J3SA 4NO0D 4JZOA 3VXMA 1UM6L 4QTHB 3BH9B 1W0WA 5C9JA 1KG0A 1EJOH 5GS1B 1URLA 2E7HA 4G8IB 4QXTB 2DQCH 1S7QA 3CCHB 2IH3A 1F00I 5C7XL 1U0QA 4HS8H 4XNUH 4NDMB 1AO7E 1IKFH 2Y5TA 3QNXB 5GSRA 3UZEA 1DBJH 1C5BH 2W0KA 5I15H 3CFBB 3FO2A 1WEJL 3BZ4B 4NNPL 2ESVE 2APVA 5LWYL 2AXGA 1BM3L 3M17A 2Z31A 2EO1A 2J5LB 2PN5A 3NPZB 5IOPB 3BXNA 4C56A 3TF7C 3QUYD 3C6LC 5CKAA 5KS9E 1QP1A 2VZTA 3SE4C 4RFEB 1N5YL 3IFLL 3LN4B 4HT1H 1E27A 1B3JA 1LO5A 1VACA 4U33A 2IFGA 2APXA 3KXFE 3TH2T 3NFNA 4WWKC 3L7FA 4YAQA 2EKJA 3DX9A 1IT9L 4LARH 4Z7VE 1CK0L 2XKNB 3FO1B 3HN3A 3V6FB 4M62L 3VXUB 4LCUA 2J88H 4OI8A 3CVIH 3KPRA 4KH2A 3IT8D 3OG4B 3ES6B 4X6BA 5CP7A 3F7PC 3LN9A 3VI4F 3MGOA 3VA6A 3KLAA 3O4LB 2OP4H 1TZIB 3P4OA 3DV4B 4NJ9L 4HW6A 3RKDC 5ID0A 5F89B 4OD2A 5A40E 2XYCA 1FYTB 4Y4FB 4HWBL 2FHFA 1GGUA 5ETUB 1I8MA 2D03L 2Q8BL 2X1WL 2GK0A 1IL1A 1KNOA 5SWQB 3ABZA 5IW6A 4ZAKC 3U9UB 1P4BL 3FHAA 2MTPA 1NMCB 2JJWA 1RJLB 2DF3A 4N0FA 1SHMA 4P23A 5F1NA 3ROLB 1X5LA 2WWMC 1MCEA 4H0GA 4MQ7A 3TNNA 3BQUA 3KR3L 4TYUA 3HZMA 4QY8A 4KKCD 5I1KH 3FQUA 4H5SA 4JJ5B 4ZTOH 4HIXL 2VN7A 4ODHL 1F42A 1G6VK 3RZWA 2BC4A 1QVOB 3BEVA 1HILA 1GHFL 4PRIE 3TYGL 3ZE1F 1OSPL 4LSPL 4O2CB 1C16B 4XCCL 1ZVSA 3QEUB 3Q6GH 2HMIC 4U3HA 1R0AL 1AO7A 1WC7B 5JQHC 1FN4A 5C0RL 4PJ8D 5DMJB 2FX9H 5DD3H 5F9JB 2ESVA 4GBXA 2BSSA 4HWZB 2ZUVA 3U83A 5DJCA 4EN3B 2ZCKL 5JHLL 2J8UF 3B9KD 1MAML 1YN7B 5KS9A 3JV6B 2DQFA 5EZJA 3MRQA 3W81A 5CSZB 4MJ2A 3KXFA 4RMTA 1ZLWH 4TSAL 4X6EB 2I5YH 3MBEB 3MLTB 5F9WB 4Z7VA 4XVSL 2ZZUT 3GUTB 5LGKA 3C5JB 3GMLA 1FZMB 4HD9A 3OAUH 1XF3A 5J4MA 4QOKD 4ODVH 3GI9H 3LEVH 4POUB 3S35L 2MCPL 1E4WH 2DQIL 5I30L 2MQ3A 3B2UC 4NQXB 5C0JB 1EX0A 3OKMB 5C2UB 2CRZA 3WUWA 3OHXA 2M8XA 2EEBA 3ORJA 4KI5C 2VLMD 1FAKT 5LCVL 4DZBA 4O2EA 5C92A 1RV6X 4G8FA 2BRRH 3CSYA 4J3XA 1JNJA 4NN5B 2HJFA 2COQA 1RUQL 1NCBL 3ILPA 2ZCLH 3MRKB 3VJ6A 2YBRA 2B1AL 3EYQC 4XTRC 1RFDH 2Q7YA 4Y4HB 2X2YA 4MNQE 4RAUB 3VRLE 1N26A 3C5SB 2VZVA 4LCCA 1T2JA 4G6KL 4OIIH 2H2PC 3LS4H 4CUCA 5EIVA 4XNXH 3VWKC 3QWOA 3GNML 3DV6A 5CZXD 5ALCH 3VE0B 1EZVX 3E2HC 2FJGB 1GC1L 4I9WD 1F6FB 1MCCA 3LQMA 3P77B 4L4VD 4F2MB 2EO9A 4IIQC 4WTXA 4JANB 4C4KT 4PRIA 5EZIL 3ZMRA 1MREH 1NBZA 1YEEH 4OCRL 1T03H 3MYJA 1S3KL 1K9TA 5DA4A 2RR3A 2PXYB 4MAYC 4R4NC 2ATPA 4WHDA 4OGYL 2N7BA 4LASH 1Y6KR 5AAMA 5KVEL 2EIZB 1NAML 1S7XB 4D0BA 5CBEB 4JR9L 3HKFA 3QDMD 1DEDA 4LLUA 1LO0L 4ETQB 5E24E 1QLRB 3T8XB 2DLEA 2V17H 4HPYH 3UBXA 1BZQK 4KK8D 3ZHLA 5TGBB 3KJ6L 5KSAD 1U93A 3HI5L 3D25B 1ULVA 4YDKL 4L5FL 3U36A 4CU8A 1HHGA 4MJIB 2OXHA 4I0CC 2ICEA 5FYKU 1REIA 1KB9K 3EO9L 4M03A 5EDXA 3RL1B 3WIFA 1NGZB 4XBPA 1YMHB 4OKVB 3NBNA 5EPMA 5IWLC 4NO2A 2EH8L 5D1XC 3O3EA 4G9DB 3X14A 4QCIB 4HGKC 3CPLB 3F7QA 3JV4A 2GW5A 3VRJB 3P2TA 3STLB 4OLVH 1I3UA 5BZDB 1VKXA 4PV8B 1YC7A 3IDNB 1QQDA 2C3VA 2WW8A 5M95B 1BLNB 4P5TA 3FONB 5SX4I 1XCTB 4MD4B 3L6FB 4V2BA 2HLAA 2ID5A 4NN7C 3WKMH 4BQBA 3BYYA 1IRAY 4MNQA 4CMMB 3VXMD 3RZCA 1H5BB 4TQEL 1UWGH 5C0GB 1JV5A 2LV4A 2ZUWA 1V7MH 2NY4D 1IEAB 1NKOA 4LHQB 4YXHL 2CMRL 5FO7A 3LDBB 3IRZA 3D0LA 2VQUA 1B4JH 3MJ7A 3P4MA 5FUOL 3VFUA 3MUY1 4L9LB 2I07B 3EOAB 5DS8B 2DQGL 1JGUL 1TTFA 1C12A 1S9YB 3TVMC 5CZVL 3WL9A 3HUJF 1GGCL 1T6WA 1CFNA 1CGVA 4HFUH 4HKXA 2Q20A 4NWUL 2EYRB 4U1IB 2ED7A 5CMAA 1V3JA 5IR1A 4PBWD 1MI5E 3GJFK 1ZWIB 1N0LA 4MQXC 5IJKA 5ABDE 5BVJA 2XKSA 1OGAB 3WJJC 1INQA 4XNMA 1JK8A 4ODWA 1QLFA 2HT3C 3GO1L 3LRSB 1E4KC 4UQ2B 4QHKI 1W72L 4OFDA 2AV1B 1CR9H 4G42B 2OXGA 1FSKC 1ZA3A 3GSUB 4D9RD 25C8H 3KPTA 4JFZL 4Y5YB 4OF7A 4J8RB 4PR5A 1HHIA 5GRVL 2ED8A 3DUSA 3QULB 1FL3A 4PTTA 4Z5RA 4NCC1 4PRPB 1FH5L 2CO7B 1XGPA 3BAEL 3HRZB 4JHAH 1JBJA 5DGQA 2R2EB 4M4RA 1ETZB 1DQJB 4RFOH 2EXYC 2OCFD 1IGFH 2R56L 2XTJE 4ZFZA 1PX3A 2R0KL 3G9AB 3L5HA 2DL2A 5ADOH 5KOVC 1CLZH 5T3ZD 3T0VA 3C9NA 2B5IC 4OZIE 1JNHB 1JCKA 4PJ9A 4NQDB 1LE9B 1KLFA 5K9JH 3OF6A 1TXKA 4M1GH 4ALAH 3G6AB 5CIPB 3U79A 1G0YR 2UV3A 1FIGH 5L2JB 2QQQA 3O3UN 2D0GA 5KN5B 1FE8L 3PHQB 4MQTB 1A6PA 4Z18A 3QSKB 3BHBB 4IOFC 4QXGH 1U8LB 2ARWA 3BIKB 1A7RL 3LN5A 4QHNA 3VXSB 5IB1B 2AJ3A 4AH2A 5F7FA 4EXKA 5DHVH 1EFXA 4LSVH 4PGBA 3RX8A 5DHVA 3DIFA 5A2FA 4OLEA 2ZNWA 1R3JA 1U95B 4NQEE 4PJIE 1EAPB 1NDGA 2DLHA 4UQ3A 3G08A 1CXFA 3GGWA 3SY0B 3QFJB 2BVPB 4G6AC 4MAUH 4PLKD 4DGYH 4HH9B 4QXWA 4HJGB 2ERJC 2PYFB 1DQQB 5BRZA 1BX2B 1XF1A 2JKXA 2VNCA 5F72S 2WINB 2IAMC 3HMWH 2R0LL 2E3VA 2Z35B 4QWWC 3X11A 4UB0H 3RU8L 4WW2A 3SGEI 3FRPG 2LU7A 3N1PC 2N4IA 1YPZF 1ZGLA 1WFUA 1XF4A 4GLRI 5IVXF 3MRHA 2F15A 4EI5B 3KYKL 4PJFF 1YUHA 3SDCC 2DI7A 3IDGA 2B0SH 1SJEB 5B8CB 4OZIA 2B20A 2P42B 1ZHBA 2PO6C 5JW4R 2F53D 3QUKA 2DQEH 1A7PH 2GITA 3GBLA 1IGJA 1J1PH 5HHPA 5IBLD 3T77A 2PCPA 5E8OA 4MA3A 4NSKB 3HAEB 4P5MB 4Z6AT 3RWDA 2UYLB 4DQOL 4PRID 3OKOB 1UJ3A 1UA6H 3HUJB 5F6HJ 4OZ4B 2W38A 3LV3B 4NUJB 2D4DA 4QRPB 3G5VA 2QSCL 3PWLA 3LKQB 5T3ZL 1IQDA 1KIQB 5T33L 3EJZC 3ZSSA 3AY4C 5CHNA 4EOWH 5I75B 1YMMB 3MLPA 1AI1H 1MH5B 3W39B 2KDGA 4WDIB 4GJTB 1RIUL 3BWUC 1OAZL 4YNYB 2CIIB 4PB0L 2J1KA 3EFDL 2YUZA 3LRGA 3QZWG 4N0YL 3QO0A 4PJIA 4NQEA 5I71C 5E8DH 1D5XB 4PGJA 1UKSA 3VGDA 2EE3A 4KDWA 4XP1L 1QRNB 2MHAA 4K94C 1XGTB 2H6PA 4P2QD 4MXQC 4FABH 3AGVA 1PG7L 5MP6L 1A9EA 4YDIL 1SBSH 4YHMH 3HE7B 4N5UA 5E56A 5KAQG 4H8WH 3O11A 2X4PA 4MXVF 1Q9OB 1YQVH 5T1LA 2KBGA 4CJ1A 1YN6A 3PP3K 2VDNH 4ZD3L 4QNPE 3LB6C 2YS4A 5CSBA 4OB5L 4UV4H 2BK8A 4KKLC 2V7NA 3D39E 3BKCH 3EYFA 4YXKH 1HXMB 3L9RA 2W07A 4P49A 5C6TH 3WD5L 4I5BA 5I74C 1P69B 4X9HA 3JXAA 3JWOH 3DARA 1H15A 5BOPA 3LS5H 4O4YH 1A02N 3IJSA 4P5TD 3VXRE 2AQ1A 4P2OB 35C8L 4LQFL 3CIQA 4UU9A 5FUZH 5FECA 4RWYL 3NCEB 3RZCD 3JZ7A 4ONGH 2CRMA 2F19L 3TBTB 3ALXA 4GLRH 4PY7A 2NPLX 1INEL 3S88L 2O5YL 4U6HB 3RJQB 3VWJB 1C5CH 2R2CA 4EBQH 3QAZC 5B39A 2AXHA 3CFIC 5GS0H 4C54A 4FTVD 3HC0A 1P7QD 4NRZA 5DK2A 1W0YT 4QRQA 1U3HC 4KY1H 3VGGA 1LEGB 3FAXA 3KDMB 4YHLL 1Q0YH 4S1QL 5F7EL 1NCNA 2BOBB 4TUJA 3WKNA 3CFKA 5AZEH 3QWRA 4N5EC 2QKIA 1RULL 3EO0B 3CK0L 2ITCB 1JPSL 3CFJA 1CL7I 5EH1A 2CKBL 3MRJB 3ALWA 4X80H 3N50A 3L3JB 3WS3A 1BP3B 1AY1H 1HQRB 4P2RD 2MPAH 5F21B 2AVGA 4HC1L 5HHVH 1QO3B 5J6HA 1KULA 1W0VA 4RQQB 4AQOA 2H2SC 1EDQA 4W6XB 1IQWH 3TYFA 5IVXB 2DYPA 4G3YL 5DO2D 4MJ5A 2VXTH 4PRNB 4YHKL 1BBDH 3WFCH 5I2IA 5T1DL 4FQLH 4N9OB 4XRCA 2OR9H 4X4XB 1FVCB 1SJVA 3D39A 4MXWH 3TBVB 2DKSA 3VH8A 1M05B 3QH3B 1CZ8H 2P4AB 4L8BA 1QSZA 2X6MA 5A2KH 5HHOE 2OLDA 3UTZA 1MFNA 3VXRA 1NKRA 1HYSC 2YEZB 2V7HB 4JFPA 2ZUUA 1I7RA 5DJ2B 1CGWA 4NRXB 4RZCA 1PY4A 1ZT4B 2WBKA 3QUMH 1RUMH 4ORZC 3K4ZA 4UTBL 4KI5F 3W9DA 5CEXB 3BGAA 5BS0D 3V4UL 4HLJA 3QUMA 4QTHA 3BH9A 1KELL 4X5XB 5GS1A 4LLMA 4G8IA 1TQCC 5IW3A 4X83A 5C08E 3PDDA 4MS8C 4ENEC 5BO1H 3QNXA 2F8VA 5B21A 3E8UL 3RIAF 1WBZB 3CFBA 3BZ4A 1CD8A 3BJ91 2F58H 4RGMB 4P4RA 3SQOH 4GKSB 2IMMA 4XMLH 3DURB 1WSST 1RAMA 4EXPX 1DFBL 3T3PF 3BEWB 3RPKA 4G5ZH 3RAJL 1MI5D 5D1QC 3FT3B 3CAFA 4F9PA 1MCJA 3OZ9L 4H20L 4RGOL 1J1XL 1YECH 3MXWH 2AXFA 1G9MC 2A0LD 4PGEB 5D7JD 5HPOA 3LD8C 5FKPA 4NPYB 2XKNA 5GGSB 4D0DB 3FO1A 4K8RC 2FIKA 2FBJH 3V6FA 3C5ZC 4MZ2A 4OF3A 3SGDI 4IRSA 1DANU 4JREC 2VLJD 5DJXB 1FFQA 1J0HA 4KDTC 5IKCB 4JHZA 3ES6A 1LO2H 5HI3C 3PGDA 2VABB 2DQDL 3ECBB 1QNZH 1TZIA 3PV7A 2IPUG 1CG9B 1T0MB 1JYNA 2ZCHH 1CL7H 3I3DA 4O58H 5F89A 4FFZH 1I9JH 1KEMH 4JKKA 3FO0L 1WFOA 5JORB 5F1IB 1DSFH 4JFFE 5SWQA 4XHJC 3IRPX 4X8XA 1KYOJ 3CXDL 3OAZK 4MVBD 3U9UA 1T66C 1KJ2B 5F6IC 1G9NH 2A77L 3BVNB 4JLRB 4YLQT 3RUGB 5DHXB 1RJLA 2AQ2A 3ZYZA 4DKFH 1NBQA 4KRPD 4LLYB 3ROLA 1SYSA 2VUYA 3RVWC 1FP5A 2IJ0C 3QUZB 4TOYH 1NLBH 1CF8L 4OGXH 4NHCH 3TO2B 4BH7B 1LWRA 3MOBH 2XACC 4GW4A 1EGJL 4JJ5A 3LKNA 4M8VA 3QDGB 1I9RH 2IG2H 1QBML 4D9LL 3WLBB 3MRPB 1QVOA 3QCTL 3ULSA 1KPRB 3VXOB 1CD9B 4Q9QH 3VMOA 4BUGA 1L7IH 4R2GC 1FZKB 4MCYA 5D7LD 5C08A 4ISVB 5E6IB 1WC7A 4LNRB 2WNGA 4OAWB 3E3QC 2NW2B 2DWDA 3S4SB 2HWZH 2FX7L 3PHOB 3G04B 4LCYB 4HWZA 4XVTL 3MMEB 5CSGA 3UPAA 3L5XL 4EN3A 4Z76A 3S36H 3V5HA 4NQED 2DQUL 3DNKA 1YN7A 5GS2H 3CZFB 3FCTA 4UINH 2OJEB 2GUOB 5FYLL 4JY4A 4U1GC 3C08L 3OGCB 5CSZA 4X6EA 3TFKC 3MX0A 3MBEA 2A9NH 4UOJA 1CFVH 1RUKH 3GUTA 1ORQA 2CQVA 3VFGL 1CVRA 1MCOH 2LE9A 2EDDA 4XPAH 5T1LD 4MJIE 1I8IB 4N1EA 2QQLH 1UM5L 3LIZH 5EBMB 4TVPL 3HHRB 4NQXA 4AENB 1JUFB 3S34H 5H94A 2A6IA 2E9WA 5C0JA 4YIQB 2PW2A 1EEQA 3PHSA 2P5WB 2YPLB 1I9IH 2HVKB 3SE8H 32C2B 4XZUA 5EUKB 5T5FH 2NZIA 2X4UB 4NNXB 3S96B 3D2UB 5DURB 3UP1A 1X5IA 3T0ED 3O6FC 1EHNA 4JFFA 2A83B 4APQB 5D1ZD 5KVDL 3T2NH 1LGVA 3MRKA 3MODH 3B8SA 5EC2A 4Z0XB 1RJYA 3MLRH 3ZE1E 4RAUA 1F8TL 3C5SA 2FX8H 3MSPA 5E2UH 5FYKE 2ICWJ 1HKLL 3L3IB 3TP4A 3OX8A 5MERB 1I1AB 3K1DA 1RY7B 2DS4A 3VE0A 2R2BB 4W68A 2QQKH 3O8XC 1Q1JH 3QNZB 4LVOC 2FZ3A 4UAOC 4WO4B 4RGNC 1IZKA 3P77A 5AG8A 4F2MA 3LH2L 4AIZB 2G2RB 4JANA 3E2HB 5EU7E 1TZGL 3C8HA 4LU5H 5A2LH 3VXPB 1R5VA 1EO7A 2PUQT 3R0NA 5J12B 4ELME 5KBNC 2PW1B 2OZ4H 4WUUB 5ITFB 2PXYA 3GK8H 1MFAH 3VDBA 4I0PA 2OZ4A 5JXEC 3OKDA 3EOTH 3AFLA 1NC2B 3CMOH 4FQXC 2EICA 2EIZA 2QBWA 5HYSG 2CKNA 1S7XA 5CBEA 1L0YA 1CFQB 4PJXF 1OGAE 5I73B 1SMOA 3TO4C 4OZHF 1VGEH 3WN5C 1OAXL 2YUVA 3DX6A 2OJZH 2VE6B 5DEFB 1A22B 4K7PH 1IM9D 43C9B 2F5BL 2G5RA 1U58A 2XPGB 3D25A 4CGTA 3HC3H 2DYPD 4LSUL 2NX5E 4X98B 3VFSB 4MJIA 1MQKL 5DHYA 4WNQB 1UGNA 2AGJL 1ZTXL 3KYOB 1U6AL 4OCSL 5SWZD 1CN4A 1A1OA 1NC4A 5F7LB 4G9FE 1NGZA 3DX8B 1IAKB 4JFOA 5DD5H 3GM8A 1CE6B 4OKVA 3D39D 2E6JA 1JYXA 4H88H 1KCKA 3CPLA 3P9MB 3QQ9C 3TZVD 4J4PA 5AZ2L 1G7JA 4IHOB 3VRJA 3QPXH 3BO8B 1P6FA 3STLA 1I75A 1TJIL 2QHRL 3VXRD 5BZDA 3ZLQC 4PV8A 4ZTPL 4FS0A 5TFSL 4IRJD 1E4JA 1T7YA 5TH2B 5L0QB 1YEJL 1BLNA 1JJUA 1YEGH 4XT1C 2DDQH 3CNKA 5FYKH 3J7HA 4NQDE 4Y89A 4EI6A 1MELA 3RVUD 4PJAF 1HXYA 4PJHF 4GXUM 4CMMA 1H5BA 4NKIL 2XY2A 5IESL 1BQLL 2CDFA 1QSFB 1WZ1L 2BVEA 3HLAB 4LCIH 4DKEH 5FM5O 1TENA 5DLMH 1X4ZA 2NY2B 1AQDB 4LDOB 3UYRL 2W9EH 4N90E 4L9LA 2I07A 1AD9A 3EOAA 5DS8A 1WLHA 3VXSE 4DN3L 4DAGH 5F93C 2NY3D 4M7ZC 5HTSA 3RVVD 1S9YA 3EDFA 3RNKB 4GRLB 1FGVH 5IM7A 1A14L 4ELMA 1JNLH 5EOCL 1FVEB 1DBML 4RISH 1T0PB 1VADB 1F6AB 4MJ6B 4U1IA 2EYRA 3U7WL 3T0AA 3TJEL 5BCAA 3EYUL 3JUYA 4S11A 4YDLB 4KJYB 3QFJE 3S3JA 3I75B 1RJZB 3ROOB 3F7VA 4JQIL 1OGAA 2NR6D 4JM4L 4IRSD 3BDYH 1DVFA 3QA3A 5DYOA 1I85A 4KVNL 4UQ2A 3ARBB 5I17B 1LP9F 1MNUH 2VXQL 2AV1A 1FLRH 4WU7B 2O5XH 3GSUA 1FNEB 3SDDA 3OKNB 3CC5B 2P8PA 1TMCB 3MRMB 2ZOLB 1R5WB 3V95A 4JDTL 2M1KA 4KK9D 5CJQL 2NX5A 4ZOEA 4JVPA 1F3JB 3TESA 3QULA 1JI1A 2AP2A 3BYTA 4DOHB 5EBWB 3RA7H 2QV2A 1NBVH 4BYHA 4YUEH 3UTSE 3I85A 4G9FA 3HRZA 4CADB 2D7TL 3CVHH 4UTAH 2R2EA 3MLSH 3GKWH 2IANE 3IGAB 1DQJA 1FPTL 1QLEL 2VXVH 3CVHA 2AK4B 5C8JB 1L6XA 3L5WB 2EDJA 1L0QA 5HHOD 1V5JA 4POYA 5FEBA 5ICZB 4UT9L 5L8JB 1NLDL 1KCUH 4MQSB 1B0WA 5ANME 4NQDA 5CIPH 1LE9A 1I8KB 2HVJB 3NOIA 4LHUB 5BXFB 5CIPA 4TNWK 3NABL 1A9BB 2P1YA 1QSED 3GHBH 1OARH 2CSPA 3CXHK 5D8JH 5C08D 4WFGD 5KN5A 3EYVB 3QCUL 3PHQA 4QRPE 5T5NF 5EG6C 3BHBA 4N8CH 2CO6B 1U8LA 1FNLA 5DWUH 3GBML 3D6GA 3MLXL 5JNYA 3VXSA 3QI9B 4NZUH 3P30H 4PJXB 4U6XA 5IB3B 4HJ0C 2AEWA 2FD6L 3HTLX 4Y19B 2YPVL 4WI6A 2L4OA 2UZIL 3LEXB 1GGBL 1U95A 2OL3B 3QUXB 4MX7B 1EAPA 4HV8A 2FR4B 3GSRB 4LCWB 1HKFA 1A6AA 5TF1L 4NFDA 3SY0A 3WJLC 3S9DB 2G9HB 3UTTB 2VLLB 3QFJA 3K8LA 4HXBL 1DLFL 4Y8DC 1UADC 3REWB 4H1LG 4HJGA 5I1JL 2X4SB 1DQQA 4G8GE 1BX2A 4JM2B 4ZPVB 2HYMA 5I18H 3LEYL 3MR9B 4L3CB 2WINA 4TUOB 2UVEA 3NAAL 1DL7L 1TTGA 2X7LB 1EMTH 4GUPA 1EJ6A 5DQDH 3G6JF 2NY5H 1ZS8B 2R0WH 4RNRB 4R26H 5I19H 2OX5A 3GMRB 4GO6B 2J4WH 3UTSA 4JFFD 4URTB 5ALBH 4NFCA 2Y06H 2IF7A 1CGYA 4PJHB 3U2SB 4HQQH 3QIWA 2IANA 5I8KL 1U41A 2ARJB 1CS6A 5CZXC 1QSVA 4IOSD 4PJ5B 5E70A 1T89A 5E2VL 6CGTA 5B8CA 4PS4H 1C1EH 2C1PA 5D5MF 5IW1B 3S37X 4DK3A 1IAOB 4MZ3A 5ANMA 4ZMAT 4NSKA 4P5MA 7FABH 1A6VL 4XNYL 2UYLA 4ZOBA 4K3JL 3TIDA 4NKMB 3CD4A 5F7DB 4K07A 2FB4H 3KYMA 2BVYA 2HKFH 4X6CB 4QRPA 2QADC 3HZVA 3MXVL 1MHPL 1X7QB 4OTXL 3RDTC 4I0PD 1CDJA 1KIQA 3GIZH 3LKPA 2IH1B 2FEEI 4R0LB 4GMTH 4KGJA 3CH1B 5I6XB 2B1HL 2MOVA 1MH5A 3M1BB 3W39A 4N9GB 5IEKB 4YNYA 3UPCA 2CIIA 4JY6B 3V6OC 1B6DA 4Y1AB 4LRIC 2BSRB 2VMFA 1D5XA 4Z7WF 5ESVB 3PXHA 3VCLA 1U8JA 2XTLA 5C0DA 2DB8A 1INDH 1ZANH 4I1NB 3HPLB 1XGTA 4QGTA 3UPRB 3WDIA 4JG1L 3IXTB 4WFED 3M8OL 4MJID 4PRHB 3HE7A 4G8GA 4KV5E 4M7LL 2EECA 5IVXE 1GZPB 4PLOB 2GJ6B 1NC4D 4ZQKB 1OQOA 3TBWA 5C70A 5AYUL 5EIIB 5ACZA 2R0ZL 4QLRA 2AK1L 5H37G 2X44D 3EIFA 2XKUA 4X0KB 1S5IL 4X4ZA 3QG7L 1HXMA 3N9GH 1IGML 4GS7C 4MA1B 3RTQB 1PSKH 1GIGL 5IB5B 4AZ8A 2W59A 3DRQB 3ZDZF 2FJFB 1C5DA 1RURL 3A67H 2YMXH 4P2OA 2NY4C 2EDEA 5I74B 1RZIB 4C4KO 1LK3H 1VPOH 4Y4KB 3HC4H 3DTXB 4QO1A 4UOW1 2AABH 1DBAH 3IFOA 3TBTA 2Z31C 4P4KB 2YHGA 4GG8B 3VWJA 3MACL 1MEXH 1FL6B 3FOMB 4Z7OF 2BCKB 3I6LD 1IEHA 2IBGA 1KCSH 3PWNB 5F7KC 2YC1A 4DVRL 1KJVB 5JW4M 3VGHA 5FB8B 1OQXA 1IC4L 4I18B 3QIBB 4HWUA 1CFTA 1DP0A 5C6WH 2APTA 1LEGA 3KDMA 4CVXA 3AB0C 2OK0H 2BOBA 3GZKA 1Y18A 5FCUL 3V9FA 4MXVE 1I4FA 3BGFB 2AJUH 1DVFD 2BHZA 2ENSA 3EO0A 2ITCA 3LCYA 4OLXL 5DJAA 5DJDB 2F54B 5C0FB 3G6JB 5HJ3A 3SDDD 3O3DB 3ZE0F 3Q48A 5J0BA 1P2CB 4ORGB 4E42B 3PABB 2NX5D 1XFPA 4HUVB 4OCMC 4RQQA 4YO0B 4WFFE 5IVXA 1QFHA 5J13C 4I77L 2R69H 5DI8B 1UZ8A 1QACA 4NIKB 5IBUG 3WLWD 4G9FD 4P23C 1JN6B 1A7QH 4DZ8B 1RZKL 3SKJH 3TM6A 5C0IB 4JN1H 3BQUC 4X4XA 1EK3A 4RA3A 3WCYA 1T2QH 4KROD 2VN4A 3RUGE 1M05A 1A6WH 2A74B 3FFCB 5H8DA 3T0DA 4IEFB 4KZEH 1KXVC 1OTTD 2DL9A 1BQUA 4ZS7H 2IQ9H 1TVHB 4OLWL 3MGTB 3RL2B 3T65B 1NL0H 3Q1SL 2IPTL 2YEZA 3BP6A 4LLVB 5J3HD 4BUHA 3MLUH 3T2OA 4NRXA 1ZT4A 4B5EA 5J1SC 4GXVL 1MRCH 5CEXA 15C8H 2YD3A 4K9EL 4GBXC 3LKSB 4X5XA 1UWEL 4E0RB 3SE9L 5HHNA 2NY6C 4H25A 1MPAH 2FO1A 2RCSH 1OAUL 2X70B 1CICD 3CFEA 3QHZH 1Q0XH 3VXSD 1QFWI 4NO3A 3PGFL 2IADB 3T0XA 3L3HB 1MQ8A 1CDYA 1V3KA 3EJJX 4GKSA 4YE4H 3DURA 4Z7WB 1U9KA 3O81A 4HIIB 4HULB 1XR9B 3BEWA 5FO8B 3IKCA 3W2DH 2X4TB 3ARFD 5HPMA 3FT3A 5IFHH 5HGBA 3CSBA 1CD1B 4GRWF 1TTUA 2FJHB 1MSPA 5IQ7L 1DBKH 2R9HD 2F5AL 3BZDA 4GSDL 4DKDC 1MCQA 4JGJA 3W0WB 5GRZA 4D0DA 4C58B 3OKEA 2V2XB 5DJXA 3JWDH 3O0RL 2ZPKH 3DO7B 2YXMA 4Z7UE 5IKCA 4CDHA 4PB9H 3OMZA 2JK5A 2MWCA 2VABA 4HJJH 4WUKL 3ECBA 5KJRL 2YPLE 5DZOA 1YYLL 2IFFH 1T0MA 1WIPA 4JFDE 3O41B 1T22B 1IGCL 1SJXA 2V2WB 3FB7B 1G7MB 3UTSD 3CUPB 4R90L 1A0QL 4F7MB 1XGQB 4LCCC 3VFWA 1FAIL 3MRCA 1OP3K 1KPVB 5F1IA 4Z8FH 1CBVL 2HFTA 1DCLA 2I25N 3I6KA 3QIWD 2VXSL 2IAND 4F15C 1I3GL 3BVNA 4V1DD 4XC1L 3RUGA 1DDHB 1ONQB 2DM3A 3CLEL 4LLYA 3VD3A 1LO3H 4QTIL 1WBXB 1YY9D 4Z78B 1S5HA 3TO2A 1EJOL 1TITA 1NGPH 4BH7A 3A6CL 2CLVB 4PLJD 2DQCL 3O4OC 4JN2B 4TSBL 4XP5L 5CJXA 1JPGA 4Y2OA 3IS1X 4EQ3A 3L3DB 2A73B 3CGTA 1IKFL 3MRPA 3AAZB 1C5BL 4UMGA 1KPRA 4QRPD 3H0TB 3GBNH 1KB5H 3HB3D 1FZKA 2DQHH 3SOBH 4LFHG 1KB5A 4ISVA 3ZKXB 4MMZC 1FNHA 2VL5B 4LNRA 3NTCH 4KPHH 4R2GB 2NW2A 3UTQB 3S4SA 2P8MB 4JFHE 3PHOA 4LCYA 2IBBA 3KPPB 3MRNB 3BP4B 1ACYL 4RMQA 4OM1L 1FORL 1Y0LB 5DD0L 3CZFA 2OJEA 3MYZA 2GUOA 4WHYH 3JVGA 4LMQE 5FGBA 3ZKMD 2VDKH 2KZ1B 2E27H 3UROR 1EVUA 1N4XH 5DD6B 3PWPB 1CE1L 3FOLA 2HT2C 5DMGC 1UCBL 4PJCF 1MFDL 1X5HA 3ILQC 1BFOB 1KACB 4PJDF 2XZQH 4G8GD 5HHQA 4G6FB 4S1RL 1I8IA 1KC5L 2P5EB 1I9EA 5EBMA 3FN3A 5TDPA 4ONHB 4AENA 2VC2H 4YIQA 5EIQA 4R8WH 3B2VL 4ZO6A 5KANG 1CIUA 5GGVH 4L4TD 5DRWB 2YPLA 1E4XH 4LOUD 1JZ2A 4JFDA 4HKJA 4DFHA 32C2A 4N1CA 1RUAH 4ZUWB 5F8QC 3FT4B 4LVHB 4A6YB 4NNXA 3D2UA 1F4XH 3RZCC 3QQNA 1QFPA 1ZEAL 1K4DB 5CZKA 5ERWA 2A83A 5IF0B 4APQA 1GSMA 3V4VH 3GB7B 4JFYB 5F96L 4L4JA 1R3IH 1WK0A 3SN6N 4JRYD 1MOEA 4Z0XA 3O6FB 4LPUA 2E7MA 4ZTOL 1HWHB 5IVNA 4J6RH 4FZEH 4TNVF 2GI7A 1R3LB 4ZXBD 2BDNH 2R2BA 3QNZA 1RHHB 1UYWH 4WJ5B 4WO4A 1OSZA 1X9QA 1SVZA 4CVZA 4L1DA 4NQVB 3SDYL 5HVWA 5DQJB 4HX1B 4JDVB 3VXPA 5IJKC 3EGSB 4GRWB 5D70H 5FHBL 2PW1A 1WICA 3WXVL 1LEIA 2Y1VA 1T1XB 2Q76B 4LLQB 1RIHL 4UT6H 3LHPH 1D9KB 1UKQA 1NC2A 2I5YL 5JXAL 1CFQA 2KL6A 1P1ZA 4NRYB 4R4FH 1NGQH 1KXTB 4RRPA 1CGXA 4XPGH 3OAUL 3ARDB 1JRHI 4PRDA 4ODVL 5DJ0B 2VWEE 4NUGH 2VE6A 5DEFA 1CDUA 43C9A 3UCRA 3NIDE 1ORSB 1S9VA 2NY1C 3VFSA 4X98A 3BH8A 2YWYA 3IYLW 5E8NA 3VG9C 3DVIA 3NZ8B 3KYOA 5EUOE 4DOHE 1L4IA 3HCVA 1OTUD 3VGFA 4XMKH 3DX8A 1MJJB 3A6OA 3WFHB 1CE6A 2E7BA 2ICWA 1KLUB 3RWGB 3RY6A 1CU4H 4PJ9C 2AK4E 3P9MA 4FQ1L 4GAJH 5HHME 4G7VH 1RIVL 4H26A 5TPWH 1H0DA 2XV6B 4O2FB 2VXUH 5TH2A 4P46D 4OCWL 4RIRA 3VW3L 3JTTB 4P5KB 4XNXL 3VGEA 3T1FB 3L95B 3P11H 3UJIH 4NO0B 5EBLB 4WV1C 5TE6L 4Z0BH 4TPRL 4XCFL 3O3AB 2GCYA 3HLAA 1IC7H 1WWCA 3KWWA 2EXWD 3KPNA 1T03L 5IP4A 4ZDHA 5I1DB 1AQDA 2FGWH 4U6VH 1A2YB 3MFFB 5JHDE 1FNSL 2NLJB 5GJSH 4PJXE 1PY9A 2ADFL 3X12B 5M94B 2VDLH 4PJEE 3QUYB 1B2WL 3RNKA 4HBCL 4GRLA 1QZ1A 4JPWL 3MV9D 4Y19E 4PY8I 2A0LC 4YWGL 1FVEA 5I76A 5L7XH 1T21B 3HNTH 1VADA 3MQIA 3JV5A 1MHEB 4MJ6A 5D93C 4PJCB 4CDGC 2MNUA 3RWIA 4PJDB 4JO2L 1TETH 4KJYA 3I75A 2XZZA 1RJZA 5CLWA 3SCMA 4DUWA 5GGVY 4IDJH 4WW2C 2PTTB 5JIPA 1VGKB 3TJHD 1PKOA 5I1AA 1S7VB 3WNPA 1FO0H 4WU7A 5HGHB 2R8SL 4LRNL 1FNEA 2FH8A 3OKNA 4FMFA 5DZNA 3MRMA 2JLLA 1R5WA 1FO0A 5CJOL 3U6RB 1LE5B 1IKNA 5LXGH 2J2ZA 1T5WB 4X7EC 3FJTA 4OLZH 4WGVB 2XTJC 4N0RA 4LPYA 5EUOA 3BIBX 4B41A 3VMNA 2ZUSA 5CJ5A 3B3IB 4CADA 1O5DT 1I1YB 2ZNXA 4F8QA 4R7NB 4PGCA 1JF5A 1PJ9A 4MSWA 1NEZG 5C8JA 2AK4A 2A6KB 3EW3B 2WUCH 4F3FB 1JZ8A 4OCXH 4PJ5E 1N6QL 3WBDA 1HHKB 2XICA 1AGFB 1UJ3C 1UWGL 1KBGH 3BPLB 5F1OB 2X89A 3NIGF 4FFWD 4MGXA 3GIVA 2R4SH 4D3CL 4N1HB 3K8MA 2OSLA 1JGVL 4Q6IA 3D9AH 2HVJA 2W60A 2I9LA 4XCNB 1QKZH 3MRDA 1A9BA 2IALB 2E5EA 4BZ2H 1RD6A 1TFHA 4X6CE 2HLFD 3UC0H 2K3TA 5A16A 4ELKA 1R3HA 4PJ8B 2XWJA 3QDHA 4ZO7A 1L7TH 4CKVX 3QI9A 5JHDA 4PJXA 1FDLL 3N1MC 4MA7L 3F6IA 1EHAA 2EEDA 4PJEA 1IC5L 3V4PL 4AL8L 3B9KB 4BFEA 4Y19A 1N0XH 5DMKA 1U92B 4BFIA 3OB0K 5K9OB 3LEXA 3QUXA 4MX7A 4Y1AE 5FK9B 4YC2B 1NGYA 2FR4A 3U1SL 3GSRA 5IFAH 1E6OH 4H8WC 4M93B 1K3IA 4JRXE 4KMTL 1VCAA 2WLZA 2HRPH 3ULUC 2DJ4A 4YK4C 1JPTL 2WSKA 4PRHE 3REWA 1VEOA 4B7IA 4FZ8L 3L5JA 4IRZL 4JM2A 4Z9KB 5HD8C 1RHFA 5I1IL 3MBXH 3MR9A 1T7XA 3V8CA 1BWMA 4TUOA 1KFAH 5CD3B 1DBBH 5KVFL 5ICYB 4JFDD 2X7LA 4X99A 1NMAH 3JWOC 1F3DJ 1MJ8L 3IU3A 4LP5A 1ZS8A 4GW1B 4RNRA 1FRGH 3BKYL 2VDML 5CS7A 3GMRA 1AFVH 3WXWH 4KTYA 4AM0B 5EN2A 1G6RH 4OD1L 3ARUA 4U1KB 2ZJSH 2APWA 3U2SA 1G6RA 3VFPB 1JWUA 3PNWA 4XAWH 3HZKA 4OM0L 4NQSB 2ARJA 4WRLA 1WBYB 1BAFH 3QRFM 4LF3B 4F9LA 4OGAD 4M6NH 3C2AL 4PJ5A 4HKBA 1I8LA 4LSTH 5HYQA 4HCRH 1BVKB 5GS0C 3TH3T 1JWSB 5JLZB 1FIGL 4EVNB 4HCRA 2YN5A 5DF0A 2Y5EA 3LQAL 3HS0B 4KK5C 5C07D 4L4VB 1WT5A 4NM4L 3N1QC 4QRTA 4NKMA 1O7VA 4NZRL 5BVPL 1BIHA 2X1QA 1NSNL 4X6CA 3VG0L 4LSVL 1X7QA 3MZGB 2Q87A 5DD1L 2AW2A 3CLFH 2VITB 1QOKA 5GGRY 3WHXB 2IH1A 4R0LA 3CH1A 2W9LA 1L0XA 4NO5B 2B4CH 4UDUB 4JG0L 5E2WL 3M1BA 5KZCD 3NCJL 3QDMB 4L8SB 5IEKA 1AR1C 3FFDB 3GI8L 2NMSA 4Y1AA 1DQDL 5KS9F 4ZUTB 2OTUB 1MIEH 3MA7B 2F54E 3TGXA 5DJZB 2DQJH 4JRXA 1CLOH 5KSAB 2EIBA 1IGIH 3G6JE 5F1KC 2X4QA 3SDAC 1PZ5B 1SVCP 4RMSA 4PRHA 3DO3A 5D71H 4FNLH 4JY5L 4YQXL 4AEIH 1PFCA 3SGKA 3TT3H 5F88B 5F8RC 4YHZH 1Z0MA 5FHAL 1D5ZB 3R8BB 2XQYK 3SGJC 4OFPA 4WI2A 4X0KA 3AREA 3GHEH 1OP5H 2CDEB 2N7AA 2HJLA 3FFCE 1G7HB 4U49A 2VAAB 4BM7A 2Y25A 4OQTL 1TJGL 2VLRE 4I0KA 4LVNC 3DRQA 4FMKA 5GS3A 1IFHH 5GS1C 2UVFA 3DSFL 4BQ6A 1A4JA 1RZIA 1A3LH 1IC1A 4JZOB 3RKPA 3UEZA 3VXMB 3NA9H 1W0WB 4Y4KA 1CTNA 5C9JB 1KG0B 2D0FA 2C3HA 2SEBB 4LSQL 2NY4B 3FT2B 3SQBA 1QBLL 3AVEA 1F4AA 4HLZG 4POZC 4I2XE 4P4KA 1MUJA 3H9SE 3LQZB 4GG8A 1HYRC 3RWJB 1Q72H 3MREA 3FO2B 4C83B 2R4RL 2BCKA 3WFDL 3M17B 2HTLC 5TQ2L 5E99L 4F9PC 5C71A 5J57B 2W65A 4FP8L 1KJVA 2A1WH 4UT7L 1AI1L 5FB8A 4BK5A 1A6UL 2DLIA 4I18A 3QIBA 1LO5B 3RIFF 1SJHB 4NKDB 1ZGLP 5JMRA 3L7FB 2VDQH 1TZHA 2ADJB 4DGVL 3VD5A 3SCMD 1EEYB 5EA0L 4R6UA 1X4XA 4HK3N 1WUNT 1A7OH 4KVCL 4X6BB 2YKLL 5CP7B 3WUZA 3MGOB 3H9YA 2F54A 5C0FA 3WO4C 4FQHB 1HZHH 1YEFL 3KLAB 4QRSB 5T3XE 3ULUL 1MLCA 3EYSL 3G6JA 3P4OB 4HMCA 5FA3B 4MDIB 4C57C 3GSXA 1P2CA 4ORGA 3E0GA 4NJAL 3RY5A 3PABA 4OD2B 5CEZD 5ID0B 4HUVA 4UV4L 5KSVB 4YO0A 2D7PA 1NMCC 4XP4L 5KG9A 4P99A 1MHHB 2GK0B 3BKCL 2X1XR 5DI8A 1LILA 1KNOB 3RGVD 1VERA 1ODAA 1G9NC 2RJMA 1JN6A 1K5NB 2EKSB 4NWTH 1MFBH 1KV3A 3RIAK 5C0IA 3LS5L 4LAQH 4MD5B 2J8OA 4K23L 5HHMD 4TULL 4Y5XA 5FUZL 2A74A 3FFCA 3HI6H 3PDOB 3WFZA 2LAAA 3TNNB 5I1HH 2VLRA 3HZMB 1TVHA 4H5SB 3MGTA 3RL2A 5J1AB 3T65A 3ULVE 3VGAB 3QNYB 2Y07L 3O6ML 2WK2A 1ZLVK 2PTVA 2DRUA 1F5WA 3INUL 3VRLF 3G5XA 4OSUL 2BY0A 4I2XA 4AK1A 4E0RA 1ITCA 4EN3C 4H1LB 3CMGA 1F4WH 1FN4B 2X70A 1BHGA 5J06A 1I3RB 1AR2A 2BSSB 2V5TA 3B5HA 5JHDD 2H1PL 1RZFL 1KT2B 4JVWA 4M43L 1EEZB 2GQHA 1UACH 5KS9B 1QFUH 4CN6A 3MBEC 3CFDB 3FRPA 4XMPL 5F9WC 3MRQB 4HIIA 1XR9A 4PYHA 5F7NC 2VZUA 5HGAA 1P5UA 3QRGH 1CD1A 2FJHA 3GMLB 4FQIH 1GVIA 1KEGH 5GZNC 3GSQB 1MFCL 4MHHI 2N56A 1KCVH 3QDJB 5E2TL 2P7TB 4JM2D 5T3XH 2V2XA 5BOZG 2P5EE 1KIRB 2CUMA 2NY7L 3MJ9H 4Z77B 1ZMYA 3DO7A 5E9DD 1DE4A 2Q1EA 4FQJH 3HG1E 3MJ9A 2F8OA 1N8ZA 4NN5C 2HH0H 5EULV 3VFTB 5FGSA 2IQAB 4DZBB 4RBPH 1EHLH 3O41A 4O2EB 1T22A 2OTWB 1T1WB 5JPNA 1G7MA 1P4LA 2NCMA 5BZWA 2XRAL 3CUPA 5CD5C 3NZHH 2BMKB 4OF8A 1KPVA 1JHKH 3O2WL 4J12A 3VJ6B 1JHLL 4KKAD 4OFKA 5F7HA 4GKNB 2V9RA 4LCCB 4OKDA 4EIGB 1ONQA 4OD3H 4PUBL 2JB5L 4ODSL 3ULVH 4KKBD 1F58H 1WBXA 2F53B 1MCDA 3MV01 4Z78A 3QZWA 4U3XA 3OXRB 3MJ8B 2DLFL 2CLVA 3GMMB 3PL6B 5A3ID 4PRIB 3L3DA 2PXYC 2A73A 5BO1L 4LKCA 5AWNH 1NBZB 3AAZA 4I0PC 5IROA 1ROWA 5JUEH 1AJ7H 3MRIB 4PP1D 5TDNA 1UWXH 2I26N 4GRWE 3RQ3A 2GKIA 2X1OA 5FM8A 4RWHA 5BV7L 2VL5A 3HFML 5TE4H 3BUYB 3UTQA 2P8MA 3BP5B 2I60H 5CCKL 3OJMB 3CX5J 5C0BD 4I13B 5DUMH 1YA5A 5LGJB 3KPPA 3MRNA 2CLZB 3BP4A 1X4YA 3LMJL 2BERA 4XBEH 3O6LH 1U8KB 3UBXB 1Y0LA 3S36X 3PUCA 3TT1L 5DUPH 4JRXD 4P2QB 5LQBL 3BD3A 5DD6A 3O3BB 3U36B 3UDWA 1BGXH 4CAGA 4GKOA 2UY6A 3PP4H 5KVGL 3H3KA 4BQ9A 3DI3B 3DRTB 3BT2L 4KWUA 1T80A 3WIFB 2P5EA 3SE3A 1CL7L 3F65A 4J4PC 4XBPB 4EQ2A 2MQ0A 4LEOB 3WUWG 1UM6H 4OLYH 3HG1A 1GZQB 4LGSB 4NM8L 1DSFL 1K2DA 5TDOB 1JVKA 4WVRA 5DRWA 5DC4B 5SX5H 5C7XH 3ARED 4A6YH 5HY9B 1G9NL 2VZ3A 4NQCD 4ZUWA 1VKXB 2VH5L 4YZFE 3FT4A 4A6YA 2A9ML 4RDQF 1WEJH 2C3VB 1H5BC 5LWYH 4FG6C 4P5TB 1D6EA 5MI0B 1BM3H 5D7SL 1TIUA 2H9GB 1K4DA 5IF0A 2HLAB 3GB7A 4JFYA 4Y7MA 4LSRL 4WCYL 1FNGB 1N5AA 1CQKA 3LDBC 2Z9TA 2E9JA 1QPPA 2YK1L 1N5YH 2L0DA 3IFLH 2IG2L 3KS0J 3WFBL 4L9LC 4U7SA 2Y36H 1S7UB 1XH3B 4D0CB 1IZJA 4J1UA 4K71B 1IT9H 2O61A 1R3LA 3MJ7B 5J1TC 1CK0H 1FLTX 4AQ1B 4M62H 3V6ZA 1RHHA 4FTVB 2ADGB 3WNOA 4F8TA 2DM7A 4WJ5A 1Q9WA 1P7QB 2FH6A 5DQJA 4GRWH 3MLWL 4JDVA 4HKXB 3DJ9A 4Y2DD 4XVUD 3EGSA 5IR1B 3BPNB 3ZDXF 4WTZG 1I85C 4LVEA 1T1XA 2Q76A 3OKKA 4HWBH 1ZE3C 2D03H 4PJDE 2Q8BH 5ITBL 3ARPA 1INQB 1JK8B 1MFEL 3P0YH 4HWBA 4PP2B 4NP4L 1AHWB 3SDDC 1RUKL 1FHGA 1P4BH 4NRYA 4FQCL 3K3QA 2IGFH 4PJIF 2GY7B 5DJ0A 1N3NB 1ZA3B 4P2RB 1NJ9B 1I1CA 2GJZB 3WLWC 3ETBF 1JWMB 1HHIB 3CZJA 4QHLA 5IB4A 4DUVA 3S34L 3KR3H 1ORSA 1S7TB 4XC3L 4F57L 1I9IL 4HIXH 4P3CL 4XWGL 4N0CD 4ODHH 2AXJA 4KROC 4W70A 3OQ3B 3TLRA 2R29L 3MCKB 1GHFH 2Z0BA 3EFFA 3IDUA 3TYGH 1OSPH 4LSPH 1CVSC 3SKUD 3WFHA 3VG9B 1KLUA 4XCCH 5DVKA 3RVXD 2EDLA 3ZL4L 1R0AH 2DLTA 5C0RH 2VLRD 1IMHC 3OB8A 5J11B 2FX8L 2P46B 3F12A 1CLYH 3I9GL 5JHLH 3P0VL 4P5KA 1MAMH 3HE6D 3BPOC 2GSIA 3L95A 5BS0B 4NO0A 5EBLA 1OM3L 3UTOA 4TSAH 3O3AA 1WFNA 3H9SD 3D3VE 1FGNL 3FQWA 5JO5B 1PYWA 3CSGA 1X6NA 4XVSH 2J6EL 1YDPB 4S1DC 4XI5C 5I1DA 4HEME 3S35H 2MCPH 1A2YA 1XMWA 4XVJL 5I30H 3MFFA 1R3KA 3BX7C 2WIMA 1MFAL 3GK8L 3J8F7 2NLJA 2VERN 4MLIA 2V2TA 2Y6SC 4KDVA 5D72H 3VI3F 3Q3GB 3QUYA 1J86A 1NDGB 4KJWD 4UQ3B 2DM2A 3GGWB 3UMTA 1MI5B 1T7ZA 1T21A 4JDZA 1ZVHA 1K4CA 4PJCA 5AUMB 1Z3GH 2X9YA 4PJDA 5D7JB 5DVMA 5D93B 3F58L 4MDJB 4M1CC 1RUQH 1NCBH 2OI9C 4Y8AA 1GGTA 1N7ML 2VLJB 2B1AH 5DVLA 4U0QB 2CGRL 2FLBT 5T3XD 2YD1A 1VGKA 2EIEA 2JJTA 4G6KH 3FRUA 2NY5C 3KNBA 3C09C 1S7VA 4XNZB 3S7GA 3QIUD 3GNMH 2H26B 3KVQA 3QIWC 3TBYB 4EI5C 1T5WA 4N8VG 3RPIB 5K59E 3TPKA 1SM3L 4JQVC 1XF4B 1T6VN 3LSOA 3EHBC 3QO1B 3RY4A 1T89C 5B8CC 4JPIB 1I1YA 4QNPF 3NMEA 4OCRH 2QSTA 5CJ8A 2EDYA 4R7NA 1D5BB 2QQNL 1D6VL 4WEUD 1S3KH 1WF5A 4OCYL 2EDNA 4P2YA 4KRPB 2XY1A 2A6KA 5EB9A 2F74B 4WY7H 5FYKL 3X3GL 2X10A 1ZHBB 4OGYH 2GITB 3ULVD 1AGFA 1N2RB 5D6CB 5KVEH 3V8OA 3T77B 5FYJD 1NAMH 5E8OB 5C9KA 4KRMB 5L9DL 4JR9H 4DKEL 4KTDL 1OPGH 1LO0H 1NAMA 3HB3C 3SEPA 4I9WE 5D2NB 2KH2B 4F7PB 4L4VE 1QBAA 4W6YB 5CINL 4LEXL 4XCNA 5LVEA 3G5VB 3PWLB 5JIHA 2IALA 1WAAE 1FL5A 3D3VA 5D7LB 5I75C 2B7DT 3U46B 3MFGB 1IQDB 3B83A 3ZO0A 5EOCJ 4RMWA 3BOVA 3PWUB 4YDKH 4L5FH 1F4YL 1JNLL 1ERNA 4XP9H 5HI5C 4WHCA 1T04A 2J7LA 4PPTA 3T0WA 4YFEA 2LVCA 3EO9H 3ZKMC 4PJIB 3NFSH 4NQEB 5E0QA 4YH6A 1OWRM 3WSQL 1V05A 3B5GA 4HF5L 3HE7C 5FK9A 4RMUA 3NCMA 4S0TD 5I8CB 4YR6A 1A9EB 2JF1A 4NN6B 3D87B 1MNUL 4R4BB 5AD0A 3O11B 2O5XL 1UB6A 2VLKE 5T1LB 4ZAKA 3V0AC 4GAGL 1YN6B 2VR5A 1PLGL 4G7YL 4EDWL 4TQEH 3MV7D 3HG1D 5CD3A 3G5ZA 2GAZA 2CMRH 3TA3D 4P2OC 2ZUXA 1AGCB 2J12B 3UAJD 4B0MM 3AU1A 4GW1A 2VXVL 5FUOH 1AGDB 3GMNB 3T4AB 4L9DA 3T0EB 3IJSB 2DQGH 4AM0A 1JGUH 4DKAA 4DTGL 5D1ZB 3G6DH 4ESKA 5C0CD 2RBLA 5CZVH 2EC9U 5FECB 2EDRA 1RVFH 2VIRB 2HA1A 3FZUD 3HZYA 3VWJC 5FFLA 1GGCH 3O9WD 4NQSA 4NWUH 4Y16D 1DN0B 4XNQA 2AI0L 3B6SA 4LF3A 3Q2CA 3V0WH 1V7NL 5I8OH 3PV6B 1Q38A 2BRQA 1BVKA 1JWSA 3MROA 4OT1L 5JLZA 5B39B 1GOGA 1OARL 5ILTL 4EVNA 5D8JL 5H35B 1NBYB 2HKHH 3GO1H 3HS0A 3AS3A 4NBYB 4L4VA 4KJPC 4NRZB 3MCG1 1W72H 5LBSL 1OAQL 5DK2B 3WV0A 1WAAA 2C5DC 3BKJL 4JHWL 4QRQB 1W72A 4U0RB 4JFZH 1RU9L 2EDXA 2X1PA 2AJZB 2DBLL 2VZ1A 3CFKB 4P9HL 1II4E 1FH5H 3OR7B 4RAVB 4YX2L 2QKIB 3BSZH 5E95B 4UNUA 5HDQL 3CFJB 4ODTL 3FHQA 3FFDA 1F3DH 3RX5A 3WS3B 1MIMH 2R56H 4ZUTA 1AXSB 2OTUA 4V2CB 1FJ1B 3X17A 3MA7A 3G9VA 1NFDF 4KK6D 5DJZA 1IM9B 4M8QA 1PKQB 4ZSOE 5JW3H 5KSAA 5I9QC 4HDIA 4U6YB 2GY5A 1OTUC 2VLKA 3EDJA 1CDIA 3TYFB 1KJ3L 1PZ5A 4JVUA 4UNTA 4GQ9L 2A38A 5DQDL 5I2IB 5SWZB 4XRCB 3ZT7A 5F88A 1ZXQA 2J4WL 3STZB 5EOTB 3D39B 3FMGH 3SJVD 2Y06L 3VH8B 1A47A 3ARZA 1T5XB 5DR5H 3TZVB 1B9ZA 2EDFA 2V5MA 1A7RH 1QHPA 1WIUA 1G7HA 3OAYK 2VAAA 3VXRB 5T3ZE 3DUHA 4IRJB 4P57B 1J8KA 1X6LA 2DD8L 1HQ4B 5JQ6L 4K3DL 1LO4L 3W9DB 3QUMB 1JNNL 4MAYA 5F3BB 4LLMB 2SEBA 4KRNA 3A6BL 3FT2A 3K2UL 1Y6MR 3FB5A 4RGMC 1KOAA 3LQZA 5B38G 4KUCF 3RWJA 2CR6A 1H3UA 2DJSA 3BWAB 1CYGA 4C83A 4P4RB 1GAFL 1AXTH 2NY3B 3GIZL 1DUYA 1ZHNB 1SMAA 2R0LH 2FEDC 3RU8H 3C60D 1SJHA 1K6QL 4NKDA 2AXFB 4LGPB 3PWJB 3HMXL 4LAJH 2FWOB 2ZUQB 5FKPB 4EZMA 2ADJA 1YJDL 3WMSA 2FIKB 4IM8A 4MMXC 1EIBA 1NEZB 2ZSWA 4IRSB 1EEYA 4NBXB 3QDJE 3KYKH 4TTDC 3O2VL 3PGDB 4FQHA 4ZSOA 4QRSA 2CRYA 3BP7A 1U8HB 3I02A 5FA3A 4MDIA 2X4NA 5K9QI 4XP6L 3WO3B 4OFYD 3QPQD 3WO4B 5KSVA 5IUSA 3BZFB 4F7EB 5DGRA 1MHHA 1K3ZA 3O6KL 1KB9J 4DQOH 2W1NA 1K5NA 2EKSA 3QUZC 2QSCH 2X4RB 4FFWC 4MD5A 1FC2D 4RSVA 1SYSB 4ZYKB 5T3ZH 2PTUA 5CJXC 5HHOB 5T33H 5D2LF 4M6ML 3PDOA 4PRBA 4U05A 3NPSB 3NACL 3U9PL 5ESQB 4GW4B 5J1AA 2F53E 3LKNB 1DBAL 1IGYA 3QNYA 4BZYA 5BW7A 1OAZH 3ZE2E 5F70A 3EFDH 1HDMB 5FV2A 4N0YH 3K4AA 3ULSB 5F7YC 1EBAA 5E6IC 1UXWB 1QSEB 3D3VD 4MCYB 4XP1H 5IV2A 4RFNC 4H1LH 5C08B 4WWKD 1OT2A 4ZNCD 3UBXI 1PG7H 4H1LA 5MP6H 4YDIH 5D4QA 4YGVB 3GMQA 2DWDB 2BSED 1I3RA 1LK2B 4K55A 1P4IL 1KUMA 4ZUVB 1MJUL 4Z76B 3VD7A 3JVGC 1KT2A 3LPWA 5FGBC 5LAXB 4DGIL 3DETC 3V5HB 4ZD3H 1EEZA 2X41A 5JDSB 3VFNB 3CFDA 3FCTB 3UO1L 2VDPL 4JY4B 1NFDB 1QBBA 1A7BA 2JB6B 1OAYL 4ELMF 4U1MA 5KW9L 4HBQA 3WD5H 4P2QE 1ORQB 4GG6F 2FEEL 3QEGL 4DEPC 3MV11 5E1HB 4AYFA 4ZAKD 3BI9X 1A6TB 35C8H 3GSQA 1IGTB 3QDJA 1G7LA 4LQFH 5GIRB 3X3FL 2P7TA 4NHUB 1FBIL 1NUFA 4LLWB 2NXYD 1KIRA 2WWMD 2A6IB 3CFCH 4X7FC 5H94B 3OPZL 2PW2B 4Z77A 2F19H 3S88H 2Z93B 2O5YH 3RX7A 4APQC 1BQHB 4XZUB 3SKJL 4CU7A 4ERSL 3VFTA 2D7MA 3RBGA 2APFA 2IQAA 4TTGA 5IHUH 2OTWA 1T1WA 2VR4A 4JFFB 1A6WL 3RI5F 2BMKA 2W91A 3WIIL 1FCCA 1M4KA 4ZS7L 5EC2B 1RJYB 1JTPA 1G0XA 4GKNA 1I1AC 2GYSA 4KTEL 4MNHA 3SKMA 1QG3A 2IBZX 4U1LA 4WO4C 4YHLH 3OX8B 4OF5A 2YD7A 4UZGA 1F4HA 4AEHL 3NCYP 4S1QH 1ZLSL 2F53A 1OB1B 1DZBA 3KYNB 4OZGE 4HWNA 3OXRA 3MJ8A 2FZ3B 5ESAA 5J12C 5IT2L 4JZJA 5IVOA 3GMMA 5DT1L 1RULH 3DMMA 3CK0H 3PL6A 2CKBH 4FTVE 3QHZL 3N85L 1QTYT 1IAIM 1R5VB 4JZNA 5EWIL 2CKBA 5GGQL 4OLUH 4HC1H 2W0FB 3MRIA 1KJMA 1QYGL 3FQNB 3V5DB 1ZSDB 4YE4L 4ZFFA 4I0PB 1DQTA 3OKDB 3GRWH 3ARQA 1SY6L 4HC1A 5I73C 4G3YH 5H37H 3BUYA 3W2DL 3GRWA 1EHXA 3BP5A 3VFVB 3B2UD 4YHKH 3ARYA 5LGJA 4D9QE 3HR6A 5A2JH 2CLZA 1D5MB 3EO1A 5HSFA 5T1KD 1U8KA 4LHJB 1CGSL 2VDOH 3DX6B 3MRLA 4KI5D 4KUZH 3GEWB 3ZTJG 2QR0B 5CKGA 3SPVB 4P2QA 4P2RE 1U58B 3WHE0 3O3BA 2VLKD 2AEQL 4NZTL 3T08A 1N6UA 5DHYB 12E8L 4XTRD 3EYQD 1CWVA 3DRTA 3RY6C 4TNVK 5E00A 5CGTA 1A1OB 1NC4B 1FV1B 3JV0A 2C4FT 4JFOB 2H2PD 4LEOA 5E4EB 5TQ0L 4S1SL 3REVB 4KHXH 1GZQA 1KELH 3VWKD 5D2LB 1FVDA 5TDOA 1HINL 3K46A 2BXYA 4TRPL 1KJ2L 3RP1A 4WEMB 5L0QC 4TSCL 1G7JB 4MA8L 3SDXB 5HGGS 5HY9A 1D3CA 4YHPA 1IEBB 1A6ZB 2O26U 2KKQA 1AE6L 2H9GA 4JFQB 4EI6B 3B9EA 1HXYB 2AJSH 1AIFB 1DFBH 1FNGA 5T1MA 2NY2C 4FFYL 4MAYD 2CDFB 4R4ND 3RAJH 5BS0E 3U4BL 4BFBD 2EYTB 3OZ9H 1UM4L 4H20H 5D7KE 3SO3B 1S7UA 1XH3A 4D0CA 4OZGA 4ZUUB 1H3VA 1TVBB 4GRLC 4RAHA 1RMFL 3H3PL 1AD9B 2VTFA 4FTVA 2ADGA 5B3JE 4DK6A 3LZFL 3DHJA 4OFIA 3DXAD 3NTCL 1P7QA 1GRWA 5IM7B 4ELMB 4GT7A 1CTOA 4M61B 4YDLC 3AS1A 2DQDH 1AQKL 5FXCH 1UG9A 4JO3L 4GG6B 4DW2L 3NCFB 2JIXD 4GAFB 4J3WA 3MOAL 2VWEC 1QFWL 3QJFA 3ARBC 3F7VB 1OF2B 2W9DL 4ZUSB 4OFVA 4PP2A 1DVFB 2DQTH 4OIAA 1NMBL 1AHWA 3QA3B 5DYOB 3CXDH 5D1XD 3U7YL 1IKNC 2B2XL 2A77H 2VLJE 3I50L 1LEKB 1N3NA 4I3RL 1NCWL 4PREB 3SDDB 4P2RA 2P8PB 1GOHA 3KPMB 1NJ9A 2UWEE 2GJZA 1OTSC 1YNLL 2NX5B 1JWMA 3CDFA 4P3DB 1S7TA 3PGCB 4FXKA 4R8WL 5INCB 1EGJH 1F90L 2R2HB 4M9OA 1Y6NR 5K9KB 4WEBL 1QBMH 4G9FB 5FUCE 4D9LH 1EGJA 3QCTH 3MCKA 5K33A 1F4XL 4XPBL 1BECA 5JOPD 3CVHB 3K7UA 4KROB 3V4VL 2UUDK 4HUKB 3QCVH 1HN1A 4I4WB 1NGXA 3PIQB 1R3IL 4XXCC 4U4BA 3R1GL 2E8YA 5I1LB 3T0BA 5DFVD 2A6JB 2FX7H 1NCAL 4XVTH 4KC3B 3TVMD 3L5XH 2P44B 4FZEL 2DQUH 4U1HB 1I1RA 5DA0B 5BS0A 5D2NE 3VXQB 3IJYB 4PV9B 3C08H 3PG2A 5IMKB 2HT4C 4NKQB 3QI9C 2AKRA 1UZ6E 2HTKC 3BPOB 3FN0H 5B4MC 3ZDXE 4C55A 3OSKA 3KHOA 4BQCA 5D7LE 5JO5A 3U30B 3VFGH 1CICB 1YDPA 2MMXA 4NQUA 2HT3D 5JNYB 4KQ4H 4U6XB 3QUXC 1VHPA 4QXUL 4LKXB 1D5IL 2XZAL 5E4IA 3OR6B 5L6YH 2W92A 1BEYH 3Q3GA 4HV8B 5HBBA 1G9EA 3GSNB 3WS6A 3ARFB 1MI5A 2ZWLT 4HGWB 1A6AB 4JM2C 5AUMA 1PQZB 2D9CA 4NUGL 1F45A 5D7JA 4OI7A 1JE6A 4MDJA 4WWID 5KVDH 3QDJD 2JJVA 1IE5A 1VFUA 2EXYD 2VLJA 1ACZA 1F8TH 4WTWA 4LPCA 1YEKL 2OI9B 4JB9L 2UWEA 4Q58C 2HFEA 1HKLH 4GUPB 4XPTL 3VDAA 2JTDA 2H26A 4XMKL 1N64H 3TBYA 3RPIA 3IVKB 2RFXA 3C09B 3UTSB 5IBTH 4PG2A 1CU4L 4KV5F 2AEPL 3T0EE 3QO1A 1I8LC 3QIWB 2IANB 5C0NC 4QT5B 4PJ7F 1TZGH 4JPIA 3KPQB 4OGZA 3IDYB 1LNUA 5D9SB 2NZ9C 3T09A 1GGIL 4IOFD 1D5BA 4LPVA 5C86A 4V1DB 1NFKA 3OJVC 1NCCL 4UV7L 3BJLA 2O5ZL 2F74A 1WT5C 2C1PB 5CGYD 1KENH 4LDEB 1N2RA 5D6CA 5ANMB 1IILE 5DK0B 1IC7L 3PJSB 4HG4K 3DMMD 3PL6D 5KOMC 1YEIH 5D2NA 3TIDB 1OAXH 3VA2C 2NXZD 3VI3E 4F7PA 1J1OL 3DWTA 3KYMB 2E7LA 2KUTA 4CMHB 5HGDA 3HZVB 4R0LC 5D7LA 5I6XC 4LIQL 5IMLA 3I3EA 2F5BH 3U46A 2YD5A 2VDLL 4BSVB 1RZ8A 4QRRD 2FRGP 5GRUL 5HYFA 4ODBD 1MCSA 3PWUA 2B4CC 1X44A 3LKPB 1EUUA 4FXGB 2YSSA 4HUMB 4F7CA 1MQKH 2AGJH 2WP3T 1ZTXH 1U6AH 1NGWB 1ES0B 2OR8A 4OCSH 3OGOE 4NOBA 5GRJL 3TV3L 2C9AA 4XGZB 1HCVA 4ZFGL 2VL4A 3VFMB 3VCLB 1U8JB 2K1MA 5C0DB 1A5FH 5AZ2H 1LD9B 2VOTA 5I8CA 2QHRH 5GRWA 1PKQE 1O0VA 5DZLA 3SGKC 4ZTPH 4R4BA 4JFEE 1YEJH 4G8GB 1F11B 1HSAA 1EO8L 1CXEA 3IFNL 3TBWB 4CU6A 2RQ8A 4XWOC 5ACZB 4JKMA 3AREC 1JRHL 5SWZE 4NKIH 3ELAT 5IESH 3KPOA 4MA1C 1RZJC 3UJJL 3RTQC 3FQRB 4XH2A 3QXDB 2PO6D 4GW5B 4L4TB 2VISA 1J05A 4I48B 5TE7H 5ADPL 4M00A 1AGCA 1C5DB 1AGDA 3GMNA 4Y4KC 3S6CA 3T4AA 3T0EA 4MLSA 4DN3H 4G80B 4LL9A 2WUCL 4M7KH 5D1ZA 2X4OB 4I3SL 3T04D 1YYML 4QYOB 1V3MA 1A14H 2WUBH 4JRYB 4P4KC 5CILL 4UNVA 2VIRA 5EOCH 1DBMH 5BMFL 3U7WH 4YJZL 3QG6A 3IFOB 1DN0A 2AQ3A 3FO9B 3RUGF 4OCLC 5K93A 3D0VA 3TJEH 3EJZD 3EYUH 1XGYL 3PV6A 1WFTA 1UH2A 3G5YA 3HAEG 4X9BA 4ZXBB 4JQIH 5H35A 4JM4H 5FA4A 4I18C 3QIBC 1NBYA 4GFTB 2YC1B 1EXUB 4KVNH 2C7UA 1ZLWK 1UKTA 2VXQH 4MXQD 4Q7DA 1WWBX 4M48L 1CFTB 4U1SB 1DUZA 3BGFC 3KPLB 4OV5B 1LDPL 2OL3L 4YBLB 4CVXB 4M7JH 5CJQH 1WCBB 3ARGB 4E41E 1MY5A 2AJZA 1Y18B 2V6HA 1I4FB 4D9QD 1KLGB 5HVGB 2VSCA 1E6OL 3OR7A 3AS0A 3LB6D 3MUGB 4RAVA 5IMOA 2Y7QB 2D7TH 4MYWB 5DJAB 1FPTH 4QHMB 1QLEH 1Z0NA 2Q8AL 4F33B 1QR1B 5DRXB 2XZCL 1AXSA 3IFPB 5HJ3B 4A2LA 1FJ1A 4XPFH 4P2CG 2DI9A 1IM9A 1PKQA 4N0CC 2ADIA 5IHLB 4U6YA 4JFEA 1BFSA 4UT9H 1NLDH 3BN9D 1UQSA 1UZ8B 3NCCB 4PJ7B 5I9QB 2AJXL 4JRWA 4Y5XC 5SWZA 3RVXC 4BZ1L 3NABH 1YC8A 2BY2A 4Z7UF 5HDBF 4K3EL 3STZA 5EOTA 2MKLC 3K81A 4UIKH 3QCUH 3MLVH 4RX4A 3BZEA 1T5XA 3S8WA 3TZVA 5FCSH 3GBMH 1LDSA 1ZVYA 2F9BT 2N1KA 2JCCB 3MLXH 3BP6B 4P57A 4IRJA 3RIFK 5FDYA 3DUUA 4P46B 2FD6H 1RQ5A 1HQ4A 5E08L 5JOFB 2WBJA 4HIEB 4O5LL 1U3HD 4QHUB 5JZ7C 2UZIH 1GGBH 4GRMA 5MEOA 1TNMA 4HK0B 5D7KD 5F3BA 5FYLD 1QD0A 3MUZ1 5HHNB 1QSEE 2BJML 4H25B 3P73B 1X3DA 1IAMA 4WFGE 4IJ3B 3LVEA 1BJ1J 4FQXA 2YA0A 2NY0D 1VB9A 4HXBH 3CFEB 2XQBL 2ATKB 3K8KA 4NO3B 4N5ED 3DHMA 1VSCA 4Q0XL 3BWAA 2XN9D 3NH7L 5I1JH 2R1YB 3LEYH 1AKJB 1ZHNA 3W11C 3V7MA 4TVPD 1N59B 3MV9B 3IKCB 3QXAA 3NAAH 1V3LA 5DEGA 2IEPA 5JW5B 5HPMB 2BY1A 1NFDE 1Z6JT 4WI7A 5HGBB 4Q9BA 1YNKH 4F80A 2FATL 4E41A 6FABL 4YHOL 4GQPH 1WZLA 3PWJA 3NFPA 2FECI 2FWOA 1P84K 3JBG7 3TPUA 2Z92A 3DYPA 4PG9B 1NCTA 1CGUA 1IGIL 3OKEB 1NEZA 5L8LB 5I8KH 4K94L 3WIHL 4P59L 2PNDA 1P6AB 4JO1H 4QHKJ 2JK5B 4FNLL 2AJYL 5E2VH 1A3RL 4AEIL 1AD0B 4NKOB 1HYSD 1U8HA 3TT3L 3KJ4B 4YHZL 4IS6B 5JIKA 3VFWB 3MRCB 5EU5B 3BZFA 4F7EA 1TNNA 1RZJL 1A6VH 4KXZH 3I6KB 4XNYH 3UJTL 4O9HH 3IDIB 2BZDA 2K9UA 3D85D 4K3JH 3UYPA 3KPSD 3FB6B 4LFHD 3JTSB 1QUNA 1C8PA 2X4RA 4MS8D 1BVLA 5A2IH 5J7CC 3MXVH 4ENED 1MHPH 4ZYKA 2ITDB 4OTXH 1J11A 4Z7NE 5HHOA 2OMBA 5F3HA 1CFBA 2R1WB 1S5HB 3RHWF 1OOAA 3IAQA 2DJUA 5ESQA 5IROC 2B1HH 1JPGB 3QJHB 3ZYJA 3D18B 4OJFH 4MNGB 1HDMA 5C3LD 5D1QD 3ZKXC 2Y9RT 1C08A 4O02L 1UXWA 3O2DL 1QSEA 5F9OH 2D7NA 1S78C 4DN4L 3WEXB 3BRGC 4KZDH 1AP2A 1MRFL 2K7QA 4CN4A 4ZG1A 1KB5B 4HUWB 3ME0A 1EUTA 4YGVA 2A1WL 1VESA 3M8OH 4K8RD 3C5ZD 4RFNB 1KN2L 1MWAB 2VQ1B 3VXTB 1NFIA 1LK2A 4YFDB 4M7LH 5DJYA 1JHTA 4ZUVA 2LFGA 5LAXA 2BHYA 2GTZB 3BKML 1IBGH 1OCWL 2R0ZH 5HI3D 5JDSA 3VFNA 3UDWC 2AK1H 2H8PB 1NFDA 1T20B 2WM0A 2JB6A 4H0IA 3F7YB 1BD2D 5KSBF 2WMPA 3QG7H 1QR4A 1JFQL 3FOLB 3SE3C 4X6FB 1GIGH 3FB8B 5GISL 4XHJD 4WFEE 5HHQB 4BJLA 1U91B 1A6TA 1HSBB 1T66D 5CUSH 1IGTA 4QF1A 5GIRA 4Z7UB 5TDPB 4NHUA 2V5RA 4DEPB 4LLWA 5CGMA 4LVHC 8FABB 4FQ2L 1Z9MA 3QXUA 1TVDA 3IETA 4JFDB 4HKJB 1XT5A 2OMNA 4J7RA 4NWTL 2Z93A 4Z7QE 1BQHA 5D2LE 3NIDF 3MACH 1T0NB 1J0YA 4IMKA 4OBSA 3SDXE 5ERWB 4MD0B 4G8EA 3DOSA 5EUOF 3U0WL 1I7ZA 1KIPB 1DJSA 3DI2B 4GKZA 3DVGB 2E8ZA 2AJVL 3QWQB 1IC4H 1FNAA 3KLDA 4J3TA 2ORBH 2XQYG 3WYRA 3ZKSD 1FZJB 3RWHA 1OB1A 1YNTB 3KYNA 1OSZB 5C07B 1J87A 2YPKA 5E8EB 4CVZB 3I6LE 5AG9A 4OLXH 5HYJD 1NDMA 3GJFH 4Q2ZB 3TFKD 1DQML 4HUXB 3CXHJ 2RAMA 1D9KC 3GJFA 4EUPB 3S4SG 4AIOA 2W0FA 2KPNA 5EC1A 1LEIB 3FQNA 3V5DA 1ZSDA 4GG6E 3C2SA 4I77H 1DTUA 3ARDC 4YEEA 5GHWL 3VFVA 5E94B 4Q9CA 1NH6A 1WGOA 5JPMA 5KZCB 3QRGL 1P1ZB 1RZKH 4YBHA 4Q6YA 1MCPL 1VENA 2R23B 4PJEF 1D5MA 4PRDB 3RWFA 4ZS6D 2EDOA 2D2OA 1HH9B 1G9ML 3OTTA 2QR0A 1K8IB 2E6PA 3SPVA 4LGRB 4KJQC 1S9VB 4K8RL 5LKNA 4OLWH 4JFED 4TUKL 2DMBA 3Q1SH 2IPTH 3BH8B 4ONFL 2ZKHL 3LPFA 4L8CB 5E8NB 3NN8A 3KLHC 3OV6A 1JF1B 5FOJA 4HLZH 4X4ME 1CXHA 3HCVB 1NANH 4GXVH 2NQCA 1EHLL 1FV1A 3SKNB 4F37F 4JM2F 2ICWB 4K9EH 3REVA 1UWEH 1MRDL 2R1XB 4RX4D 5D2LA 4U1JB 1PG7W 3O8XD 3SDXA 4H26B 2GSGB 2VZSA 1H0DB 1BZ9B 4RGND 3PGFH 3CSPA 2XT1B 4FOMA 1IEBA 1A6ZA 4OD3L 4RIRB 1A21A 1S7RB 2WBJD 1F02I 4JFQA 2RIKA 3ISWA 1AIFA 1TJHL 4M3JA 3FQTA 2GCYB 5JXED 2EYTA 3KWWB 2HFGL 3H7BA 4FQXD 5IQ7H 5L88H 2F5AH 3KPNB 4GSDH 1Q94A 4ZFOL 4ZDHB 4ZUUA 3JWNC 1TVBA 3QUYC 3FAWA 4P9MH 5DSCB 5DVNA 2Z8RA 1KSRA 1U8MB 3TO4D 5I1GL 3UZQA 4HH8A 4PTUA 2GFBB 4DVBB 3O0RH 2YD6A 1YEHL 5KSBB 4PD4K 4M61A 5I76B 4K7FA 5J6GA 4WUKH 5I0DA 3Q5OA 4E41D 5KJRH 4X6CF 1YYLH 4ACPA 4GG6A 3RWIB 1IGCH 3L3KA 4R90H 1A0QH 5DUPL 3HI1B 1CBVH 4RRPG 1U8OA 2DWEB 2JJTC 3PWVB 3QHFL 5SWSD 3SCMB 1OF2A 3V0VA 3TH4T 4ZUSA 3LPGA 2VXSH 3FL7A 4NNYB 5E5UB 2D7QA 3D1MC 4F7TB 5I1AB 3QQ9D 5GGRB 1LEKA 3CLEH 1EPFA 1MCIA 4PREA 4XPHL 1J9CT 2WLYA 4QTIH 3KPMA 1FO0B 3MRFA 1B88A 1H8SA 4OLYL 1ADQH 4P3DA 2DN7A 3PGCA 3A6CH 5INCA 5EUOB 3U48A 4TSBH 2Z8WC 4XP5H 4X4MA 2R2HA 1ADQA 5BQ7B 3HR5B 3ESVF 4GMSL 3RGVB 5K9KA 4A6YL 2EIDA 1IAII 2FNBA 2HJKA 2XFXB 4PGCB 3BPLC 4MSWB 4KKCC 1F6LL 1LQSR 4NYLB 5HHMB 4V1DE 4X5LA 1NAKL 4I4WA 3PIQA 5I1LA 1Z9SA 3GIVB 5BV7B 2A6JA 3L1OL 4M4PA 2BVOB 3SHSA 2OSLB 2Y36L 1ACYH 1TCRB 4Q6IB 4OM1H 1HIML 1FORH 4HEPG 2W60B 4U1HA 2I9LB 3IDXL 2WQRA 3BESR 3C87A 3MRDB 5DD0H 1OLLA 3VXQA 4PJ8C 5MENE 3IJYA 4PV9A 2G60H 4C59B 5IMKA 2BP3A 1CE1H 2AEIT 3WFEH 5IMMB 2BVTA 5A16B 1UCBH 4ELKB 5L2KE 1R3HB 3B9KC 1MFDH 3DGGA 2XWJB 3MGAA 1CICA 5JHDB 1X5FA 4L3ED 4S1RH 1KC5H 1KN4L 4YC2C 4PJEB 5IFJA 2L7JA 4R96A 1OY3B 3B5TA 4LKXA 3S35X 5DMKB 4BFIB 3OR6A 1KXQE 1XCQB 3GSNH 4M93C 3MV8D 3MCLL 3BDBA 4EIZC 3B2VH 3BPCB 1P7HL 3P0YL 1NGYB 3GSNA 3ARRA 2DMKA 3ARFA 1RZ7L 4HGWA 4JKLA 1M71A 2IGFL 3IU4L 3PP3H 1PQZA 4WFHE 2NXYC 3TWCL 5KTEL 1ZEAH 3DYOA 4KAQL 2Q86A 4GH7B 3ARSA 5F96H 4JFXB 1KPUA 2YRPA 1SQ2N 5F6HI 5E9DB 5C3TA 2P45B 4U2YA 2BVQA 5GRXG 4X99B 3GM0A 3I84A 4OF6A 3IU3B 1E6JL 5FF6B 4L4TE 3QB7C 4Y88A 4BSWA 1JYVA 4EKXA 3DROB 3IVKA 1KTRL 5EN2B 1MAKA 3MO1A 1H3GA 2YD9A 4JPVL 2Q6WB 2DOCA 1G6RB 2BHUA 3SDYH 1JWUB 3PNWB 4QT5A 3SO5A 3HZKB 3KPQA 5D9SA 1U3ZA 1CLYL 4JRYE 4V1DA 4WENB 3QFDB 4YDJA 5FHBH 4L29B 2DAVA 2P48B 4HKBB 2Q3ZA 4QGYA 3WXVH 5HYQB 3DX7A 1IAIH 4X7CC 4HJ0D 1RIHH 4JPKL 3QP3A 3S3PA 4LHUG 3BW9B 1XF5A 5DK0A 5JXAH 1OW0A 3PJSA 4MWFA 1AC0A 1ZKAA 4HWEL 4AMKH 4QRTB 2GT9B 5MENA 3HNVH 5FGCB 4E5XB 4HZAA 4XB7A 4L1HA 3ZTNH 1GPOL 5SV4A 5L2KA 4BSVA 1CI5A 5H2BB 5D72L 1JI2A 3LKOB 4L8SC 4XHQA 4FXGA 2EC8A 2JJSC 4M5YL 3D69B 3I2CH 5C0BB 4KK8C 1NGWA 1ES0A 3ET9F 1CXIA 1Z3GL 5EOQL 5KSAC 2H3NB 4F58L 2ZG1A 4M1DL 5GJTL 5EO0B 4XGZA 3VFMA 5EORL 4JRXB 3TIEB 4FQ1H