3C6SA

Crystal structure of fab f22-4 in complex with a shigella flexneri 2a o-ag pentadecasaccharide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
DIVMTQAAFSNPVTLGTSASISCRSSKSLLHSDGITYLYWYLQKPGQSPHLLIYHLSNLASGVPDRFSSSGSGTDFTLRISRVEAEDVGIYYCAHNVELPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab F22-4 light chain
publication title Structures of synthetic O-antigen fragments from serotype 2a Shigella flexneri in complex with a protective monoclonal antibody
pubmed doi rcsb
total genus 48
structure length 216
sequence length 216
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6sA01
3WSQL 2BVPB 1RZFL 4S1RH 1IL1B 3QBTB 4I77H 4IRZL 1TLKA 1FGVH 4Y19A 1BMGA 4XX1E 5GS0D 2R1XA 2VXTL 3OXSA 1WCBA 4C55A 2WM0A 1J86A 1JGVL 2PTUA 5FO7A 3MRMA 5DVLA 4FZEH 4YZFF 4PBXA 2J8UB 3PGFH 5KSUA 3H3PL 4JO3L 3DXAE 3SE8L 2VERN 4P4KC 5DJZA 1UZ8B 3BJLA 3T2OA 4PJCA 1B6DA 3AM8C 4ZFZB 2MCG1 2NY3C 4FQIH 3RJDA 2DLFH 3QEQD 3F7YB 5DQDL 5C6TL 3F7RA 4XP6L 1KULA 5DHYA 2P24B 1ZKAA 3JTSA 5E8NB 1MHEB 4YHKL 4H26A 4M43L 2O61B 3VW3L 3OZ9H 4GKZA 4LLDA 5IVZB 3FRPG 4XVTH 1YNKL 4P99A 1S7VA 1LO0L 4LVNC 4WFFE 3P30L 4I0CC 2GK0A 4ELMF 5EWIH 4DKFH 1O7SA 1U8JB 4R8WH 2HH0L 5I1LB 5I2IA 3F58H 4IIQB 5EO0A 3BT2L 2GJ6A 1RIUL 3X3FL 2X4PB 5EPMA 4DCQB 2W1NA 3WIHH 5K93A 4LARL 4L4VE 1BQSA 1AH1A 4MNHB 2AEQH 4QRTA 1F3DJ 4H1LG 4KROB 3VXOA 5DJ2A 1IKFH 2X4RB 1MJUH 4ZAKC 5D6CB 4BELD 2PTVA 2HKFL 2HLAB 3IJSA 1DQTA 2R2HB 4K7PY 3T3ME 5HYJA 2A6KA 3PGCB 1UVQB 4PJ9D 5E99L 5C8JB 1ETZA 1DEEA 1S78D 3GI9L 43CAA 1UG9A 3QJFA 3FO2B 2EE6A 5DQJB 5HDBE 1FDLH 5BRZD 1JFQH 1KJ3L 1NFKA 4G8FA 2OTUB 5ESVA 4DUXA 1XF2B 5IROC 2CO6B 5FYLH 4FP8L 5IFAH 1JHLL 1JGDA 1RFDL 3X11B 3MLTA 3AS0A 1I7TA 32C2A 4I4WA 3EUUA 2NNAA 3GMNA 4MX7B 3UTTA 5DUBB 1RJCA 4XHJC 2E8YA 1TQBB 3IU3A 2G5BB 3TFKD 3BP4A 4WNQB 5FHBH 2J5LB 3LS5L 3U9UA 3D69A 2ZCKH 1DUZB 5GGQH 4WUKL 5HYSG 1P4LA 4OTXL 1A14H 1VFAB 3QFJD 4N1CA 5ICYA 2IPTL 3EGSB 2F74B 2DM4A 3FQWB 4DKEL 4L3EE 3TEUA 1CL7H 5ANMB 1F4HA 4ZOEA 4I18B 4KRNA 4OFDA 2MCPH 1WBXA 3DX6A 3WHXB 5I1GL 1JNLL 4HAFA 5FA3B 3A6OA 3BMVA 4JO4L 3T65B 5BXFA 5EZLB 5GJTH 1MJJB 1TNNA 4KKLC 2GSIA 3HHRB 2VZOA 1M7IA 3TNMA 5F6IB 3FT3A 1CTOA 4FOMA 4OKDA 1BD2A 4LCWB 5FGBA 1MCHA 4JG1H 2ZUTA 1FZKA 1KNOB 4XTRD 2ZOLB 1YDPA 2ITCB 1E4KA 1DTUA 4AH2B 3WEXA 1KUMA 3CH1B 1IAOA 3VXNA 4JG0L 5D96B 2Y07H 4KZDL 1ZHKB 4UT6H 2HFGH 5T1MA 1HHIA 2X4SB 1HHHB 3IDNB 2F8VA 3MRHB 4L3CB 3MRDA 3RWHB 4P2RE 1MAMH 1WWBX 3P4LA 2JB6A 3TO2A 2RFXB 5C1MB 1PY4A 3OGCA 4CUCA 4GKOA 1XT5A 4HEME 2SEBA 3H9SD 3EYVA 4ZUTA 5DS8A 5DJCA 1NCWL 3RKPA 2A83A 1I8KB 2X05A 1OLZA 3BEWB 4S2SA 4F33B 4N8VA 3DIFA 4PS4L 3BH8A 5DEFB 3OKEA 3FN0L 2AQ3A 1PLGH 3MTRA 4J12A 1A4JB 4JFYA 4OT1L 5DEGA 3H8NA 3BPCB 1PFCA 3U7WL 4F57L 2XKNA 2AXFA 3VMOA 4RA3A 1B90A 1OAZH 2XN9E 3T0DA 1CGUA 4KKBC 1VFBA 3WFBH 3NFSL 2WK2A 4ZUUA 4IIQC 4TUJA 2VLMD 3C08H 3CX5J 5IFJA 3IFNL 5KG9B 4XNUH 4IMKA 1AE6L 1CLYL 3IJYA 5BJTB 3QEGL 2X1XR 5I18L 2FO1A 4X6EA 1VPOH 4KROC 5K9OA 3GUTA 5FFLA 3QUZD 4I9WD 1F6AA 3O8XB 1UGNA 4ODTL 1ZT1A 5T1LA 5KSVA 4ZNEE 4JFXB 2ATPA 4D0CA 1I3UA 3PGDB 4LHJB 4NQXA 2VMFA 4S10A 4L4TB 4NFDA 2B39A 3QI9B 1XCQA 4RWYH 4UILH 4GW4B 4ERSH 1MFCL 2DTMH 2DLTA 4W6XB 2VLLA 5DD3L 3EJZD 2VSCA 1JPST 1YMME 4QYOA 4M9PA 2EDNA 2P8MB 1JF1A 2FEDC 2FX8L 3TIDB 3ZDYE 4F8QA 5IV2A 1X4ZA 1X5JA 4JPVL 3ET9F 2JJSA 5HJ3A 2ICES 1QFUL 5E5UB 5EIVA 3DVGB 2HG5A 2K7PA 5EU6A 3D2UA 5B39B 1TQBC 1FORH 1WQVT 3QDJD 1QEWA 5C07B 2J5LC 3MV7A 2LU7A 1T3FA 2VO5A 1UWXK 4W6WB 3RL2A 1HXYB 4GOSA 5B22A 4K7FA 1JTOA 3GSQB 3T0BA 4UU9A 3BDXA 5JW3L 1RZKH 4LLVB 3QIWA 5DHXB 3HCVA 2CK2A 4HFWB 5DK0B 2V7NA 1I9IH 4NJAH 1ERNA 4KKCC 1E27A 1AFVL 4UUJB 4MS8D 4QXTB 3RNQB 1Q8MA 1QO3A 4I18C 3F5WB 4HKXA 4NWTH 1KCSL 4ODWB 4X6FB 4TULL 4Y5YB 4ZO8A 2VLJB 3QDGE 4FQLH 3V5HB 4RIRB 1YECL 1OAYH 2ZCLL 3SJVB 1MELA 3C9NB 5EIIB 1A7QL 1UC6A 2NX5E 5GGUA 5GRJH 2VQUA 3REWB 1MOEA 5F6IC 1NDGA 4JKPL 3BYTA 2FH8A 4P4KA 3NOIA 1MRDH 4W4OC 5ICZA 1NCUA 4M48L 2BSTB 2J8UF 4V1DE 4LPUA 4PB9H 5CSZA 4D2NA 3IKCB 3KLHC 2X4QB 4KMTL 3MNVA 4O2EB 1EJOL 5D96C 1EMTL 1TDQA 5LQBL 4U3XA 4LCUB 3IDJB 3T8XB 4PP2B 3H42H 3PQYE 2NY4D 4HHAA 1RUQL 1MJ8H 4EZMA 4XNZB 3PWUA 1H3VA 1J0KA 5D7LE 3DTXB 4PRHB 2ZOKA 2XZZA 1FVDA 3MRFB 1IQWH 3V5DA 3WKNA 2OK0H 5INCA 4K8RC 3K1KC 4NGHL 4Y19E 1PG7L 2VZVA 4XNYL 3BPLB 4YO0A 1AGBA 5JZ7C 1C5BL 2XZAL 2YPVL 1WZ1L 4GMTL 3MRQA 4HFUH 4NO5B 3MOQA 2VC2H 1RVFL 3HE6A 4JRXD 4OBRA 3OMZA 3B9DA 1T0NB 1GGYA 4PJCE 5TDOB 3GJEB 3WN5B 4QRUB 5ADOL 5EU7E 3BH9A 1A1NA 5MENB 4HQQL 3D48R 1KTDB 5IROA 5CEXA 4GLRH 5DMJB 1JZ4A 3QO1B 4F2MA 4ZD3H 3RA7H 3V0WH 3FB7B 3GGWB 1IMHC 3CFJA 1KB5B 5JUEH 2XOTA 4PV9A 3O8XC 1HE7A 4WEBH 4ELKA 4PGBB 4RMTA 2GJ6E 3FHQA 4X5WB 5HI4D 5L2KD 2LU3A 4RZCB 3AUVA 1U8PB 4NUGL 2R0ZH 1X5AA 4F80A 2DI8A 2P5WA 1JIBA 1CDCA 4X6CB 1GGTA 2PR4L 1F11B 3TF7C 5DR5H 4U6YA 2F19H 3QI9C 5CD5D 1IC4H 1WITA 5C0IB 3G5VA 2GEEA 1FRGH 4WV1B 4P59H 3N1GC 4LK4A 1NMAL 4KWUA 4LLWB 1T03H 3U82B 3CFKB 5HYJE 2PO6C 2FJFB 2FEEL 2GY7B 1WJ3A 4UTAL 4AM0B 2C1OB 1V8HA 1CT8B 3HZVB 4NN7B 1JN6B 3MLYL 4YDJB 5BS0B 1MNUL 3U46B 5C08B 5KSBB 4ZQKB 3OPZH 5FO8B 1IVLA 1KLUA 3WHE1 3FFDA 4DVBA 1YY9C 4MAYD 5IVNA 4L8DA 4X4XB 1A7OH 4KK8D 2DM7A 4L8SB 1JNJA 1FNEB 2UVFA 3UTTE 2QSTA 4G5ZL 5FIEA 3EFDL 3VFNB 2VDNL 2BVPA 4XCNB 3CCHB 5I1KH 3HS0B 1IL1A 2EDWA 3WL9B 3SDDD 1OT1A 3PP4L 4OZHB 3QDMD 3T1FB 1N2RB 3O81A 1D5IH 3LN9A 4Y5YC 2CD0A 4LP5A 2YA1A 1QLFB 1H0DA 1QFWL 8FABA 1NBZB 3AMKA 2RIKA 1I3GL 5ALBH 5FM4A 5B3JE 3JWNC 1FAIL 4DAGL 3WYRA 5F96H 1UZ8A 2CKBB 4ZFZA 4WJ5B 4EI5A 4M5YL 2WV3A 3CDYA 3F7YA 1I4FB 4XCFH 2C4XA 2P24A 5E8NA 4HEPG 4J2XA 5I8EB 4XPBL 1WICA 1P1ZB 1HSAB 5FUCC 4P46D 2X1WL 5IVZA 1BD2E 4RA0C 5EBWB 1I8MB 1MPAH 4DZ8B 4TPRH 1U8JA 4FABH 5I1LA 4AL8L 1ZGLB 1P4IH 4IIQA 5AZEL 2FD6H 4RBPK 3OV6A 4PLNC 3WIFB 4DCQA 3L5HA 1A64A 2RCSH 3ULUD 4MNHA 1Z6JT 2K1MA 1NGYB 3EW3B 1MIEL 3ARUA 4YZFE 3QIBB 1EGJA 2HKHH 2HTLD 2X4RA 3ZSSA 5DWUH 4N0YL 5L6YH 5IEKB 3TA3D 3NABH 1O0VA 2HFTA 4KRPB 5D6CA 1L0QA 3LZFH 5EZIL 2YD3A 1G7JB 2HLAA 2R2HA 4I13B 4IRSB 3WXVL 1ZT4B 3HLAB 5K9JL 1UVQA 3OG6B 1FN4B 4JN1H 5C8JA 3ZYIA 2VLRB 2EIZB 3CUPB 3WN5C 3W9EB 2BHYA 3FO2A 3UJTL 2HMID 4JRYB 1P5UA 4XPTL 5I15H 1TXKA 4HWUA 1UACL 1QRNB 5K9QG 2OTUA 1XF2A 5I30H 3L6FA 1T7YA 3VRLE 3BEVB 4ELME 2IQAB 2R15A 3X11A 4U2YA 2G60L 2VZ1A 4LSDA 5BMFH 3F12B 4CRPA 5I8OH 4MX7A 1E0OB 1SQ2N 4JFPB 1KEGH 1F8TH 5BOPA 2WQ8A 1MCWW 1YEIH 1VGEL 2X1OA 3A6CL 2IG2H 3BO8B 2VXVL 3RRQA 2G5BA 2W0LA 3QWQB 3UJJH 4WNQA 3L7EB 2NZ9D 5E2WL 2FBJH 2IPUK 1YEKH 1DUZA 4MDJB 4EUPG 3MA9L 5HGDB 1LNUB 1VFAA 4R4BB 5CGYC 5AD0B 5ESQA 4OGYH 5EUKB 1CVSC 3EGSA 3FQWA 5EOTB 5ANMA 1MY7A 3A6BH 4I18A 4PJDB 3S8WA 2CDEB 4OD1L 1QFHA 1NLBH 4X99B 1E4XH 3RBGA 3T65A 1MF2H 3MJ9L 5EZLA 4RGNB 1MJJA 2ADJB 3OJVC 1CGVA 2BOCB 3E6FB 2J6EH 2IQ9L 2AJZB 4D9LH 4LCWA 2NXZD 1KNOA 1K4DA 2XFXB 2ZOLA 2R4RL 3PF2A 4L8SC 3L5XL 1FNSL 4GAJH 3DMMD 5CIPH 5E2VH 5EU6E 3WNPA 2DM3A 3BQUD 3MV7E 3O3UN 1SEQL 4XVSL 4KXZI 1ZHKA 2A6IB 2X09A 4KTYA 1U2CA 1HHHA 3IDNA 5HDQH 2Q8BH 3MRHA 4L3CA 2D9QB 4UT9L 5EUOB 3RWHA 5JOPD 3TNNA 1AGDB 1C5DB 5JDSB 4ETQB 2RFXA 2AJVL 3QG7H 3ULUH 1A0QH 1FFNB 1H3GA 4LDLB 4Y4FB 2DQTH 1F4WL 1LMKA 2EDEA 4F33A 5KZCD 2M26A 2BC4B 5DEFA 4Z76B 2FX7L 1AD9A 1I9RL 2MWCA 4RSVA 3KWWB 5DMGC 3BPCA 4N90D 4GQ9H 1CFQB 5FV2A 4LMQE 2PN5A 4G80B 5DGRA 2E7MA 1SJEB 3WIIL 4HUUB 4CU7A 2J8HA 2NR6C 3ZT6A 3QEHB 1D3CA 2JLLA 4DGVL 3EKCA 5BJTA 3U36A 4LGPB 2E5EA 4LLYA 3B5GA 4Z95L 1OP5K 3GKWH 3QIBC 4Z8FH 4J3UA 3QNZB 2YD8A 4J4PD 2C4FU 4OLXL 5I17B 4K3GA 4KRPC 5HHOB 2CSPA 1OB1B 4G7YH 5L88L 4IRSC 5E9DB 4DWHA 4LASH 3PGDA 3QCTL 5GZOC 3MOBH 2EKSB 4KY1L 5FKPB 5BV7H 2ESVB 4YGAB 5CJQL 3S35L 3N9GH 5KS9A 1NGZA 1ZHLA 3QI9A 5FM8A 4LHUG 2QQKL 2PW1B 4GW4A 1U58B 4X6CF 2X4NB 25C8L 2VNCA 2P8MA 1CD1B 3N1QC 2ZUQB 2QADD 4XPFL 2I9LB 1RZ8A 1RUPH 4JZOA 1F4YH 2JTDA 5B39A 3G6AB 4ONFH 1X5GA 3LQMA 3AVEA 2Z91A 2NY0B 1HOCB 1R0AL 4FFZH 1HXYA 3D0VB 3ZKQD 1FFOB 1FCCA 2GQHA 3ARBB 3GSQA 3R1GH 1X7QB 2XTJD 4P3WA 2LTQB 4JQXC 1EUUA 4HFWA 5DK0A 2OP4H 1FO0L 2D0HA 2EDTA 2EXYC 1WFTA 4QXTA 3NAAL 3RNQA 5MHSD 4WHYG 4ZSOB 1RU9L 1HYSD 4NC2B 3P4OA 1X5XA 2Z31A 4ODWA 4X7TA 3S6CA 3V5HA 2I60H 4RIRA 2HVKB 4OZHF 3PDOB 3C9NA 4U0QB 5EIIA 4RGNC 4JREB 3IU4L 3UP1A 3UZVB 1LDSA 3MACL 5FUZL 1S7QB 5HHXL 2XNAB 1QBLH 2BSTA 2AV1A 4YNYA 5F7DB 4XBPB 4LGSB 4HUXA 1A6VL 4I48B 3D0LB 3IKCA 4TN9A 2X4QA 5DTFA 1ZWIB 3K4AA 4H88L 2VITB 3WUWG 1ED3B 2GHWB 1AIFB 2F5BL 1CTNA 1GGBH 4I0PB 1UWEH 3VWJB 1T1XA 1EERB 3IDJA 2VLKB 4Z7UB 3T8XA 2BJMH 4PJIB 1VFMA 4R26H 5I19L 1MLCA 4IBLT 4ENEC 5DD5L 2ZKHL 1LK3H 4AG4H 1RHHB 1UXSA 3DTXA 1DLHB 2GSGA 4PRHA 2FL5B 3MLSL 3MRFA 3MJ9A 2EEBA 1F2QA 1CF8L 4XNXH 3HZYB 5EO9B 1CK0L 4QHLB 4WFGE 4Y4FC 1T2XA 2E7BA 4Q9RH 1BHGA 1BFOB 3HUJB 2JCCB 1Z9OA 4PJHB 4WHYH 2W0FA 2QSCL 3TBSB 2QR0A 2EDJA 4PJ7B 4NO5A 4HKBB 1FNLA 1XCTB 4FXLA 2AEWA 4NQCA 1JZ6A 2E6PA 4QEGA 4M7KL 3NZHH 5L7XL 5DURB 4NM4H 1AO7A 1T0NA 3RVUC 2XZQL 4OCSL 5TDOA 1A02N 1CG9B 4QRUA 3FQXB 3SE4C 5ISZB 2QSQA 3CZFB 1IEBB 2OCFD 1NUFA 4OFPA 1EDQA 1KTDA 2WAHA 2D4DA 3QO1A 5T1DH 1DEDA 4ZOBA 4RMVA 4RAVA 3T2PA 5K9KA 3GGWA 4U3HA 2VDQL 1PEZA 2F5AL 2XWBB 1HK6A 2EECA 4PGBA 4X5WA 1DFBH 4CN6A 3QCVL 1UXWB 4RZCA 3MBXH 3GB7B 3GSWB 4IS6B 1U8PA 4QF1B 4JM2B 3P73B 1LDPL 2XY1A 1UH3A 1F11A 5DLML 3V6OA 1K5NB 1GAFL 1A6ZB 1JK8A 5FYJL 4CJ0A 1EK3A 1AC0A 5C0IA 4PJBB 4QRPA 1IILE 4WV1A 1IGYA 3LN5B 1U8NA 2CXGA 4MHHI 1T04B 4PV8A 5TE6L 1MCOH 2FJFA 2NLJB 3O45B 3DURB 5SX5H 3ZTNL 3EYSH 4AM0A 2EYTB 3V0VB 2C1OA 4OI9A 3S37L 1CT8A 1WEJH 3BGMA 3HZVA 4PJDF 4YFEA 1JN6A 4UBDD 1OTUD 4YDJA 5BS0A 4DGYH 3C6LD 4O58L 5KSBA 4ZQKA 4UIMB 4V2CB 1J9CT 2NY0C 2CKNA 3GNML 5JHLL 3ARBC 4X4XA 2V9RA 3HNSH 1OP3K 1FFPA 1FQ9C 4HF5H 1FNEA 2LTQC 3JVGC 1IM3B 3VRJB 5HPMB 5DA0B 1MLBB 2VXSL 3CCHA 3NCJH 3O6KL 1J1PH 4JAMA 1A6UH 3HS0A 1HDMB 3KPQB 1MCSA 1MI5D 1FH5L 1T80A 3WL9A 4FQJL 3BI9X 4OZHA 1N2RA 4M6OL 5ALCL 2GI7A 4YX2H 4C56A 2OL3L 3HR6A 1T21B 3QQ3B 1NBZA 2OTWB 5BQ7A 3E2HC 4JREC 5A2LH 5ELIA 5JXED 4JLRA 3P2TA 5ANME 1ZLWH 1QLRB 4MQXD 5EUOF 3OAUL 2H8PA 4GT7A 3DO3A 1MCKA 3ELAT 1BBDH 1LEKB 1FYTD 2OI9B 3MGTB 1QR4A 2CKBA 4WJ5A 2AI0L 4LVEA 2BNRD 4M6MH 5M95B 1E4XI 1I4FA 1FC2D 4QHKI 5KBNC 1EFQA 4PJ9B 4G42A 4ZO9A 5JIIA 1G0DA 4NM8L 4H25B 1FO0A 4I0PC 4MJID 3VWJC 4NO2B 1P1ZA 1H3TA 1HSAA 1NCBL 1U8LB 2P46B 2CIKA 4UQ2B 2PF6A 3I3EA 1MRCH 4LCWE 3GHBH 1H3PL 5GHWH 5BRZB 1J1OH 5EBWA 1I8MA 4QRRA 3QJHB 1TFHA 1OPGH 4DZ8A 1BIIB 3U0TB 4WI9A 5JPNA 4MXQD 1ZGLA 3S96B 3MRKA 3WIFA 5BVPL 1Q9LB 4M9OA 5LAXB 5A2KH 3UPRB 1MFAL 2CPCA 2YD7A 1B0GB 4PLJD 2R0WL 3PP3H 4WW2A 3AS1A 5T1KB 1XR9B 3QIBA 2I07B 3K2UL 3S3SA 3MRIB 5IEKA 1BQUA 4YWGL 3MC0A 2XA8L 3MRRB 4PY8I 1G7JA 4IRSA 5FA4A 3T77B 1ZT4A 3HLAA 4R0LB 3CMOL 1X6NA 1NSNL 1DBBH 2XRAH 3QFJB 1B9ZA 5DJAB 2AJXH 3OKLB 1R3JB 3ABZA 2VLRA 2EIZA 3D6GA 4KTEH 4S1RL 2P49B 3CUPA 1ZA6B 4OZFH 3W9EA 2MKWA 4NHUB 4JRYA 1N8ZB 3DWTA 2P42B 4C57C 3SGEI 5FHAH 1JV5B 4I77L 5F97E 5T33H 5F88A 1FGVL 3QNYB 3BEVA 2AERT 2IQAA 2W65B 3HMWL 1XGRA 4R9HA 1T7XA 4RRPA 2BX5A 1FFQA 4P5MB 2IADB 1P6AB 5IFHH 3F12A 4M8VA 3U4BH 4FZEL 2GY5A 5JPMB 1ZEAH 4JFPA 3RVWC 5L8KB 3PGFL 4DQOH 3BO8A 3I6LD 1J88A 2DB8A 4BM7A 1JYNA 3L7EA 4K3JH 4JM2C 1NAMB 2ZUSA 4FQIL 4BFBD 1KB9K 4MDJA 3LDBC 4OGXH 5HGDA 4LSUH 4WEMB 3OZ9L 4R4BA 3GFUA 5C0GA 3ECBB 2HN7B 5EUKA 4XVTL 1EAPB 5EOTA 4YQXH 5GS0C 5EWIL 4DKFL 1NPUA 3L5JA 4R8WL 4LOUD 3WHE0 2VZ3A 3F58L 1KTKE 2W38A 3IFLH 4M03A 4L4TE 2CDEA 4LEXH 1JNNH 2A0LC 3T2NH 5ESAB 3K80A 2WINB 4PRPD 2UZYB 3WIHL 4X99A 5T3XE 3H9SB 2C3VB 2ADJA 2AEQL 3BWAB 2ADIB 2N56A 3FB6B 1IKFL 4BQ8A 1PG7X 1AGEB 3E6FA 1WFOA 4X9GA 2ENSA 1MJUL 4Z0BH 3N06B 5B8CB 2XFXA 5GQBA 1EHLH 7CGTA 5DJXB 3ARRA 5C07E 2VL4A 4WFHD 2A6IA 4ZS7H 1YUHA 4G8GD 1FDLL 3ULVD 1JFQL 4HWNA 3ALPA 3B2VH 5FYLL 4M00A 3WCYA 1AGDA 2PYED 5JDSA 1T2QH 5CD3A 2OM5A 1DUYB 3CGTA 2VXQL 1KC5H 2OI9C 4Y4FA 4RDQG 4DN4H 3MLZH 3RPIA 1TZHB 1I1FA 3AB0B 2VLJE 4G7VH 1OSPH 3SJVE 4M1GH 4MXVF 4PJ9C 5E8PA 4Z76A 2ZCKL 3HUJF 2JCCF 5GGQL 4FHBD 1UYWH 4OSUH 3KWWA 5TDNB 1S78C 1CDJA 5FEBA 2C26A 3S5LB 3PHOB 3MXWH 1A14L 1UB6A 4PJ7F 4IRJD 1CFQA 1M6OA 4ODHH 2OL3A 1AJ7H 2AKRB 4G80A 2AEIT 5IB5B 3CSYA 1EAJA 1SJEA 3BZFB 3TWCH 3C5ZA 4HUUA 3UTPE 4LRNH 3D3VA 4HBCH 1CD0A 3U7YH 3K46A 2FJHB 5FUCE 4N8CH 5GJTL 3QNZA 4I2XB 3TFKC 4KDTC 3QDJB 4KI1A 4ZDHA 3EHBC 3RHWF 4AEIH 4PRHE 5HHOA 1KIUA 1U92B 3QHZH 1OB1A 4OLWH 5GJSH 2KUTA 4JG1L 2ED7A 5TQ0H 5EZJB 5FKPA 2EKSA 4IHOB 4R0LC 2ESVA 1EO8H 5I8KH 5BZDB 4XMPH 5GGSY 2Q76A 3JBG7 2Y07L 2ZG1A 4EDXB 3HI1B 4UT6L 4OJFH 1IGTB 2HFGL 1FHGA 5CZVH 3UJIH 3QRFM 1HEZB 2X4NA 3IXTB 15C8H 4PY7B 4R97B 3OAYK 1CD1A 1AO7E 1WZLA 2YEZA 1RJYB 4PJBF 3WFHA 1MAML 1S7XB 5DA4A 2I9LA 2V9TA 3GMQB 5MENE 1DZBA 3G6AA 1MREH 1EX0A 4XTRC 3UMTA 2EO9A 1HOCA 4BFGA 2R69H 3FRUA 1RZKC 3ARBA 1X7QA 2MNUA 4JGJA 1QR1B 1PLGL 1TVBB 3RIFK 4UMGA 2IMNA 4FRWA 3V7MA 2MMXA 1K4CA 1OAZL 2Z4QB 2NY4B 5JW5B 4WRLA 2A77H 3WFBL 5I71B 4NJ9H 4YHZH 3ULVH 3V6OE 3C08L 2H41A 3WO3B 1NBYA 4XNUL 1DN0B 4HK3J 2IAMA 2HVKA 1JUFB 3ZE2F 3ZKNC 4FXKB 4LSTH 2CGRL 2WIIB 3JV0A 4OM1H 3WBDA 1VPOL 1YC7A 5C6WH 3NTCH 1QSED 1UA6H 1INDH 1S7QA 5E1AA 5F7UA 2XNAA 3CPLB 1MVUB 3VD5A 5D1ZD 4I48A 4JRXB 3D0LA 5D2LB 4RDQF 5BS0E 1YPZB 3PIQB 1ZWIA 1AIFA 5C08E 5KSBE 1I75A 4ZODA 4I0PA 1A6WL 2D7NA 4GAGH 1G7MB 1Z5LB 1A9BB 4Z7UA 4RWYL 2BOBB 4UILL 4PJIA 3QQ4B 3RDTD 4F7PB 2DTML 4N1HB 5D1XA 4ISVB 3DVFA 3FKUS 2NXYD 1RHHA 4L9DA 5CEZH 1TETH 2X4UB 4LLUB 5M7QA 3WIHA 2FL5A 3G5XB 5EA0H 1Z2KA 3L1OH 5EO9A 5CFHA 4OZHE 5CKAA 1QRKA 1BOGA 4QHLA 3LEYH 5T3ZD 3KHOA 4XVUD 2DKUA 5JIKA 3ARED 1BFOA 3AB0C 4PJHA 2JCCA 1IGJB 4DJMA 1FORL 3TBSA 5CBAB 2V5SA 3FOLB 4NNPH 4PJ7A 1G0YR 3MRGA 4HKBA 1U6AH 1XCTA 4WI3A 3GMMB 4NDMB 3TBVB 3O2VH 1F2XK 4JDVB 2J88H 1RZKL 1AHWB 3IDMB 3VFSA 5HHQB 1I9IL 4NQDD 1CG9A 3EJZC 1CICD 4QT5A 1SJHB 2C3XA 3WNOA 5ISZA 3CZFA 4HUMB 4U6XB 2GIYA 4WDIA 3U83A 4NWTL 1MAKA 3B9VA 4OV6F 4FZ8H 4Z7QF 3KJ6H 4QRRE 2IF7A 1U8HB 5MP6H 1PZUB 1E4JA 5GRJL 2XWBA 1T5WB 3CH8A 4UTBH 4X98B 5DT1H 3F7PC 3DX9A 1A4KA 3F8UB 1UXWA 3P3YA 4MAYB 1MRDL 1I8LC 3GSWA 4IS6A 2HRLA 4GG6A 4JM2A 3P73A 1ZTXH 2YHGA 4PB9L 3FO9A 5IKCB 5E5RB 3KYOB 1KCRH 4MS8C 3VFVB 1JRHH 4NOFA 1K5NA 4EI6A 3W5MA 1N0XH 1A6ZA 1BJ1H 3SDDB 2Y7QB 4URTB 3FONA 3H42L 3GK8H 3CNKA 3X3GH 1MCWM 3LN5A 3FO1B 4R97C 1T04A 1A7PH 3JV6B 3G08A 5FECB 2NLJA 3O45A 1XEDA 2VLRE 3DURA 5JNYB 4Q9BA 2EYTA 4BQBA 1IQWL 2OK0L 3V0VA 4JRYE 1S9VB 3MRNB 1T0MA 1JMZA 1QRNE 4NQEA 2Y5TB 3SDYH 2NCMA 4U1LB 3VI4E 4XAKE 4S0SD 2BHUA 3QEQA 4DOHB 4YJZL 4HFUL 2R8SH 4GXUN 2VC2L 5D70L 2DWEB 3F7VB 3IJHB 3S36H 5I0ZA 3J7HA 3GMOB 1IM3A 3IDIB 4P46B 3U30B 3VRJA 3HZKB 5HPMA 3B5HA 1QNZH 1HDMA 2DN7A 3G5YA 2NY4C 3F7QA 1UFUA 4HIHB 4QKXB 3V7AG 5I71C 4DVRH 4H20H 4OCMC 5TPWH 5F1KC 2DWDB 1MIMH 3WS6A 5IF0B 1CS6A 5CMAB 1T21A 3QQ3A 4GSDH 1KBGH 2FX9L 4XBEH 3PHSA 3QXDA 4ZD3L 3RA7L 3V0WL 2JIXD 5JUEL 1QLRA 3QUXB 5T3ZH 4PJDE 5FYKE 5IESH 1N64H 1JHKH 3TA3B 3MGTA 4WEBL 5A16B 4FTVD 4NFBA 4K55A 2R0ZL 4RGNE 4QOKD 4PJ9A 1Y6MR 1NUNB 4GMSH 2CQVA 3FTGB 4NO2A 5DR5L 5DUPH 2F19L 3JWOC 2K9UA 2KL6A 1U8LA 4OFVA 4UQ2A 5BRZA 2VDLH 1IC4L 2D3VA 1FE8H 3RWDB 1G6RH 2QSVA 3QJHA 1IQDA 1FRGL 4P59L 1BIIA 5DJ0B 3UXFA 1JYXA 3MCKA 1T03L 3UYPA 2OQJB 5FYJE 4HLZH 3S96A 3L95B 2AABH 2BVOB 4OGAD 5FCSH 2DBJA 5LAXA 3UPRA 2MSPA 1B0GA 1XR9A 2JB5H 2IALB 2I07A 2E27H 3GJFH 5TF1H 4JFHD 3OPZL 4KDTA 3MRIA 3VFWB 4P2OB 2EO1A 5BV7B 3BWUC 2J3SA 1CGSH 3X13B 4MNGA 2BVEA 3V8OA 3CC5B 1A7OL 4WVRA 3T77A 4MB5A 1PKOA 3QFJA 3OKLA 1R3JA 3QNXB 1AHWC 5E7BA 4WTZG 3V95A 5CD5C 3GMLA 3THMH 5I1KL 5B4MD 4NHUA 1N8ZA 2R9HC 3OWEA 1JV5A 3QNYA 2DJ4A 1D5IL 2VDRH 5BW7C 2P44B 2O93L 5AG8A 5DZLA 4L8BB 3V4PH 1HWHB 2N4IA 1OCWL 4P5MA 2IADA 3MSPA 5JPMA 5ALBL 5J1AB 4LP4A 5J3HC 3GSXB 1LO4H 1GVIA 3BD5A 4JKWA 4KJWD 3SKUD 3PDGA 4ZOAA 5F96L 1OSZB 3D3VE 4MAYC 4BA8A 2NXZB 2L7JA 2OXGA 5C92A 4APQD 4KK8C 1CR9H 1ADQH 4XCFL 3DMMB 4LL9A 5E24E 4YPJA 5D7JD 3SDXF 4D9QD 3S4SB 2VWEC 3ECBA 3SDDC 2HN7A 5I1DA 5HHOE 4P5TD 1EAPA 3GHEH 3DYMA 5DJ6B 3ESUF 1FL6B 2R4SH 3KPSD 5E9DE 4HH9B 4O2CB 3QAZB 2ESVE 1MPAL 1BZ9B 4MA8H 4P2CG 4TPRL 4FABL 3HE6D 1P4IL 3UDWC 5D5MB 2FD6L 5ESAA 4W6YB 3RQ3A 1MUJB 2DKMA 2WINA 4Y8DC 1C5CH 2RCSL 4OM0H 4PJ5A 5F9JB 3H9SA 2C3VA 3BWAA 2HKHL 3FB6A 2XQYG 1WUNT 1AGEA 5DWUL 2G75B 5L6YL 3NABL 2VTFA 3LZFL 5B8CA 2DQDH 1MWAH 4DW2H 5DJXA 3U1SH 4P46C 3E1F1 4JN1L 4LFHD 1R24A 3KLAB 5FM5O 1LE5B 5D2LF 1YPZF 2VKXA 2VISB 5I15L 6FABH 2P5WD 3JWDC 4U33A 1IAII 5I30L 5HYIA 3D5OF 4PRNA 1K2DA 3T4YB 1KFAH 2X9YA 3SDCD 2UWEB 2BMKA 3LVEA 4ONOA 1VEPA 5BMFL 4LGRB 3QUXC 4OCRH 4ZSOE 2HTLC 5I8OL 3QUZA 4CVZB 2X1PA 1QVOB 2APTA 1JZ7A 1KEGL 1F8TL 5EBLB 1XGYH 1YEIL 3U2SB 3MO1A 3TIEA 2FR4B 1TZHA 2IG2L 4K3EH 5FGSA 3UJJL 2DDQH 2IH3B 3IETB 5HSFA 5J6GB 5BO1H 1IC5L 1QYGH 2FBJL 4CN4A 2V2TB 1YEKL 2E7LA 5TDNA 1M71A 4JCLA 3RVTC 1RMFH 3S5LA 1I7UB 4XC3H 1WGOA 4HUKB 1ZSDB 3ZKMD 4OGYL 1BZ7A 4I3SH 3OR7B 4HH8A 4JANB 4BZ2H 5IIEB 4HGMA 1TTFA 5D8JH 2AKRA 5IB5A 2A2QT 3A6BL 3BZFA 1TTUA 1B4RA 1ND0A 4LSPH 2FSEB 4HWZB 1FCGA 2QADB 2WANA 4XT1C 1PSKH 2FJHA 4JHBA 4Z7UE 2VLKE 4LBEB 1AC6A 4PJIE 1TCRB 5ADPH 2OTPA 1GL4B 1NLBL 1E4XL 4WUUD 1MF2L 2CH8A 5MERA 4I2XA 2VH5H 2WMPA 3QDJA 4JFFB 4OKVB 4P2OC 4PB0H 4S1DD 2NZ9C 5BV7C 4QXGH 4KKNA 4HUVA 2J6EL 1U92A 3EFFB 4U3CA 1BVLB 1YQ2A 1BGXH 4U6TA 4D9LL 3QP3A 1I8LA 3NZ8B 5EZJA 1FL3B 3WS3A 3Q5YA 1EXUB 4N0UA 1NCAH 4MXVE 1F4AA 1X5ZA 5HDOA 5E2VL 2EDDA 4PJHE 2JCCE 3AS3A 4IMLB 3DV6B 2OZ4H 1QQDA 3ZTJG 1F58H 4EDXA 3HI1A 3DLQR 2IBZX 1IGTA 4PJ7E 1Z3GH 4QGTA 3QZWG 1HEZA 3H7BB 4JDZA 3IXTA 5HDQL 1FJ1A 4OLZH 4BZ1H 1IGIH 2BY3A 3FQRB 1CGYA 5GS2D 1S5IH 3U0WH 1RJYA 3FQNB 4Z78A 5GGSB 1INQB 5ISZE 3QG7L 3ULUL 5FYLE 1A0QL 1JPSH 4Q0XH 1RIHH 5F8QC 2DQTL 4O9HL 2NXZC 4X9FA 3CAFA 2YA0A 2IJ0C 1DBKH 5TQ2H 1YEGH 1G9NH 2BNUB 1H3UA 3B3IB 1QR1A 3OKNA 1TVBA 4PBVC 1YYLH 4G8IA 4MQ7B 4GQ9L 1G7IB 3CFIC 2FATH 4RCAA 4PJEF 5JW5A 3QAZC 4J7RA 1RZJC 2B20A 5IHUH 4X80L 1WBYB 4POUB 2PTTB 1DN0A 3SY0A 5EOQH 1JUFA 4FXKA 3G6JA 2WIIA 4PJBE 2XKUA 2PCPB 1JL8A 3MLUH 3GKWL 4Z8FL 5EFIB 1KPVA 2GJZB 1LEGB 2LQRA 4I3RH 5ACZB 1EZVX 3CPLA 3TJHD 4G7YL 1MVUA 4LASL 3DRTB 3MOBL 4JRXA 5D2LA 5BV7L 1YPZA 3PIQA 5HHNA 3N9GL 3TH3T 4R4FH 2PKDA 3FMGH 3IS1X 3O6FD 1G7MA 1Z5LA 3GZKA 3ZYOA 1A7NH 2ZPKH 2BOBA 3QEQE 4GFTB 3STZB 3QQ4A 3T0VA 5JDJA 3WNNA 4ISVA 4Y4HD 4OF7A 2CUHA 2X4UA 2YUVA 4LLUA 4F3FB 5KAQF 3G5XA 3CXHK 4OD2B 3QWRD 4L4VB 3KDMB 5GGVH 1KTLB 1N5AB 1JMXA 3ZE2E 1RUPL 4J4PC 5J4MA 2GFBA 3EZ8A 1NDMA 2BDNH 1F4YL 4TSBH 4MNQD 5KN5B 1KT2B 3L5IA 1W72H 5L2KA 1IGJA 4ONFL 4YLQT 5CBAA 3EDJA 2FYYB 5GRUL 1NEUA 3L3OA 4FFZL 4GXVH 2AXHA 4NDMA 4OB5H 3UTSA 3R1GL 3TBVA 2X7LB 1LQSR 4XB7A 5F6HJ 4P9MH 4JDVA 4OZFB 3HNTH 1FGNH 1L9MA 1AHWA 4WU7B 3IDMA 2GKIA 1MSPA 5HHQA 2OP4L 5DQ9B 3BFOA 5LXGL 1SJHA 4TSCH 1JBJA 1A3RH 1N7ML 4HDIB 4PLKD 5MI0C 3RKDD 4XVJH 3WFZA 2EEDA 2QADC 5GS2H 5FGCB 5D1QD 5BRZE 5KVEH 3GBNH 3OR6B 1NFIB 1Q9KB 5GRYA 3C6LB 5E94A 1YEEH 3K0WA 1IM9D 1T5WA 2WLYA 4QNPF 4X98A 3PV6B 3U4EB 4K94C 2QQLH 4MAYA 2WWMD 4NKMB 1QBLL 3GO1L 4ONHA 1CGWA 1DE4B 3ZHKA 5IKCA 3NCEB 3IDXH 2YRPA 4RMRA 3BDBA 1ES0B 3GEWB 3KYOA 1JYVA 3VFVA 2Y5EA 1GGBL 1XGUB 1MI5B 1UWEL 5D93B 1A2YB 3IYLW 1HYSC 2BJML 3QDMA 4WI4A 4HPYH 4MNGE 4R26L 3NVQA 3FO1A 2YUZA 4MD4B 1ACZA 3MJ7A 3QFJE 1LK3L 3MZTA 4AG4L 5FECA 2XA3A 3T0WA 3BRFA 4X7SH 4D0DB 2EIBA 5JNYA 1NJ9B 3UDWA 5MEOB 1HNGA 4XNXL 1WT5C 3MRNA 4Z7QE 2Y5TA 4WI7A 1FYTB 3HRZA 1K8DB 4Q9RL 5D5MF 2VN4A 2CDGB 1KLGB 2J6EA 4U1LA 2X40A 4QHMB 1MQ8A 2BNRB 1P6FA 1MH5B 2Y06H 5HYQB 4N9OB 3UROR 2DWEA 4MJIB 3F7VA 4XGZB 1C12B 3NZHL 3GMOA 3IDIA 4P46A 5EC1B 1HCVA 3HZKA 4NM4L 5F7KC 2ED9A 3RHWK 5DMYA 4JO2L 1IAMA 5DD0H 4XX1G 2DWDA 1J18A 3U6RA 5C0BD 5CMAA 2DD8H 2JELH 1H15A 2LU4A 4J8RB 5T1DL 2XI9A 4JGUA 1K3IA 1Q9OB 2L4OA 1DN2A 2AK1H 1KACB 5EULV 3H3KA 5JMOC 5JLZB 2CLZB 1PZ5B 3LSOA 1DQMH 3TA3A 2UWEF 4L9LB 5A16A 1BM3H 1DFBL 4MSWB 1HI6B 3TT1H 4X4MA 3MBXL 2F53D 1VACA 5IMMB 4OF6A 2X10A 3H9SE 4R7NA 5HDLA 1DBJL 4F9PC 3FTGA 4AEFA 4NZJA 4EJ1C 4Y88A 3DHJA 2P5ED 3EYFA 3RWDA 1KGCD 3C2AH 4GO6B 1PEWA 1JTPA 4YBQD 1T1WB 5C0NC 1AXTH 1MCOL 5CJBA 3CD4A 2BVOA 3L3KB 3EYSL 3P0YH 3WNLA 3LIZH 1NEZB 4UV4H 2VLME 5CWSA 3O41B 4DGYL 2IALA 1M1SA 5A3ID 2AJ3B 4RQQB 5L8LB 1JJUA 2CMRH 5DSCB 3VFWA 2IAND 4NO0A 3HI5H 2Q6WB 4B50A 2XXCB 3IXAB 3HNSL 3PL6D 3CC5A 3QHTC 1ONQB 4HF5L 4FS0A 4Q58C 4JDTH 4I9WE 5E6YA 1J05B 1NFDB 3QNXA 2COQA 4JO1H 4Y5VB 5J7CC 3NCJL 1A6UL 1U8IB 2HTKC 1TJGH 4TSAH 4EIGB 4YX2L 1U93B 2H26A 3B6SB 2ZSVB 2PXYD 1QBMH 3CX2A 4PRPB 4KZEH 1OTUC 4LMQI 4A6YH 4H8WH 2AEPH 2P1YA 3C6LC 5J1AA 3GSXA 5E6IA 5IGXH 1BBDL 4JB9H 1OSZA 3LKPB 1T5XB 3MROB 5J12B 3MLVH 5C0RH 3DMMA 1CFNB 1IBGH 2EDRA 5E03A 1J1XH 5IJVB 4I2XE 1Q94B 3QDJE 3BQUA 4U2ZA 3S4SA 3LQAC 2XICA 3QIUD 1FVEB 1NCNA 4G8GB 1KB9J 5DJ6A 4Y4KC 1MRCL 3GHBL 5GHWL 4HH9A 4NRZB 1J1OL 3BKCH 4O2CA 4XHQA 1H8SA 4XWOD 1OPGL 5JA8B 1BZ9A 4N0UE 5KTEH 3W9DA 1OWRM 1KPRB 5D5MA 4CNIB 5JXEC 3PHQA 4MQXC 3HKFA 1NMBH 1I3RA 1CBVH 4YUEH 5F9JA 1UH4A 3GBLA 4HWEH 3HTLX 1OW0C 3FZUD 1QSVA 3MODH 1ZHNA 5I9QC 1G9MH 4OI7A 2KZ1B 5JORB 4LAQH 3TVMD 1UWXH 1VESA 4U6VH 3QFDB 3QUMH 3T1WA 1DBBL 2AJXL 3OKMB 5ENWB 2VB5A 4X8JA 4KTEL 3KLAA 4KK9D 1LE5A 2ARJQ 2YWYA 5B3NA 4XI5D 2JJVA 4MXQC 5FHAL 5T33L 1OD7A 3T4YA 4J6RH 2X6MA 3FT2B 4PLJC 2UWEA 4KFZC 5IB4A 5IFHL 4QRPD 1JWUA 3U4BL 4B7LA 4CVZA 1QVOA 4J4PA 1ZEAL 3O2WH 4FQXD 5EBLA 4DQOL 2R1XB 4L9LC 3U2SA 2FR4A 2B2XH 1XGTB 4JR9H 5DK2B 4NQSB 1B0RB 2ZUYA 2IH3A 3MRMB 4K3JL 3G6JE 4OBSA 4ORZC 1HHKB 2YPKB 4PG2A 4OGXL 4LSUL 1PGRB 5DJZB 1I7UA 1ZSDA 4CMMB 5FOBB 4U7MA 2KKQA 3OR7A 4JANA 5IIEA 3T3MF 5DHYB 3T4AA 4U1IB 4JRXE 5D2LE 1OQXA 1YPZE 4YQXL 3LEVH 5L2JA 3KG5A 4GKZB 5C7XH 2EC8A 1MY5A 3IFLL 1U8KB 1T83C 3UBXA 1U36A 5GPRA 3BKYH 2R0LH 5HDBF 2IFFH 4LEXL 1JNNL 2HFFB 3T2NL 3HPLA 4FA8A 5F93C 1DVFD 1S7VB 1TCRA 4QY8B 3BUYB 4OZ4B 1NEZG 5I2IB 5DFTA 1LGVA 4C56D 1P9MC 4KQ4H 4OKVA 2GJ6B 4XAWH 3EFFA 4Z0BL 5EPMB 4KK5D 5JHDD 2NYYD 4X5XA 3QO0B 2A1WH 5C70A 1BF2A 3M17A 3UTOA 1EHLL 1F3RB 2XT1B 2EDXA 1FPTH 3VXOB 4Y5VC 3C60A 1VERA 3MGOA 1EBAA 4IMLA 1PKQA 3DV6A 3VG0H 5L2KE 1RIVL 2V5TA 4ZS6D 4UT7H 3IJSB 3LH2H 4ZS7L 1G9EA 3H7BA 4LLAA 5GSVB 3OQ3B 2HP4A 1D6VH 2C9AA 3B2VL 3FQRA 2R1WB 4PR5B 4LEOB 3FQNA 1T6VN 2WWKO 3QJFB 3FHAA 4DFHA 1T2QL 1KCUH 1INQA 3WFCH 3MQIA 1KC5L 1HSBA 4KTDH 1WAAF 3MYZA 1N5YH 1QSEB 4DN4L 2QLVB 3MLZL 5J12C 1AGFB 2YWZA 4G7VL 4P2YA 4TUOB 1OSPL 3TPUB 3MLTB 32C2B 5D1ZB 1S3KL 2BNUA 4LSVH 4M1GL 4FQ1H 1RPQA 4MLSA 3IAPA 4HG4J 1TVHA 2YPLA 3GMNB 5KSAD 4Q9QH 3UTTB 3B3IA 1UYWL 4OSUL 4Y2DC 2BHZA 2K3TA 4MQ7A 3QXUA 3MXWL 3VFOB 1A7RL 1AKJD 3IRZA 3RDTB 4HGWB 1G7IA 4HBQA 3U9UB 5F7NC 4ODHL 1EO7A 3D69B 4YHIB 5C09D 4MLIA 1AJ7L 2NXYB 3UX9B 3OBAA 2NTFA 2IH1B 5IBTH 1WBYA 3TWCL 3ZHDA 4LRNL 2PTTA 4HBCL 3U7YL 2VWEE 3VG9B 5D9SB 3ZT7A 3FT4B 2YN3A 5CZXD 3SO5A 3QDME 2PCPA 4N8CL 4R2GB 5J8OA 3AREB 2ATKB 5EFIA 2GJZA 4NP4H 5KANI 3EO1A 3GM8A 4AEIL 5ACZA 3QHZL 4OLWL 5GJSL 5TQ0L 4YH6A 4OZGB 1EO8L 5I8KL 5E95B 4XMPL 3DUUA 3M07A 3TNMB 4F9PA 4K9EH 5I16B 1J0IA 1ZT7A 4X9HA 1BD2B 1E6OH 1CICB 1G6RB 2I5YH 3VGBA 3UJIL 5CZVL 5E4EB 3RWJB 15C8L 5HVHB 1IAOB 1XZ0B 1A47A 1JZ5A 1XAUA 2WBJD 4OD2A 5KVGH 4C4KT 1I1CA 3MRBB 1KTLA 1N5AA 4RMUA 4H0HB 4OLVH 4P23D 3GJFB 4DUVA 5KN5A 3MRDB 3OL2A 3D18B 3VA6A 1TNMA 1MREL 3SKNB 2B8OT 1P84K 4HULB 1I85C 2G2RA 4YDKH 1T7WA 3OGCB 2R69L 1C08B 2X7LA 3EYVB 3G6DH 3MOAH 5DS8B 4OZFA 2A83B 1FIEA 4MWFB 5DQ9A 4YDLB 1CWVA 4B7IA 2DBLH 2A77L 1NFDF 4NJ9L 4YHZL 4HDIA 2DLIA 4LU5H 3ULVL 5D71H 4S1QL 3SGDI 2AXGB 2UUDK 2CRMA 3KYNB 2PYFA 2Z8WC 4RMWA 4LSTL 3OR6A 1Q9KA 1L7IH 3DVNB 4RBPH 4CGTA 5HGGS 3C6LA 4OM1L 4ZUUB 3RIAF 4TUJB 3NTCL 1LP9A 3ALXA 3PV6A 3U4EA 3P9LB 2CLVB 1UA6L 1INDL 2ZUUA 1V3MA 4NKMA 1UZ6E 3IJYB 3QHFH 3JV4A 5C6PB 1DE4A 1DL7H 3VGAB 3GUTB 3UAJD 1ES0A 1E6JH 1F6AB 1DQLH 3SOBH 1U41A 3I6KB 1MI5A 4GAGL 4PTUB 1A2YA 4D0CB 2CDFB 3TH4T 1UWGH 5BOZG 3LRHA 1OLLA 4MD4A 2CJUH 4M7LH 4PD4K 1N4XL 1TETL 3SQBA 1NJ9A 5MEOA 2JIXB 5JXEA 4OLUH 2WLZA 5EA0L 2F8XC 3L1OL 2W92A 1RURH 4MJ2A 2EC9T 3LEYL 1FYTA 1K8DA 1AGCB 1ZA3B 1JF1B 5GRWA 1INEH 2FBOJ 4FTVB 1OW0A 3KHQA 2BNRA 4G6JH 4EEEA 4QNPE 5LJYH 3LQZB 2DQFB 3QXVA 5D1ZC 1G6VK 1CDUA 4UOW0 1MWAB 5HJ3B 1MH5A 4NNPL 5HYQA 1FG2B 1U6AL 3MLWH 3B4NA 5GRZA 2W59A 2HG5B 4MJIA 4XGZA 1C12A 3O2VL 1CDGA 4CBPA 1FYHB 5EC1A 2J88L 3MV7B 3RDTC 1M4KA 1T3FB 5I6XB 1JI2A 2APXA 4K7FB 3B9KA 2NXYC 4UU9B 5DZOA 2DJSA 1SYVB 3BZEB 2EZ0D 3HCVB 2XWTA 3VG9C 1KCKA 4J8RA 1E27B 5AG9A 1Q9OA 4CVWA 2FB4L 4XVUC 4FZ8L 1FZOB 4NT6B 4R2GC 1U95B 3AREC 3KJ6L 2CLZA 5MP6L 4HKXB 4LCCA 3CFEA 3EDEA 2YS4A 5JOPE 4UTBL 4E9LA 3LPWA 2AJYL 4L9LA 1EA9C 5D5ME 4MSWA 1HI6A 4U1NB 1LD9A 1N59B 2Q86A 3Q6GH 3VDAA 1CLZH 5IMMA 3QDAA 4LPTA 1J8KA 1YEDB 4XXCC 5D7KD 5LCVH 2ZJSH 3CFDB 1KCRL 1KCVH 1CICC 1JRHL 1N0XL 3NCYP 1SVCP 3GK8L 5E4EC 3X3GL 1E4KC 3FN3A 1R3IH 2FH6A 1J8HD 5HVHC 3MNVB 1A7PL 4N90E 2JKXA 1T1WA 4AEHH 2XQYK 2CLRB 1Z9MA 1T83A 3L3KA 3TYFA 4QCIA 5HI3D 5F7LB 3B8YA 1CXIA 1NEZA 1EHXA 2AJ3A 3SDYL 5F7HA 5DSCA 4APQB 5AWNH 3INUH 5INCB 2UWEE 4WFED 3IXAA 2R8SL 4P0DA 5D7JB 2APWA 1ONQA 4Q6IB 1LO3H 2X4OA 1F4XH 2FIKB 2A38A 1OQOA 3S36L 1NFDA 4EOWH 4YO0B 4G9FD 4Y5VA 5C0AD 1AGBB 4YDLC 4P5TB 3O3DB 4N8VG 1U8IA 3KPSB 1F5WA 1Q1JH 4NHCH 4DVRL 4XMKH 2OXHA 4H20L 5TPWL 5JTWA 4JFED 3HE6B 3MJ6A 1MIML 3RGVD 3B6SA 2MQ0A 2ZSVA 1BJ8A 3C87A 4GSDL 1KBGL 1X5YA 3AS2A 4XBEL 4WIQA 4BSWB 2M8XA 2QQQA 4DKDC 1CVRA 1KN2H 2LFGA 3BH9B 4QO1A 3BGAA 5T3ZL 1AQDB 4PJXB 5IESL 1N64L 1OP5H 1JHKL 3N1MC 1T5XA 3MROA 4TQEH 3KYMB 3QQ9D 3VGAC 4YEEA 2X2YA 1CFNA 35C8H 3CVHH 5I8CB 4TTDD 5IJVA 4N0FA 3QWOB 4GMSL 4JFFE 5F1NB 5E56A 5DUPL 3VXRD 1YJDC 3M8OH 4HMCA 4N5ED 1VADB 4Z9KB 4G8GA 5I1EH 2MQCA 2VDLL 4NRZA 1FE8L 4AT6A 2XTJE 1BQHA 1G6RL 3RNKA 2P5WB 3ME0A 1GSMA 4RMSA 5LGJB 3LRGA 3SDCB 3MJGX 2PYEA 5JIPA 1PKQE 1JVKA 2CR3A 4KGJA 2AABL 4CNIA 5TFSH 1FNFA 3MUGB 4NC1C 5MHSE 3LEXB 1DJSA 4FN0A 1MHHB 2NY3D 1MCLA 2JB5L 1NGPH 2E27L 5TF1L 4N68A 1CIUA 5B3JF 3KS0J 1HH9A 3ARXA 3BSZH 5JORA 1CGSL 4LIQH 1QA9B 1MFEH 5E08H 1LO5A 2VZTA 3QFDA 1JTTA 5JXAH 5I6XC 3OKMA 4IRJA 2QQNH 1KLUB 2Q7YB 3P4NB 3FFDB 3THML 3W2DH 4DVBB 1SM3H 4OZGF 1DQDH 4BUGA 4F7MA 1NCCH 1MFNA 3EBAA 4Q9CA 1RUAH 2HFEA 2VDRL 3FFCD 2J4WH 1EVTC 3QISA 1B0WA 4OGAC 1T2JA 3FT2A 3V4PL 1UB5B 5DQDH 4WUUB 1N0LA 4ZAKD 3SCMD 4BZYA 4D0BB 1LO4L 1H0DB 8FABB 1M05A 4KDVA 5EG6C 1XGTA 4LLMB 5DK2A 4NQSA 5TE7H 1B0RA 5FDYA 2A73B 2LVEA 1CR9L 1I85A 1SMOA 2OBGA 3G5ZA 1ADQL 1HHKA 3EOYG 2YPKA 3MBEA 4U7KA 4NQED 4K7PX 1SHMA 5DJ8A 3WO4B 3VH8B 4BFIB 4CMMA 4YPGB 5FOBA 3BP6A 4EI5B 2MTPA 3KAAA 4U1IA 1YJDL 2VL5B 3D39D 4MA8L 4JY4B 1BOYA 2D7PA 1U8KA 5DEZA 2HFFA 1NQBA 4XHJD 3I75B 2P8LB 5LGKA 3ARVA 2NY6B 1C5CL 3RPKA 2RB8A 3BUYA 4OZ4A 4KJWC 4QY8A 3VRLF 4OM0L 1VKXA 4XCYB 3ZYZA 4APQC 4HKJB 1GOGA 4K3DH 3QO0A 5C0FA 5D7JC 3C8HA 4Q6IC 2BVYA 2DQDL 1MWAL 4DW2L 1MFBH 3U1SL 3KPRD 4FP8H 3QR2A 4P5TC 1OOAA 5H37G 3K8MA 4WW1B 5BZWB 2B1HH 3VU2A 4GUPB 3HE6C 5GSVA 1L9NA 2BNQA 3NCBB 6FABL 1DANU 3AU1B 3DV4B 2R1WA 4OAWB 1HHGB 4DK6A 4EXKA 1CFSA 1KFAL 4KKLD 4LEOA 4PR5A 1ACYH 3BD3A 5F9OH 4G6KH 1IC7H 1S7RB 4OCRL 3ROLB 3K1DA 5EDXA 3ZDXF 3L6FB 1QSEA 3OKYA 2X89D 1XGYL 2B5IB 3IDGB 4G6MH 3MYJB 1AGFA 4D3CH 3Q1SL 4TUOA 5FGCE 3L3IB 3TPUA 3P4MA 4K3EL 5HI5D 3MV11 2DDQL 5J1TC 5D1ZA 3SGKC 1RUMH 1U3JA 1QYGL 3O6FB 1QOKA 5AZ2H 3I3DA 4IJ3B 1RMFL 4F7CB 3T2QA 4XC3L 3GSUB 3VFOA 2X41A 5JQHC 2VOTA 3RDTA 4HGWA 4P9HH 4I3SL 4BZ2L 4JO4H 4YHIA 2KZWA 5D8JL 4Y4HB 5LVEA 1WIOA 2IH1A 3SDCC 3HB3D 5F89A 4H1LH 4LSPL 1MI5E 5ESQB 3D87B 5D9SA 1PSKL 3FT4A 2CIIB 5DYOB 1KYOJ 5ADPL 1FNGB 3AREA 4MNQB 2ATKA 2VH5L 1Q9WA 2UYLB 3KPLB 1WAAE 2WBKA 4UV7H 2FJGA 4PB0L 5C9JA 1ITBB 4QXGL 4MXWH 3S97C 4AQOA 1BGXL 2Y1VA 2YD2A 4X6BB 1QSFD 1VFOA 1WWWX 4OZGA 1KIPB 3WNKA 5SX4H 1FYTE 4XZUA 1NCAL 1E4WH 2LAAA 2MPAH 1OP3H 4XXCA 5I16A 2BNRE 4NQDA 2OZ4L 1G6RA 1CICA 2R2EB 4WI8A 1F58L 1ODAA 1K4DB 1Z3GL 4UDTB 2M1KA 3RWJA 4MJIE 4OLZL 2KPNA 5JW4N 5C71A 4KROD 1IGIL 3ZL4H 1XZ0A 3H6JA 1S5IL 5D1QB 3U0WL 3HA0A 2DF3A 4H0IA 2IBBA 5IUSA 4FQCH 4KJPD 4MAUH 3MRBA 2QTEA 5KW9H 1IM9B 3GJFA 1JPSL 4GAFB 4S1DC 5E7FA 3T3PF 1EJ6A 4Q0XL 1RIHL 3D18A 3ZMRA 3U7WH 5E2JA 3SKNA 4P4RB 3TNNB 4KVNH 1WIUA 4WY7L 3TN0D 2IBZY 1DBKL 5TQ2L 5DVMA 1YEGL 2Y6SD 3O4OB 1C08A 4PJ5D 5IEHA 3CSBA 5DRWB 1IFHL 3WO4C 3VH8G 1YYLL 3R0MA 4OCXH 4EI5C 2FEDD 4MWFA 1LEIB 1NANH 4JKMA 2FATL 3NIFE 4TNVF 3CU1A 3RBSA 5E70A 3WMSA 4XP4H 1UJ3B 1AD9B 5TJWK 2ED8A 5IHUL 3RGHA 1FFRA 4J1UA 2AXGA 3DOSA 4A6YB 6CGTA 5EOQL 3KYNA 2NY6C 1TCMA 3VE0B 3DVNA 2DIJA 4C83B 1OTTC 3B9EA 3W81A 3MLUL 4WI6A 3UZEA 3MLRH 2QBWA 3RI5F 1JPTH 3P9LA 2CLVA 4I3RL 1ADQA 3BW9B 5IMLB 2D0FA 5C0CD 3U36B 4LLYB 1MCPH 4PJXF 4WCYH 1E28A 3VD3A 2L0DA 4LPCA 4ACPA 3I6LE 2I26N 4R4FL 3FMGL 3I6KA 2CRZA 3N85H 4U31A 3DX7A 4PTUA 3O9WD 1IKNA 4JHAH 4QLRA 1A7NL 2ZPKL 2CDFA 4QHUB 1FNHA 1K3ZA 3P9MB 1T66D 5C0BB 5B38B 5KS9B 1VFUA 1NFDE 1NGZB 1OF2B 1ZHLB 1CFVH 1RJZA 2JIXA 5H94A 1YNLH 3V52H 1RV6X 5GGVL 5JW4R 1AGCA 1ZA3A 2B5IC 2BDNL 3TBTA 2DQIL 4BQCA 4TSBL 3KLHD 4FTVA 2BSED 3TJHC 1W72L 3LQZA 2DQFA 5TGBB 4PRPE 1MWAA 2BRQA 1RZ8B 2AK4D 4QOKA 4GXVL 1FG2A 4MB4A 4JZOB 4OIIH 3O6FC 2VR5A 4OB5L 4Z7VA 4FFYL 4IJ3C 2CUIA 1Z9LA 4P9ML 4YC2B 3QRGH 3HNTL 5HHMD 1FGNL 2P5EB 3RWFB 2Z91B 2AJUH 5IBUB 1J5OH 4Y4HC 2ZSWB 4NBYB 1MCJA 1A3RL 3EYQD 1SYVA 3BZEA 3WV0A 4WFHE 4I0KA 4XVJL 4LDOB 1EGJH 4JFZH 3SBWA 1HNFA 4G8GE 3MLXH 5KVEL 3ZE0E 1FZOA 3ULVE 4NT6A 3GBNL 1AI1H 1U95A 2VZSA 3P4OB 2BSSA 1YEEL 2Z31B 4X7TB 1RK1B 3DSNA 5CHNB 2IANB 3MJ8B 1S9WB 2AGJH 3CSGA 5F3HB 4U1NA 2QQLL 2C3GA 1N59A 3R4DA 3PL6B 3IDXL 3VGFA 1YEDA 3LN4B 1UCBH 4OZIB 1UQSA 3CFDA 4TNWF 3KPOB 4X83A 2AV1B 4U1JB 4YNYB 4HUXB 1EEYB 5I75B 4PLKC 5F8RC 4HPYL 3RKDC 5DTFB 4Y8AA 5BCAA 2ZUWA 3HAEB 5C0EA 2V5MA 3BXNB 2CLRA 5D1QC 2PXYB 4CVXB 3D1MC 3O8XD 1T1XB 3I9GH 4X7SL 1EIBA 1U3YA 4U6HB 3WJLA 1KCLA 1MLCB 3KPNB 4P5KA 4GAYB 4O02H 1BEYH 3IDUA 1UXSB 3QH3B 2GSGB 4APQA 2VDPH 4MVBC 4HS3B 2Y06L 3GKZA 1VDGA 3MV9D 5D7JA 4Q6IA 4HZLB 1JZ8A 5D6DC 2FIKA 1ZVSB 2OZ4A 3B8SA 4MA3A 4K23H 2W0FB 3QIUB 1CD8A 2D2OA 3P11H 2QR0B 4P5TA 3O3DA 2GITA 3KPSA 2PO6D 1EHAA 1XF5B 1KELH 4NQCB 3D9AH 1N26A 5DD0L 3JUYA 3OX8B 1NKOA 4F7EA 4GRWB 1AO7B 4H8WC 4Q2ZB 1GZPB 4ZYKB 1OY3B 2DD8L 2JELL 1M7DA 4BSWA 2H2PC 2KDGA 2AK1L 2OSLB 4AZ8A 4BJLA 1KIQB 5EU3A 2R1YA 1AQDA 4KI5C 1EV2E 4PJXA 4GBXD 3B9AA 1DQML 4JZJB 3MNWB 1KJMA 1QLEH 4YHMH 1BM3L 4RAVB 3TT1L 3KYMA 5K9KB 3TVMB 4GXUM 1HILB 3SGKA 4PGCB 2HT2D 5I8CA 3QWOA 4M1CD 1W8OA 4TVPD 2H6PA 5EZOH 5F1NA 2H45A 2D9CA 1S7WB 4UTAH 1OAXH 4XP9L 1V7NH 1S9YB 1VADA 2VLJD 1GIGH 5F6HI 1J0ZA 3MGAA 2WSKA 3C2AL 3K3QA 4MDIA 5LGJA 3UTSD 4K8RH 4FFVD 1JYWA 4HS8H 4NCDA 3SDCA 3BGFB 1AXTL 3T0ED 2QKIB 1JK8B 3OAYH 4PJAA 3MUGA 3P0YL 3VD7A 5F1OB 1DQQB 1JPFA 4QRPB 1G7PA 3LEXA 4YHLH 5I1CL 1BX2B 3N50A 1IGYB 2YK1H 3H3BC 4WU5A 1U8NB 1MHHA 1H9VA 4FQXB 3LIZL 2UZIH 4UV4L 4PV8B 4GW1B 1G9MC 2DKSA 2HLFD 1SBBA 2CMRL 1CQKA 4JVUA 4DN3H 1KENH 3QPQD 4OF5A 3HI5L 2G9HB 3BGMB 5DRZB 4IEFB 1OAKH 1QA9A 3CU7A 3P77B 3BP7B 4AQ1B 1TPXB 5B39G 4JDTL 3BX7C 2C1PB 1QSEE 4YC2C 3RIAK 1NC4D 3O2DH 4XRCB 4JO1L 2Q7YA 3P4NA 3Q3GB 5IBUG 3WDJA 1TJGL 3WLBB 1PJ9A 4ESKA 1J12A 1FFPB 2XZCL 4JJHA 4TSAL 4OFKA 5HHPB 4CU6A 5F7YC 3IT8D 4JAMB 3NFPA 2XWJA 5DO2C 1DVFB 5TF0A 1V05A 4I3GA 1QBML 1UB5A 4KZEL 4WUUA 4A6YL 5A3IC 4RFNB 4H8WL 5F3BB 5IK3B 2Z31C 3FOMB 1W72A 1BWWA 4XPBH 4C56B 2ADGA 4QWWD 4D0BA 5M94B 1OD9A 4JB9L 3NH7H 3ILQC 1GPOL 2Y25A 1XF3A 4LLMA 5JHDB 3JTTB 2W60A 5BQ7B 2A73A 3PL6C 1BFVH 9CGTA 3MLVL 1CL7I 4F7TB 4JLRB 1FZJA 5C0RL 5T3ZE 1SEBA 4L29A 2H8PB 1IBGL 3IFOA 5T3XH 1AR1D 2VDKH 5MEND 5DD6A 3VH8A 4BFIA 3VA2C 4YPGA 4XCEB 5I75C 2ENYA 4HUWB 2BFVH 2VL5A 3O4LA 4OZGE 3VRIA 1CLOH 4Y5XA 4G42B 5SX4I 3HAEG 3H7LA 5GRVK 5KTEL 1FO0B 4JY4A 2PXYC 3HFMH 5DHVH 4NSKA 4OV5A 3QDHA 2CIKB 4NQDE 4MZ3A 3VXUD 5CJXA 2GTZA 3I75A 2P8LA 1Z0NA 4QRRB 1NMBL 4XNZC 4YUEL 2YSSA 5JPNB 4HWEL 4XCYA 5EO1A 3VD4A 1X5HA 4ZMAT 3X14B 3MRKB 2CXKA 4HKJA 1MAJA 1CXLA 3ZZ1A 3MODL 4WHCA 1QFWM 1G9ML 4ODSH 1G7QA 4KUZH 5KSAB 4WW2B 3ZYJA 1WK0A 4R90H 4LAQL 4JJ5A 1F3JA 1C7SA 4KI5F 3BPLC 4HKZB 1J7VR 3QIUC 3L3HA 4TVPH 1KSRA 5CKGA 2P48B 4KV5F 4WW1A 3QQNA 3ARWA 4XWOC 5C09B 3NPSB 5BZWA 5FA4B 4NIKB 2WP3T 4GUPA 1RZIB 2DAVA 4RAUB 1RQ5A 3MUZ1 4UNUA 3KLDA 1L0YA 3AU1A 3DV4A 1KTRL 1WTLA 4OAWA 1HHGA 3T0AA 3BRGC 2W0KA 4J6RL 1A1MA 1NANI 2IMMA 3UEZA 1QBBA 4K2UH 2YUXA 5KS9F 2BRRL 5HGHB 1JPGA 1BJ1J 5F88B 1S7RA 3IF1B 3ROLA 4PGZA 1BVKB 3FZUC 1UM5H 2EIDA 4WO4D 3BD4A 4JZJC 3IDGA 2WUBH 1XGRB 3C5SA 2B2XL 3MYJA 1J11A 3L3IA 4JR9L 3TVMC 3IKKA 3H9ZA 3O3BB 2YC1B 4M7JH 4EKXA 2DQUH 3O6FA 4YK4B 3PXJA 2E7CA 4KK9C 1B6UA 4PJFA 1Q0YH 4F7CA 3GSUA 2BVUA 4JHZA 3GIVA 2FHFA 5E5MA 4M6NH 2UV3A 4NO0D 1GHFH 5CJ8A 1BECA 4Y4HA 3RAJL 3V6OC 2DIBA 3LEVL 3BGFC 5CJ5A 1VGKA 5C7XL 3P9WB 4MB3A 4N9GA 5F71A 4BH7A 5C0GB 3BKYL 2R0LL 2WBJB 2IFFL 3QWRA 4WV1C 2CIIA 4KK6D 3IGAB 4P23B 4FQXC 5DYOA 1FNGA 4MNQA 1JNHA 3KPLA 2UYLA 5TDPA 2XIDA 3LKRA 3VWKA 4KQ4L 3ZDXE 4S1SH 4Z6AT 5DMGD 4XAWL 4PTTB 4NN7C 3BE1L 4X6BA 4NC1E 2A1WL 4YE4H 1TPXC 3TM6A 1FAKT 1KIPA 2UY7A 3WFEH 3KPPA 5CCKL 1FPTL 5E6ID 4FTVE 3A0OA 3VG0L 3PWVB 3S36X 2R2EA 4G6AC 4UT7L 3LH2L 4UDTA 1HQ4A 1D6VL 1KB5H 1OP9A 4GRLD 1DVFC 4MMZC 3U4AA 1I1YB 2YZ1A 5D1QA 2RAMA 4RFNC 1YUHB 4KRPD 1KCUL 1X6LA 1IM9A 3WFCL 3TCLB 4KTDL 4KMLB 5GZOD 1N5YL 5HD8D 4EUPH 4KK5C 4P4RA 5DMKB 3UYOD 4Y0GA 5CD3B 4FG6D 2H2SD 2KQMA 4Y16D 4LHUD 1D9KD 4LSVL 4C54A 4FQ1L 1KIRB 1MCCA 3MRPA 3GMRA 5DRWA 5DK3A 4Q9QL 5F9DC 3I85A 4JFHE 3RPIB 5D6DA 1I1FB 1SYSB 1P84J 5FAAA 2BY0A 3DX8B 3Q6FB 1DSFH 1J0JA 4NQVB 2YBRB 1LEIA 2J7LA 3U7AA 2EE2A 5HXMA 8CGTA 5E8PB 5J13B 1UJ3A 4DKAA 5JR1L 3DUHA 4YBLB 1UB6B 4A6YA 4PJ8A 1M6OB 4PRAB 3S88H 4K3HA 4UQ3B 3UYRH 3VE0A 5KVDH 2JJTC 2OL3B 4C83A 3CSYB 3Q2CA 4GRWF 4Z7NE 1A7BA 3C5ZB 4MCYA 4F58L 5H35A 2OR7A 2EDFA 3D3VB 3MUY1 4ORGA 3T3PE 4D9RD 4LLQA 3BW9A 5IMLA 3QCUH 5KSAC 4MJ6B 4WW2C 1OVZA 4JFOB 5C0DB 1NBQA 4EN3D 3LD8B 4HWBH 4ZDHB 2DI7A 4K9EL 2WW8A 3NPSC 1E6OL 4QHUA 3P9MA 2I5YL 5C0BA 3N1FC 4X9IA 3SKOB 5B38A 4U1GB 4D9QE 4X8XA 1CE1H 4O4YH 2Q76B 1OF2A 1AXSB 4PPTA 5CZXC 3RWCA 3KPSE 2CKBH 4GKNB 5KVGL 4OFYD 3UO1H 5CGMA 4PLOB 4NZUH 2BY2A 3ZE1F 4OLVL 1WTGT 4PG9A 2F54D 3QG6B 1LO2H 4J3OC 3OG4B 2YEZB 4RRPG 5JA9A 1XFPA 2F53A 3WFHB 5TGBA 4ZFGH 4OQTH 1Q0XH 3DJ9A 4YDKL 5DJDB 1EHNA 4YK4C 1XGPA 4B5EA 3G6DL 3MOAL 4PJXE 4GLRI 3O0RH 2DQGH 1TTGA 2P5EA 3RWFA 2RGSA 1NGWA 1U0QA 4JM4H 2D03H 1I7ZB 4ZOCA 3BIBX 3FRUB 2EYRA 5KSBF 2DBLL 1J8HB 2ZSWA 5IHZB 5DGQA 2XG4A 4Z77A 4LU5L 2GYSA 5D71L 3HZMB 5FV1L 2WBJC 5HVWA 3C60D 2E8ZA 2ICCA 1K4CB 1ITCA 3I84A 2XG5A 1L7IL 3BAEH 4OIBA 1G7LB 2P5WE 2XQBH 3LCYA 5IWLA 3CLFH 4PGDB 3OB0K 2JK5B 3KS0H 1RK1A 5HY9B 5CHNA 2IANA 3MJ8A 5CS7A 1NBYB 4G3YH 4MD0B 1S9WA 5F3HA 2IAMB 4PJAE 5CILH 2Z92A 5IB3A 3RVUD 3PL6A 3QHFL 1DL7L 2ZKHH 3TZVD 5CEYA 2BZDA 4UI2A 3LN4A 4G9FB 5C0AB 4OZIA 1E6JL 5IR1B 1DQLL 3SOBL 3KPOA 5FDWA 5E1AB 3RVVD 4U1JA 5EORH 2FCBA 1EEYA 1CK0H 4I5BB 4K7PH 1UWGL 4JFEB 2J12B 4PP1C 2H32H 3MX0A 5E6ZA 2YPLD 3HAEA 3RGVB 1A5FH 2J8OA 1C1EH 2CJUL 3BXNA 1MCQA 4M7LL 4BH8B 2PXYA 4XH2B 4CVXA 1FSKB 4YXKH 3EOTH 1Z9SA 4U6HA 4OLUL 5D1XB 1LE9B 3B2UD 5E9DD 1BBJB 1RURL 3KPNA 4GAYA 4N0CD 3VXQB 4R96B 4LSRH 2FO4B 3QH3A 4M3KB 1INEL 4TOYH 4P2RA 4G6JL 5EU5A 1D5ZB 2CK0H 4PBWD 4HS3A 2CRIA 4WUUE 4S0TD 3S3JA 3UAJC 1BOGB 2P43B 3MLWL 3CK0H 4HZLA 2DRUA 1ZVSA 3CDGA 3VXRB 1S7SA 3QIUA 5FYKH 3OF6D 5AYUH 1I7RB 3E6HA 3RVXD 1XF5A 4WW2F 1XGQB 5J13C 3MRGB 5DVNA 7FABH 5HGBB 2BCKB 4YBLC 3L3DB 4NQTA 3OX8A 4Q2ZA 1GZPA 3VFSB 4ZYKA 4CW1B 4QT5B 5SV3A 2OSLA 3S9DB 4JQVA 3C5ZC 1KIQA 4WDIB 2OLDA 4RAHA 2QJDA 4JZJA 1I9JH 5C2BH 3MNWA 3MRLB 1CIDA 3TVMA 3Q6GL 4JPKH 1CLZL 3VI4F 1HILA 1Z0MA 4OD3H 5DMIH 3LD8C 4LVNB 4PGCA 4PYGA 3WD5H 5E2TH 3KJ4B 2L7UA 1TJHH 1A4KB 1S7WA 2ZJSL 3B5TA 3DX9B 1KCVL 5LCVL 3SE9H 1S9YA 2YKLH 2DMCA 4M61B 4GG6B 3S37H 2APBA 4U7SA 5DVOA 3EOAB 3FO9B 4U1GC 2EZ0C 5I1JH 3FFCB 4H1LB 4JN2B 4EI6B 3MLPA 2QKIA 1KV3A 3GNMH 2ZNXA 1DQQA 3FONB 4ZAKB 3SCMB 3E3QC 4E41D 3HE7D 1RY7B 3FCTA 1BX2A 5C2UB 4DZBB 4TNVK 4FQXA 5IVOA 3RJQB 4GW1A 5CLTA 3G08B 3KR3H 4POZD 1WWCA 2ZUQC 3RY6C 5AWNL 1KG0B 3INUL 2G9HA 2VLKD 5DRZA 1T0MB 5LG1A 3P77A 1YYMH 3BP7A 4RFEB 4NQEB 5FB8B 3NCCB 2YD5A 1LO3L 2C1PA 2FZ3B 4EOWL 3SQOH 4XRCA 2DQCH 2N7AA 3Q3GA 3QEQB 1RZGA 3RI5K 3VGEA 2B4CH 4NHCL 1Q1JL 1P7HL 3WLBA 2LVCA 4OCYH 1FLTX 4PUBH 1P53A 3F62A 3D39B 1KLFA 4HSQA 3C8KB 5HHPA 4PJFE 3ULSB 5HI3C 5IW6A 3G5YB 1DVFA 5GGRB 2DI9A 1W2KT 5DI8B 3FN9A 3JSSA 5F3BA 5IK3A 1YMHA 2GCYB 3FOMA 4OI8A 1KN2L 1ZOXA 5HYSB 3RL1B 3OGOE 3TC9A 5D2NA 2IAMC 5JHDA 3JTTA 3QXDB 5F1IB 4F7TA 35C8L 1YN6A 3CVHL 4MNQE 1FBIH 5JQ6H 1WBZB 5JIHA 3M8OL 4ZUVB 4XCEA 4G9DA 4XPAH 5I1EL 1F6FB 4HUWA 4JGMA 4PRBB 2D7MA 3TPKA 2R0WH 3RGVC 2EXWD 5K9QI 4RWHA 1FSKC 5TFSL 5D1XC 1NUGA 1IQDB 1LWRA 3VI3F 2PNDA 2JJTA 3B9KD 3RTQD 3DI2B 2HVJB 3MCKB 3WFDH 1L7TH 5D7LA 3SPVA 1NGPL 3QQ9C 3VXSD 3X14A 2V2XB 1KJVB 3PWNB 3VD9A 1G84A 5EBGA 5KOVC 4XBGB 4TTDC 3BSZL 5KSAA 4LIQL 1MFEL 4TYUA 5E08L 5GIRA 3IFPA 2FLBT 4HKZA 12E8H 4LRIC 4M3JA 3HMWH 1AY1H 4N5EC 4YIQA 3U9PH 5JXAL 1AKJA 2QQNL 1FL5A 3W2DL 1SM3L 2VSDA 1U2HA 2A0LD 4PFEA 5C09A 4MNGB 1DQDL 1IGCH 3BMWA 1RZIA 4RAUA 2Q7NA 1NCCL 4DTGH 1ORSB 2XXMB 3AGVA 1SJXA 1YEFH 1RUAL 3GMLB 4HLJA 5FKAB 2J4WL 2YD9A 1N6QH 4TNWK 5EH1A 5IHBA 4Z7OF 4MD5B 1SVZA 5HGHA 4X7EC 3IF1A 1BVKA 4WI5A 5E0QA 4C58B 1EFXD 3TO4D 5C0JB 1WZMA 3VXMD 1K8IB 5F1SA 1FIGH 4G43B 5TE7L 5DRNB 2AQ2A 1OT2A 4HD9A 1QSFB 3LKOB 3O3BA 5HYFA 3NMEA 2YC1A 2Z93A 4AEEA 4M6AA 3KJ4C 1PW3A 1CFTA 5F9WB 4P9HC 4U0RB 4KI5E 3M45A 4JEGB 3RZCD 1ZANH 3CFBB 2DLFL 4KV5E 3NA9H 2V17H 2OR8A 1WFNA 4P2QD 4NN5B 4BSVA 3D85D 2WBJA 5I1DB 3SCMC 1HINH 3MFFB 4HK0A 3IGAA 5ID1A 3N0PB 4P23A 4KDWA 5T5NG 5C0BE 5F72S 2B1AH 5KS9E 2QL1A 3H9HB 2FECL 2XV6B 3VFRB 3TN0B 2AVGA 2ICWA 2C4FT 1WZKA 4XNMA 4NKQB 4PTTA 4K3DL 2MHAA 5IMKA 4RGOH 4PJ5B 4JHWH 3RU8H 3NGBB 4OQ1A 5ID0A 4X4ZA 1MFBL 1OGAD 3PWPD 3PWVA 5E2UH 2F53E 4WWKD 4YFLI 2VXQH 2B1HL 4LCYB 1J10A 5IG7A 5FO9A 5T1KD 2HJLB 1ZVYA 1OAQH 2GJJA 1I1YA 1R24B 2P5EE 1ACYL 1WF5A 3TBYB 3EHBD 1KGCE 5F9OL 1P5VA 4G6KL 3L3JA 3WS6C 1IC7L 3TCLA 4PRNB 1K2DB 1SMAA 4Z7UF 4G6ML 5IFAL 3BN9D 4PJIF 5DMKA 2R2BA 2EH8H 5C0CB 4D3CL 2BMKB 2DQEH 3VFTB 5DF0A 3ESVF 2EDBA 3N1PC 5GGTH 1KIRA 1RUML 3QUZB 3I02B 2NY7H 3MO1B 3OHXB 3TIEB 2PW2B 5AZ2L 4GG8A 1SYSA 3O9WB 5GS0H 2IANE 2R29H 3DX8A 3Q6FA 4JZNB 5IQ7H 4NQVA 2YBRA 5FHBL 1CYGA 3W82A 1F90H 4P9HL 3BJ91 2APFA 3IB4A 1JGUH 2DMKA 4PJHF 3VFGH 4RX4D 1M71B 4EVNB 5A2JH 1YY8B 4OZIE 3R06B 1PDKA 4U1KB 1BZ7B 4PRAA 4UQ3A 2BP3A 4OCNC 2YR3A 4TRPH 3HPJB 2NW3A 1JF6A 4HXBH 5FGRA 1CL7L 5TH2B 4TVSa 3F6LA 5F44A 2MCPL 4ZPTA 5CEZD 1ND0B 1XF4A 2V2WB 3FQTB 5HI5C 3DHMA 4UV7L 2Q87A 1UENA 1B2WH 4MXWL 2AK4B 4MJ6A 3CVHA 3KXFD 2DQHH 4NKIH 3ARPA 4JFOA 5C0DA 2R23A 5MERB 5JMRA 3K2MC 1E4WL 4WTXA 2MPAL 5HHMB 4EDWH 3M1BB 4HUVB 1UEYA 3BESR 3EYUH 3ZKND 3WS3B 1R6VA 4N0UB 3SKOA 3HB3C 3MBED 2C7UB 4LVOB 4MYWB 1FVCB 1AXSA 1EEQA 2MFNA 4GG6F 1QQDB 3ZL4L 4JM2F 4JPIA 2VIRB 3OB8A 1CLCA 3MFGB 4GKNA 5FCUH 2NMSA 4FQCL 5T5FH 4MAUL 4NQCE 4JDZB 5KW9L 4BQ9A 4UB0H 1FJ1B 5I1AB 3MZGB 3QG6A 3REVA 4ELMA 1KJ2H 4GRWE 1JHTB 4KVNL 3MUJA 1A1OB 3RY6A 4Z78B 2RR3A 5JOEA 1WLHA 5T5NF 5DJDA 4RNRB 4UDUB 5IP4A 5F9WC 3G04B 4U0RC 5GS1B 2A6DB 3C5JB 3GMPB 1IJ9A 1B88A 3UBXI 4OCXL 4HZAA 1I7ZA 2CGRH 1DBAH 4NN5C 1J8HA 4XP4L 5IHZA 5JOFA 4LSQH 3OKNB 3H0TA 3HZMA 4ZFOB 4G8IB 4KJPC 5ACLA 1P7QD 5IMOB 4O5LH 1G7LA 2BNQD 4PGDA 2JK5A 5HY9A 3TN0C 3UPAA 3ZE1E 1A6WH 3BZ4A 3MLRL 4HC1H 2Y6SC 4MD0A 3SY0B 1JPTL 2UVEA 1FLRH 3IVKB 3MV8D 3G6JB 1NGXA 1F6LL 3K4ZA 1NKRA 2VE6B 3MV9B 3MCG1 4QRPE 2W9EH 5C3TA 3TJEH 3NGBC 5I76B 1UEMA 1MCPL 2IC2A 2X4TB 4WCYL 1KPVB 1CFBA 4G9FA 2O5XH 3ORJA 2OS7A 5C0AA 4AIZB 5IR1A 4E5XB 3BOVA 2PO6B 3N85L 5B8CC 3R8QA 3U0PB 3CJJA 4JHAL 4I5BA 4NZRH 4JFEA 1ZK9A 5DHVB 4PRID 5HHNB 3RGVA 4UINH 4BH8A 3VMPA 4XH2A 5K59E 3UTQA 1CFVL 1QFOA 3Q5TA 1BLNB 5INDA 4KXZH 3CXDH 4ERSL 1YNLL 3I2CH 3QB7C 3V52L 1LE9A 3F65A 3AROA 1BBJA 2QHRH 1NAMH 1Y18B 4HIIB 3SE3C 2MQ3A 3VCLB 3VXQA 1OGTB 4GBXB 4NBXB 4R96A 2FO4A 4IDJH 3UTZB 4KUCD 1L6XA 1F00I 1D5ZA 1UCTA 1JGLH 1WISA 3DYPA 4U4BA 3QUZC 5EOCH 3HG1D 4LF3B 2GFBB 4OIIL 1NDMB 4C56E 4P57A 3O9WC 3VXRA 3CVIH 5L2KB 4LRIA 5D2NE 2VXUH 3ARFD 1CU4H 2OMNA 3QRGL 5JHDE 1I7RA 3GSNH 1T66C 2P7TB 1XIWD 3L3OB 1ZMYA 5D7IB 2AJUL 1XGQA 4ZNCD 1ROWA 1J5OL 3UTSB 2E7LC 5HGBA 2BCKA 3L3DA 1OARH 3T0EB 2H1PH 3S5LG 1K9TA 2W07A 1EGJL 4JFZL 2W0PA 4NJAL 3DROB 5GISH 2HRPH 3AM8A 4CW1A 3MLXL 4J3TA 4H0GA 2ITDA 1AI1L 1U8MB 1BZQK 5FUOH 2ZNWA 4KPHH 2DM2A 3DRQA 4FQLL 1LVEA 1OAYL 2AGJL 3MRLA 4ZFFB 3FRPA 4ZO7A 1K6QH 4WEUD 3QT2A 5E94B 1NC4B 5F9AC 3QUKB 1UCBL 4XPHH 5B21A 1PY9A 4M61A 2Z35B 4ONHB 3KGRA 5GZND 1F42A 3EYQC 3EOAA 3MA7B 4HT1H 4LVOC 3LY6A 3FFCA 4H1LA 3DSFH 4JN2A 2YUWA 2VAAA 4XMLH 3I9GL 4XP1H 1QHOA 3QDMB 5C09E 4ZAKA 3SCMA 1CGXA 4DZBA 5D70H 1X3DA 1MJ8L 5I1HH 5FF6A 3MJ7B 4O02L 1HCFX 4NC0B 1BEYL 4W68A 4EBQH 1U42A 1KXQE 3BZDA 2VDPL 3MMEB 1KG0A 2WWKT 4HW6A 4O00A 2HWZH 4RFEA 5FB8A 3HRZB 5GS1C 5GXBB 1EVUA 2FZ3A 4K23L 2FX9H 3CMGA 5EC2B 3DBXB 3P11L 3H2WA 4G6FD 1GGUA 4BYHA 5J11B 1CXFA 1XR8B 5CIPB 3D39A 1KELL