3C6SA

Crystal structure of fab f22-4 in complex with a shigella flexneri 2a o-ag pentadecasaccharide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
216
structure length
216
Chain Sequence
DIVMTQAAFSNPVTLGTSASISCRSSKSLLHSDGITYLYWYLQKPGQSPHLLIYHLSNLASGVPDRFSSSGSGTDFTLRISRVEAEDVGIYYCAHNVELPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of synthetic O-antigen fragments from serotype 2a Shigella flexneri in complex with a protective monoclonal antibody
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab F22-4 light chain
total genus 48
structure length 216
sequence length 216
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-02-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6sA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6sA01
2ITDB 1EO5A 2R69L 1QA9A 3LVEA 4Y16D 3G6JB 1HKLH 3MV7A 5IOPA 4XZUA 3IETB 2IFGA 3P30H 3VWKD 4ODHL 4KROC 5E24E 3IETA 2DYPA 3DRTA 1FSKB 5EBMA 2IMNA 5SWQA 3G6JA 5ANMA 1JJUA 4XNYH 1Q9WB 1FNLA 4RIRB 4AY0A 3SDDC 2R0WL 3C8KB 3PWUA 3RAJL 1G7PB 5L9DH 4KK8D 5IJKA 5J1AA 3O2VH 3MUY1 5E2VL 2DIBA 5D6CB 3TO2A 1OTSC 1G1CA 4X4ZA 5A2LH 2A9ML 4MNQA 4PR5B 1PLGL 2YN5A 1PDKA 5ITBL 3MOBH 3WCYA 2M1KA 1AJ7H 4OLEA 5KSAA 4BZ1H 3E0GA 4H25A 3GJFK 2E7LC 1MUJA 5L2KE 3DETD 5B39G 3SDAD 4HS8L 3HCVA 1NQBA 1WCBA 4G6JL 3SQBA 3BDYL 4OFKA 3G08A 3ARBC 1U3ZA 4JANB 5TQ0H 1CU4H 5FUOL 1WBYB 5IVOA 5INDA 43C9A 2ZUQC 4UT7H 2Z91A 1R5IB 1ZLUH 2EDEA 2R29L 4J8RA 4YFLF 2BNRE 3CPLB 5C07D 3T2NL 1QUNA 4GW5A 5INDB 5JDSB 3TA3C 2XY1A 4JANA 4OCMC 4J3WA 4JO2H 1V3MA 1TJGH 4C83B 5GGQH 3E6HB 4KWUA 5DUPL 2E6JA 2B0SH 1V3JA 1MUJB 3HE6A 4YPGA 1NGPH 4JN2B 3OB8A 5D5ME 1A2YB 2EDTA 1E4WL 4HIJA 3TNMB 4FN0A 5DYOA 4PGDA 1CDUA 3QG7L 4G7VL 3EOAB 3LN9A 4MD0B 3FB7B 4YHIB 2A1WH 1AE6H 5KVDH 4U6YB 4N5ED 3O6LL 4Y4HA 5E8NB 2GEEA 1OGTA 1H5BC 3SGKA 5CGMA 3LRSA 3WJJC 1WFUA 4XXCC 4OJFH 5D7IA 4KUZH 4YDJB 4HFWA 3X17A 2E9IA 1X6NA 3LQZB 1I8MB 1BM3H 4XZUB 1RJYA 2VDKH 4LMQE 3KYOA 4CU6A 1NBVL 1ZHNB 3PQYE 2A77L 3O0RH 4OZFB 1YY9C 3OBAA 3VCLA 2AJXL 1HYSD 1CTOA 4KQ3H 3RY5A 3HA0A 4XMLH 3MCKA 4S1DD 3VFPB 2VDLL 1VGEL 2P44B 1PAMA 2XTJE 3P11L 3QISA 4P5KB 4WWKC 3MPCA 4Y4HD 4XPGL 3D69B 3D0LA 1CDYA 4BH8B 3CVHL 1N64H 5DMKB 3S88L 3NPSC 4PJIB 5IBUB 2CIIA 1I8KA 4G3YL 1CGWA 3IFNL 4UT7L 1FNGA 3ZDXE 2X10A 3BH9A 4DN4L 4HUXB 4HGWB 3MRRB 5EOQH 4U1HA 3UO1H 2DIAA 4YFLI 3MRMA 4XVTL 2P24B 2IG2L 4FFWD 5F1NB 3UXFA 3KWWB 1KBGL 1H15A 3MYJA 2BDNL 3PP4H 1X4YA 3LEXB 3SO3C 3EYVA 4F7TB 5DQ9B 4FABH 1FZOA 4ZUUB 1DLFL 3IGAA 1IEAB 4UILH 2AV7B 3OR7A 3OHXA 4JPVL 4X7SL 1UA6L 4P46B 3GSQB 1BOGB 3AB0B 2FD6L 1MJ8H 5EOTB 1K6QL 1ACZA 1DBBL 1X3DA 2ZCKH 4D9RD 1JHTB 1A6VH 4HJGB 4R96B 1VEPA 1FH5H 3P30L 2DQCH 5FUCE 5KN5A 1MJJB 1IEHA 2CLZB 4GAJH 2CKBB 2FEEL 2Y6SD 5JOPD 3ARRA 3KDMA 5L6YH 4M1GL 1FHGA 3UTTE 4HXBH 4R9HA 5DMIH 2VABB 2BOCB 1I8IB 4JRYE 4ZXBD 2F8XC 1KNOB 4YHPA 5SWZE 4FQ1L 3HZYB 5MENE 1ACYL 1DE4A 3K4AA 5F21B 1IILE 5I17B 4HKJB 1L7IL 3BMVA 3W39A 5J0BA 8CGTA 5KVEH 4BZ1L 4Z5RB 2KDGA 3D25A 4OZHE 4HUUB 1AXSA 3GK8H 2R2BA 2DKMA 2Z4QA 3HC3L 1UXWB 5A16A 5IW1A 1I9IH 2X1QA 1X4XA 3EW3B 4NRXB 2IJ0C 4HS6A 4NNYB 3T3PF 3L5HA 4DKFH 3UTZB 5EU3B 4LIQE 1A6UH 2HMIC 5DFVD 4MA3B 3PXJA 2JB5L 3CDGA 4C4KO 1KIRB 1CD0A 4U1MB 5JHDB 1KIPA 1ADQL 3O3UN 5CP7B 5A2JH 1UJ3C 1AXTL 1DBAH 4LSQH 5FYKL 4X7FC 5T3ZE 2ZCLH 4GW4A 5GS1C 2CDEA 4NN6B 4ZNEA 3CU7A 3SGKC 2I27N 3UBXI 1MH5A 3UJTH 1P6FA 5AZEH 3A67H 1OGAB 4JO1H 4YE4L 4BZ2L 3KPSA 4Q2ZB 1MI5D 3MBXL 4TPRL 3P4MA 3PGFH 4PTTB 4I3RH 5AWNH 4XCNA 2HAZA 4PJ5E 1TETL 2NTFB 1JNLH 4XPHH 3V95A 4HC1A 3FO1B 5EBLA 5MEND 4BQ8A 3CFEA 5FOBB 3F5WA 4P3DA 3SKOA 3KHOA 4L4TB 5C1MB 2WMPA 5CGTA 4JFEE 4JCLA 2QR0A 4LCWD 4Q7DA 5GZOD 2HRPL 3OXSA 5D1ZA 5TE7H 2AEQL 3NIGE 3N0PB 1CE6A 5KTEH 3L5WA 5HHOB 4POUB 1RZJC 2BNUB 1T7VA 1MRDL 3NN8B 4G7YL 1JUFA 1T0MA 4LFHG 4HMEA 3QULB 4IRSD 3WIHL 4L9LC 1OLLA 3L5WB 3O4LB 3CXHK 1JCKA 2VZTA 5J6HB 3HMXA 3CFBB 4F8TA 5ICZA 2BSSA 3H9SD 1C8PA 3V5KB 4MVBC 3SE4A 1QFWI 5TDNA 3QUMB 3JV6A 4LVOB 1YC8A 1HXYA 2YWZA 3VXUE 4MSWB 1FPTL 5C0AB 2AJSH 1JZ8A 3ZL4H 1FO0L 3B9KB 1OAQL 1KBGH 4H88L 1RHFA 4NQDA 3RGVC 3QZWA 4PRHB 5EORH 1CF8L 1MFBL 4PY7A 3MGTA 1N3NA 1FAKT 1YMME 4OZHF 1E4JA 1T5WA 1KIPB 4NQXA 1S7UB 3CDGB 3VXTB 1A5FL 4AL8L 4UT9L 4XVSH 5I73B 1QR1A 4GO6B 4OGAD 3BH8B 4PRPA 5I8CB 3UTZA 4Y2OA 3RDTB 1BX2A 4L3AA 4GG8B 4HS6B 2C4FU 1QSEE 1U3HB 2DM3A 3X14A 1UACH 1GGBH 1RZGA 3S34H 4P23B 3OKMA 3T0AA 1EHXA 4OFDA 2P45B 3RIAF 4KMQA 4HIEB 3K80A 1ZHBA 5CIPB 2HT3C 2VZ3A 5D5MF 2A38A 5DQJA 1ZAGA 1FVEB 3DURA 1RPQA 1BBJB 1HHGB 4WV1A 4ZUTB 1DE4B 2PW2A 1YN6A 3DX8A 4P48A 4Q97A 1HSBA 3LIZL 3C2AH 4OD3L 4B0MM 3V7AE 3QI9C 2WUCH 2A6DA 1SEQL 3DMMA 1UADC 1T66C 3VXPB 2AK4E 4V2BA 1M71B 1A9BB 3W9DA 1YECL 3PL6A 4X9GA 3VG9C 1XGYL 5DJ6A 4EOWH 4C54A 5IIEB 5EO1B 2XOTA 1IC5H 4JHAH 1JFQH 25C8L 2NY3B 5FO8A 1BQHB 3D3VB 3N1GC 1BBDH 4L4VB 5EZOH 5TE6L 3MV7E 1OM3H 3MJ8B 5CEXB 3WXVH 3LB6D 3O6FB 3WUWA 4F7EA 4U1JB 3QDGE 4KKNA 3OAYK 5HGGS 5I74C 3ORJA 4HK3J 2R0ZH 4BFIB 1MFBH 2OK0L 3BFOA 1JWMB 3MRJA 3AXLA 4PFEA 5K59F 4EJ1C 4QRRE 1CLOH 2DWEB 4ZUUA 1VCAA 1E4KC 2ARWA 4HS8H 3ALPA 1QSFE 1TQBC 3QYCA 3LN4A 3QB7C 5D7JC 3SDXF 1EXUA 5IB2B 1QR4A 2AQ1A 1SJEA 1Z5LA 3GI8H 4DTGL 2OZ4H 2JELH 2VXUH 4FQXD 4MA1C 3PWJA 4Q6IB 1QRNA 1SYVA 4J4PD 3SDCB 4PJIA 1S7XB 5IESL 2JCCB 4PJEB 4N68A 3HAEH 1S9VB 1O5DT 3TPUB 4WRLA 2HG5A 2BVUA 3FQTB 2Y9RT 1W72H 1I1AA 3MCKB 1WV7T 2CMRL 3WFDH 3PHOB 2BCKA 3DOSA 3V5KA 1FRGH 3TZVA 3BWAB 4ZFFB 2WQRA 2Y6SC 4FQLH 4XRCA 5FYJD 4IDJL 1JNJA 2JK5B 4X6CE 5L2KD 1VFAB 1T0MB 1X5AA 4XAKD 5I1LB 4ZDHB 2CR3A 3LKRB 5JIIA 1OTTC 4IOSD 4GOSA 2IC2A 2BOBA 1PZUB 2A9NH 3K7UA 3DXAD 4AZ8A 4MZ2A 5H35A 1RVFH 1RUPH 4PV9B 1NJ9B 4Y4HB 5E8NA 1F45A 2ZSVA 5HDQH 4U6YA 4XVJL 4OV5B 5IQ9A 4ZO7A 2X1WL 3UDWC 3C5JA 3UROR 1KN2H 5GGSY 1MCWW 3SGDI 3FB6B 2RFXB 5BVPH 2BNQA 2DN7A 5DJAA 1QPPA 4JKKA 3LAFA 4K71B 2FX7L 4NCC2 3TN0A 4F9LA 4UDUA 3STZB 2V5SA 5IV2A 2BXZA 2DBJA 4Y8DC 4NUJA 1ZGLM 2CDEB 1FNFA 4FQPA 2NZIA 1ZHLA 4QYOB 4R0LA 1A4KB 2Y07H 3CUPB 2NXYC 3ZKNC 1ZT4B 1W8OA 3O9WC 4LBEB 4IRZL 1JGVL 2B4CC 4PBWD 1FG9C 1MF2L 2P4AB 1GIGH 4DUXA 1T7ZA 4Y16C 4QRUA 4GBXC 5D71L 5B38G 4L8SA 3DI2B 3ESVF 1FJ1A 3TBTB 2FO4A 5E03A 3VGAC 2DKSA 5KSAB 1GVIA 1UM4H 4IHOA 3VXQA 3CAFA 1IAII 2HKHH 3C6LA 4RBPH 4NO5B 4KZEL 3KS0J 3MV8E 2BMKB 2J8UB 3GNMH 1YMHA 4X8XA 5DHVA 5IKCB 1XR8A 2RHEA 5K9OB 1YJDL 5E8DH 2ZSWB 2V5TA 2OCFD 4HQQH 4IIQB 1FNSH 3E8UL 2PF6A 3MLYL 2BVQB 1RUMH 1YZZA 3K8LA 4ZTPL 1KIQA 1GC1H 1N26A 4PG2C 5F1KC 5IF0A 2H3NA 1RZKL 5D93B 3MV7B 1H3GA 1OSPL 4XPAH 1XZ0B 3OGCB 3QDHA 4ZQKB 3SJVD 5JNYA 1ZA3B 4KKBC 3RJQB 1A7QH 3QFJE 4Y1AE 5IMOA 3Q6FB 3TBVA 2V7NA 1EHLH 5E6ID 4PLKD 4QNPF 4HMCA 3HC4H 3QXWA 2Q7NA 2YXMA 3EUUA 1IVLA 4K2UL 3QNYA 2YD2A 3EYSH 1FRGL 4XP5L 3PV6B 3NFSH 4J12A 3GMMA 4K7PL 1FL5B 1G84A 3QEQD 3QQ9C 3I9GL 1XF3A 1X5JA 2AJZA 5E99L 5EC1A 5TPWL 1RZFH 3RVTD 1CIDA 3OJ2C 5GRUL 4DVRH 3U46A 2VLRB 2FR4A 4KH2A 5EIQA 4M7KL 3QDME 3MYJB 2FB4L 1T4KA 2BRQA 3ES6B 4F57H 4NFDA 2NQCA 2VLRA 2V2WA 2AJVH 4N0FB 5A43C 2C26A 1RIVL 3UAJC 4NKMB 3CZFB 3DROB 3I50L 2V2XA 2VE6B 5HHPB 1MREL 4Z7OF 1XFPA 15C8H 2Q6WB 3H9ZA 3VXMD 3HE6C 2P5WE 1E6OH 4XNXH 4HJJH 1BLNB 4UUJB 4DK3A 4JDVB 5DRWA 1AI1L 2YA1A 4LLUB 3GDBA 1I9RH 2W65A 4BSJA 3KJ4C 1BD2E 1JMZA 4OZFH 4RFOL 2AKRA 1EH9A 4G43A 3Q6FA 3D3VD 2EIDA 3L1OH 1MY7A 2HT4C 4LKXB 3KYAA 1HQ4A 3V7MA 1QSEB 1FNAA 1FYTD 4WUUE 3D18B 5E9DE 4M6OL 1UFUA 1VEMA 3S5LA 5KSVB 4HUMB 1OB1A 2APFA 2O5XL 4X9IA 4O2CB 4LU5H 4HMDA 3VRIB 1PGRB 4F7MA 2CUIA 4UQ3B 4HG4K 5IROC 2R23A 1RIUH 4HPOL 1QO3A 4KMTH 1DVFB 4NN6C 1CCZA 5ADOL 4U7SA 5BV7H 3OAZK 2OTPA 2CDFA 4S2SA 4JRXE 2UVEA 1N2RA 3UBXG 5DHVB 3V6OE 3P0YL 5F7WC 4NO5A 4JZJC 1P9MC 1TTFA 2YPLA 1WBXA 3ZE2F 5D7SH 1GXEA 4AIZA 1MI5E 3HKFA 4X5XB 1AE6L 3UC0H 3P77A 1FV1A 5I8OH 1D6EA 5L0QB 2PYFA 5EU7C 3DVGA 4WO4B 3FJTA 1T21A 3K8MA 5DVNA 4ALAL 5DGRA 3M1BA 4PJEF 1XF4B 5EUOB 1ZT4A 4PYGA 1MY5A 4TOYH 4JY6A 3LS4H 5DLMH 4NZUL 4NUJB 5KTEL 1CFQA 2ILLA 1X4ZA 4R90H 5GGTL 4HD9A 4L1HA 4I18A 5JTWA 5D96C 3MLRL 4JO4H 5E2JA 2QQNH 1INEL 1NGXA 2YKLH 1MNUL 4TRPH 1P84K 4ZTOL 5IMMB 4JQVA 3RUGF 3BP4B 2C3XA 4HKBB 2DLFL 1CDCA 5DGQA 4MYWB 1HH9B 1TXKA 3IKCB 1WUNT 1BIIB 1IAIH 1MAKA 1I8LC 3ULSB 5IQ9B 3VXUD 3G9AB 3S97C 2O5ZH 4FQQB 1JYVA 2X2YA 1A4JB 1OM3L 1PD6A 5DD6B 2AW2A 2BOBB 3MBED 4ELMB 4J1UA 4P46C 1R0AL 4GXVH 1TJHL 2APWA 5F7LB 5CAYB 5BRZE 1RI8A 4ZS7H 5C09E 3W5NA 1CL7I 2KQNA 1DQQB 2HMID 1AIFB 1F2XK 5D6DC 1MQKL 3DRQA 2O26U 1RUAH 4HW6A 5FO9A 5LQBL 4D9QD 4OLVL 2CGRH 1MCPH 1CE1H 1CT8A 1DJSA 1HKLL 1TZHB 3VFRA 3C5SB 3V6ZA 4KV5F 1BAFL 4PY8J 3ULUD 2UWEF 4WI3A 4HWEL 3FFDB 4NQSB 2AXGA 1WT5C 2VXSH 5IFHH 1GAFH 2W38A 3HAEA 4W81A 3B9EA 5DD0H 4IDLA 5EU7E 5JZ7C 3IJHB 4KVCL 4F2MB 4NN5C 1U8MB 1UB5A 3WEXB 3IDXL 1AGBA 3U7WL 3R06B 3KXFD 2Q86A 5DRXB 5F3HA 1KPVB 3L7FB 3MR9A 5ERWB 4KAQH 4I5BB 5GZND 4J3VA 3W2DH 5SV3A 1YPZA 5D1XC 4MXVE 4APQB 5DEFB 2MWCA 3UYRH 1KJ2L 3V8OA 1H5BB 1CGSH 3ZDZF 2E8ZA 1YEIL 1X5HA 3FT3A 4KI5F 1CG9B 1A9EB 4GRMB 4KPHH 5CEYB 4UU9B 4NBXB 4KXZI 2KUTA 2ADIB 4ZD3L 1IGJB 4KK5D 5EBGA 5KG9B 4JO3L 2IF7A 1W72A 1A7NH 2NY5L 4LCWA 4X7EC 3QEQB 3VGAB 4KFZC 2NXZC 2H2SC 4KI5D 1WC7B 3MXWH 3BHBA 4Y16B 3VU2A 5ESQA 1BFOB 1H8NA 5I76A 3NGBC 4UINH 5GSRB 4U1NB 1KCVH 3RVWC 2EKSA 2JTDA 2EDXA 3HC0B 5KVFH 4U31A 3MRHA 1NDMA 4RA3A 5ID0B 2YPKA 3X14B 2EYSA 4P2OB 2ICEB 3P4OB 4ONFH 5GS3A 3QFJB 4LVEA 3ZDZE 2ZP0T 1BVKB 3HI1B 1Q38A 1UB6B 3VFOA 3QPQC 3UBXB 1I8LA 3ZYJA 3OPZL 2ZUTA 4I13B 5EN2B 3UC0L 3ZHLA 4Y4HC 3PL6D 5F7MC 1FFPB 1QSFA 3KPLB 5FYJE 4KGLA 2AK4A 1WAAA 4G5ZL 4WVRA 3WIHA 3NACH 2B1HL 3HPLB 5LQBH 3FN0L 3RVUC 1C12A 1HHIB 4X6DB 4G8GB 3AS3A 4O58L 1NFIB 2QSCH 3K2MC 1NC2B 5JQHC 5B3JF 1JPTH 3H7LA 1DANU 1OSPH 4XBEH 4KMTL 3S3PA 2B1AL 4QOKA 4PRDB 5I0ZA 1RIUL 4ODWA 3TIDA 4YBLC 1CICD 1NC4A 4XXDA 3GIVA 5F7HA 2VQUA 1WBZA 2XZAH 5C08D 5DI8A 2EDDA 3FOLB 1JP5A 5DVOA 5HY9B 4DZ8A 3EYFA 1AXTH 2Z8RA 3OKOB 1H0DB 4FQHB 4JHWH 3V5HB 3RVXC 1B4RA 2IANE 3V4PH 4UINL 4WI9A 1B0WA 1DBJH 2VKWA 4L4TA 3MRNA 3SGEH 3F5WB 1B4JH 5D7JB 1VPOL 2IWGA 3UYRL 3RWIA 3VXSE 3DJ9A 5CJBA 3AREC 1RZ8A 1XR9A 3GHEH 4DCQB 5E94B 5I16B 3MSPA 3QHTC 1S7VB 1RUQL 4UMGA 3I75B 1MFAL 1YNLL 2B5IC 4JFZH 5C0CE 1Y0LB 1G7LB 3MLVL 1BFSA 3KYKL 4JQIH 2MOVA 2R1YB 4D8PA 3L95B 2ZNXA 5I8OL 1YEDA 2L0DA 2MMXA 4FTVE 3VXSB 5I1KH 3DARA 1S7SB 1E4XH 2B1HH 2NXYD 5A2IH 1H3VA 1R3HA 3MLYH 5ISZB 1I7ZB 1J8HD 2NX5B 4LLWB 1VADA 3LKNB 1YYML 3MOAL 4ZAKD 3W0WE 4KJYB 4ZUWA 4HUNB 2YD5A 3TEUA 1PVHA 3P4NB 3QA3B 4JG1H 5T3XD 1XR9B 4XVUD 5F6HJ 1LO2H 3T09A 4OCSH 4ZS7L 1GAFL 2J4WH 5D70H 2AJUL 3NPZB 4JPVH 2YA2A 4Y5XA 1NAMH 5ALBH 3MNVA 5GGVH 4YAQA 4P23C 4YDVA 1NDGB 3MA9L 3RA7H 1Q94A 3JTTB 4HS3A 4WHCA 4LGRB 5LGJB 2JCCF 1PG7X 1OP5K 5I9QC 5GS2D 2CGRL 1XIWA 4GUPB 1I75A 2PYEE 3QIWC 2OZ4A 1UQSA 4K7PY 4PJBE 3MROA 5EIIA 1JGDA 3MACL 1RFDL 4XXDB 3G5XA 3BW9B 4P2YA 1P7QA 3KPMB 4EDWH 5F7YC 4U3XA 1JHTA 5C6PB 4Z7VA 4WW2F 4TVPL 2X4NB 1RIVH 3FO0H 3WE6A 3RGVB 1CGUA 3GO1L 3MBEA 3I50H 1FGVH 1S3KL 3TGXA 3VFUA 3VXME 1IM9B 3DUHA 1S7TB 2Y06L 3VFMB 3GSNA 3MUHL 4NRZA 4HXAL 1T1YB 2X4PB 5I6XC 3EDJA 35C8L 4GAYB 5CHNB 1BHGA 4L8DA 1KC5L 3OGOE 5K9JH 5FO7A 3IGAB 4MXQC 1YNKL 3NA9H 5I18H 4R0LC 5DEGB 2XG4A 5T3XE 1RHHA 3TT3L 3PP3H 3EJZC 4TUKL 1MIEH 5DWUH 1RJZB 4PV8B 2R4RL 2N56A 3SJVA 1UYWL 3QQNA 4PJXE 3A0OA 1BVKA 3FN3A 1SM3H 3N9GH 3UZQA 1K2DB 1UGNA 2CXKA 4X6DE 4L8BB 2DKUA 1JYXA 1JWSB 4ZOEA 1TPXC 3PIQA 3MRHB 3D0LB 1P53A 3EYOA 4PTUB 4F58H 2DWDA 4MNHA 4YGVB 1AQDA 3QUKB 3D5OF 4GRLC 3T0EB 5KSUB 1IGTB 5GSRA 2P8PB 4LVHC 4WEUD 3KYOB 1EHNA 2V7HB 5D7SL 2HKFH 4FFYH 3V52L 4Z0XA 3BXNA 1R5VA 3LQZA 1A1OA 4LQFH 4KV5E 4YDJA 2VAAA 1P7KA 3DX6B 1KB5L 5IW6B 5MERB 1G7QA 3O2DA 4MMZC 1J10A 2GTZB 4ONHA 4YO0A 5JDJA 1LMKA 4HF5H 5FYLD 4PG9A 2OK0H 1YNTA 3OAZH 4KKCC 5FHBL 3HR6A 2BVTA 2VQ1A 4TTGA 1JF1B 1GGIH 3VRJA 1X5XA 3TNMA 4PJXA 1LK3L 1W8NA 3UJTL 1NAKL 1QRND 3GBLA 2CJUH 1QQDA 5SWZB 4AL8H 1RURH 4L3ED 2E5EA 1OAXH 5F7FA 3OJDA 2CO7B 3L3IB 1IFHL 4XWGL 3GZKA 5IBTH 2B20A 3AMKA 4K7PX 4EN3D 1RK1A 2MCPH 2DS4A 3FRUA 5DA4A 2X7LA 3RIFF 2E7BA 1QBLH 5D6DA 2Y1VA 5FAAA 5ILTL 4BK5A 3MRGB 3VE0B 4MA7L 5DC9B 1ZEAH 3IJHA 2OQJB 5FIEA 5EULV 2HRPH 3NCMA 1WIUA 4MA8L 4HV8B 3U7WH 1EVTC 1ZGLB 2QHRL 3L3DB 2I60L 4H25B 4Y2DC 3W9EB 1KEML 4O51A 3IT8D 3BE1H 3QHZH 3DV4A 3CMGA 3U9UA 4Z77A 5JUEL 1R24A 1FZMA 1TZHA 5DHVH 4JPWL 4F33B 5AUMB 4H8WH 1G7PA 4I77H 1CDBA 5TF0A 4YC2C 1C16B 3S3SA 1UZ8A 4FQLL 3TBWA 1G0XA 2E6PA 4EI6A 3SY0B 3AS1A 5JHLL 1MWAB 4M03A 2DDQL 2GY7B 2IAMB 2VWEE 3RWCA 2JIXD 3MFGB 1OCWL 4HAFA 4JLRA 1W72L 1JZ7A 3OR6B 2NW2A 4P4KA 4YK4B 4K3GA 2VLJE 2RAMA 2VUYA 1E6OL 4XNXL 2QQLL 2EDWA 1X6LA 1URLA 3TC9A 5GISL 3SDXB 4MJ2A 2IQAA 3VW3H 3LQAC 5HBBA 2PXYB 1C1EH 2BNRD 3GI8L 1LK2B 3KPRB 3MJ7A 3QWRD 4DTGH 2VLME 4G42A 1MJUL 1LILA 4NO0B 1M7DB 3T4AB 1J05B 3BUTA 1FIEA 3HZVA 1MSPA 5MEQA 3RY4A 5EOQL 2AGJH 5FA4A 2WP3O 3V6OC 2NPLX 2PN5A 1PYWB 2GFBB 3RVVC 4RMWA 3T0EC 2FCBA 1J8HA 4J4PC 2AQ3A 3GMLA 5D71H 5J12C 1QG3A 4QTHA 5GS0H 1NC2D 1GZPB 2F74B 1FV1B 3DMMD 4CADB 2QADC 1J0YA 5F3BB 2VLKE 3JV5A 4F15C 5FGSA 3L3KB 4PJ8A 1LP9B 4H8WL 4OLYH 3IVKB 2FYYA 3O8XD 3NABL 4Z8FL 5C08B 1S5HA 3MJ9H 4RFNB 4PJFA 4J6RL 4N0RA 1G7IB 1I1AD 5H37G 4BH7B 4DGVH 5GHWL 1FFNB 4MMXC 2CLVB 4XI5D 1HHJB 2R2EA 3U83A 1J18A 4WFHE 3JUYA 4RAHA 4GAJL 2O61B 1Z0MA 2WBJB 5T1DH 3D0VB 3TFKC 4ONHB 2A2QT 2WIIA 3L3OA 1G7QB 3FQUA 3FMGL 5IW6A 4M7LL 4XVTH 2E27H 5DC4B 1ZT1A 3U9PL 3ARBD 3T0BA 2QADD 5BQ7B 1HQRB 3BMWA 3MLZL 4X99B 5F9JB 1RZIB 3GM0A 2I9TA 5BOPA 4TSBL 3RPIB 4MQ7B 1HQ4B 2AI0H 4POZD 5AYQA 4PB9L 1IC1A 4X7SH 3DUUB 3GIZH 3QCVL 1R3IH 3D85D 4GBXA 5EU6D 5CZVL 4Y2DB 3FHAA 2C1PB 5CILL 4NZRL 5BVJB 1H8SA 5DJZA 4HT1L 3DHMA 4BSWB 2EIEA 1OF2A 1FVCB 1C5BL 4MD5A 2VE6A 4NKMA 5DS8A 5T1MA 1A6UL 4DKEH 2Z92A 4MD4B 1B0GB 3O9WD 4LSSL 4JKPL 1W0YT 3ARTA 1T6VN 4QCIB 3QWOA 4U1SA 4UBDD 3EHBC 1ULVA 2GKIA 1HINH 3F12A 4QXGL 1PG7W 3T65B 4YNYB 5C0BD 1AC0A 2BY1A 1D9KC 4NNPL 3L5XL 2FJGB 2R39A 4MQXC 1U2CA 3IDJB 5I1JH 3GSOA 2VDOL 2ESVA 1S8DB 4HBCH 5E7BA 1QLFA 4NRZB 3HUJE 3MJ9L 4O2FB 1RUPL 4UBDC 3P3YA 4EUPH 4XPFL 4XNMB 3WE6B 2OJZL 3WXWH 4Z7VB 2QEJA 4L9DA 2EE6A 3P4LA 1A6WH 1DN2A 4KHTH 4BFBD 3ARFB 2OSLB 2H26A 4MXVF 5MP6H 4Y19B 4KJPD 2CPCA 1QEWA 4MJIE 1RUKH 1KCSH 4V1DD 5HSFA 4K55A 1IC7L 1ZWIB 3HG1B 5CWSA 4HGKC 32C2A 3LY6A 4F7CB 3WKNA 2X70A 4JFFB 4OT1L 3BKCL 3B5HA 3RVXD 4HDIA 5IVXF 5I8KL 1BZ7A 3NVQA 4NN7B 2H9GB 4FTVD 4IBLT 4IRJD 3V6OA 3QHZL 1XR8B 2RIKA 3M8OH 2NW3B 1SBSH 1F97A 1MPAL 4OZIE 1T0NA 5ISZE 4AMKL 3TH4T 5E2WL 5FFLA 1FAIH 3OAUH 4X5WA 3VXQB 1P6AB 3T0WA 4LL9A 4AEIH 3V4VH 1FZKA 1TZGL 4OZIF 5I66A 4L29B 4M6AA 2G5BB 4CU8A 2ATKA 3DMMC 1DBML 3O2WL 4QRUB 2EXYC 6FABL 4TNWK 1UT9A 4K3JL 4UIKL 4TSCL 2FZ3B 1XF1A 1UWXH 4XB7A 4QYOA 4R0LB 3DVNB 3O4OC 4WFFD 3IF1B 2P8MA 3ULVL 3MRIA 2VDML 5FEBA 2EDNA 1Y0LA 2ZJSL 4G6AD 2A1WL 2IAMD 4PJFF 1C08B 5GRJH 3S5LG 2VDPL 4PJ9B 2MHAA 3DO7A 3WFBL 2E8YA 4ZODA 1FCGA 4P3CL 5DD1L 3ARGA 1CLCA 1N7MH 1HIMH 4PLJC 4XNQB 4R8WH 4LRIA 4RNRB 1TIUA 4ONFL 4PJAE 4IM8A 4GS7C 4H20L 5D7JA 4M93B 4ZUVB 4JGJA 1PQZA 1NJ9A 2QQKH 3DSFH 4PGBB 5TE7L 1D5XA 4NYLA 2NY6D 4ZS6D 2AXFB 3ZDYF 3TH3T 3KPSD 1MLCA 4RWHA 5C2UB 1L0YA 1P84J 4P2OC 1F6AB 3MNWA 4XPHL 1YNKH 4YDIH 3TJEH 5DJXA 1I7RB 3HS0B 3MRLB 2WUBH 2X89A 4GMTL 5F1SA 5SWSB 3VA6A 3BIKA 4PJHB 3DSNA 3H8NA 4L8CB 1N8ZA 4BZ2H 4YR6A 1OPGH 3ARZA 1KELL 2IH1B 5FM5M 2EE3A 4KKAC 1BAFH 3FQTA 1EFXB 4OGXH 2VLLB 1VACA 1C5CL 1UWEL 32C2B 3PWNB 4OLZL 2VDNH 1ADQH 2VISA 1IGML 3ARVA 1MCHA 5IB1A 1KLFA 4KJQC 5MENA 1VEOA 5JW4N 1SJEB 1KJ2H 1Z5LB 3O4OB 3MXWL 2E7HA 4NP4H 1T2QL 3VFVB 3VI4E 2XIDA 1G7HB 5CILH 4OBSA 1U9KA 1GZQA 5GRJL 3T08A 3MJGX 3MYZA 1MWAL 3S36H 3OAYH 2R2CA 3EJYC 2KKQA 2PUQT 2YSSA 2PTVA 3GIZL 3ZKMC 4WGWB 2QADB 4W4OA 1XGYH 1S7RB 5D1XB 3PHQA 3V0VB 5FGBC 4M7LH 1UM5H 3HC0A 4G6FD 4C58B 3SDCD 3U4BH 4AJ0A 2F53D 4NQVA 4HIHB 5FO8B 5FA3B 5AZ2H 2VLRD 2CLRB 4R7NA 1IC7H 2AERT 3AU1A 3C60C 1YUHA 1B0GA 1BFOA 5D2LF 2YPLD 1KJMB 2BSTB 5T1KB 1CDIA 3BHBB 3HNTH 4Y16A 2JJTA 4FRWA 4BSWA 3IJYB 4HSQA 2WWMD 1MCQA 3M8OL 1KTRL 4PJCF 5HI5C 5BO1H 4YQXH 3SBWA 1HOCA 1RVFL 1WZ1H 3C6SA 4RGNB 5F7DA 1UJ3A 4KQ4L 3GMQB 1GH7A 2D03L 1CG9A 5C2BH 4JFQB 4HIEA 1ADQA 3REVB 1MCFA 1RZGB 1A7OH 2UZYB 3DVFA 4KTEL 5JW3L 5DEFA 3QO1B 2IAMC 3VMNA 4APQA 3FQUB 1I3UA 3MV01 5HYFA 2ZOKB 3QRGH 3SKUD 1D9KB 4G8EB 3R06A 1F4YH 3O6MH 3K81A 4ZFZA 3PGFL 1T22B 1J12A 3HNSL 2OTWB 2YD9A 1YMMB 4P2QD 2WV3A 3O2DL 4NRYA 3QZWB 3DECA 1GIGL 2HRLA 2ADJB 3B2UD 2Z35A 3LEYH 4N9OB 4KXZH 4NQSA 4P2RB 2IMMA 3VWKA 5DXWA 4AH2A 4NGHL 4NSKB 2PCPA 4OUUB 4U1KA 3OTTA 1J0JA 5D96B 3EDDA 4NBYB 5E8PA 4ELME 3KLAA 4H1LA 1DUYB 1T1ZB 2VLJB 4YHML 5TDNB 2VDNL 1AGFA 1DDHA 2X89D 3NGBB 4WU5A 2Q8BH 3RKDC 4Z7OE 2EDHA 1AIFA 1BQLL 3VXOA 3WO3B 3D2UB 3O4LA 3QULA 2VLKA 1KLGB 3HMXL 1GGCL 4FMFA 4J1UB 3SDAA 5BZDB 4M7ZC 3CDFA 3BEVA 3QUML 3OXSB 4K8RH 2XA3A 5GIRB 1NAMB 4GQ9L 2I25N 3MX0A 3JWOL 1SMAA 5FOBA 4EI5D 1FLRH 3ZSTA 1QFUH 5GGQL 5CEZE 3QG6A 5BRZB 4UOW0 4FFZL 5GGTA 3GHEL 5LWYL 5GIRA 1CR9H 4HPYL 3PGCA 3HC4L 3NTCH 5DUMH 4PJ9D 5C0DA 1GGYA 4HUWA 3MLWH 3TBYA 4U3HA 4ZFGL 2HTLC 4OCRL 3LOWA 1KLGA 5FV2A 5DRNB 4ODVL 4PRNA 4OLUH 2OX5A 3GSVB 3H7BA 3S4SG 4Z8FH 2ARJQ 4RMUA 4CGTA 2LAAA 2DQFB 1AHWA 3ZTJH 4LVHB 3IXTA 2F58L 4G8FA 4NN5B 4NKOA 4OQTL 4J3SA 4DKDC 1DUYA 1T1ZA 5C07E 1GGUA 2XQYK 1WQVT 1T1XB 1R24B 1F42A 3U9UB 5L88L 3DV4B 2PYFB 3L5XH 1LE5B 1G9NC 5GZOC 3I02B 2XNAA 4QHNA 3P0VH 5CMAA 4PRPE 5C0JA 3WNLA 4NO3A 1WBXB 1UXSA 1UXWA 5A16B 4OI8A 1Q0YL 3ZMRA 1NGYA 3VGDA 1CK0L 2OTWA 5DZOA 4P5TB 1U93B 1N2RB 3PABB 3VE0A 2XA8L 3ZDXF 4FA8A 3AREA 4HKJA 4YK4C 2NY7L 4YEEA 5TE4H 4O02H 5CZVH 5CEZD 4UV7H 5BZWB 3MJ6A 2ZOKA 4U1IB 2QL1A 1QO3B 5K9KB 4ZOAA 1LNUA 2H2PC 2BOCA 3WHXA 2YD6A 5GS0C 5I1HH 4NO2A 1QSZA 4OCWL 1MCNA 4XPAL 3ZE0F 3DX7B 1KENL 1JWUA 4NC2B 1MJJA 1S7QB 5LAXA 5AYUH 1C5DB 4POZC 3MMEA 3D1MC 3QDJD 4YC2B 3T4YB 4P99A 4IMLB 2FX9H 5IWLC 3WJLC 5T3ZD 2X4QB 2VQ1B 4U4BA 3UPAA 3VXRD 2EO1A 4JAMB 1IEBB 1VGKA 3QEUA 4U3CA 1D7FA 2XPGA 4WTZG 1TNMA 5LCVL 5TH2B 2OI9C 2GTZA 4Z7QF 4LF3B 2P5WB 3EO0B 5I9QB 3MRDB 4XVJH 2BSTA 4AK1A 4DW2H 1MCOH 3NH7H 5DHYB 3CFCL 5EU5A 2IBZX 1N7ML 1XF5B 2P5EB 4IIQC 4R7NB 1GGCH 3LSOB 2HFFA 3QUXA 2YOCA 3V0WH 2GAZB 4PRBB 2FR4B 1EEYB 1FGVL 1S3KH 3RL2B 1T2JA 1UH3A 5FCUH 4U1HB 4UTBH 1MHEA 4K94L 5EU4A 2GJ6A 1E4XI 3ULVH 4WHDA 3PV6A 4LLMA 4OFYA 2YPVH 1T66D 4IS6A 4W4NA 2W0KA 4F80A 3WSQL 1GJIA 1T89A 4RFOH 3P40A 3LMJL 4P5KA 4ODXB 1JRHH 3H9SE 3VFPA 2BRRH 4N8PA 4ZFGH 3QDJA 5HYQA 3QDJE 4LCUA 5GGSA 5HD8C 3GM8A 1K5NB 1RHHB 4ZQKA 5DEGA 3QJHB 4A6YA 4YHNB 4XXCA 3TYGH 3MLXL 3QIBD 1XGUB 1Z2KA 1A64A 2FHFA 4HHAB 1JN6B 1U8NB 5LXGH 2PO6C 3KPNA 5IF0B 5DSCB 2A77H 3O0RL 3UZVB 2HFGL 5ESVB 3RIAK 3O3DA 4F57L 4TUOB 4YHZL 4LLDB 2ITCA 3RVTC 3L3GB 1B0RA 2JIXA 3VH8A 4YDKL 1YMMD 3HZMA 3RWEA 3EYSL 4XP5H 3U79A 3CH1B 2K1MA 2BMKA 1QLRB 1F3DJ 5GSVB 3MLSH 1A6AA 5I1IL 4EQ3A 5BW7A 1A2YA 3P9LB 1A14L 2Q8BL 1EGJL 1FH5L 4WU7A 3UJJL 1A6VL 2EXYD 5JOFB 1CFSB 1WICA 5GPRA 1D5XB 4LFHD 3ZLQC 9CGTA 4YAQB 5FV1L 3BE1L 3CPLA 1AKJB 1NGPL 2ZG2A 3LKPB 1PG7H 5TQ2L 1VFOA 1T1WB 5IG7A 1VA9A 4O2EB 2Z91B 4M62L 4EI5A 1LDPH 4YHKL 4RX4D 2A6JA 5C0CB 4QWWD 3U7YL 5EA0L 1IC4L 4QT5B 1Q8MA 1LWRA 4G9FE 1AFVH 3S8WA 5GRWA 3M17B 3I6GB 3KPQA 3Q3GB 1VADB 1MQKH 1J9CT 4IRSB 1VHPA 2FDBP 1NGQL 2IBZY 2Y36L 2X5PA 4DKAA 3LKQB 3EDEA 4WNQB 3QFDB 4YDLB 1J1PL 5K33A 4UT6H 1F58H 3C5JB 1LEIB 4OKVA 3ZL4L 4QHLA 4X80H 15C8L 1U36A 4G6KH 2DLTA 4R90L 4XBPA 5SV4A 4BYHA 5D93C 5FYKD 5HYSA 3G5VB 3GMOB 2VIRA 3QQ4A 2XTJC 4QY8A 2DQHH 1DBAL 5I66B 5EPMA 4FMKA 4X9FA 2JK5A 4AG4L 2RB8A 2V6HA 3FQNB 4KROD 4D0CB 1XGQB 3AUVA 3BAEL 2QSTA 3VD3A 1HI6B 4KHXH 2Y5TA 3KR3L 5TFSH 4I9WE 2DLEA 4LQFL 3GKZA 2UYLB 3OXRB 3U0WL 1IAOA 3B2UC 5GRYA 5I30L 3KXFE 2OR9L 1S9VA 1T7YA 3QIWD 3OZ9L 1FLRL 4I4WA 1NL0H 2HLAA 1S9YA 2FX9L 3F7RA 3SDCA 1UZ6E 1H0DA 1QRNB 1FFOA 3EYFB 5DFVC 3VD5A 3LZFH 4F58L 4S1SL 1ZOXA 4FFVD 3DUSA 2OSLA 5A2FA 1ZLSL 2EDOA 5F6HI 5C8JA 3LN4B 3BEWA 1MCIA 4UIMA 4XNMA 1A1NB 2HJFA 2R1WA 4OZGB 4NPYB 3WLBB 5E08L 1NFIA 1RSFA 1DQLL 3ILQC 5B8CC 2JJSC 1S8DA 5FYJU 4M8VA 3QHFL 2W9EL 3NFPA 1U0QA 3THML 5DEZA 5L8JB 2FJGA 3ELAT 4YNYA 3IDNB 4HPOH 2VITB 3VXRB 4GXVL 4OCWH 5EZLA 1XAUA 2BP3A 4MWFA 2J88L 4MXWL 1SYSB 4MDJB 3NCJH 4UILL 1JGEB 4IRSC 2HYMA 3QIUB 4GW1B 2NY7H 2J1KA 4RFEA 3CFDA 2P48B 4M7JL 1TTUA 3Q0HA 2VN7A 5E5MB 4ZOCA 5FKAA 4MJIB 1DBJL 4MCZA 4BUHA 3DUUA 2VWEC 1MCEA 3KAAA 3PDGA 5C0GA 5DRZA 3WS3A 2XY2A 5J6GB 3TCXA 1HHKB 4G6MH 4L4VE 5C0GB 5I76B 2H6PA 4MJIA 1RZIA 1EEUA 2YZ1A 3G6DL 3BP7B 5ACZA 5IMLB 3RTQD 4QWWC 25C8H 3CFDB 3LQAL 3PJSB 1PG7L 5TQ2H 3G04A 2X4SB 4Q6IC 4ZSOE 1KUMA 3MUGB 1NCWL 1ZLSH 3GSXB 3ARGD 1ND0A 4JPWH 4FQ1H 2GJZA 4D0DA 3SQOH 2FSEA 5D1QA 4YHOL 4P9MH 1ZKAA 4PP1D 5C3LD 4FP8H 4GKZB 4R7DB 4JN1H 2NY1D 3C2AL 4OD3H 3UJJH 1TQBB 3L6FB 2EDKA 1CZ8L 3N85L 1OLZA 4LAQL 3K2UL 5I1JL 3ARXA 1G6RA 3G5YA 5CJOL 3CSYA 3L3HB 5CD3A 4KHXL 2PR4H 2X40A 4MAYB 1IGYA 4OD1L 3OKEA 3X11A 4F3FB 2PO6B 3O6FC 5E4EB 4WI5A 4DKEL 3EGSA 3MR9B 3T0XA 2OL3H 3V8CA 4PJBF 2I07A 3EIFA 3RUGE 4K8RD 1LEKA 5CLWA 5GGUA 4D9LH 2EZ0C 2XZCH 4OF0A 3EOTL 5MEPB 3DUSB 4CJ0A 3KLDA 4HWBA 4XC3L 1NLBL 2B7DT 5I1EH 5KVGL 1TLKA 1F4XH 5DR5H 3O3EA 3CGTA 4KJWD 5MEQB 3QI9B 3FFDA 3QEQE 2D4DA 5H2BA 1FL3B 1FVDB 2D7OA 4XAKE 2BNUA 1QBAA 1RV6X 4LSUH 2Q7YB 3KYNB 5KSAD 4DOHB 2RBLA 2V5YA 5CUSH 4Q74A 5JQ6H 4JZJB 1FG2A 2OLDA 3CDYA 3DBXB 3IRPX 4TYUA 3VXNA 1F00I 1MHHA 3FO1A 4Z7VF 5EBLB 5CCKH 5CD5D 1U92A 5T1LB 1SQ2N 1JMXA 1LDPL 1DVFC 3U6RA 1KN2L 2IAMA 4APQC 4Q2ZA 5FDYA 3TVMC 3T0VA 3RDTC 3CX5J 4GRWF 3VG0L 4NQCB 4OCSL 1U8OB 4RGOH 4KJQD 2APTA 2W60B 3TNNB 4XWOD 1ED3A 3Q5YA 4OLWH 5JXAH 3WFCH 3QRFM 2WZPD 2W59A 4QHLB 4OGZA 3OF6A 4HK3N 5AG9A 3HRZB 5CBAB 5T1DL 3RNKA 4DZBB 4HLZG 1NGWA 1EK3A 2DMCA 3DSFL 4QRPE 4BQBA 3EFDL 3QNXB 4NO0D 4KK9D 3CSPA 3K74B 1HCVA 5IW1B 3RIFK 5ICXA 5JA8B 1TDQA 4I18B 2JE8A 1H3TA 4JRXD 5DUBB 4X98B 4FTVA 2PETA 5IG7B 2VZVA 3LKPA 1MVUA 4ISVB 2LE9A 2X7LB 3GUTB 2NY5C 4LNVA 2YXFA 4UT9H 1G9NH 1KNOA 5DMGC 4DFIA 4ETQA 3HMWH 3DVGB 1BGXL 2J8HA 4PRIB 4YIQA 2QSQA 2Y07L 4CMHC 5DDHB 1OTTD 1YQ2A 2HTLD 3L3IA 4X5XA 5MHSD 5GS0D 3KDMB 3HHRB 3P9LA 5KZCB 4QTIH 1VFUA 4PP2A 3SOBH 1IAKA 4TUJA 3DYMA 3MO1A 4BZYA 1UVQA 3QUZD 5KSBB 3MFFB 1K8DA 4AENA 3HZMB 1E6JH 4HIXL 4HJ0C 3H3PH 4RAVA 1QZ1A 1SHMA 1PJ9A 1T3FB 3U7YH 1QOKA 1Q1JH 4XNUL 2GIYA 5AD0B 4DJMA 3DX6A 1NBZB 2AJUH 1FFQA 5F7UA 3CVHA 3BP6B 4OZGF 2AV7A 1GSMA 4U6VH 4XP4H 1P1ZA 2YUXA 1I3RA 4KDTA 3RWDB 5KS9A 5FKPA 3U36B 4ORGB 3ULVC 4EUPA 1H15B 3GSWB 4NQEB 2OMBA 3O9WA 5I1DB 3SGJA 2QKIB 4AEHL 4WUUB 3RHWF 2YD7A 4PJHF 3R1GL 4LP5A 1EEZB 1SM3L 1AY1L 4B53A 4NNXB 4LLUA 4JDVA 2H32A 4GRWE 1JI2A 2VDRL 4M7ZB 4MS8C 4NM8H 1JRHI 4V1DA 4FP8L 5C0NC 4UOW1 3IFOA 3OKLA 1D5MA 2V2XB 1NCNA 3NIDF 3GMRA 1KCRL 4WJ5A 4YJZL 1MFCL 3QO0A 1P4IH 3TA3B 4LEOB 4PV8A 1HN1A 1CQYA 2WBJD 3UTSE 3O9WB 3RWHA 3ZYZA 5HHVH 4EUPB 1OAXL 3JWOC 3B9DA 3TT1L 1J86A 4QXTB 1NCTA 2F8OA 1A14H 2EICA 1A3LH 3ARBB 4P5MB 4XP9L 3RU8L 3VGBA 3WKML 1KT2B 3D48R 2BC4B 5E4EC 4PJ8D 2VSCA 1DFBH 4MAYC 1X9QA 2GJ6D 2G9HB 3CC5A 1ERNA 4NM4L 1UM5L 4K71C 3ARWA 4MX7B 4AQ1B 1VGKB 3BJ91 4JAMA 5E2TL 3D85B 4D0BB 2HKHL 3IDIA 1A6ZA 5IR1B 4GFTB 2DQJH 3VH8G 5EZJB 3NZHL 1TJHH 5INCB 1F5WA 2D0GA 3B5GA 3DYOA 3MMEB 4Z7WE 1S7QA 3DTXB 1FBIL 4BELD 2KL6A 5LBSL 4MAYD 2X09A 1NMAH 3EOTH 4JN2A 3HE6B 5DDHA 4X9BA 1N6VA 3OX8A 1LNUB 4MJ5B 2BNRB 4KC3B 1NDGA 1NCBL 5J1SC 1S5IL 2RGSA 4JEGB 5DJ2B 3O3AB 4IIQA 5FF6A 4LLQA 4CMMA 1F2QA 3T1FB 1FL6B 4HZAA 1K4DB 1M4KA 4KMLB 4DKFL 3L3JA 4WW1B 3GB7B 5BV7C 3EFDH 1C5CH 1MHCA 3ZE2E 4OF3A 3TO4D 1QFUL 3IDGB 4CDGC 3NFNA 1HWHB 5D5MA 3H0TB 3A6BL 3I02A 2H41A 1MFDH 3K3QA 3NFNB 4NJ9L 5D5MB 3SDCC 3QG7H 3BPOC 4OLYL 3F7YB 1RY7B 2D9QB 1I7ZA 4MA1B 3UCRA 1GOGA 1PZ5B 2D2OA 5L2JB 4XTRD 4J3OC 3CMOH 4RGOL 1X5KA 3C60B 4TPRH 5HDLA 3B8YA 1S7WB 3RQ3A 4CMMB 1S9KC 4L3EA 2FHBA 2C7UB 4U0QB 2W9LA 4Z7NE 4UB0L 2F54A 4LSVL 3G6DH 4ZO9A 4FQJH 4MJ5A 2ICWB 3CX5K 4I0KA 3OX8B 4NQCD 1EEQA 5D72L 4Y5YB 4PLJD 3U4BL 3DIFA 2IGFL 3PQYA 4GG6A 2GT9B 5E94A 3DTXA 5T1LA 1Z3GH 3S36X 2WBKA 2RFXA 1P69B 35C8H 4M00A 5BOZG 4PIRF 1IFHH 2BSRA 4JFPB 5IJKC 1U8HB 5ITBH 2VC2H 3D85A 4XP6H 2DQTH 3KS0H 4NWTH 4N90E 2Q76A 4YBQC 3RZCD 4Z7VE 4V2CB 2G9HA 3CC5B 4H8WC 3LD8C 5EB9A 4XCEB 5E7FA 1FVDA 3NOIA 4K9EH 3GBMH 5HYJB 5I1LA 3DNKA 3PWVA 4H1LG 1FDLH 1KGCE 3B2VL 2GK0B 3CCHA 3HLAB 1XT5A 5EZIH 3D2UA 3ARBA 4YWGH 4PJCE 4DW2L 4QXTA 4Q6YA 3GIVB 4ZFFA 1CFVL 1S9WB 3FT4A 1DFBL 2EZ0D 3GHBL 2VERN 2APVA 3QO0B 3UPRB 1WIPA 4JJHA 5DUML 4PUBL 1TJIL 4UTBL 1GC1C 4LSTL 2Q1EA 4U1KB 3BGMB 2ZUYA 1WFOA 4OCXH 3Q6GL 1NCAL 4G7VH 3ET9F 1BD2A 5E99H 4K8RL 2QLVB 1FFPA 1QSFB 4NCDA 2GYSA 5IB2A 4I2XB 4M93C 1EO8L 3NCFB 3V5DB 5ICYB 2DWEA 5T3ZH 1CS6A 4LSQL 5FYKH 4HPYH 5HI3D 3AXLB 1Z9SA 3ARDA 3REWB 1WAAF 1JWMA 2WINA 3CXDL 1NBZA 1V7MH 3SGEI 1LD9A 1EDQA 2IQ9H 5D7LB 5CGYC 1I9RL 1IL1A 1BZ9A 1DBBH 2LABA 2FJHA 2YPVL 4LSUL 5C0AD 1BQHA 3D3VA 3VJ6A 3S4SA 2OS7A 4EVNA 1K3ZA 5F88B 3GMNA 5F7DB 4WFGE 5DJ0A 2YD4A 3ULUC 3HE7C 4AMKH 3O4LD 5ESQB 3CVIL 1BVLA 3CSGA 5D7KD 3GMPB 3L5JA 1QNZL 3NAAL 4CVXB 5T1KD 1K85A 3LPWA 5FB8B 1CGTA 1MLBB 3FOMA 1HSBB 3NH7L 4R4FH 3FO9A 1D3CA 3CLFH 3RJDA 2ADIA 3TCLB 1Q9OA 2VR4A 1FVEA 2AJYL 1Q72H 3FB8B 2XWTB 1Y6KR 5FYLL 2XI9A 1ITCA 2W0PA 5IEKB 3MCLL 4YXKH 2CD0A 4HIIB 1YYLL 4KRLB 4Z6AT 3OKMB 1GPOH 3FQXA 2DQUH 4M8QB 5HGAA 2FIKA 3MREB 3NFPB 3R0MA 4N0CC 4M4RA 5B21A 4JKWA 1S7RA 2HJKB 5C0ND 5B4MC 1NGWB 3FZUC 3KNBB 3VA2C 2HJFB 2R1WB 3GEWB 4RAUB 4HULB 1DSFH 1P7QD 3C9NB 1T04A 4OB5L 1AGBB 4O58H 4Q58C 1JYWA 5I1AA 1UWXK 5HYEA 1CGVA 3FMGH 4L4JA 1ORSA 4Z7NF 1DP0A 3MGTB 4FNLL 2ATPA 1ED3B 1X5GA 4PRHE 4WFGD 5F96H 3X13B 5C08E 3WXVL 3GSUA 3MLSL 5D2NE 1CE1L 1MCPL 2WNGA 1T03H 4ELKB 2Z8SA 1H9VA 2FRGP 4XPFH 4YDKH 4E41B 4CVWA 2IH1A 3VXNB 4QRPB 4NZRH 5DTFA 1XGPB 1HI6A 5IGXL 1JGLL 5DJCA 5JO5A 4Z76A 5SWSA 3MRLA 1S78D 1MAMH 4QRTB 1KN4L 1OAYL 4I0CC 1MCJA 2CRIA 5EPMB 4DGIL 2H8PB 4UV4H 4LVNC 1IZKA 1C7TA 5J89A 3VWJD 1MFNA 1XIWC 5CEZL 2OI9B 4F7PB 5I73C 4XNYL 4ELMA 4WI7A 4X4YA 3G5VA 3GMOA 3QQ4B 1CLOL 4UIKH 4HEME 1BEYH 3QCUL 3O11B 4UTAL 4C56D 2IGFH 1KG0B 4PRIE 2CIKB 1N6QH 3P73B 5GGUB 2GSGA 3SKJL 4QEGA 1UWGH 2A73A 2A0LC 2HFEB 3S35H 3S37L 4AM0B 1NGZB 4QO1A 4RAUA 2EEBA 2EH8L 1IC4H 5KBNC 3HMWL 2R69H 3MA7A 1MWAH 1BBDL 5EZOL 3B9KC 4J3TA 1XIWD 3AB0C 3P9MB 3I6GA 3KPQB 1CXEA 3MNZA 3G5YB 3W0WD 1G6RB 3E6FA 1QFWH 3JVGA 1CXHA 3U4EA 4GG6E 2C3GA 1A21A 2KZWA 1BM3L 5F7EL 5D7JD 3DGGA 1MFDL 4AM0A 1N0XL 1YY9D 4RMSA 4HKXB 3CXDH 4P5TC 4WWKA 1NCCH 3SGJC 4RFNC 5CD5C 4PJAF 3SHSA 2I24N 3FO9B 2B4CL 3QXTA 4JPKH 4L9LB 5I1IH 4BKLB 5HI4D 2HFTA 4JFYA 4N0UB 1E4XL 4F15B 4NRXA 3TVMD 1EMTH 4OSUL 2BVYA 5A3ID 3MRPA 3T8XA 4LHUA 2YPLB 4G6JH 2HTKD 2UY6A 1NC4D 4YQXL 1FDLL 2R2BB 4DVBA 1JHKL 4WGVB 4CRPA 4K9EL 3D25B 3FHQA 5F9WC 2P5EE 4H0GA 2NW3A 4JFDB 1XGPA 5TDOA 1MFAH 1YNLH 4X6FA 2VTFA 5CINH 1U8KA 2V9TA 4P5TD 4MGXA 2CDFB 3INUH 5H8DA 2FWOB 5D7LA 1M1SA 5K9QI 4JDTH 4NKIH 4JRYA 3WFHA 1JTTA 4RFEB 4NNPH 4WEBH 3WYRA 1AD0B 5A1AA 4DGYH 2ED8A 7CGTA 4TVPE 1XGUA 3DYPA 3SDYH 1A1MA 3VI3E 4TN9A 5ID1B 4X6EA 2W9DL 5GS1B 4JDZA 4A6YB 1GOHA 1A3QA 2EXWD 2PXYC 1TVHB 2HTKC 3S37X 2DJ4A 4OM0H 1V7NL 5TDPA 4XWGH 1KTDB 1T04B 5H37H 3V4VL 3RI5K 4YUEH 2ZUUA 4OGXL 3RU8H 1SEBA 1N64L 3TYGL 4JB9L 2UWEA 3O2DH 3BP5A 4IJ3B 4G80A 2X4TA 3KPOA 1I1FA 1QHPA 1LO0H 4TVPH 5I19L 2BK8A 4OF5A 2VDKL 5F7KC 4NJ9H 2D3VA 3IJSB 1EEYA 3T0EE 2GAZA 3TLRA 3TBSB 1H3WM 4QOKD 2DQEH 4X8JB 2JJWA 5HDOA 2ADGB 4LCYB 5DHYA 3MRRA 2HWZH 3HLAA 2MQCA 3DETC 4LAQH 1FVCA 2DTMH 5LKNA 1FL5A 2IANA 2XWJA 3QNYB 3RWJB 1JHKH 2FNBA 3E1F1 2XPGB 4FQCH 4FZ8H 1E0OB 1YC7A 2C3WA 5KOMC 4R4BA 1RZKH 4D9QE 4OZIA 2CK2A 3RZCB 2X4QA 2G60H 4JFZL 2BSRB 4JFPA 4EEEA 3QAZC 4MLIA 5MEOB 3RPIA 3EJYD 4UDTB 4YPJA 5L6YL 1J0ZA 2GCYB 3DX7A 2R1XB 2E7MA 4OZHA 2GUOB 2NY2D 3DIFB 1FSKC 3G9VA 3T1WA 2FGZA 1ETZB 1T2QH 2AJYH 2QTEA 1ITBB 3FN9A 3GSNL 4MXQD 3NMEA 5IVZA 5C6TH 1IGCL 3PWPD 4KZEH 2O61A 43CAA 1E28A 2CLVA 3D9AH 3MRKA 1L7TL 3SO3B 1XF2A 5GRXG 4F9PC 4PPTA 2ZSWA 4OGYL 3WJLA 1QKZH 1S5HB 3LKQA 4ZTPH 4KK6D 3VGHA 3FO0L 5JIKA 1OW0A 4X0KA 2Y25A 3GBNL 1UWGL 4Z78A 4GXUN 4HZLB 1NMBL 2FX8L 3UYPA 3MV8B 5IK3A 3F7VB 2NZ9C 4EDXB 1AI1H 2UV3A 3PDOB 1ONQB 3HAEG 2YKLL 2WP3T 4TRPL 4PJXF 3CUPA 4LLQB 1AKJD 4PBVC 5E08H 3VFWB 4JCMA 5D9SB 1WBYA 43C9B 1CICC 2NLJA 5CJOH 3MV9E 3UAJD 3BWUC 1F4XL 1Q9KB 5I1CL 4R2GB 1AGEA 4Z7WA 3GSVA 1TPXB 4PRNB 3IDMA 3VWJB 5EFIA 3MRQB 4XCEA 1R6VA 4S1SH 1VFBA 1J0IA 1PW3A 4G8IA 2DM7A 4X6CB 3GSRB 5IP4A 4PJAB 2NX5E 4FOMA 5EOCL 3LHPH 4JFOA 3UMTA 3GSRA 1NAMA 4I0PD 4JPIA 1B0RB 4KJWC 3PUCA 2GT9A 3P0YH 3BEVB 2R9HC 1MIEL 2DYPB 3ARDC 3SGDH 1FFRA 3MRQA 2NMSA 5HYJE 3ULUL 3W0WB 4MA7H 1IM3A 3RWGB 3ILPA 4HX1B 1ZLVH 4U6VL 1QA9B 3QPXH 1Y6MR 4F8QA 5D9SA 4XX1E 1J5OL 1UZ8B 3S34L 1KCUH 3VFWA 5D7IF 3RKDD 4PJDE 4NZJA 1AGFB 4W68A 4WV1C 4P4KD 2DQDL 1K4CB 4OCYL 4X4ME 2A74B 5F44A 3QDGA 1SVZA 4QHKI 2BHZA 4AT6B 4C4KT 2JJTC 5CJ5A 5FYLH 3IFLL 3MZGB 5EC2B 4UOJA 3QIWB 2XFXA 4W70A 4Y2DD 3ROLB 4P2RA 5C0EA 1V7NH 4TSBH 4PJEE 5EU4B 3ARUA 4LMQI 5E56A 4OBRA 2N4IA 4ZTOH 4DAGH 3VXUA 3ZYOA 5I1DA 3MZTA 3T2PA 1P4LB 3LSOA 1FL6A 4N1EA 2P5EA 4S1RH 3OMZA 3H9HB 3JWDL 2BX5A 3A6OA 1MCDA 1JF5A 3R8QA 1D9KA 3KXFA 1I3RB 4IOFD 3TT1H 3LRHA 4K3EL 2MNUA 5CJXC 3WMSA 4BJLA 2FBJL 2BNRA 4KROB 1YEGH 5TE6H 3SCMD 4NZUH 5KSBF 3UTSB 4OIAA 1BECA 3EO0A 1INDL 4OZ4A 1ETZA 2F58H 4JFFE 5F9OH 1QPXA 4Y4KA 2GUOA 1KENH 4JQVC 4XAWL 5EG6C 5E70A 3MJ8A 4LNRB 3N1FC 3L5IA 5MEOA 3MFFA 4ENEC 2P43B 1SY6A 3IB4A 1EMTL 3MO1B 4IMLA 4WCYL 2GTWA 1DVFD 1GOFA 5LAXB 5IIEA 1HOCB 3P9WB 3W9DB 3RHWK 4L3CB 3AAZB 5GJSL 4AEHH 4IOFC 5FM5O 1LO5B 1ZEAL 3DMMB 1SJHA 1B4JL 3IJYA 4RDQG 3ZKMD 5A2KH 1IQWH 4PJFE 3QIUD 4P46D 1TCRB 1W0WB 3KVQA 1R5VB 1JPGA 5BMFH 4FS0A 3CDCA 3TM6A 3BZFA 1YN6B 3DX8B 5BV7L 4NHUA 2BHYA 3AU1B 2ADGA 1KTKE 2HJLA 4FTVB 4YHYB 3TBSA 1DUZA 3RL1A 3UJIH 3PXHA 1UEYA 4JFXB 4U7MA 3A67L 2AXJA 3BPLB 3W81A 2DB8A 3V0VA 1D5MB 5CMAB 4QXGH 4OKDA 5D2LA 1U3HA 4QHNB 3EO1B 2FL5B 3EYUH 4GG8A 5DK0A 1J87A 1IKFL 2N7AA 1KJ3H 5DJYA 3L1OL 4JFFD 4BA8A 4CVZB 4D94A 2E7CA 3ZKSD 3RNKB 3L7EB 3BP5B 1JRHL 1BFTA 4CVUA 1KFAL 3QDGB 4XTRC 5CZXD 4NM4H 5HYIA 1S7UA 5SX4I 4IRJB 4YZFE 2R0KH 5DFTA 3NIFF 5DMGD 5FKPB 1TZGH 5J13B 1FO0A 1M05A 5GRVL 4I0PC 1DQDH 4BUGA 1QKZL 4MJID 3BPCA 1UCBL 2AI0L 4JJ5B 4ZAKA 3ARDD 3VI3F 2R8SH 1NBQA 5D2NA 5DD0L 3DVIA 4JZOB 4PRID 5JUEH 4FXKA 3MBEB 2O93L 2D7TL 2W9DH 4FQIH 5BRZA 4JFOB 2J5LB 3D87B 4YR6B 3WDHA 5L8KB 4KKCD 1FG2B 3G5XB 3WIIL 1EJ6A 3D39D 2SEBB 5CIPH 3ZT7A 3LB6C 1UJTA 2P7TB 4TTDC 4RMQA 3HR5A 5DVMA 1FN4A 4HC1L 1BPVA 2VLKB 3H6JA 1YA5A 4PRIA 4MQSB 2ED7A 4L9LA 5EZIL 1RIHL 2OTUB 4Y4FB 4LGSB 1QVOA 4Y1AA 2CKNA 1KTLA 3EYQC 4NDMA 3FFCA 2VXTH 4GRLA 4HXAH 1HH6B 4QHUA 1ONQA 4PGJA 1F3RB 4KVNH 5DUBA 1OP9A 4OF7A 2X4RA 3N1MC 1QACA 2WLZA 3IU3B 3OKEB 3X11B 4R97C 3SCMC 3R4DA 3RWFB 4TUKH 1OD7A 4MQTB 4XWOC 1O7SA 3HI5H 3RRQA 1I85C 2ZOLA 3SDXE 2WBJC 3ZT5A 5I8EA 1WTLA 2E9WA 5ISZA 1MRCL 1R3HB 3LPFA 4HEPG 1FO0H 4IEFB 5JHDE 2CIKA 3L95A 4JO3H 5IB5A 1JYNA 1EUTA 5D8JH 1KF9B 1HSAA 1NFDE 4HLJA 2BVEA 4Q9QH 4WW2B 3RUGB 5TF1L 3PJSA 4JGUA 5HYSG 1HZHH 5J3HC 2H8PA 2F54D 1KYOJ 1FE8H 2VDQH 4CJ1A 3OQ3B 1NMCC 4MNQE 1MCKA 5J12B 4R6UA 2ID5A 5I75C 4PY8I 5DO2C 5I1GL 3JWNC 1IKFH 4ERSL 2F53B 5IUSA 2CRMA 4P2QE 4MVBD 5C09B 3MRNB 4KUCF 1XH3A 4G5ZH 5T5NG 1F4AA 1X5LA 3ZE1F 1TZIB 3EO9H 4WENB 2XWJB 1MI5B 3QIUA 4GW1A 3HI6L 3V5HA 5T1KA 4XCYB 1U91B 1J1XL 4TULL 4Y4KD 5FYKU 4DUWA 1OT2A 1NCAH 3C08L 4GXUM 2ATPB 3CK0L 3MLVH 3N06B 2WW8A 2OR7A 1UKQA 4R96A 4HJGA 3HNTL 3IJSA 1T20B 3RZWA 1TJIH 1QLEL 1NFDA 5I71C 4LSDA 5I1CH 4Q9RL 5D1XA 1U41A 3HPJB 4JRXB 4Y5VC 5ILTH 1QLFB 4KTDH 4JVUA 2K7PA 5CD3B 1AGDB 3CSYB 3LEVH 4PS4L 5T33L 2JB6A 3ISWA 2XKNB 5IEKA 2Q3AA 3FB8A 3IFPA 2F53E 3LEYL 3L6FA 5C8JB 3KWWA 1OOAA 1A7NL 4EZMA 2X4OB 1TVHA 2V2TB 1FBIH 2EYRA 4LEXH 4KRPB 1TNNA 2E9JA 3GO1H 1IT9H 5MENB 2Y5EA 3GSXA 5ALBL 4MNGA 1DL7L 2VXQH 8FABA 4U6XB 3G04B 3OSKA 4S1RL 4Z7UF 4XHJC 1V5JA 2DAVA 2FIRT 3GMPA 2C1PA 1LHZA 2VLLA 3VDCA 1XH3B 3DXAE 5HGBB 3QXVA 4R4FL 5E8OB 1WTGT 4KKBD 4XBGB 4OIBA 2Y5TB 3LH2L 5C0IA 1DQLH 5DVLA 4I3SH 4XBGA 1PEZA 1UYWH 2IEPA 4X99A 5F9JA 4M9PA 4ESKA 3QEHA 1U8JB 5E5MA 1OTSD 4JQXC 4BQCA 4RDQF 1WC7A 3D2UD 4WCYH 4XH2A 5L0QC 4PRPD 4PJ8C 4WEMB 4U6XA 2WINB 5EOCJ 5E9DB 3SDAC 1HSAB 4XCFH 2VIRB 3SQOL 5TPWH 5K9JL 2DLIA 1CD9B 2V2TA 3FRPG 5AEAA 3FB5A 1F4HA 4CN1A 2AK1L 3O45B 1R3LB 4I2XA 1Q0XH 3WO4C 4W6WB 5ACLA 4OCRH 1AR1C 3FN0H 4PGDB 4PJBB 4PGEB 3QJFA 2K9UA 3IVKA 2I5YH 1M7IB 3DX9B 4S1DC 3PWLA 3ETBF 1AXIB 3PGDA 4E41E 4FNLH 4LSRH 4ERSH 2R0KL 5E2UH 2MHAB 3DO7B 3SPVB 5L2KB 7FABL 4YPGB 2F74A 1C08A 4MAUH 2ED9A 3WFDL 1GZPA 3HPJA 1U8QA 4NFCA 4I5BA 2NY0B 5IBLC 3MRIB 2NX5D 4GW5B 2PW1B 3MRCB 1GGTA 1WWWX 3VXRE 1OT1A 3LQAH 4Y1AB 1UA6H 4WFHD 3RBSA 3RA7L 3QT2A 2DQUL 4LHQB 3KJ4B 4QF1B 1NAKH 5JOFA 4L8SC 1WEJL 3TO4B 1CTNA 2FEEI 1MI5A 1M7DA 2IG2H 5LG1A 1KB5A 1NBYA 5GRZA 1RZFL 1IKNA 1RFDH 1TVBB 3PWPA 4JVPA 4GQPH 5FGCB 1Y6NR 2VO5A 1A6AB 3C6LC 1JVKA 4HF5L 3C5SA 3F65A 2AP2A 4HUKB 3BT2L 4Z76B 4OLZH 1BWWA 3GRWA 2LVCA 1N59A 3DRQB 1CQKA 1XGQA 1MAML 4FXKB 5DLML 4E41A 1BZ7B 1RK0B 3INUL 1G9ML 4HDIB 3AGVA 4KY1H 2ITCB 4XHQA 4XMLL 5DJ8A 4LLYB 5GISH 1PX4A 3G5ZB 5I6XB 3BPNC 5IOPB 1LO3L 4YHNA 4ALAH 4FZEL 1ZLVK 1CD8A 2YUWA 4GLRI 1LEIA 2XWBA 2PR4L 3C5ZC 3EKCA 5C0FB 5HGDA 5JPMB 5BS0E 1QBMH 4N0CD 1HH9A 3R1GH 4DQOL 4Z77B 2ZWLT 4IRSA 4JHBA 4N5UA 2BDNH 2OMNA 3ZTNH 4ZXBA 2FL5A 5F9AC 3M17A 4JFHD 2UVFA 4NZTH 3IU3A 1FIGL 2FIKB 3MREA 4J2XA 4OLWL 2KQMA 4FQXB 4HV8A 4PJ5D 2C1OA 2CDGB 3HZKA 2Q87A 5F7EH 4Z7QE 3VMOA 5C0RL 2IPKA 3OKKB 1I9JH 1KJ2A 1MHCB 2A6JB 4PRBA 4XX1G 4ZUSB 4EI5B 3S88H 3F12B 1JK8A 3HMXH 4EKXA 1EPFA 2ZKHL 1KTLB 3VD4A 1IGIH 3B43A 4LCWE 5DJ2A 5C70A 1RURL 1C1EL 3TA3D 1MLBA 3FOMB 3CIQA 4YUEL 2OXHA 5FB8A 4LF3A 3P77B 4HCRL 3RFZC 3TIEB 1YEIH 2EIBA 2RCSL 3JTSA 3HR5B 3GRWH 4PJCA 4YXHL 2H45A 1IMHC 2V5MA 4FFVC 4P9HH 1PBYA 3UDWA 3WFEH 4K07A 1IJ9A 1I1RA 5ENWA 2J8UE 3FT2B 4D0BA 4PJ7B 3AS2A 3BDXA 2VNCA 4XPTL 5FDWB 4PG9B 1JWUB 3RI5F 1INQA 1BGXH 1HWGB 3QBTB 1VGEH 1WIOA 5BQ7A 2APBA 1R3JB 4G9FB 5MERA 1HHHA 2VAAB 1BFVL 4MCYB 4M7KH 4JRYD 2X1OA 1G9EA 2XQBL 5BO1L 1FO0B 1CGSL 1M05B 3TH2T 2VOTA 1QSEA 3AREB 5FYJL 4HXBL 4P5TA 2WQ8A 3EDFA 1AQDB 3QUKA 3MLTB 4NC1E 2FH6A 2BJMH 4WWKD 4OF8A 3STLB 2Y7QA 5DD3H 2VR5A 4CADA 3QIBB 4ONGL 5DK0B 1K2DA 3EO1A 1HNGA 3VMPA 3DROA 1ZS8A 3STLA 2D7TH 1MFCH 4GJTB 3GMLB 1WWAX 4LRNH 4JFXA 1K8IB 5IMKA 5HXMA 2ICWI 2FD6H 3WL9A 1CWVA 4NKOB 1N4XL 3WIHH 5KANG 2GFBA 3B5TA 4NQEA 2HFFB 4M6NH 2H1PH 4NQTA 4K3DL 4YBLB 3EJZD 5JR1L 5FA4B 3PP3K 4LDLB 4NHUB 1I9EA 3RWDA 3BZFB 5KVFL 2AJZB 1LEGB 5B4MD 3ILPB 1HINL 4O02L 5EO0A 5B22A 3W0WA 5HYJA 5CCKL 1SJHB 4H20H 4X6CF 3GSNB 4Y4KC 4P2CG 3VFMA 4P9HL 4RBPK 1RJCA 4JPIB 4LPWA 3CLEL 4ETYA 4UTAH 1DR9A 2PXYA 1INQB 5C09D 4GAGH 2AEPH 4EN3C 4OTXL 3MRFA 1UVQB 4YHZH 5KOVC 2QQNL 3MBXH 4PJAA 1ZA3A 2WSKA 4L4TE 3MV7D 5JNYB 3QH3B 2YMXH 5C07B 2NY1C 4LNRA 3D39A 1MIML 3MROB 3TP4A 5ITFA 3JTSB 3GK8L 1R3IL 4OAWA 4NO2B 4W4OC 3DV6B 3S3JA 1U8PB 3T77B 5I74B 5LGJA 2EXWC 2PXYD 1IBGL 4ETQB 3LEVL 3MV9B 2E27L 3U9PH 2C7UA 1EVUA 1KEGL 3MLZH 5E6YA 4H88H 7FABH 3BKCH 1KXVC 2AABH 4D3CH 1NL0L 4G7YH 4HCRH 4NM8L 3BGFB 4MAUL 1DDHB 3PDOA 1TITA 4P59H 4ZUSA 4YH6A 2J2ZA 3NIGF 1KJ2B 3VXUB 2B4CH 1CFTB 1RQ5A 2BY0A 5L2JA 3F7YA 2QV2A 2EDJA 4M1DH 1X5YA 4PJGF 5GGVL 1Q0XL 3VWKB 3EAKA 1RUAL 3ARPA 2VB5A 3OKDA 3QIWA 3ROLA 4MNQD 1LP9E 2NXZB 1WT5A 2HT3D 3IDGA 3BD3A 4DZBA 3NCBB 1LGVA 1T1XA 1T2XA 3OV6A 3CFKB 2R56H 2W0LA 1CFNB 5F8QC 1S7SA 1SEQH 5E0QA 3F7PC 1X5IA 4WFEE 4MJ4A 3QDMA 2EDLA 1ZTXH 1AHWB 3SE8L 3VGGA 1E28B 3MRKB 2VMFA 3BQUB 5GS0L 4A6YL 3LCYA 1G7LA 4NQCA 4LKCA 1OQXA 3WFEL 4Q0XH 3MODH 2ZG3A 5HVGB 4M43L 4YX2L 5J3HD 3REVA 3BZEA 1E4KA 1RK0A 1Q0YH 4UDTA 5DJAB 4JFQA 4JQIL 1NKRA 4TNWF 3QNZA 3RWIB 3C09B 2XKUA 3DBXA 1DLHA 5F8RC 3MRFB 1F11B 4JZJA 2ZSVB 1U3YA 1ZMYA 4ODUA 5E2WH 5F71A 1VFBB 4MJ6B 3SKMB 5TJWK 3V0WL 2WWKO 4ZDHA 1F58L 1P7KB 3TO4A 3IDMB 4WTWA 3OKOA 1Z3GL 4PS4H 5IBUG 4DZ8B 3B9AA 3QPXL 5FECB 5DK2A 1YUHB 5J11C 2VJXA 4U6HA 1FIGH 1OQOA 2CSPA 1IGMH 2AVGA 4LVOC 4WU5B 1JE6A 3RWHB 3PNWB 2CXGA 5EIVA 5IMKB 5HVFB 2BERA 4H1LB 1KXTB 3EYOB 4PTUA 3SE3A 2ADFL 2YRLA 1OGAE 3T04D 5HHVL 2BY2A 2MPAL 5FYJH 4MAYA 1IGFL 1S7XA 1MCCA 2XZQL 5L2KA 1I1FB 5GGRY 4J6RH 2NZ9D 3C6LD 2LTQB 4FZ8L 3WXWL 4P3CH 4PJ5A 5DD1H 4JG1L 3EZJB 1T6WA 1GZQB 2B39A 2DL2A 4PJBA 4URTB 1RJZA 2HFGH 3K4ZA 2DTSA 1KTDA 3A6CL 3C09C 1YMMA 4ONOA 4KUZL 1EFQA 2J6EA 2YUVA 1H3XA 4ORGA 1PEWA 1JGUL 2GJZB 4D0DB 5GS1A 4LOUC 5FO7B 4MCYA 3OG6B 3QFJA 4XPBH 5DQDL 2EDQA 1D5ZA 1LP9F 3PWNA 2OBGA 4G9FA 4JRYB 1UH4A 3WFHB 4XH2B 5LVEA 4KGJA 5JW4M 4MNGE 1IM9A 3MGOA 3QEHB 2R1XA 4OZHB 3VFUB 5FDWA 1AHWC 4RAVB 3SJVE 4PJDF 2G5RA 2MCPL 1UJ3B 1ZLWH 5IESH 3KPMA 5IFAL 4LOUD 4U1NA 5B3NA 3RZCA 3KPPA 2FHCA 4R4BB 3PL6B 2BNQD 4E41D 4YHLL 4OV6F 4X80L 4QRPD 3MRPB 4WO4C 3T8XB 3RWJA 4NOBA 3O2VL 4MXWH 5GJTL 1OGAD 2FECL 2YR3A 4DWHA 3QI9D 3GJFA 8FABB 3KLHD 4XVUC 4YDVB 3T2OA 3PQYD 3LV3A 4HBQA 5J7CC 1OARL 1PQZB 2CK0H 4NBZB 5DZNA 1BVZA 3DGGB 2JJUA 5GS2H 4NFBA 3CVIH 1I1YA 4O00A 4FQXA 3MNZB 4FFYL 4JE4B 3CJJA 1AGDA 2OZ4L 4PRHD 1OL0A 4PJHE 3QNXA 4LCIH 3S96B 2EIZA 4ZXBB 2H2SD 3RDTA 1SVCP 3BH8A 2YWYA 3SEPA 4GMTH 3GFUA 3TWCL 5F3HB 2FGWH 1SEBB 3IF1A 5HGDB 1F3DH 3LDBC 4OD1H 4NQXB 2HFEA 4CAGA 1V7ML 1P7HL 1OHQA 1KCSL 3HE7D 3P73A 2LVEA 3OB0K 1KXQE 2DMBA 4NJAH 4D8PB 4R26H 4JDZB 2MSPA 2BNQE 1HDMA 1U91A 2X9YA 5IB1B 4MB5A 2CKBL 2GITB 4JN1L 5LGKA 1OAZL 2XRAH 4X5WB 1CN4A 4OIIL 4DCQA 3FQRB 5I16A 4EUPG 2Q3ZA 1U3JA 5TGBB 2FWOA 3IFNH 1EFXA 1U92B 5HVWA 3J8F7 1VDGA 4NGHH 5CZKA 3MV8D 4I3RL 1N59B 5BS0D 2EE9A 3QXUA 3CD4A 5DVKA 5JOPE 2Q20A 2N7BA 2Y06H 1FZJA 1DQJA 4H26A 3UTTD 3PWPB 2E9BA 1NBYB 2ICCA 4G8GD 1JZ3A 2AEWA 1CD1B 3NPSB 3J7HA 3UZEA 4Y0GA 1JZ4A 4G6AC 4HGMA 4QY8B 1DBKH 5HYSB 3QRGL 1AQKH 5MEPA 1T89C 2F19H 3MODL 4WWKB 1CLZL 1MCBA 1EX0A 1A6TA 5F89B 1INEH 1JTOA 3VFGH 2B8OT 4O4YL 1EGJA 4RNRA 1DQTA 5T5NF 1GCFA 2D7MA 3EGSB 3B6SB 4O2FA 4RWYH 4JB9H 1CZ8H 4DGVL 3BP4A 5JW4R 3VDBA 3U30B 2J88H 4G8GA 3S96A 4PJ9A 3DPBA 5J9PB 2J7LA 1MCWM 3I2CH 3RNQA 3DX9A 1MH5B 2FBOJ 3MCG1 3QJFB 1I7UB 4LPCA 2HT4D 3KPLA 4OFIA 2XWTA 1NGZA 4DEPC 3RX7A 4F9PA 4Q0XL 2IPTH 1FQ9C 3FB5B 4NDMB 4LDOB 1QVOB 4ZYKB 3UBXA 3O11A 4ZNEE 1NEUA 1T21B 1ND0B 1I7TB 4P9HC 4K7FA 2DQCL 5J57B 5KSAC 2ICEA 2VXVH 3P4OA 3MLUH 4OFYD 5TQ0L 1U8JA 4OB5H 3IDYC 4GBXB 4NQDD 1NLDL 4OD2B 4RGNE 3G6JE 5AWNL 4PRAA 2D9CA 5DTFB 5DRZB 2NXYB 4MQ7A 2QHRH 2ZUQB 5D8JL 3MTRA 3HZYA 3MV11 4FQXC 3AM8A 3RDTD 2AJ3A 2XA8H 3ZE0E 2CK0L 4JJ5A 4ZAKB 1YEHH 3HG1A 1JI1A 1ZWIA 2FLRT 1LVEA 2C3VA 4NP4L 1I85A 5KS9E 4QRRB 1YEFH 3WNMA 1BJMA 4ENED 1HHJA 2R2EB 4G3YH 2CLZA 1FFNA 2DI9A 4NUGH 3S5LB 4TQEL 1WK0A 4BK4A 4WI8A 2Q8AL 2CR6A 3VXRA 4Y8AA 2VITA 5IHZA 3T0ED 3IFPB 3BN9D 4PJFB 1BJ1H 2XKNA 2AKRB 5L7XL 3SDDB 2YC1A 1DCLA 1NSNH 2JB6B 2WBWB 4YLQT 3DI3B 1H5BA 1JTPA 3HC3H 3L7EA 3KNBA 4TOYL 3BN3B 4JRXA 1KCLA 3WHE0 1Z9MA 1IRAY 4OZGA 3CZFA 2LAGB 2HN7B 5HGAB 2AEPL 4OLXL 2YRZA 4UIMB 5HHMB 5HI5D 2R0ZL 5T5FH 1J7VR 1EBAA 3QUZB 4XC1H 3VFTA 3WN5B 1Q9OB 3MRMB 4XI5C 2PTTA 4LK4A 3NACL 3ZE1E 2EKJA 4RA0C 3GMMB 1J05A 1M6OB 4C56A 4LLVA 4CW1B 2C4XA 3HE6D 4KVCH 4GG6F 1LO5A 3BVNA 5B39B 4HFUH 4ODUB 1IAOB 3SDXA 2OL3A 1CGXA 5C09A 2NY3D 4NZDA 3VG0H 4NZTL 5IVXE 5IVXA 2YHGA 4EVNB 3VJ6B 1Y18B 1JZ5A 4KK5C 1C5DA 2FJHB 3OGCA 2RQ8A 1VKXA 1MFEH 5HVHC 5HJ3A 1HQRA 1RJYB 5K9QG 2LU4A 1ZT1B 1EAJA 3BAEH 4Q9BA 2YEZA 3ZKQD 4WDIB 1RAMA 3O8XC 4RISL 3UTSA 5D7IB 4EI6B 3BQUA 2ZCKL 3BDBA 5C92A 5ICYA 5FXCH 4XBPB 3BYTA 3BKYL 1REIA 3WO4B 4AYFA 4YHIA 2NY3C 3DHJA 5DD5L 4M5ZH 1CFNA 1BIIA 1H3UA 4WNQA 5L88H 3ZYIA 3VG9B 2X9WA 1UXSB 4JY5L 3H3PL 5L9DL 1GHFL 3L3KA 4PJ8B 5DZLA 2QQLH 1CLZH 1LE5A 2O5YL 1FJ1B 3TBTA 1RZJL 1YPZE 1ACYH 2VLKD 4LSPL 2D4FA 1YEHL 4LBEA 3H3KA 1K4DA 3EYQD 4J8RB 1R5IA 5FF6B 1XF4A 4B5EA 4Q9RH 3FT4B 1J0KA 4KKAD 5JHLH 3FTGB 3QUYB 1FPTH 3D6GA 3IRZA 5MP6L 1JV5A 1YY8B 2D7NA 4Y7MA 4HX1A 1P5UA 1SMOA 4OI7A 4N0UE 3WUWG 5I15L 1U3HC 4OAWB 4WU7B 4JM2A 5HYJD 3QR2A 1KCUL 1TQCC 2ERJB 1QQDB 1B2WH 4KDVA 4KRPC 3MJ7B 3D39B 4XAWH 5D6CA 5C07A 2BNQB 1MCSA 3FB6A 3DGCR 4Z9KB 1AGCA 5F72S 3PWUB 4P2QA 3RTQA 3IDIB 1TFHA 3FRPA 2DTML 1ZLUK 4C59B 1G9MH 4X6BB 5H35B 4WHYG 4N90D 4ZO6A 1QBML 3MJ9A 3DRTB 1U6AL 3KR3H 1D5IH 5EU6E 3U48A 2XICA 3WBDA 3O6LH 1OP3K 1OAUH 1VFAA 1JNLL 2ICWA 1KGCD 2OJZH 5D2NC 4UNUA 2V7HA 5KSVA 5FGBA 2DQGL 2NLJB 3TBWB 2A9NL 1K5NA 1NCDH 2G75B 4AG4H 1ZE3C 3U0PB 1JPFA 5AUMA 1GHFH 1K8IA 3QEGL 3BZ4A 3F7VA 3RVVD 1FCCA 1FZMB 4CKVX 4IS6B 2X42A 4IOIA 3IFOB 4HZLA 1H3PH 4L8BA 2J4WL 4Z78B 1DN0A 3H0TA 1RU9H 5DURD 2Q6WA 3WNNA 1J8KA 1XCQA 1WFNA 1T5XB 3KPRE 5C0RH 3PWJB 4XMPL 4JM2F 4F37F 1DEEB 3SJVB 3ME0A 4WUUA 1YEFL 3B2VH 1L0XA 4N0YH 2HJLB 4AEIL 4ZFZB 3U36A 2NY0D 4P49A 1D6VL 4YFDB 5L8LB 4DOHE 3EOBA 5EC1B 2DL9A 3FRUB 5CJQH 2VXUL 4YHKH 4ZFOL 4GAYA 1TMCB 1EO8H 5GZNC 4Z18A 4X4XA 1T1YA 2X4PA 5D2LE 2OR8A 5DMJB 5TH2A 4U1JA 3HFML 3RGVA 4JFEB 1G7JB 4KZDH 4JREB 1G1YA 4KK8C 4YFEA 4AENB 3FT2A 3VRJB 5KSBA 3NFSL 5ENWB 3SDDD 5E6IB 5EZJA 3U7AA 5IT2L 3C6SB 1D5IL 4K3EH 5C0BB 5GJSH 1G7JA 1EGJH 4MX7A 3MXVL 5I30H 5J4MA 1M71A 3FCTB 3B3IA 3TIEA 3U0WH 3F62A 2KZ1B 1OW0C 1ZV5A 4P4RB 3BT2H 5FM8A 1KIQB 4J3XA 4XHJD 2BC4A 4U1IA 1UKSA 1KT2A