3FU9A

Melanocarpus albomyces laccase crystal soaked (20 min) with 2,6-dimethoxyphenol
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase-1
publication title Structure-Function Studies of a Melanocarpus albomyces Laccase Suggest a Pathway for Oxidation of Phenolic Compounds.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
total genus 166
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu9A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu9A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu9A03
1ASQA 1AOZA 5B7MA 2CBPA 1IUZA 1NIEA 2ZONA 1ZDQA 3KW7A 5AKRA 3NJJA 4AZUA 2DWSA 3AG1B 4CSPA 2JKWA 3TBBA 2HX9A 2P80D 3WIAA 3QJQB 1AACA 2XV2A 2YXVA 5B7FA 3EH4B 1JXFA 7PAZA 4KOBA 1JOIA 1W6WA 2QPDB 4YSRA 3NP4A 4F2FA 3HEIB 1ILUA 1NWPA 3JTBA 4A67A 2PP7A 3CZUB 1J9RA 1JZGA 1RZPA 1AR1B 3S8FB 1OOWA 1R1CA 2BZ7A 4A68A 2I7SA 4E9TA 1AANA 5F7AA 2FT7A 4E9VA 4DP2X 2JXMA 2X87A 2GI0A 4DP8X 1JXDA 4E9XA 4EF3A 3ABLB 2EIMB 1A4BA 1UATA 2XLLA 1W8EA 3UAAA 2XX0A 1L9SA 2VSKB 4AKPA 1TEFA 3CG8A 1DZ0A 4YVUA 4DP6X 1NWOA 3QJSB 2VW7A 4BK5C 5I26A 2XX1A 2CJ3A 3UACA 1J9TA 3ZDWA 2FTAA 2UXTA 2XV3A 3OM3B 2XVBA 2OJ1A 5B1JA 2YAOA 3NJLA 3CDZA 2J56A 4NAJA 1KDJA 3H4HA 4HCFA 3CVBA 3FSAA 1PZAA 3FSWA 2H47C 2HRGA 4DP4X 3OD3A 1J9SA 1GS8A 5I5MA 2IWKA 4DP1X 3NJGA 1FWXA 1ET7A 2I85A 5I6NA 2Y1AA 2TSAA 3IBOA 4HALA 4KO9A 2GIMA 1JZEA 2OV0A 2BP0B 1GY1A 1HAWA 2BHFA 2GSMB 2IDSA 2XU9A 1PNDA 3X1FA 2IAAC 3QJUB 2PCYA 3BQVA 3FT0A 4UF7C 3NYKA 9PCYA 1OCRB 2J5WA 1NDTA 1OE2A 1AAJA 2XXGA 1BXUA 3JT2A 3T9WA 5D4HA 5A7EA 4QKTA 3D12B 2LLNA 1JERA 3G5WA 4YSDA 1W6LA 3AG3B 1EHKB 3N55A 1PZCA 2PP8A 3ABMB 4TXVB 4DPCX 4G70B 1TEGA 1IBYA 4YSOA 2FQFA 1I53A 1BQRA 4HAKA 5D4IA 5E9NA 2BW4A 2IH8A 2ZOOA 1ILSA 1GSKA 3WNJA 1KYAA 1ID2A 1OF0A 1BXAA 1PLCA 3UABA 1A4CA 1CUOA 2IH9A 5D4JA 1GYCA 2J57A 2YARA 3T6VA 4UANA 2ZWNA 3QPKA 4CSZA 1KV7A 2IDQA 1WS7A 1J5DA 1OE3A 1ZDSA 4KNSA 4AKOA 2VM4A 4Q8BA 1PNCA 4DP7X 1EZLA 1M9WA 2MRYA 4JKNA 3FU9A 3IE9A 4KO7A 3PPSA 2VW4A 2Q5BA 1L9RA 2VMJA 1AG6A 5ANHA 3S3DB 1L9QA 3FPYA 2DY2A 1ET5A 3S3BB 1JZIA 1VLXA 5I5IA 4DPBX 1BAWA 3X1BA 4G7RB 2FQDA 4E9YA 3FSVA 3IEAA 1PZBA 1A8ZA 3KW8A 1BQ5A 2VN3A 2FT6A 3AG2B 3WG7B 2FQGA 1E67A 4W1TA 4BDVB 3FQ2A 4HCIA 1E5ZA 1AS7A 2BZCA 1F56A 4G71B 1GS6X 2W8CA 3X1NA 4A2HA 1MDAA 3QQXA 3FYEB 4GYBA 2BP0A 3NJIA 2R7EB 1JVOA 3QJRB 4YVNA 2CAKA 3DIVA 4BXSV 2Q9OA 3SQRA 1J9QA 4Q89A 1NTDA 1PF3A 5I6LA 2FT8A 2BO0A 2CCWA 2DV6A 2IWFA 2N0MA 2PP9A 3T6XA 3NJMA 1T5KA 2B08A 2YXWA 3GYRA 4GP5B 3S8GB 3RYMA 3PXLA 2VSMB 2AZAA 4HCGA 2XV0A 1KBWA 2GB2A 1A3ZA 1MG3C 4KO5A 3V9EA 3QJVB 2UXVA 2IWEA 1IKOP 2MTAA 2WO3B 3ZX1A 3TU6A 1NIFA 1CYXA 1L9PA 4FAAB 3ABKB 1AZUA 2WO2B 4P5SA 4PAZA 4GY4A 3T6ZA 1X9UA 2GC4C 1FA4A 2AFNA 1MZYA 3X1GA 4E9SA 4YSEA 1ZIAA 5I5JA 3ASOB 1M57B 2YAEA 1WA0X 4HHWA 3NJHA 1E5YA 1IC0A 2PPDA 4A2EA 3L45A 4E9QA 1BYOA 1WA1X 1JZFA 1JXGA 1AQ8A 1A65A 1CYWA 3TASA 3AY2A 2IDUA 1NICA 2HX8A 5TK2A 2E86A 2YAPA 2HXAA 4HHGA 1SFHA 4FA7B 2HX7A 3NSCA 1E30A 2EILB 2H3XC 2UXGA 4AI7A 1ASOA 1GR7A 2QPEB 2VW6A 4NERA 3FSZA 4BDVA 2TSBA 2UX6A 3PCYA 4K9JA 2B3IA 2OCCB 3S3CB 1NIBA 3V9CA 4YSTA 3UAEA 3NSFA 4YSPA 4GP8B 7PCYA 1BYPA 4AX3A 3FYIB 2R7EA 3EHBB 2J55A 3NSDA 1XB6A 2YAHA 4G7QB 1KGYE 2DYSB 1L9OA 3H56A 1AZNA 1XMEB 1ZIBA 2XYBA 3PLYA 3NP3A 1PLAA 5I6OA 1PAZA 3IN0A 3PAZA 1NIAA 1SHWA 2QDVA 1SF3A 1NPNA 2PPEA 1DYZA 4GP4B 2NRDA 1OE1A 4G72B 1JVLA 1ASPA 5PAZA 3TBCA 4UAHA 1XB8A 5LDUA 1E65A 3NJNA 1J5CA 8PAZA 1NZRA 3AZUA 1ZPUA 2PPFA 3DKHA 1B3IA 1NPJA 3EH5B 3U25A 5PCYA 5B1JC 3FPXA 1WS8A 3C75A 4KO6A 1HAUA 1M56B 3PAVA 1XB3A 2XUWA 1SNRA 2PLTA 4L0PB 1QNIA 2GBAA 5TK4A 2FJSA 3DTUB 5EHFA 1N70A 2EIJB 4YL4A 3SBQA 1KCWA 1KCBA 3WKPA 4YSSA 5AZUA 1CURA 1QLEB 2FWLB 1WAEA 1KBVA 4M4RB 4A2GA 2DWTA 3T6WA 1SJMA 3OQRA 3OMNB 5B1KA 3ZBMA 1RCYA 3NT0A 1PY0A 1SFDA 1MG2C 2PCFA 3ERXA 4N8UA 2HRHA 1SF5A 2IDTA 1RZQA 2BP8A 1V54B 1URIA 4NB7A 1ETJA 2GC7C 1RKRA 3CVDA 1SHXA 1KDIA 2AANA 4JHVA 1AZCA 3ZIYA 2BWDA 3WI9A 3FU8A 1V10A 3CVCA 1GY2A 5IY5B 1NIDA 1OCZB 5B1AB 1A4AA 2A3TA 4A66A 4E9RA 4ENZA 3BVDB 1SDDB 3GXUB 4KNUA 1AG0A 2FNWA 4BWTA 2PPCA 4BWUA 3NJFA 2CALA 3FQYA 2HLEB 2YAFA 2YAQA 5AFAA 3T71A 4N4YB 3FU7A 2FQEA 4BWWA 3EH3B 2UX7A 1N68A 2BW5A 1OCOB 4WKXA 4M3HA 3X2QB 3HB3B 3SBPA 5I6MA 1V55B 5F7BA 4X4KA 3WKQA 1ET8A 1PMYA 2YQBA 2YAMA 2XXFA 1OV8A 5FC9A 5I6PA 1GW0A 2BWIA 4A2FA 3FQ1A 1QHQA 4YSQA 2BP8B 1ADWA 1CC3A 4DP9X 4G7SB 2VM3A 1AIZA 6PCYA 4P5RA 2W88A 4HZ1A 2I7OA 3WNIA 3MBWB 2QT6A 4WTQA 3TA4D 1FFTB 3NJKA 4F7KA 4YSCA 4E9WA 1GS7A 4ZK8A 2HZHA 1BXVA 2EINB 2WSDA 2QDWA 1ZV2A 4YSAA 2PPAA 3ASNB 1BQKA 1JZHA 1YLBB 4A2DA 1L9TA 4GXFA 4KOCA 3H4FA 2CUAA 3N2JA 6PAZA 2GHZA 4QLWA 1HFUA 1OCCB 2XWZA 1TKWA 3EF4A 1BEXA 2AZUA 4YSUA 4BXVA 4DP5X 4RH4A 1PLBA 2Y69B 3FU7B 4MFHA 5B3SB 2IDFA 3OMAB 4HIPA 1NINA 2DYRB 2EIKB 3OMIB 1AZRA 1WA2X 2P80A 3SBRA 3UGEA 2UXFA 3UADA 1MZZA 3AW5A 3MX0B 5B1BB 2ZXWB 2AVFA 2H5UA 4AKQA 5I6KA 3CDZB 3ABGA 1TU2A 1AS8A 2RACA 3NSYA 3IN2A 4DPAX 4PCYA 5B7EA 1AZBA 2X88A 4F2EA 2JFCA 5I28A 1SDDA 3QJTB 1PCSA 3GDCA 3AG4B 4DP0X 1IBZA 1AS6A 3FS9A 4W9ZA 4KNTA 3X1EA 4JHUA 1JZJA 3PAUA 1X9RA
chains in the Genus database with same CATH superfamily
1WFMA 5HDBF 2Z34A 5TD4A 2OTPA 2IGLA 2QZQA 1R3HB 4IM8A 2CH8A 3SGJA 1NLBH 5JW3H 4UM8A 1NIEA 4A55A 1YEHL 4OF0A 2V5RA 1AIFB 5G4MA 1G7LA 4H20H 4ZZKA 4XBPB 1KNOB 2OYLA 3F7YA 4E0RB 3BISA 3ZKSD 5HHMD 3W1ZA 3BKML 2A1WL 3CN0A 4KK9C 3TO4A 3ZE2B 3ARXA 1JXFA 1XCWA 5ES4B 4PJ8A 1QBLH 5DD5H 4DO4A 3NP4A 5IW3A 1XV8A 1TQVA 2WWMD 3TEXA 3W81A 4MJ6A 4WK4B 4P46B 2R4SH 3SCMC 5ABDE 2O6CA 3OX8B 1EJOL 2VYRE 3O11B 5AZEL 2VJXA 4E9TA 3Q0HA 2WLLA 1DQML 1VRSA 4Z3TA 2WB1A 3QUXD 4Y1TA 2F8OA 4JQXA 4ZFQA 1BM7A 3ARGC 2WWKO 2Z4TA 3UDWC 4AEIH 4K9EL 2JIXA 2WTRA 5EB9A 5F9AC 3HG1A 1NEPA 1NCNA 4P2RA 5IVZB 3CG8A 3KPSD 4AEFA 4LSVL 2VWEE 4AYFA 5HPOA 1O6SA 1V7NL 1ETB1 3L5WB 5F44A 1AXTL 4PI2A 5AVYB 2OK0H 4AZ8A 3CNKA 2HTKC 2X4RA 4J6RL 1J9TA 4LVHC 4Z18A 1DDTA 3E1ZA 3LH2L 4N22A 5HYJA 4UCFA 5JDSB 3NIGF 2YFOA 2JLLA 2VR7A 3V2AR 4Z7NB 3B7SA 4PP2B 4YHPA 3FQUB 1KTKE 4A04A 4OD1L 5AENA 1HHIA 3O3EB 1CFQB 3IU3A 2Y1AA 2PNDA 3IBOA 4JO3L 1AHKA 1GY1A 4XVSL 4FFTA 2XU9A 3X1FA 4PU2A 5DMJB 2J4WL 5IMMA 3SDXA 4UTAL 2WKOA 4ODWA 4XVOA 4UF7C 1TQUA 5CJXC 4EI5D 1Z9MA 1X5HA 3BSZA 3V4PH 4FTDA 4EDXB 4YHOH 2XXGA 1A1NB 1I7TB 4OFQA 5EZOH 3WCYA 1S7TB 3GJFA 4F7MB 1UWEH 1ULVA 2IANA 5HD8C 4M03A 3JYBA 3TXAA 4IJ3B 3WEBA 2H26A 2ZYRA 1EAPB 1M7XA 3JUZA 3ABMB 5K1NA 4PJCA 4GSDL 3SKJL 1JPFB 4K4KA 1SUJA 3WJMB 1KN4L 3M7FB 4ZX3A 1GVIA 5E6IB 3HIZA 5EUOF 3TA3B 2CD0A 1I9RL 4HAKA 4NOFA 1F3DH 1UYWH 2X4QA 3ARYA 4HG4J 3SEPA 1HL5A 4OH2A 2R2BA 4UANA 1KYDA 3US0A 4JMXA 3GI8H 4YBLB 4ABVA 3MRMA 4AKOA 4YUEL 5SWSA 3QCTL 3RIAF 2H32H 2C4FT 2P48B 4X98A 1QYGH 2CWRA 4B0MM 5F6IC 5T3XE 3L7EA 5MEPB 1L9RA 1WQVT 4P5TD 5C0BA 3QEQB 3LXBA 5D7SH 3ECBB 5AW7B 3QIBB 3ZL4H 1M42A 5C9JA 4K15A 1RV6X 1ONQB 1L4IA 3UL4A 1LTXA 5C86A 1YY9D 5EZJB 4LCWA 1ETZB 5INCA 3K8MA 2ICCA 4IU3A 3BD3A 2YSSA 3KPPA 4X7EC 3FTSA 2WTPA 2EO9A 1HOCB 4NN6C 5FGBC 3VXUB 2P8LA 3EH1A 4KFMA 1SOXA 2GBTA 1G87A 1IBFA 4BCYA 4OCYL 3RJOA 4JJOA 3PQYA 1RHHA 4S1SH 1JJUA 3Q8FA 5ETUA 5IV2B 1T7YA 1MFEH 5E7BA 3L4YA 5EWIH 3RJDA 2GTWA 3QPQD 4NRXA 3T0XA 3D7PA 3FQTB 4KKAD 1KG0B 1S5IL 4NCC1 4WI0B 4Z76B 2VXTL 2IWFA 4KK6C 4UT6L 4H1LA 3EGDA 4X5WB 1T21A 1XHHA 2EDRA 3WO4C 3OKEB 5JQ6L 2AK4D 2VXUL 4ES8A 2GB2A 5CGTA 4N20A 3VD4A 4OCSH 1SMOA 4FHJA 5HSFA 4G9FB 2IGFL 2PR4L 4GRMB 2RTTA 1AYOA 5JZ7D 3MU3A 4IRJD 3VRJA 3EG9A 5D1ZI 2VRQA 2O4EA 5ESAB 1HH6B 5FGCB 3WLWC 4HIIB 2X0VA 2VOTA 3FMGH 3I3EA 3TEWA 4NN5C 4GW1B 1A64A 1X9UA 1IC5H 1QLEH 3RNKA 5CZVL 4ZO6A 2VMCA 3E8UH 1WZ1L 2WYIA 3E9UA 3ZE2F 3QDGE 1KIUA 3D39E 3UBXA 2WBJB 3WTUA 4G8GD 4TQEH 4YBQC 2VDNL 2WMPA 4TPRH 4E41B 5MEOB 4A2EA 4M7JH 5JHLL 3FF8A 2NY4D 1H15B 3ABZA 5GIRA 3HCVA 4OZIE 1TTCA 1UG9A 2HRPL 2ICWJ 4NZ8A 5F7YC 4NKOB 2Z35B 2JJUA 2HX8A 1RI8A 2VO5A 2C3XA 1NCDL 3VG0H 4BRVA 1PZUB 4PUBL 3UZQA 2ZXDA 3LKSB 5FX3A 3A22A 3WYRA 5KVGH 3RWIB 3NRFA 4XP9H 4HOMA 3DVNA 3ECVA 3MV9A 1WDAA 2UXGA 5GGTA 3ULSA 4B9ZA 4JO4H 5CINL 2Z0BA 3ZQ9A 3Q43A 3ESOA 1IMHC 2L7EA 3S3CB 3COOA 4NCC2 5HP5A 2GTZB 5D93C 3MRIB 1XZ0B 2YKLL 4LHUA 5JPMC 4AX3A 3DO7A 3AMLA 4JDEB 2X05A 2XTLA 1T0PB 2CKNA 2DDQH 3T2NH 1F0LA 4KUZL 2AQTA 3U9WA 3G6JE 1U8NB 3C5ZD 3OLDA 4Z7NF 2AXWA 3LPWA 3UMNA 3HMXH 3NP3A 4BHUI 1MFBL 3VO0A 1I8IB 3CQFA 4GXVL 1Z5LB 3FUJA 2Y3AA 1JNLH 2QDVA 3T3PB 1SF3A 2A83A 2X2UA 4KX8A 2WKGA 3KGRA 2XWRA 3DJ9A 4GJTB 4N28A 4U1LB 4NXSA 1WCBB 4LLUB 3LN4B 5FGSA 4FQQB 4OIAA 2AEPH 5C3LD 1KB3A 5C0AE 2KYIA 2W81C 5JIMA 1OAUL 3P02A 4GSUA 4G6MH 3RUGE 1E65A 4AYID 4KPHL 3BVUA 4ZUVB 1D7FA 2XWTA 2DMHA 3U30C 5JW5A 2QVTA 5FUOH 2G5UA 2Y07H 4F9PC 5DS8B 3LXUX 2N59A 5F71A 3F6IA 4N26A 1A9EB 3M17A 2E9IA 4YDKH 2AMUA 1CT8B 1J8SA 3VWKB 4JRXA 5DZ9A 2DI7A 1K2DB 1CF8H 3PAVA 4KAQL 3QCVH 5J06A 5KTEL 3DXAA 2XUWA 4WTXA 4WLCA 2PLTA 4QJ5B 4FJYA 4KROB 3RWFA 1FH5L 5HDRA 3CLWA 1CFVH 3FRPB 2LLLA 4YL4A 5CJ5A 3HN8A 3TBVA 2X4UA 2CRYA 5D71L 1LP9E 2KZBA 3LRGA 3KYKH 5IB5A 2VKXA 3PUCA 8FABB 2VERN 3SJVA 3CHSA 5C0DB 2DWTA 1J5OH 5DDHB 3KPRA 2YQ2A 4L18A 4JL2A 3KYMA 1TENA 4D3CH 4TUOB 2SODB 1YN7B 4ZFFB 1NGWB 2Z4QB 1I7RB 2KL6A 2VDRB 4PRNA 4JFPA 5G5DB 5ACZA 4Z95H 2FVNA 4UV7H 5FHAL 3Q9QA 3BI9X 3KLHC 2CIIB 3V6OC 3SE8H 1FAKT 3O41B 1HSBA 3UYRL 4BFOA 3KPOB 5MP6L 4XCEA 3ML9A 3LMJL 5GRVK 1SJHA 1U91B 3F01A 5FCUH 5B1AB 3HC0B 5HHPB 5IROD 2W65B 4LPVA 1QFWM 3MROB 4ENZA 4IKIA 3FB5A 1K6QL 1ZLWK 2OJZL 5AB0A 2QQNH 4RDBA 1S9WA 2CALA 2CBTA 1FLRH 4OZHA 3RWHA 4ZOEA 2I26N 5J8OA 4FKEA 2RHEA 3EGSB 3QUXB 1T89A 3SOBL 4LSTL 5GZNA 2ZUWA 4RIRA 1KJVB 2VZ3A 1F02I 12E8L 4DEPB 3N85L 4M6ML 2Q8BH 1BIIB 4A2MA 1I3UA 1UM4L 4DKAA 2APBA 2QR0A 2YA1A 2P26A 3QO1A 1E2ZA 2DBLL 3KPSB 4GQZA 5CP3H 5TQ0L 3T4AB 2XXFA 1OV8A 3L2LA 5FC9A 1NEZA 3S5YA 1HWGB 4H4NA 4JO2H 1U8CA 2FUQA 5LBSA 4H25A 4CW1A 2V5MA 3PWNB 1H3VA 3AACA 1W72A 2IH3A 3OR6B 3QQDA 4BE6A 1BQLL 1T7XA 3QUMB 5IB4A 5DFTA 1HINL 2G75B 2MIZA 2Z65C 3CFTA 3PYCA 4JFQA 5DHEA 4P2OB 4ABQA 5J1TC 2HZHA 4XNDA 2KI6A 4N2IA 4H8WL 4NFBA 4Q7DA 4RQQA 1A7NH 2MNUA 3MC0A 3GWJA 2EIEA 4XPAH 3E0GA 1GGYA 2EXTA 2G2RB 5FHBL 4KOCA 3JWOH 2QFRA 4WGKA 1B9ZA 1X6LA 1L7TL 4N0RA 3UJJL 2UZXA 3B9AA 5D7IA 5L2KA 3BVXA 2XWZA 4OUUA 4N24A 4D9RD 3L3JA 3SDDD 2AZUA 4BK5A 4EI5B 1OGAE 4RH4A 4CVXA 1YYML 4HH8A 4CKQA 5B39A 2DYRB 2X9YA 2Y6SD 5SWZD 2P80A 4G5ZL 3TWYA 5AG9A 3FNKA 2FX9H 1PKQE 1VHPA 2AVFA 1FJ1A 3HG3A 3ZTJH 2FLMA 2IFFL 4R0LC 3QRLA 2YPLD 1QO3B 1UQSA 3GXMA 5EU5B 1HZKA 2RIKA 4PSPA 2X88A 1HHHA 1K5NB 2WQSA 4OZ4A 3STZA 3IGAB 3ZDZB 1PIGA 4W93A 3IPFA 1AS6A 2AJ3A 5LWYL 2I27N 4GT7A 5DVKA 4DERA 3SGKA 1ASQA 4WO4A 2C26A 1AOZA 2IADA 1UB6A 3P0VH 2C9QA 4FQIH 3VXME 5I75C 4WNSA 3MNVA 4YHZL 4P5TB 3HS0C 5B38G 4P2YA 2NSMA 1J1OH 4JZJA 5EO0A 1R75A 3DV6B 4MJIA 4EDWH 3LKOA 4YDLB 2EVGA 2NY6D 1JZ4A 1FQ9C 1VACA 3OKNB 4EEEA 1ZTXL 3LN5A 3QUYA 4YC2B 4PJFE 4FFZL 5FUZL 1FH2A 3T3PF 3MA9L 2IF7A 1MLBB 3BAEH 2E6QA 4HIJB 4RDQG 4UZSA 3FFCE 2BZDA 4OCRH 4N2HA 4WW2B 3ROOB 2WW8A 4HUXB 3VWJD 1WFJA 3L08A 4FFWC 1JZGA 4LOEA 3WN6A 4LP8A 1N12A 3MV7E 4YE0A 4F58H 5AAWC 4K2UL 4XO4A 3MRPB 2XOTA 2PYFA 3MLXH 2QVFB 4PCTA 1CLYH 2JXMA 3G3LA 3Q3GB 4IEFB 4X99B 4XE5B 4L8CB 1NFDE 5DCCA 3B2MA 1RP9A 3JWNH 1MFVA 5LXGH 3NBNA 3U0TB 2DM2A 2E27L 3PY9A 2GY5A 5CSZB 2QPSA 4YVUA 2FBRA 3KE0A 1A6WH 4FNPA 1KMGA 1OSEA 5CLXA 1NAKL 2WANA 5DWUH 4KVCL 5EN2B 3U6RA 5I23A 1FE8L 1P2CA 2XV3A 2GJZB 3ATDA 1QKZH 3D4ZA 3HFMH 2VH5L 4FL4B 5B1JA 3L9YA 2AK4B 4PJIE 4HS8H 3MACL 5DLMH 2EKJA 2F5BL 3RGHA 1HVXA 4HCFA 5D7LE 1MW2A 3FSAA 4IOSD 2H47C 4IRJB 3RA7H 1XF1A 4X5QA 2X7LB 2EDOA 2N7SA 3OAUL 4DKFL 1JNNH 3N41B 1HC1A 1XXDC 4R26H 3MCLH 2IPKA 2HN7A 1CF1A 1Q72H 2NYYD 5G4OA 4HLJA 1Q1PA 1XTMA 3HLKA 5I82A 3V0EA 5HYQA 2IQAA 4G8GB 4QHKI 1ORQB 5GGVL 4L37B 2J8UA 1AAJA 4YK4C 1BXUA 3KH4A 2R23B 3KWXA 2W9LA 2LLNA 4NZDA 3GXFA 3D0LA 1AGBA 4GH7B 2ESVA 4TXVB 4XMZA 5L88H 1ZA6A 1NDGB 1F4AA 4G70B 1I3GH 3E2HC 2RJMA 2D0FA 3MREB 4NNYA 5F7EH 4QT5B 2CQVA 2FSDA 4CMMB 1HU8A 3QDMA 3MYJA 5KSAD 4X50A 4WWNA 4GI8A 5I24A 1MOEA 3EXJA 3KWVA 4QHKJ 2X4PB 3K3QA 3ARPA 4Y4FC 3AQDA 1KV7A 2BS71 3GGWA 4P4KC 1N2RA 4Y16C 3KR3L 5J5EA 1E9OA 4TVSa 2VXVL 1DQVA 3EJJX 1RZ7H 4AC2A 1K3ZA 1SYSB 1DFXA 1T04A 3PDOA 7FABH 1KCVH 4QLRA 5D6DA 2PYEA 1BPLB 4HA1A 5JO5B 1QVOA 3C5ZB 1ET5A 4DOHE 4GEJA 4P3DA 1MCPH 1INQA 2R1WA 4Y5YC 1XGUA 2W94A 3QSKB 5FS5A 2XPGB 4I1RA 3CH8A 4YHML 3L4WA 4G5AA 4D7BA 4RMBA 4GLRH 2RB8A 1PZBA 3DETC 4FA8A 3L6FA 1CXKA 4X8GA 3BUDA 3SPCA 3TIEB 3FU5A 4YGAB 1YAZA 1DCLA 3RPIB 3V5KB 3P9MA 1CYGA 4OTXL 2OR7A 1DVFA 2E46A 4PVNA 2BC4A 1PU0A 4OFYD 1FSKB 3GSXA 4JKPH 3UROR 3BKJH 4UMGA 3P2BA 3VNYA 3GSUA 5H4ZA 2V9TA 3ZZLA 6FABL 2FJUB 1AC0A 3ZUCA 1GOFA 1N5AB 4MZ3A 1CICD 1F4WH 1XCQB 1RJYB 1ICTA 3SQRA 4FXGC 4JGMA 2CDFA 4Z77B 2PWHA 5HDLA 4LSDA 5B1CA 2BO0A 2E6JA 4Z3FA 2BVYA 1TR7A 1NAML 1FFNB 1CFSB 4LEXL 4JM4L 5E2UH 5AOKA 4HJIA 1QQDA 3ZDZF 2HAZA 2X6BA 2C3WA 1A6ZB 5GZOD 1YEWA 1TLKA 2VSMB 2GW5A 4LIQH 4HC1H 2AQSA 4KV5E 3L1OH 3WFEL 2UXVA 1QHOA 3QT2A 2DLFH 2WO3B 1QBLL 4GSQA 1QATA 4S0HA 3S0PA 1KY7A 5H37H 3ZHFA 4HWEH 1MCBA 3NA9H 3TJHC 1JD7A 2EYSA 2X4SB 1Q9LB 3P4OA 3STBA 3VG9C 3G6AA 4TVPE 4TUJA 1CGTA 2H1PH 2D3VA 2RBLA 2ZCZA 2X44D 2FH8A 5BV7H 4HUCA 1WBZA 1P4IH 4PJ9C 3MFFB 4IK7A 4KKQA 1PX8A 2C1OA 1IKNC 1XF4B 4HXAL 4ZUWB 2VABA 5KBNC 3KJ4C 1IAMA 1A6UH 2EC9T 2WZ0A 3CHOA 4PRAB 2EDEA 1CI3M 4LP4A 4IDLA 1ZT7A 1MCOL 2QADD 4JFFD 4X4ME 4WJ5A 4S1DC 4QXTA 1MHPL 3EJSA 2Z91B 3OJ2C 1HYSD 3TFBA 3SDYL 5IBUG 4F8LA 2HVKB 2IBZX 3BUYA 3L3OC 5DC4B 1G7IA 2WSKA 4DGYH 4G6JH 4ZAKD 3FOLB 4UTAA 4LU5L 3LTVA 3VRIB 1GGTA 3CFCH 1X7TA 1OTUD 2XWJA 4OD3H 1YQVH 1JN6A 4EUPG 4PJAA 5D6CB 1T4KB 4FKHA 1PX4A 1HHKA 1ZV5A 4ZPTB 3FT9A 4JRLA 4Q0XL 4WFHE 3M46A 3HBQA 5CCHE 3VM7A 4EOWL 2V2WB 4M43L 1SXCA 4TUKH 3FU3A 1FG2A 2F61A 1CBJA 2YLKA 1CG9A 3U4EB 4X8JA 2D2CC 4AH2B 3NIDB 1NMAH 1YCSA 3QXWA 5DFWH 3H3PH 5J12C 3AMKA 5AW3B 3REWB 2GHWB 4MWFA 3PWJA 5C7XH 1UVQA 3CV5A 2X0UA 1HILB 1M3IA 4UZUA 3PAZA 1ODAA 5I71C 3MTXA 1TJGH 5DR5H 4YHOL 3N41F 3TV3H 1UWEL 3EOBA 1KIPB 1ZSHA 2W0PA 3C6LD 1I7ZB 4WENB 3U9PH 3CBJB 3JWDL 1TZIB 4U3CA 4HS3B 3SDDB 1E7VA 1ZPUA 3CN2A 2FJGA 4LLYA 3BRGC 2GI7A 3KDMA 3UC0H 3FT3B 4U1HB 1ZHKB 2CKBH 2DJSA 1SY6H 2X40A 5D72H 1I8UA 1XF5A 2F18A 1RZJH 5SWZB 4LSRH 2QVKA 1XB3A 2ZXAA 4UWQB 2OMUA 3KH3A 2OTWA 5FK9A 3BEVA 1IQWH 2G9HB 2Y7QA 2YPLB 1UZ8B 3MRBB 3GRWL 5EHFA 3REVB 3RVVD 3O8XA 3A6CH 3DX2A 4CADA 1QYGL 2Z7YA 1SLXA 4MAYA 5JIQA 2D7TH 1EMTH 4N0CD 4ODTH 4FQXD 3BLKA 2G0LA 5E6YA 2R27A 1A3LL 1RIHH 5AOMA 5DMKA 2XQBH 3UYPA 3ZL4L 3ZBMA 5HYFA 2X1WL 2OR9H 3SGEI 4UBDC 5JXED 1PY0A 3QC6X 1ZXKA 1DBML 4OGZA 1V3LA 2GC7C 1RKRA 5E4EC 5MERB 4HWUA 4PJGF 1F6FB 3VD9A 5LDSA 1VZHA 2BSTB 1HCYA 2EKSA 2XACC 2XPYA 1JZ2A 3GJEB 1JG9A 3CHXA 4RAVA 4LQFH 4M8RA 4I4WB 4UT6A 4C83A 4HZLB 3PP4H 4S1SL 4N25A 4P5MB 2I07A 3CIQA 5T3XH 1MFEL 5JIDA 3HA0A 4ZPVB 3SO5A 3VVVA 4AIXA 3L2NA 3QCUH 1CK0H 4BFGA 4A66A 4OSUH 1V3JA 1ZLUH 2AS5M 3R06A 4KNUA 4QXUH 4FADA 2BLFA 4NCDA 3GM8A 4RFNB 4HU8A 2HLEB 2YAQA 4Y1AA 3M86A 4DCQA 4N4YB 1MH5B 3L17A 1DVYA 2P5EA 3EH3B 3VFOA 2AV7A 1RK1A 3DX0A 1F6AB 2Q7YA 4Q74A 4UB0H 4XX1G 1IIIA 2NY0C 5JYMA 3OKYA 5K69A 5JHLA 2X1QA 2NLJB 5I18H 3IJEB 5B4MD 3RB7A 4CSTA 4ELME 4JY6A 5DRXB 4HDIB 5TQ2H 4WK0B 3O0RH 1QFOA 2P47B 3THMH 1IFHH 3DI2B 3A23A 2Q6WA 4G7SB 4X7SH 1X5IA 1LYQA 2J8OA 5L2JA 3IDJB 1UB5A 1IC5L 2WXKA 2YD5A 3SCMA 4Z7AA 4Z7WB 5ANME 1LE9B 1JGLL 4WTQA 2VLRD 1BG1A 3KJ6L 3RVWC 2HRLA 3GO1L 2I60H 3LNHA 4YGVA 4QHPA 1G9NH 3MRCB 5JYLA 4TPRL 3GMOA 1WFIA 2CZNA 4YDJA 4P2QD 1BQKA 4M4RA 4NENB 4W70A 1YLBB 1NEUA 2WNWA 3MA7B 2A73A 3U2SB 4MRCA 5EH1A 5C3TA 2YD9A 3W82A 2XI9A 5C08D 3ARGA 3UDWA 2I9TA 3S7GA 4PFEA 3IJ7A 5DXWA 2FATH 1KXVC 1K9TA 2EXYD 5C0FA 5KW9H 2DN7A 2E9BA 3DX9B 1BWWA 3D25B 3PJLA 1PLBA 2BDNL 3HI1A 4XP9L 3SQBB 2A38A 4NNXB 1PTZA 5IOKA 4ZBJA 3EYVB 4IRZL 2HLAB 2NX5D 3B5GA 4XCFL 2FBJH 4DZ8B 4GG6B 4ZFGH 2VLKA 1ZHNA 3TJPA 4XMLH 1C08A 3ZDYB 2BSSB 5I6KA 3KHQA 2RACA 4WW1B 5CIPA 3DV4B 4C56A 2HH0L 5KSAB 2EDKA 3CGTA 4JANB 1AJ7H 1PCSA 3RL2B 3B4NA 4DVRL 3MHZA 3MLPA 1CDIA 4XP5L 5GS0H 5DJCB 3D69A 3NZSA 4GQ9H 3VI4E 2ZIDA 2CDEA 4PTUB 3BN9C 4ZUTB 1S7RB 3VGDA 2CXKA 1NGQL 2P49B 1MHHA 1BXXA 3NPZB 4AYBA 5F0MB 4F7PB 4MGXA 1JNLL 5JUEH 2AAVA 4ONHA 3W11C 3NIDF 3PXHA 1RZKL 5A2CA 1MCJA 3LIZH 2AEPL 5BMFL 2UYLA 3NSXA 4FC3E 3ROLB 3W9EB 3ZT5A 3T8VA 3CX5J 5IJVA 2ZWYA 5AYTA 3UGXA 3QJQB 4G6ML 4FQLL 4JFOA 4XZUB 1KPUA 4UIMB 3MMEB 1EWHA 2ZNWA 3LD8C 4KOBA 4LCCC 1DLHB 4PI0A 4YSRA 4Z78B 1IVTA 3Q2WA 1FGNH 1UFGA 3FT1A 1XBRA 1ILUA 5F2FA 3PWLA 1MF2H 1EEUA 3DA0A 4YDKL 3VD2A 3GM0A 1P4LB 2PW1B 3GKZA 1X4YA 3A0OA 4M5YL 3GSNL 2R2HB 4MZIA 5HJDA 3TEYA 2J1KA 4XCNB 3UAJD 3MBED 2NXZC 3SE6A 4V1DA 5IB1A 3ARTA 3CDGB 4WI5A 5C71A 1LMIA 4K94H 1VZGA 4X6FB 2OMNA 3UZVB 3FONA 1XSIA 4Z8FL 3KYKL 3FQNA 2DW5A 3WIIL 4XNAA 1MCQA 4LPYA 2DJ4A 1ZT1A 2XG4B 1KTDA 4G3YL 1W8EA 2P46B 4G1EB 3ARUA 3IFLL 4L4TA 1CICB 1J5OL 25C8H 1TEFA 2GJ6E 3WXWL 1JDAA 3QK0A 4ZMQA 4HWZA 1WFOA 4D3CL 2CJ3A 1QFPA 1R3KA 2C9VA 3V6FA 4WU5A 5BRZA 2VXSH 4PJ8D 3O3BA 1K72A 4L1HA 1KIQA 3ZDWA 5FGBA 2NDGA 1QTPA 4F27A 2OYPA 3BHBA 3VH8B 2BFVH 5C8JB 1HNYA 2W60A 5EIQA 4DP4X 2FECI 5DO2D 7CGTA 4BUQA 2GVYA 1UEYA 3IXTA 3MV11 2QMKA 2W91A 3QJOA 4NKDB 5A2LH 5MEQB 4HALA 1GJWA 4PV8B 5B8CC 2ENJA 3EYOA 1MLCA 3A47A 4YX2H 2BNRE 1RUAH 1CQYA 2OMZA 4BQ6A 5F7UA 1I3VA 2WAHA 4MS8D 4I85A 2JIXD 4NQEE 5JMRA 3CBRA 1FLRL 2C4XA 2PCYA 3HG1D 9PCYA 4P2RD 1HN1A 1LEGB 3HNSL 4Y9BA 5GRUH 3WGVB 2JNZA 1ACYL 3MUHL 3EDKA 2DQ6A 1S7SB 2B1OA 4RESB 2QADB 3CLFH 4JFFB 4YFLF 3V8OA 2Q8BL 5HYJD 3CVHB 1LD9B 4Z7QB 1NA8A 1T7VA 4X9IA 3GLAA 4AT6B 1WAAA 2G3ZA 4MA3A 3VFTB 4OI8A 1ILSA 2OAAA 4H2AA 5FW8A 4OLZH 4PJ7B 4ZAKB 4LSSH 2Y6TE 4YH6A 4O4YH 4WI7A 3DVFA 5FCSH 1IGTB 5DK2B 4GBXC 4XB7A 3BAIA 4U6HA 1M53A 4KZEH 1HEHC 2EO1A 1J5DA 4Z7UB 5HY9A 1CDHA 4GW5A 3K1KC 4Q14A 1TJMA 3EYQD 1L5GA 5ESVA 5IVXE 4ENED 2JI3A 3O3UN 1S9KC 5F1IB 1IC7L 1MNNA 2ZZUT 3MV01 4XPAL 3FFOA 3UBGA 4EZMA 2X12A 2F53B 4RBPH 3S3PA 4N2LA 4Z7WF 4YPGB 2DY2A 4JVUA 3TGXA 2IAND 3FTGA 1RZ8B 5AW1B 1I1YB 3TBTB 2NQCA 3SGEH 1WZAA 3BDBA 1L7IH 1CBVH 1CFBA 1TJIL 1SJVA 5EZIH 3R4RA 1FO0A 3PGFH 4HMDA 5K9QG 2AC0A 4MJ2A 2V17L 2ZOUA 1JFHA 2KC0A 1KBGL 3D33A 4KVNH 3ARSA 3C6LB 3DHUA 1OHZA 2NW3A 5BZDA 2GSIA 2HT3D 1I7UA 1A4KA 2V6HA 1A8JH 2R0LH 1R5WA 3QIWB 3KDPB 3VFSA 5SWSD 5JPMA 4G59C 3PWUB 3CSTA 1U3JA 2AGJL 1DQLL 2DM4A 1TQCB 3DLQR 5T33H 1EO8H 4FFZA 4GG6F 1DBAH 5T8IA 4J3WA 5C0BD 3L7FA 3SKMB 3ZDYF 4FS0A 1OAJA 3RLSA 3S2AA 2QSVA 4B27A 4JFTA 1Y0LA 5CWSA 4KZDL 1E43A 3IT8D 3PV6A 5DFAA 2DD8H 1R4XA 4QMEA 4LCWD 5EO1A 1QOKA 3U1QA 2ZX6A 2YXWA 3AREA 4FQXB 5BV7C 4QHUB 4R84A 5I1DA 3KL3A 4G6AC 4Q52A 2AZAA 1VEMA 3US1A 2ZKYA 3SY6A 2ZSWB 1AHMA 1YY8B 3UPRB 2M83A 5CCGE 2F1AA 3NCWA 1W0WB 1W8OA 1SEQH 1F5WA 2MCPL 3SDCA 3WIFA 1TCRA 3PQYD 1KEGL 5DVLA 4F9PA 4NBXB 5GGUB 1G7MB 4WI9A 4KKPA 4XBGB 1QLRB 3HZMA 2PWEA 3FUMA 3T8MA 2GC4C 4KI5E 1KPVB 4OV5A 4F58L 3K8KA 2NY5H 5I1AA 1VFOA 5L6YH 1TOXA 2F6AA 3C8DA 4IKNA 5EWIL 1FNLA 2ZF8A 2WC7A 4FQ2L 4GUQA 3LZRA 3B5HA 2AQRA 5DQJB 1I8KB 2BY1A 1S3RA 4NUQA 1OB1B 3FW6A 1X6NA 1GGUA 5ADPH 3D18B 4XP4L 1KZYA 4YLQT 4DKTA 3K91A 1A6WL 1K8DA 5DYOA 3JV4A 4OGYH 5DWUL 5LGYA 1A7OH 1P6WA 1UA6H 2VN7A 3ZRFC 2UX6A 3ZT7A 5DHVB 2HLFC 3NCYP 1XSKA 4GSRA 3V6OA 3DX6B 1N64H 3C08H 5TF1L 4IKLA 2J2ZB 5KBLA 3NA4A 1TO5A 5I16A 1JNNL 4YHYB 2Y22A 3HE7A 1ZAGA 3PHSA 3BP6B 4J3SA 3FUDA 3MCLL 1BAFH 1F90H 1Q72L 5I15L 4Y2DC 3HAEG 3WN5B 2ZNXA 2VLRB 5CEZL 5I17A 3GFUA 4UOW1 5I1CH 1CFTA 1N7MH 4Q9BA 1DBBH 4B3VA 4ICXA 1BHGA 2H3KA 3MRHB 4BQ8A 4JFWA 2FWOA 4P2QB 5C1MB 5IOPB 4XNYL 3MV9D 1EUUA 5K9OA 1B0RA 3K2MC 5C08B 3R7QA 2MOVA 5L88L 3WJJA 3NH7L 5PAZA 1QLFB 3DTXB 1A5FL 1I3GL 4PP1D 5C0NC 3P77B 5IHHA 1Z9LA 4W9EC 3WO3B 4LF3B 2NMSA 1N0XH 4RCAA 4MXQD 4B96A 1IILE 2YD3A 3CFKA 1QFHA 4OLUH 4PV9B 3V10A 4LHUD 3ZDXB 2V9RA 4NM4L 2FX7H 3MKGA 5CMAB 1JPST 2ZOLB 4BUHA 3BUBA 2NX5B 3UOAB 4N0UE 5AKTA 1J1PL 4Z7QF 1U42A 1OIOA 1MCWW 4W9CC 2GBAA 3WSQH 3GS4A 3QNZA 4BSJA 4JZOB 4HJEA 4PEEA 3HN3A 3RWDA 2K9FB 3B2VL 4PJ7F 2FYYB 5HVGB 3WUWA 1WAPA 3AAZB 5HGBB 1T6BX 4AM0A 3Q8EA 4KJQC 2WNKA 1FLTX 3PNWA 1AQKH 3IGFA 4M7LL 4Z7UF 2GSGB 2Q10A 2QKSA 4ZO8A 4C55A 2Z6FA 4NZTH 4DKEH 3VFPB 4GIOA 4Y5VC 4KVPA 4WEBL 4EN3C 3W5MA 1BFOB 3H7BA 3U36A 3GDBA 4ODUA 1E40A 4R83A 4FJZA 1B0IA 1NAMA 3EJZD 3S96A 5FEBA 4MXVF 4OKDA 5CHNA 3MNWB 1G6VK 3CZNA 3NPSC 3DXAD 3WI9A 4QD2E 3FU8A 4AOFA 4R0LA 4S10A 3U48A 5GGVY 3CPLA 1FNAA 1UT1A 4OCWL 4P4RA 3UTOA 1RFDH 4QI3A 4PTTB 3G08A 3PABA 4BFNA 1QZ1A 5I2IB 2C9XA 5BZWB 1BVKA 5BQDA 2Y5TA 3BVDB 1VADB 1I1AC 4E41E 1OW0A 2EQDA 5F1OB 5AW2B 2KMWA 3LKQB 4GPVA 3SJVD 4U7MA 1F4WL 2MMXA 5A2BA 4OV5B 3DC0A 1JF1A 4YR6A 3KYOB 4X5XA 2H0FA 4JLRA 3IYLW 3KPRD 3SE3A 3VFGH 3DOSA 4NN7B 4WI8A 4I13B 2ZWKA 3GSVA 1BG9A 1A7RH 3DIFA 1RIVH 2V2XA 2YPVH 4UM8B 5IR1A 3V6BR 4G7YH 3UAFA 1I1FB 3X2QB 1LVEA 4XNXL 1G9NC 3K6FA 1G7LB 1DO6A 3F7YB 3QISA 1D2PA 5HBBA 4IW4C 5T3ZL 1ET8A 3L1OL 3BZFA 2I25N 3WOVA 2YXMA 2DLFL 4I77H 3FTUA 3LB6C 4PJ8B 2BP8B 5ENWA 5HGGS 3HC2A 6PCYA 1WUZA 4E5XG 2CLZB 4MJ6B 2QSQA 4RRPA 4NJ9H 5AAWA 5T1DL 4AQ8A 3TFKC 5BV7L 2WSDA 1P4IL 1KULA 3PV7A 2WLLB 2A99A 3MLYL 5DJAA 1WD9A 2L7UA 3QZPA 1IEAA 4OJAA 1JCVA 5L9DH 1A6UL 2O5ZL 1JZHA 4IHOA 3A4FA 3Q06A 1IAII 5GZND 4UQ3A 4NYLA 3WFCH 2MEJB 3N2JA 1Z0MA 4LOVA 3IRCA 2D3LA 2JIXB 1E6JH 3DX4A 5GS0C 3MDJA 1U95A 4P2RB 5IESH 4OLWH 3ULUD 4AYFB 1JGDA 1MEXH 3BPNC 4TV3A 5ECJE 4JO5A 5DSCA 5EBLA 3SPGA 4DGYL 5B3SB 5KS9F 1IRAY 1QMUA 3ELAT 4TVPH 4AZ8B 2X4RB 1ZVHA 1GL4B 1MAMH 3CFCL 5CCKL 5HYJB 4KRPC 4ERSH 4N90D 1EAOA 2EDTA 4RGOL 3WDJA 3RGVC 1T03H 3Q2VA 5EUKA 1QSFA 3L54A 4YHPB 4KDTC 4W9JC 1AKJA 2B2XL 4F2EA 4ZW5A 2N1KA 4NQVA 4X8CA 3AG4B 2WBXA 3IU3B 3ZTNL 1KXQE 2EDBA 3FS9A 1WZLA 3HRZA 1H5BA 4PJ5A 2XG5A 3GTTA 1G9EA 1X9RA 3MV8A 3Q6GH 3GIZH 5C7XL 5IMMB 4U6YA 2G60H 1CLZL 2LQRA 3SDXB 5L2KD 3WNMA 5B7MA 1IUZA 3RDTA 2JB6A 3VDAA 3PHAA 1D6VH 3RIFK 3KW7A 4ECNA 4XE0A 3OTTA 4NO0A 3SPIA 3GRWA 1NKRA 4DJMA 2XVGA 3FUFA 3VTAA 3GJFB 2H32A 2IANB 2HX9A 4RGNE 2P80D 4HJTA 4LASH 2H26B 3R7RA 2VDPB 4NUGH 4WHYG 4DAGL 3KLDA 4F8NA 2XWBA 4PJCB 2B59A 1JOIA 2AJYL 2HSIA 5HHME 3BD5A 5SV4A 1MY5A 3HEIB 3BE1L 4PY8I 5D72L 1SXAA 1PG7W 2ATKA 2X4QB 3CMOL 5L7XH 4ZMOA 2P43B 1F4YH 4LSRL 4Y4FA 5BOPA 4NC1E 1Q1JL 2R2BB 2R69H 4P4KA 5FB8B 1I3RA 3MRMB 2VZVA 4WO4D 4ZFZA 5SWSB 1E3ZA 3S97C 1T80A 3ZDXF 4X98B 4ODTL 4PV1C 2YUZA 3QDJE 1ZT4A 3L7EB 1A4BA 1UATA 4WO0A 4EAEA 5C0BB 3QH3A 4PY8J 3UAAA 3MR9A 2F8IA 1IGCH 1L9SA 6CGTA 2OR9L 5TE4L 1ORSB 4Y5YA 4MJID 1CQKA 4RMUA 2VW7A 5C9JB 2WIIA 2DTSA 1BOYA 3QUYD 4LCWB 5INCB 3WNNA 4IU3B 2E0PA 2DQEL 5HVFB 5TJWK 2YSSB 5FYLD 4JFYA 3SYQA 5IQ7H 1KLGA 3RVXD 3HC3L 3IWVA 5HJGA 5I0XA 1SDYA 1IBHA 2XN9B 1Q0XH 3PP4L 4UQDA 3ARQA 3ILQC 4W81A 5H94A 5FOBA 5D5MA 5ETUB 5ABZA 4N1EA 5I6NA 3VE0A 3AB0B 4Q97A 4U4BA 3QHZL 3AGWA 4C47A 5E6UB 1MPAH 2IDSA 4QXUL 2GTWB 5J6HB 4NRXB 1MFDH 1WRFA 2OSLA 5DWPA 1G43A 4FXGA 5SWQA 1E28A 3LEYH 4Q6KA 1XL6A 1WH0A 2E56A 2X4NB 1N8ZA 5IVNA 1PEZA 4UB0L 4DPRA 2ZG3A 4YSDA 3EGDB 4TVUA 1HZLA 1T21B 4DPCX 3ZTEA 3HUJA 4YQXL 3RB5A 3IGLA 1D5IL 4MRBA 3LEVH 4L2LA 5DGQA 3H0TA 1OD9A 3VRJB 4HWNA 3WNJA 1I9JH 2NTSP 3BH4A 2EIBA 4AW7A 4F15C 3T6VA 4GQQA 1KOAA 3RNKB 1JMZA 3AU1A 4PCSA 3L1GA 2LU7A 5J1SC 1TXKA 4N5ED 4UT7L 1IM9A 2ZE0A 4K73A 4IRZA 4PJ9A 1KIUB 3UBXB 1G9NL 1YNLL 1C8PA 1IKNA 3TX4A 2WMPB 4CC4C 2RCSH 1DQDL 1CE6A 5FYKE 4L5FE 3MLRH 1AG6A 1M7IA 3SPJA 5GIRB 3S3DB 3FPYA 4POZC 5HYSA 5I8CA 3PJSA 4URKA 2HA1A 3ZXAC 4RWYH 1X9QA 4L29A 1JGUL 3HBGA 2ESVD 3MJ6A 3TVMC 2Y2WA 1MUJB 1KIRA 4B5ZA 4CVZA 3CU1A 1YYLL 4Y2LA 3UZQB 4TNFA 4MCZA 3V4VL 2WIMA 3QDMD 3DVNB 3FL7A 3MV9B 3ARBA 2QVMA 2WD0A 1JS4A 1DBKH 1UACL 3PL6C 3ULSB 3UO1L 1LO0L 2UZYA 3HRPA 4ZFGL 1XR9A 1U0QA 3LX9A 1OWWA 5DEGA 1FZMA 1GS6X 1M1XA 4QY8A 1I8LC 2XZCH 1AE6L 4JQIL 3FQXA 4J5VA 2H2SD 4B9FA 3MOBL 3EOTH 1P7HL 4LHUB 4W9LC 1AJ7L 3DO7B 5C0RH 4G7VH 3MUGA 4ZD3L 4OIBA 1WISA 3FCUB 4UI2A 5GS0L 4QTHA 1FAIH 2PYED 3GS7A 3BC9A 2HB0A 2NYZA 3SE4C 1M7DB 2FT8A 3RNQA 1K8IB 1G7HA 2X4OA 3GPSA 2VDKB 3ZKND 3SY0A 2EH7L 2OS7A 3GSNA 3T6XA 1T5KA 2AK1H 2YGPA 3KPLB 2A83B 2WLKA 1T20A 4ODSL 4OLXH 2XV0A 3QEGH 1HS6A 1O0VA 1A7QH 4YS4A 1E4JA 3EFOB 1QSEA 4KO5A 4RMWA 5F7DA 5J0BA 3SDXF 2WKOF 4I87A 2FYVA 2AK4E 3EDFA 3R19A 4IBZA 1DVFD 2EYTA 4R4FH 5JW5B 1UWYA 1D3CA 4AY0A 3ZHKA 5EOQH 3QWQB 1MF2L 4GY4A 4MB3A 3IXAA 3M17B 2W9DH 3BLBA 2OX5B 4KK8C 4F2ME 3E3QE 3DXAB 3VGAB 1IVLA 5IM7A 2Y06H 3QJHA 3RWFB 2Y25A 4BFKA 5IHZA 3OF6D 3K72B 5I74B 3TBVB 1H6EA 2X4UB 2AXHA 3FO0H 4KTEH 4RMRA 4OIFA 2JI2A 4DTGH 1INEH 2AW2A 4G8GE 5FF6A 1AQ8A 1IAIH 5IB5B 4BJLA 4HWBH 3CUPA 5GHWL 3FT2A 5C07A 5T1MA 1CD1A 3T0EE 1BD2E 2ADGA 4ELDA 4W9IC 4HX1A 2BSEA 3KPRB 3PRZA 3KYMB 4YIQA 1GC1L 1TTFA 2LE9A 4ODHL 3OHMB 5D70L 1GR7A 4WAFA 3TPKA 4NFDA 2WQUA 2FIKA 4ZX6A 1OALA 2N3JA 4PRNB 4JFPB 3N0AA 5GJSL 3PCYA 5ACZB 4C4KT 1GTNA 5A2JH 3GB7A 2VDMH 5DJ2B 2BFVL 4WUUE 5ESQB 1NCIA 3OPZH 1GAFH 4YXLH 1LNUA 4GO8A 7PCYA 3V79C 2VR4A 2YUVA 1HSBB 4F37K 4TF4A 3RBGA 5DZJA 5FWQA 4XCEB 1NSNH 2VR6A 5EIIG 1FNSH 3B9DA 3APNA 4YDMA 2I24N 3MRFA 2IPUG 4P0DA 3AABA 4MKTA 3BVNA 3RHWF 4AV4A 2AP2A 4UDUA 3H42H 3DSFH 1S9WB 3FH8A 5J6GA 2V37A 1AVAA 1NIAA 4OZHB 5INDA 3RWHB 2XIIA 1XGRA 3CXDH 4HH9A 5AQ0A 5KZCD 5CZXC 5DYFA 4EUPH 2EICA 4G6KH 1OSPH 2PXYC 4A6YH 5BVPH 1TQBC 2BHZA 4KUCF 4BSVA 4RIRB 3ZR6A 5BO1H 5HVHC 5IKCA 2QTVA 4H44C 1EV2E 1KTBA 1J5CA 2O5NA 2DQTH 5FA3A 3FU0A 2QR0B 3VQ1C 4GO9A 4IS6A 4K23H 4S0SD 5CUSL 5AVSB 3TYGH 1GTFA 1NEZB 4OLZL 1ROWA 4Q9RH 1U8CB 3DX8B 3MJ9L 4O4YL 1XWVA 1U36A 4MJ5A 4H25B 4CW1B 3CPUA 4XP1H 3IS1X 1W72B 5B3JF 3QQDB 5AVQB 3PS6A 3DGGA 2EIZA 5IB4B 4NP4L 1I8MA 1N70A 3DOHA 3MLWH 3MO1A 1HT6A 2WQ8A 4O5LH 4L2YA 3WFZA 3FZUC 1NC2A 4PLKC 5FLVA 1UCBH 4FDWA 4RQQB 2FK9A 1ADQH 1KBVA 5LKNA 3TS8A 1RZGA 1E6OL 1XH0A 4B3EA 1RCYA 4FZEL 1KXVA 3OHXB 3JVGA 4M5ZH 1I1CA 3BXNA 4TQHA 5D7IB 5L2KB 2CXGA 4OUUB 3GTNA 1ZLWH 3U46A 3O3AA 4OLEA 4NB7A 3HG2A 3VXSA 4CVXB 4BZYA 3II1A 1SHXA 1L0YA 3QS3A 4KVNL 5DO8A 5B39B 3VQLA 4YHLH 3QWNA 1EEZA 3DURA 3V7MA 3I6LD 4JFZH 3GXNA 1FJ1B 1JPTH 2MPAH 2XWCA 2OL3L 3CVCA 4LLAA 4ZS7L 2NNFA 4N85A 4APQC 4X5PA 3GSOB 2DTML 4JFXA 3O8XD 1UQSB 5ALCL 4OB5H 2P28B 3M07A 2JV6A 1CGSL 1HHHB 4OZ4B 15C8L 2NY3C 4MAYD 3STZB 5T33L 5K9QI 3L4TA 1GSMA 3VSVA 4DN4H 2FNWA 5AB9A 2AJ3B 2FEDC 2XXMB 2Z3FA 3HHSA 2ICWA 4JRYE 4BQBA 3E9TA 3WLBA 3HZVA 4TNWK 4WO4B 4D9LL 4DN3L 3FUIA 2IADB 1UB6B 2NY7L 4M3JA 2YD8A 3IVKA 3NTCL 1PW3A 4R8WL 3MNVB 1HOEA 2XZAH 4Q6IC 5F7BA 3OGOE 2CDGA 4MJIB 3LKOB 4DQOH 4LCCA 1Z9SA 1VACB 3V0JA 3D3VA 4PBVC 4TSAH 3QRGL 4DVBA 3QUYB 5EF2A 2W0LA 3GJFK 4NQDB 2DLTA 4JG9A 1IBBA 4IHBA 4IMLA 4N8VA 2P4AB 3MRKA 3GUFA 3F7PC 4HEME 4BM7A 4ZS6D 4L8DB 2WN3A 1SXNA 3STLA 2PYFB 5EFIB 4D0BA 3VX1A 4Y1AD 4XMKH 2BVPA 2JXMB 2P5ED 4A2DA 4XBPA 5D4QA 1D5MA 3MLTB 1IC1A 4KKBD 1HFUA 4LO9A 3O6FC 4X6CB 3RL1A 5JIKA 4G83A 4KK9D 1BEXA 2DI8A 3HFFA 1LK3H 5HI3C 2A2QT 5FGRA 1D2OA 4QHLA 2CGZA 4ZNEE 1N59A 3F84A 4D9RE 3ZMNA 3DRQA 3OLIA 3F04A 3U6RB 1MRCH 3OX8A 1P2CB 4A7SA 3G5XB 2ZXWB 4MMYA 1WWWX 4DEWA 5F6HI 3SCMD 2CNZA 4N0FA 5SWZE 4EKXA 1J5IA 5DHYA 3N50A 3VD7A 2QKIC 5IZ7A 3H1ZA 1N64L 1Q38A 1TU2A 5EU3A 1U8MB 1U8IA 5BW7C 1EJFA 1MIEL 4JNXA 1CXFA 1EH9A 2GUOA 2YBRB 3C9NA 4FCAA 3B2UC 2YPLE 3RFZC 4NSKA 4W9ZA 4KNTA 1L6XA 3MUZ1 2AXGA 1JGVH 2VQ1A 5CAYB 3ARGD 2IPKB 3VXNA 3LNFA 2G2NA 4ZTPL 5F6HJ 1N7ML 4U2ZA 1DBBL 2QQQA 5HYQB 2IQAB 4ZSOA 3WEAA 1WCQA 4HUKB 5TDOB 4HQQL 4M1DH 4R97B 2BIMA 3QG7H 4RAHA 4AZUA 1W15A 3LYRA 2JELH 4A7VA 2HTKD 4YE4H 5DZOA 4PP2A 2ESVB 3NUKA 4QOKE 3VMNA 3WXVH 1ZA6B 5B7FA 1U3YA 2A9AA 2VLKD 3MLVH 3VYOA 4NNYB 1Z6JT 3K6OA 1IGFL 2QPDB 4ODVH 2BHUA 3KLAA 4JR9H 3EJPA 3BZ5A 3MYJB 1AFVL 4C56D 35C8L 3MBWA 1IKFH 4GBXA 2YWZA 1J9RA 3CZUB 1RZPA 3L5HA 4R90H 1WT5C 2AEIT 2H4EA 4NQSB 4TM9A 1OP4A 2AABL 1BFSA 4HSQA 3WSQL 3GBMH 3GGWB 1N2RB 1KEMH 4L9LB 5A7BA 1E9OB 1FVDA 4TRPH 1A1NA 2ZUSA 2M1KA 1S7TA 3L4VA 1MJJA 4ZFOB 2WTOA 4E9XA 2K3TA 1T04B 1H6TA 3PDOB 5HD8D 3V0HA 1IZJA 4DZBA 2NYKA 2PYEB 1QVOB 2VSKB 4LHJB 4P9MH 4P3DB 1JVKA 1INQB 4HD5A 4IGBB 4OY9A 4A2LA 1XGUB 4OCMC 3QI9C 2XIBA 1QFUH 32C2A 1DVZA 4Y9EA 1BBDH 3VX0A 5DS2A 3L6FB 2QV4A 3D2UA 1IE5A 4HU2A 4CDGC 1CXEA 3KPMA 3QWOA 4GO6B 5D7IF 4H0HB 3P9MB 3AWFA 4JQVC 2G4EA 4Z7WE 2FECL 4V1DD 3M88A 3NIFE 1NCHA 2FZ3A 3CXHK 2BC4B 1FWXA 4FZ8L 4OVVA 3E1F1 2X3CA 3GSXB 2PETA 5IK3A 2KDGA 1COBA 3AQZA 2I5YH 2XWDA 4MZ2A 1XO8A 4GRWB 4L0ZA 2WLZA 1M6OA 4YWGH 2IAAC 3KS0J 5IG7A 1MHEA 1IJ9A 2ZAIA 4L4TD 1XGPA 4Z7VA 4YZWA 2CDFB 3DVIA 3TWCL 2R29L 5I73B 2MSPA 3VXUA 1FL6B 3EF7A 5BRZD 1SJEA 3C87A 4XPGH 3RIKA 1QQDB 4RWHA 1NBQA 1BVNT 3O9WC 1IBYA 4FEMA 5IV2A 4XH2A 3A6OA 4I77L 2B4CL 3S9DB 2ERJC 5CD3A 2DS4A 1A1MA 1SBSH 2YARA 1IGIL 2EYSB 3P4OB 3TCXA 5EEWA 4H7VA 2C9AA 1OE3A 1J10A 1OQOA 1ZDSA 3G6AB 4PJXE 4TUJB 4HCRL 4WI0A 1N26A 5HHVH 3R1GL 2C9RA 1U8HA 1WBZB 2DMKA 4O51A 3S4SA 2C1OB 3Q1SH 5F21B 5TGBA 3NAAH 2Q5BA 2VABB 3H9HA 2J5LC 3S5LA 2K45A 3P0YL 1ZT7B 4N6RA 3QDAA 2H7WA 3TTSA 2IG2H 5BOZG 4WJ5B 4MB4A 4QXTB 4L8SC 5IESL 5MI0B 1XAKA 5AVUB 1CR9H 1QSZA 4WTWA 3BUYB 5KZCB 3W38A 5ITBH 1HWWA 1LO3L 1G7IB 4BSWA 3O6LH 4ZUUA 4TVPL 4X5LA 3ZRSA 1BQ5A 4ILDA 3WLWD 4B9GA 5LG6A 4LARH 1MAML 1YEEL 4TL4A 3SZ6A 4Z3JA 1DO5A 4X6CF 2XWJB 1AS7A 1NMBL 3RQ3A 5LAPA 1JN6B 4PJAB 2OI9C 5CJQL 4NPKA 1HHKB 4HT1H 4R9HA 5EG6C 1FNHA 3DPBA 3WKMH 5F93C 2IOIA 2EDNA 3BFOA 3CFUA 4GYBA 3NQKA 4YBQD 1FG2B 4PGBA 3IMSA 4V2CB 1CG9B 3IS0X 4X8JB 4YZFE 5LVEA 3C5XA 4Y2DA 3S36L 4UV4H 1V7MH 4MWFB 3PWJB 2F1EA 3QQ9D 5FO9B 1AMYA 1QTSA 3NZHL 1F00I 5JW4Q 4FFYL 3N42B 5ACMA 2B5IB 3EOBB 4FNUA 3QFJD 1X5MA 1YG9A 3LVEA 2DKMA 1A14H 3TOPA 4XWOD 1IKOP 3IWUA 5HHOE 1R0AL 4CILA 5L8LB 3B7TA 4LLYB 2FJGB 4XXWA 4B95C 4XAKD 2H6OA 3KDMB 2EO7A 1U8NA 3LVTA 1XF5B 1WGVA 2AQ3A 1D9KA 4LLWA 5I5JA 1M57B 3MCKA 3ULVF 2OMUB 1Z5LA 2OTWB 2VR8A 4L3AA 5FK9B 3BEVB 2Y7QB 3PE9A 1G9MH 3O8XB 1NBVH 4LLUA 4E68A 3WJLC 4CADB 3CFEA 4MQXC 4MA1B 4ZMVA 2VDRH 1JWMA 3ARED 2YQ3A 2XZQL 2CR3A 4U1GC 4YHKL 1IGCL 4BH7A 2AEQL 2VC2L 3UYPB 5DMKB 5EORH 3JXAA 4JFFE 1DHKA 1O7DE 5ILTH 5DS8A 4MSWB 1E30A 4KXBA 4Y5VA 3SDCD 2HYMA 2IXQA 4AI7A 1VEOA 1CZ8L 2ZSVA 5E23A 4EN3A 2ETWA 3GXPA 4J3OF 1FGVH 1KFAL 2BK8A 5C6TH 2B15A 1G5GA 4ADJA 2WWNA 2G5BA 4GKSB 1VGEH 4RAVB 3NSFA 1EVUA 1RXLA 3VXRA 2GKIA 2X3AA 4GP8B 1JF5A 1XF2A 4HPYL 2I07B 4KZCA 5TPWH 4F91B 4UMSA 1FORH 3P3YA 4J2QA 1I1AA 4MD0A 3CSGA 3AJ7A 3CFJB 3R06B 1MJUL 2Q7NA 1RERA 3VQ2C 3IN0A 4Y1AB 3BWAA 4DCQB 1I7RA 5EOTA 2WKLA 2P5EB 3H6JA 2AV7B 1RK1B 1YJDH 4MB5A 2Q7YB 4OQTH 4Y9CA 2UWEA 3OV6A 4LBEA 1JVLA 4S1RH 5KSBF 1TIUA 4UAHA 1PKOA 2VDNB 4DGVL 3QUMH 3NCBB 3BO8A 1H9VA 4XVJL 2R0WH 4HGWA 1S9YA 3KPOA 2CRIA 3LEVL 5DZPA 2VZTA 1ZJAA 2CNYA 5EZLA 3LPPA 5CJ8A 3SGDI 3VMOA 3HAEH 5HHPA 1TQTA 1I9JL 3FPXA 4PVMA 2E4TA 1IBGL 1M56B 5KVFE 2Q6WB 4H5SA 2XBDA 5FUCE 1MI5A 2CIKB 2EC9U 3HE7D 3OC8A 4B0MB 5L2JB 4WWPA 1CXHA 1UB5B 3V4VA 1YEDA 4G43B 3SCMB 1IAIM 1I85A 5TK4A 4ZMYA 2FRGP 2J12B 3QS2A 4TSBH 1UXSA 1X5YA 4QXWA 4J39A 4YGVB 5C0GA 4WWKC 1KJVA 3F05A 2APSA 2RCSL 3GMOB 4X9YA 5F7MC 2NUPA 2NNRA 4YDJB 4M4RB 1Z5HA 2A73B 4NHCL 4JQIA 3Q2NA 3OQRA 1YMME 3ARGB 2I9TB 1U3ZA 3T4AA 1MG2C 3FQ4A 4KH9A 4FLSA 5J1AA 1SF5A 3W0WE 4AK1A 4EBQL 2W5PA 2DIAA 4U0RC 1ERNA 2O5XH 3O6KL 3LS5L 5FKAA 3KS0H 5J13C 2XNAB 1DBKL 5ICXA 3N9GH 4XN4A 5KYWA 1BZ7A 3NABH 4LVHB 4OFDA 4HPOH 2BWDA 1BMGA 4P2OA 1MRDH 2WVVA 4M6OL 2VLKB 1PLGH 1ZHNB 4YO0A 1C08B 1ZA3A 5GSVA 3VFWA 1NIDA 4KKRA 5IY5B 2K6ZA 3WIHL 3OBAA 4L5FH 4PWJA 3EOTL 5CIPB 3ZOAA 4C56B 4ZJ9A 4NGHH 1MSPA 3RVUC 3RP1A 5BS0E 4OV6F 1FAIL 4LRNH 4FRWA 3G6JA 3R8QA 3D69B 5DJ0A 1R5VA 4PJAF 1CFMA 2CDEB 1KB5L 4AG4H 2W9EH 1FN4A 1MHHB 4XRCA 3JZ7A 1FFOB 4AV5A 4NKQB 4ONHB 2X0WA 3N1GC 1CD9B 3B9EA 4OJFH 3D5OF 3CZFA 1DQJA 2AQNA 2WJ5A 2UYLB 3WKQA 2BINA 5IJVB 2H0PA 2R56H 3K2UL 2YQBA 4XMXA 1HSAB 5C0AA 2OYKA 4NWTL 2K3HA 2ZKHL 4JFOB 3RUGA 3SB3A 1IB5A 1KPUB 2GITA 4PG2C 5DD0H 4R4FL 4JS7A 3MGOA 4DP9X 1BZQK 3Q2LA 4Y4HC 1G1KA 5FAAA 3NG5A 1GCYA 2X1OA 3VSTA 4JO8A 5K93A 1D5XA 3N43B 3PWLB 5K1VA 3HNTL 2W9DL 4KI5C 4PRIA 5ITFA 4WNQA 1ROCA 4E9WA 4O2CA 4RMSA 1T5WA 1BXVA 3P40A 3QZLA 3T04D 4V1DB 2D03H 5IB1B 5FO8A 3FN3A 2VLRE 5I30H 1EX0A 4P23C 3ZO9A 4LLQA 1F97A 3FONB 3FQNB 4HWBL 5IBTL 1E5BA 4P2QE 1KTDB 1UUSA 2XY2A 3QJFA 4LCIH 1OPGL 2PWDA 3CC1A 4BGLA 5HGDA 4L4TB 2XFGB 5C08E 2XBZA 4BCXA 1T2XA 1MLBA 4M6AA 4K3EH 4L48A 2F2HA 1O9VA 1ZS2A 1R3KB 2O72A 4H1LG 3V6FB 4WU5B 5BRZB 3HJEA 1HEZA 3O3BB 1TQWA 3X3FH 3OZLA 2GTQA 2QSTA 2Q3XA 4NN6B 1WZKA 1X9LA 1VGKA 2CGRH 4TL5A 4YFLI 4JN1L 4FFWD 4BCZA 2W38A 3ML8A 3BHBB 2NX5E 2BVOA 4V2BA 4JJ5A 1KELL 2WNXA 3V0GA 3RKPA 3FAXA 1AMXA 1DJIA 4KMTL 3IXTB 1BWMA 1NL0H 1YEGL 4DP0X 4FQJL 2ZD0A 2QPFA 1CGWA 2OMVA 3HI5H 5DJ6A 3EYOB 4FNLH 5G55A 2X70A 2APXA 1P6AB 1THCA 3MJ9A 4HLZG 1QUPA 3BFQG 2OW7A 4X7DC 5EEYA 2F54A 1Y18A 4YXKL 3UPAA 2X38A 5EN2A 5EZPA 1C12A 1AC6A 1F1AA 1F18A 1VAHA 3KBFA 5DD3L 5DUMH 1J8RA 3P9WB 4OZFA 2PO6C 4HJGA 1CPUA 2ENQA 3WS3A 3U0WH 5IHBA 3WIAA 1B4JL 4QJ3B 4HFWA 1FRGH 4X7TA 3WO4B 3MGAA 7PAZA 3HR6A 4GIPD 2X7LA 3S6CA 1QSFD 3QG6A 1TETH 5F70A 4UNIA 4K23L 1SVBA 1D5ZA 4MA3B 1BEYL 4PWIA 3TF4A 5LGHL 2VXQH 5IP4A 4A67A 1AKJD 4Q9RL 3OG4B 5A40E 3V5DA 4R2GC 4QXGL 4NN5B 4U6HB 1NCOA 2YS4A 4PJ5D 5F7AA 5GGQH 3MV8D 2OM5A 4LHUG 2GYSA 4DP2X 4KRLB 2ZX9A 5HY9B 2FEJA 2ZXEB 4GW5B 1E4KC 2YC1A 1N6QL 2R23A 3LZQA 5ESVB 4NZRL 4UQ9A 4WHYH 1L5GB 3RDTD 2WHVA 2YSTA 1ZXQA 2OL3A 2JK5A 4OKVA 4H8PA 4NO0D 1KB9K 1NDGA 4EIUA 2Y72A 1FPTL 4JB9H 3FTGB 1VFMA 1KCRL 3M1CA 2OFQA 3AADB 3VRLF 3TVMA 2VDQL 3FH7A 3OSVA 1RVFL 1YRKA 1PFOA 2VTFA 3AT8A 5GGRA 4MASA 3SKUD 4HS6A 2FB4H 1OGAA 3HKZA 4XC3L 2WVSA 3MOAH 4R4BA 4LAQL 3PL6A 4GAGH 3C2AL 2IV9A 3QR2A 1GPOH 4AQ1A 1A9BA 2NW3B 3BT2H 3QFJB 4NAJA 4KK5C 4Y4FD 2GSIB 4JFZL 4R6UA 5DT1H 1JPTL 4LSQH 1VERA 4P4KD 1A4KB 4GQRA 2DQFA 1R5WB 1ZK5A 2I85A 4M6NH 3VFSB 4PJGA 5JPMB 4XWGH 2NQ3A 3C2SA 5HPMA 4JY5H 2ZUXA 4DN4L 1TFHA 2J88L 3L7FB 1KFGA 3I85A 4NNPH 3SE4A 3O2WL 5I1EL 1NM4A 1Y0LB 3OZ9L 4XCCH 5CWSB 4IBSA 5E2TH 1QWHA 3PV6B 1YEJH 2EEBA 3VXMA 3HG1E 3BYYA 5EO1B 4PJBA 3KCWA 4QAMB 3DETD 1U30A 4N6QA 1JFQH 5I1DB 4XR8C 1RULH 2OA9A 3T08A 3TLRA 3FN0H 3BKYL 4FQHB 4GS7C 5F1SA 3A21A 4DQOL 5HYJE 3SDCB 3SGDH 3U30B 1ZGLA 1TCRB 1N5YH 5AL0A 2B9BA 2VDOB 1RP8A 4WY7L 2IH9A 1N5AA 1JYXA 2ZWNA 3FFCA 1NGPL 3L3DA 5K59E 1UKQA 4DUVA 4JKWA 4Q8BA 3MV7A 4IBQA 5CBEA 1GGBH 1KXHA 4DP7X 2VIRA 3CFBA 4C4UA 2H8PA 4FLRA 4PWEA 1LHZA 4MNGA 3L5JA 2WUBL 4H26A 3GK8H 4BRJA 1KGWA 1A6ZA 1GGCH 4J3XA 4JO1H 3T09A 3N43F 4RX4A 1ZLVK 5E8PA 3VGGA 5IFAH 2YUWA 3IFNH 3QXVA 1BAWA 3SODB 4ZW7A 4XPFL 5LCVH 3SE9H 2ZYSA 2Z31C 3AT0A 2AEWA 4TLSA 1K8DB 2O5YL 5IQNA 1CL7H 5DYOB 3JV4B 2UZIH 1M3JA 4PJCE 5F7NC 1Q9LA 1BLIA 1IEBA 1O9ZA 1QNZL 1KLUB 3AG2B 5FW6A 5GGRY 3TJHD 2OQJA 5KBPA 5ALBH 2N1TE 5I76A 2CPUA 1NEZG 4X0KA 1XF4A 4J23A 4JPWL 3LQAH 5D7LA 1IM9D 4HHAA 1W80A 2EH8L 4PJ9D 4YDNA 2N56A 4KROC 4UINL 4ZOCA 5E2WH 3S8WA 5I16B 3HE7B 4LSPL 1NGXA 1JGVL 1KN2L 4ZW3A 3N40P 4P5KA 1J8HA 2HVKA 4XVTH 2R1XA 1VCAA 5I17B 4IIQC 1CFTB 2VDLL 3EDDA 3FOLA 3QHTC 4JPKH 3MXVL 3EFDL 3VRIA 1DVSA 3VFRB 3KYNA 2PXYA 2YEZA 2FWOB 1XGYH 4RSYA 2Y5EA 3EJUA 4HCGA 3GMMA 1G9MC 1QX1A 3ARBD 4DSYA 2F5AH 1B0RB 2DL9A 1QW8A 4LCWE 4TUUA 3CSYA 5D6CA 5K9OB 2FO1A 4RGNC 4GI9A 3BAYA 4UQIM 3MLVL 1PJ9A 2ZCHL 1A7PH 4AYEC 5B39G 2EABA 5IT2L 3F5WA 4O02L 4NKIL 3CFKB 4P5SA 1NCUA 3T6ZA 3PQYE 1SPDA 2VUKA 5GRYA 2TRHA 3NJHA 4NC1C 5DEJA 3F7KA 1WAAF 3ZT6A 3QNZB 1W2KT 1PZ2A 4RA3A 3VI3F 3F7QA 1RK0B 3RWDB 3WUWB 1KIPA 1H8NA 3EDEA 4I5BA 3ET9F 1WG3A 1YEIH 3KXFE 5CN3A 1F8TL 1YEFL 4AM0B 1T7ZA 3HI6H 5I19H 3QUXC 4JE0A 4HW6A 4NZJA 4OGXL 3EYUH 5DFVD 3AWGA 1QSED 3RWJA 4FA7B 5F7FA 2FWSA 2GAZB 4AV0A 3NSCA 1QFUL 1KYOK 5D96C 5FYJU 5F7WC 5KAQF 1U2HA 2ENYA 1MFNA 3H7BB 2F7RA 2R29A 3U36B 4ZMWA 4ODUB 2DQCH 4DUWA 5GSRB 1YJDC 2VSCA 4X80L 3PNRB 3S96B 5CHNB 2DF3A 5D1QC 5LNGA 4R0LB 4BH8A 3CPLB 3DX7A 2QZ5A 4P4RB 3G08B 3PABB 1KGYE 4IBTA 4W68A 2I5YL 3RX5A 1TSRA 2DQGH 3I6KA 2P42B 1BVKB 2Y5TB 3UZEC 5CEXA 1TT6A 2XYBA 2Y7MA 4YFDB 5C07D 1N4XL 3LNGA 4RFEA 1JF1B 4YR6B 4UBDD 2QPUA 1Y1DA 4X5XB 1ACCA 3D08A 1UENA 4MQ7A 2BSED 2Y23A 4JLRB 3DOSB 1DYZA 4ZI8A 3GSVB 3K7UA 4HCRA 5I75B 1F1DA 1OE1A 3DIFB 3VNZA 2V2XB 3MJ8B 3N5AA 5IMKA 3RGBA 5IR1B 1P5UC 2EXWD 5E1QA 3L48A 1VPOL 3HS0B 4Q6IA 4B9IA 4EI5C 2QQKH 3BCDA 3LEXB 4I4WA 2E8YA 3MV9E 1NZRA 4U6VL 5F1NB 3K74B 1QI3A 2PPFA 4LDLB 3BZFB 3CK0H 3BEWA 1NCCL 1K4DA 1FHGA 3OAYK 4R4NC 3VD5A 5D7KE 3SQOL 3S35L 4HIEA 5ENWB 1HYRC 2P5WE 4M62L 1UD5A 3UJTH 3GHBH 2D7NA 1NUFA 3IKCA 5T5FL 2ZCLH 1ZVSA 2SEBA 4PJDA 1T1WA 4M8QA 5BO0D 4K71C 1KCBA 4YDVA 5DJAB 4UQ2A 1IEAB 4ATTA 4IHOB 2EEDA 3LY6A 3WTWA 4XOBA 5HI4C 2MKWA 1R33A 4NYLB 2F7OA 2FLBT 4UQ3B 1AXSB 2NY0D 5DRXA 5DQDH 4NQCE 3O6FA 2XA8L 3ERXA 3TBSA 3VAEA 1UH3A 2BNUA 4FN0A 4I2XE 1U95B 3ETBF 1JHLL 1JGDB 1S3KH 1GW6A 3O6LL 3IDJA 3QRFM 3VM5A 2AANA 1YY9C 3ESNA 5GS2H 5C0JA 5F7LB 1L0QA 3GD1C 1FFPA 1RMFL 5IGXH 3HR5B 4FFYA 4I3RH 4JRWA 4MBRA 1QSFB 2QKIA 4JRXE 5BW7A 3ETSA 1MFAL 2JJTA 3EKCA 3DXAE 4LMQE 4NENA 2A3TA 3WKML 1AKJB 1NC2D 2A0LC 3RFZA 4NQVB 5I1HH 3GHEL 2W07A 3B9KC 4LVNC 1N67A 5DUPL 4OIIH 3M1OA 5KBDA 4PJ5B 2XG5B 2ZXCA 3IMRA 3VCLA 3MV8B 3D25A 3HPJA 5MENA 1BM3H 5LBVA 3FN9A 4U6YB 3W3BA 3U83A 3SQBA 3QGVA 3SJVE 4MDRA 2XXCB 2JB6B 2OTUA 4GXUM 2HLAA 3VXSD 4KKAC 3KPRE 4YK4B 2IPTL 4NO0B 4M7KH 4J7RA 2H32B 2BSSA 3ZYIA 1UHVA 3RX7A 4LFHD 5A16A 1SN5A 3E2HB 2F1BA 2ICES 4ACPA 2XWBB 2B59B 4AQZA 3RL2A 1HXYA 1ADWA 4BBWA 3QJXA 4PWKA 2VM3A 4P5RA 1DLFH 2HP4A 4BZ1H 4ACTA 2ATKB 5JZ7C 3BPLC 2J73A 1WT5A 3QJZA 4GKZA 3Q05A 1S7RA 4Y4FB 3IK2A 2KUTA 4JG1H 4WHDA 2OMWB 3E3QC 3POCA 4F7PA 4P4KB 1G7QB 1HKFA 4Y16B 3BN9D 3FAWA 1I3RB 1ZV2A 4PGDA 1FIGL 5DJXB 4ZFZB 2K8QA 4U1SA 2K6WA 3OAZK 3H4FA 4OZHE 3MCYA 2BIHA 3ES6A 4UZGA 3SO3C 1ZT4B 2E9GA 3QH3B 3MR9B 1DLHA 2NY4C 4FQ1H 5EORL 2HUHA 3CQQA 4FTVE 3T0EC 3TEUA 4Y5YB 3QI9A 4XOCA 2IDFA 4JN2A 2APWA 1WLHA 2WIIB 2F74A 3D3VD 3OMAB 4F57H 2EIKB 3ATEA 3OMIB 5AWNH 1WA2X 2VDKL 3FJTA 3U1SH 3ULUE 1MZZA 1LQBC 5D1XA 2Z64C 4XCNA 4PBDA 4XMPH 4V11A 5KYYA 1KLGB 2NSXA 3B2DC 1QR4A 1B9KA 1AS8A 2X1PA 4HJ0C 4JQVA 5E1AA 2NXZD 4N90E 3ZE1E 5AOIA 3IM1A 1AZBA 4X6FA 4NIKB 3PDGA 3OJMB 2LV4A 4CC0A 4F5CA 5ELIA 3QJTB 5H94B 2DIBA 1X4ZA 3NCJH 5D5MB 5C6WH 5FOBB 4OT1H 4P59H 3VE0B 1OP3K 2E59A 2BOBA 4PGCA 1BZ9B 4W6YB 5CGBA 5IQLA 1MQ8A 1BSIA 2X28A 4UQBA 1EDHA 1ID5I 2X89D 3ZKXC 3LRMA 3WKNA 1U2YA 4FXGB 4JPVH 2ZX5A 5SWQB 4KNQA 4CDHA 1E28B 2J25A 2HKFL 2KLTA 4RLDA 5D7IE 5JLZA 1YJDL 5CEZD 1S7UA 1UJ3C 5JMOC 1N8ZB 5FDWA 2RQEA 2JKWA 4U7SA 4S1RL 3O2DH 3VH8A 3O9WA 1UWGL 3BPOC 2HG0A 1TVHA 5FV1L 1WIPA 3HUJB 1TEYA 3L5XL 1KBPA 4ELMA 1AR2A 5E7FA 4NKDA 5E6SB 3H0TB 2EC8A 2GFBA 3CFDA 3H2PA 5FIEA 1Z66A 5J6SA 3B2XA 1J86A 1QZNA 2XKUA 4HUUB 4KY2A 4WJG3 3TEZA 1CB4A 4K7PL 4S0TD 5H37G 3VG9B 1VF5C 5AVXB 5SX5K 3QNFA 3AU1B 2V7NB 2WNGA 4AJYV 4E9VA 2X87A 2OCJA 1S8DA 2HVJA 1IM9B 4JCMA 2UY6B 3B2PA 4PJ9B 4TSBL 5KVDL 4DP8X 3CFIC 1KSRA 3B37A 1EDQA 3LDBC 4MNHA 2ZOKA 1GGIL 1KYFA 3E6FA 3KJ4B 4Z3GA 1CE6B 2G9KA 1KJ2H 2XLLA 3VW3H 3FB7A 4IDJL 3WIHA 4ISVA 1IJNA 1J11A 1OT1A 1Y07A 4KHTL 5HYSB 5I8CB 3PJSB 3KMDA 4AVIA 4KITB 4PB0H 4L29B 4AVJA 1NWOA 2LVCA 3J8F7 1GMEA 5AAMA 2XX1A 4PJ7A 2VAAB 1XF3A 4CVZB 4I89A 3L3OB 5KVFH 1IGTA 4MJIE 4AMKL 3W39A 3KCPA 2IAMC 3WFHA 1SXSA 1V27A 4CKVX 2OMTA 1BQSA 1KB5A 2YAOA 4K7FA 5GXBB 3UG4A 4R5TA 5JXAL 1PYWA 4GBXD 4Z7UA 2A77L 4XTRD 2Y7OA 3EBIA 2E75C 1PZAA 1Z2KA 1XR9B 1R5IA 4PVLA 5KYNA 1JPGB 4IK6A 2OZ4L 4Q58C 5FYKL 1BMWA 4QY8B 1T2QH 4QNPE 3FQXB 2F53A 4J3OC 1RZ8A 4YAQA 2BS9A 2W92A 2D9CA 3BGMA 1I1YA 4NPYA 3MUGB 3TBTA 5JA9A 3IFOA 4LRNL 5J12B 1WEJL 4LDCA 1MCCA 5EDSA 1OCRB 3CZEA 3IAPA 3RNQB 1G7HB 1B88A 2X4OB 5C6PB 3SY0B 4IU2A 3CZLA 4LDEB 5I71B 5M95B 3MYZA 1G6RH 5FW7A 4ZTEA 5KJ4A 2YEQA 5BQ7A 2GIYA 3N55A 2DLEA 1T20B 3TH3T 3OLGA 1P0SE 1ANUA 4FQCL 3D2UD 1OAYH 4PB9L 3QIUC 3DWTA 1USQA 3QIWA 1QSEB 5HDBB 4JGNA 5F7DB 4HWBA 3PWUA 3WTVA 4FYSA 4QYOA 5DD0L 5JIIA 4N2BA 2EYTB 1PLCA 4K8RL 5T3ZD 1A4CA 4RMTA 5D4JA 4DK5A 3L9RA 3LAFA 3IXAB 2X09A 3I50H 5D7JC 5TFSL 3QYNA 3P30L 1NFIA 3L13A 3HG5A 4N8PA 2F7PA 5IM7B 2ORBH 3QJHB 1YPZF 3CTTA 3PIQB 2WLNA 4LVOB 2MWCA 4QAWA 5I30L 3BKCL 2Y2YA 2VQUA 2ZUQC 3WJLA 1HKLL 3VXUD 2ZSWA 1BZ8A 3B56A 5FF6B 4QRPA 1ACZA 4XN1A 2G3XA 4G6AD 2J8UE 4LCIL 5DHVH 3CUPB 4DPBX 1ZANL 3L2MA 1U21A 4FD0A 1CD1B 2P8PA 5EU7E 5T1MB 2EDWA 1DTUA 2AJXL 4ZX4A 2GJ6A 4AEEA 2I9LA 3IEAA 1OM3L 1TJHL 3V4UH 1K85A 1A6TB 1RSYA 5AOJA 1HZHH 4FE9A 4OCXH 4YIQB 5HGAA 1T66C 1KPVA 2VN3A 3X3FL 3D87B 5E4EB 4XX5A 5F96H 3WFDH 4HV8A 2FIKB 2JH2A 2R0KH 3QDME 2CGRL 3GT6A 3EO9L 2C3HA 3T1FA 3GB7B 1RUQL 2JKJA 3NN8B 2LFGA 2Y6SC 4YDIH 2XFXA 3TBYA 4B60A 1GCFA 3ATBA 5KS9A 3DO3A 1LNUB 2BP0A 1K4CA 1JVOA 2JJVA 1F3DJ 1OB1A 3LS4H 4FNLL 1MDTA 4PLOB 2DYPA 2X9ZA 3MRFB 4FLHA 1FFRA 2WLHA 3BVNB 1JV2A 4KJWD 4FYRA 2X6MA 1V8HA 2BVQA 4UDUB 4WFFE 3DHMA 1MFMA 2PP9A 1U92A 4GFTB 5EMYA 5INDB 5D5MF 1HJCA 4HH9B 4NS0A 1WPCA 4GP5B 4MAUL 5DUML 1EGJH 3MSPA 3U0WL 2Z8SA 4JY4A 5D2NE 2NY0B 4HD9A 3DX6A 2B0SH 3FF7A 4LSUH 4JUSA 2HLFD 5FO7A 2FJHA