3FU9A

Melanocarpus albomyces laccase crystal soaked (20 min) with 2,6-dimethoxyphenol
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Laccase-1
publication title Structure-Function Studies of a Melanocarpus albomyces Laccase Suggest a Pathway for Oxidation of Phenolic Compounds.
pubmed doi rcsb
source organism Melanocarpus albomyces
total genus 166
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu9A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu9A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu9A03
5I28A 4UANA 1WA2X 1PNDA 3V9EA 2PPAA 3WIAA 2BO0A 1JXGA 3T9WA 1OCZB 3NJMA 2N0MA 4DPBX 2IDSA 3QJSB 5F7AA 4N8UA 4JHVA 1ILSA 4MFHA 1WS7A 2QT6A 1CYXA 1ASQA 1PMYA 1PF3A 1IKOP 1NICA 4G7RB 2GIMA 3IEAA 1AAJA 4YSRA 3X1FA 2J56A 3NJGA 4NAJA 2P80D 2Q9OA 1A4CA 3S3CB 4BK5C 3FPXA 1GS8A 3MX0B 4BWWA 1A4AA 2GC4C 4HCFA 3UGEA 3GYRA 3NJHA 3H4FA 2FQEA 1AS7A 2P80A 2H47C 4X4KA 1BYOA 2EIJB 4KOCA 1ET5A 3FYIB 1NTDA 3JTBA 3T6ZA 5D4IA 6PCYA 2I85A 1E5YA 3FSVA 1KDIA 2PPDA 4DP2X 2BW5A 2YAOA 2NRDA 1JERA 4CSZA 2I7SA 4TXVB 2YAQA 5I6MA 2HX9A 1L9SA 1KGYE 4F2FA 1DZ0A 1JOIA 3PLYA 4BDVB 1GS7A 2X88A 3FU9A 2AFNA 1WAEA 5I6LA 5TK4A 3PAZA 2QDWA 2BWDA 1CYWA 1RCYA 3AG1B 2W88A 5D4HA 1MDAA 1AOZA 2IDQA 1E67A 1WS8A 4BWTA 2QDVA 4E9XA 1RZPA 3FSZA 4G70B 4HHWA 4NB7A 3CG8A 1IC0A 1SF3A 1SDDB 2FT7A 3X1NA 3GXUB 3ZBMA 3C75A 6PAZA 3ERXA 1A65A 3NSFA 2QPDB 2UXFA 2DV6A 1ZPUA 5A7EA 2PCFA 1N68A 1AZBA 4YVUA 4G7SB 4YL4A 1E30A 1IUZA 2FQGA 1NDTA 1XMEB 4KNSA 2XXFA 8PAZA 1ADWA 1QHQA 2VW6A 4GP4B 1ASPA 2QPEB 4NERA 1RKRA 4UF7C 1TEFA 5I26A 1OCOB 4M3HA 3UAAA 2CUAA 4KNUA 4WTQA 2XYBA 1GSKA 3OMAB 2PPFA 1MZYA 2CJ3A 2UX6A 4L0PB 2EINB 1PLBA 2OV0A 5B1AB 1OCRB 2I7OA 2GI0A 5I6PA 2XUWA 5B7EA 2FQDA 5TK2A 2VM4A 1A3ZA 1OE3A 1GS6X 1JVOA 4A67A 3IN0A 3WKPA 4ENZA 2AVFA 2VMJA 4KOBA 4CSPA 1L9OA 3NP3A 1NIBA 2FJSA 1AQ8A 4HAKA 3ASNB 1PZCA 3S3BB 4JKNA 4GP8B 4BXVA 2HRGA 3T6WA 2YAFA 1I53A 3MBWB 1J5CA 1AR1B 5B7MA 1ZDQA 1OE1A 1W6LA 3ZDWA 4YSAA 1GY2A 1W8EA 3AY2A 1AS6A 4DP6X 4E9QA 3BVDB 2CCWA 1JXDA 1BXVA 1M56B 4JHUA 4YSTA 2RACA 2XV0A 1ILUA 1ET7A 3WI9A 1BYPA 2ZXWB 1NWPA 2TSAA 1SHWA 1ID2A 4HCGA 4WKXA 4YSQA 4A2DA 1BXAA 3NP4A 1ETJA 1V55B 5EHFA 3ZIYA 1OF0A 2Y69B 4YVNA 2XX0A 3PAVA 2ZWNA 1CUOA 1NIFA 3HEIB 5B7FA 2WSDA 3TBCA 2W8CA 3TA4D 3DTUB 2BW4A 2IWKA 5PAZA 2DY2A 3T6VA 4BWUA 1XB3A 2JKWA 4A2GA 5D4JA 3UADA 1OOWA 2BZ7A 3OQRA 3H4HA 2MTAA 3NT0A 1JZGA 2JXMA 1SF5A 4W1TA 2TSBA 2A3TA 1AIZA 1AZUA 1PCSA 2LLNA 1URIA 1PZBA 5I6OA 1OV8A 3CZUB 2YQBA 1J9RA 1BAWA 9PCYA 1VLXA 3AG2B 4KO5A 3SQRA 4DP5X 4YSCA 4F7KA 3WKQA 3CVCA 3TBBA 4PCYA 4AI7A 3IN2A 4EF3A 4E9WA 4AKPA 2YARA 3G5WA 2VSKB 3UABA 4DP4X 2PP9A 1WA0X 4P5SA 1JZJA 1BXUA 4KNTA 4YSSA 2IWFA 2AZUA 5B1JA 5IY5B 1NPNA 3NJJA 2UXTA 4N4YB 1AS8A 4YSPA 4G72B 4QKTA 3QJUB 1A8ZA 4G7QB 1NIEA 2PP7A 3U25A 4DP0X 1ZIAA 4BXSV 4DPAX 3QPKA 2XLLA 1TEGA 2GBAA 2HLEB 5I5MA 3DIVA 1JVLA 3NSYA 2IDUA 2PP8A 4A66A 3EH4B 4AKQA 1L9QA 2DYSB 3D12B 2XU9A 1J5DA 2GC7C 3AG3B 3UACA 1J9QA 3AW5A 2WO2B 2YAEA 2XX1A 1AG0A 3FQYA 1CC3A 5AZUA 1OE2A 1SFHA 3NYKA 1FFTB 2HX8A 2VSMB 1OCCB 1FWXA 4KO7A 3NJIA 2EIMB 1BQ5A 1BQKA 1AZCA 3HB3B 3EH5B 2VN3A 2VM3A 1M57B 2ZOOA 1GYCA 1KBWA 4DP9X 3IBOA 1UATA 5I6KA 3EH3B 3OMIB 2HZHA 3DKHA 1NINA 4Q89A 4AX3A 1ET8A 2FT8A 3N2JA 3EF4A 5I5IA 4KO9A 1XB6A 3FS9A 3T71A 4E9SA 4ZK8A 3WNIA 4YSOA 1AZNA 5LDUA 2BP0A 1KV7A 1RZQA 3UAEA 3NSDA 2VW7A 1BQRA 1KCWA 3PXLA 4GXFA 1X9UA 4A2FA 2J5WA 4Q8BA 1L9RA 1PY0A 3ZX1A 2R7EB 1SHXA 1E5ZA 2GSMB 2XV3A 1JZFA 2J57A 5B3SB 4YSDA 2IDFA 2BZCA 4GYBA 1NZRA 2E86A 2HX7A 2X87A 1B3IA 3S8FB 2YAMA 3KW7A 2HXAA 4AZUA 3JT2A 2DYRB 1JZIA 1V54B 7PCYA 5F7BA 3FT0A 4A68A 4DP8X 1IBYA 1ZV2A 1E65A 1EZLA 2GHZA 3FSAA 3X1BA 1W6WA 3FU7A 1J9SA 2CALA 2PPEA 2XVBA 2YAPA 5FC9A 1SFDA 2AANA 3SBQA 4P5RA 1FA4A 1ASOA 3QJVB 2R7EA 2IH9A 5PCYA 2OCCB 4DP1X 1X9RA 2B08A 1N70A 1PNCA 3ABLB 2UX7A 2AZAA 2IWEA 2IAAC 4F2EA 3SBRA 2Q5BA 1XB8A 2FQFA 2H5UA 2YXWA 3L45A 1HAUA 1KBVA 3CDZB 3OD3A 2CAKA 1DYZA 2YXVA 1BEXA 1JZEA 1HAWA 3RYMA 2IH8A 2XWZA 4HCIA 3ASOB 1AZRA 3S8GB 2J55A 3PPSA 2BWIA 3KW8A 1SJMA 3X1EA 1HFUA 1YLBB 4KO6A 3PCYA 2Y1AA 4K9JA 1NIDA 5B1KA 2CBPA 5B1BB 1GW0A 1KCBA 4FAAB 1ZIBA 3TU6A 1PAZA 1SNRA 2FWLB 3FU8A 1TKWA 1CURA 1IBZA 2PCYA 3QJQB 1AACA 5I5JA 1TU2A 4E9VA 4UAHA 3GDCA 1EHKB 2WO3B 2XXGA 2ZONA 3CDZA 3NJFA 3V9CA 5AKRA 4AKOA 4A2EA 5E9NA 4E9YA 3NSCA 2DWTA 1MG3C 3T6XA 2UXGA 4FA7B 3FQ1A 2MRYA 2GB2A 3X2QB 2VW4A 2IDTA 1QLEB 4E9TA 5B1JC 1AG6A 2FNWA 3OM3B 4A2HA 2DWSA 1L9TA 1M9WA 4HZ1A 4BDVA 4DP7X 4QLWA 1MZZA 2BHFA 3BQVA 4HALA 4GP5B 2H3XC 4W9ZA 2BP0B 3CVDA 4RH4A 1PZAA 5ANHA 1F56A 7PAZA 3CVBA 5AFAA 4YSEA 1NIAA 2PPCA 1KDJA 2HRHA 3ABMB 2BP8B 3S3DB 3ABKB 3AZUA 3OMNB 1GY1A 4YSUA 3NJKA 2OJ1A 1ZDSA 2JFCA 1NPJA 1NWOA 2FT6A 4PAZA 1SDDA 1V10A 3WG7B 3EHBB 2EILB 3H56A 3N55A 1PLCA 3NJNA 2UXVA 1WA1X 1JXFA 4E9RA 3FQ2A 4HIPA 2FTAA 3FPYA 1A4BA 3FU7B 4GY4A 4HHGA 3WNJA 3FYEB 4G71B 3X1GA 3QJTB 1AANA 1L9PA 2B3IA 2XV2A 3FSWA 1JZHA 3ABGA 1KYAA 2PLTA 2YAHA 5I6NA 4DPCX 1MG2C 1R1CA 2EIKB 2BP8A 3IE9A 3PAUA 1QNIA 3QJRB 1PLAA 3SBPA 1GR7A 1J9TA 1T5KA 3AG4B 3QQXA 4M4RB 3NJLA 3TASA
chains in the Genus database with same CATH superfamily
1ZE3C 3MLUH 4JK0D 2VDOL 1PNDA 1BXXA 1BAGA 4N8PA 4YGVA 1N8ZA 5IUCA 7CGTA 2OMTA 1J0IA 5DEJA 1SZNA 2DQCH 3O2WL 5J13B 1WCQA 4UQ3B 5K69A 4N8UA 2E9WA 1AKJD 1WS7A 4B9ZA 1J9CT 2E7MA 2R2CA 2OMZB 4MA8H 4X80H 4CVXA 3WD5H 4Y19B 5IJDC 4R7VA 1T1YA 4EDXB 4KKBD 5K33A 3Q13A 1YPZA 2GBVA 1GC1C 1R75A 1QSEE 3KE0A 3K8MA 4NM8L 3SGEH 4MQTB 4N22A 3MUJA 1FZJB 1A4AA 3OXSA 1WICA 2C3WA 5I0VA 4G7YL 5DMJB 2EIEA 5CIPH 2FB4H 3TVMC 1XWVA 3FT2B 1IJNA 5DD1H 4NO2A 4I13B 2A9NH 3N9GH 1YNTB 3PIQA 4GSXA 5D9SA 2EIJB 4KOCA 3ZE0F 1PKQB 2BVYA 1CGVA 4QO1B 4I85A 2D4FA 2CCLA 6PCYA 5D2NB 3VFNB 1LP9B 1E3XA 5IJKA 1NCDH 2XWTB 1UM6H 4OJDH 2P8MB 3OGCB 5I6MA 3EBGA 1Z5HA 2GTWB 1KGYE 3EBAA 3KS0J 4FCHA 5BVPH 5IB4B 5E51A 2G75A 1DUYA 3AWFA 2FD6H 4KRPC 4BZ2H 4Q9RH 3U46A 4ZUSA 3F12A 4MMZB 3D48R 2VT0A 3KYKL 3KM1A 3RWFB 4DGYL 4JO8A 5DEGB 4LPVA 3HC4L 5DWUH 1NKRA 4RZKA 5KVGE 1B0GA 2FEEL 3NCWA 3F2LA 3QIWC 4JFEE 3S37L 2FL5A 4AGQA 5E56A 2VDNB 3WNOA 3U4BH 4E9XA 3QDJA 2X4QB 1N59A 4PRPB 4N0UA 4U1HA 5AD0B 1ULVA 4S2SA 3GXUB 4YEEA 4F24A 4ZMVA 2H32H 1CR9H 2OTUA 4A6YA 1YC8A 5HY9A 1JXKA 3RWGA 4ZG1A 5AW0B 4PD4K 2VDPB 3VFUA 3L1GA 4ABWA 4XNAA 2FECL 4JW3A 3CNKA 4QD2E 1AE6L 2WUBL 2AK4A 2XXFA 5E9DA 4F9LA 1JPFA 3OZLA 1QACA 4QRQA 2RAMA 1XQ4A 2B59A 2QPEB 3VXUE 5GS0D 3NGBB 5F1KC 3FQRB 4K5OA 1WEJH 4KQ4H 1I8UA 5FECB 4XZUA 3FRPB 2X5PA 5E1AB 2PPFA 3VI3F 3E0GA 5GGTH 3CFNA 3VXUA 3Q5OA 3QUZD 4ORGB 4FQ2L 3HMXL 3EOTH 3R4DA 5BRZD 1J11A 3BUDA 2DI8A 5H94A 4KROD 3RKPA 4ZMXA 3P0VH 2Q3ZA 5JYLA 2V17H 4YHYB 2HKHH 4YXHH 5C7XL 3V6OE 4FXGC 3DYOA 1R5IB 5ALBH 4A67A 4Q6IB 2I25N 4HKJB 4JG1H 1RVFH 1MCHA 4JO2H 3NEXA 4ZNEE 3FQNA 1W91A 1MAKA 2JIXA 1VGEL 3SGEI 3MNMA 3U9PH 3TWCH 3P11H 4OQTL 5DJCA 5DT1L 5D1QC 1AKJB 4JFSA 4R0LA 2PWDA 4Y5XC 1ZVSB 2P4AB 1DTUA 2Y23A 4RZCA 3TBSA 1P4UA 4KZEH 3V5DB 3WTSA 4C4UA 4S0HA 5FYLE 4FG6D 1GVIA 4D3CH 1DJZA 3G04A 2ZAIA 3IDIA 3FOMB 3AY2A 3QRGH 4LK4A 4OAWA 5D71L 1BZQK 1ZLVK 3D0VA 2L3BA 4YN3A 2EUVA 5D4QA 3IVKA 5CCHE 5E5UB 1IAMA 4DN4L 3UZVA 1SOKA 5HHOD 1T1WB 1IIKA 3M1BA 1SHWA 5AEAA 3AITA 2EAEA 5TQ2H 1AOHA 3N50A 4PJCF 4U1LB 3UTOA 1OD9A 1MHPL 3CSBA 4I7ZC 2X1QA 3KLQA 3WNNA 1CFNA 4U3SB 1T20B 3T3MB 1I7TB 1X5LA 1PG7X 4ZMWA 5AG8A 5PAZA 3DSFH 4KK8C 3WAJA 4H8WC 1N19A 1RUAH 1GXEA 4RA0C 2K45A 1QEWA 1TZAA 1AGBA 4RMWA 4N9OB 1QQDB 1ZE3H 3VXTA 1AH1A 1MN4A 2WJ5A 2KZ1B 3V4VL 5KN5B 1MEXH 1PD0A 1BQHG 5FCSH 3ZYZA 1CLZH 1OV8A 1T66D 3DRQA 4MNQD 4RRPA 3TYGH 4XRCA 5I71C 4PJIF 1DSYA 2WWNA 2X09A 4IRSA 1AXSB 5E5LA 2P24B 2C26A 3ZYIA 2FAUA 1FAIL 1YMHB 2R56H 5EO0A 4NXKA 3ELAT 4C4BA 4HJUA 4WUKL 2G60H 2QPUA 2PW2B 4JE0A 4JPKH 4PCYA 4P2CG 3ZIMA 4YHKL 3GSNL 3IN2A 1O6SB 4GEIA 2I5YL 4L4VE 4JLRB 5GRWA 1LO2H 2EIZA 3QISA 1WFOA 4YSSA 3LHPH 2BVOB 2G4EA 2YBRA 2QGCA 5F9JB 5IHUL 3H85A 3SKOB 3O8XC 3MNVA 3CFMA 3HFFA 4IK7A 1AS8A 3V5HA 1CICA 4CMHC 5FW6A 2QR0A 4X4ZA 2AI0L 2YFNA 3RWEA 3TX4A 2FJFB 3L5HA 1GAFL 2YBGA 3NJXA 1AD0B 5ESAA 3LH2H 3PNWB 5D7LE 3BVTA 4C54A 1QBLL 1G43A 1UM5L 5H4YA 3QUZB 4UQAA 2P47B 2A83A 4KROB 3MLTA 4PGJA 2BSTA 1U91B 3P30L 5IEKA 1FV1A 1E3ZA 1HOEA 5FK9A 1INEH 2FJUB 1XO8A 2YAEA 4ZMLA 3LV3A 1JDAA 1OE2A 2A4EA 2DQJL 4ZTOL 4IMKA 2NMSA 4Y16B 2VDKL 3EGXA 4FQXC 4L3ED 3P9LA 1N64H 2ENYA 3D5OF 3STZB 1Y0LA 3TEUA 3QWRA 3JSSA 4WDIA 3D2TA 4FOMA 3QULB 3NA9L 4LEOA 4R26L 3UTZA 4DNLA 5FGRA 1XSIA 5JA9A 5DK3A 1UATA 4IBQA 2EXWD 3EJPA 4ODUA 2MQGA 4RISH 5DYOB 3S4SB 3VXRD 3BAWA 3IM1A 4HKBA 1D5MA 1T0MA 5DJ6B 2A6JB 1Y6NR 3OKEA 5J4MA 4OLVL 2WLLB 4G9FA 1B4JH 3MA9L 4TUJA 1UTDA 5HHOB 2CKBH 5T3XL 1T21B 4G8IB 5IUSA 3G5VB 3JTTA 1TQCB 5FHAH 1JNHA 1U21A 2E9IA 3BSZH 3PU7A 4HUWA 4WCYH 3ZX1A 2NYYC 4XXCC 4UDUB 3SGDH 3F5WB 4JFYA 4ZQKB 1WV7T 1WBYA 2YAMA 5INCB 5B39B 4Q9QL 4G6MH 2VDRH 3JT2A 1QEXA 4FQ1L 1M7XA 2OK0H 3HR6A 3D25A 3VFGL 3D69A 4A68A 2ITCB 1R19A 4GSDL 3FTYA 2JKJA 4LOVA 3IK2A 5GRYA 1JN6B 1KTCA 4LPWA 2CALA 4Z7OE 4KTDH 3U9UB 3NQIA 3GXFA 4R96A 3QXDB 3FB5A 4WFHD 2DWEA 1FA4A 3QA3B 4J3OD 1FLRH 4IQHA 4MNQB 4XPHL 2IOOA 3BDYH 2NY5H 2ZOTA 3O41A 4OT1H 4D9LL 1HHGB 1PNCA 1Z3GH 2PXYA 1KELL 4G80A 3DIFB 1HI6B 3DTXA 2V2XB 3T08A 4KMQA 3UTQA 2VLKE 3QFDA 1JNNH 2X2IA 1RI8A 1JS4A 2CCVA 5FLUA 2X2HA 4X6DA 1DJSA 5CBEA 4JJOA 2VLKA 4FGMA 4K94C 5LHDA 1QSVA 1FZOB 1YYLL 1PFCA 5T33H 4JFOB 3IETA 2IC2A 1T1ZB 3C6LC 4NHUA 3NEOA 1NM4A 3L5XH 1MAML 3AUWB 2DTSA 3MLXH 4NM4H 4ZXBD 4U1NB 3FFDA 2AERT 1NIDA 3N42B 5I0WA 2D7QA 3PE9A 3VSQA 1N5AB 2ATKA 1PAZA 3OAYH 4U1KB 1CURA 1MVUB 2FBOJ 1L6ZA 2DRUA 3CSFA 1TZGH 1BFVL 5IJCC 3GRWL 1EHKB 1PIGA 1I3GL 3WEXA 5CEZE 1FDLL 5HGAB 4K7PL 3DVFA 1CI5A 1FNGB 1D5BA 3BZ4B 5LQBL 2VH5H 4I8DA 4HBCH 2JH2A 5KSBF 3DNKA 4XBEL 3RY6A 3NIFE 4EUPA 3BVNA 3HBPA 1YEKL 4KJQD 5ANMB 5FEBA 3VFRB 2R2BA 5DWPA 4L3EB 4J3WA 3RIFF 3VE0B 4IU3B 4ABQA 5CGMA 1RPKA 5A3IC 2RALA 2UYLB 3P4MA 4XI5C 4F7EA 3VI4E 3KPSE 4DKDC 2Y24A 1FL5A 2R83A 1GZHA 3MR9A 5C07E 4Z3TA 3ZHKA 2WSPA 3KPTA 4QOKE 4RDBA 3KYMB 3SO3B 1CMOA 4NYLB 4BZYA 1L0XA 3C9NB 5C07A 4YSEA 1UACH 2R0ZL 3SGDI 2PPCA 1KDJA 5SWQB 5GHWH 1WBXA 2HRHA 4LSQL 3KXFD 4PHZA 5CIPA 5DGRA 3PV7A 4OFDA 4JY5L 4PJDE 3T4YB 1A1NB 2E5EA 2F5AL 2YPVH 4JCLA 4YDLC 1JZDC 1E6OL 4H0LC 4DFIA 5BUPA 4XNZB 4YHNB 5FGBC 1PZ2A 1GOGA 1SMAA 3MACL 4QXTB 3D3VA 3QCUH 1DVUA 2EEFA 3KLHD 2DDQL 4N20A 5LAXB 3A3YB 3G6DL 4AE0A 1FAKT 4BKLB 5AOKA 4JHZA 5C97A 5LXVA 4JKMA 1U8NA 3ABGA 2YAHA 1FL3A 4EI6B 2QSTA 1N0LA 5EZJA 4WW2A 1FO0L 5HYEA 1L9MA 2O5ZL 2QSQA 2QSVA 3CXHK 1FG2A 1JXJA 3TNNA 2WGXA 4GG6E 3N43F 3TYFB 1NSNH 4XBPB 2FH6A 3S36H 1U3ZA 4ZMYA 5IHZB 4F9PA 4JM4L 5K9QI 5IIEA 2JWYA 2BXZA 5KS9A 1KLFB 3DHPA 3T9WA 3LRSA 4PRNA 2EH8L 5DUPH 4QCIA 4F7MB 3QG6A 2NR6C 3GC3A 2VXTH 2H32A 3L2MA 5JPNB 4JHVA 1ILSA 2PR4H 2Z91B 2Y72A 3DX6A 5J3HD 3SDDC 5DJYA 1PCXA 1IGTA 2C3VA 2NY7L 4QHNB 2UVFA 3TZVA 2VERN 4PP1C 3V6ZA 4HQQL 5D7IE 1ZT1B 3G5XA 3GSWA 1G1YA 3OXRA 2DMGA 1E4KA 1IQDB 2R2EA 3S3CB 3SPHA 1GS8A 4FNRA 2C9VA 1TMQA 2EDRA 3AWEA 1KLUA 3WLBA 2ADGA 2Y4SA 3P69A 3ZHLA 3H4FA 1M1XA 2ZX9A 1G84A 5GGTA 3PGCA 3EBHA 3F00A 2HG0A 4ZXBB 1AS7A 3QORD 4PJ5A 3AREB 4LIQL 2JB6A 1QLEH 2VWEC 2XQ0A 5J6HA 4I3SL 4MVBC 4G8EB 2WQWA 3EBIA 2MPVA 1F90H 1JK8A 1RPQA 4BFIA 1E5YA 3ZPDA 1FBIL 4CVZB 3IFNL 4L1TA 1H0DA 4PJFF 4AC4A 1JERA 1XSOA 1IC5L 1L9SA 2GW5A 1D9KC 1DZ0A 3W3BA 2CG9X 4RA3A 3L3DA 5DJ2B 4FABH 2FWSA 7FABH 1ZHBB 2WXMA 5FUCE 4X8CA 1C1EH 2A9CA 2Z7YA 1F8TH 3QUXC 5CCGE 1CYWA 4FG0A 3AG1B 3OVUB 4N8VG 5D2LB 3SGJA 3B9VA 3SZKC 4LHJB 3VGDA 2D2OA 1KNOA 1E67A 1OAZL 3OJDB 1X5YA 4G5ZH 5HI3D 1RUKL 4CGUB 2JJWA 1TETL 1E5AA 4HK3N 4HF5H 1K5NA 3F65A 4WWKD 2CGRH 2R0KL 3C75A 2V3FA 1YN6B 4MBRA 3KXFB 3NCJL 4K94H 4HIHA 3WY2A 3TURA 3TJEL 3ZZ1A 1UJ3C 4KNSA 1Q0XL 4ZOBA 1G7QA 1MH5B 5LKNA 5DJDA 3ETSA 5LUMA 2YSTA 3K6DA 5G5DB 4G11A 3RX9A 1KT2B 1ZA6B 2E6QA 3LEYH 5L7XH 3RHWF 3LKRA 2XYBA 2DM2A 3PWNB 3QFJE 3GBMH 4HJTA 1GW6A 2PW1A 4JZJA 3G6JF 3BJLA 4QY8B 3VACA 2XA3A 2X4PB 3FCUB 4HUKB 4UM8A 1PLBA 2LTQB 4GO9A 4OUUB 5LGKA 1OF2A 1ZLDA 3N85L 5DK0A 5BW7C 4PLNC 3A22A 3TF4A 1V7NH 1VFMA 2LHAA 4S1DD 2X6BA 3QQ4B 2GSIA 5IWLA 3THML 1IKNC 4NWTH 1O5PA 2MCMA 3ZL1A 4BH8B 2WXNA 1YY9C 3VFOB 3C5ZD 2YUXA 4JM2F 2C9PA 3NP3A 4NI3A 1IKFH 4ETQA 4N2BA 3GSOA 4TSAL 4KKZA 4DTGH 3MRPB 2VZVA 1UJTA 1C7TA 1S9VB 3K8LA 3MBXL 4X4MA 2IQAB 4GRLA 1J5CA 3KGUA 3UP1A 4P2OA 2IGLA 2NZ9C 1EFQA 2OR7A 2FR4B 2WANA 3AUVA 1EMTH 3CHQA 4NUPA 1OHQA 2SEBA 1BXVA 3BAJA 4JFDA 3IGKA 3F6JA 2FJGA 3JWOL 3PHOB 2WOBA 3GI9L 2VRQA 2AEPH 1XGPA 2BSEA 4X8XA 1FNEB 4U05A 3QORB 2C4XA 3IJ7A 1I8MB 1TTBA 3A4FA 3A67H 3MLWH 3UTSE 3QXVA 5EZIL 1IT9L 1VADB 5D8JL 3IDNA 1KXTA 1FSKB 5I1CL 1S7WA 3WIIH 2ZWNA 1NMBH 3ZTDC 5KOMC 3RNKA 5IFJA 2CJTA 1Q0EA 3TBCA 2J1YA 5D1XB 1JGDB 3U6RB 2OW6A 1QO3A 5BS0A 4AG4H 2P46B 3HZKA 3FUIA 4PJBA 5D7JC 3DOHA 1H3GA 3FO1A 3H4HA 2JXMA 1GMIA 1SBBA 1MUJB 1USZA 4DETA 1CBVL 4NNXB 4L8SA 3WS3A 2A6IA 4XMPL 5EIIA 3PDGA 4XWGH 4TNVK 2W94A 2W60A 4ODVL 1T89A 5BUAA 5DC2A 3RU8H 1OANA 2RQ8A 3B2UD 5A2IH 4UIMA 2BVUA 5JO5A 1BZ7B 9PCYA 1I8LC 4OUOA 4Y7OC 4ZZKA 1VEMA 3D39D 2FO1A 2BNQE 1HS6A 2EC8A 4WWKB 5EU6A 5IFHL 3UJIH 1LWJA 3ROLB 5AW2B 1KYUA 5IJKC 2O30A 2VTFA 1NGQH 2PYFB 3BP5A 2CK0L 2VSKB 4DP4X 2WVUA 1VDGA 2CKBA 1VFBB 2PP9A 1UUNA 2G0LA 2RCSL 2O4EA 3GNMH 5J1AA 1VZHA 3RVUC 1DQMH 1QRNE 3BSZA 3EGDA 1O9WA 1TOXA 2VRKA 3OMZA 4HC1L 2AS5M 4YHIA 2NSXA 1CD1A 2N01B 3ZKMC 2IAMA 1I85C 4OD3H 1KIRA 3ULUL 2CM5A 5IMOB 3OKNB 4G72B 3F84A 2KH2B 3QO1B 5D70L 4GBXD 4Z0BH 1OTSD 4L5FL 4HULB 3AQYA 4P4KD 1FPTL 4OZGE 4Y1AA 1MRFL 2ARJB 3CXDH 3GD1C 2VR6A 1TZIA 4XB8A 4XBGB 4CC4A 4N2LA 2G2PA 3OAZH 3EYVB 4P59L 4MJ5A 2MTPA 1OZUA 3C60C 4TL5A 3BJ91 4OZGA 3E8VA 15C8H 4FS0A 1GMEA 1SQ2N 2JJTC 4AKQA 4QRPE 2DYSB 1X7SA 2GC7C 3SQBA 1ZV5A 4P2RE 2R59A 3D87B 4NNPL 1U3NA 3IB4A 5I74C 4I2XB 4HHAA 4DZBA 5BZDB 5IKCA 1FE8H 3NK3A 3C5ZB 2QSCH 4NQCE 3ML9A 1A22B 1R3KB 4L37A 2B16A 4HUVA 3C12A 4Z7UB 4B27A 4XN8A 2VM3A 1U8JA 2UZYB 3BOVA 1M57B 5EBMA 1TCRB 35C8H 5SWSA 5TGBB 4DP9X 3PDDA 4R4BA 1F3DH 1QPXA 5ADOL 2M1KA 3CVIL 1YQ2A 3CH1B 4IOSA 5IV2A 4X83A 4Y2LA 2XWJB 4X5RA 5J1TC 2J8UF 3ZDZF 4LSVH 4G8GD 2RJMA 2CHZA 3S96B 3NIGF 2BP0A 5E8DL 3A24A 4APXB 1RZ7H 5DJ8B 4PGBB 5JHAA 5GZND 4GS7B 2FYYA 1MJJB 1UWYA 2D0FA 3ARFD 3BZ5A 4JDVA 1YZZA 4WU7B 4YDIL 5DUBA 1MF2L 3V6OC 5D55A 5MEQA 2VDOH 2VLJE 3BYYA 4ZMPA 3GS4A 1NGZB 4N1HB 5D96C 1SHSA 3CSYB 2HX7A 4PJ9C 4G1MB 5CEYB 3O2WH 4ODHL 3KW7A 1LHZA 4PRDA 3NZUA 4YUEL 2DYRB 3MO1A 3VD1A 1G9ML 5C0AD 1ZV2A 2KKQA 2LFEA 3U6XA 4WI7A 4TTDD 1J8SA 3WO4C 5ECJE 1JHTA 4H0GA 4LAQL 3AJ7A 4P49A 1KULA 4MAYC 4X7EC 4X7TA 1UXMA 4NM8H 2P3YA 5CZXD 3K91A 5TDPA 4OVUA 2OCCB 4QYOA 4HUUA 1RY7B 1X9RA 1EERB 1HZHL 3BLBA 3QNXA 1PKOA 2CRIA 2DBLL 2YFOA 3O6MH 3D39B 4O2CB 3L4ZA 1AGDB 4GW5B 3FCGA 5C08B 1P6AB 2GJPA 2X0WA 3LRMA 3N41F 2DJSA 2X05A 2NCEA 2YPVA 1I7UB 1E4HA 2J2ZB 1DYZA 2N3JA 4KAQL 4XX1E 3TGXA 3MLPA 4UQ3A 2QZQA 4XO3A 4N0CC 2J55A 2OMZA 3KPOB 1K4DA 1J0JA 3P2BA 4M7LT 4Y19A 3X1EA 3EF7A 2JTDA 3PCYA 4OZFB 2AMUA 4A55A 3MRIB 4EDXA 4GBXB 3U4KA 1TEYA 3LOWA 3IYLW 4EDWH 1NQBA 2VCOA 2HVKA 3KYKH 4JRYA 4P4KB 5H37H 3V4PL 5I8OL 1GW0A 5EU4B 1BF8A 2VZ1A 3HC4H 1BFOB 5DZPA 3R7RA 3S37H 2DQDL 1FZJA 2ESVA 1P6FA 4NKQB 1SRDA 5E8NB 3BE1L 1RP9A 3BWUC 1PKQE 2GT9B 5EBLA 3MHZA 3NJFA 4BCXA 4LPTA 4G82A 5D2NE 1LP9E 2AITA 2Q2EB 3ARTA 1HTYA 2W9EL 4OCSH 1YNTA 4LLVB 4QO1A 3F62A 5A40E 5BOZG 5D2NA 3VFNA 1WISA 2JI1A 2XWTA 4B96A 2P8MA 3OGCA 2OTPA 3DX7A 4AOFA 3OAYK 1AG6A 3QDGD 5E7BA 3EYOB 1CGTA 1AE6H 1RZ8A 2WUBH 3ZXAC 1ZJBA 3K6NA 2BY0A 4KH2A 1MQKL 4Z1PA 5DHMC 3ILPA 5AB9A 5F7FA 2OZNA 4AVHA 1IGML 3DJTA 4MMZA 1WAAF 2K9FB 3RWFA 1NFDF 3LZFL 3L3HB 4HMCA 4PRPE 4MRBA 4FQ2H 2XY2A 4FFZL 5K9KB 5HBBA 4MZ2A 2Y22A 2NT0A 1GY1A 4G8GB 5IVXF 1C12A 4YO0A 4DW2L 2X4QA 5JXEC 2Y6SC 5C7XH 1CB4A 1T0NB 5AD0A 3S5LB 2A6KB 3ARFB 5F44A 1VAHA 2H3NA 3H56A 1ECYA 3ARGB 4UYPA 1IARB 3L9RB 2MPAL 4KK6C 2FCBA 2P8PB 1P1ZB 4PJ8D 2IFFL 3ARDC 1VGEH 3FUJA 4PSPA 2Y5EA 5CZRA 5JHMA 4RQQB 3D52A 4NQDB 4OQTH 1J1XL 5DT1H 1ES0B 3T2PA 4F7PB 1XCQB 1QNIA 4JQXA 3N44B 3FQRA 5FECA 1NGXB 1ERNA 1OAKL 2VJXA 3FRPA 1EHLL 5E1AA 3SGKC 3BP6B 4LVOC 4MQSB 5CNHA 2FEJA 3MJ7B 4XO5A 3O11B 2COVD 3D6GA 4ORGA 3HN3A 5CEXB 5GSRA 3WJJC 1M4KA 3OQ3B 4PWGA 5F88B 4DN4H 1VHPA 3M17B 3M46A 3FCTB 4XP9H 1R5IA 3MCLL 1IC4L 3TESA 3TH4T 4Q6IA 1SBSL 4JKPL 1PX8A 3QIUC 4NQQA 1MHPH 1GYUA 3ZKNC 1NICA 5IJVB 2JNZA 4ZO6A 1OGPA 3GK8L 4UUJB 2IH3B 4X6CB 1TQTA 3C8KB 2XNAB 3LB6D 3PJLA 4WAFA 4RSVA 1QSZA 2WXHA 3SDAD 3VVVA 1FF5A 3KGRA 1ZD6A 2ZUTA 3WEAA 4U49A 1AKJA 3V0HA 3WFDL 2VQ4A 1ZVSA 4PV8A 3V5DA 1RV6X 4KTGA 3MROB 2E9BA 4ECNA 2BP3A 2J1ZA 2NY4D 2VLRD 1MHCB 4FJZA 4L0ZA 2ZOKB 1J5IA 3ZE2B 3RILA 3L81A 2QEJA 2D2CC 4KMTL 1IGCL 1QWHA 3AAZB 1HHIB 1LO0L 4X4KA 3V4VH 2X28A 2E3VA 3OJMB 4H4NA 4WGKA 2F1EA 1BVKA 1R17A 2I85A 3BPLB 4ZX5A 1R5WB 1T1WA 2ENPA 3KVQA 1FAIH 4GAAA 2Y7MA 3T3ME 4UZGA 4U1LA 3JWNG 2KLSA 4WUKH 3BP4B 3L9BA 1M2VB 3H7LA 1I7RB 3KJ4C 4Z95L 3GSNH 2BCKB 2I5YH 4YIQA 1J10A 2R4RH 1T20A 1AIFB 1IBBA 1I7TA 5IHWA 2BWDA 3QDGB 4OSUL 3MNZB 1PW3A 4PJGE 1N10A 5IHUH 1EEYB 3BGMB 4ONOA 2C1OB 4KUCF 1K8DB 2IGTA 4LCYB 4XPAH 3CZJA 4J3VA 5ID0B 2AI0H 1QQDA 1GAFH 3VFPA 4UDTB 2CJSA 2VDMB 3QPQD 1QBLH 4W9CC 2EQDA 4AIXA 1UM5H 5CD5C 4U3HA 2OMYB 2IPTL 4JJ5B 5KUKA 4KQ0A 5F7EL 2YGNA 1AXSA 2V33A 2P24A 3NUKA 2DMCA 1NDTA 1YMHA 3P30H 1SLWA 2VJ0A 4GG8B 1QHQA 2BMKB 2PW2A 3RY6C 3L4WA 4GI8A 3SBWA 1YUHB 4B9YA 1O6SA 4NERA 1RKRA 1S5HB 2AJSL 4UIKL 4PJ8B 4WTQA 2DQJH 5CSGA 1W72L 4ZTOH 1GSKA 3PWUB 4MAUL 5CJXC 2D3LA 5D7SL 2VDKH 1UGKA 3D07A 4P23D 2BVOA 2YC1B 4UT9L 2EINB 1FVCB 5F9JA 4PI0A 5I1EL 3SKOA 4KXBA 4HJGB 1S9KC 2OMXA 4KHXH 2JKLA 2EE3A 3NA9H 4AM0Q 3DX2A 4NSKA 5E6YA 4APQD 4Z5RB 2FJFA 4M62L 4R26H 1A3ZA 5FWRA 5K59F 4MQXC 1AC0A 5CLZA 1JVOA 3PNWA 2VLMD 5BRZE 4HX1B 4H1LB 2AJYL 2NQCA 1OWWA 1IBHA 1OQOA 2VSCA 3HS0A 3NVQA 4POUB 4CJ1A 3QUZA 1HYSD 4LU5H 4OLVH 4XCNA 4NO0D 4CSPA 2ZKWA 4N2NA 3MA9H 4JFTA 5C0EA 1YO4A 1WIPA 2H26A 1U91A 2XOTA 5T3XH 4WY7L 3MRHB 4HFUL 3B56A 4IYKA 5B3JF 3E7JA 4GP8B 1UM4L 5LBSL 4G83A 1A2YB 3WL9B 1N4XL 2OYKA 3V8OA 1A25A 4JPVL 2ZTBA 4P06A 1NGWB 3TO2B 4RFEB 4Y16A 4U7KA 2A0LD 3FZUD 1A9VA 1PD1A 1ZLUK 4S1RL 3SDAB 1CDUA 3STZA 4HIEB 1BVLB 3EG9A 2Y5QA 3GEWB 5KVFE 3QULA 2OMUB 4GSDH 3OX8A 3A23A 4P5TC 1G6RL 1FJ1B 4HSAC 2NY4B 1NWPA 2TSAA 5DYOA 3GTVA 4A2DA 2BVEA 4BE5A 2BIOA 4K5NA 2V9QA 3P9MB 5HHOE 5DJ6A 3WTYA 2A6JA 3FK3A 4M93B 4S1SL 4JB9L 3CN3A 5BZWB 2YRLA 2WLLA 4FFYA 4H8HA 4W81A 3E6HB 4XPHH 3VGEA 3ZKQD 5B38B 5HHOA 2W8CA 1T21A 2ZOUA 4G8IA 4XWOC 4D9LH 1JPGB 2DY2A 3CIQA 5AZ2L 3SN6N 1P7QD 3LKOA 3TZVC 5TFSL 1OOWA 1DJHA 4AT6B 4HUNB 3D50A 4Y2DD 3K4ZA 4D9RE 1MCQA 5JIPA 3VNYA 4OQ1A 4R90L 5B39A 5K9OB 1PSKL 3OKLA 2IBBA 4KU1A 4FFWD 3T4AB 1SVCP 4UTBA 5I6OA 1YYLH 3B9KC 1KZYA 1PEZA 3MJ9L 4D0DB 3QUMB 2YPLD 1T7YA 4M61A 3DYMA 4J8QA 4HK0B 1K72A 4XAWH 4OD1L 1T4WA 1YUKB 3U9UA 4F7KA 3D06A 3RNQB 1DQQB 3QA3A 5EF0A 4MNQA 3U2JA 2NX5D 1G7IB 3GPEA 1BFVH 2CPUA 1G7LA 3BO8A 3GRWH 2EXTA 4GSQA 1DEDA 3KPPB 4XPTL 1I3GH 3LXCA 4C4KT 3B3IA 1HHGA 5AOMA 3NIDB 2BSDA 2HYMA 2XN9A 1B0RB 2V2XA 3W11D 5IY5B 2UXTA 5LQBH 4OCWL 3QQNA 2AQRA 3RWIB 4B60A 4NUJB 4JVUA 4XN9A 2Q6WA 1NCAL 4XBEH 5E2JA 4YHLL 4WK4B 4WVRA 4S0TD 3SGJC 1YEKH 1QTPA 1FZOA 1F4YL 5FUCC 1ACYL 1NMCC 4KGJA 4P23B 4BKSC 4YJZL 4JFOA 3B7UX 4TSCL 3UO1L 1T1ZA 1ZHLB 2AQQA 5JW5B 1DSFL 3UEQA 3O9WD 3H0TB 3NCEB 3SDCC 3SJVA 4U1NA 1I8IB 3RJDA 4ONGL 2E4FA 2FBJL 2OFQA 2UZXB 4N6QA 1W8NA 2R0ZH 2WZAA 1Y7VA 4U1KA 4WI5A 1MVUA 4LSQH 4KY2A 5F71A 3RAJH 3VQLA 1M1SA 3LIZA 5JDJA 2WJ7A 3S88H 4NO0B 1EIBA 1OCCB 2WKLA 4AV4A 2F5AH 3RVWC 1E6OH 2WZ5A 1FNGA 2XXCB 4W9KC 5JW4N 3MACH 2J4WL 5ANME 5CP7A 1DBKL 2EADA 1AZVA 2A5UA 4B41A 1JHLL 3UCRA 2WO4A 4PJXB 2DDQH 3EH3B 5ANMA 3CQFA 5EC2B 3VFRA 3L4UA 4L3EA 4KO9A 3VE0A 3HVDA 4IU3A 2UYLA 2WLKA 1A6WL 4YSOA 3VXRE 3KH3A 1DCEA 1IAKB 1ZAGA 1FO0H 1A9BA 2O5ZH 2GG1A 3M1CA 5CEZH 1IIIA 3KYMA 4N26A 2HSIA 3C9NA 3GTTA 5SWQA 4BFOA 4DGUA 5I2IB 4JM4H 2Z1KA 3RVVC 2XV3A 1RD6A 1Q9WB 4YSDA 5ECGA 3T4YA 1J8HD 2EH8H 4LCCC 2Q3AA 4YHNA 4AZUA 4YK4C 3GGWB 1E90A 1MCBA 3LDBC 4QXTA 1P7QB 3MZGB 5F7BA 3ULVE 2WYZA 2AXJA 2YD9A 1OTUD 3P4LA 3KJ6L 4RMBA 4ZBJA 2YZ8A 3U0TB 4Y2DB 3WJLA 4R5XA 3ZY7A 5LAXA 3IMSA 4HQQH 3K6FA 4L2LA 4OZFH 5E9AA 4F3FB 3ESUF 1MFBL 2DLTA 4M7ZB 2BHZA 2ENJA 5F6IC 4EI6A 3J07A 3PGDB 4CKQA 1IILE 4K7FA 5DQ9A 3R1GL 4YHOL 4BUHA 2DLGA 2YPLB 4WFHE 4M7LL 4MASA 3TYFA 4XBPA 3ABLB 1FNSL 1JCVA 4LIQH 2OR9L 3RQ3A 4KKCC 5IHZA 3HMXA 4I3SH 5EEYA 4AQAB 2XVGA 1YNKL 4PMEA 1KLFA 1FBIH 5KANI 3CDZB 2NX5B 1JDDA 3IFNH 3E8UL 3G5YB 4F7MA 4DGVL 1GPOL 1HDMB 2E6PA 1LWRA 2XWXA 5JPNA 3HNVL 5DC0A 1PFOA 3RI5K 3HI1B 2Z91A 2P43B 2NUPB 1D5ZA 1IFHL 4ONHB 5I1DB 5HHQB 4QHNA 1HFUA 2IGFL 3HFMH 1LE9B 1NFAA 1ZT1A 5G4OA 5IHBA 1F1AA 4OQTA 1T89C 4ZFZB 5L8JB 3VXMD 1IQDA 2F58L 1I3VA 1AYRA 1UXWB 4UV7H 2DM3A 2HPTA 2BOBB 1EAPA 2PCYA 1OAZH 3DHMA 1LQSR 3QXAB 5AAWA 3O9WB 1GA2A 2ZONA 3U7YL 1TETH 3AREA 1O7VA 3CV5A 3DXAD 4PB0L 4YWGL 2R0KH 3WY1A 4G8EA 1LEKA 4NC0B 3VXSD 1RJYB 5D72H 3OC5A 4CVZA 1ZANL 3PL6B 1OLLA 2R1XB 3NCJH 3EYSH 2H1PH 1ZTXE 4X6DF 3TJEH 3SY0B 4U2YA 3REWB 1Q0XH 1TQVA 3VRIB 1UYWL 2FLBT 3KLAA 4HOMA 5HVHC 4HWUA 5DJ2A 1UQSA 4Y8AA 4P9ML 4OF0A 1HC1A 5D2LE 5JIQA 3APFA 3UG5A 1WWBX 3POCA 4FQQB 4WEMB 1NOLA 3X3GL 4DN3L 3U30C 3LN5A 1WT5C 2ODHA 2BP8B 3CC5B 4FA6A 1WP6A 1K2DB 2ZAGA 1F58L 1SYSA 3EJUA 2ZNWA 3AZUA 3OJDA 3OMNB 3N85H 1Q38A 3QJHB 1NPJA 2GY7B 4HP5A 3MRBB 3KXFE 4ZTPH 3V4VA 5A7BA 4PVMA 2NPLX 1YN6A 3THMH 2MCG1 4K73A 1TJGH 4YZWA 3KXFA 4F58L 4LMQE 3C6EA 2VLLB 4E42B 4E9RA 4ODTL 3VB8A 1J8HB 3GINA 4X8JB 3E9TA 3EO0B 1L9PA 2GSGB 1MH5A 5GRJL 2X4RB 2Y06L 1EEUA 1CIUA 5G5DA 1YN7B 4IIZA 3SBPA 1KT2A 3MBXH 4XXWA 1BWMA 1J9TA 4MD5B 5J6SA 1M3IA 4TLTA 2QVIA 3PWNA 5F0PB 5ENWB 4QY8A 3P77B 2IADB 4J2QA 4JG9A 5E1GA 2X4PA 1RZFL 1EV2E 3GMOA 4AMXA 3BAXA 3AB0C 3CFQA 5CFHA 2NY3C 3JWOH 3MXVL 3GI9H 4JQVA 3ZSSA 1QI3A 2Z8VC 4HWBH 4DHLA 5IMKA 1KCVL 1IEHA 3QQ4A 3F6IA 4XVJL 5F72S 5BRQA 3D7PA 5EZIH 1IT9H 5HYSA 1V05A 3F58H 5D8JH 4BH8A 2J72A 3VFOA 2MFNA 5I1CH 3FH7A 2EVJA 2Q7YB 5DZLA 2UWEE 4CC0A 1KYOK 3MRPA 1S9VA 2M8XA 1QRKA 2IQAA 3VI3B 4R4ND 4LF3B 1TYJA 1OB0A 1QR1B 1CBVH 2FR4A 1HXMB 1U8KB 4XMPH 2B77A 4LVNB 1N8OE 5DA0B 2OJZL 1KG0B 1T0PB 4ODVH 1RZIB 3T77B 3PHOA 2F0CA 1CLOL 1QBMH 4G9DB 1Z3RA 4BUQA 1XTMA 4XHJD 3KH4A 3QORA 2LU4A 3TBWA 3DXAB 3MV7D 4Y9CA 5I6XC 5IFHH 1VADA 4Y4KB 4GAGH 3VXSB 1A7BA 2CK0H 3BUIA 4BFFA 4Q2ZB 5J13C 5I6LA 2CKNA 2RCSH 2ZJSL 4R3SB 3V7AE 5CUSL 5D1XA 3Q43A 5D4HA 3SDXE 4HC1H 5IESL 2WNWA 1C8QA 3ULUH 1A9EB 1WS8A 4BWTA 3H9ZA 3HZ3A 2QV4A 5D70H 4X50A 4L5FH 1MUJA 4WFFD 5BVJB 4NNXA 1FPTH 5C92A 1XF2B 2FT7A 3OGOE 1MRFH 3TT1L 3X1NA 3OR7B 1UKTA 4M8VA 3TV3L 3ILQD 5ALCL 2QPDB 5CSBA 2AKRA 4UQ2B 3UTTA 1BZ7A 2J20A 4PJCB 5K9QG 4IHBA 5ABAA 4WWKA 1PG7L 3JUZA 4XC1L 5D2NC 3ROLA 4KZ0A 4NNPH 3ZMEA 2G4GA 2PYFA 2YLHA 1XZ0B 5BJTB 2ZWKA 3OSVA 4JVPA 1VFBA 2DH2A 4KRLB 1I7ZA 1SUHA 4OLWL 5DRWA 4JUTA 4X4YB 1J87A 5KJ7E 5IB3A 4LLQB 5I1AB 1UVQB 5B1AB 2R39A 3CFCL 4MMZC 3OKNA 1DN0B 4M48L 4XB3A 5E6ZA 4MA3B 5B7EA 2I26N 4KDWA 1ANUA 4LDEB 5ADOH 1PVHA 2NDGA 3CVIH 2ARJA 3RIAK 3APDA 1ZGLM 5EEVA 4XBGA 3HPJB 3C2SA 4PJIB 2YKLL 3EYVA 1DJGA 5C8JB 3CBKB 4FL4B 1IGFL 5AW5B 3EOAB 4EN3D 1TYEB 1NBVL 1YJDC 3NPSB 2KI6A 3ZQXA 2J25A 5DMGC 5E8DH 5KZCD 3E6FA 4MYWB 4I2XE 2WNGA 4HAKA 3MRMB 1SEBB 5D6DA 5F7HA 2CSPA 4UZSA 5T8IA 4YDIH 1JZ4A 4RMRA 2KC0A 1MF2H 1I3RB 5ADPL 4RAUB 5TE4L 3T6WA 4I2XA 2G30A 4HU2A 5ABZA 5BZDA 4L48A 3GRWA 1J1PH 1X7QB 3C5ZA 4Z7UE 3ZDWA 3VG0L 3GLEA 1N9PA 3T0XA 3MRGB 4ODHH 3FO9B 5AG9A 3DBXB 4K3EL 4KV5F 3NGBC 4JQXC 4YUEH 4X9FA 4Z7UA 5I9QB 1G9MH 2UZYA 1G94A 1TCRA 1G0XA 5TGBA 5HDBF 3RWHB 3MV8D 1IM3B 5JLZB 5LXGL 2Y25A 2Y7SA 1S3KL 5JORB 2CRZA 5AKTA 1L7IL 2NY0B 3GMMB 3CH1A 4LP5A 3AXHA 4LAQH 5IQ9B 2X70A 2XWJA 4ODXB 5HI5C 2GHWB 2WBJA 3ZT6A 5M94B 3N1FC 3WNLA 4IBWA 5C0BA 4DCQB 3N40F 3S96A 5AKSA 4APXA 5DJ8A 1HZHH 3X3FL 3ZTJG 4Q6IC 2DBLH 1MJJA 2P52A 1KPRB 3NRFA 3V6FB 1PZSA 1BAFL 3K46A 3UX9B 5HYFA 3PNRB 5HHXL 3ETBF 1JZGA 3BAIA 4KAQH 2VITB 3CSYA 4MCYB 2Y36L 4G1MA 5CEYA 1H3UA 1H3TA 2JKRM 3RDJA 5HXMA 1S7TA 1ACZA 2XJKA 4I18B 2QQNL 1NCNA 4YL9A 4IK6A 3LKQB 3NESA 4KKBC 3TS8A 3HVNA 3Q01A 4OZHE 2P42B 1EHAA 1KTJA 3BXNA 3V4PH 5C3IA 5I8OH 1JL8A 1Q9LB 4LPUA 3OLDA 2W0FB 3DGDA 4EIZC 1A6AB 2VISA 3L3KB 1FO0A 1BDYA 2DQDH 2YARA 3GZPA 2NYKA 3ME0A 1B3JA 2EVHA 3BE1H 1H9VA 4ELMF 2YD5A 2D8KA 1PU0A 3KYOB 4QF1B 2JI3A 3D39A 4O2CA 5DO8A 2HFEB 5B1JA 2W9EH 3KWUA 4FD0A 5C08A 2CWRA 4M5SA 4QKTA 1HOCB 4PSRA 3QJUB 3TBYB 4MNGE 1NIEA 3L17A 3IFPB 3EO9H 2UY7B 4KVCL 3ZRCC 2AF2A 1H6EA 3JWDC 3O3EB 3RPKA 3PWVB 3KPOA 4YEFA 1MQKH 1IB5A 3HR5A 9CGTA 5MEOB 4OZFA 1IGMH 5IW3A 1BA9A 4F33B 3EH4B 3BW9B 3GBLA 3LZFH 4NBYB 5GRVK 4OIFA 1AQKL 4L3CB 1BFOA 2YD0A 4UNIA 5AVYB 3ZL4L 2XZZA 4FFZH 2GJ6E 1OK8A 5E8NA 1SFHA 4EN3B 2GT9A 3Q9PA 4DW2H 4MB1A 2MSPA 5KZCB 1AZCA 3B2DC 3WN6A 3SBWC 2OZ4L 3K72B 4DOHE 2WBKA 3NFSL 4LLVA 3BPNC 4AUYA 1JI1A 3ZK0A 2KZKA 2MPAH 3L1OL 4LP8A 4LSDA 3VXPB 4HG4J 3DO7A 2QFRA 3NMEA 4LCVA 2IFFH 5KJRL 3NABL 2HB0A 5DJ0B 1OPOA 4MZRA 3EYOA 5F1NB 4P4RB 1JNLL 1WFNA 2WLIA 4XO8A 3R7QA 5I5RA 1P5UB 5IFAL 4LRIA 1J1XH 3F01A 3C87A 4ZK8A 5GS0C 1LEIB 5L2JA 2VC2L 4TNWK 1DQLL 3MREB 3MV8B 1OAKH 2YXFA 5FF6B 1QWUA 3QUZC 5IROA 2DD8L 1CN4A 1ETB1 1OGAB 4G8GE 1HYRC 4W6YB 1NCJA 5I23A 4ZFFB 5K9KA 2H7WA 5IP4A 2O6EA 2J57A 2H45A 4G8GA 1JV5B 4M3KB 1F3DJ 2X87A 5E8EB 4XR8C 5IMLB 1T0NA 4ZAKD 3S5LA 1TVDA 5GZNA 1ML0A 2A6KA 3MCLH 1IC4H 3UJTL 5KSBB 3WEBA 3ARGA 1NBYB 5F8QC 3L1FA 3L9RA 5DFWH 2P8PA 1MRDL 1UOWA 3TFBA 2C3HA 4JPQA 3REVA 3K2KA 2QZ5A 4IKKA 2LGNA 4JFUA 3GK8H 5C0AE 1JF6A 4ZSOE 4NQDA 1X7TA 3LRHA 1AXIB 3VJ6B 4PJAF 3RL1B 1XCQA 3GUFA 1VGKB 3QC6X 3WFDH 2QHLA 4K55A 4FG6C 2W81C 1NGXA 3FXIC 4N68A 4F15B 4MXVF 3FONB 3BP6A 3B9AA 3O11A 4KMTH 5I73C 1IGCH 5DHYB 3QE5A 1LO0H 4GUQA 1CXHA 1TKWB 5L2KD 5IG7B 5CEXA 1XB8A 2Z3FA 5F88A 3L45A 3KBFA 5EO9B 1KXQA 2EDMA 6TAAA 1JZEA 3M17A 1IBFA 1ITBB 1MI5E 2VQ1B 3FCTA 2ZT9C 3AT8A 2RH0A 2OKMA 3F05A 1DEEB 4TV3A 2BWIA 1HH9B 4Z95H 5IJVA 3DURB 4IJ3B 3ENEA 3HG3A 2IH3A 1BIHA 4UUJA 4X6CA 3C8KA 2XNAA 3ZHDA 1LO5B 4HS6B 2CBPA 5JW3L 3PXHA 1ZY9A 4OSUH 2BCMA 1GGYA 1FL6B 1SXZA 3ZE2E 2NY2D 1V5JA 3N43B 3H8NA 4AKOA 3DVGB 3SE3C 5C86A 2MNUA 1XR9B 2ZOKA 5F0MB 3H3PL 3AAZA 1HHIA 3T8XB 1QWNA 3ULSA 1J0HA 1KGCE 2IPTH 4BSWA 2IMNA 4FX5A 3X2QB 5F7EH 1R5WA 1R3IL 2JQAA 4PVLA 3NZSA 4FFVC 2WUCL 1JGVL 5GRZA 5DR5L 4MMXB 2A73B 3WN5C 4Z7NF 2DWSA 3ZJAA 1BJMA 3BP4A 3LEVL 2ICEB 1I7RA 4CVWA 3QDGE 3BQVA 2BCKA 3LPFA 4H2AA 2AJSH 3CZEA 4UIKH 1G7HA 1MY5A 2XT1B 1AIFA 1MREL 1W72H 5HGDB 4MAUH 5ANHA 5FM4A 1DQDL 3MNZA 4ZFOL 4FQIL 4UT9H 2P1YA 4HEPG 1A5FL 4TSBL 5I1EH 1EEYA 4F2MB 2PF6A 2WTOA 4Y4FA 2C1OA 1K8DA 1ZSDB 5GJSL 1X5AA 4LCYA 4RNRB 4Y2NA 4NN7B 4YSUA 4JRXE 2EICA 2ZIDA 3HHMA 4M62H 5J06A 3IXAB 5C0CD 4V2BA 1JZ5A 4PAZA 1B2WL 1II4E 4NIYE 1Q1JL 5HHPB 2QTVA 1P84J 2AJYH 2P5WD 2VKWA 2P48B 2HN7B 3L3JB 4JJ5A 4PJFB 4AE1A 3KL5A 2XKNA 4QKXB 5I1HL 1ED3B 1HCVA 5FLVA 1ZPLA 3SYAA 1E2WA 4WY7H 4UQBA 3O3BB 4GG8A 4HFUH 4ODBD 3X14B 1NM9A 5DZAA 3VGAB 5J6GA 1UM4H 5LBSH 4NJ9L 3UIYA 1HWGB 3PAUA 3ZYJA 2B39A 1S5HA 3GF8A 3SO5A 2DJMA 4PJ8A 5T1LD 3Q1SL 3RZCD 3PWUA 4E9LA 4MA1B 1H8OA 4HC1A 5DTFB 4ZUVB 2YC1A 1VA9A 3C5XA 4J3UA 1E5CA 4DVBB 4HJGA 4H5SB 1H19A 4NP4L 1BWWA 2Z35B 5LAPA 4Y0GA 4Z5RA 3SO3C 3HE6D 5HYQB 4HAGA 1XH3A 1G6RH 4HX1A 4MFHA 1FRGL 3RX8A 3VFWA 2J1XA 5L2KB 2EKSB 4S1SH 4G7RB 3NRQA 4JB9H 4JZOB 4X7DC 1INQB 1CGUA 1UCTA 3UEZA 4ESKA 1IAIM 1KIUB 3M8OL 5HD8D 5I76B 3DVIA 4YH6A 4V33A 1QFOA 2GITB 4B9FA 4FA8A 4KUZL 1CDGA 4HUCA 4JGNA 3QEQD 4HGWB 4LEXL 1A2YA 3WL9A 4L9DA 4FG4A 5TFSH 1NGWA 3G6JB 3TO2A 3ULVC 3RX7A 3WKML 3HS9A 4RFEA 3L8QA 3QIBD 3G7TA 4WHTB 4R90H 3FT4B 2ZKHL 4HIEA 3FYIB 1BVLA 3WUWG 2VLRE 4R5TA 3CWGA 2ROXA 2NY2B 2OMUA 2Z93B 3MJ9H 5A1AA 1R3JB 2C4FU 5KBNC 4CSZA 2I7SA 2PCXA 5BV7B 1FJ1A 4KC3B 4OD1H 3JV0A 4F2FA 1GJIA 1E8XA 3QB7C 4J3OC 1FNHA 3LPOA 1BX2B 3U7AA 2E9GA 5BZWA 4ZZFA 3DDFA 5B38A 5JPNC 4XPTH 3WDHA 4DK5A 3MCYA 1MCOL 1JPGA 2ICCA 3CZNA 4C8XA 1TVBB 3TN0D 4NQXB 4OCWH 2DPKA 3B2MA 4I48A 3ESOA 4AT6A 4KXAA 2EJ1A 4J12A 4PG9B 5HVGB 1NCAH 1HHKB 3FSZA 1JZ3A 4YHLH 2VN4A 5TQ0L 3WEMA 5K9OA 4M8UA 3T4AA 1ACYH 3VDBA 5TJWK 4X5WA 4I9WD 1GL4B 1A8JH 3UO1H 1U8HA 2CUMA 5HDRA 1DSFH 3QUMA 4ZXBC 1N7ML 2YEQA 1SUJA 1WZAA 2FHCA 1E8YA 5BUGA 1IUZA 4ONGH 5C0CB 3UIZA 2FBJH 3O4LE 4MD0B 3RNQA 1U8MA 2P5WB 4KY1L 4Z77A 3NIDE 4MKTA 3HG1A 5HPOA 4MB3A 4HIJB 5DSCB 3QO0B 2NLJB 3MVSA 4NFCA 5MERA 4PUBL 3KPPA 3UAFA 2NTFB 1DLFL 4L8CB 3MA7B 3SZ6A 5H37G 5J12B 1B0RA 5CCKL 2WGNB 2EVGA 2J4WH 2GI0A 4JG0L 1DBKH 4WV1B 4L4TD 3RWIA 3KLKA 4NUJA 3PUUA 4ACTA 1JHLH 4OFYD 4OVVA 5TK2A 3H9SD 2EE9A 5AB1A 3VYOA 4YE0A 5KYXB 1KFAL 5TH2B 2WNKA 2FUQA 2JKSA 2B4CL 4B0MM 1ZHLA 5JW5A 2VLME 1N12A 1A6WH 3M88A 2X41A 3OKMA 3H0TA 2BFVL 1JAEA 1NIBA 3HE6B 1AQ8A 3V4PA 1EJ6A 4XO4A 4KH9A 1OVZA 4LNRB 3S3BB 4PWKA 4ZS6C 4S11A 3SCMC 5FM5M 1G7PB 1JG9A 2KL6A 3SDYL 4EI0A 4FYSA 1OGSA 1L6PA 4LPXA 3WFZA 1GJUA 3FO0L 4MA7L 1DVSA 1DDHB 4K5PA 4C83A 2VXVL 1CK0L 4XC3H 4O2FB 2OX5B 1JZ2A 4PJXE 2WQXA 2Z64C 3QEQB 4PLKD 3VRLF 4XNXL 3BVWA 2O6CA 3AFLA 3MXWL 4ZW8A 2ZXWB 1MY7A 3DOSA 3TTSA 2WXOA 5E6RB 4KJPD 3QIBB 5EC2A 1AHKA 3V0FA 1MFBH 2RBLA 1MCCA 4U4IA 3OZ9H 1DBJL 3QHZL 3ESMA 2D9CA 5DZJA 5E99L 3PWLB 5JPMC 1OF0A 3PAVA 1IAKA 4M5YL 1CUOA 3R1GH 1XIWD 4YHOH 3VDCA 5B7FA 4M7LH 2D7TL 5IBUG 2VZ3A 5E23A 3VCLA 3CLFL 4BA0A 1FNSH 2WVSA 4FFZA 1KUMA 5IQMA 1YNKH 1I1AC 1UD2A 1Q9WA 4KDTC 4Z3GA 3E8UH 1WK0A 3QNYB 1X6LA 3Q48A 1GPOH 4DGVH 1E9OB 3GGWA 3HNVH 5J3HC 1JIBA 3UROR 1P7QA 3TN0B 1IFHH 4AW7A 1E9PB 2IPUK 2IGFH 3CHPA 3W39B 5D1ZC 4Y2DA 3U0TA 1SJHB 3AG2B 3SPVB 1EAJA 4F3FA 3GKWL 3WFHA 1JYXA 3B5GA 1RIHL 2J8UB 3GMPB 3E1F1 3ZDZB 2F58H 4QNPF 1ZGLB 1CGYA 3NIGB 2JKIS 3PGDA 3T0ED 4PJ7E 1XCXA 4N8VB 2W59A 2YPLA 3HKFA 1JPEA 5A2CA 3U7YH 2NX5E 1SHMA 2BLFA 4PB0H 5C0IB 1FSKC 3ULVH 2PUQT 4AQAA 4EXKA 3QUYA 1VEOA 2VUKA 4NKIL 4G6AD 2NX5A 2V9TA 1A1OA 4AL8C 2A6DB 2K8MA 5J89A 1HDMA 1KXHA 1DBML 5IQ7L 3HI1A 4BXSV 2IBZY 1KJVB 2Y1ZA 4ZYKA 2NUPA 1TEGA 1UYWH 2JJSC 2D9QB 2WLZA 2HLEB 3QUHA 4ONHA 3DIVA 5I1DA 5HHQA 4P9MH 1UD6A 4L4TB 3NSYA 4G42B 2JTYA 4OIAA 3CUPB 1OAQH 5AYUL 3H9SB 1QFWL 5FO9A 3TF7C 4CDGC 4ZFZA 4LVEA 4O2EB 2K1MA 1QR4A 3I3BA 4DN3H 2DBJA 1UXWA 3AW5A 3MUGB 1MJUH 2BOBA 2WO2B 3ARBD 1F58H 4MCMA 2NXZD 3QXAA 3TP4A 3O9WA 1BREA 1XMWA 2VSMB 1UH2A 3EOBB 3S8WA 5E2UL 1OAXL 1ETA1 5DJZB 1OGTB 3HB3B 3N41B 3F85A 2ADYA 2VDLB 4BV1A 4PP2B 3JVGC 1RJYA 3MQIA 3K0YA 2FVNA 4GUPB 4F58H 4OIBA 3PL6A 2C9UA 2R1XA 4OF7A 1YSOA 2W65B 3BMVA 4DIXA 4ODTH 1N0XL 1F02I 3N2JA 4XZ4A 3SY0A 2OI9B 3REWA 4K8RL 3GO1L 3VRIA 2Q3XA 1XZWA 5GRJH 1CE1H 2Y06H 4MHHI 1A6PA 4HUXB 3NCYS 4D9QE 2DQ6A 3B8YA 4ZFOB 1RHHB 1X9UA 4WTZA 3UPAA 5EH1A 4M9OA 1RZFH 2BNRD 4HETA 3PYCA 4XNBA 3CC5A 1L0PA 3RI5F 2JELH 4X98A 3BZDA 3QJHA 1NUNB 2CDFB 3MXVH 1NUFA 1YEHL 1XIWB 1NKGA 4S1DC 5C3LD 1T0OA 3T04D 2X6UA 1PGRB 1ORQB 1EZSA 4NNYB 1KCVH 1EO8L 3HN5A 1J8HE 4XVJH 1EJ8A 2VXQL 2KS0A 1E65A 4LCUB 2VLLA 3O4OB 1WSST 4IOFD 4N5EC 5EIVA 2J5LB 2QKIB 3S6CA 2Y3AA 2XVBA 4K3JH 4X8JA 3IFOB 3B5TA 4KUCD 3EO0A 2GSGA 1CXEA 5AAMA 3NA4A 3KEDA 5PCYA 2JF1A 1NFDB 1YVLA 4MD5A 5CXPA 1KEGH 2J6EL 5ENWA 1N70A 4C56D 1E50A 2WCSA 1MVFA 2BRQA 2IADA 2O5XH 2IAAC 3ECVA 2GEEA 1QZNA 5IVXB 4MRCA 2OJZH 4QYAA 4ZTEA 3U4EB 1QLRB 4GS7C 2HA1A 2V5TA 1CLOH 1OW0A 3K2UL 3RUGF 1G87A 4OH2A 4HCIA 5BRPA 4BZ1L 1BW8A 1BZDA 3EUUA 2WZ6A 2VXSL 2ZF9A 1A6VH 2Q7YA 3MNWB 2ZJSH 2HT2D 3SEPA 4JY6B 5CUSH 2GFBB 3ATEA 5F9AC 4XN7A 4FAAB 3UBXI 1OTTD 5IESH 5L9DL 3QDJD 4YQXL 1OSEA 2JE8A 4R97B 3UXFA 4TM9A 3VI3A 4E9VA 3MLVL 3VXME 4LF3A 4FTDA 4JGJA 3DJRA 1XFPA 4FI7A 1QR1A 3ECWA 4KDVA 3UMNA 2ZUQC 4HS3B 1HXMA 1U8KA 3CFBB 1A0QL 3B3BA 4IW4C 5AVVB 3Q8BA 4JGUA 2UXGA 3TV3H 4FA7B 5ALCH 3EOYG 1KG0A 4J6RL 1RZIA 3DXAE 3ARBB 4XMZA 3LD8B 3T77A 1T6BX 2NXZB 1YYML 4M1DH 2EABA 3T0BA 4G9DA 5B1JC 5F6HJ 3VXSE 5BZXA 5MEPB 2CLZB 3QK0A 1HXYB 3DDGA 4HFWB 4WEEA 3CU7A 2Z8SA 1PG7H 3VM5A 1LNUA 4HZ1A 4XC1H 5IR1B 2WTPA 4Y4KA 2AQPA 2AEIT 2OXGB 4XX5A 4WTWA 1T3FB 2VXUL 4HZLA 4J28A 4RH4A 5J11B 4R3SA 2FATL 2JQMA 4UMGA 1U3YA 3TOPA 2OSYA 2CDEB 5B8CC 4ABUA 1YMMD 1BM3L 3S3DB 1P7BA 1A9EA 4GBXC 1OTSC 3PFUA 3QH3B 4PY8J 2X2JA 2F9BT 4M48H 1J0YA 1GIGL 4P4KC 2JFCA 3I9PA 5JQIB 5EF2A 2HTKC 3BKYL 3E2HB 3OR7A 2E76C 4HT1H 4ADGA 2JV6A 2YKLH 1PLCA 4PJCE 2BNRB 3MJ9A 1IGFH 1SXSA 1ZT7B 2JIXD 4UQ2A 1FG9C 3QZWG 2LQRA 1NBVH 4O4YL 4HIPA 3VSVA 3KWWB 3SPCA 1HHHA 2NNXA 2PETA 3VB9A 4NC1E 5KANG 4LSRL 2L0DA 3EJQA 5ADPH 4HCRL 1W16A 1DVFD 5AW4B 5TE4H 2QVKA 4NQED 1T1YB 1XZ0A 4B9PA 5C0FB 4WO0A 2Z92A 4MWFA 2X1XR 3QQXA 4H20L 3Q6FB 4BFKA 3VG0H 1CTNA 4X4YA 4LRIC 3DECA 2VZUA 4LMQI 2PYEA 5I1AA 5I28A 3SKMB 2ITEA 3K4AA 4K3EH 1DN0A 4UWQB 1KJ2B 4PJIE 3AS0A 1OCZB 4MA3A 4EIUA 5LXGH 1S3KH 2IDSA 3QJSB 5F7AA 3ZOAA 2R0LL 1L7IH 3PIQB 5E7FA 3UERA 3HPJA 2AEWA 3GJEB 3LS4L 5DU7A 5AENA 3GS7A 3P0YL 1WFTA 1JFHA 5C8JA 3LEXB 3FQWB 1IKOP 3EOAA 1AR1D 3MAWA 1UB6A 2D0HA 4NAJA 3ARFC 2P80D 3ARQA 1P5VB 4M4RA 3MRMA 1SEBA 3X3FH 3QXTA 5K9JH 1BVZA 1D6VL 4MQ7B 1R24B 3WD5L 1I3RA 3FPXA 4RAUA 4ZUSB 3U46B 1BAFH 1LYQA 2YD2A 5J56B 3UGEA 3FN0L 5HHXH 4AZ8B 4MBOA 3BUTA 4QTIL 2Y36H 3AM8A 4YBQD 3MRGA 1ONQA 3FO9A 3DBXA 2FL5B 4IRSD 2QQNH 4FJ6A 3QDJB 4P5KB 4TTDC 1D3CA 2FB4L 5F96L 3RWHA 5JLZA 2HMIC 1IM3A 5TDNA 5JORA 1NGYB 5D1ZI 2CLRA 2GPZA 3GMMA 4U0QB 4MNHB 1K85A 5HY9B 3PGFL 5IQ9A 5CZXC 1UM6L 2AFNA 4AUJA 3EAKA 3MV7E 4QRTB 2NXYD 3NK4A 3SD2A 4KQ3L 4I0PD 4LT7A 3UTPE 1AGFB 2CM6A 4QRFA 3EUDA 1HXKA 2B59B 4G7VL 4QEGA 3RIAF 3T3PE 1KGIA 5DHVH 4BHUA 1RZPA 3II2A 3NBNA 2E7LC 4YXLL 4F80A 4MCYA 3CX5J 3IU4L 4ZOAA 2EDNA 1CLYL 4OZIE 1NAML 5E2VL 4I18A 4KVCH 5IM7A 2UXFA 3BWUF 3O2VL 4WFFE 1E7VA 1ZK5A 1YMMB 4POYA 3O2DL 2CU9A 1JP5A 3FTSA 1HHJB 4PS4L 2ZG1A 1E30A 4GW1B 3FU5A 4PGEB 3DMMD 5EDSA 1AQKH 1FYTA 3ZL4H 1A6AA 1OCOB 2JIXB 4F93B 1DE4B 1WBZB 4MS8D 4CNIB 3KYOA 3RTQD 4QF1A 4QHLA 2DKMA 1O9VA 5DJCB 3TJHD 2HFEA 2OZ4H 5M95B 4ATTA 3W82A 2BJML 3ALPA 1FC1A 3PV6B 4E41A 2CQVA 3VXQB 4RZCB 3NFSH 2LVEA 1DVFB 1HOCA 3L1OH 4NQEB 4QRSA 2XG4B 5EULV 3W38A 3NABH 3GJFH 5DEFB 3D0VB 1GYAA 2UY7A 3N1MC 5KSAA 1JNLH 3EOTL 3MV9D 1RIVL 1HKLL 3O3EA 3PWVA 1XEUA 4WNJA 5IFAH 4G9FD 4KOBA 1VF5C 1TNNA 2VC2H 1J8KA 2HKHL 3L4CA 4XN2A 4YXHL 5MEOA 1SQMA 1DQLH 2JKNA 3NH7L 2BSSB 1RJZB 3BW9A 4IBUA 3VFSB 5EG6C 4JO2L 4JX0A 3ZQ9A 4CGTA 1CFNB 4P9HC 3AMLA 4EN3A 1AR1B 2FLRT 3K72A 2APSA 3QI9C 5FYJE 2QQLL 1ITCA 2WVTA 4DT2A 1DLHB 3EH1A 4PJ8C 3WJMB 1AGBB 2ZUUA 4NQVB 5I1GL 3M45A 1MRDH 3PP3K 3MRNB 2RACA 3VXPA 1URLA 3WI9A 3QG7L 5GGRY 1EXGA 5ICYA 3FNKA 4X4XB 4JY4B 4P4RA 5F1NA 3Q5YA 1GOHA 3DRQB 3MV8E 1P5UA 3NP4A 4KJWD 3RVTD 2Q7AA 3CK0L 5H35B 1LEIA 2BRRL 4M43L 3ZQWA 5F9WB 3B5HA 3BHBB 3BH8A 3EYFB 1LVEA 1BYNA 1JGLL 2CR6A 2XQYK 2PXYD 4QUOA 3TA4D 5FF6A 3DTUB 1DANU 1TR7A 1OGAA 2XVKA 5AWNL 1XB3A 4L1LA 4ZFFA 4MAZA 4D0BB 2MTAA 3NT0A 2YRBA 3P1VA 2A3TA 5E8EA 4ZW3A 5IMLA 1J7VR 5DD5L 1AIZA 5FOBB 4HEME 4I0PB 5MENB 5KSBA 1QATA 3KWXA 3V5HB 1NBYA 4GT0A 4ZO9A 5I66A 5ESAB 4Z7OF 4BFRA 3WE1A 3SDAC 3EKCA 1WGOA 3WBDA 1DL7H 5JW3H 3AS3A 5IVOA 4JN1L 3VJ6A 5BOJA 4N6RA 1VGKA 4B0MB 4DGIH 3MLTB 2NY4C 3LNIA 2BSTB 1U2HA 2GEQA 3FONA 4J3TA 4DKTA 3I3EA 3VH8G 1ODUA 4JPKL 1S7RA 5FYJL 5DHYA 3DMMB 5FK9B 5K1VA 1S9XB 5IG7A 2YQGA 1GC1L 2OSXA 1IC7H 1CQYA 5I8KL 1M7DB 3P2TA 5EO9A 1ZT4B 1BQHA 3BISA 3HNSH 3PQYE 4TNWF 1R3IH 2OL3L 2VQ1A 4IIQC 5IHLB 2WUCH 1A7NL 1JGVH 3RTQB 3U79A 5DR5H 1B4RA 2F7OA 2O5YL 4WDIB 5C6PB 1P7HL 4GKSB 3LEVH 1HH9A 1OLZA 2D31A 2PP8A 2XIIA 2HP4A 4ODUB 1MREH 1ZA3B 3LJ3A 2X9YA 3BGFC 4N9GB 1LO5A 4HS6A 4IRJD 3WNKA 3QARA 4BK4A 1T0MB 2I07B 4FQIH 1HX0A 5AL8A 1A5FH 2DEYX 3MV9B 1A14L 4TSBH 3P3SA 3V10A 5KAQG 2TRHA 4G9FB 3SE4A 5CP3A 3CVHH 5T3ZE 3DVGA 1HILB 1C5CL 1XR9A 4EKJA 1BQ5A 3JTTB 3QPQC 1BG1A 2FWOB 4X9GA 1Q1JH 3D3VD 3MJ6A 5KVEE 3BT2H 4HIIA 2ERJC 5G4MA 3FUMA 1TVHB 3NIFF 4KHTL 1GYVA 3IBOA 4U1GC 4WENB 5I17B 1WBYB 5I1HH 2W1NA 1NINA 3CU1A 4GFXA 2A73A 2DB8A 3FS9A 3V95A 5I0YA 3E1ZA 4BFNA 2DLEA 2ARJQ 1REIA 1R33A 3WNIA 2ICEA 1UENA 4NJ9H 5FS5A 2ZKXA 2WYTA 3Q1SH 1U3HD 1CXFA 4P23C 1BQRA 4R96B 3ZDYF 3DHJA 4FP8H 4QHPA 1L9RA 1EHNA 4F2MA 3V0AC 3DHUA 2COQA 4APQC 1ZSDA 2OCJA 4NP4H 4NRZB 4RNRA 4PJDF 1NH6A 4BK8A 1S7UB 3Q2CA 3IXAA 3GXNA 2PXYB 4G80B 2Z6FA 2VJ8A 4PLJD 4U1SA 4X2UA 5DEZA 1KB3A 5HHPA 4U2ZA 3UTQB 1BZ9B 3QFDB 4OU3A 1FRGH 5AW9B 3L3JA 5C2BL 3IE4A 3EJSA 4TULL 2WXPA 4PJFA 4X6DB 3VQ2C 1GZQB 1O0VA 1W6WA 2UZIL 3M8OH 1ED3A 2YAPA 2BDNL 4POZD 1J0KA 3N1GC 3O3BA 4KUZH 3X14A 1E3FA 1AZZC 4LEXH 1KCLA 3BVXA 5AZEL 2DYPB 4PJ5D 4GG6F 4KTDL 2A0LC 3FZUC 3WKMH 2ODIA 4JE4B 1RUPL 5DTFA 4FNSA 4ZUVA 2AZAA 2YD1A 2UY6A 1DBAL 1X5MA 4X9BA 5FA3B 4DVBA 2I9TB 1TO5A 2FQFA 2H5UA 2Z35A 5E2TL 3VWKA 1CFSB 1QKZL 2CAKA 3CPUA 5HYQA 5L2KE 2ADJB 4UTAA 3INUL 1D5BB 2XWZA 4A39A 2MNJB 3EO1B 5CGYD 2BSCA 2HFFB 5L2KA 2EKSA 1LMKA 1PY4A 3NCYP 4I9XA 4Q6YA 5E4EB 4JZOA 5ERWA 1INQA 2IIJA 1KIUA 5D7IF 5I82A 5I76A 5C9JA 4K9JA 5E6ID 2R2BB 5C0JB 3EXLA 2GITA 2BM3A 3G6JE 1MCOH 2YA2A 1M7IB 4JO3L 2FWLB 5H4ZA 1FL5B 2DIBA 3GLDA 3RG1C 3CFEB 4NUGH 2JB5L 1KACB 5GZOC 2H0PA 3HLKA 4M7ZC 3V9CA 4N2OA 5LNDA 4FFWC 3CSPA 5TQ0H 3NSCA 4WHTA 4LOEA 4IRJB 2YSSA 2IPUG 3FT4A 2ICWJ 1WBXB 5JR1L 4PRID 5LDSA 1OXYA 5CIPB 2Z93A 1R3JA 4M29A 4H8WL 1AR2A 3ALWA 4FMFA 2VH5L 5CJBA 3ZR5A 4AVIA 4A2HA 4KTYA 1M9WA 1MHHB 2GIYA 3IGAB 1BX2A 2YEZA 1NFIA 3EDJA 4Q9CA 1DCLA 4KY1H 3C09B 3HIZA 2B5IB 5GGVL 3WFCL 4ODSL 5CJQL 4PUBH 1XSJA 5EN3A 1DLFH 3ZE1E 3T1FB 1UA6L 1U8NB 3RRQA 3LMJL 4OD2B 3JZYA 4KK5D 1TVBA 1TFHA 2APVA 5EZJB 4NQXA 2KLRA 5CCKH 5IOKA 1WCBB 4LVHB 1VKXB 1ID5I 4JG0H 1FG2B 2OJ1A 1OSZB 1HHKA 2D7MA 2F19L 3GLAA 1U3HB 3Q44A 1KFAH 2KBGA 2BIHA 3RDTA 2ZYIA 3ROOA 1U9KA 2NNCA 5C0CE 4FF9A 3LRSB 3R0NA 4N5UA 3KDMA 4QCIB 2F54D 2P5WE 3BQUD 3QG6B 2BFVH 3PJSA 2H32B 1JVKA 4O02L 1Z9NA 1PX4A 1B2YA 2B3IA 5EZLB 3DX6B 2K9UA 1KYAA 4GRLD 2F8IA 2P5WA 1IGTB 2C3VB 1ZLVH 4BSJA 5J0BA 1PLAA 4P2OD 4DH2A 1R34A 4HIJA 4ADJA 2NQ3A 2NLJA 1T5KA 3FO0H 5INDA 3GKZA 1WLHA 2VXVH 3OXRB 1CK0H 4L8CA 4ODWB 3TVMD 3MA7A 3H7BB 4JFDD 4UANA 3EADA 1M6UA 4BELD 4D2NA 2PPAA 2BO0A 4JM2A 1A3LL 1JF1B 1KLUB 5DHVA 4WV1A 3WO3B 3ZTCC 1M1XB 4BK5A 4XNXH 4PJ5B 3MXWH 4XOCA 2LT9A 1NDMB 2R69L 2WCGA 5KYXA 2P5EE 4XX1G 5EEXA 5TH2A 5J6HB 4MDJB 5I8EB 1U8QB 1COBA 1ESOA 1QAWA 1XD1A 4RAVB 4RFOL 2H1XA 3QHZH 2BX5A 2ETWA 5E99H 3KBEA 4KRPD 3S3SA 4M5YH 4X5XA 4O5LL 3HE6A 3GMQB 4B5ZA 2Z0BA 1KWKA 2W0PA 2D7TH 5BS0D 1RJLB 3LNDA 5CWSB 3CLFH 3L3OB 3I6LD 2DS4A 3SB3A 1G7PA 4CN6A 2BZDA 1H15B 2JSFA 4HCFA 5ILTL 3QIWD 1Z9MA 5GS1B 3QEQE 1DDHA 2XZAH 3CFDB 4LLMA 2OZ4A 5E6IB 4O2FA 4DVRL 2OX5A 1WFJA 4BQBA 4NLAA 4CAGA 2QTEA 1XL6A 3QEQA 1OTUC 4TQHA 5A6LA 3ARYA 1GGBL 5EUKB 5ACMA 5IF0B 4PJHE 4GXUM 1FC2D 2GCYA 4TXVB 5EU6D 2G5RA 1MFVA 3P3YA 4MKMA 1KGUA 1YEGL 2ZWZA 3GKWH 2KLTA 5TDOB 1RIHH 5TE7L 3C2AL 4PRIB 4M1CC 3CZFA 3PWLA 3IJSA 3VMNA 4HIHB 3W0WE 2V3EA 3ZDXE 1OAYL 3K7UA 3AC0A 3QQ9D 5A16B 5TK4A 4D8OA 2IAMD 3F8UB 1Q4NX 1E4JA 4EAEA 4FABL 3D33A 5DFVC 2BY2A 4G8FB 4WZ9A 1XGZA 1NEZG 4Z78B 3LKRB 3D8MA 3SE9L 4YHML 5IQLA 3MV11 4F92B 3VYPA 2ADIB 3QNYA 2V9RA 2ZX5A 1JNJA 3ZBMA 1DBMH 6PAZA 3NSFA 1IVTA 1BZOA 4J27A 5HDBB 3QR2A 1OF2B 4OJFL 2EEXA 2B1HL 3DGCR 3ZDZE 3W39A 3L48A 3HZYB 1TT6A 4XAKD 4U1MB 1SJHA 3NIGE 5AYUH 3SPVA 3GLZA 4I9WE 4LVNC 1AO7B 4BRVA 1QFWH 3GSXB 3GMPA 2J8UA 3ZT5A 1J8RA 1ZGLA 4N2GA 1F6FB 4K94L 4EI5A 1TJXA 1TEFA 3CFUA 4N8VA 2DM4A 2YMOA 4LP4A 4GQQA 3ZHNA 3FUDA 2F54B 3BQUB 3GSOB 4ZQTA 5E2UH 1OAXH 1BLIA 3K8KA 2PWFA 3HRZA 4LKCA 1A47A 5C0IA 3LH9A 1SLVA 1CL7I 4GRLB 2ZOWA 2ZUYA 4OCMC 4P2OB 4BEIA 3E3QE 1OE3A 3QJOA 1KLGA 4IOSD 2A6DA 1GS6X 3BX7C 5K1JA 1RPUA 3LPWA 3PY9A 4K8RH 4JFDB 3TVMB 3DVNB 4Z7WA 1JE6A 3H9SE 3LIUA 3SHSA 4WW1B 1X9QA 2BSBA 4L4TA 2AW2A 1Y1DA 3CDGB 4TQPA 1L9OA 2FJSA 3CUPA 1GGCH 2ZUXA 3H9SA 1EJFA 3RBGA 1SXCA 3QCVL 4NWTL 4KX9A 4O2EA 2OYLA 3V0EA 1UADC 3MUGA 4KK8D 2N59A 4OGAC 5ICZB 2VO8A 1LK2B 4FHBD 5IMMA 1XF3B 1IKFL 3GJFK 1KYDA 4KRPB 3EFDL 12E8L 3EOBA 4YHPB 1YEHH 3WFEL 5DJZA 1T7XA 4MZIA 3FDWA 3HZKB 1EO8H 4NC1C 5SV3A 4PP2A 3FO1B 2VXQH 4GQ9L 4GUPA 5C0EB 4F8QA 4K23L 3RKDC 3QIWB 2W65A 2WW8A 3DARA 2KT6A 1D5RA 5EIIB 3JWNH 3LZQA 4YSQA 1EMTL 4TVPL 2YA1A 4YLCA 2H6PB 2DQGL 1LMIA 4EJ1C 3TEZA 1PL3A 3WEOA 5F7NC 3MBWA 4ZUTA 1OKEA 1HK6A 3CCHA 2J6EH 5EU6B 3A67L 1LEGB 4ZFOA 4FL4C 1RHHA 3MSPA 4PRAB 3JV4A 5J5EA 1NCBL 2JKWA 3BP5B 3FHQA 3NPSC 2CGYA 3OKOB 5AOZA 1X44A 1OOAA 5B4MD 2WOYA 2CDFA 3WDJA 2K7QA 5J1AB 2TSBA 5CJOL 3K2UH 4H8QA 4KZCA 3NDYE 4AG4L 3NCMA 1ORQA 4NNYA 1KIRB 4Y19D 3VQ1C 2YD3A 4BZ1H 2F8VA 2YO3A 2X2UA 1I4FA 3KG5A 4LCUA 4JRYD 2VXSH 2VDRB 1C16B 4KO5A 3D09A 3U2SB 1I9RL 3IFOA 4AXWA 5I9QC 4MJ5B 3TBBA 2Z8RA 2ESVD 4FXGB 3RU8L 2ATPB 4AI7A 1IV8A 1DJXA 3FTZA 4R4NC 1WAAA 5L9DH 4YQXH 5KG9B 1JRHI 1NFDA 3MLVH 4ZMAT 3FN9A 3KPQB 3OPZL 2DWYA 3T0EE 5L8KB 4Y5VA 3K1KC 5KBLA 2VUYA 3GHEL 1A0QH 5IKCB 5C70A 5IVXA 4M6NL 2OYPA 1BQUA 1SXBA 1F2XK 4JFXB 1FI8C 1QLRA 5HGBB 1ND0B 4Y5XB 1YYMH 4OBRA 1G7JB 1WZMA 4KGLA 2OR8A <