3FU9A

Melanocarpus albomyces laccase crystal soaked (20 min) with 2,6-dimethoxyphenol
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
559
structure length
559
Chain Sequence
EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-Function Studies of a Melanocarpus albomyces Laccase Suggest a Pathway for Oxidation of Phenolic Compounds.
pubmed doi rcsb
source organism Melanocarpus albomyces
molecule tags Oxidoreductase
molecule keywords Laccase-1
total genus 166
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu9A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu9A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu9A03
1I53A 1A4BA 1ZIBA 4JHUA 2AZUA 1SJMA 2PP7A 2YAEA 2N0MA 2H5UA 3UABA 4A2EA 4CSZA 3L45A 2VSKB 1URIA 3FYIB 2ZXWB 1AZRA 1TU2A 1JZHA 1PLCA 1IBYA 1NINA 4DP1X 1KYAA 2P80D 3MBWB 1SFHA 2YXWA 3NSDA 1RKRA 2IWEA 3BQVA 3EH5B 3OD3A 3OM3B 1OE1A 2CCWA 1L9RA 1E67A 1FWXA 3NJHA 1EZLA 3IEAA 3GDCA 3DTUB 3FQYA 3IN2A 5B7EA 1AZUA 2BW5A 1PLBA 1SHWA 2X87A 1OV8A 1J5DA 2W88A 2AANA 1E30A 2P80A 2BP8A 3FSWA 4ENZA 4HIPA 3S8FB 4NERA 1NPNA 1PAZA 3NSYA 1NWOA 1HAUA 4DP7X 4BDVA 1GY2A 3NP4A 3AG2B 1JERA 2Y1AA 1GYCA 3T6XA 1KDIA 1ET8A 2FT7A 2VM3A 3FU7A 1J9RA 3TBCA 4EF3A 1RZPA 1CYWA 1MG3C 3WNIA 4A2DA 3S3BB 2UXVA 2IH9A 3GYRA 5ANHA 3H56A 3SBQA 2DWTA 4YSCA 3NT0A 1OCZB 2IDTA 3H4HA 3FYEB 1ILUA 4DP5X 1AAJA 1SHXA 5I28A 3PAVA 2TSAA 4HCGA 5I6MA 5I6PA 3ZDWA 4A68A 4E9RA 6PCYA 3H4FA 3T6VA 2GC7C 2OJ1A 1WS8A 1ZIAA 1OOWA 1A4CA 2FT8A 2JFCA 2A3TA 5B1JC 5TK2A 1GR7A 4BXSV 1JZFA 1NTDA 4A67A 1MG2C 1AZBA 1UATA 2BO0A 1NIAA 2DYRB 3T6ZA 2UXGA 3X1NA 4YSAA 3ABKB 4E9VA 4W1TA 1GS7A 2FNWA 4YSDA 1BAWA 1JZJA 1X9UA 4YSOA 2XLLA 1A3ZA 1M57B 3OQRA 3FSAA 2PPEA 2B3IA 1BQRA 4N4YB 1SF5A 1M56B 1B3IA 2BZ7A 3WKPA 3G5WA 3EH4B 3WKQA 3ABLB 1KBVA 2YXVA 5AKRA 2BP0B 3C75A 2YAMA 5B1JA 1CURA 2UX6A 1OE2A 4HCFA 1WA0X 5F7AA 4HHWA 2IDFA 1V55B 1PZCA 1TKWA 5I6NA 3AG4B 5I6LA 3WG7B 2DV6A 4UAHA 1T5KA 5IY5B 4E9XA 5AFAA 1L9PA 1AACA 2MTAA 4AKOA 4MFHA 5I26A 4ZK8A 3TBBA 3QJVB 1AS8A 5EHFA 1W8EA 1J9TA 5TK4A 4RH4A 3WI9A 1JZGA 2FWLB 2NRDA 1OF0A 4A2HA 2IH8A 2MRYA 2VW4A 3S3CB 4KO7A 5E9NA 3AG3B 1JVLA 1PZBA 2FQFA 4YSEA 4NAJA 3NJIA 1ASOA 2XU9A 4P5RA 3ZIYA 1NDTA 2HXAA 1W6LA 4GY4A 1AIZA 1J5CA 4K9JA 2FQGA 4E9WA 2HRHA 2Q5BA 3D12B 4A2GA 4FAAB 1WA2X 3BVDB 3JTBA 5B3SB 2YARA 3FPYA 9PCYA 4DP6X 1F56A 4QKTA 2J55A 3HEIB 3GXUB 2YAFA 1JXDA 2AFNA 3EF4A 3HB3B 4G70B 1GS6X 1VLXA 4QLWA 4HZ1A 3CDZB 1BXUA 4KOCA 1NIEA 2UXTA 4P5SA 2I7SA 2B08A 3TA4D 4YVUA 4Q8BA 3T6WA 4G72B 3NJGA 2ZWNA 3FU9A 1JXGA 1AR1B 1KDJA 1AZNA 2IWKA 1CUOA 1BQ5A 1IC0A 4DPAX 1SDDA 1ET7A 1OCOB 1X9RA 1ILSA 4DP2X 1WS7A 2Y69B 3S3DB 1E5ZA 3NJFA 2YAHA 1HFUA 4FA7B 2CJ3A 4HALA 2GI0A 3UAAA 4AI7A 1R1CA 4BWWA 2VMJA 3NYKA 1WA1X 3QQXA 5D4JA 3NSFA 3WNJA 4A66A 1AQ8A 2E86A 1E5YA 4GP4B 3EH3B 2XXGA 3CDZA 1V10A 2YAOA 2VW6A 3FPXA 3PCYA 1AS7A 1M9WA 2XV3A 4F7KA 2XWZA 2FT6A 3CZUB 3T71A 2BW4A 4KNUA 1A65A 1DZ0A 3FSVA 1ZPUA 3ZX1A 1BYPA 3JT2A 1NIDA 3QJQB 7PAZA 6PAZA 2CBPA 1ZDSA 1AG0A 5F7BA 3X1BA 2XVBA 3FU7B 2IWFA 3PXLA 2QDVA 2EINB 2RACA 3IE9A 1L9OA 2XX0A 3ASOB 1SDDB 3ERXA 4CSPA 2H47C 1ID2A 3QPKA 2PCFA 3SQRA 3FS9A 5B1BB 2GC4C 3TASA 1J9QA 3FQ2A 1PMYA 1PF3A 3CVBA 4F2EA 1JVOA 1TEGA 2HLEB 2QDWA 2FQDA 1YLBB 1L9TA 3FU8A 2JKWA 2R7EB 4DPCX 2J5WA 1QLEB 3DKHA 1JZEA 1RZQA 2XXFA 2PPCA 1JOIA 1JXFA 4M3HA 3ASNB 1GS8A 5B1AB 1ASPA 1BEXA 2VM4A 4A2FA 1MZZA 1SNRA 1TEFA 1AANA 3TU6A 2CALA 4UANA 3U25A 3NJJA 2I85A 3UACA 1ETJA 2FQEA 2EIJB 2J57A 2LLNA 5B1KA 2XV2A 2VSMB 4G7QB 3OMAB 1KGYE 2W8CA 4TXVB 1FA4A 2HX7A 1AZCA 1KBWA 1MDAA 1WAEA 5I6OA 4HAKA 2XV0A 2J56A 2UXFA 3T9WA 1FFTB 3NJMA 3SBPA 8PAZA 3WIAA 1EHKB 2GB2A 1BXAA 2R7EA 2WO3B 1BYOA 1ZDQA 2TSBA 4G7SB 1E65A 2IDSA 4Q89A 2EILB 4YSSA 2JXMA 1GY1A 1CYXA 1L9SA 5D4IA 1XB3A 4JKNA 1PY0A 2XYBA 4BDVB 5B7MA 1N70A 4NB7A 5AZUA 2FJSA 3PPSA 2DWSA 2OV0A 3OMNB 4AZUA 2DY2A 2PP8A 1N68A 2GBAA 4WTQA 2QT6A 1XB6A 3X2QB 2BP8B 2IAAC 1NPJA 1MZYA 1AOZA 1ADWA 2H3XC 4KNTA 2QPDB 3EHBB 4KNSA 2IDUA 5FC9A 4L0PB 4G7RB 4E9YA 4YVNA 1GSKA 4KOBA 4YSQA 3SBRA 1KCWA 4YL4A 2GIMA 2DYSB 2PP9A 3FQ1A 3NP3A 4PAZA 1XMEB 5LDUA 1NWPA 2WO2B 1NICA 1BQKA 3V9CA 2OCCB 1HAWA 1PNCA 4GP8B 2AZAA 2XX1A 1GW0A 3UADA 5D4HA 3N2JA 1JZIA 2BWIA 3ZBMA 2PPAA 1KCBA 4GP5B 3UGEA 4E9QA 1AS6A 4BXVA 3RYMA 3UAEA 3AZUA 2VN3A 3DIVA 3PAZA 3S8GB 3ABGA 3AG1B 2WSDA 4N8UA 1PNDA 5I6KA 2BWDA 4G71B 2YQBA 1QNIA 5I5IA 4WKXA 3ABMB 1IUZA 2FTAA 4W9ZA 2XUWA 4KO6A 4DP9X 4YSPA 1IKOP 4UF7C 4X4KA 1L9QA 1NIBA 3NJLA 5A7EA 1OE3A 1ASQA 4AKPA 1PCSA 2PPFA 4M4RB 1PZAA 1A8ZA 3X1FA 4AKQA 5PAZA 2BP0A 3QJUB 2PLTA 2UX7A 1SF3A 4PCYA 2YAQA 4KO9A 2PCYA 1NZRA 3OMIB 4E9SA 1BXVA 4BWTA 1QHQA 1RCYA 3PAUA 7PCYA 1W6WA 1PLAA 3NSCA 2I7OA 3IBOA 4GXFA 1J9SA 4DPBX 4F2FA 2VW7A 3V9EA 3NJNA 3X1GA 3PLYA 4BK5C 1KV7A 2BZCA 2PPDA 3X1EA 2GHZA 2ZONA 3QJTB 4YSRA 5PCYA 3QJRB 1AG6A 2HX9A 4BWUA 5B7FA 2BHFA 3KW7A 1NIFA 1CC3A 3N55A 4HHGA 2HZHA 3KW8A 1DYZA 2X88A 3FT0A 1OCRB 3AW5A 4DP0X 2EIMB 1V54B 4DP4X 4YSTA 3NJKA 3IN0A 5I5MA 2QPEB 3MX0B 2EIKB 5I5JA 3CVDA 3QJSB 3AY2A 2YAPA 1SFDA 2HX8A 2HRGA 1OCCB 3FSZA 2CUAA 4JHVA 2GSMB 4E9TA 2AVFA 2IDQA 4YSUA 1A4AA 3CG8A 4GYBA 2ZOOA 4KO5A 1ET5A 3CVCA 4DP8X 1XB8A 1ZV2A 4HCIA 2Q9OA 1IBZA 4AX3A 2CAKA
chains in the Genus database with same CATH superfamily
4PS4L 1ZIBA 4BSWB 1MJ7H 1CR9H 5E2TH 1TQBB 4AL8H 1C8PA 4AE1A 2JF1A 1C9SA 5KTEL 5MI0C 5LG6A 3D25B 4MA8H 4NQDE 5ETUB 1BFOB 4RIRB 1ML0A 2Q2EB 3RGVD 4MTMA 5EORH 2Y6SD 4YN3A 1YUHA 1NC4B 1DVYA 3MLVL 4MQ7A 4PIRF 2ZXWB 2IDCA 1NINA 5FGBA 1IC1A 3MBWB 5CJQL 5KOMC 2NT0A 2EYTB 5EU6A 2ZWYA 4XMPL 3CSPA 3VFPB 1Q0YL 1CBVL 1YYMH 4EI0A 1B88A 2P4AB 3L3OB 1IAIL 3EXJA 4NCC2 4OV5B 3HLKA 4ABUA 4GSUA 2XFXB 3B7UX 5I1GH 3EH1A 5KVDL 3ZZLA 2ZCLL 4H5SB 1GAFH 3L48A 3UTOA 2CH8A 2DMBA 3QEUA 5SWQA 4JN2A 3U1SL 3QUYB 4Y5YA 4X8JA 1U6AL 1CDUA 2VDOB 1N64H 1XAUA 2EDMA 3D4GA 4FEIA 3DYMA 4G80B 4K94C 4LCIH 3NZUA 4XMTA 4BGLA 1SLXA 1V7ML 5EU3B 2XNAB 3HI5H 1BQHB 5LBSL 4H1LH 4JFOA 4WTZA 3Q5OA 1WBYA 4I0KA 2D03L 4U6HB 3ZRFC 3KYNA 4ONGH 3I02A 4AGPA 2FBJL 1I1RA 1KXVC 3FCGA 4GMTL 4LARH 3S3BB 3ZKSD 1HKFA 3BKMH 3HZMB 1BBJB 3NT0A 4KKBC 2X2IA 5GGQL 5HVFB 4NQXA 1LWRA 1JDCA 4NM8H 3MNWA 5D7JC 4WNQA 3PIQB 1CK0H 1NCWH 1N6UA 4AJVA 1DEEB 5T1MA 1TJHH 3PWNB 2F54E 4A68A 3QQDA 3TYFA 4AXWA 4H0LC 2Q0ZX 4ADIA 3S4SG 3QJHA 3H4FA 5JO5B 2EDKA 5SWSD 4NUJB 4XO3A 3WHXA 5KOVC 3FT3A 3MJGX 4HLZH 4B6ZA 2FECL 4OZFB 3T0EE 1ZHKA 1XQ4A 3WTWA 2I60H 5LQBL 4PJEB 5KSAC 3HB3C 1ZE3H 2FJUB 4FFVD 4XOAA 1WICA 4H0HB 2ZSVA 3SHSA 5FYJL 2UXGA 4I77H 3LNEA 4GAFB 5EU5A 5I15L 2DRUA 4XCYB 1TCMA 1WCBB 5MEQB 3DX6B 4ZUTA 4KTDL 3C60C 4QT5A 3T77B 2DQGH 2WXFA 4OF6A 5FUZL 5F7KC 3MRMB 3OQRA 4AK1A 2BY2A 3OZ9H 2CA3A 1IC7L 3OAWA 1I8LC 3AAZA 2YHGA 3CH8A 1SF5A 1T04B 3S3PA 3TNMA 1RHHB 2ITEA 5ALBL 5IFHH 4R0LB 1KIRB 5CJ8A 2ENQA 2L8AA 2IPTH 4HS3A 3MV7D 1Z7JA 2YAMA 1RZJC 3HHMA 1PCXA 2K3TA 3ROOA 4I2XA 3U9WA 4XT1C 5KZCD 4F2ME 4GQRA 3EYOA 4Y5VB 3DA0A 2HAZA 5HHVL 1LP9E 1JPSL 1T5KA 4LQFL 5F7DB 3NMEA 1HT6A 5AFAA 3WAKA 5I30L 3JV6A 1AACA 3HLAB 2WTRA 2D3NA 3LZQA 1N5AB 2EDBA 1EZVY 2M83A 4PJAB 3EFDH 2JB6B 3RL2B 5FGBC 1KG0B 4ZFQA 4KV5E 5L2KA 4IDJH 3HHSB 1C8QA 3K8LA 1OTSD 4AITA 1BVLB 3BKYH 5L8LB 2ESVB 3MGOB 2VXQL 4U3SB 1QWNA 3QUYD 4MMXB 3ZE0F 2KC0A 2OXHA 4S1RH 2HXAA 3B6SA 4H40A 3HRPA 5TGBB 3NRFA 1WHOA 3DTXA 1AIZA 2FJHA 1LK3L 2XETA 4R2GD 3ULUC 2VLRB 4FQXA 1U92B 1HHJB 3FB8B 4JS7A 5EEVA 3E3QE 1MAJA 3O2VH 4JM2B 1FFPB 2IV8A 3QH3B 1MJUH 3VTMA 2F0CA 3NAAL 4XCCH 1WUZA 4GS7C 2JV6A 3L7FB 4LGRB 1MFEL 4PTTA 3D50A 3F7KA 3MNMA 2H1PH 4N1CA 5CS7A 2LTQB 2AAVA 2GY5A 5J1SC 1YECL 3L4CA 4R7VA 3TO4A 3BKJH 2QVTA 1JNJA 1U8QA 3LXUX 1PEWA 3OAYH 2XN1A 1S7SB 5EUOF 4LAQL 4QHKI 3WIFA 1XL4A 4GKNA 1HFUA 3TZVA 2D9CA 4ZO6A 1ZT4B 2QR0B 1DBJL 2FYYA 4QRQA 5IK3A 4U3SA 4Z3GA 5LN8A 5D4JA 1AO7D 1FGNL 2BS9A 5I1KL 1IFGA 4D0BA 3IM1A 2CM5A 4GP4B 2VR4A 2X4UA 1A21A 4JM2F 4WO4B 1BG1A 5HHQA 2Y23A 2B4CC 4PJDA 4U1SA 5LB1A 4X50A 1A65A 1BZEA 2YGPA 1DZ0A 3W2DL 1RVFH 5KS9F 1USZA 2NDGA 2P48B 4P2RA 2W60A 5GIRA 4BQ6A 3UZEC 1KSRA 2Y6TE 5F7EL 2MNJB 3AM8A 1GGYA 2C1OA 3HVDA 3QRGL 2BOLA 4KAQL 5C0ND 4JO4L 4PGDB 4RDQG 1KIQA 2VAAB 1J1PH 1C12A 3KWTA 2NW2B 3QUYA 3VUAA 3EJYC 5DK0A 1TYEB 2Q2LA 2VR6A 4XMPH 1TSRA 5ESAA 1O7VA 3C09B 4N5UA 1UOWA 2DAVA 1H3UA 2Y07L 4FQXD 4L8SC 4GAJH 1DJYA 5D6DA 2YIHA 1YNKH 2MHAA 1KC5L 4QY8A 3VW3H 5D6CB 1UEYA 4HIHA 4RGNB 1FVDA 4GBXD 4R96A 4RQQB 3SOBL 2VQ1A 3KGRA 5CEYB 5I1HL 1G7JB 4G6JH 2YLHA 4LNVA 4PRPB 1CLYL 1VCBC 3AXLA 3I6LE 5IB3B 4XN4A 5CAYB 1NLBH 5ESQB 3MCLH 1NANI 3P2DA 4NNXB 1HVXA 4WF7A 1CDCA 1O6SA 3HMXL 3KXFE 5IBLC 3D39B 2LLGA 3ASNB 2Y1VA 4JHWH 4NNPH 1L0YA 1C5CL 3PG2A 1BEXA 2BP3A 4X6BA 4KDWA 3BT2L 4C57C 1MLBA 4S1SH 1J48A 3BH9A 3VM5A 1QVOB 4UANA 3UACA 3FT3B 4M1DH 4B5EA 4I13B 4DEPC 2J57A 4XBGB 4F9PC 5KVGL 4NLAA 3QG7L 4FHKA 2XV2A 1C5BH 5CU5A 5FCUH 3H6JA 3VRJA 1FNAA 3TVMA 3TO2B 4U2ZA 4Q97A 3FTZA 1U6AH 3LHAA 5J6HB 3UTSD 1J0HA 3AAZB 3O6LL 3MZGB 4Z78B 1L7TH 3O9WB 1NAMA 3IJ8A 3CWGA 2ADJA 5SWZE 4MJ4A 1F8TL 4F92B 3CC5B 5E5MA 1M42A 4UILH 5K93A 2CLRA 4N9OB 4JDEB 1BYOA 3AMKA 3Q8FA 3D51A 4DH2A 4PH8A 1HZLA 2JKNA 1BF2A 4HK3N 2IDSA 1FH2A 1E2ZA 1AHWB 4LOUD 1G7HA 5FB8A 2JXMA 4HXAL 4AQOA 1BZ7A 3TBWB 2XG5B 3T3MF 5J9PA 4RAHA 1JXJA 4WY7H 4AEHH 1E4XI 2KBGA 3VXUE 1N68A 2COQA 2LFEA 4Q6KA 4DCQB 2J88L 3FTYA 1KELH 5CGTA 2VH5H 5I8EA 1KCUH 1ZA3B 4CL7A 4OZHA 1MZYA 4KK8C 3THMH 1CG9A 2YD2A 2WD0A 4N0YH 5JQHC 4IIZA 1T4KB 3GKWL 5FC9A 1X5IA 3TA3C 3LDBC 1I1AD 3B5TA 4ZMYA 4H25B 4OVUA 5C0EA 3BQUC 4LO9A 1P9MC 4EI6A 3TVMB 5E08H 3DYOA 3SDYH 2R4RH 4JFXB 3UJTH 2AERT 3IPEA 4IU2B 4QRBA 4W9FC 4R4BB 1NFKA 4FFTA 3B2XA 3OGCB 3ZKMC 1A4KB 2C9UA 5JW5A 3DOHA 4MVBC 4JEGB 4LLYB 4MA3A 1RIHH 4AIXA 1YUHB 2XKNB 2VH5L 2Q1EA 5DZOA 5IW6A 2VLKE 2OMXA 1IGTA 1S5IL 4APXB 3P4MA 2Z35B 3OL2A 4KJPD 4E9QA 2W94A 3RFZC 2VR7A 3G6JA 4KMQA 1EVTC 1AE6L 4TUJA 4NN5B 5DUML 5FS5A 1AXSB 4G9DB 5FKPA 1E6JL 4OM1L 1J87A 2FJFA 4MMYB 5B4MD 4ZFFA 4IJ3C 1KJ2A 2AJZA 3T2LA 2VN5A 4UINH 1I8MA 4G8GB 4IU3B 2KZ1B 4F80A 4L1LA 5JYMA 2XYCA 3DWTA 5I30H 1MSPA 3L1OL 3DK0A 4AKPA 4Z76A 4ZI8A 3QFJA 1J0KA 3FTSA 4M4RB 4F24A 1E4KC 1T5XB 3GHEH 4AIZB 2QKIB 3X1FA 1OSYA 1DO5A 1O7DC 2BP0A 1CCZA 4FF9A 2NCMA 2AJUL 3LH9A 4KO9A 1J1XL 4NKIH 1U0QA 2O5YL 5KJRH 3IRCA 1EO8H 4LVHC 2C7UB 1RZGA 1LO0L 4DO4A 2Q6WA 2BNRA 1WP6A 2UUDK 1X7QB 4N8CL 1Q0YH 5HVHB 1P53A 1EAJA 2AQ1A 1C5CH 1NUNB 3IETA 2DQUL 3DSNB 2YKLL 4JFFD 4WK0B 4DZBB 1AKPA 4IRSC 2ZKXA 2E9GA 3E3QC 4X9YA 2Y06H 4FQCL 1BVNT 3LZRA 4FNTA 1MCRA 3CFCL 1OQOA 2W9EL 5FUOH 4Z5RA 2Z31C 4KVCH 3DI2B 1AD0B 3T1WA 1HZKA 1LMKA 2FCBA 1NFDB 1S7QA 4XBEL 5L0QC 5CGYC 5JO5A 3ULSB 3IU4H 4B9GA 1RMFL 1RURL 4OJFH 3QDJB 3ZHFA 2GHZA 5SWSA 4NQED 1IFHL 1TJGL 1KGJA 5J4MA 2CKBA 3IDXH 5JA8B 4CJ0A 3LV3A 4MAZA 1U8KA 3HZKB 3HCVB 4P99A 2N1TE 1WSST 4X7TB 4QRPD 5LBGA 4OZHF 1Y1UA 5AZEH 4K7PX 1OXYA 1BOGB 2Q76B 4LCYB 3O4OC 5EA0H 4PTUB 1AHWC 2SEBA 3Q6FA 1PY9A 4LEXH 2YZ1A 5BZWA 2DL2A 4AMXA 3O6FB 1JPFA 3MMEB 5I74B 1UADC 5DI8B 5C97A 2CIKB 3OKNB 3VXMB 4W9LC 3WE6A 2A38A 4ELKA 4OIAA 4JQIL 4IMLA 4OLWL 3S88H 4CDHA 2EIEA 1CXFA 3JWNC 4CSTA 3VFMB 3GXMA 2VRQA 5DD6A 1I53A 1YEGH 2CZNA 3GZQA 3QHZL 4JAMB 3UG3A 4RMRA 1IJNA 2JJUA 2PP7A 4MDRA 4WWOA 4M93C 3WLBA 3D5OF 4A2EA 2YC1A 4L4TE 4AM0A 1NCUA 3BAKA 4KI5C 3IFLL 1IAKB 2BNRD 1BREA 3H3BC 3PWJA 4O51B 1MCHA 4V2BA 2R2HA 2HN7A 2EE2A 3CFQA 5EZLB 2IBGA 1NGYB 5AD0B 3GINA 3LZNA 4X80H 2YMOA 3ZE2E 3RZCC 1OGAE 1QO3B 5JDJA 1KCVH 4WHYH 5I0VA 1S9WB 5I1AB 3KPLA 5IB5B 4L1DA 3RVWC 1PD1A 2BM3A 3QHZH 4FYSA 3SCMB 4LIQE 5LVEA 5FGCE 5GS3A 5GQBA 1PLBA 3MCG1 1LEKB 1ZLSH 3C2SA 1UH2A 1GGCL 5EZIL 3SJVD 1H3WM 1G7QB 1E3XA 2P80A 3LH8A 1S3KH 4DKTA 4HV8B 5KUKA 4JDZB 1HAUA 1MAML 3L2MA 5B8CC 1UD5A 2HFFA 3CZSA 4UNIA 1CE6B 1VSCA 4PLJC 3ULVL 5HHMB 1HE7A 4BK4A 4RGND 1C1EH 1X44A 2FT7A 5T1JA 1W8OA 1MAKA 3HMWL 4I18C 1LO5A 1AGDB 3DTXB 4JX0A 4WCYH 4BKLA 2WNXA 3OJDA 4JB9L 5HYJE 3V4UL 5TH2A 4W70A 4JJ5A 4MAYA 4WFFD 5C0RH 5D96B 5DVLA 4YSCA 2IXQA 2VXTL 3MREB 1TJGH 2YOCA 1HEHC 1CFTA 3GTTA 4TS6A 5ENWB 2YMTA 2AMUA 3PGFH 1OP4A 3PNRB 4GB9A 4FFYA 1XGRA 5IG7B 4HG4J 5IB4A 1NMCC 3QUMA 1MCKA 1S7XA 1AXSA 3TBSB 2YSSB 4K71C 4Y5XB 4POYA 2H32B 4YBLC 5JXED 1WS8A 5CHNB 3WNNA 4UV4H 4XXCC 2DM4A 2G75B 4OQTL 4ODHL 1EXUA 3L4ZA 3FB5B 3UAJC 1PZ3A 4PBDA 1S7VB 2R56H 4GKNB 1QD0A 1QASA 1H8OA 4PJHA 4HVBA 1AO7B 2A9CA 3STBA 3I02B 1NCWL 1NC2B 4QD2E 4LDOB 1BAWA 3EZ8A 1KCUL 5ICXA 1E50A 3D69B 1M57B 3B3BA 4YXLL 4GS7B 4PJAE 1WIUA 1W16A 2DWDA 4KMTH 1Q0XL 3GJFK 3TCXA 4JM2C 2WCPA 1XX9C 2P8PB 4QF1B 4OJCA 1JVKA 4AQ1B 3WKQA 4J1UB 3FT9A 4MMZB 1ZANL 2XA8L 3VXNB 5AOLA 4JE0A 2ZJSL 5LNGA 3GO1L 2HFEB 1FYTB 1DBAH 4OZFA 1TCRA 4TKWA 4HCFA 4OZFH 4XNMA 4YGVA 4JZJB 4YHYB 1GMEA 3OKDA 3NVQA 4JM2D 1OSPH 5KWYC 3U83A 3WG7B 2DV6A 2VXSL 4NO3B 4E9XA 5IM7A 1WAAA 1ACYH 3BGMA 4KPHH 1ZHLA 3B9VA 5C8JB 4U3XA 5EHFA 3L3IB 3P73B 3BVVA 2PWEA 5D70H 1J9TA 2HT4C 1H3PL 4URKA 4X7TA 2E8ZA 3QQ4B 2AV7B 4OFQA 4FQ2L 4LSDA 1LLAA 3B1TA 4O2CA 3S3CB 2ID5A 5SWSB 3AG3B 3GMOB 4EI5C 4N5ED 4PWJA 3GSRB 2J5LB 4OI8A 2MCG1 5TE7H 4P5RA 3RWHA 3NIGB 4OKVB 1PD0A 1WGVA 1FDLL 5D1XD 1EDYA 3EYOB 4MA8L 5DI8A 25C8L 2WXOA 3D9AH 3RUGB 4ZTOH 3MRCA 3BOVA 2F54B 5SWSE 3HUJB 3GSUB 2AFNA 3EF4A 4L3FA 4MXWH 2E9BA 4LNRA 3OKEA 3IDUA 5AZ2L 3O2WH 5IBUG 2ATKB 1HL4A 2VMEA 2ZUTA 2DQHH 2VQUA 4Q8BA 4JY4B 3C5ZD 2C9SA 4HD5A 2D0FA 4OGXL 2R59A 1XF3A 2VL4A 5JHMA 1R4XA 3CXDH 2AEQL 4NQDA 4JUTA 3Q5YA 4Q6IC 2BSCA 3M8OL 3VGBA 2WLZA 4MQXD 2ZG1A 1BX2B 5D55A 2HJFB 1UENA 3QPQC 1E27B 4JG9A 4YMPA 4DCQA 5F0JB 1IM3D 5CNHA 3DUSA 1BEYH 3V0DA 2EYSB 5FO2A 4YHOH 3CDZA 2D31B 2YAOA 2BWQA 5DRZB 3RVWD 3ZY7A 4BHUI 1EZVX 4NQSB 1DN0B 4NO0A 1BYPA 1JHTA 4L37A 3HHRB 4NJ9L 3V6OA 5C6TL 3GBML 1YY9D 5DA4A 3TOPA 5IVZA 1JHKL 5C09E 3R06B 5HGGS 4J8RA 5JHLA 1TQWA 3FU7B 4IU2A 3QDGB 4TLKA 4UYPA 1MJJB 1OP3K 4WEUD 4X4ZA 1HYSC 3PQYE 4MB1A 5E2VH 3L3OC 1OZUA 2LAAA 4LOUC 4LT7A 4QOKD 5I8CA 1Y0LB 4RA3A 4DOHE 1WAAF 3DIDA 4ZFFB 5JHAA 1WISA 1J0ZA 4H8PA 4M00A 4XN5A 1ZLSL 4XX1E 3A6CL 4QHMB 4Y4FC 4I89A 3SPVA 3VXRB 1F45A 5E8PB 4P9HH 3DX3A 2NNRA 1J5CA 1O0VA 5B8CA 4WUUB 2ZSWA 5ERWB 2IADA 4Y4HD 4X80L 3MOBL 4UOW0 5EH1A 2BMKA 4CDGC 1ACYL 2AITA 3QZWB 5HYJB 5T33L 1JOIA 4LQFH 2B1OA 2NYKA 4MKTA 4ZX5A 3LEXB 3N42B 4FXGC 4OB5L 3VNZA 1S7XB 4CVZB 1DSYA 4I18B 3NCWA 1AY1H 2I85A 2A6IA 4G8IA 3HE7A 5DC4B 1P6AB 4Y4HC 1S4IA 3MV9E 5HDOA 2NNAB 2OXHB 1OB1A 3TA3A 3VI3F 5HHNA 2YXMA 3FB7A 3SE3A 2YD8A 5FOBB 1NAKL 4HXBL 1UWXK 3O6FD 1CICA 4LSUH 3S37X 4XNZB 4GW4A 1JCKA 4WEMB 4NC1C 5T3ZD 2UXFA 4X7SL 2WWKO 3Q06A 3N1MC 4JFYB 4WK4B 4JDVA 4FDWA 5I75B 1AO7E 4LLWA 2WQRA 2WSKA 3GSNB 1QA9A 4GKZA 1IX2A 1OW0C 1U8MB 2GT9A 4GXVL 1KPRB 1GY1A 1U95B 3QZNA 5D8JL 1XB3A 3ZMRA 4LDLB 3RTQA 4FULA 1I1AA 4HUXA 2ZSWB 5ERWA 3I9AA 3SODB 2UZIH 1BOGA 2Q76A 1UKTA 1I8LA 4BCXA 4NRXB 1T7VA 2UUDH 1JGUH 2FGZA 1U91A 2DLEA 2XPGA 2QT6A 2PP8A 3ROOB 2VZ1A 3Q43A 4JO2L 1Y07A 4LVEA 1CD8A 3Q48A 4QHUA 3KWWB 4WFHE 5BZZA 5HPMB 3T3ME 5AW2B 1F1AA 3EHBB 3MBXL 1DQQA 2X0VA 1BVKB 4HLEA 3M7OA 3DDFA 1BBJA 5FYJH 3UTZB 4LBAA 4G8IB 4WJ5A 3ULVD 4NQCA 2GIMA 3OKYA 2BIHA 1MQ8A 3B9KC 5GRVK 5CD3A 2NY4C 4BELD 2MOVA 5HD8C 1M3JA 2YD9A 3OX8A 4AEHL 1HHKB 4UQDA 1F4XH 4OZ4B 2AK4D 2GTZB 4ZMOA 1CS6A 4HK0A 5D1ZD 1R19A 1ZLVK 4O58H 3CU1A 4HEPA 2EEBA 2CGRH 5CJOL 5AW1B 1XF4B 5IJCC 3FFCA 3V0HA 3LEYL 1FO0B 5DD6B 2WUCH 4KY1H 1WTLA 5FEBA 4TL5A 4JZOB 2AHIA 1TMCB 2H3NB 2K4WA 1OSEA 2WQWA 1YMMA 4PJFE 2X12A 4M7KL 3QJHB 1I3VA 2VLRA 3FTGB 5D7JB 3UTZA 2BK8A 1QNIA 1KCRL 2F08A 2QMKA 1WWAX 3E38A 1SEQL 2LR4A 3DJTA 2CO3A 1UJ3C 5C0IB 2CO7B 3HRZB 4UF7C 2NSXA 5D5MB 4DN4L 4EKJA 1VFBB 5E6SB 1TTBA 3ZTCC 2DQCH 3Q1EA 2EDXA 4L2LA 4QTHA 3TA3D 4D8PA 3GLEA 1UJTA 1PKQB 3B2VL 3REVA 2XTJE 3DXAD 1XF3B 1FVEA 2DQFB 3VJ6B 1MRFH 3OWRA 4NM4L 3TC9A 3TO4B 2R0LH 1CGSH 3IFLH 1IT9H 1AI1L 1JWUA 2ADIA 3EYVB 4IOIB 5EIIA 4K8RD 2WOBA 5I1HH 1PEZA 3TN0C 2NX5B 3ARWA 5FF6A 1BMGA 5FFGA 1S5HB 2WJ7A 4X8GA 4OCMC 1ETA1 1LTXA 4MA3B 3UBGA 5GGRA 2RD0A 1MCSA 1MIEL 2EUZA 2JLPA 4HJSA 4IMKC 4Y89A 2WKOA 3ARUA 2NNXA 5F89A 1NOLA 1MRCL 4P46C 4E36A 1TKWB 5ESVA 3S34H 4AQ8C 5LNEA 1F4WH 4UI2A 2VW7A 1ODAA 1D6VL 4TNVK 2BRRH 3X1GA 4FQQB 4DW2L 3R4RA 4NT6B 4OI9A 3UGUA 1K6QL 4M8UA 2EEFA 1UM5L 2CM6A 3QARA 2VLJA 1N67A 3DBSA 4IKIA 5G55A 2NUTB 3BAXA 2H6PB 1BAFL 5CFHA 1RUKL 3FONA 1EWHA 2UWEE 1DYZA 4PU2A 1OALA 5F7MC 3FT0A 4M4RA 2KPNA 2E5EA 4PBXA 1SBBA 4KZEL 4OZIF 4HKJA 3U1PA 3D3VD 3JUYA 4YPGA 3SOTA 2PW2A 4DUWA 2HKAA 4ZDHA 1E4XH 1T7XA 1Q9LA 3MYZA 3SPVB 1NFDF 5H35B 4WVRA 1MCOL 4PSPA 2EUVA 5A43C 1QSZA 4LLVB 3HAEA 4GKSB 1FNLA 4I1RA 1UURA 3C6EA 1Y18B 12E8H 3D6GA 4FI6A 4XRCA 1J5OH 2ZOOA 4YXLH 4JL2A 3U7YL 1S7WA 3HZYA 3CFIC 4IRZA 1CLVA 3Q2VA 3B2DC 2MNWA 4QXTB 4ZOCA 4LRIC 2OSXA 2W9LA 1XR8B 4U4IA 3DIFA 2GUOA 3NUKA 4LVOB 3ZTJG 2H1XA 4Y4FB 3D3VB 3O4OB 5IVOA 1OLLA 3X3FL 4KUZL 2FYYB 1X5ZA 1IBHA 5EBGA 4EJ1C 1I9RL 5F7YC 3WJLC 2XOTA 4JG0L 3U0WH 5LCVL 2ZNWA 2EVJA 5EU3A 1I8KA 2Y07H 1BQHG 3VXSA 5I1IH 2P80D 1KCSL 2PWGA 2FDBP 1WGOA 4X99B 1MN4A 3WFBH 3CHXA 5IOKA 2DTMH 5GRZA 4Z3HA 1X5AA 2GK0A 1JWMA 1HKLH 1EFQA 1NANH 3CAFA 2QQNL 4KRPB 2YD0A 4YK4B 2X87A 3ZR6A 4UDTB 5SWZB 2YUVA 3S5LA 3KNBA 4LCUA 4MD0A 3HE6B 4XNUH 4U7SA 5GZOC 2VLKB 4JZJC 2P28B 3NZSA 3QEQA 3WTYA 1Z32X 2ZKYA 4TLSA 5D2LF 1GY2A 4MJIA 2A1WL 2CCVA 4ONFL 1UM6H 4HIIB 3ARBC 1C1EL 3IJEB 3ILPB 1O5DT 4JRYE 2VM3A 3ARFD 3A22A 5JQ6H 3ARPA 4N2NA 5I75C 1ZOXA 3KYKL 1QI4A 4NGHH 4WWID 1CYWA 1CXKA 4Q0XH 1I7TA 3VD5A 1G9NH 5TD4A 3MBEC 3BWUF 3MRCB 3PV6A 4X6CF 3KPRB 3KLDA 3DECA 1DVFB 4GRLB 5CP3H 1YDPB 1AMXA 2F53A 4Y4HA 3JWDC 4DESA 2XWTA 3BZDA 4AIEA 2VZUA 3O3DA 4DP5X 2WW8A 1AAJA 5LAXB 4F58H 1YECH 1U2CA 3MRFA 3UCQA 1UCTA 4MYPA 5I6PA 4E9RA 5BJTA 4IRSD 3P4NB 3K72B 3T6VA 2E59A 4YDZA 4Z8FL 3BH8B 5F7DA 4Y8AA 3QZBA 4U31A 3N43F 1I31A 2ZIDA 3NAAH 1O6VA 2CXGA 4XCCL 1JGLH 3IGAB 5LUMA 4ISVB 3NEOA 2JJTC 1IFRA 4TVUA 4TL4A 1NBZA 3SQBB 1LO5B 1AZBA 3RPBA 5T3XE 1PS3A 5E9DB 4NKMB 4U6TA 2R2BB 1FNEA 1X5FA 3ZKND 5F97E 3RTQC 3HZVB 3OKKA 4H2CA 4YBHA 3V0EA 2V2WA 4F58L 2B4CH 2BVOA 2NLJA 3SO5A 3IDYC 1JF6A 2GFBB 5D9SA 1KYOJ 3GI8H 3P11H 2BIMA 4L1SA 2AGJL 3ARED 4Z0XA 4Z7VB 1HXYB 1HTYA 1XEUA 2A0LD 4MCZB 3G5WA 3TIEA 3M6DA 3UDWC 4L05A 1OGAD 1IGML 1UT1A 1Q94A 4ACPA 2B5IC 1NAMH 2L3BA 3CHOA 5CD5D 2MPVA 1J10A 3CLWA 1XCXA 4HWZA 3MODH 3SYAA 2P5WD 3LIUA 2R0KL 3EYVA 3QEGH 4XXWC 4CU6A 3ZO0A 4QTFA 2D73A 1WA0X 5F7AA 3KXFB 1G7HB 3AG4B 1Y6MR 4LSQL 4DVBB 1OSPL 1HYRC 5AZEL 5IWLA 5K39B 5IY5B 3CFBB 2N4IA 4GW1B 3GBDA 4UTCA 5KG9B 2JTDA 5DJ0A 5FYLL 3CHSA 4G6ML 4UT9A 4G6JL 4X5PA 1AP2B 1ZTXE 4JJHA 4LCWB 5IJVA 3VWKA 3AT9A 1ITCA 1XGUA 4LCCB 2MRYA 2WNGA 3ULSA 4C4BA 2J1WA 4WFFE 3SYCA 3QXVA 4Q4EA 2JCCB 2R15A 5DEZA 1TCRB 1F6FB 3ATEA 3GBLA 4CU7A 2HVBA 5EV7A 3FC8A 4MCZA 1VGKA 2F74B 4J3WA 2HRHA 4WI5A 2ZOLB 2BSEA 3VYNA 1N3NB 4PJ9A 9PCYA 1F56A 1TZHA 2JI2A 5CJQH 1MEXH 4ODXB 4N0RA 4Z7QF 4JRXD 4Y19E 3F3HA 3MN8A 1BP3B 3IGLA 4YFLF 1NIEA 4MD5A 4K3HA 1KN4H 1UZ6F 3V6OC 1BYNA 4GT0A 4WHYG 4PJ5B 1KZYA 4ZTEA 5I8KH 2GSIA 4N2DA 5HDBB 4MA7H 4GW1A 2YD6A 4FFYL 7FABL 1KDJA 5HBBA 4EN3B 1HEZB 1OGAA 4EZKA 2G5BA 4FLHA 4OZFG 3VXRD 1VPOH 3UBHA 5CWSB 2J72A 3MRHA 4Y1AA 43C9B 4FG4A 1U8JA 3BSGA 2YSSA 3DC0A 3BN9D 1HOCA 3PWPE 4M29A 4NUJA 3CFEA 3DSNA 3TWCL 2C1PB 1RUML 1E4WH 3I85A 3GMLB 4KI5E 1MCNA 3BE1H 1GZPB 3QAZC 4OD1L 2E86A 4TNEA 2FHCA 5EZLA 3T0WA 4IBZA 2YD3A 2OJEA 3CZUB 1SMDA 2LU3A 3FN3A 4GRLC 2DMKA 5A1AA 1ZPUA 2FO8A 2QVFB 2AABL 1NIDA 4AYID 2CKBL 5JR1L 1C7SA 4WENB 2CRYA 2GW5A 4HPYL 1A6WH 3JWDL 4WO4C 1XCTA 1IFHH 5D93C 5B38A 1UA6H 5DYOB 1Z9NA 3LS5H 1CB4A 3SDDA 4ERSL 2DQJH 4UUJB 3ISYA 1RP8A 3LKOA 4S0TD 5CZKA 3SGKA 1FJ1A 3VTAA 5EFIB 3G6JF 3TJHD 3QCTL 4OFPA 3DRQA 5MI0B 1AZVA 3HPJB 1D3CA 1XSOA 5D7JA 2ROXA 5AOJA 4Z3JA 4UT7H 2DYPD 4XPAH 4JY6A 3QQ9D 5FFOA 5K9KB 2F68X 2H47C 4KWUA 2FJGB 1GKOA 4B3EA 4HKZB 5C0NC 3BWAB 5FO7A 2VDNB 3D2UB 1FP5A 1BIIB 1IGJA 3I3BA 1FLRL 2A9MH 2ZX6A 4GRLA 3LRLA 4DN4H 1KJMB 5MHSD 4LLAA 4XP1H 3UIYA 4RGOL 1QLEB 1XH3B 4A7GA 5B38B 1R0AH 5CLYA 1SBSL 2YFNA 2BFVH 3HR6A 1OCWL 4JN1H 2F54D 2KLSA 1SNRA 4MRCA 4A04A 2WC7A 3CPLB 2CMRL 3ARYA 4XBPB 4NHUB 3WIHH 3I50L 4R4ND 1GH7A 3VRIB 2ICWB 1NMCB 5C0FA 2VDQB 1FZOA 5JLZB 3KH3A 1TVBA 4DKAA 4AEFA 1JZ7A 3ULVH 3BQUD 3MV8A 3NPSB 5JPNB 3PWLA 5I8EB 1JFQH 1HDMB 2NY5C 1ZSHA 3UMTA 3MOQA 1GGBL 5EDSA 1G43A 2AQRA 5AKSA 1BF5A 2GKIA 3L4TA 4CBPA 5BS0A 5F3FA 3DNKA 1QTSA 3V4PL 1INEH 5I1EH 2XG4B 4XB8A 4WEEA 4PLKD 1CTMA 3PHQB 3OZKA 1EMTH 1KJ3L 4G7SB 1FO0L 2VN7A 2W0KA 3EOTH 4NZRH 5IQMA 5JORB 1Z6JT 4OCXL 2JVUA 4K3EL 3BD4A 3T0EB 3CX5K 1Q94B 4P3DA 1ND0A 1PY0A 3RWEB 3KPOB 4GEIA 5HHXH 5I9QC 4GQZA 5HDRA 4HKJB 3UROR 4UT6A 4LPUA 4JPKL 2O30A 4A7TA 2VXUL 1G9EA 3KM2A 1JGDB 3I84A 1UD6A 1AQKH 1OTUD 4F9LC 3VXMD 3KBFA 3CK0H 1ACCA 2FEJA 1R47A 3S5YA 4FGMA 4KNTA 3WNOA 5EO1A 3S35L 3N6YA 1U3YA 5IR1B 1NC4D 1U4EA 1ADQL 3U30C 5FKPB 3ZOAA 2HT4D 4M8QA 1RERA 2AJUH 1E9PB 4NM8L 4QOKE 5EN2A 4X5XA 2Z91B 4K3DH 5I1JL 1LEGA 4DKEL 4U7MA 3K7UA 3GWJA 1CPUA 5F3HA 3MFFA 1OAYL 2R29A 4K8RH 3A24A 1MFMA 1VGKB 2F74A 1TUPA 3L9YA 5DJ8A 2XX1A 1Y1DA 1FPTH 1QAWA 4GSXA 4IRZH 1QRNA 4MNQD 1RHFA 3X3GL 3WBDA 4FHJA 3U9UA 5FW7A 2ZF9A 5C07D 3OHMB 4JRWA 1CJYA 1FGVH 3FQWA 4ETQA 2YPVA 1Q8MA 3ELQA 4HPYH 5TF1H 4BXVA 2NXYB 5D6CA 3ZMEA 5D7IF 2X9XA 4AENB 2Y5TA 1OP3H 1MVUA 4Y4KD 4F7EB 1CN4A 1UZGA 3KL3A 4QRTA 1P7QA 2APBA 4QDGA 1ZHBB 1HCZA 4P59H 1U91B 2XPGB 5KYNA 3HPLB 4O2FB 3BLKA 1FFNB 3VDAA 1BQUA 4O9HL 1KIPA 2WXQA 3MV9D 1I1YB 2VJXA 4GH7B 2XZZA 4P9ML 4ELMB 2NY6C 2JCCE 1KEML 2J8UA 2R4RL 1OHQA 5DFVC 1MH5B 2PCPB 3IVKB 2Q3XA 2K7PA 4XNMB 5D2NE 5EC1A 3P9MA 5FECA 1C08B 2PUQT 3EFOA 3ARQA 1HH9A 3VI3B 1HILB 4JN2B 3GTVA 1E43A 4X7DC 2J1YA 4G8GD 4UTBH 3FFCB 3P02A 4P5TA 2XY2A 3CFDB 3VW3L 4DSYA 1AXTL 1OB1B 3E8VA 1QSVA 1EFXB 1NUDA 5IEKB 3IBOA 1YMMD 1YQ2A 1HK6A 3PRZA 1GIGH 5IREA 4QRRD 4TN9A 2AMGA 3C6LA 5ALCH 4CC4A 2IOIA 3E1ZA 3PLYA 3WKMH 1BVLA 3EYFB 4W68A 4JCWA 3OKOB 4D0CA 5DU7A 2HX9A 4JLRA 3ULVE 1E28B 5LAXA 1T22A 1X9LA 4C47A 2QEJA 4MB4A 2Y36L 3KPNB 1MY5A 4HHGA 4UV4L 1JZDC 5JHBA 5EEYA 5FO7B 4JREB 3P4NA 3F7PC 5IQ7L 4PJHF 1KB5B 5L8JB 2AK4E 5K9JL 4DP0X 1D9KA 1IBGH 5FM5M 4H88H 3FB8A 2OMTA 3SO3B 3QYMA 1A5FL 4P8QA 4XZ4A 3L3KA 5I5MA 4AC4A 1U21A 4MAUL 4QMEA 5E4EB 1YUKB 4A6YL 2WXKA 1DVQA 2H6UA 3QJSB 2E75C 4HA1A 4K7FB 4CADA 4C56B 2NY5L 4IIQB 4JHVA 5GJTH 2A6DA 3DX0A 4HS6B 2IDQA 1CE6A 1VERA 2EDWA 5AQ0A 1DANU 5FYKE 3PL6C 1RJZB 32C2B 1OV8A 1IBZA 1A3RH 3FUFA 4AX3A 4F27A 4JHUA 3O2VL 2VLJB 2VR5A 2XWCA 5HDQL 4OJFL 2QV2A 2XVKA 4UAOB 2ZOUA 1NDGA 4TUJB 2C9QA 3UABA 2NYYC 2WLNA 1XGTA 1O9WA 1QZNA 5IHLB 1QUPA 1SJEB 2K45A 2XTJD 4PJ8C 2IANE 3KWXA 5AW8B 4O02L 5JPMC 3UCRA 2CLVA 2D7QA 3O9WD 3IGFA 2NX5D 4K73A 3KBHE 1LEIB 4FLRA 4FQIH 1TXKA 4ZXBA 1TENA 3I75A 5BMFL 3ZUCA 3QORA 5KUMA 1ZT4A 1LNUB 1ZWIA 3SDCC 2F18A 5F96H 4JO8A 4GBXA 2AK1H 4AJ0A 3CFNA 1GJIA 4ZFGL 3GZKA 2BIPA 1CFTB 5MEOA 4M03A 2PR4L 4JFHD 5BZXA 4C8XA 3CX2A 4M9PA 2QSTA 3ZDXB 1Z0NA 3DBXA 1IGIL 1NPNA 4AVKA 5FHBH 5JPNC 2OMNA 4KITB 3D52A 2JB5L 4R8WL 4W9EC 5CIPB 5IWLC 1J8RA 3VXUD 3NG5A 5DQ9A 1TJXA 3MLYH 1A6AA 4KZCA 5C9JB 3GRWL 3FU7A 1E6JH 4OM1H 4PJEA 5F7UA 2XT1B 4UIKL 2VQ4A 1HESA 4A2DA 1M6UA 3MV11 3O6KL 4Q56A 5ANHA 1X3DA 3C2AH 3SBQA 1K8DA 2DJMA 4C59B 1IZJA 3O9WC 2VM9A 1HSAA 3H4HA 2LGNA 3D3VE 5C0BA 5SV3A 3M1CA 3MOBH 4EIGB 1VKXA 2PTTA 3A23A 2VMFA 4MDIA 3VXRA 1PPIA 4J4PD 3VG0L 1A7NH 3E6HA 1C16B 2VXSH 5BQ7B 1E5CA 3MUZ1 5GRYA 4NQVB 1YRKA 4GJTB 4HUVA 5D72H 3EUUA 5IVNA 4JANB 1E8ZA 1I3RB 1NTDA 2EKSA 2H4EA 2J2ZA 3PS6A 5TE6H 3ABKB 2YUWA 2QGEA 2ZF8A 1DR9A 3B9KB 2DWEB 1EXHA 4FZ8H 4XPBL 5J5EA 3Q9PA 4TNGA 1Z0MA 3CN1A 5J1AA 4GMTH 4NUGL 4TSCL 1HH9B 3S3JA 3EKCA 3NDYE 3GPSA 1I1AB 4HUXB 1CMOA 3F12A 5KBDA 3RPIA 1PKQA 4V1DB 4MJJA 1OARH 1FGNH 2Y2YA 1NCGA 2G60L 3WMSA 3NZHH 4XVSL 1QLRA 3B5GA 3EDEA 4HHWA 1MW2A 4UM8A 3WEOA 1MI5D 1RJLA 4XP4H 1AC6A 4WJG3 4XPTL 1JTTA 3KL5A 3VGAB 4X9BA 1RK0A 4JFFE 1USQA 2QVKA 5DGRA 1GOGA 2Y9RT 4ZD3H 3L8QA 2YEZA 4G6MH 1I1AC 3ATBA 3FU0A 4FQJH 3SPHA 4ANWA 3WUWA 1QBLH 2X4RA 1R5WB 3H0TB 3N9GH 4JRYD 4BBWA 3ML9A 3DROA 2HTKC 2VDRB 4K5OA 3Q3GB 3TIDA 5FLUA 1G7IB 4M5YL 2XIIA 3L54A 3OKOA 5IJDC 3HFMH 3VCLB 3JTTB 4NIKB 2NZ9D 4IJ3B 4L4VA 3ECBB 5HJ3B 5CEZH 3QULA 4HEPG 2BPBA 5CGBA 2DQEH 3NSJA 2CMRH 4AGMA 3KPQB 5E4OA 2W95A 4ZMNA 2B59B 3LXAA 3NFNB 4X6FA 1CD0A 1PFCA 5JOFA 4QTIH 2BNQA 1YYLL 1T4WA 4XP5L 1EUUA 1NGXA 3QNZB 4M6NH 4YHLH 3FUDA 1MY7A 4FJYA 4EDWH 1G1OA 3QCVL 2WBJB 5E6IA 4YVUA 5KZCB 4PRBA 3VRLE 4TULL 3C5JB 1KJVB 3T6WA 3QFJB 4H8WH 1JAEA 1PZUB 3BW9A 2A9BA 2FB4L 1M2OA 3TCLB 3ZLQC 4S2SB 3NH7H 1CXHA 3ECBA 3GB7A 1GXEA 3NK3A 4EIBA 3SYQA 4I1NB 4S0SD 3V6FA 1KY7A 3MUHL 4PGDA 1IGCH 2W80C 5EU6E 3W38A 1TQSA 1E5ZA 3JVGA 4FQXB 5HI4D 3TEXA 5CCJA 2MKLC 5D1ZI 5FW6A 5IMMA 5HD8D 1X7QA 2VWEE 3BMWA 4K8RC 2WXNA 5KSUA 3FT2B 1DQDH 1WC7A 4EE2A 4A66A 2HN7B 3OAZK 1N6VA 7FABH 5ADPL 3EH3B 5F0PB 1MRDL 2A74C 2WBJA 5HGDA 5INDA 4H88L 5DHEA 2XV3A 2EVHA 3SDCD 1NEZG 1G9NC 1PU0A 1VESA 1K5WA 3V8OA 2HKFL 1ZDSA 2XZAL 5JOFB 1L9NA 3V0VB 1XH0A 4Q9BA 4UOW1 3O3EB 2HRPL 5DEGB 4HIEB 1ZLUH 2DQUH 3U4EA 5F0LB 2Z93A 1BDYA 1KCKA 1Q90A 1T1XA 2NY1C 2RQ8A 3TJPA 1F0LA 3HTLX 1D7BA 4P23C 1QSFE 5F6IC 2XRAH 1EHLH 2QFPA 1Z2KA 2FGWL 4XI5D 1U8JB 5D71H 1LDSA 4N2OA 1UWYA 3FTXA 1F6LL 1KZQA 3AUVA 4LF3A 4WKZA 2E74C 4AEIH 3ERXA 1A7OH 4DEPB 1VZGA 2UZXB 4HAFA 3VXPA 3MX0A 2ADYA 2PCXA 2AJ3B 3TASA 1U8MA 2GT9B 3TX4A 2VDRH 3IJHB 1WPCA 2YBGA 5JQIB 3CVBA 5EPMB 2HLEB 4ABWA 2YA2A 3S5LG 3ZU8A 2X41A 1GGIL 4MSWA 3K6OA 1P2CB 1E2WA 2J5WA 1E9OA 2WLKA 5BV7B 3HNTL 5MEPA 1T1XB 3D2UD 4GUOA 1F1DA 3MBEA 1IEAB 3QQNA 2BS71 4NRZA 1UC6A 4WHTB 3RBSA 1E7VA 5C0AE 1JZ8A 3B7SA 5D7SL 3VD1A 1B4JL 2L7JA 4GEJA 4JR9L 5FYKH 4F7TA 5B1KA 4G7QB 3OHXA 4ZX3A 2YZ8A 4N0UB 2ARJQ 3JT0A 4TXVB 3LHPH 3VXRE 2CBQA 2VDQH 4RRPM 1WAEA 5LG1A 1TVHB 1WD9A 1M05B 2VC2L 2XV0A 2XZQH 1C5DB 3MRIB 3W2DH 4LSSH 1JYVA 2DYPA 4W9JC 8FABB 3D0LB 1MW1A 2GB2A 2R7EA 2WLLB 3A4FA 4OD3H 4LHUA 4ZUWA 4DGIH 4UNVA 2J71A 5DC0A 5BV7L 3ML8A 1R3KB 3UYOD 5ALCL 2E7LA 3I74A 1D6EA 4Y9GA 5DZNA 5EOQH 4P2OD 1N70A 1YNTF 4HS3B 5DVMA 1MCJA 3MRLA 3PPSA 1TJIL 2EVIA 1BA9A 2GJPA 2NQCA 2IQ9H 3BZFB 1ZA6A 2B15A 3S8WA 2X6MA 5L4FA 1XCQA 5SWZA 2X1WL 4OCYH 2HT2C 3D9AL 3ALPA 2MOGA 1MF2H 3JVGC 1HXMA 4M43H 2X1QA 3BP7A 2Q7AA 4IOFC 3UZQA 3O2DH 2WB1A 4O5LL 4QYOB 1GSKA 2J8HA 1SJHA 4YDJB 3BRGC 4NRYB 1OF2B 3BPNC 3FDWA 4W4OA 4MJ6B 4CW1B 2QSQA 2WO2B 3IMRA 1E5AA 1YN7A 3V9CA 2BIOA 5HY9B 5DHVB 4X0KA 3RJQB 3ZDYF 2IOMA 4O2CB 3TBSA 2AV1B 5J3HC 1EAPA 5E1HB 1E3FA 1HIML 2P8MB 1OANA 3QUZC 3AADB 2VMDA 2VLME 1PD6A 2H0FA 3NEEA 2XPZA 4EOWH 3M45A 2APVA 4Y16D 1BFOA 4KDVA 3TLRA 4URTB 4GMSL 3KPOA 1SLWA 3UBFA 2OTUA 2BFGA 4Q6YA 3UDWA 2R1YB 5IJBC 4JHZA 3IAPA 4BQ9A 4WFGE 2FX9L 2GIXA 2OI9C 4X4KA 2AXGA 4OVVA 4YE4H 5A7BA 2AXFA 3RNKB 1EK3A 1KYDA 4PJ9C 1JMXA 5FYJD 3VYOA 4U1GC 2OYMA 1A6UL 1HHHB 3N1GC 4HQQH 5AYUH 1JS4A 3F65A 3IDNB 1OTUC 2UX7A 2XKNA 4LL9A 3RVVC 4N22A 1NZRA 3G6JB 4LP4A 4PJDE 2AQSA 2YKKA 3HN3A 1BXVA 2FIKB 3VA6A 2WQAA 4PM1A 4DEUA 4ONHB 4FNLH 1X5MA 4XBPA 1NCAL 3MV01 4JFPA 5T5FH 3KGSA 4CJ1A 2XN2A 4ZNEA 1J8KA 7PCYA 1CIUA 2UY6A 4CKVX 1WF5A 2FBOJ 4H1LB 4FTVA 4Y2OB 3UTSA 4DFHA 1MELA 2QV4A 3SPCA 5ECJE 4DPBX 1JL8A 3OPZL 3RA7L 3QUXD 4BK5C 1KV7A 1UJ3A 1IIKA 4WAFA 3VFTB 4AL8L 1ZHLB 2YGOA 1OAUL 2KHAA 1DVZA 3C60B 5TE7L 4XAKE 5E9DD 1NIFA 3DHPA 1DEEA 1RZGB 1OWRM 5F7FA 5IOPA 1SUHA 5ITFB 3D0VB 1OCRB 4LE8A 4GO9A 3AQYA 4H20L 2NQDA 3DUHA 2QSVA 4GXVH 4CBZA 3HPJA 2HLAB 1IVLA 3GPEA 4BFEA 3QEQD 3PJSB 1A4JB 2HRPH 3CVDA 3AY2A 2YAPA 1SM3H 4JFSA 4POZC 3WFZA 3QUHA 2AEIT 5DGQA 2HRGA 3FSZA 3KPSB 1HI6A 1ZVNA 2QZ5A 3OG4B 2GSMB 4P5KB 2FIRT 4FCHA 1A1NA 4EIZC 3MNZA 4OBSA 4QI3A 2WYTA 4GYBA 1ZEAL 1M7DA 3CVCA 3WL9A 1XB8A 1ZV2A 5IIEB 3K4DA 2OR8A 2Z31A 1A6ZA 3LRMA 1XH3A 4L9LC 5J1AB 2ZKHL 3HG0A 2ATKA 5BV7C 1RQ5A 1CT8A 3HE6A 1RMFH 1RURH 3CXHJ 2E47A 3D05A 2DWYA 4HBCL 3TPKA 2HKHL 2X70B 2B2XL 4IBYA 4D0CB 3LSOA 4PGZA 5TDPA 1AZRA 4L29A 3BVWA 4D0BB 5A2FA 5D2LE 2ENSA 3BYTA 1KYAA 3TF4A 2K8QA 3WN5B 4IBQA 1NPUA 1KJ2H 1ZLDA 1MCLA 3DX2A 1TT6A 3QUYC 1CU4H 3S97C 3Q3GA 2W07A 1BD2D 5E1AA 1HHIA 4CSSA 4RGNC 4Y1SA 1QLFA 4JAMA 2RTTA 3FUNA 2IMNA 4I4WA 4F37F 1WFIA 1ZA3A 2J73A 2WVUA 2X53A 2ZWKA 3VG9B 4XHQA 2A7BA 5D1ZC 3JUZA 1S5HA 5A2KH 4NJAL 4XZUB 4DGYL 4NYLB 1HQRB 4MD4B 4F8LA 2PCPA 2O6CA 3IVKA 3O41A 3MCYA 3A67H 3K8KA 4NKOB 2FBRA 5I0XA 1WV7T 4BYHA 5ITBH 4J3SA 5C6TH 3HS0B 3RL1B 4ZMVA 4L48A 1WWCA 1G6RL 4JKKA 4LKCB 1QPXA 4FXGB 2W0FA 1CQKA 3PGCA 4MJHA 4QYOA 4XOEA 3ZO9A 2DWTA 4OAWA 5GISL 1WD8A 3K2UL 1A7PL 5C7ZA 3HI6H 4LFHG 3LH2L 2C3HA 3L3DB 1IGTB 4XWGL 2J6EH 3IT8D 1XFPA 5D9SB 2WWKT 4FFYH 4S0HA 5FR3A 1U8OB 3V9FA 4HCGA 3ZDWA 3BVNA 3CE1A 3ZTJH 3ZQ9A 4BFGA 1BGXH 5ADOH 5F8QC 2HTKD 2QHLA 1N19A 4JN1L 2L4OA 2GC7C 5I19H 5CCKL 2EZ0D 2YD1A 4NENA 4R26H 5CEXB 3O45A 3U9UB 2KS0A 3RGVA 4NZUH 2EYRB 1KOAA 4BUQA 5IJKA 2CR3A 4C55A 5HYJA 1TQCC 1PZDA 2IAMA 4H8HA 5BQDA 3MRBA 2XPYA 3C9NA 5HGHB 4AK2A 5L9DH 3UTPD 3T6ZA 2FO4A 2G2RB 4UM9A 1U3HC 1S7RB 4L3CA 4PRDA 4E9VA 3W1ZA 5HYQB 2FNWA 3EO1B 5I18H 4NEHB 2YK1H 5FLVA 2ODHA 3DOIA 4P49A 4RAVB 3ZRCC 2B14A 2B1HH 2V2TA 1H8NA 3T4AC 2DLFH 4OGZA 4PI0A 4L3EB 3PWNA 2Z7YA 3GFUA 1SRDA 4F9LA 4ZQKB 3EIFA 4C54A 2D0HA 3PE9A 1KBVA 1NMBH 2P49B 4PJIA 2W0LA 4WW2A 1PSKL 2PR9A 1DQDL 4G6FD 2UX6A 1BOYA 4Q74A 4LLQB 4J8RB 1XSIA 2B1AL 4A63A 3QQ3B 1C12B 2CCLA 4PJHB 2IDFA 4L4VE 5HI3C 3VU1A 5KS9E 3D06A 4LAQH 4UAHA 4K07A 1Z3GL 4P2AA 4L5FE 5JPMB 2I9LA 1E6OH 5I26A 5CKAA 3QJVB 4N3TA 3KPPB 4EO5A 4MX7B 3MGTB 2RFXA 5K1NA 2V2TB 3KEDA 4P59L 2BSRA 1SOKA 1ORQB 5ABAA 1OF0A 2YQGA 3GLAA 3OC8A 3BH9B 5I82A 2VW4A 3G9VA 5JW4Q 4K55A 5J13C 3JWOC 3DDGA 4KTYA 2CK0L 4XO5A 5FV2A 1O6SB 1ASOA 3OSVA 1LEGB 4MNGE 2QQNH 1G0YR 1GSMA 2WVVB 3STLA 3NA9L 2Q5BA 5C0JA 15C8H 2NXYC 1UB5B 4A2GA 1T83C 1Y7VA 3EJTA 2WUBL 3G3LA 5DMKB 2CNZA 1KCSH 1OY3B 2YAFA 3DK2A 4JW3A 4ODVL 1WWBX 4QRRA 5BVPL 3BD3A 5KYYB 1Q9WB 1UT2A 1UYWL 4PS8A 5LDSA 4WI0A 3SD5A 4GPVA 4JREC 3D34A 3T3PE 5B39A 1RIUL 1NCOA 1U8HA 1UASA 3EO9L 1OWWA 5TDOA 1AR1B 3U2SB 4JY6B 2MNUA 2VCOA 4M6OL 4OFIA 1IC0A 3FQRA 2BOBB 4LZKA 3V7MA 1CFMA 4OZGF 2WXMA 4OKVA 1QUNA 1XCQB 3ZK0A 4TVPE 3OXRB 4K9EC 3S3DB 1FJ1B 5HHVH 2H1LM 3QQDB 2DLIA 3NJFA 3TYFB 1MFAH 1U8IB 1KPVB 4OH2A 1VENA 4JKWA 3S4SA 3WFEL 4E68A 2J1KA 3EADA 3ZZQA 2GI0A 2XACC 1KLFA 2G5RA 3WHXB 3DETD 2VMJA 4A6YB 4JFDE 5DHYA 5FXCH 4D9QE 4D9LH 3A6BH 3MLZL 3MUGB 4NKDB 4LP8A 3WDJA 2VXTH 1OT4A 3U4BH 2P5EB 3KGTA 2K8MA 1F13A 2YJQA 5JMRA 3NFNA 4KRPC 2G3XA 2ZXAA 5L4MA 4GRWB 2ZICA 5D7LD 1A1OA 1NKOA 4GBXB 1R17A 3RAJL 1QUNB 4N5EC 3X1BA 1TLKA 4Z7WB 2OSWA 2XVBA 3V6FB 3RL1A 3ATFA 4Q14A 4QR7A 1JG9A 3PHSA 5MENE 3TCLA 5K69A 1TJMA 4G42B 4MD4A 1FAIL 1IVTA 4PLNC 5GRUH 3ASOB 3BGFB 4LLDB 3H9YA 3FTWA 5CSZA 3FZUD 1IM9A 4HUUB 3QUMH 3STZA 5I2IB 4GSQA 3FQNA 1P5UA 3O4LE 1T1ZA 2W65B 5KYWB 2A74A 3DETC 3IAQA 1NCNA 1TEGA 3Q01A 4NOFA 5BRPA 1CI5A 2Y3NA 1CFNA 1FC2D 3V5KB 2J8UF 2DQTL 4FL4B 1IEHA 1TPXC 1VADB 3CQPA 4KX9A 5CILH 3IDNA 5AWNL 5A2BA 1KV3A 5JIHA 1BVOA 3BSHA 2WOYA 3O3UN 3UYPB 4C56A 5FYKU 1GS8A 5ETUA 3W3BA 1CE1H 4NXSA 3VMOA 2BSDA 4PWHA 2DLGA 2N3JA 1MCOH 2H32A 2YSTA 4MNQB 5HI4C 5I1DA 3GSOB 2F5AH 5DJZB 2DQJL 1R9FA 2AQ2A 3N9GL 2X4NA 2X5PA 5F1NA 2RAMA 2VSMB 4X0NA 1EO7A 3GMNB 1SEQH 3C6SB 1KFAH 1KY6A 2OLDA 1AZCA 1R5VA 5T1DL 1SJXA 4CN4A 5A6MA 3L2LA 5TQ0H 2BSSA 2H2SD 4HAKA 3MNVA 1S7RA 4L3CB 6CGTA 5HYQA 2XZQL 4CMHB 2J56A 1A6TA 3SBPA 4YO0A 2C5DC 2HJKA 3VVVA 5I5RA 5ID0A 2YEQA 5KSBA 4HCRH 3AREC 4A7VA 2A6KB 3HE7D 2WIIB 2NY1D 1ZDQA 2AK1L 2HH0H 5MEPB 3PHAA 5CWSA 4GUPA 3BRFA 4Q89A 3NGBB 3CU7A 2H2SC 4FFWC 2APXA 5I8OL 5SX5K 4JHWL 4J3OD 4M9OA 4V1DA 4UOJA 1IC5L 4HWZB 3MLRL 4OFYA 5JIKA 1KTLA 7TAAA 3IDJA 4KFMA 2P5WE 1NMAL 4M8RA 4ODWB 4C83A 1G7PB 2EIBA 1U2HA 1EZSA 5CZVH 1AOZA 1MREH 3MR9B 1IGYB 2QBWA 3N85L 4MHHI 5DJ6B 4KNSA 3DPDA 4X6EB 1QSFD 5BZDB 3QR2A 3DXAA 3MNZB 4LL4A 2A73A 2UVEA 1GYAA 3FQ1A 3R0MA 1SYSA 4ELDA 4KH2A 1JCVA 3GSVA 1H5BB 5IHUH 4KHXL 1QSEA 3BEWB 4QRSA 4NN5C 5KS9A 4FS0A 2M2DA 3STLB 3WOVA 4DQOL 4GG6E 3GSXA 3HG1E 3ZGHA 2LQRA 1BFVH 2GTWA 1JGIA 2DQDL 1FH5H 2CHDA 3SY6A 1JZIA 2BWIA 2QQKL 3EOAA 2L7EA 3QO0A 4TV3A 2PTUA 5DF0A 1CDIA 3QULB 4IRJA 4PBVC 3AZUA 5BJTB 4OZHB 1X5YA 2D4FA 1A1MA 1CGWA 2BNQE 3BH4A 2E7DA 5BW7A 5ACMA 4IBSA 5C0AD 1T80A 4BE6A 1FHGA 1FCGA 3L4UA 4F8QA 4F93B 3BD5A 2ZUUA 4EI5A 4LDEB 4Z9KB 2BP5M 4W9ZA 3KBPA 4IHOB 1YN6A 4XI5C 4MWFB 4MJ6A 4CW1A 5L0QB 4ZNEE 4YUEL 2WZ6A 1HH6A 1K4CB 3ULUF 2D3JA 4FMFA 4FTVE 1KIRA 4E5XA 2VOTA 4RWYH 4P07A 3U2SA 5DJYB 1SXBA 3AXLB 2DIBA 5ABDE 3ISRA 3QWRA 1LVEA 5HYSB 3BFOA 1MHPH 2WYIA 4HX1A 2WZPD 5KN5A 2FR4A 1GOHA 1LO2L 4K15A 2LV4A 1T0OA 3TNMB 4DGYH 2H9GA 3RPIB 4WHCA 3FNKA 4PR5B 3CMGA 5IKCA 1CF8L 3DHJA 5FV1L 1N8ZA 1JI2A 1TEYA 5IUSA 3MRPB 4ICWA 2EDQA 3RVTD 2DQIH 3U2JA 4F2MB 4GXFA 2G5UA 5L2KB 2JK5A 3OR7A 2WINB 1IQWH 3H3PH 4HFUH 1JHTB 2F8VA 1JI1A 1UKSA 2WLYA 5F1IB 1KCVL 5F3BB 3H9SB 4Z7QE 3ZYIA 5J0BA 3O11A 5T33H 4BH7A 1AG6A 4D7BA 4JCLA 1AP2A 1FFQA 1IILE 2G4EA 3N55A 3WXWL 4R7XA 1DFBH 2FATH 2GUOB 2QTVA 4Y88A 3WLBB 2GJZA 1QWHA 3DYPA 4OIBA 4ZTPH 3MRLB 3UG5A 1BCIA 3IXAA 2V6HA 5JXAH 3HJ0A 2FX7H 5TPWH 2BVTA 3BZEA 5KAQG 2PCFB 3SZ6A 5EZPA 1JK9A 1YEKH 3GI9L 4PJEE 1SFDA 5JIDA 1MXGA 1EEYB 3FL7A 2ARWA 5D2LA 4CVZA 3CUPB 1RZ8A 1AFVL 1QW9A 1D5IH 5MENA 1NDMB 3E8UL 4PJIB 4WW2B 5M95B 3LPGA 2EECA 4JNXA 5C0AA 2BMKB 2C3XA 3BP6B 2F15A 3FHQA 3VGGA 1JNNL 2XFXA 4N68A 4Z7VA 3C09C 3BWZA 1T21B 4HIQA 1O7DE 2RALA 3ZYZA 4X8JB 3TYGH 4HCRA 2ENJA 2BNUA 3LNFA 4ORZC 4UDUA 1HQ4A 5FYJE 1CDGA 5DUPL 2VSKB 3VFRB 1JTOA 3FYIB 3JV5A 5EZOL 2E7LC 1BPLB 4YDLC 2ZYRA 3OF6D 3PWUA 4KKBD 3EJUA 3K0YA 2X40A 3CFJA 4JGMA 3WIFB 1EEZA 1O9VA 1PTZA 1TTAA 3IU4L 4MNHA 4PJBF 3K4AA 5I15H 3OM3B 3IJYA 4W9KC 1DSWA 5AB9A 3PGFL 1L6PA 3FQYA 1HN1A 5C92A 2WIIA 2BW5A 1NGPL 1R5IB 3DUUA 4LHUB 3DURA 2YPLD 4ZUWB 2XQYG 5E6UB 2ZQKA 2AI0H 4GMSH 2EE3A 1EHAA 4F7CA 3REWB 4RIRA 1SDAB 4LSQH 1KPRA 2BNRB 1YEJL 4ODTH 1INDH 1TETL 1ZTMA 3QWQB 3ZZ1A 1OAKH 4UBDD 1FIGL 2J43A 5AVXB 3J7HA 4WHDA 1OPGH 1JERA 2A73B 2Y1AA 5IMLA 3L3HA 5TDNA 4ZX4A 3T5WA 4ENEC 4LSVL 4WTZG 2ZYSA 3RX8A 5EBWB 3G08A 4JPVL 1T0NB 4LKXA 5ISZE 1HHKA 2JKXA 4HQQL 3IK2A 2FX8H 3NN8A 3I9GH 3DJRA 3WNIA 3MV8D 4KRPD 4RFNC 2HWZH 3LAFA 2IANB 3L3JB 3NIGF 4GG8A 4HWEL 4BFBD 4EBQL 4EQ3A 3RX9A 4XNZC 1LWJA 3SDAD 4PREA 2IOOA 3FO0H 1ILUA 4NQDB 3H1ZA 5IQNA 3KNBB 4LCUB 2J3SA 1LYQA 2HTLD 2HYMA 2ICWJ 1HOEA 2OMVA 3PAVA 3ARFA 4XH2B 1NGQL 4PY8J 6PCYA 3S5ZA 2E27H 4JFEE 2UZYA 1QVOA 2BSBA 1M7IB 3QXTA 1FO0A 4M7LT 3VYPA 1WZ1L 3RBGA 1DL7L 5I73B 5CXPA 2FYVA 5IW6B 2MIZA 2HG0A 4JZJA 3L2NA 4NAMA 1YEDA 4KXDA 1MG2C 3KLAB 4JK0D 1NIAA 1OW0A 1KTDB 1FDLH 4CNIB 2XWJA 3V4PA 1GS7A 4KXZI 4QAMB 4PGCB 1F4WL 1OGTA 3GTNA 4I85A 4JFYA 4RAUB 2Q8AL 3F84A 1KBGL 1ZLWK 2XWTB 4PQXA 4P2CG 4MZ3A 3X12A 1YEHL 5ICZA 3H0TA 4MCNA 4AUUA 5T1MB 1TQVA 1JV2A 2D4DA 3QORC 2B3IA 3GK8H 3OF6A 4LCWA 1RJYB 3IMVA 3DO3A 3MLXH 5GGTH 3ZDZE 3TS8A 4N2EA 2VZ3A 4PG2A 2NXZC 3SQOH 5EULV 1LK3H 3L1GA 4WTXA 3LKNB 2GITB 3I2CH 4RMSA 3BXNB 3RWDA 2F9BT 4KQ4H 1INEL 5I1EL 4LBEA 2BY1A 4KHTH 2ZSVB 3UPAA 2GVYA 3AREA 5C71A 2DJSA 1VZHA 5I6LA 4R97C 3IDIA 5CLXA 5EWIH 3LMJH 3KYOB 2PO6C 2OMZA 1OTTD 2VDKL 3F5WA 1NL0H 3BW9B 1U3HA 2VDPL 3FFCE 3QO1A 4PJCE 2IFFH 3SKJL 3ZE1B 3MCKA 2GABA 2YBRA 1NGPH 3IXTA 5E00B 4AQ1C 4P48A 4H2AA 1PSKH 5AYQA 2YRZA 4HOWA 1DDTA 4YR6B 1YMME 5E8PA 4V2CB 3B1UA 1NJ9A 3L7EB 4GQQA 1RUPL 1YEWA 3GSNL 4G8FA 2P8PA 2XJKA 4MS8C 5LBVA 1HHIB 1UJ3B 5CSGA 4QCIB 2A77H 3DSFL 5FM4A 5IVXA 1FL3A 1S78C 2VGLM 4X4YB 1KN2L 2OTWB 3SDXA 3VWJD 3IGUA 2FSDA 4PPTA 1IO4C 3A5VA 3KL0A 4X0KB 1BHGA 1NSNH 4HUKB 5BVJB 3LRHA 5I76B 3TO4D 3BVDB 1P84K 4F8OA 3H6AA 3Q2WA 2XBZA 5BVPH 5FOJA 5L6YH 5DRZA 4XPAL 2HSIA 4Z3EA 4ZBJA 3Q7JA 1ORQA 1TVDA 3RJDA 1GZHC 3WJJA 3NJGA 4JKPH 1QQDA 2ROYA 4ELKB 3TT1H 2F53D 4W9HC 1RD6A 2XICA 4MMXC 3QO1B 1D7FA 2E6JA 2DD8L 4JFVA 3RZCA 1Q38A 2G0KA 5ENWA 1KBPA 3II2A 1QA9B 5DEGA 3BAEL 4HGMA 4GAJL 3VFWB 4JBSA 5DYOA 2EKSB 2J5LC 5E51A 4K2UH 3TV3L 3IF1B 1CGYA 2YAHA 4HUWB 5E99L 3MKGA 3MRNB 3V52L 1YPZE 4FRWA 5D1QE 2YC1B 3RZWA 3WXWH 2W9DL 1UCBL 4OM0H 3NYKA 4ZFOB 2IAND 1RUAL 4D9LL 3NSFA 5D70L 3VGAC 3QFGA 3WEXA 4R0LC 2GIYA 2XXGA 5F7EH 4BKSC 1X4XA 4U1MA 1P4IL 4APQD 2FH6A 1JSYA 1VHPA 4L4VD 1YO4A 1MCEA 2QADC 2W07B 2OZNA 3MC0A 3QIUA 4H4NA 2WVSA 1UXMA 3VXTA 3P3RA 2Z91A 2NY0B 2OX5B 2FZ3A 2ZKMX 4KXAA 4DZ8A 4HKXB 5D7EA 3SB3A 5IHZA 3MRHB 4Y1AB 3UAFA 4JFHE 4M43L 4MA7L 1B2WL 4GAGH 3CDCA 4JM4H 1IKFH 3TPUB 3GS0A 4OSUL 3GMRA 3LX9A 2BERA 3LN5A 3DV6B 4Z7UB 2EDHA 3B9AA 4CSPA 3HZKA 4FXKA 1OO2A 1PL3A 4KJQD 3GGWB 2OSYA 3BKJL 2KDGA 3MO1A 4XH2A 4Y2DC 5EOQL 2XWBA 2PXYA 1MQKL 1I1CA 1M53A 4NBZB 1YLBB 2G4GA 4WIQA 5TTRA 2EO7A 2R7EB 2WQUA 5IVXF 5HJ3A 4HKXA 1MJ8L 2ARJA 3BEVB 2NW2A 2QADD 1AHWA 4K94H 1Z9MA 1BFSA 2H3KA 1JPGB 4MQSB 1TFPA 1B0WA 5HHOA 5HXMA 3ZDYB 4FABH 3QIUB 2ZOTA 4PV8A 2EH8H 5GRJH 3VNYA 2V7HA 3IFPB 3TBTA 1N0LB 1JMZA 1DSFL 4DJMA 3MA9L 2YPKA 4WSKA 3AU0A 5IMOA 1P5VB 4NC0B 3U0TA 3L4YA 3P54A 4HMCA 4ANXA 3F58L 3VGDA 1ONQA 3LQAH 1ETZB 2ALWA 1H6UA 4P9HC 4APQA 1VF5C 3EHBD 5CD3B 1XMWA 2WO3B 4KTDH 1ZVSA 4U1HA 4BH7B 4WO4D 1GGTA 4B0MB 4R90L 2YPLA 3BCDA 4H8QA 4OQTA 4LIQH 2WINA 4JDZA 2A4ZA 4JKNA 3C8DA 4UT6H 1A7QL 2FJSA 4D0DB 1CQYA 4AZUA 1ZGLM 3GB7B 5HVHC 3W9DA 2EUWA 1KBGH 5D7LE 1D5BB 1E4JA 1KNOB 2WCGA 4XP9L 4F15C 4PLJD 5TF0A 1GTFA 4LKCA 3G5YA 3UBXI 2IALB 4NAQA 1MI5E 3ARXA 2OMUB 4Z7QB 3DGCR 4I5BA 3MLTB 4PV1C 2KYIA 4KOBA 1NDMA 4KK6D 4X6CE 5FO8B 1Z9LA 2Z8SA 5FA3A 5L2KE 3HNSL 4JDVB 4P3CH 5EMYA 1X6NA 2LVCA 3QCUL 4R5VA 1TZGH 4IIQC 5TGBA 1P6FA 1B2YA 4CMMB 3G6AB 2F19L 4X5WB 4HS6A 3P4LA 1AJ7L 4L37B 5C0CA 3NCFB 2F7IA 2G75A 1IEBA 1I9IL 2IEPA 2PPAA 3T0ED 1ZXQA 5GGUB 3WSQL 4PJBA 2LW3A 2ICCA 1KTKE 3G5YB 3QRBA 1KT2B 2VN3A 3QNYA 3TO4C 2D7TH 3PGDB 1B0GB 1JFQL 2K78A 3G5VB 4OLZH 2CO6B 1RUPH 4YH6A 3QWRD 3ZE0E 3PPEA 4B41A 3HMWH 5I1GL 5FO9B 4R5TA 4MB3A 3DJZA 3O3BA 3TTSA 2BXYA 3C5ZB 3HOGA 3SDXE 1BW8A 3MRBB 5HGHA 4EDXA 4HAGA 2VDPH 3ABZA 4PUBL 2R4SH 2YMXH 2X7LA 4J3OG 1KEGH 5EEWA 5KEZA 1A8ZA 2WTOA 4FFWD 5FA3B 5F93C 4LLMA 4EN3A 3QT2A 1YY9C 3MA9H 1NCDL 4Z6AT 3EO0A 5A6IA 1KXTB 1U3JA 4E9SA 3R1GL 4YX2H 1D5XA 4W9CC 4ZS7L 3GUTB 2R2CA 5DZLA 3EOBA 1A22B 2OMYB 4BUGA 3BO8B 5HDQH 1JGVL 4KKAD 4TM9A 3WELA 3ROLB 4LOEA 3ZJAA 2DH2A 4ETYA 2I7OA 1A02N 2C1OB 4L1TA 5LCVH 4ZAKA 2A5UA 4N90E 3G5XB 3DROB 1OM3L 1MXDA 1BPVA 1UWFA 3C08H 2J8UB 4P2RB 4LCVA 5CO1A 4FMKA 4BK8A 4MZIA 5JXEA 3VFUB 5DJDA 3IGAA 4BCYA 1ECYA 5DMIH 4G3YH 1R5WA 2NR6C 1DP0A 5AYUL 1JNLL 5BNXD 5I0ZA 3VDBA 4FEMA 3BSZA 3CSYA 3AXIA 3T65A 4PV9A 3T4YB 2FNBA 5GZOD 4ODBD 5D7IA 4GI8A 4Y2LA 1OB0A 1P4LB 1JPST 1WFMA 3IN0A 2J6EL 4YBQC 3HBGA 3SBWC 2QPEB 3KJ4C 5F71A 2UY7A 3B8SA 4KZDH 1DBKH 4LMQE 2JQAA 3V4PH 4ZMQA 3WN5A 1TZ8A 3PWVB 4PJGF 4NSKA 1XO8A 2BCKA 3VD9A 1N59A 4DN3H 4M6ML 1HQRA 4G3YL 5F1OB 4NNXA 1SXNA 1E28A 4A2MA 1SJMA 3FRUA 1U8LA 1MCQA 3ARDA 1DBBL 5JPNA 1RUMH 4NFBA 5B3JF 4Y2NA 1RJCA 5J57B 4X98B 5FUOL 4F15B 4EZJA 4NHUA 2WLJA 4P4RB 4HZLA 3IRZA 4F7PB 1IBYA 1I75A 1QMUA 3AM8C 1IIIA 1OK0A 3JTSB 35C8H 5D5MA 1Q9KA 3P3UA 1B4TA 3WU1A 3V7AE 3II3A 4O5LH 2HMID 5DS8B 5IEHB 4PJAF 1G9HA 1CK0L 5DVPA 3ZHNA 4YS4A 5BS0B 2DEXX 1KELL 3IXTB 5E00A 2ZP8A 5LXGH 2Y25A 3K81A 1NBQA 3BUPA 3LNGA 4MDIB 4GLRH 3FSWA 1UTDA 4TLTA 2B7DT 4UTAL 4R7NB 3A4DA 3GXDA 4X8CA 5IROA 5CJXA 5MENB 1FE8L 4KNQA 1HHJA 4NC1E 3AFLA 3I6SA 4QOKA 1DBAL 3CVHH 4HFWB 3WS3B 4NBXB 4KH9A 1AGFB 3M86A 3RWCB 4J3TA 1F02I 1I8UA 4B7IA 1J9RA 5FHBL 5TQ2H 1I1FB 2ZX5A 1RZPA 4IM8A 1EPFA 2ZE0A 2ZUVA 2IF7A 1XWVA 3I6LD 4E41B 5CEZD 4KVNH 5JMOC 4ELMF 1P2CA 4PRIE 3ENEA 1P7KB 2NCEA 3KXFD 2V5MA 4OJDH 4OZGA 1ORSA 1NAML 4M5TA 3QEUB 5SWQB 1KGIA 2I26N 4ZXBB 5I6MA 3F01A 3TIEB 1K85A 4UCFA 2HCZX 4GINA 4YDNA 1WE5A 2R56L 4U6YA 5DJ8B 4NIYE 3T0VA 3TH2T 1F4XL 3WENA 2AJXH 1IARB 4QGYA 4APQC 3S96B 4BH8A 2I9TB 3O3BB 5G5DB 5A6LA 5FDWA 3EJZC 2FH8A 1RV6X 43C9A 2V3FA 1S6NA 4OR1A 5I73C 3D4CA 4YC2C 2Z1KA 5SWZD 4NC2B 2V2XB 5CZVL 2OCJA 1EERB 1VEMA 3QIBC 4B27A 1VFUA 4HMEA 1JZJA 2XVGA 3QIUD 1ZHBA 5J6GB 3PIQA 3IPBA 4FQ1H 4Z7OE 3MNWB 2UWEB 3BKYL 1UWEL 3L95A 4Q2ZB 4EUPB 3VX1A 1SOXA 4N4YB 3FH8A 1LQBC 2KKQA 5DK0B 2N01B 4HLJA 2E9JA 3E9UA 4E5XB 1RULL 4KJWD 1NBYB 1HXKA 4IBUA 1Y6NR 3V5HB 1Z5LA 4IRSB 3TP4A 3Q05A 2C7FA 5GJSH 2QHRH 4LPVA 3SJVB 1OE2A 4MNGB 4WV1A 4G43B 4GKZB 3BUTA 3QISA 2DIEA 3E8UH 5I6NA 1G9NL 1GRWA 4AYDC 3GJFB 3AMLA 4WGKA 2RCSL 5J12B 1GZQB 4E9LA 1XD0A 3GS4A 4NZFA 5DK2B 3KPRD 4Y0GA 4N87A 5TDOB 2G60H 4LF3B 4MFHA 4PRPA 3LKQB 2I5YH 1ZS8B 4AV4A 2BY0A 1N8ZB 2WVTA 5I66B 4FXKB 1IE5A 5CKGA 4HOMA 3LV3B 3NACH 4WI0B 1XR9A 4MNHB 1MFBH 1SJVA 2ED9A 3IFNH 1EX0A 2ZXGA 1HL8A 1F58H 2CUMA 3WUWG 4R5XA 2QL1A 4KQ0A 1CZ8L 4YZFE 3OZLA 2IIJA 1PG7W 4GIPD 5J56B 2VLKD 1KTJA 1VFOA 4IGBD 4EPSA 4NAJA 3V5DA 4JZOA 1AGCB 4FNSA 3ZIYA 1NDTA 5BRZD 2H2PC 2X4QB 3L9RA 4HBCH 5IT2H 1JE6A 4TRPH 1EANA 1TTGA 3ARGD 4I3RL 5FA4B 4HIJA 3TZVC 3W0WB 5IB2A 3PF2A 1JUFA 4MMZC 4FAAB 4R3SB 4ZS6C 3SKNA 3ILQD 5K5YA 3U7AA 2CIIA 5GGVY 2YLKA 1W15A 3FT2A 4M48L 4XAWL 3K2IA 3VFMA 1GS6X 2WBJC 2V4LA 5DJCB 2Z8RA 3CDZB 3FH7A 4BSWA 4KOCA 3OLEA 2IGFL 2P5EA 2YPVH 3CH1B 2XTLA 4UBDC 2MCAA 5FUCC 3U79A 4LSRL 2Z7UA 3N42F 4D8PB 2BDNH 3F5WB 2WLMA