3FU9A

Melanocarpus albomyces laccase crystal soaked (20 min) with 2,6-dimethoxyphenol
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
559
structure length
559
Chain Sequence
b'EPTCNTPSNRACWSDGFDINTDYEVSTPDTGVTQSYVFNLTEVDNWMGPDGVVKEKVMLINGNIMGPNIVANWGDTVEVTVINNLVTNGTSIHWHGIHQKDTNLHDGANGVTECPIPPKGGQRTYRWRARQYGTSWYHSHFSAQYGNGVVGTIQINGPASLPYDIDLGVFPITDYYYRAADDLVHFTQNNAPPFSDNVLINGTAVNPNTGEGQYANVTLTPGKRHRLRILNTSTENHFQVSLVNHTMTVIAADMVPVNAMTVDSLFLAVGQRYDVVIDASRAPDNYWFNVTFGGQAACGGSLNPHPAAIFHYAGAPGGLPTDEGTPPVDHQCLDTLDVRPVVPRSVPVNSFVKRPDNTLPVALDLTGTPLFVWKVNGSDINVDWGKPIIDYILTGNTSYPVSDNIVQVDAVDQWTYWLIENDPEGPFSLPHPMHLHGHDFLVLGRSPDVPAASQQRFVFDPAVDLARLNGDNPPRRDTTMLPAGGWLLLAFRTDNPGAWLFHCHIAWHVSGGLSVDFLERPADLRQRISQEDEDDFNRVCDEWRAYWPTNPYPKIDSGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase-1
molecule tags Oxidoreductase
source organism Melanocarpus albomyces
publication title Structure-Function Studies of a Melanocarpus albomyces Laccase Suggest a Pathway for Oxidation of Phenolic Compounds.
pubmed doi rcsb
total genus 166
structure length 559
sequence length 559
chains with identical sequence B
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2009-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu9A01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu9A02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3fu9A03
4YVUA 2DWTA 2P80D 2PCFA 1BYOA 1GW0A 1RCYA 2HRGA 1KBWA 1PY0A 3EF4A 3UAEA 1AR1B 1E65A 3S3DB 1N68A 1PZCA 2NRDA 2VMJA 1CYWA 3NSYA 4G7RB 1IBZA 1NIDA 2R7EA 4HCIA 2QPEB 1YLBB 3JTBA 2EILB 2BW4A 1ASQA 4DPCX 1JXGA 2H47C 4GP5B 5TK2A 1HAWA 1ET5A 1J9SA 1GY1A 4BWWA 2H3XC 1ZDQA 4A2DA 1OCCB 2FQEA 1JZEA 1WAEA 1X9RA 2B08A 1IBYA 2XLLA 3FU7B 1ZIAA 1ET7A 2W8CA 4N8UA 4YL4A 2FQGA 3IBOA 1AQ8A 3EH3B 1J9QA 2IDUA 3NP3A 4JKNA 6PAZA 3NSFA 4WTQA 6PCYA 2RACA 5B1JC 1SF5A 3CZUB 5LDUA 2YQBA 4CSZA 1AZRA 2BWDA 1OCOB 4BWUA 2HX8A 4HALA 2PP9A 4DP8X 4YSUA 3FSWA 2DWSA 1AZNA 2AFNA 3ZBMA 3N55A 3PCYA 4BXSV 2IDSA 3T6VA 1N70A 1WA0X 2PCYA 1M56B 3CDZB 2XVBA 4BK5C 1TEGA 5PCYA 3SQRA 3KW7A 2AZUA 3FYIB 3PXLA 4A68A 1A65A 1FA4A 3TBCA 1OF0A 2BZCA 5I6NA 4E9YA 1EZLA 2PPCA 3NJKA 5I28A 3OM3B 3S8FB 3T6XA 1PLCA 1XB3A 3OMIB 1J5CA 3DTUB 4Q89A 3WIAA 2Q9OA 2XXGA 1SFDA 2XWZA 1M9WA 1E67A 2UXGA 4DP5X 4YSAA 1URIA 4NERA 1OCRB 3S3BB 1GS8A 2BP0B 4X4KA 3TA4D 4E9QA 2TSBA 1CUOA 3DIVA 1ILSA 4KO5A 3TASA 4HCFA 3NSCA 4A2EA 2OCCB 3FQ2A 5B1KA 1F56A 2X87A 3AY2A 3X1GA 1J5DA 1NWPA 2BHFA 1HFUA 3FQYA 3NJHA 3AG1B 3NJNA 1I53A 4AKPA 2P80A 4HAKA 4E9VA 4DP6X 1BXUA 2EIJB 5I6MA 1OE2A 2HRHA 1NIAA 1JVOA 3UACA 1ZV2A 2B3IA 5B1BB 4KOCA 1AG6A 5I6LA 3AW5A 7PCYA 3D12B 2YAOA 1MZYA 7PAZA 1T5KA 2XX1A 1QNIA 3RYMA 3G5WA 1BQRA 3AG4B 3ABLB 3X2QB 1BEXA 1V55B 1W6LA 3QJVB 1A3ZA 1GY2A 2N0MA 1AS6A 2QT6A 3FU9A 2IWFA 2YXVA 4M4RB 4ENZA 4UAHA 2AANA 4KNUA 4GYBA 2I7OA 4N4YB 3T71A 2TSAA 2BP0A 1SHWA 1PCSA 4DP2X 3OMNB 2IDQA 3H4FA 4FA7B 4DP9X 5B3SB 1JZIA 4ZK8A 2ZONA 1AIZA 2CALA 4GP8B 1PLAA 3U25A 1BAWA 2CJ3A 2UXFA 1A4CA 3NYKA 4A66A 2MRYA 2UX6A 3QJTB 5D4HA 3V9EA 4CSPA 2EIKB 4P5SA 4A2HA 2XV0A 2UXTA 1L9QA 4HHWA 1QLEB 2VW6A 3S3CB 4G7SB 3PLYA 1NINA 2ZWNA 3ZX1A 2AZAA 5B1AB 3EH5B 4A2FA 4YVNA 2J56A 1TEFA 2LLNA 2PPDA 3QJSB 5I5MA 2HX7A 3ERXA 3JT2A 2QDWA 2GHZA 3PAZA 5I26A 2FT8A 3GYRA 2AVFA 3FU8A 5EHFA 4PCYA 3NJJA 2YAHA 3FS9A 1JZJA 1ILUA 3N2JA 4P5RA 4KNSA 3OMAB 4AZUA 2CAKA 3X1BA 3IN0A 1DZ0A 4HIPA 3T9WA 4JHUA 1R1CA 3NJLA 5I5IA 2UXVA 4YSPA 3L45A 2FT6A 3FU7A 2ZOOA 2BZ7A 1L9RA 4GP4B 3KW8A 5I6KA 4W1TA 2BP8B 1IUZA 4BDVB 1RZPA 1EHKB 2VN3A 1RZQA 2CBPA 1RKRA 1JZGA 3EH4B 1ETJA 1AS8A 2BP8A 1AZUA 4MFHA 9PCYA 1A4BA 2CUAA 4YSDA 3NSDA 1CYXA 1B3IA 3BVDB 1PZBA 3UGEA 2IDFA 3ASNB 3SBRA 1MG3C 4KOBA 1GS6X 4PAZA 1XMEB 1SF3A 5F7BA 2GC7C 2WSDA 2FNWA 3MX0B 5IY5B 3OD3A 4UANA 1ZPUA 5A7EA 3IE9A 2VSMB 5D4JA 4QLWA 4KO6A 1WA2X 2GBAA 1MG2C 2HXAA 1JVLA 4G70B 1BXAA 1SDDB 1PMYA 4JHVA 1GYCA 2VW4A 2QPDB 2W88A 2OJ1A 2PPEA 2DYSB 1AAJA 1VLXA 5B7EA 2VW7A 3QJRB 3WKPA 3WNIA 2YAQA 1X9UA 8PAZA 2YARA 2YXWA 3GDCA 4AKOA 1PZAA 5F7AA 5B7FA 1PF3A 1JZFA 2WO3B 3CDZA 4BDVA 2MTAA 4E9SA 3NP4A 3T6ZA 1E5ZA 3ABMB 1GSKA 2PP7A 2H5UA 3ASOB 5B1JA 2CCWA 3PPSA 3NJFA 2HX9A 1KYAA 3WKQA 4F7KA 3NJIA 3FPXA 3DKHA 1SJMA 2XU9A 1ASPA 3ZIYA 2DY2A 3WG7B 4YSCA 1TKWA 2BWIA 3AG3B 1E30A 3PAVA 3X1FA 1AACA 4G7QB 2JXMA 3FPYA 1GS7A 1BYPA 2HLEB 1PAZA 4HCGA 1KDJA 3FT0A 3V9CA 1KGYE 4DPBX 3FSZA 4DP1X 4FAAB 3FSVA 1ID2A 1TU2A 4GXFA 4E9RA 2PPFA 2ZXWB 1M57B 2FWLB 1NPNA 1PNCA 3ABGA 1IC0A 1ZIBA 4NB7A 4TXVB 4UF7C 4A2GA 3NJGA 1J9RA 1KCBA 3H4HA 3S8GB 4NAJA 1JXDA 5I6PA 1ADWA 1ASOA 4DP0X 2E86A 3PAUA 1AOZA 2JKWA 3BQVA 3TU6A 2XV3A 2IH8A 2QDVA 1JXFA 3CVBA 3UAAA 2VM3A 1A4AA 1CC3A 1J9TA 2IAAC 3UADA 1ET8A 1PLBA 1V54B 4G71B 1L9OA 4WKXA 3CG8A 1W6WA 1NIFA 2I7SA 2J5WA 4YSEA 1A8ZA 4KO9A 2GI0A 2I85A 2J57A 4K9JA 1JZHA 2Q5BA 2Y69B 2IH9A 3FYEB 1W8EA 1KV7A 2FTAA 3T6WA 4KO7A 2OV0A 3SBPA 1V10A 1NDTA 1OV8A 1SHXA 1KBVA 2BW5A 2XYBA 4G72B 1NIBA 3NT0A 1MZZA 3HB3B 1DYZA 4BWTA 1AS7A 4F2FA 3OQRA 2FQFA 2Y1AA 1ZDSA 2J55A 3QJQB 3SBQA 3WI9A 3WNJA 1L9PA 3FSAA 2XV2A 3IEAA 4EF3A 1MDAA 1FWXA 3FQ1A 3X1EA 2GC4C 1E5YA 1NIEA 4AX3A 4GY4A 1HAUA 1OOWA 2PLTA 2JFCA 2GB2A 2A3TA 1BQ5A 2BO0A 4W9ZA 2XXFA 1SNRA 4E9XA 2DYRB 5AZUA 1OE1A 4HHGA 4M3HA 2R7EB 5TK4A 2WO2B 1NTDA 1KCWA 5AFAA 3CVDA 1PNDA 2EIMB 4QKTA 2YAFA 1OCZB 2XUWA 5I5JA 3QJUB 4YSSA 1FFTB 1WS7A 1WS8A 4YSTA 1NWOA 5FC9A 3ZDWA 4AI7A 2FJSA 1IKOP 4Q8BA 4DP4X 5B7MA 2FQDA 2GSMB 2YAEA 4BXVA 2IDTA 1SFHA 2HZHA 4YSQA 1AG0A 2X88A 5AKRA 3NJMA 5E9NA 2VSKB 1WA1X 2EINB 5I6OA 1NPJA 1JOIA 1AZCA 2UX7A 4DP7X 5D4IA 3QQXA 4DPAX 1XB8A 5PAZA 3QPKA 2FT7A 3EHBB 2VM4A 3MBWB 1AZBA 1QHQA 3HEIB 1BXVA 2YAPA 3GXUB 3X1NA 4RH4A 1BQKA 3H56A 3IN2A 1AANA 3AZUA 1JERA 2GIMA 3C75A 3TBBA 2PPAA 2IWEA 1GR7A 1KDIA 2YAMA 4HZ1A 1CURA 1OE3A 2XX0A 4L0PB 4E9WA 3UABA 4F2EA 1NICA 5ANHA 4E9TA 4A67A 2PP8A 4YSRA 3ABKB 2IWKA 4KNTA 1L9TA 1XB6A 1SDDA 1L9SA 3AG2B 4YSOA 1NZRA 4AKQA 3CVCA 2DV6A 1UATA
chains in the Genus database with same CATH superfamily
4UOW0 1BGXH 5C0DA 4UYQA 3QUXB 4IJTA 3QIBB 1YUHB 1PTZA 1KBWA 2F6AA 4DK6A 1NEPA 3NEXA 5I1LB 4U6YA 3HHSA 1KJ2B 4G7RB 3RY6A 1XIWD 1LEIB 1P84J 5E4OA 1YN6A 1KYOJ 3HJEA 1PPIA 2YPLB 4MZIA 1CFVL 2XFXB 1OSZA 1TSHA 3RQ3A 2V7NA 5DRZB 1FFNB 3EO1A 4QOKB 2VRAA 1IM3D 3ARTA 4GKNB 5IM7A 1MFMA 1EXUB 1OB0A 2AXGA 3BQUB 5TD4A 5KTEL 3CQFA 3PJSB 5J3HC 1F3RB 2FQEA 2NZ9C 1QLFB 4Y5XC 4PGCB 5HYIA 5I17B 1WITA 5ICYB 3DIFB 5F89B 1HWWA 3EH2A 3FJTA 5BRZD 5EDXA 1ACCA 2F54B 5T8IA 6PAZA 3KS0J 1YPZB 2NR6C 3BMWA 4FYTA 1WFJA 5F1OB 4XPBH 1SF5A 2J8UB 4OW6A 1QATA 2HX8A 3TA3C 3TYGL 1Y18B 5GGTL 1A4JB 2J6WA 4WU5B 5D1ZD 4H13C 1JI2A 3FO2A 1AD9B 3I3BA 4N22A 4XBEH 3QEQB 3WTYA 3P77A 2ZNWA 3NAAH 1J5OL 2BSRB 5HHOA 4JG1H 1N70A 4M7KL 5DK2B 2H1XA 4X7EC 2WJ5A 4GW5B 3US9A 4PJHB 3PNWA 4OFYD 3UAFA 3DX8B 4WFFE 3SPVA 3QXAB 1Y0LA 2PWDA 2ROXA 4U7KA 2W0PA 4EBQH 3JYCA 2EDYA 1EEQA 1G43A 3QIUB 1J05A 3TBCA 4E42B 5J11B 3QIWB 1ZVHA 5EF2A 1NOLA 1EZLA 4RAVA 3BDYH 3I6GB 3L4ZA 3OC5A 4PRPE 3KS0H 1R47A 2XHNA 2Q7NA 1E2ZA 3CVIL 4K8RL 2CM6A 3O3BA 2W07B 1Z32X 2L8AA 3X13B 1Q0YL 3H0TB 4JFPA 3FT2A 1PYWB 4RX4D 5BV7B 5HYJD 3ZGHA 3H3PL 4Y2LA 6TAAA 3F7RA 1CF8L 3UTSA 1KIQB 1REIA 1CT8A 5EOQH 4HCFA 1C5DB 2EZ0D 4TUJB 4ES9A 3FQ2A 4TQEL 3GMOA 1CDYA 2OSLB 3PGFH 2C3HA 2UUDK 3N91A 4K3EL 1LWRA 3Q48A 4H0LC 3MKKA 2GQHA 2P8LB 1JYNA 1XIWC 2WV3A 4OVVA 5C0FA 3PUUA 4E9VA 1G7LA 2QFPA 5TF1L 4F2MB 5FHBH 4AT6A 2B3IA 3NCYP 2WBJA 5IMLB 2ZXBA 2MEJB 5DTFA 3PL6C 2OYPA 3N85H 4GG6E 4W9HC 2V2XA 4HPOH 4IRJB 3ILDA 2R56H 1CGVA 4KHTL 4G7VL 2N0MA 4KAQL 2C3VB 3S36H 5TGBB 3SIKA 1QACA 4OCLC 4B9PA 2ZG3A 4OKDA 4J23A 5LBSH 2ADIA 3VCLA 3MREA 4OCNC 5DJZB 2CPCA 5D6DA 4ZUVB 1PCSA 2BVOB 1KIUA 2ICEA 3MACL 1QWHA 4M48H 2IDQA 3MRQA 3MUY1 4S2SA 1E4XL 3F7LA 1T22B 1WWAX 4OTXH 3TJEH 3TV3H 1ZT7A 2QSCL 4LGRB 4OZIF 2R69H 2WXQA 3U25A 2YEQA 1NGPL 4XP6L 5ELIA 3VFSA 4AH2A 5E23A 2F8IA 2EC9T 2EYTB 2MCAA 2W0FA 2GVYA 1RZFH 2EVHA 5IEHB 1D6EB 1E3FA 1BEYH 3LZFH 4PVLA 4YL9A 5BRZE 1A14H 4WSKA 1DVUA 1ORSB 4PJXA 5CZVH 1QLEB 4AQEB 5IMMB 4ZMQA 5I1KL 4L3FA 3VQ1C 4ZX6A 4MJJA 1UXSB 5KVFH 5AW2B 4H8WC 4YVNA 4YHZL 3PAYA 2R83A 4OI8A 1WAPA 2P8MA 2V9RA 5I2IB 4YHYC 5E8EA 3LIZL 2BSSB 3PAZA 4TUOB 3D33A 4HA1A 1QEXA 4PRIE 5LWYL 1LO0L 3IDUA 3KJ6H 5FK9B 3UIYA 1P69B 2LE9A 2AJYH 4N2IA 4W4OA 3GRWA 5D70L 3IMWA 2X6BA 1BJMA 3OKYA 4B95C 3RWCB 3FU0A 5I5IA 3UC0L 3T4AB 1SGKA 2CRZA 3QULA 1URLA 3VI3E 5EPMB 3WL9B 4AE1A 5TDNB 1I3VA 2VZTA 1E5BA 4ZW7A 2NX5B 3ZE0F 2CRMA 2JIXD 4B60A 2NNAA 4N85A 9PCYA 4N2CA 1R3IL 4HIEA 3DJSA 4MAYA 1UM4L 3O6LL 3RVUD 4GRLA 4DO5A 1W91A 5D1QD 1EZVX 1IMHC 3I6KA 1SJHB 5DD3L 1GZHC 1XMEB 4CA4A 5SWQB 4G82A 3ARQA 5HGHB 3LIZH 4A63A 5ICUA 1VFOA 5KVEH 1INDH 3GMMB 4X6BB 1OP5H 5AW5B 3RUGB 4AEIL 4HS8H 4GLRI 1QQDA 1UG9A 4GG6B 4KKNA 3DXAB 5JPNB 2A6JA 2F61A 4OM0L 1PMYA 4MNHA 3B6SA 1IC4L 5F9OL 4HLZG 2CMRL 2O6DA 1OTSD 2EC8A 1XDTT 2DJUA 2HG5A 3F7VA 3DSFH 4YBQD 5HVGB 3CN0A 4KK8D 1TU2B 3ZMRA 5F70A 1OPOA 4K5PA 3PG2A 5B22A 2YRBA 4JPKL 3O4LD 5E6ZA 1E9OB 2WVUA 3BP5A 1UACL 5KWYC 3L1OH 3MACH 1TQBB 1EDQA 5EN2B 4CN4A 3E3QE 1MH5B 3QP3A 1KY6A 5J06A 3ULVH 4UOW1 5DJDA 2B1HH 4M8QB 3ASOB 4N2BA 3V0WL 1RPKA 3HG1A 2AJZB 3DOHA 1YMHB 1I82A 3DVFA 3WKQA 3SE3A 4JN2B 3TBWA 4KQ3L 1TZ8A 4IU3B 5E8OB 3SZ6A 2EDEA 2CDFB 3BWAB 1ITCA 1T0NA 3U1PA 2B5IC 3CFDA 2R1WA 4Y5XA 5KAQG 3I85A 4OM0H 4PREB 3WOVA 3IMUA 5E70A 2A1WH 3FPYA 4GG8A 2QVTA 1TT6A 3JVGA 2X9ZA 1KB9J 2PW2A 5HYSA 3KPRE 1UA3A 4AUYA 4ILDA 4IKIA 1UTDA 2GBVA 2KPWA 2PWGA 4X4ZA 1ES0B 3BSZL 4TQEH 1ZLVK 4HMDA 4M03A 2A6IA 3ESUF 3AGVA 1KTBA 1WCBB 5KBPA 4J3VA 3OC8A 4EZJA 1MWAH 1QWUA 1UENA 2BP3A 4PWGA 3ARUA 3QNXA 4KVNH 1QVOB 4OJYA 4TXVB 5HHXH 4OZHF 4LBAA 3T77B 1BFVH 2EO9A 3ZRSA 3E2HC 4JZJA 1NFKA 4MNQA 5ECJE 3UJTL 3B2UC 1BZDA 3ULUC 4JG9A 4EO5A 1ZT1B 4AK1A 1WAAA 3RWDB 1OKEA 4JZJB 4YWGL 1QW9A 5L7XL 2QVIA 2VLRB 3MLYL 2ED6A 3O6KL 3FUNA 4X7SH 3BW9B 4BBWA 3L4TA 3ULUE 5FYJH 4IRZH 1R5WB 4OJFL 5F7WC 2XZAL 3IDMB 3WIFA 1G7QA 5BOJA 3PJLA 1BZ8A 5F1NB 2QLYA 4XBMA 3U9PH 2Y23A 5K9OB 4X7FC 1RK0A 5D7LB 1JPSL 2C7FA 3QQ4B 1MIMH 1DEEB 3NAAL 2DI9A 3T4YA 2NPLX 1M7DB 1V10A 4RGOH 2V8MA 1ZGLM 1SRDA 3Q8CA 4GKSA 1U58A 3QUXD 4QRRB 2C26A 4WI0A 4YE4H 3WKML 2X2YA 5FDWA 2F7OA 4Z78A 5I1CH 1MZZA 4JMXA 1VDGA 5E8OA 5TDPA 2OLDA 3OXSB 3TBWB 4X9FA 4XTRC 2JNZA 4OKVB 1UQSA 3FUJA 4PB0L 4O4YH 1DBJL 3H1ZA 5E8PA 3C5ZB 5I1DA 4GRWE 2EDNA 5IV2A 2AS5M 5KTEH 5CP3A 5AAWC 5JOPE 3HZVB 2XA3A 4KPHL 1DQLL 1ECZA 4LPYA 1OP3H 3HI6H 3F8UB 1CZ8H 1NIEA 3CLFL 4JG5A 1RIUH 4QKXB 1L9NA 4OF5A 5DZJA 4ZUTA 3W9EA 1OOWA 1TTGA 2GB2A 4HBCH 3X14A 2BO0A 4UUJB 2ZICA 1F58H 2YJLA 1S7RA 1RY7B 5K39A 1HHJA 4G7VH 4FMKA 5LBGA 2ZNXA 3BPLC 2P47B 3KE0A 3N85L 4WCYL 1PNDA 4P2OB 2DQJH 1N5AB 3WLWC 5T1MB 1HTYA 2QHLA 3P0VL 4JL1A 4ETYA 3BYYA 1FFTB 2GCYB 5JQ6L 1BYNA 3GI9L 3FT3B 2A6JB 5HHPB 1IGTA 2FWOB 3ZE2E 1IKOP 4QRQA 3VA2C 3UBXA 4GXUM 4D9RD 1HL8A 1LGVA 1GTNA 3TURA 3A6BH 2RQ8A 1KCRL 5FFGA 5B8CC 2EDFA 3KR3H 1HXYA 3Q1EA 4MNQE 2ZXEB 2EXWD 2VL5B 2ZUTA 2WGXA 5E5LA 3TXAA 43CAA 1M1XB 4HU8A 2Y3NA 4YHPA 4OSUL 5K1VA 1CI5A 1J0KA 1NPUA 2WSKA 2W9EL 2A77L 3HPJA 4G8EA 1TETH 3SDDB 2CCVA 4IS6B 2H1LM 5CLXA 2WNGA 1KELH 1XH2A 1YDPB 3N3EA 4LASL 1GYAA 2VERA 4G11A 2BM3A 1ZGLA 1E6JL 4XO5A 2NX5A 3ARWA 4B3VA 2PR4L 5JUEL 1OARH 3D48R 3TYFB 5FECA 5ITFB 4XP1L 2WWMD 2XY1A 4KQ4H 4LPVA 3VMPA 1SBSH 4ODXA 3AREA 4PTTA 4E9WA 2AJVH 4M7JH 5EO9B 1GYVA 3DVGB 2Q2LA 4WEBH 4NAMA 3RWJB 5FK9A 2ENYA 3RBGA 1UOLA 5ANHA 4JKPL 2BSCA 3BUIA 4YSRA 2IPTL 1UYWH 4I0KA 5E8EB 4P4KD 3QT2A 2A99A 3F7YA 4AQAB 2J4WL 5ALCH 1H8SA 1L9SA 1YEGL 1JE6A 2JJVA 3PIQA 4J4PA 4UT7L 3SGDI 1WVZA 3CIAA 5FO9B 1NDMA 2ICWI 3B9KC 1ZA3B 4R0LA 3ZKQD 2AQQA 1UXSA 2FJGA 3FU5A 5HHQB 3WS3A 4IK6A 4AQEA 5IMMA 1KXTA 1DQDH 3VJ6A 1PZCA 4PBVC 2VMJA 1CYWA 4XPBL 3K71B 1IBZA 4FQPA 25C8L 2LV4A 4I0PD 4OCSH 3TVMB 2HB0A 4JFEB 5J6HA 4PJGA 4UQ2A 2R4SL 2YZ8A 1ZT7B 1GAFL 1YEDA 4JQIA 4XP4H 3TV8A 4URKA 2X12A 2EKSA 4KROC 3BZ4B 1WTLA 4R7VA 4PLKC 2FGWL 2J44A 5D96C 4J28A 1TJHL 5J1AB 3R06A 2IOMA 5EWIH 2JCCE 4DKFL 1AQ8A 4KK9C 4D8OA 3MREB 5DJZA 4QF1A 2XQYG 3AQDA 2FE0A 4S11A 5FOBA 2VE6B 4XAKE 4FFYA 3T2NL 5D8JL 3T6QC 2ZOKA 4QF1B 2WANA 4X8GA 3VFMB 3FSWA 3DXAE 1AZNA 2AFNA 3OAUH 5J1AA 1P4BH 1CBVL 2Y06H 4YHML 4LSSH 4UIMA 3MNVB 4XPHH 5ILTL 1MJJA 1XTMA 1DQML 4F2MA 4AYBA 3MCLH 3BJLA 4JHWL 5I15H 1PBYA 2E8ZA 3AS2A 1LDSA 4J27A 5C0BE 5J6HB 4HC1A 5JMOC 1VFAA 3T0ED 5BZXA 3QNYB 4LLAA 4OF7A 1DVSA 3U7YH 2C9QA 1X44A 5L4MA 1MLBB 4HISA 3G6AB 4PJBF 3NCEB 4OLVH 2ZUUA 2PPCA 3NJKA 4H44C 1HHIB 1BBDH 4K3DL 1CT8B 4QOKD 3UTSB 2I9TB 4R96B 3A4EA 4R0LB 3DTUB 3RVVD 3WIAA 4FG6D 2Q9OA 2XXGA 5FO9A 5CJQL 1OPGH 3POHA 4X6DA 4DP5X 1H3PL 1D5XA 4OLYL 4F8PA 5AB2A 4YHYB 5I1EH 3HS0A 5BRZB 4QNPE 3W0WB 5IUSA 1MFBH 1U6AH 4N28A 3DIDA 4MB4A 5B1KA 3DX7B 3ZU8A 5EU6D 5BMFL 2ZCKL 1N5YL 1A7PH 1EBPA 4HGMA 1UKQA 4L8CB 5BMFH 1VA9A 4JJHA 1HFUA 5J12B 4N90D 4PVBA 5ISZD 3ETTA 4ODBD 5TFSH 3OTTA 1YO4A 2V2WA 3BSZA 2VDOL 2R39A 3P9LA 1L6PA 1MAJA 4TUUA 3I9PA 3MUZ1 5IW6B 3PNWB 3KPRB 4GW5A 1HYSD 2O61B 4KOCA 4RZCB 4CSSA 3GJEB 1H15B 1JRHH 4PJGE 4DK3A 1V3LA 3T1FB 2XN9D 3DUHA 5ANME 4OT1L 5HHVH 4IS6A 3L5WB 1RZJC 1T5KA 3BKMH 1QNIA 4G8EB 4H8WH 3SDDA 4H2AA 5D2NC 4NQTA 1Y18A 5I73B 4LU5H 2FCBA 3QJZA 3HI5H 2WQUA 3WO4B 4UQ9A 4KY1H 1JGDA 4F8LA 5A3IC 2CO6A 3HR6A 1MHHB 2CBOA 4RFEB 5SX4H 3MODH 1CLYH 4PJ8B 5LXGL 5I17A 1XX9C 3RGVB 4OI9A 2QFRA 5DVLA 3K8KA 3GSUA 3JUZA 5GSRB 3V5HA 3ZIMA 3EBIA 4U1LA 2Y06L 2ZONA 3WIIL 2V7NB 5DRZA 4HU2A 2R8SH 4JZOA 5DMKB 2BMKA 1SZNA 3UBFA 4G9FA 1X5MA 4NOFA 1OM9A 5T33H 3ARFD 1BVNT 2C3GA 4RESB 4Z7VE 3WD5H 4AY0A 1WD9A 2XV6B 4CSPA 3E6HA 3WGVB 1HHHA 4E5XG 4M02A 1N2RA 1V3KA 5L0QB 3RTQC 2NT0A 3B2VH 1E5CA 1NSNH 4Y5VB 5B1AB 4UWQB 2WVVA 5AVUB 1S4IA 4OR1A 4QRRE 3VO0A 2IC2A 3B2XA 1OTUD 4XZ4A 2LLNA 2PPDA 5C9JB 5CEZH 3ERXA 4EDWH 1SHSA 4FNLH 4NZTH 4MD4B 5E2TL 1YECH 5E8PB 5IV2B 5D7SL 1VACB 2JJSC 1GPOL 2PUQT 3KBHE 3QHZH 2AVFA 3LZLA 5D2LF 1ZV5A 4E5XA 4PGJA 2V2TB 2FO4B 2YAHA 4APQD 1UB6A 2B1AH 1TVDA 4J12A 4AZUA 5IFAH 3D2UA 1S46A 3N1FC 4TVPE 3KL3A 4P57B 1ZLWK 3GXDA 4ODWA 2ZSWB 2ALAA 1U58B 3NJLA 4HT1H 3DDFA 4M6MH 1JRHI 3H9SA 2XWTA 4ZUUA 2YFNA 4ELME 1J0ZA 2ITCA 5DWUL 5IKCB 1RUAH 3DGGA 5BUAA 3NZ8B 1JF5A 3ENEA 3IT8D 5DHXB 5C8JB 4UI2A 4OLZL 4HIXL 3W56A 1T83A 4B97A 3GDBA 5F1NA 2DJSA 3GFUA 1G7QB 1AGFB 3IDMA 1XSIA 1B4TA 5DCCA 2IXQB 3ATEA 1SF3A 1G6RA 4JHZA 2AJVL 4M7JL 4FA6A 4XPFH 4L8SA 2ZQKA 4KQ4L 1WWBX 3MA9H 2E9BA 3SE3C 1WA2X 4ZPVB 3T0AA 1MG2C 3IXAB 2B2XH 4MNQB 3GMPB 3RDTC 2DQIH 3QDMD 3KBPA 2EZ0C 3DMMB 2KZKA 2BHYA 2GUOB 5FWQA 4QRRD 2OJ1A 3D85A 4MSWA 4L1SA 4JLRB 4JGJA 2VUYA 2QHRH 4KI5D 3DJRA 1OVZA 1I3RB 2CIIA 1C1EH 2WKOF 3ECQA 4UOJA 1CTNA 4Y9GA 3UEZA 1WCBA 2Y7LA 1F1AA 1E3ZA 2P5EB 2WP3T 4V1DE 3QWNA 4I89A 3L8QA 5F7AA 2ZX9A 3HAEA 5IJVA 3NFPB 1P84K 3W2DL 2X1XR 3PQYD 1MN4A 2PW2B 2EDXA 4WQOA 1DJWA 1B6UA 4JE4B 4FNTA 1JZFA 2YD3A 3SDCB 3V0DA 3WE1A 4DIXA 2GBTA 1G7HA 2HT3D 3HHMA 4I0PB 1S7TB 2EVJA 5FLUA 3VXMB 4AW4A 4Y5XB 3O2VH 1VENA 1JVKA 2JQZA 3ABMB 5HI3D 2YD7A 3O6FC 1U8IB 4LOEA 4AYFB 2PETA 4W9IC 1EHXA 5C0CE 4L8SC 1JUFB 3BE1H 3P4OB 1KYAA 1MF2L 3L81A 4F1ZA 3EZ8A 2WHVA 1XF4B 2GJPA 3NJIA 3V4UH 4NUMA 2J1KA 2AJZA 4TNFA 3EYQD 3HG1B 3VXUB 1FVDA 2AXHA 5LBVA 4XP5L 2N56A 3TA3D 4PCKA 3CSFA 1OAJA 1W72A 5DHDA 4G7QB 5F6IC 5DZPA 3P40A 2E7BA 3S2CA 1LVEA 5I8CB 4O4YL 1PFOA 5C0AD 4DGVH 3U4BH 4HWBA 3IFNL 2CNYA 2NTSP 3GMQA 4JFHD 2NY7L 4I18A 3G5XA 3OLDA 1Z7JA 3D39B 5K9JL 3DBXA 2R1YB 2YLHA 4Y1AB 5FGRA 4JUTA 2ORBL 4ZAKB 3X3GL 1WBYB 4P4RA 2WQ8A 1ZIBA 2QPFA 3GLEA 3VGFA 3IDJB 4I85A 5M94B 4YAQB 4MNHB 2L04A 4Q9RH 3S7GA 5FKPB 2XQYK 1Y6MR 1Z3GH 3GMMA 1FGVH 4OD1H 3JV0A 4GQZA 4XHJD 4TRPL 1P5UC 3DX3A 4MJID 1KFGA 5F96H 2HT3C 3D1MC 4I0CC 5FV2A 5ISZE 5K9QG 4H0GA 2BXZA 4JY5L 5LGHL 1TTFA 4L4TB 3WNLA 4JQVC 2VDRL 1RFDL 1XO8A 3BPLB 4U1GB 4NQSA 2VC2B 5GGQH 1HXKA 3CBKB 3H54A 2J6EL 2X4TA 3OSVA 3TGXA 2BIPA 2WWKT 3WXVH 5BPPA 5FPIA 4Q9RL 3UJIH 2V3FA 1OAZH 1LWJA 1CLVA 1R46A 2FEDC 4G42B 4KO7A 1ZTXL 3X3GH 2WWMC 2EIBA 4PJ9C 5HP5A 1XVSA 3FH7A 1UXMA 3SE4A 1NIBA 3UTTE 1PJ9A 5EF3A 1H9VA 1PEZA 1ZOXA 4UZUA 3IFNH 1N7MH 3NZHH 4IBZA 1XSOA 3GSRB 4RDBA 1R5VB 1XGYL 4L23A 5KG9B 1X5HA 3UH8A 1UA7A 2FATL 4Z8FL 5I2IA 3D4GA 4R9HA 1CDIA 3RJQB 2G5RA 2B8OT 3UTQB 4EF3A 4NYLB 4OZIB 4ZXBA 2XYCA 3IJEA 3J2PA 1IVLA 3MZGB 4LSUL 3F83A 4AX3A 4H7VA 4LVEA 3GB7A 3CK0L 4YFDB 2YGVA 5JYLA 3CDGA 5DJXA 4W9ZA 4QGYA 1W8NA 1D6EA 3A22A 2DYRB 2W0FB 5BVJA 2EYTA 2XFGB 3FHEA 3VFPA 4EN3D 2DQFB 3B43A 1X9QA 3KCWA 4I1RA 3SKMA 4AH2B 1AOHA 4J3UA 3OKEA 4P46A 1QEWB 3F7QA 4J3WA 4WWKC 3TWCH 3HB3C 4QKTA 1CDGA 3GB7B 5BRPA 4LLMA 4HZAA 3ULVL 4GW4B 3RZCB 2GUYA 4ZZKA 3ZKMD 3KYOA 3DRTB 5JXAH 1XCWA 5LCVL 4JM2C 3UCRA 3GZPA 2RIKA 4OCWL 2YAEA 4NLHA 1BLIA 4NFDA 2WQAA 3F12B 1SFHA 2J2ZB 2HKHH 4PW9A 1UEYA 5DJYB 5AWNH 1S9YA 2X88A 2VMDA 5HYJB 2WWOA 4MNQD 2A38A 2OP4L 1KYUA 2BWQA 1KGCE 4TPRH 4LLWA 4PJBA 5JZ7D 3INOA 5H2BB 3KPPA 1P4LA 1XB8A 2F54E 1KN4L 2FT7A 4QXWA 1T21A 3QORA 4Z77B 1AZBA 1AQMA 3GK8H 5HVFB 5F3BA 4NN5C 1JFHA 2VSDA 1WDAA 1Q72L 5EZIL 4HHAA 3S97C 1INDL 4UQ3A 1JERA 4Y2DB 3RU8H 3PWPB 1EAJA 3S8WA 2IVFC 3VQLA 4ZTPL 2IPUK 2CDGA 2KDGA 4L0PB 3DOIA 3UABA 3HUJE 4BFGA 2X2UA 4JY6B 5DGQA 3VYPA 1I8LC 4PVNA 5AOZA 1KTCA 3SPJA 2BSTA 2BIMA 1Y6KR 5KSUB 1PYWA 4KNTA 1H9DA 2XVLA 3LQMA 1A6ZB 1GH7A 2LQRA 1KPVA 3UPAA 1JGVH 5DRXA 4AKQA 5LQBH 4ISVA 1B9ZA 3LH8A 2VR8A 3IDJA 4HT1L 4N20A 2I60H 2W9DL 4N2OA 3MNWB 3O3DB 4HFUL 4P4RB 1T04A 2ZP0T 2FJFA 3BFOA 4X8XA 1FSKB 2GKIA 5IWLC 1Q1JL 1J05B 4Q6IB 2X1WL 3C8DA 1VZHA 2P24A 3EW3B 3UTPD 4WO4C 3GTVA 3NTCH 1ASQA 2Q86A 4FNLL 1RJCA 4NZTL 5I8CA 1BVKB 1CIUA 1UZGA 2P7TB 4GINA 1J12A 2H26A 3HAEH 4X8JB 3EO9L 4RSVA 1RZ7H 1NCDH 5HI5C 4JANA 3NMEA 2OYKA 3VMOA 4N25A 3V4PA 3D6GA 2OMVA 2HUHA 3DLQR 3QEQA 4JDEA 3M7FB 1IGIL 4AQOA 5A2JH 3BWSA 3FO2B 1BZ7B 1A4JA 4WU5A 1HJBC 1J9QA 4FG6C 2VB5A 1UGKA 1TQSA 4WTQA 5FCUL 1XF4A 4OM1L 4PW4A 5LDUA 1DANT 3D9AL 2YUXA 1QSEB 3LPPA 4NSKB 3SHSA 1UCBL 3UDWC 3VGAC 4L3EA 4YUEL 2X41A 3FU3A 3RVWD 4AEHL 2X7LA 4ZI8A 5MEOB 5GRZA 4PJBE 3SYQA 2PYFB 5LXGH 4DN3L 1SXZA 3QIUD 1B4RA 4HH9A 4G1EA 3ZT5A 4HMCA 4KY1L 1P1ZB 4PLJC 5DDHB 5TF0A 2NLJB 3REWB 1HJCA 4H8HA 5E03A 2YQ2A 4XCCH 2AZUA 3VDAA 3ZKXC 4MDJA 5E24E 1AVAA 4RGMC 1OF0A 5TE4L 1XR8A 1UM6H 4M1CD 4FQLH 2EJ1A 5E2WL 1CQKA 1GOHA 1OAXL 4ODVH 3UAJD 4JLRA 5BO1H 4F5CE 4MSWB 5F6IB 3TX4A 2GUOA 4LNVA 3DMMA 3OMIB 3SDCC 3E2HB 3M1CA 1MHEA 4NT6A 4ICWA 2OW7A 4KU1A 4DZBA 1SFDA 2LAAA 2XWZA 4DERA 2Z9TA 3QORC 1IC5L 4KXZI 3QHTC 5K1JA 4XMKH 1HSBB 4M3JA 3MV7A 2BCKA 4E9QA 4HLJA 1DVTA 1CUOA 1FE8H 2WXPA 1U8OB 1UD3A 4L8SB 3ZPDA 4IBTA 3S3SA 1G6RB 2X87A 3T4AC 3P69A 2F53B 3GBEA 2JIXA 3ES6A 1EHLH 3GIVB 4ZO9A 3QUHA 1IBFA 1PY4A 3PGDB 4CC0A 4OCXL 3QDJE 1M2VB 2L0DA 3Q6FA 1J8HB 1P53A 3NZUA 4OLYH 2BNQB 4TSAL 4DNLA 1IO4C 1G5AA 3A6OA 4XT1C 2JB5L 3D7PA 2AVGA 5GHWH 2ITCB 1T4WA 1O7VA 4LLVB 1HL5A 3RAJL 1U4FA 2DQTH 4NFCA 3APNA 4G5AA 2XX1A 1BZEA 4XWGH 1YEKH 1RURH 4P57A 4CVXB 1TCRA 3FRUB 4OZ4A 5BUPA 2UZXA 3EFOA 1RZIA 3T08A 3TBSB 4NO5A 3ZE1B 4B3EA 4G8IB 4IRSC 4XVSL 4K23H 2WBWB 3JYBA 5B3JE 2R2EB 3MCLL 1D5IL 5DK0A 5C0NC 1V7ML 1HS6A 2ICWB 3HBZA 4F15C 1FNSL 5CUSL 4S1RL 4RMVA 2OJZL 3QCTH 5DJ2B 2VXQH 2Y25A 1N0LB 3RHWK 2JCCB 3PV6A 1U8JA 3VG9B 1ZE3C 2WSPA 1HQRB 2FIKB 5B3SB 4DEPC 2WTRB 2D7PA 3MC0A 4Q9QH 3MRCA 3D3VD 4TVSa 4LSPL 3UG3A 4D0CB 4GH7B 3QZNA 4JY4B 3WHE1 3E6HB 4KBPA 4K3GA 2AI0H 3BVWA 4NM8L 4TV3A 5KW9H 3OLEA 2H45A 1AQHA 5DMKA 5EO0A 1KZQA 4ZSOB 3V8OA 2EDLA 4M6OL 5E95B 2FX9H 4G7SB 1V3JA 2MOGA 5GSRA 3PLYA 3U79A 3V5HB 4I77L 3DO3A 2Z8VC 3FFDB 3LKSB 4L4VD 3V4LA 4ETQB 3VM7A 3I9GL 2NY3C 4L3EE 5H37A 4L2YA 3UTTB 3C6EA 4AJVA 3H3BC 2Z7WA 3ZZ1A 2W91A 3OVUB 2VT0A 1M05B 3BH8A 4CMMA 1J88A 4NN6B 2YWZA 1D5ZB 3ARBB 25C8H 3L7EB 4EIUA 4Z7OF 2PABA 1JZJA 4NM8H 3LN9A 3FTYA 3QG7L 1LO3L 4LEEA 2VAJA 5JHDE 1JPFB 4ADGA 5I75B 1A7NL 3MNDA 4QTHA 1R1CA 1WBXB 3EJJX 5D55A 3TIEA 2PWFA 5KSAC 4NPJA 1OZTG 4GP4B 3T1FA 3L3HA 4R6UA 3GJEA 2Y5EA 4K94L 1RZPA 1EHKB 5GGRA 4BDVB 4F5CA 1DQJB 3C08H 3BOVA 5JPMB 2O61A 3SJVA 1G84A 1ETJA 5D1ZI 4FJYA 2VDOB 1QBMH 3INUL 1P7KA 4K23L 1SN5A 3PGCB 3VI4E 4N0CC 4F57H 5C86A 1DVZA 2JELH 4OLEA 4WFGD 3GS4A 4UM9D 4PRHA 1R33A 1YNLH 3LXCA 2ZXDA 1ZLUK 3RIFK 1YJDC 2FSEB 1OT4A 2NT1A 4HIJB 5D4JA 3S3PA 5CEZE 4WFHD 1BF5A 3HS0B 3IF1A 5BRZA 5FUOH 4GAAA 1JFQH 1H6TA 1U92B 2H7WA 3K6DA 5BNXD 2V8LA 3MPCA 5J6GB 4K71B 2X5PA 4TSAH 4R96A 5EZLA 4JVPA 1BVNP 1IQDA 4FQCH 2DI7A 4GAFB 3PWNA 2FECL 3N40F 4UV7H 1U3HD 4RRPM 2VLKD 1I8IB 1V27A 4IGBC 2CLRB 4O9HH 4DCQB 1FJ1A 2IFFL 4FMVA 1QR1A 2W65B 2MNUA 1TFPA 1NDGB 2GI7A 4KUCD 2L7EA 4O02A 4ENED 4J7RA 3K8MA 1EO7A 3MKGA 4NQEA 2QJDA 3BGFC 1BZOA 4IU2A 1DDHB 1Y07A 3CJJA 3WCYA 3DOSB 4F8QA 4OIAA 5BO1L 5F2FA 4N2NA 4GRWB 2P8PA 4BSJA 3TPUA 4LPXA 4DVBA 3PPSA 3IKKA 3M1BA 1UM6L 2VE6A 5FOBB 4HBCL 3SJVD 4FQXC 1ZGLP 1ASPA 2CE6A 5EO1A 4Z7IA 1AHKA 1PDKA 5LN8A 1CZ8L 2D7QA 3MYJA 4PYGA 5FB8A 3ECBB 2DYPD 5D1ZC 5F7EH 4OCMC 5CHNA 1BQHB 1AACA 3BZ4A 3GUFA 2XG4A 3FQRA 2NR6D 3QR1A 1O5DT 1YEDB 1DQKA 1LK3H 3MUGA 3TJHC 1AHWC 4UQ2B 4BINA 3LHAA 4R4FL 4QRBA 4I3GA 5DMGC 4I3SH 4Y9FA 4Y2DC 5GISH 4OFKA 5I0WA 2VNCA 5F6HJ 1OZUA 5C0AE 4Y4FC 4DFHA 1N6QH 1KXTB 3QUMH 1X4ZA 4JFYA 3FFCA 1EO5A 3WS3B 1CGSH 1IC0A 4Y7OC 2VQTA 5F1KC 3ARFB 4IM8A 3C5SA 3DRQA 1ADQL 3VI4B 2Z92B 3CXDH 4BFNA 3KVQA 3WHXB 3CMOH 4AQ8A 3TU6A 2DPKA 2YIHA 4OD2A 1JXFA 3SDXE 3CVBA 1R75A 5HVHC 2C5DC 2J1ZA 4AOFA 3V6FB 3OB0K 3WTSA 2J21A 3DVGA 5EU3B 4PWFA 4TUKH 3HBGA 2IPKB 2TRYA 3V4VH 3U1SH 4ZMTA 2YD0A 3LEXA 4CRPA 5F7YC 3RGBA 3CAFA 1A8ZA 1G7IA 4EI5D 1KB5L 4AXWB 4YR6B 5L4IA 3P4MA 4HJGB 1WC7A 2NUPB 1KJ2L 3UGUA 4HWEH 1A6VH 1Q8MA 2DWEB 3II2A 3VFGH 2IH9A 1W8EA 3SPIA 4WWNA 3OKDA 4LSVL 5HXMA 2NNXA 1KTDA 3M88A 5TPWL 3S5LG 2NYZA 1RH8A 4GUCA 1A1OB 2AMUA 1MI5D 4NQEE 4RMRA 3DETC 5F7DB 3P4NB 2F5AL 1KIRA 1JL8A 3SDDC 1M1XA 4XNQB 4RBPK 4HV8A 3OKNB 3QR0A 2HN7A 2FQFA 2VL5A 1EAPB 3VWJB 1HXYB 3KEDA 2Q3XA 4L5FE 1A7OL 2E47A 3EJUA 3NH7L 3FCSA 2AJ3A 3MRBB 4ZFGL 4NNPH 4R4ND 4Y19A 3RDJA 5MP6H 1KN4H 4UZGA 4CW1A 5INDB 3P1VA 2AQTA 4X0NA 4XXWA 1N5AA 3D52A 2MTPA 5INCB 4NI3A 1A6UH 2OZNA 1A3LH 4DEWA 1HEJC 4TM9A 4DOHE 3CUPA 4QRSB 1HINH 4Z7UB 4ODSL 4HGWA 5F9DC 5IZ7A 1P9MA 4HUCA 1XFPA 4OIFA 2Z8SA 1FI8C 2QKIA 5JIDA 4WTZA 3B5HA 2ZXQA 5AWNL 4JFDE 4L1TA 4NCC2 2F8VA 4FZEL 3EDJA 2YAFA 5ESAA 3Q3GA 4LK4A 4AIEA 1IFHL 1QLRA 2W9LA 5ANMB 1O0VA 1LL1A 1UACH 4I3RH 1NWOA 3ZDWA 4Q8BA 4DVRH 2N7AA 3QK0A 4LL9A 5CEXA 3O11A 5EC1A 4OKVA 1MSPA 4YMPA 3NJMA 5HGBB 2GPZA 5J6SA 5TDPB 3S35L 4HD9A 1L0XA 2XTLA 3BX7C 3V0AC 4CL7A 4Z78B 2Z31C 4K94C 3WV0A 3FONB 4U1MA 1IC4H 1YNTA 1JAEA 4N0UB 2EUXA 4BQ6A 3RI5K 1CICC 5J4MA 5JHLL 2VM4A 3O9WB 4XMPH 3B5TA 4LNRA 1CE1L 3FB6A 5D7LA 5F1IB 1WZAA 1NCOA 3L08A 5IBTH 4Y5YA 3TJPA 1IL1B 1QSEE 2EDQA 4XCYB 4Z7NE 1NC4B 2DLGA 3MLZL 2YAMA 3JV6B 2EDBA 1A5FL 1OE3A 2XN9B 4IIZA 5ID0A 2XX0A 1FYHB 4XMXA 4FYRA 1X5KA 2HFFB 3MRPA 3RL2B 2UUDH 5DUJA 2ZYIA 3ARDD 3H7LA 3VD7A 2NQCA 3WEXB 1FNHA 1KLFA 1NAKL 2MCG1 1Y7VA 4URTB 3ARGD 4R90H 1LP9B 1R3JA 4BD4A 5K59F 4GUQA 2BFVH 1SDDA 1BBJA 2FBJH 1YEFL 2OTUA 3CC5A 5T1LD 4ESKA 1IGMH 1DBKL 3DKHA 2XWRA 3QNXB 1BYOA 1RCYA 3G7TA 5EBMA 1RFDH 3LZNA 4JM4L 5IFHL 3OKOB 4JRYD 3P3TA 1LO0H 4FYQA 1M2OA 3GBNH 2H1PH 3QEQD 3G9VA 2F1AA 1MOEA 2R2BB 1FBIH 4HUUA 5DLLA 4N2EA 1AGDA 4LOUC 4PUBL 3WBDA 2DH2A 2H3XC 3F62A 4HXBH 1TENA 2DH3A 3HC0B 3DSNB 3QIWD 4NO0A 5AYUL 3SPHA 4F92B 3DURA 4WV1B 1X9RA 4M8VA 4Y2DD 3GKZA 1AXTH 3UBXI 5I73C 1RZKL 1G0DA 3EH3B 2GFBB 4PG2A 4P59L 1HCYA 4JKNA 1CFNA 3DX0A 1NGQL 3O3AB 1NBZA 1WK0A 4GQQA 4TN9A 5GS0H 2PP9A 5DRWA 4D9QE 5DJDB 4GBXA 3WMPA 4BGDA 3L1FA 2WB1A 5KEZA 2DQDL 5GZOA 4QTIH 3W11D 1AFVL 1XTLA 2Y1VA 3EYSL 1X5ZA 3NK3A 5E4EB 5T5FA 4XNMA 4TVPL 1VIWA 2K7QA 3T0VA 5KVDH 5AAWA 4BK5C 1JJUA 3GI8H 3HE6B 4XP5H 2HLAB 3NRFA 2O5NA 1BIHA 1LM8V 4F58L 3B3IA 2HT2C 1S7UB 2OMTB 1SLVA 4M29A 3T2OA 4P23C 5KAQF 4C55A 3MLRH 3VE0B 2O1AA 2BZCA 3WO4C 5HDRA 4PJHF 1MFCH 1BA9A 2WUBL 2J71A 4L9LC 4JK0D 5EUOE 2WOYA 4CADA 2MQGA 1ORQA 4OBSA 2ZJSH 2VH5L 1PLGH 1M42A 4QD2E 3GPSA 5AEAA 3K6FA 2FJHA 5TF1H 5LDSA 5GS3A 3BZEB 1X5AA 4YC2B 2UXGA 4DQOL 2G5BB 2YS4A 3KZ8A 4MLIA 5C07E 1GS8A 2NZ9D 4GFTB 1WBZA 3W2DH 2WLNA 4L1BA 3EYSH 3HR5B 4U05A 3FDWA 4PFEA 2HVKB 4PI2A 4LHUG 4N90E 4JQXC 2AK4B 5GS0L 4UDTB 5E99H 3UYOD 1F97A 1JTTA 5I74C 1SJHA 4OV6F 5I75C 3NJNA 1G9MC 2QHRL 5TH2B 2NY5C 2BHUA 2CD0A 4QNPF 1MCCA 4JM2A 4QUOA 4D0DA 4J4PC 4IKNA 2ATAA 3GBML 2EIJB 5I6MA 5DJ6A 2HRHA 1U2CA 2WMPB 3HS9A 2Z93B 3CVIH 2F68X 2H0FA 4RMSA 5EBLB 4JR9H 1FC1A 3BWUC 3V5KA 4ZMVA 1DL7L 2WLIA 4TQPA 3S5LB 1S7SB 2JK5A 1NGYB 15C8L 1B2YA 3B83A 2X10A 2FD6H 3D39E 4P2QA 1WGVA 1I75A 3ZE2B 1QSZA 1UH4A 4PS4L 1YJDL 4H4NA 5E2VH 5IJCC 2CIKB 2MPAL 3EJYD 4PWIA 3GBNL 3C5XA 4CU6A 4GPVA 1Q9KB 4PJHE 3ZR5A 4HWZA 4AV0A 4N4YB 2FRGP 4GYBA 1JN6B 4P9ML 2I32A 3MLXH 5LNEA 4IOIA 3VSUA 1X5JA 4JVUA 4AVHA 2J5LC 5ALBH 1JGLH 1I1AA 2XXCB 5T3ZL 3RY4A 1F41A 1P5UB 5MERB 3BEVA 4PP2B 2ZTBA 4Q9CA 3CNKA 4Z18A 1VB9A 2LT9A 4LLQA 5GRUH 1KN2L 4PRNA 1M1SA 2OMUB 3MROB 5GSVA 2X3BA 5I82A 3P3YA 4FFVC 2P45B 1A4CA 3LVTA 4LP4A 4HS3B 2UX6A 3MFGB 3SDYL 4A66A 4ZAKC 3QHZL 3JWDC 1OB1B 4I48B 3F7KA 3TO4C 3D85D 2DWXA 1T22A 1ZA6A 4HUXA 3X3FL 1QFPA 4TOYL 5EULV 1I7ZA 4XMTA 5FF6B 1KNOB 2QVKA 5C6TH 2EXYD 3B7UX 1EFXB 1OT1A 5D72H 3LKNA 4GEJA 1QFWI 1H3XA 3CPLB 3BQUC 5BOPA 3VXTB 5FYJE 3NESA 5CR1A 4LRNH 3LOWA 3VXSD 1CE6A 3O9WD 2PTTA 4GUPA 4YOKA 1XSKA 1JF1B 1RJZB 2R8SL 4KRPD 4PB9L 4C57C 3UYPA 3F6IA 4CBZA 4XP9L 5C0ND 4IK7A 5D2LE 4IRSD 1Q0EA 4Z7OB 4AV4A 5CXPA 4KMQA 1T4KB 3NABL 2RALA 1A64A 3O6FB 5J7CC 1CLYL 1EHAA 5FYLD 1TJIH 3VXUE 1CYXA 1OAQH 5CN3A 3RPBA 4EJ1C 3O41A 2XPYA 1OGTA 1TO4A 3ASNB 3N1GC 4F9LA 5H94B 4KOBA 2OSLA 5LGYA 3NCFB 1MAML 2GC7C 2XA8H 4JPWH 3A4DA 3ZR6A 4O02L 4UANA 1KIQA 2EE6A 3I3EA 3O4LB 1IAOB 1E4WL 2YC1A 3GO1L 3MNMA 3IVKA 4AG4L 3S5ZA 2VDQH 4AIZB 5IB3B 2IQAB 1LE5A 2D3JA 2X4QA 2HXAA 2VLKA 5C0RH 1GOFA 5EF0A 1DBBH 4AVJA 1GYCA 1DN0B 3CFKA 1ROWA 4FZ8H 3VFNA 3TM6A 2Y7QB 1E4XI 4W6WB 4KK5C 1JNLH 3QJRB 5B38G 4F7MA 1FN4B 3J8F7 5L9DH 3QORD 4M7LH 4MB3A 4LO9A 5IOKA 1WPCA 3O2DH 4QGTA 2BSED 2WPGA 1H6EA 1HESA 3V0VA 2V5RA 4XH2B 1MFBL 1E7UA 1U6AL 1TZGL 4UV4H 4PJHA 4Y5YC 2X3AA 1PZDA 1E2WA 2I27N 3W39B 1TOXA 3DUSB 4YXHL 3FO9A 1F8TH 2Y6SD 3KG5A 1ZEAL 4OF8A 4N2KA 7FABH 1B0GA 2HVJA 2ZAHA 3HNVL 3PWLB 2CCWA 4FERA 4ELMB 4X9BA 2J8UA 4PJ9B 3U83A 3HS8A 1KIPB 4YZFF 4PH8A 4BYHA 3V4VL 4TUKL 3DIFA 3UYRL 2BWIA 2FR4A 4ZYKA 2EQDA 4LQFL 1KEML 2RBLA 1SVBA 3TL5A 5KVEE 4WI5A 4LSSL 5EOCJ 5IESH 4TNVF 1P4BL 2CBMA 1FFNA 3EO1B 1XH3B 3VXRA 4MZ3A 3B34A 4HPYL 2YOCA 3FT0A 1UJTA 4UTBA 2PCXA 3V9CA 1JMXA 4QHLA 4G6KH 4LCYA 3CFUA 1W0WB 1GIGL 2OS7A 3FSZA 1KJ2A 4DK5A 4GXFA 4CN1A 2A0LD 4QO1A 2NY6D 3ROLA 4WHDA 2OXGA 4UBDD 4X8CA 4H0IA 3VXNB 2X70B 2ZXWB 4PSRA 1ZLWH 1H0DB 3ALPA 1PNCA 4JFWA 4OUUB 5C0DB 2OA9A 5ID1B 5HYJE 1GGIH 2FGWH 3DHMA 4PBXA 3D4YA 2Z7YA 1IAKA 1PZ5B 4JPVL 5I6PA 4GAYB 3TPKA 2VLJD 3PAUA 4WEUD 2MOVA 1FAKT 1QFWL 4W9JC 2K7PA 1VEMA 3C6LA 5A16B 3MLTB 5F7EL 4KUZL 3VFOB 4HKXB 5CJOL 1ZHKA 1PLBA 1V54B 4BZ1L 3M1OA 4N9GB 4YBLB 4OZFH 1KXVA 1MWAB 5GGSY 1KN2H 3QFJE 4JFXB 5DUBB 2YWYA 3ARSA 4YSEA 4JG0L 5ACLA 2DYPB 2ZKHH 5I1IH 5D5MB 1C12B 4NZJA 2R1XB 4R26H 5DD1L 4Y4HB 2NW3A 1KV7A 2FTAA 3TCTA 2XRAL 2WLYA 2VDPL 3MFFA 4GO8A 4UT6L 4YHNB 4S1SH 3BAYA 1B0RB 5KSVA 5ESQB 2COVD 2MPAH 3QDMB 1JWMB 3ZL4H 2EIDA 4L4VB 2UWEB 4PJIF 3EOAA 5MEPA 4QHNB 5HJDA 2J55A 4FYSA 4P3DA 4I2XE 3NBNA 1J5IA 3WFBH 1QFHA 3KLLA 3ARDB 1JK8B 3FSAA 1ZWIA 3ARYA 4LPCA 4GS7B 1WJ3A 5BZDB 4X6EB 4NO3B 3RZCC 3KNBA 3Q2LA 2XG5B 3TN0A 3FQTA 1NBQA 2GC4C 4MXVF 4LASH 1VADA 5GQBA 5DZ9A 2OJEB 1UHVA 3QI9C 4LIQL 5BV7C 3SCMB 4NRZB 3CQQA 3L54A 4ACPA 2JFCA 4XWOC 3QNZB 3QI9D 2C1PB 4IDJL 1NFIA 1ML0A 1BD2B 3TA3A 3RUGF 4PGBA 3LX9A 1JWSB 2WO2B 3ZKMC 1MEXL 2Q8AL 5F7MC 4A04A 1HE8A 3CZKA 4IBLT 3MV8E 1MNNA 3GMLA 3JTSA 3ESMA 3BHBB 5TQ2L 3WEAA 3MTRA 3Q13A 4WZ9A 5ISZB 2OXHA 1NM9A 2K8QA 1QBAA 5FC9A 3D4CA 4AI7A 1VHPA 2BJMH 5IHHA 5T3XL 3P0VH 2CLZB 3GNML 4L3CA 4UM8A 3DV6A 3LQAC 5JIPA 1DHKA 2ZPKL 1MW1A 3OXRB 4OIIL 3TFKD 4KTDL 1PAMA 3CGTA 1PQZA 2G75A 2QZ5A 1NAML 3NFNB 3E8UH 4TNGA 4AMWA 4CVZB 4QRPA 3NPSB 3QG7H 2VDML 5I16B 1A9VA 5D4IA 4UAOB 2ADYA 2CA3A 3MBEC 4PHXA 1DSFH 4EUPA 4OV5A 3GI8L 3FTGA 1FFOA 5DU7A 3SGJA 1U3JA 3LVEA 3HI6L 3QFJA 4LEXH 4YDVA 5LJYH 2GIYA 3WEOA 1TZIA 3BN9C 2YAPA 5D6DC 1QRKA 5DGRA 1WCQA 1S8DB 3BCFA 3N1MC 4PRBB 5HYQB 1YN7B 3QQ3A 1XBDA 3AZUA 2A83A 5IEKA 3ZL2A 1CURA 5LAXB 5KYXB 2D7OA 5CILH 1ID5I 3GSOB 4FG4A 1MFEH 2UV3A 3SE6A 1L5GB 3WKMH 1O9ZA 5I0DA 3OJVC 2JMRA 3MR9B 1NFDE 2QSVA 2DF3A 1JPSH 4XAWH 1TQVA 1W2KT 4AM0A 4JO1L 1ONQB 1N4XH 4ODHH 4ANXA 2UWEE 2VXQL 4IEFA 1GW0A 4P5MB 5TE7H 2Q1EA 1UT9A 1JNNH 1U8MB 3L3KA 1M9SA 2EYSB 1EAQA 4XB3A 3NCJL 2X9WA 5C08E 2MH4A 5ABZA 3AS3A 5TE6H 3IB4A 3E6FB 2AKRA 4YLBA 3TEZA 3OAWA 2HP4A 3C12A 2BFVL 4ORGA 1E9PA 5JHBA 1BFVL 5JW4Q 4QIRA 1KCLA 3SD5A 4MASA 3L1GA 4XVJL 4FL4B 1K4DA 1GGCH 3OZ9L 1BAFH 3LD8C 3R8BB 1KBPA 3V6OA 2IDUA 1DVYA 1T5WB 3VD5A 5I8OH 4G83A 3ZXAC 1YUKB 1S5HB 1LO4H 4CSZA 4GRMB 3OAYH 4LPUA 2NY4C 3W1ZA 4OFYA 3ZHDA 1ZLDA 2R0KL 3ULVD 1JWUB 4DAGL 3REVB 3HZMB 5FFOA 1KGJA 3O2WL 4PJ7E 3O3EB 4F9PC 4HJ1A 5GGVL 5CO1A 4K7FA 4F7TB 3HZKA 3LS4L 5PCYA 5BO0D 4AUUA 5CBEB 2DTSA 1CGXA 3UG4A 3NIGE 2ZUXA 3G5YA 1QRNB 3CFNA 2YPKA 3ROOB 3MZTA 3HNSL 3W82A 1EJOH 3ZUCA 3LNEA 1CFQA 5KS9B 4L37A 1B0WA 3BC9A 5CCJA 4WHYH 3KPQA 1IGFL 2B1HL 4WUUB 3V0WH 4ZNEE 1RJLB 1TMQA 3TS8A 1MQKH 3T6XA 1WT5A 2DWDA 1H8OA 4HCRL 1UUSA 2CHNA 4F8OA 4FLHA 4GIOA 1UJ3B 43C9A 1UWXK 1LQBC 2DQUH 2YBGA 2AQNA 2R0WL 1HNFA 3G08B 3BIKB 4Z0BH 5DD6B 2C7UA 3OQ3B 4G5ZL 4FZEH 1MLCB 1LE9A 5C09D 3TA4D 2ATKA 4E0RB 4XO3A 3QDGD 2NY3B 3UP1A 3ULUL 1S7WA 2JKJA 3FQNA 3ARGA 5DVNA 2XWXA 4X5LA 4MBOA 5I0ZA 4PJXF 5BVPH 1T66D 3BGMB 1JSYA 4HQQL 4J8RB 4MNGB 3SYPA 4C56B 2DQHH 3BAWA 3RGVD 1WFUA 3V4PL 1NWPA 4K0OA 3AS0A 4OM1H 4XZUA 3KLHD 2IV9A 1XR9B 4H1LA 4MJ5B 3DUUB 1Z9PA 3K72B 3OAZK 5F7KC 4GAGH 4JFOB 5CCHE 3S96B 3U36A 5I6LA 1YG9A 4B9FA 1A7OH 3IGAB 1JPTL 4YJZL 3OKLA 1AR1D 3B4NA 3BUYA 4KKQA 1YEJL 4RAUB 3WY4A 2XKUA 1XCQB 2W5PA 1NFDA 1R24A 2DQGH 2HTKD 3U4EB 1GW6A 1U8CB 5I1GH 1ZHNB 4LBEB 1A3ZA 5GS2D 4RRPA 4A6YB 5B4MC 4WJ5B 1EO8L 2O6FA 2XCMC 2BNQD 1EMTL 5HPMB 3CU7A 1N0XH 3W57A 3CHRA 5F0LB 4CGUB 5JPMC 4X0KB 3LMJH 1CGWA 3HPLB 3ML8A 4ZAKD 3M8OH 3OMNB 4Z7WA 1N10A 4APXB 1J8RA 3MLUH 1LO2H 1FNLA 1I8UA 4JRXB 3TF7C 4UNVA 4APQC 3WS6A 3ATAA 5LQBL 5JOEA 4Z5RB 4TYUA 1ESOA 5DQJA 3VG9C 4EI5A 3L16A 5B3JF 5F9WC 1QRND 4U1KA 3U1SL 3IXTB 1FH5H 3LSOA 2NTFA 3FB7A 5AUMB 1MJ8H 3ZOAA 3QJTB 1C5CL 5J89A 1L9QA 2DQGL 4L8DA 4TF4A 5JOFA 4FQJH 4PWKA 4QRUA 4ZFFB 1NINA 1AC0A 2R0ZL 4WO0A 3UPRA 1JPTH 4Y4KD 3QYMA 4WGKA 4A55A 2APTA 4WIQA 4WFEE 3MOAL 3S34H 4LCWA 5AOIA 1M6UA 4GAGL 3RWHB 3TNMB 5EUOB 3MRGA 4U3HA 5KBDA 1NLDH 4NZUH 2FT8A 2XTJE 1N6QL 1K8IB 4JX0A 4XOEA 4KKCC 2O5XH 2XKNB 3LEVH 4FEMA 3EJQA 1R3HA 1YA5A 4P5RA 5EU5A 1HILB 1MCJA 3WY3A 1NCIA 4D9LL 4WJKB 4IOSA 3DX9B 2QSCH 2WN2A 3L3GB 2OAAA 4QCIB 1J0YA 2YUZA 1ERNA 3PU7A 5DFTA 3JWNC 1MCIA 2HKHL 1UD5A 2BP8B 2WXGA 4U0RB 1OAKL 3QS3A 1FLTX 2VXSL 3O4OC 1DCLA 1X5GA 1QUNA 1KG0A 4NPYB 4PS8A 3WE6A 3QWQB 4RLDA 3BXNA 1MG3C 2KMWA 4J3OF 2PXYC 3JTTB 2E6JA 4J3OC 1XHHA 1BVLA 1DVFD 1I7TB 2WSDA 4WFGE 3V7MA 1UADC 4D0BB 3OD3A 4X6FA 3BT2H 3L4WA 3OKKA 1R3KA 3CE1A 4HPOL 4YDLB 1MREH 2O5YH 2VO5A 4QLWA 3JBG7 1E8WA 1NCAH 1QR4A 3RB7A 1VPOL 4N8PA 1O75A 4V1DA 4HWNA 4R7NB 3FQWB 2H3NA 2WJ7A 4GOSA 4OGAD 1MCLA 1EANA 2CHDA 4MCNA 4MA8L 4NHCH 4BSWA 4DAGH 4RMBA 4YIQA 2BSDA 3WKPA 4R4BB 2N0KA 3L2LA 3Q44A 5D1XA 3QUKA 5KYUB 2YXWA 5D7LD 1BLNA 4OUOA 4I4WB 5G2NA 5DR5H 1PZAA 4B96A 2ZWKA 4UOZA 4WU7A 1R9FA 4PJFE 4BK5A 1CXKA 4MJIA 2XIDA 2C3WA 2LW3A 1WAAF 3QAZB 5A2AA 2C4XA 5DEFB 1Q0YH 5K69A 2GSIB 4FI8A 4ELMF 4BE6A 1C8PA 3Q43A 1ETZA 3IAQA 4BSVA 2KC0A 4GB9A 1C9SA 4MXWL 4Z7WE 3BDYL 3CZFB 3WXVL 1CB4A 2ED8A 1E4JA 2DQCH 1SEBB 2YPVA 1UB5B 3KLKA 4OFVA 3WFZA 4ZS7L 1RHHA 1OP5K 3IDYC 3ETBJ 3TN0D 1YY8A 5IR1A 4NM4H 4XN1A 5F9AC 3WMQA 1NCGA 3MRLB 4Z0XB 4D94A 3TT1H 5AOJA 1UXWA 4L0ZA 1DO5A 5SWSA 1HZLA 2E74C 2HUEA 2Y07H 3QDAA 3TONA 4JO1H 3C87A 1JNHB 1L7IH 1M3IA 1Q0XL 3F6JA 3MJ7B 3Q8EA 1Z3GL 3VYOA 4LAQH 3APCA 3O3UN 1KPUA 4GLRH 5CMAA 1HEZA 3FH5A 4NIYE 1FYTA 1DJYA 2VXUH 4G8GD 4AENB 2IH1A 2Y7SA 4BCXA 2QSTA 3VFTA 3V6ZB 3FUFA 3VWJC 2NQ3A 5BZWA 1I9IH 2VLJA 3TZVC 1W72L 3QB7C 5E6YA 1YY9C 3SQOH 3FSOA 3WEBA 4PG2C 2VITA 3LN4A 4GMTH 1N59A 1ZXQA 2W94A 1OGAA 2WBXA 4FN0A 4HKJB 2YA1A 4KI5F 1KCBA 4GXUN 1XGTA 4L3AA 5F9WB 5CIPH 2EE3A 2C8NA 2QDVA 4LEXL 5IB1B 1W9XA 4Q6IC 1NM4A 4LDLB 4A2LA 3GLAA 3OGOE 1CD1B 2XWJB 3L6FB 1T0OA 2ADGA 3JWNG 3PP4H 3ZKSD 3QS2A 1WISA 1F4YH 2NSQA 1NIFA 4LEOA 2O30A 3D3VA 1UUNA 2Y22A 1HDMA 4Q9QL 3AUWB 4DTGL 2J57A 1PKQB 3QUZC 4ZDHB 1DE4A 3WXWL 3O2DA 2PCPA 3S4SG 4PJFA 4YH6A 1QRNE 2MMXA 3H7BB 4EN3B 5HGAB 1C16B 3RPIA 4A7GF 4ANWA 5G4OA 2A9BA 3BP7B 1KBVA 2E7LC 3GGWB 4O2EA 2X40A 4G72B 1T20A 5JIIA 2B0SH 1UWEL 4JNXA 2VUOA 2K9FB 4G9DB 1Z9LA 3HCVA 1CXEA 3OR6A 2F1EA 2QSQA 4XWGL 1ZDSA 3VTAA 3QJQB 2VLMD 1U93A 2FB4L 4X7TA 1FYTD 4LCCA 5C71A 1MVUA 2V9QA 2WLKA 3WMSA 2ZP8A 5L2JB 2MPVA 2YBRB 2W0KA 3IEAA 3LJ3A 2X6VA 3VFRA 4KI5E 3QDJD 2ZXCA 3BVNB 3BAEL 4LVNB 3P3RA 4R5VA 2DQIL 1F4HA 4RA0C 2PLTA 3BP4A 2ZX5A 2A3TA 1BQ5A 3PWUB 4HC1H 5F88A 3IS1X 3SDXA 1YEHL 2BNUA 3ME0A 5I6XB 1AI1L 1DBAH 2PR9A 3LNFA 4H0HB 4RGND 2JI2A 4F93B 2ZUQB 3VNZA 2VR3A 4MJ2A 3Q2NA 2EECA 1T1WB 3SDXB 2Z31B 1KCWA 2EIMB 2A9ML 2WBJC 4GRLD 1U3ZA 4J3SA 4HOWA 2HFEB 2DS4A 1Y6NR 1DQTA 3T0BA 1RK1A 1GGYA 1Q94A 4GI8A 4YX2L 1BMWA 1IC7H 2OMXB 1S7XA 3ETBF 3THMH 2IAMD 3STLB 1DUZA 1QABA 3WTVA 2MFNA 1BD2D 1R0AL 4Y9EA 4XPAH 3OPZH 4AVIA 3PWPD 3IRZA 5DMIL 3QR2A 2C9RA 2Y36H 5IHBA 5E9NA 1IZKA 5TE4H 4PJGF 4FEIA 2EINB 2BNRE 3K81A 3QPQC 5EUOF 1II4E 4YS4A 4V2BA 3RNKA 3NN8B 4MQXC 2WKOA 1NH6A 3ZKND 5IVXB 4TLKA 1M7UA 4ZOEA 4FNSA 4CJ1A 1WEJH 3QPKA 1HT6A 2F7QA 4OJCA 1C16A 3NDZE 3HEIB 4XN8A 2WLLB 1KFAH 2VDNL 3UJJL 5GXBB 5CJXC 5KVGH 1GC1H 1AD0B 3I74A 1DE4B 1LXMA 5D7IE 3BKYH 5BV7L 5E6UB 3KCPA 5GRWA 2OR8A 4AZ8A 5KYYA 3T65B 5LXVA 4K9EH 5AZ2H 4EVNB 5J5EA 1P4UA 1ZJAA 2YOAA 5FO7B 2AJUH 3OR7A 2ADGB 2NXYD 3GSWB 5FYLL 5CLYA 3WSQL 3NCMA 4PP1C 3ABKB 4MA7L 3L3IA 4HJJL 4GI9A 5D71L 5SX5H 4NEHB 3HHRB 2EH7L 4IBVA 3VXSA 1W16A 1AQDA 3NIFE 3VRIA 1SXAA 1FUNA 4HIHB 5A2CA 4HKJA 2W81C 3US0A 1GHFL 1A1MA 1N59B 1G7PA 4XOAA 3EF4A 2VITB 3CSBA 3R4DA 4B9IA 3D18A 2G2RA 2VLJB 4G6JH 2OZ4L 3SY0B 1TPXC 4KC3B 4IIQB 1E0OB 4PJIE 5H35B 5T1JA 2D0FA 2WXFA 3S88H 5LGJA 1IX2A 3VTMA 1HEZB 1ZEAH 1J9SA 2IG2L 2RFXB 3T8XA 4KKZA 2B39A 2ADFH 4L18A 1JZDC 4W4NA 5CKGA 3FK3A 1OP3K 1OCCB 1JNHA 3MJ7A 4HFWA 3S2AA 1I85C 4EOWH 1ET7A 1UKTA 2W8CA 3BDBA 2FQGA 4UNTA 2IMNA 4ZOCA 4KV5E 4AQ1B 5IHZB 3FXIC 1B2WH 3ULSA 1EK3A 1HN1A 3KWTA 4M43H 1I1AD 4M5SA 4MMZC 4IDLA 1OLZA 1AI1H 1DBAL 2X4PA 3HI1A 3UBHA 2XOTA 1FZJA 2G4GA 2ZCKH 4YDLC 1N5YH 1Q72H 5EZIH 3K0YA 2ZKWA 2ZKYA 3LH2L 4TMPA 3MGOB 5EU6E 4HYTB 3FRPA 1O7SA 1M53A 1QSVA 2FL5B 4U1JB 2HPTA 1D9KB 3MNZA 1NCBL 2YJQA 2WTOA 1ETZB 3WDIA 5IHWA 5KSBA 4HIIB 3SE8H 3BAEH 1DUYB 1LK2B 2F74B 2GSIA 1NL0L 2VXTL 3SY6A 4NZDA 5DD0H 3WNNA 3UGXA 5E6IA 2ZCZA 1E4WH 4QHUA 1FA4A 3FUMA 3ZTNL 1PY9A 1R4XA 2V37A 1XZ0B 5CZXC 3B8SA 1PW3A 4JCMA 5I9QC 3U0TA 12E8L 1J8HD 4AL8H 2VXQA 2HT4C 5CBAA 3S8FB 1H8LA 1BFSA 3ZE0E 3SQBA 1T1XB 3KPLA 1KLGA 4MJ6B 4OGYH 4U3SA 1USZA 3FMGH 5DMJB 4HF5L 2FVNA 4PJ5B 5GJSH 4APQB 1UZ6F 5DI8B 3VRLF 2B4CL 3RVTD 3UMTA 4MVBD 1ZHLA 2IGFL 4IOFD 5FGSA 4IGBB 2JLPA 1AO7A 3IK2A 4AGLA 3OKKB 2EKJA 3FQXA 1TQWA 5DJ8B 1YAZA 2NYYD 1BFOA 1J5DA 3CHOA 3FQUB 3KWWA 1IGJA 2WY3B 3KXFA 4PJ8D 4LXFA 1F0LA 2CLVB 5IMOA 3RFZA 4Z7UE 2VJ8A 1F90L 4XVUC 3WJMB 2HRPL 2CJTA 3PY9A 3G5ZA 2H3KA 2B15A 3MOBL 5CSGA 1CD9B 3PXHA 5D72L 3UACA 2ZG1A 2V7HB 3KL5A 3P0GB 3QFGA 3QJFA 5I0XA 3IMBA 3PHAA 1EGJL 7PAZA 4PRDB 3V0GA 1F3DJ 3U0PB 2F8XC 2P26A 4GKZB 1IQWH 2X53A 3ABLB 5AW3B 2X4SB 4B7IA 4Z7OE 3SQOL 2V5TA 2YXVA 5E6IC 2ZSVA 4NKOA 4H88H 5EU5B 1Q9WB 4S1QL 2AANA 4BUHA 3AROA 4IKLA 2OMYB 1TDQA 3C5JB 5EUOA 2VXUL 3HS0C 5E1IA 1UD4A 2AF2A 3MA7B 3MRHA 1YPZE 3QEUA 1EZSA 5KBLA 1TZHA 2HJKA 2QQQA 2NUTA 3OG4B 2ICEC 4IYKA 2IO5A 5EZOL 4AYDC 2PKDA 1RZGB 3E1F1 4MD0B 4QRUB 5DJ0B 4ZFZA 1BAWA 4ODTH 2MWCA 2B9AA 3TT1L 1IKFH 1WZKA 2HLFD 4BKLB 2CSPA 2DJMA 5T1LB 3NOIA 1T89A 4OCYH 3VSTA 5E08L 3IXTA 1U8QA 3ISYA 4ZS7H 4OD1L 1LYQA 2OTWB 2R27A 4HHWA 2Y3AA 1GKOA 4M7LT 3A6CL 5AB0A 2MNWA 4EI5B 1LDPL 2GIXA 4WF7A 1NFAA 3BT0A 4ANUA 3KJ4C 2R2HB 4BFEA 3ZHLA 2HKFL 5E56A 1XEDA 2HX7A 3WNPA 1CU4H 2PO6D 5GRVL 2HWZL 4X0KA 3F2LA 3ZZQA 2Y0SA 2Q6WA 4RNRA 3ZDYE 2EACA 4GO6B 5EOCL 2PYED 4YK4B 5SWZE 4ALAC 4BV1A 2A2QT 3NJJA 4PCYA 5J57B 3MLWH 5JHLA 2QQLH 2WXKA 4IBYA 2ZP9A 3IU3B 3KGRA 3NSXA 4QXUL 4A6YA 3X1BA 4NENB 4DGVL 3NIDE 4WEEA 1DZ0A 4LOFA 5MENA 4FQXB 4Y4FA 2DM4A 1AJ7L 1EV2E 1U36A 2VLLB 3PHSA 4WKZA 4YFLF 4PRHE 1L0QA 1M4KA 2ITDB 5CP7A 5GS1A 3H8NA 4PR5A 3KR3L 5TDOA 4NIKB 4KI1A 2YQ3A 3JV4A 1GZQA 4OBRA 2Z91B 4XRCB 2V5YA 1JHTA 5F3HB 4MFHA 2A74A 2F18A 3NSDA 3P3UA 4IHOB 1EX0A 2IDFA 2ILLA 3PL6D 1N8OE 3DV4A 4PY7B 3VI3F 1GS6X 4YXLL 3N41B 3MLVH 5CFAA 3MX0B 2E9GA 3BGMA 1YC7A 2VSMB 5I18L 1S7WB 5D7KE 1D7FA 3DDGA 1NJ9B 4ZFOB 1IEBB 2X3CA 5F1SA 2ZCHL 4MQ7B 1G7JA 4MAUH 4KJYA 1QI3A 5JIMA 3CBJB 1TZOA 2XKSA 3EUUA 4J6RH 4PGDB 4P05A 2ZUYA 1FL6A 4PJFF 4TVPH 4M3KB 2NSXA 4UTAH 1QKZH 3SGJC 1FDLH 3LEYL 2KZ1B 5CZKA 2X0VA 3M86A 4PLJD 3X12B 1G9NC 4YEFA 3APDA 4QRTB 5EEYA 3CXFA 3ILQD 3P9MA 3QXTA 4I88A 4L37B 4NQDB 4MMZB 1LMKA 4ATWA 5I1AA 5CINL 3ROOA 3F84A 2W60A 5CBEA 1NCWL 3CLEH 1OM3L 3KYMA 5F7FA 4OVUA 1A0QL 2DIBA 2HJFA 1OOAA 4LSTH 5ETUB 4ZTOL 4E9SA 5I5RA 3ISWA 4M5YL 3PL6B 4K5LA 4K8RC 3A6CH 5B21A 4G6AD 3MCYA 4NKDA 3K1KC 3V8CA 1EEYB 2VQ1A 1NGWA 3DJTA 4PJEE 3L3DA 5E9DE 2FH8A 2YD1A 3BIAX 1P6WA 1S3RA 3K4AA 5L2KE 2X4NB 4U1NB 4FP8H 5E1AB 1D2OA 3QYCA 5EV7A 5FYJL 4YSCA 2ZUWA 4JRYE 4NCDA 3L3DB 4QJ3B 1NUGA 4UZSA 5C0AA 5EZOH 2Z8RA 1E30A 3OKMB 4OLXH 3CFBB 3B9EA 3WENA 2CO2A 1NMAL 1IGML 4DN4L 2HFGL 1NGXA 3QQ9D 4RIRA 5GS0C 4FFYL 3UZEC 1FAIL 5KVDE 4HK0B 5IJKC 4B41A 3PNRB 3N9GH 5I1AB 4H88L 4DPBX 1ADQA 1JDCA 3QPXL 4NQDA 4FAAB 5IJKA 3B2PA 2ZUQC 2BDNH 5JW3H 1IQWL 3MUHL 2FUQA 4PP1D 3MLZH 2DD8L 5B39B 1FL5A 1RQ5A 3SGEH 3B9KA 2A9NL 4PPTA 1HVXA 5AVWB 4HUNB 2E86A 4XMPL 3TC9A 5C0CA 2G2NA 4N2GA 4MQ7A 5C0IA 1IEBA 2N1KA 4XMVA 1RUPH 2VDMB 5DLML 3RA7L 3TBVB 4HEPA 4KWUA 3ZT7A 1QP1A 3GSOA 1E42A 3L48A 5IVZB 1AKJD 5DEGB 1FVCB 3G6DL 5KYXA 4JHAH 3WFEH 3EF7A 1YMME 4HQQH 5C0GA 2ID5A 3HUJB 2GJZB 1ACZA 1AZVA 4PRBA 5HYQA 3ZO0A 1ZSDA 2Q5BA 3BD5A 3IJHB 3BKCL 3N0PB 4L2LA 1NDTA 4JB9L 4K4KA 5F8QC 2VDPB 4XN2A 4LU5L 4Y19E 4P4KA 1ZXKA 1A9BB 4FNRA 4Y1SA 5EU4B 1ZHBB 4QT5A 3SO5A 1IGFH 4DETA 3BKML 3C60B 1SUJA 1PQZB 2G75B 2R0LH 3CV5A 3M7OA 1I8AA 4O58H 3RX8A 7TAAA 2FIRT 5C3IA 3KDPB 2EDHA 2VXTH 4IJ3B 2KHAA 3DPDA 1F6LL 1D6VH 1FWXA 2IF7A 3A5VA 1I9EA 1H5BC 3GEWB 1IVTA 4HWUA 4RQQB 3TIDA 4RMQA 2H2SD 5E94A 3U30B 1W0YT 5FUCE 5ISZA 3CZNA 2ZIDA 1OF2A 4PYHA 3SOBH 4WNQB 2QMJA 1DJZA 2VLME 2WN3A 3EYVA 4IKJA 2CRYA 5T1LA 1MFDH 2R7EB 4P5KA 2J1YA 1BD2A 2QTVA 5JLZB 4ZUSB 4JRLA 2R9HC 1S78D 3QA3B 4M8UA 1U4EA 1NMBL 1V05A 3DYOA 3T8VA 3KPMA 4AEEA 4EUPH 5D1QA 4YXKL 2J88L 4NRZA 4RFOL 3SDAA 2ARJA 1NBVL 1LEGA 2N1TE 3BLPX 2ADFL 1VKXB 5F7LB 5IW3A 3GXMA 3S4SB 3FTWA 1ZWIB 2HZHA 4AYSA 3OGCB 4DGUA 3GTTA 1BIIA 1CL7L 1AG0A 1OQOA 2OMYA 5L6YL 2G9HA 4FFWC 1YEIL 2KDYA 4NJ9L 4CBPA 1IAIH 4M4RA 4UQDA 5TE6L 3EOAB 1GRWA 2OL3H 2OK0L 3ESNA 5T5FL 4KFZC 3NPSC 3U0PA 4RMWA 3A4FA 1RHFA 4R8WL 4NN5B 1OCWH 4PRDA 3MFFB 4L4TD 3QVAA 3HBPA 5HDQH 3AXLA 4OZGE 2LTQC 5F21B 3RWIB 3FF7A 3VRJB 4MA7H 1SMOA 1JDAA 5HJGA 2FX8H 3T3ME 3TBBA 2GIMA 4GXVH 3LRKA 3Q1SL 5D8JH 3WJMA 5GZOD 1LILA 1MIEH 4LESA 1L6ZA 3QUMA 3NEEA 3KXFB 5C07B 3SZKC 1A14L 1OK8A 1A3RL 5DUBA 4K9EL 3DO7A 4Z76B 1DTUA 2DIAA 2F7IA 3U7WL 2ZCLH 1I8MB 4LB8A 1MAKA 1TQBC 2OKMA 3VFOA 5D7HA 3KYKL 4PJAB 4U4BA 1NBYA 3C6LB 5JNYA 1WG3A 4Q97A 3MAWA 2BX5A 1XB6A 5DI8A 1H5BA 2W1NA 4APQA 3RGHA 2IJ0C 1XF5B 4AIOA 1KSRA 1SVZA 1E5AA 3GXNA 1KGWA 4LARL 1KENH 3L5XH 2PCFA 4M48L 1N6VA 1I8MA 1H0DA 3FH8A 3OJDB 4Y9CA 5K1NA 3A4AA 3JT0A 1TTRA 1LHZA 4HPHA 1NMCC 1OSYA 4H25B 4C4KT 5KS9F 2VZSA 3E3QC 3N42B 4N87A 4U7MA 3WFDL 3AVEA 1BOYA 3EYQC 4OIIH 2ZPKH 1JMZA 3AXLB 5DZLA 4KXAA 3JWOL 2J4WH 1BD2E 4P9HC 4GT0A 1FV1A 1HEHC 3K6IA 1ZIAA 4YL4A 2PXYB 3PREA 2E9WA 1KGCD 3EGXA 4K3EH 4PIBA 2LVCA 1MEXH 2Q8AH 4PJ9A 2X4OB 3VX0A 2DMKA 4GT7A 1IGCH 3ABZA 5JUEH 4TLUA 4OFDA 1SN2A 3LNHA 3ZHKA 5DO2D 1CF8H 3T3PB 4P07A 5IB4A 3CZGA 3L3JA 2AGJH 1WA0X 4Y16B 5F9JA 2YFOA 2KYIA 1M56B 3BZFB 4NC2B 2ARJB 1THAA 3DUSA 4F8NA 1S9XA 1EJFA 1OXYA 2P28B 1SVCP 5JPNC 2XT1B 2C9UA 3QRGL 3K2MC 4BH8B 4BKSC 1QYGL 4ZUSA 4XNBA 1KTLB 2FUTA 3MJGX 3RI5F 3I6SA 1FL3A 3GSQA 4ZS6C 5DA0B 5C7XL 1ZD6A 1VESA 5E8DH 1MY7A 2RAMA 3CFEA 1U2YA 1XL4A 2OSWA 4CAGA 1P7BA 5DQDL 2DMHA 1BWWA 2GAZA 3TIDB 3DWTA 1JXKA 3VRIB 4ABWA 4Q2ZB 1IZJA 5JXEC 2FBRA 2XWCA 2Z34A 3JWOH 3KDMA 1HH6A 4KKAD 4AYID 4B5ZA 3B7RL 4N9OB 1FG2A 4X6DF 3DIVA 1J5OH 4P5TC 3BD3A 1IAOA 2CUHA 4F7PA 2E46A 2JE8A 2PF6A 2QADD 4N26A 4D0DB 5C0JA 2ETWA 2P3YA 1FNFA 4NQCB 4QT5B 5GGTH 3U82B 4WW2C 4NZ8A 3VI3A 4XC3L 2DQ6A 3WU1A 3FQYA 3AG1B 3II3A 4AKPA 3KCPB 4DGYL 1QMUA 3QDGA 1ZVSA 3H2PA 1HZHH 5G4MA 2C1OA 5I1HL 3JVGC 1MVYA 1SYSA 1CD0A 4DWHA 3WUWG 1ZSDB 1AKJB 3BLKA 4LVHC 4EI6A 2NYKA 4EE2A 7PCYA 1KACB 3D12B 3L95A 3VU2A 4GMTL 3BUPA 4ZXBC 1UKSA 3BAKA 3H9SD 4OLWL 4RCAA 4FTVD 5FIEA 1I9IL 1UOVA 3B2MA 3RNKB 5I1CL 3Q06A 1A3RH 1LNUA 4XC3H 3TBVA 1KWKA 3CMGA 1EEZA 4Q58C 4POYA 4P2OD 3EDEA 3Q1SH 2BP0A 4GXVL 4NUPA 5C0IB 2VKXA 2Q8BH 1XGRB 2FBOJ 2ZYRA 3FW6A 4XB8A 2Y72A 3H3KA 3IETB 1L7IL 4KMLB 2RGSA 1Q9OA 3SPGA 3HC4L 4FA7B 1J9CT 5AW6B 2XZQH 1SLXA 2MCPL 2EE9A 3QEGH 2OJZH 3QCTL 1ZA6B 4HUXB 1G9HA 4HBQA 5FW7A 2CALA 3ZTEA 4K7PY 4F20A 4IRZL 5BS0A 5JMRA 3LRSB 4RZKA 4Z3EA 1IM9B 2CR6A 3JVFC 4N2MA 2OI9B 4KV5F 1CGYA 5E8DL