3BI9X

Tim-4
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
MSEDTIIGFLGQPVTLPCHYLSWSQSRNSMCWGKGSCPNSKCNAELLRTDGTRIISRKSTKYTLLGKVQFGEVSLTISNTNRGDSGVYCCRIEVPGWFNDVKKNVRLELRRALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell immunoglobulin and mucin domain-containing protein 4
publication title Structures of T Cell Immunoglobulin Mucin Protein 4 Show a Metal-Ion-Dependent Ligand Binding Site where Phosphatidylserine Binds.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2007-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bi9X00
1M7IA 5ITFB 4KHXH 4CDHA 4PLOB 1G0YR 3B9EA 2J6EA 3EDFA 1TTFA 3QUYB 4NCC2 4P3CH 3PHQA 3BAEH 2OYPA 3RNQA 1B0WA 1LP9A 3O45A 4K94L 4JPVL 4KKAD 3RVUD 3OJDA 2IPKA 1XT5A 4V2BA 4PP2B 2EE2A 3CK0L 1N6QL 4NHCH 4XB8A 4MXVE 1ES0B 1KTRL 4NO3B 1FO0B 2QHLA 3WE6A 5HJ3A 2J8UF 2J6EL 2VXSH 2DQHH 2XKNB 4L4VD 4PJDE 4KTDH 2VDKH 5B38G 4ZOEA 1K3IA 3M1BB 1QSFD 2AEPL 1JHLL 4KPHL 3QP3A 1RZ7H 1NDGB 1TITA 1AGEB 5E08L 4P5MB 4LAQL 4OKVA 3BRDA 5HGGS 4OBSA 2CLRA 3X11B 2DBJA 3WIFB 5EFIA 1MCHA 4ONOA 2I26N 5CEZL 3MGTB 5HI5C 1U91B 2GKIA 2X89D 4JQIL 1KSRA 5T1KD 2BNUA 5GGVL 4QOKB 2R8SH 1ZLWH 2BCKB 2EYSA 2VL5A 4EN3B 4NKOB 3RWHB 1U8PB 2XOTA 3LSOB 2F5BL 4DKFL 1H5BC 1GXEA 2O26U 2XXCB 5GIRB 4U6VH 4Y4KD 4ZSOB 1OL0A 4LDLB 3K0WA 4LKCA 4ERSL 4LCWD 5SWSE 32C2B 3WS3A 5DJDA 3NMEA 5B21A 4P0DA 1EJOL 3OQ3B 4ZPVB 4P2OD 5SWQB 4P99A 4ZOBA 4LRNL 3WD5H 4M5ZH 2R56H 2I5YL 1MIEH 4AYFA 1A6TA 2FATL 5MEND 4X4XA 2E6JA 4XXCC 5GS1C 2X4TB 2GI7A 3RUGA 5IR1A 1C5CL 2NR6C 2BJML 2FO4B 1AQDA 3D18B 3UJTL 3V7AG 3H3BC 1IEBB 2GK0B 3V4VH 4E0RB 4PJAB 4HV8A 2NW2B 1I7RA 3GHBL 1E0OB 3DUSB 1DFBH 3ZKQD 3W39A 1EAPA 3RFZC 1DQML 2AJSL 4JFDE 1E27A 3HCVA 3VFWB 3WFHA 2HTKD 1IFHL 3HPJB 4NQEB 3KLHD 1DLFL 5K93A 2L7JA 1S9KC 1DCLA 2HRPH 4OZGE 4WW2A 1G7JA 4C57C 1C1EH 1J8HA 3UYRH 4RFNB 1NLDH 4JG0H 4X80L 1WAAA 4IDJH 4HUNB 2ZG2A 5DUBB 1YPZF 1IAOA 4O9HH 4JPWL 4LSPL 3C5SA 3DYMA 3MYJB 5B4MC 4TRPH 4F7MB 3X12A 3K2UH 4YHLH 1HILA 5DDHA 2EH7H 4MQXD 1NGWB 4QXGH 3VXRE 4G8FA 2ZUUA 4KJQD 4PUBH 4HPOH 4XVTL 5FM5M 4EDWH 4P46C 3QEQA 2FJHB 1I3VA 3S37H 2AJYH 1KB9K 2HLAA 3L3GA 5FM4A 2A83B 2BFVH 1QLRB 1WIUA 5F3HB 1KIRB 3LAFA 1I9EA 5EOTA 3WBDA 1NGXB 1UA6H 4FXLA 5C9JB 1PKQB 3J8F7 2DQIH 5C0DA 5SWZA 1MCDA 2VLJB 4HF5H 5D7SL 2W0FA 2AEQL 5E2JA 1QHPA 4YXHH 2VXUL 5E8DL 2E9WA 4KV5E 5E8OB 5CINL 4Z7VA 1I8LC 4IEFB 4JFOB 3QI9B 4PY7B 5C7XL 2PR4H 3OF6A 4PG2A 4P57B 3E3QC 1HYSC 5B39A 3TJEH 5E5UB 3EZJB 3G5VA 1I1AC 1CDYA 5T3XL 2XIDA 4FQXB 1K85A 1UJ3A 1S9XB 5C0RH 5EBLB 1LEKB 3L5XL 3U36B 1OD7A 1FP5A 5MHSE 4OLUL 1AQKH 2G5BA 1P69B 3WEXA 3O3BB 5H94B 1XF2B 5GS0L 2R0WL 1QNZH 2YXFA 3QQ4A 1D7FA 2RB8A 1IC7H 4JFQB 4JM2F 5IEHA 3GI8L 2NNAB 2BOBB 5DJXA 4PJCF 3FQNA 5EUOE 5HHPB 1UKQA 4ZNEA 4PJFE 1A22B 3BKML 3TC9A 4R4BB 4G9DB 2RIKA 4ZNCD 4U1NA 2DD8H 3NFPA 3CFDA 2I27N 4DVBA 5HBBA 5A16A 4YQXL 1S7QB 2FEEL 1T2XA 3ZKXC 3CAFA 4PJBF 2VAAB 4OGZA 3LEVH 3HG1E 3D1MC 2ERJC 3QDGB 3LN5A 1K6QH 4HKXB 4BSVB 3F7PC 1KB5B 3KG5A 3GHEL 1RZFL 3NOIA 3O9WB 2H9GB 3O4OC 4I77H 5DQDH 4MD0A 1OAKH 3QDJA 4HGKC 1LO2H 4GMSL 5CSZB 2HMIC 1AI1H 3IKKA 2RBLA 1L9NA 3UBXB 3QYCA 5JTWA 4ZYKA 5GGUA 4NN7C 5D71L 1TVDA 5I1JH 5CZXC 1T04A 5CGMA 4JZOA 4QF1B 1HINH 3B9VA 3PP3H 4QXWA 4WHTA 2B5IB 5GS2D 3WNKA 1RZKC 2VWEC 3IJHB 2XRAL 3JTTB 1OTUC 4XPAH 4L8SC 1YEFL 3V8CA 1BX2B 2VUYA 1BQSA 5FHBH 4GKNA 5FYLH 1MI5B 5CBEA 3ILPA 2B20A 3REVA 3U0TB 3SCMA 2K9UA 3P77A 4HWZB 4HFUH 1L4IA 4IRJA 4JLRB 1I9RH 2Y23A 3QIBA 5E1AB 1HWGB 3PL6D 3DX6A 3PGFL 2YPLE 1FFRA 1D5XA 5INDB 3CMGA 4OCSL 1N6VA 2A6IA 1WFUA 1NCDL 5GRJH 4ODBD 3KDMB 5TQ0L 5ICYA 2V5TA 4RGMB 1I3GL 1P1ZB 3RVWC 2YPVL 3INUL 5LAXA 2GFBB 1LEIB 2VISA 3I85A 4S1SH 3F58H 5D1XB 3E6FA 4HZLB 5ANME 1T1WB 1XF4B 2WLZA 2X42A 5F9WB 3ZLQC 1I75A 5A2LH 4OCMC 1FJ1B 1I8MA 3SDAD 1KNOA 2FZ3A 3FQWA 3S88H 4K07A 3NFNA 1EFXB 2JB5H 3NABL 1KIPB 4OI9A 3DWTA 4R0LA 5E2UH 3OGCA 1RIVL 1DLHA 4GBXD 3H9ZA 3OX8B 2AXFB 5BXFB 1K4DB 2FSEB 3CZJA 4PRAB 3SJVB 5JDJA 3MV11 1J1OL 4GSDL 5I9QC 2H6PA 4XHJC 5FA4A 3QAZC 4HXBL 1CXIA 1KEGL 5DHXB 1ZOXA 1EFQA 4UNVA 1XIWB 3B9KB 1KPRA 4OCRH 1N26A 1LO4H 4JM2D 2C3VA 3BDYH 4QHLB 3O4LD 4WUUB 4Z76A 5T5NG 4E5XA 3VJ6B 4TNWK 3MLPA 2I9LB 1KJVB 4PRPA 4Z7QE 3MACL 2VXVL 1OAQH 5HDQH 4BUHA 1G6RH 3QH3B 3IXTB 2YEZB 1RZKH 1LO3H 1A7NH 3JV4B 4LASL 2F8VA 5C09D 3VFNA 5FUCC 4FG6D 4I2XB 3B2UC 4J3XA 4ONHA 2R0LL 3CVHB 5HHOB 4CVZA 2IQ9H 3U0PB 2MFNA 3ULUF 3EFDL 2FIRT 3WIHA 2FJGA 2CLZA 1MWAH 4Y1AE 3MR9B 1UWGL 2VC2L 4IHOB 3U4BH 3QJFB 4UAOB 1F3JA 35C8H 4IRSB 2F5AL 3P0VL 4Y8DC 5ESAA 1K4CB 1IM9A 2R2BB 3QCUH 1H3GA 1JPTH 3D39E 5D96C 3UTPD 1QFWI 1EDQA 1W0WB 3KNBB 2GJJA 4KTEH 5HY9A 3K4DA 1CGWA 3MA9H 3VXPA 2AI0L 4ZFFA 2NY5C 5J89A 1AO7A 1HKLL 4R4FH 1QHOA 2W9EH 3WIHL 4U7SA 5KSAC 4PJ8C 3LN4B 1EAJA 2XTJB 4ZUSB 4LVOB 3QFJA 1S7WA 1TDQA 4XPTL 1VERA 2Y06H 3L5WA 4JB9L 2P8MA 4PBWD 4KRPB 3AUVA 1ADQA 5IESH 4PJHF 1HDMA 2JJTC 4WWKA 3TBYB 4KY1L 5EU3A 1FBIL 2YHGA 1YECH 4G7VL 1A5FL 3G6JF 4NWTH 5DI8B 5I1LB 4YGAB 3GSVB 1B6UA 3LDBC 4LFHG 1TTUA 5KVDH 4OLZL 1ADQL 3ZMRA 1MJUL 5IVXB 1I7TB 5C2BH 4X5XA 2E7MA 2B4CL 2QSQA 1JNLH 3IDIA 4OF8A 4WVRA 5BW7A 1H15B 2JLLA 2VZ3A 4KAQL 1CE1H 1TCMA 1JVKA 2CDFB 3TN0B 1YN7A 5I74B 1W0YT 3IDNA 3VWKC 1SY6H 3VFUB 4G7YH 3MCG1 3BGMB 2V7HB 4QRPE 4PRDA 4K3HA 3MRRB 3N1QC 1YEEH 5JIPA 2DQGH 1VKXB 1FLTX 1I1RA 1KXTB 5FKPA 1MCRA 5DMJB 5CJQL 4YDJB 3LS4L 3O6FC 1KLUA 1UH2A 3QHZL 3WXVL 2NR6D 2VQ1B 3MJ7B 3DRTA 1AGCA 2VB5A 1IEAA 4FTVD 1BQUA 1TETL 3Q6FB 2ARJA 3WS6A 5E6YA 1JUFB 4F8TA 3HE7C 3CPLA 2Z31A 3RWJB 3LZFH 3S34H 2NY5H 4R3SA 3SDXE 4MA1B 5C0IA 3ARBC 3VXQB 3RVXC 3P0GB 1F4XL 3PDDA 3DMMD 4DKDC 4X6FB 3BJLA 4WV1B 4PLKD 3ZDXF 3K4ZA 1RJYA 5B22A 3ARFB 3DROA 4U6HB 2HP4A 1MCPL 3U82B 1RZJC 3GIZL 3KPRB 5B4MD 4FMFA 4XP5H 5JDSB 1OB1B 3GM8A 2VDML 4JGJA 5DRZB 3VCLA 3ULUD 1EBPA 2VABA 4GXVL 1JNNL 4N90E 1P7QB 4PJIA 4NQVA 4N8PA 4A6YH 2AK4E 3MRGB 1WFOA 5I8CA 1T1ZB 1QR1A 4RCAA 5ACZB 4GKOA 4UQ3B 1J8KA 3KGRA 1IILE 1R3HB 5K59F 1BM3H 3FFDA 2PO6B 3A6CH 4OT1H 4ZSOE 3ZL4L 1U2CA 1XCTB 3QDAA 3RTQC 3EYUH 3G6AB 4ZXBC 5B3JF 4PGDB 4YHPB 3QWOA 1BVKB 1EIBA 3A6OA 3NIGE 3GJFA 3QCVH 4GRMA 2OK0H 3U30C 3I2CL 5D7IB 4DGIL 2R29L 1U6AL 4O4YH 3RHWF 1GH7A 4WFHD 5JO5B 1CLCA 2I9TA 5FDWA 3ZYOA 2F58L 3GGWA 5CGYC 1ZSDA 1HYSD 1I1FB 2VE6A 3TT1L 5FYLD 1ZTXL 3EFFA 3W2DL 1I1AD 5IB1B 5JNYA 1J0ZA 5J0BA 3QIUA 1UB5A 3P30L 3GO1L 3HE6B 2XKSA 4PJAE 3VXTA 4KXZH 4OJFL 4P2QB 3MLZL 3RVVD 3U2SB 5D1QC 5DUPL 5EBGA 1MHPH 3ELAT 3QEUB 5JOFB 5C0BA 5C0AB 2VIRB 4OIIH 1T66D 4L9LB 3KYMA 4NQEE 3MJ6A 4RMUA 1A02N 1P4LA 3K46A 2E3VA 1KJ2A 4LBEB 2BNQB 4Z95H 4KKBC 3DURB 3QB7C 2GJ6D 2KZWA 3U79A 3GIVB 2LTQB 2FD6L 3NBNA 1RZJH 1IEHA 4QTHA 4Y19B 4FZEH 5F6HI 2BC4A 3KXFB 2IALA 4XBEL 5J12C 4NO3A 3FO2B 1KJ2L 1VESA 2IH1A 3O2WL 5DHVH 4LF3B 4P5TB 1NQBA 4HZAA 1FORH 3HZYA 4M9OA 3A6BH 1IRAY 3RNKB 4PREA 4EQ2A 4DUWA 4ALAH 2DMKA 1MJ8H 1EA9C 4P5MA 1WJ3A 2PW2B 4PGEB 2HRLA 3D87B 3DVNB 1PKQE 5DJAA 3X11A 1B6DA 5F1KC 5EA0L 5C07A 1ZANL 4NP4H 2QKIB 3F12A 5DR5L 3MLVL 4MGXA 1WIPA 4JN1H 4I18B 3MGTA 2MNUA 1U91A 3CFEA 5KVGH 2A2QT 2MKLC 3G5YB 4CW1B 1ZEAH 4MQTB 3RWHA 1U8PA 2JCCB 4F37K 5HHMD 3PXJA 3KR3H 4HJJL 5GIRA 1T1XB 1KEML 3NFSH 1JCKA 4U0QB 3WKML 3WMSA 1SBBA 4XNUL 5F7KC 4APQC 4L4VB 1PLGL 4D9LL 2CK0L 2C3WA 4ODXB 4UDUB 2ATPB 2X4UB 1QSFB 4HS6A 5AZ2H 1ZGLB 1QO3A 1KIQA 4NRXA 4MA7H 4L3AA 2K3TA 1FL3B 1OQOA 4K7PY 3CDGA 4G6AC 5F1IB 4HKJB 1R0AH 4W6XB 4JDVB 3CDFA 3RVWD 3KS0H 3BP7A 4LQFL 4GS7C 4ELKA 3MUJA 1F3DJ 1MHHA 1F97A 5MI0B 5T1KB 2FO4A 2VH5L 3D18A 1MRCH 1SJHA 1RK1B 3TV3L 4PB0L 2WSKA 2NW2A 3RRQA 3VFOB 4GW4B 5KSBF 1S7RA 3UCRA 1WZLA 4Y4KB 5J06A 3GMPA 1GOFA 2A77L 3C5JA 3IJSB 3D2UD 4F15B 1T5WA 4LCWB 2R23A 5E99L 3VFWA 3RX7A 1MFAH 2YUZA 2ITDA 3QDGE 4X6CE 1T89C 1MELA 5DK3A 1T2JA 5CHNB 3TVMC 4XHJD 1MCOH 1Z9OA 1EEUA 3KHQA 3B43A 1A3RH 3L3JB 3TO4C 4LKXA 1UH3A 1NUFA 2CGRL 4N5UA 1TZHB 4XVJL 3MYJA 4HS3B 1GYAA 4Q0XH 1D6VL 4M43L 4JZJA 4TVPH 2AV1B 2HJFA 4JQXA 2NMSA 1AXIB 2BMKB 1KC5H 1W8OA 1W0VB 2FJHA 4ONGL 3B5HA 2A83A 5E8NB 5IQ9B 3FN3A 3ZDXE 2OMBA 3TZVD 5F3HA 5IOPB 1NGXA 2D0FA 5C9JA 4RX4D 1FNFA 3B2UD 5M95B 5DVMA 2X2YA 3FN9A 5KBNC 1RZIB 3GSNH 1DBBL 4ODUB 1A6VH 3MZGB 5F7YC 5AYUH 2DLFL 1PG7H 1GGCL 4RWHA 5JZ7C 5A2JH 4D3CH 5L6YH 2Y5TB 5E8OA 3OR7B 5KS9B 2P5WD 2OR9L 1ZGLM 1FGNH 5ADOH 2J88L 1YMME 3BSZH 2G5RA 1BD2B 1IC5L 3T0EE 2CDEB 5DLMH 4M7LH 4DTGH 3EOYG 5ALCH 4PJ8D 1S8DA 1U58B 3S4SB 2E7LC 4LSRH 2O5XL 1II4E 1CLOL 2YKLL 4QXTB 5FHAH 4F9LA 4NFBA 4X7TA 3ESUF 5EBLA 3DTXB 1SYVA 1LEKA 2J8UB 3QNXB 4N1CA 4OF6A 5DT1L 1OGAA 1SYSB 4JKPH 3RY5A 4KVNH 1XGRA 5DD6B 3CX2A 4LVEA 2WUBL 3EOTH 3NPZB 4PJEA 3VI3F 2IBZX 3O3BA 3AB0B 3DARA 1E4WL 2GTZB 1HZHL 4E42A 1IM3B 3DX9A 4K9EL 1XF2A 4Z7WA 1MVUA 4PJGE 4WFED 5CJXC 1BQLL 2H32A 5E9DA 4PGCB 4J4PC 2NNAA 4DN3H 2BOBA 1HNGA 3TBSB 3BKCH 4KUZH 3VWJC 3KAAA 4OCNC 1I9JH 1YEIH 4P5KA 4KGJA 2EE6A 2Q8AL 4AEFA 4CJ0A 3MNWB 4POYA 4L29B 4LQ1A 1WZ1H 1QFWH 5I16B 1V7NH 4HK3J 3VWKD 3HS0B 1J87A 2DQCL 3F7VA 3QPQC 5AEAA 3BKJH 4XNYL 4PJXE 4HKXA 4JY5L 1CFVL 1KB5A 3OJMB 1MRFH 2QLVB 3O9WA 4PGBB 4PBXA 1ZWIA 4WI3A 5JW4R 4OKDA 1CU4L 1MCIA 1A6WL 5IMKA 2XWJB 2HVKB 3EO9L 4D9RD 1XGYL 4QRSA 5CSZA 2EKSB 1FFQA 1T4KA 4JFZH 4QRRA 4ENEC 3RZCC 4LSVL 3UBXA 3O6FD 1NCWH 1NAMH 5GS3A 4PRIA 4J3VA 4QCIB 1VFOA 2E5EA 3MLXL 1KCSH 1P6FA 3LEYH 4CUCA 3LRHA 5ALBH 1JBJA 2D0GA 1INEH 3E2HB 2DDQL 4AT6A 2Y07H 1LK2B 2BX5A 3HE7D 1X6LA 3JTTA 1KCKA 1BX2A 3FT4B 3KPNA 3QRGL 4ZOCA 4J12A 4KI5C 3QG6B 3ARBD 1MI5A 3BJ91 4FQLL 3U0TA 3RVXD 4LCIL 2B1AL 4JLRA 2OS7A 5KW9H 4WFFE 1RJLB 1U95B 3EJZC 3ZE2F 3QHFL 3U9UB 3TPUB 4K7FA 3PIQB 2UV3A 2A6DB 4JFPB 2ZOKB 4KJYB 1NANI 4NZTH 1JGUL 3FOMB 5HGDB 1NDMA 1IGYA 5FO9B 1CGUA 3VXSD 1LEIA 4Y5XB 4U6TA 3FB7A 5CJ8A 5D1XA 1YPZB 1URLA 4OZIB 4CDGC 1T6WA 4HKBB 2XICA 3TIEA 3L5JA 1A3QA 1ORSA 1PFCA 3O0RH 4FQQB 5IJKA 3VGAC 1FNLA 3F5WB 4FFVD 4P2RD 3S5LA 4NQSB 3KPLA 1N4XH 4TSCL 3TLRA 5CBAA 4UIKL 2W38A 1KIPA 5F7WC 1INDH 2A6KB 1A3LH 1A8JH 2AXFA 1RULH 5BXFA 4M1CC 2FR4B 3MCLL 1K4DA 2Z4QB 4MS8D 3VXUA 1F4WL 2XY2A 1AY1L 3RX8A 2DQDL 3PL6B 1G9EA 1A9EA 2X1XR 4FQ1H 5F71A 4R8WL 1PSKH 4OSUL 2NCMA 3L3HB 1RUQH 1XIWA 2BVUA 3B9KA 5E7FA 2BHUA 1ITCA 4MZ3A 8CGTA 2DICA 2QQNL 5E95B 4C4KO 4QHLA 1Q9LA 3UBXG 2PKDA 3ESVF 2I9LA 5FA3A 1KJVA 4JR9H 2AABL 1RHHB 2CH8A 5D8JL 4NN6C 5D1QD 1E28A 5LXGH 2QR0A 4WIQA 1QLFA 2FLBT 5I66B 4QEGA 4E41E 4I2XA 2M8XA 4NT6A 4GBXB 5GGTA 3CVHA 5HHOA 1FNEB 3LB6D 4YHNB 1M6OA 1KCUH 5E0QA 2E6QA 1ZS8A 1JPFA 5GHWL 4CBPA 5DK2B 4YFLF 4A2LA 1MLCB 1IQDB 2PTTA 3KPRE 4IRSA 5FYKL 4ACPA 1T22B 4GMTH 1K4CA 5GGTL 4M9PA 2C3HA 4Y8AA 5IKCB 3KNBA 4PB9H 4JM2B 4AEEA 3O4LB 4IJ3C 5EULV 4PJCB 4JGUA 4JFYB 3I02B 4GAYB 3ECBB 5I8KL 5KSUB 1FL6A 3AREA 2OCFD 4QRUB 2APBA 5CILL 1RU9H 2EH8H 1U2HA 4M7JH 1D3CA 3TNMA 1EO5A 4XB7A 4U1KB 5JUEL 1NGQH 1S5IH 4HMCA 1T1YB 1M71A 4PJBB 3S5LG 5EU6A 3DXAD 3UROR 4TVPD 4JO3H 1UZ6E 4TNWF 5DFVC 2Z35A 2AJVL 5D7IE 3GSVA 2IH3A 4XT1C 5IVXA 2BSTA 3H42L 3P4MA 4K94H 5IW6A 1SVZA 4JPVH 3AU1B 5DQ9A 1RUAL 3CK0H 1N6QH 3ZE0E 5ABDE 1KLGB 2ZG3A 2E27L 3MV9E 3K7UA 2CDFA 2J6EH 4YX2L 4MX7A 4APQD 3RI5F 3V52L 4EI6A 4NM4L 2Z8RA 2P5EE 2AEPH 2V7HA 1JHLH 3Q6GL 4KPHH 4J3WA 4OFKA 2XZZA 3HAEH 3W0WD 1KOAA 4U1HA 3FO9B 3OZ9L 4UB0L 5E08H 1U8NB 3MRRA 4LAQH 1VGKB 1JTTA 2KUTA 4HSQA 1NUDA 1VKXA 5I1DB 1T0MB 1J0YA 1NJ9A 5ESQA 1DQQB 3E0GA 4WW2C 4JFED 5CEZH 4JQIH 1CE6A 4O2EB 5I1HL 3GJFK 1WQVT 4ZAKD 3MJ7A 4QHKI 1FNAA 5GGVH 4PR5B 2B8OT 5C8JB 3UTZB 1J05B 2B0SL 1X7QB 4NJ9L 3NCBB 2F5BH 5D2NE 1JUFA 4DKFH 1H5BB 5A2KH 4Y19E 3V7MA 4NOBA 3KXFE 3DVGB 1JGLL 3JSSA 4ZFZA 3RWCB 4HCRA 5KOVC 1H3XA 1JMXA 2MHAB 4ERSH 5I71C 5HGAB 3ZYIA 3VXQA 1WUNT 1EJOH 4GQ9L 1Q9WB 2DN7A 1FAIL 1HH6B 5C0CD 4X6FA 4WV1A 4LRNH 3R8BB 2I5YH 2P7TB 5DMGC 4HCRL 1AC6A 2FATH 3P73B 3D3VE 4JRYB 1OB1A 5BS0D 5GS1B 1F45A 1BIIA 1CGTA 1A7QL 4U1IA 4MMZC 3V6OA 1C5CH 3VW3L 5M7QA 1X5IA 2BJMH 25C8L 4ZTPL 3UJTH 4PJ7B 4TTDD 4D0BB 3WDHA 5DQJB 4EZMA 4FTVB 1T1ZA 4LP5A 5ACZA 3D0LB 4PG2C 2JCCE 1LGVA 3G04B 3ZYZA 2M1KA 5GXBB 3GHBH 1IAKA 3HNVL 4P4RB 5DJZA 3P4OA 1DQMH 2AJSH 2ZCKL 3UC0L 3MO1B 4PGDA 4YHPA 5DSCB 5HVGB 3BYYA 4P3DB 1BVKA 1IFHH 1UJ3C 5GS0C 2VXTL 1DLFH 4UU9A 3RGVD 4U3XA 2H8PB 3GUTB 4X80H 2V5RA 1E4KA 3BPCB 1AR1C 4WFGE 4AIZB 2VR4A 4JPWH 4LSPH 5BZDB 3ARGA 3UTTE 1HOCA 1RSFA 3LKRA 5HYQB 1EVTC 2VZVA 4AY0A 1JZ2A 7FABL 5D2LE 4DN4L 4QWWD 3HE6A 1CWVA 3DIFB 2D03L 3RBSA 1FIEA 3QEUA 5IMLB 4MJ5A 4CRPA 5C0AA 4FQIL 4LCWE 1PZ5A 4HT1L 1K2DB 1R3KA 5D7SH 2AEQH 2VXUH 1UVQB 2BNQA 4LBEA 3QR2A 5E8DH 1B0RB 1J0HA 4JAMB 5SWSA 5CINH 1LP9F 3VWJD 3GIVA 1G7PB 1OAUL 5KZCD 2DBLL 5C6TL 4JREC 1QSEE 2Q7NA 5C7XH 3C60C 4BK5A 3IT8D 4WWID 1IJ9A 1J0IA 1N59B 3HZVB 2DYPD 5AUMA 1S7SB 2XY1A 3QPQD 1I1AB 5FDYA 5T3XH 3GMQB 3K8MA 1EHLL 1U93B 3LEXA 2UWEA 2W0KA 3LRSB 3ROOB 3HMWL 3Q5YA 4PTTA 1GZPB 3UTSD 4LPXA 5JHDB 3L5XH 3V79C 2EDHA 2PW2A 4PGEA 4OLUH 4XGZB 3SCMC 1SVCP 1FFOA 4KRMB 4ENED 3FOLB 4M61B 4MSWA 4Y5YB 1NGPL 5GS0H 4R9HA 4HUWA 2R0WH 5J56B 3HI6L 3GI8H 3O3DB 3H3PL 1FZOA 3H9SD 5KS9E 3BKMH 5BVJA 1KXQE 5IHZA 2YWZA 2IGFL 1T7ZA 4LSTL 1BD2E 4XCEA 1T1XA 3QDME 3MX0A 2X10A 4LSUL 2Y5EA 4YQXH 2AJ3A 4KI5D 3ZKXB 1I9IL 1ZT4A 2DKMA 4LNRB 1KLFA 3KYOB 3MQIA 4J8RB 2ERJB 1CD8A 4L3CB 5HGHB 2X4UA 3GHEH 1RZFH 4BSWB 3GM0A 3EJZD 3D6GA 1DBJL 5L2KD 3QWQB 2Y9RT 3O4OB 3PP4L 4R0LC 2PW1B 2V5YA 4GMSH 5ID1B 4H26A 3ETBF 1NUGA 4RAVB 3MUY1 2HJKA 4H0IA 2H3NB 4JRWA 3SGKA 4JDVA 3UPCA 4ORZC 1FL5B 5F88A 4NN7B 1QRKA 2GEEA 2WIIA 5D71H 3BEWA 4Z8FL 2GSGA 1MHCB 2BK8A 3BFOA 2NX5E 3MRDB 4MA3B 2CJUL 1A6ZB 4C56D 1G6RB 3C6LC 4LLYB 5J13C 2XRAH 3WFBL 3MPCA 4L8SB 1YEFH 3HUJF 1G9NL 3I3EA 4Y2DD 1H3TA 5CMAB 3I6KB 1ORQB 5LWYL 2BSED 5IJVB 3PGDA 4D9QE 4WW2F 2QV2A 3PGFH 5CHNA 4P2OA 2BP3A 1MWAB 2HJLB 4OCSH 5T33L 1NCDH 1XZ0A 4NFDA 3H7LA 1QUNA 4HGWA 5TQ0H 5MENA 2OTWB 5IQ7L 5E2VL 1I3GH 2ORBL 1NANH 2YPVH 3INUH 4O2CA 4YZFF 1KXVC 3KPSE 5HYJD 3PV7A 3BUYA 3ULVC 3F8UB 2W9DL 2WQRA 5GZND 2AQ3A 1R24B 1W0VA 2O61A 3L5IA 4N0YL 1ZHKB 3MRBB 4JEGB 5E8NA 1F6FB 1UXSB 5H8DA 3S3PA 2AGJL 3WDIA 2Z9TA 4AM0B 2DAVA 4X99B 3ARSA 1IGFL 4U1LB 3I3DA 3NABH 4YO0A 1RIVH 3D2UB 3PHOB 3WYRA 1V3MA 4UBDC 1G7LA 1CFTA 4AJ0A 1J1OH 4WWKC 4GSDH 2FL5B 5I9QB 4HXBH 3QAZB 1KEGH 2B4CC 2H2PC 3OR7A 4BA8A 1JFQL 4U05A 2UYLB 2PYED 3MCKA 5DUML 1KJMA 3UYOD 4WHDA 2EIZA 3RQ3A 4Z78A 1ZAGA 1JWMA 3X3GL 5DJYB 4NQCE 4JO4L 3GSQB 2E8ZA 2Z92B 3RL1B 3MACH 1YEHL 2VXVH 4XAWL 4PRHD 3S4SA 5BW7C 5IF0A 1N2RA 3SO3B 4KJPC 4MMXC 3OBAA 3BH8B 3S3SA 4HIHA 4LASH 1QVOB 3GKWL 2APXA 3L95B 3B3IB 2J8UA 3QNXA 4ZDHA 1BBJB 3VFTB 2YC1B 5GSRA 1ZV5A 4KROC 1FYHB 2R0LH 3O11A 4NC2B 2VKXA 5DFVD 3HZMA 4MJIE 2IJ0C 5FO8A 3EFDH 1F58L 4PGCA 3VFPB 5CP3H 2EE9A 1UWGH 2VC2H 3BQUD 5IWLC 3EIFA 2F5AH 3P0VH 5AAWA 1T3FB 4LPYA 5D96B 4D94A 5KG9A 1GPOL 3PWUA 5MP6L 2AI0H 1HKLH 1KGCD 5I16A 2HG5A 3WIHH 1T2QL 4PJ8B 3IETB 3WS6C 1IBGL 1J0JA 4XPTH 2CUHA 2Z93A 4JB9H 3FCTB 1MFEL 1UCTA 1U3YA 3BO8A 2LU4A 4TSAL 4I3SL 1DUYA 4FXGB 4KY1H 5ANMA 1FBIH 4PG9B 4ZG1A 5ICXA 4G7VH 5IM7B 1JGEA 2L4OA 1A5FH 4RNRA 3DHMA 1FC1A 4YNYA 1PKOA 4OLZH 5E8PB 1E6OL 1ADQH 1MJUH 4A6YB 2EZ0C 4WI9A 4QCIA 5EIVA 2BVQA 2DOCA 2B4CH 3UJIL 5AAMA 5FF6B 4EOWL 4HDIA 3UBXI 1LK2A 3O6ML 5BZWB 1N3NB 2OP4L 4KAQH 1ZGLP 1NC2A 3QEQD 1EO7A 1K8DB 3QWRD 3VWKB 2EDXA 3T3PE 2VLKE 2WNGA 5JORB 5ACMA 3V0VB 5I8EA 3S4SG 1RJLA 1U95A 2HKHL 1HHKA 5SWZD 2VITB 1BOGB 1M7DA 2XACC 2ZOKA 4IM8A 3O41A 3RWEA 5D7LE 4ZMAT 3I3BA 2UY6A 5DC9B 5CJQH 3LS4H 5HGDA 1CDGA 1REIA 3WXVH 3QHZH 3O6FB 4DCQB 3EOBA 3TBTA 4OLYL 2J2ZA 5T3XD 3ZKMC 3BWAB 5I75C 1NFDF 1TETH 4HKBA 3PHSA 1XR9B 3OF6D 1MFNA 1AGFB 1ZK9A 1UQSB 4PP1C 3OB0K 5GJTL 2DQFA 3F5WA 3HE7B 3HB3C 3D69B 4OGXL 3MOBL 3BPOC 4Y1AA 2IADB 4KGLA 4UT6L 5DJ2A 4OFPA 3QIUC 5GS0D 3ARBB 2A6KA 4CMMB 1F4XH 2IANB 1DSFL 3RVTD 3FQXB 2DLGA 2Z4QA 4DFIA 3T77A 5ISZD 3BZ4B 1AR1D 1MCPH 2R1XB 3UX9B 1NFIB 3GIZH 5CWSB 3L3HA 1KF9B 4MXQD 3O3AA 2VDMH 4DZBA 4HWEL 4GXVH 3FB8B 1JNNH 2DTSA 2A73B 3GMOB 1J1PL 5DHVB 4Y88A 3PABA 3VXSB 1PD6A 3VA6A 5I19L 2R1YA 4DKEL 3BPNC 4M1DH 1JHTB 1WCBB 1I8IA 1NGYA 5CEXA 2AVGA 3IFPB 3RDTA 1M05A 1KN2L 1TJIL 2WWKT 3SDAA 1FC2D 3ZL4H 4ZUTA 4P2RB 5F89A 1YN6A 3UMTA 3VD7A 5KANG 3RTQB 2VKWA 4ZXBB 3NVQA 4GKZB 2OR8A 4JKKA 1AHWC 4W4NA 1NEZB 4TN9A 3GI9L 1CD1A 4Z7OF 3I2CH 3U30B 4AEHL 4DGIH 4HMDA 2R29H 1U6AH 2Q7YB 3QDJD 3ARQA 2BVEA 5F7DB 1BFOA 3QQ9C 1EEYA 1F3DH 1IQDA 3C60D 4JRYE 4XPBL 4QRPA 2HN7B 3DBXB 3GJFH 3QXWA 1EJ6A 1O7VA 4M4RA 5IKCA 5HVFB 3P40A 3TT1H 5IIEB 1ZTXH 4JM2A 3W2DH 3ZHKA 1CQYA 4L4JA 3TH4T 4PJCA 3I02A 4XNMA 3ARDC 5KSUA 4PJ7E 3PDGA 4QRUA 5I1KL 3P30H 3GO1H 2FB4L 5IFJB 1FHGA 3MLZH 2KKQA 3O8XD 4WHYG 5D1QB 5DUPH 3IDYC 3RPIB 3SCMD 4HIJB 4MD5A 4PJBA 4F8QA 5C09A 1UCBL 5MEQB 4ELME 1CICD 5IUSA 3CH1B 2WZPD 3O2DA 1G0DA 3IU3A 3Q2CA 3MA7A 4NUGL 3ARPA 4N9GA 4DVRL 3GMNB 3SDXA 2DTML 2FD6H 3AU1A 1A4JA 3BN9C 4HWUA 4XBEH 5MEOA 1KJ2H 4QKXB 2ENYA 2ESVD 3O2DL 3O2WH 2ITCB 3R4DA 2X05A 3TYFA 3T2NL 2K7PA 1OGTA 2ZCLL 4PV9B 1ZLSL 4JY6B 1S5HB 5DZOA 4F33B 5D6CA 1XGUB 4NZJA 4DKAA 1TZGL 3GBML 2LVEA 4F2MB 5EA0H 1ZANH 3GMLA 5DR5H 3DXAB 1DQQA 3MLVH 5DTFB 2J8OA 1XCQA 3O6LL 1B0GB 2GAZA 3C2AL 3QNYB 4XP4L 4NO0B 4L4TB 4PR5A 3J7HA 1BP3B 5C8JA 3UTZA 1IC4L 3C6LD 5F7EL 4L3EB 4EUPA 4HQQL 4AMKL 5FFLA 4JZJC 4HJJH 4HUXB 4JQXC 1TENA 3TCXA 3E3QE 3QXAA 1KEMH 3EUUA 4PRPD 3WKMH 2MHAA 5C0FA 4XNUH 1CIUA 3GSNB 1PLGH 3KPQB 4APQB 4D9LH 2CK0H 5CZVL 4XNQB 1HCVA 2Y36L 3GSXA 4XPHL 3W9DB 1Q9WA 1HH6A 4JG1L 2VMFA 1CDIA 1PGRB 3W0WB 5TDPB 5JHDE 3X13A 4GRWF 2VDQL 1MNUL 2P7TA 3S36X 5GGRY 5K9JL 2VOTA 2ATKB 3L7FB 4O51B 1JK8B 3U46B 2IAMD 4CU6A 5MEPA 3H9YA 2V2XB 3SKOB 2RJMA 4LQFH 1VACB 1RJCA 4GS7B 2DIAA 2VH5H 4ODHL 3FONA 4M6ML 1EV2E 3TV3H 1GCFA 4X98A 5DQJA 1IM9D 4FTVA 1GZQB 3QFDB 5L9DL 5IHBA 3D0LA 1A47A 4OFIA 3AAZB 1R3IL 1AO7D 3ARVA 5SV3A 3DECA 4Y16A 4F7PB 2A77H 2XQBL 3QFJD 5DJCA 5E99H 3MO1A 4K3GA 4KJWD 1UXWA 4X4ME 3RY4A 2Q6WA 4UBDD 4F9LC 4K9EC 4EJ1C 3DMMA 2DQUL 4WWKD 4U6XB 2H8PA 4YBHA 3TVMB 5C0CB 5D5MF 2H2PD 2VSDA 1PY4A 1T03L 3DX8B 1WICA 2CGRH 5BZDA 4XVJH 4BFIB 2EO1A 1QEWB 4M8QB 2PCPA 1D6VH 3MV8B 4LHJB 3CFBB 1XGQA 4M43H 4KDWA 3H2WA 2Y1VA 5BS0B 5HYQA 1DN0B 2G75B 1V05A 4P9ML 2A74B 2P42B 1N8ZA 3K8LA 4AL8L 3F62A 4Q9RL 3FT3A 4KFZC 4ONGH 4W4OC 4M03A 1ETZB 4KJPD 3OTTA 5LGKA 2MTPA 3DLQR 3E6HA 4R4NC 1HHJA 3ULUL 4JZNB 4EUPG 4N8VA 4RSVA 5CKAA 3RJDA 3BEVA 5GZOC 4K2UL 3NIDF 1DBBH 4KC3B 4QRQB 4NQDB 3QUZA 1NAMB 1K2DA 4NZDA 5FO7A 2VLMD 5AZEL 2DLFH 1GGCH 3ARTA 4U1GC 4PJHA 1UVQA 3L9RB 3NIFE 1EGJL 2APWA 4MAYA 4Z7UB 3BXNB 4MJ4A 2OR9H 1MHEB 2RQ8A 1WC7B 1EXUA 4PJ5D 2J88H 2C1OB 2NZIA 3BIAX 1NC4A 4JFFD 4IBLT 3G6JA 1IC5H 1YNTB 4NRZB 1N59A 4DZ8B 3TFKD 1PX4A 5BQ7B 4MWFB 2O5XH 1CLOH 2YKLH 3L6FB 3ROOA 1KCLA 3BOVA 4AG4L 4N0CC 1XAUA 3CC5B 3NCCB 5DT1H 2XKUA 5FKAB 2WBWB 1OHQA 4GXUM 1FG2B 2WUBH 3N1FC 3ZDZE 1E4WH 4XX1G 1E4XL 3HC0A 4M61A 1HZHH 1JRHL 4RMTA 4Y5YA 4K9EH 2FH6A 1BQLH 2EZ0D 1I1YA 1X4YA 1OSZB 4XVSL 2NLJB 2VDLL 2GJ6A 2YD5A 5F3BB 3VWJB 5TF1L 2VUOA 2BNRE 2Y7QB 2X4PB 4X6CA 4X9HA 4YPGB 2Q8AH 3CSGA 1DQJB 4QLRA 5C71A 2H32H 4OZ4B 1AXSB 4X5WB 2DYPB 4JDZB 1JPGB 2DQCH 1KCRL 2VR9A 5J6GB 1QFWM 4XNYH 3MJ8A 4JY5H 5IJKC 3MUZ1 4OD3L 1CFVH 5GGSB 4L3CA 3OPZL 5HGHA 2G2RB 1UC6A 4FOMA 1CD0A 1CU4H 1A6WH 5DGRA 2PW1A 3EO9H 1XGYH 5BVPL 5D1ZA 1YC7A 4RAVA 5F7LB 4N8VG 1BFSA 2EDWA 5EZJA 1WGOA 4LSVH 3RZCB 3VFVB 3VH8A 4F7EB 1FL5A 3EYFA 3ZKMD 5JOPD 5I17B 3MLXH 2J5LC 4MA3A 43C9B 4LK4A 1XIWC 3H9SB 3B9KC 1KELL 1U8KA 4PP1D 4J3SA 1G6RA 4WI8A 3C8KA 4LLYA 1T7XA 2DDQH 5ETUB 4FFWC 5J4MA 3VI4E 3TIDB 5B38B 3QO0A 1XF5B 3QRGH 2XZQL 1TCRA 3UZVB 5CMAA 3D0VB 2XQYG 2KL6A 4FQLH 2PUQT 1ORQA 1YMMA 3OB8A 4LCIH 2B1AH 2W0LA 3C09C 2ADIA 1TZIB 2VL4A 5E94B 3REWA 3T0EA 1D5MA 2CLVA 3QHFH 4HKZA 5L2KB 2HJLA 5JA9A 3W82A 2PETA 5HDBF 4YHIB 1JGUH 3JBG7 1NBYA 3NGBC 1F11A 5DURD 3UTQB 1JIBA 1R24A 4FNLL 3V9FA 3KLAA 1GC1L 4NPYB 3ZE1E 1UXSA 3MJ9A 3VGAB 3BP6A 3BZEA 3V6FB 2RHEA 8FABB 4X99A 1FZKB 4U1LA 4TSCH 4UIKH 3AREC 4EXKA 3D2UA 4JO1L 3PHOA 4LVOC 3GFUA 3VDAA 2ED7A 3MCLH 2R1WB 3LQMA 1R3LA 2DMCA 1F4WH 1AY1H 3MJ9L 5DJ8A 2DQDH 2DJUA 4I0KA 4R8WH 4KQ4L 4OSUH 2HFFA 2MCG1 2UYLA 3KYNB 3VRIB 4PJXA 1HXMB 1M7IB 4OLWL 5BV7L 2QQNH 3NA9L 4GG6E 2DWEA 4BZ2L 3ARDD 3VH8G 3WFDL 1DP0A 3RNQB 5HYJB 3O45B 1LP9B 5I18L 1KIUA 2Z92A 2AABH 4NBYB 2IPKB 1DE4B 5D8JH 5TE7L 3HAEB 3SQBA 3N9GL 4NN6B 1MFDL 3WE6B 5D5ME 2HVJA 5HJ3B 4Z77A 3L95A 4P9HL 2IMMA 3TZVA 43CAB 1KYOJ 3QUMA 2IANE 4RAHA 4V1DE 2FDBP 2IPUG 3JWOL 4OKVB 1A1OA 5GHWH 2DWDB 3HMXA 5F6IC 5IBLD 2CLRB 3R1GL 5DRWA 2P5WA 5EFIB 2PYEB 3QUML 1T3FA 4PS4L 5FYKH 3I50L 5GGTH 1WZMA 3JV0A 1HH9A 2P49B 2KPNA 4MNQE 2BNUB 4CAGA 4IJ3B 5DS8B 5FGSA 5I8KH 3HMXL 2EYSB 3OB0H 4TUOA 5CILH 4QHNA 2W65B 1OM3L 1BJ8A 4PRHB 1Z3GL 2RAMA 4LEOB 1A4KB 3MGAA 5JUEH 2JJSA 1WBZA 5GRVL 4F9PA 4LKCB 1OTSD 4I9WD 4FXGA 1FV1B 3WS3B 2GYSA 4PG9A 1HHGA 1A1NA 1L7TL 5C0JB 1BJ1J 2AJVH 4PYHA 5FGCE 3QO1B 3S37X 4AQ1B 5JIIA 1VFUA 3LRGA 1A6TB 2FX9L 3H42H 1OAZL 5SX4H 3GMMA 1RUAH 4NSKB 3U0WL 2E27H 3VXME 1QD0A 1UG9A 4RGNC 3V6OC 5IR1B 4YX2H 1AQDB 1K8DA 1XF3A 3ME0A 3VWKA 3V52H 4NM4H 5BRZD 3SDCA 5HHNA 4HX1A 3OAUL 4HV8B 2P8LB 3Q6GH 5KANI 4EXPX 5KSBA 2UVEA 3HUJB 3OZ9H 4UB0H 4H1LA 3W39B 1EAPB 4S1QL 1LK3L 1E27B 2VITA 4RGOL 3WFHB 3DGGB 2F53E 1BOGA 4OBRA 2EDQA 4GRLD 4YH6A 2Q1EA 4WW2B 1G7JB 3AFLA 1J8HB 5I1HH 5C08E 4DCQA 2NYYC 2NW3A 1E4KC 1M1SA 2DIBA 4MA8L 4FQHA 5KOMC 3FO1B 2B0SH 4NJ9H 3ARGC 5HSFA 2E7CA 1UQSA 1C08A 2E9JA 1DBAL 1HILB 5DDHB 1JGLH 4E9LA 2BXYA 1RAMA 3CVIL 4KTYA 3QEQB 5I71B 2IADA 1VDGA 2HLAB 3P0YL 1MY5A 2R0ZL 4GQ9H 4CMMA 4YDLC 5IB5B 3ZZ1A 1FAIH 2UZYB 4HWBL 1OGAD 1IGIL 5EOTB 4HCRH 2MMXA 3HI1A 3PWPD 1V3LA 2DQTL 3NZ8A 5SWZB 4PRBA 2W0FB 4XXDA 5I6XC 3NA4A 4OQ1A 1A7QH 3VW3H 1HI6A 2R2CA 3VXSA 25C8H 4ZTPH 3PXHA 4Z7VB 3MJGX 4OZFA 5GGVY 1R6VA 4L4TE 5IV2B 4Q74A 4DK3A 5EO9A 5CD3B 4L3EE 4R4ND 1DN2A 2FX7L 1IMHC 5B39B 1G7QA 1MFCL 4BQ8A 1TPXC 3HNVH 4P2RA 3BW9A 4LLMA 3H7BA 3EJYD 2MQ3A 3QG7L 5F7FA 3UC0H 2ZCKH 4KZDL 4WI7A 4K7PL 1FYTE 1UJ3B 4YEFA 2VXTH 1BJMA 2F54E 4O58L 3IDXL 4LP4A 2Q7YA 2BDNL 5ISZB 4X6DF 4YHZL 5F7DA 1J88A 5IW1A 3OKDA 2Y72A 3TEUA 3P4LA 2G5BB 4QRRD 4H1LG 3VRLE 4HIXL 2NTFA 2P5EA 4JRXD 4X4YA 4LDOB 2HN7A 4TULL 3WO4C 3Q3GA 3QQ4B 4OCWL 4CVUA 5IEHB 5IIEA 1UT9A 5DJXB 3FQNB 5DK0A 3QXUA 1IGML 2YPKA 2CKBA 4KKAC 7FABH 3RVUC 3IRPX 4DN4H 4U1NB 3CFDB 1AR2A 4DVBB 1MAML 2D03H 4XZUA 3ULSA 3GSRA 5T1DL 5LQBL 3OKKA 3WHE1 4HIJA 5DRXA 1JNHA 4M3JA 4FQIH 4QYOB 3S35L 2CKBL 5MEQA 4HT1H 3MREA 5D2NA 4P2CG 1YNKL 4RWYL 1LILA 5TPWL 4MD0B 3QDJB 1DUZB 4KK6D 1CS6A 3P4NA 3GMNA 1MLBA 1OAUH 1CDJA 2DBLH 5C6TH 4JREB 2UUDK 3C60B 3MV8E 4ZYKB 5CS7A 5IBTL 5GGUB 1G9NC 5C86A 1N0XL 4UNUA 1T04B 3CSYB 4JN2B 2ITCA 4FHBD 3CX5K 5ELIA 3FT2A 1EHLH 1O7SA 3D3VA 5E00B 4OZFG 3HMWH 2DB8A 1HHIA 2ICES 2LE9A 1S5HA 2ARWA 1KTDB 4N8CL 1XGUA 2JK5A 4GQPH 4Z7NF 3SQOL 5SX5K 1F02I 1MSPA 4GKNB 5CBEB 2BY1A 2R2HA 3SCMB 3MUGB 5IB4A 3DXAA 1NGPH 5FUZL 5DTFA 4NQDE 1N5YL 3DX6B 3QNZA 4P2OC 3HI6H 3MODL 2OX5A 1B0GA 3EAKA 1GHFL 2DI9A 3H3PH 2ZUXA 4Z7UE 1U8MB 5EC2B 3E1F1 5L88L 5A2FA 5HYEA 3DV4A 3WXWL 3WLBA 2IGFH 5LAXB 4LSTH 4HUXA 3AS1A 4LSUH 2VISB 4POZD 3I6GA 3E6FB 3X14A 2ESVB 4W81A 1I9IH 2ZPKL 1NFDB 3JWDC 3KPPA 5ADPL 3BDBA 4XNQA 4P3WA 5J1AA 1I8MB 1K5NA 4RBPK 2FZ3B 3FQWB 3W9DA 1SBSL 3NFNB 1DBJH 4HUUB 3W0WA 3PP4H 3TT3L 1T20A 4R0LB 3OGCB 2CO6B 5FYKD 1N0LA 1UZ8B 1JK8A 2HTKC 1YEJL 1QRND 5EU7C 5TE4L 5IGXL 3TPKA 3SKOA 4B7LA 3X3FL 4JFEA 3IAGC 1L6XA 1VACA 2GQHA 5FA4B 3VDCA 1RZ8A 3BISA 4B5EA 4Z8FH 4H5SA 4WGVB 4ZAKA 1UACL 4I5BA 2CJUH 3KHOA 1QOKA 4R90L 1KPRB 1CN4A 3QFDA 3C6LB 2VZOA 5J13B 4PD4J 1SEQL 3RBGA 1TNMA 2VLRE 2VQUA 4P49A 1MJ7L 4Z76B 3WFBH 1QG3A 4MQXC 4E5XB 4OAWB 1G9NH 4F7PA 1TVHA 2XG4A 3CLEL 2XQYK 4PRPB 3DNKA 2XN9D 3D25B 5LWYH 1QSEA 4MXVF 4LLDB 1T89A 4MNGA 4OIAA 4U6XA 5C0CA 1WSST 4LLAA 5T33H 4PJDF 4GLRH 2EXYC 1MREL 5DMIL 4ONHB 2QTEA 4UTBL 2ZUTA 2WQ8A 1JN6A 5IQ7H 1SM3L 4M8QA 5E2VH 4CVZB 3SEPA 2ORBH 2IPTL 4YIQA 2VDPL 4A2MA 5BS0A 3WFCL 4PTUA 5KJRL 4MVBD 2FJGB 4M4PA 2W9DH 2R9HD 5ITBL 1MJJA 1RMFL 1YMHA 3OHXA 2YSSA 4N0YH 1F3JB 3MV7D 3SDYL 5ESAB 3TBWB 1ZVSB 3FFCE 1IM9B 3EJJX 1WFTA 1KYOK 2AGJH 4ZO7A 5HY9B 3SKNB 4RZCB 3VXPB 1IGFH 2H45A 4OZHE 1W8NA 1AO7B 2HWZL 3G5ZA 4Z9KB 4N0UE 1JF1A 4F7TA 1WIOA 4KI5E 4Q9CA 4GAFB 3QFJB 1S7WB 1CF8L 1SQ2N 4QRQA 3L5WB 4XAKE 3ZYJA 1NAMA 4S0TD 1BVLA 4WW1B 3RGVA 5T3ZD 3FZUC 1LQSR 3QDMA 4WWKB 3L9RA 3CZFA 3PQYE 1X5XA 1JFQH 5FAAA 1AD9B 3X17A 3L1OL 3VD9A 4P59L 5DUMH 1VFAA 2EDEA 2NXYD 3AVEA 3WFZA 1YNTA 5IVZA 3X3GH 5JW4N 4JO4H 4DUXA 4X5XB 4U7KA 1I3UA 5JMRA 4WO4D 1YEHH 4JO2L 4XAWH 5CLWA 3IDIB 4MWFA 1BF8A 1MEXL 2XZCL 1A6UL 4GW1A 4IOIA 2WP3O 2P24A 2L7UA 3GKWH 1YN7B 3CC5A 3BD3A 3IDNB 4Y4FD 1FG2A 2NX5A 3L3DB 4KROB 3ZTNL 5F7HA 5IP4A 3ILQC 3IDMA 1QBBA 1R3JB 4PRDB 2IPUK 4YBLC 3T4YB 3VE0B 1F58H 3C5ZA 4JANA 5IVOA 1KV3A 3BKYL 4GAJL 4G9FE 5E2WL 5EOQL 5F3BA 4JM4H 5FKPB 1NMBL 4PJ5B 4JJ5B 4WDIA 2Y7QA 4JFFB 4OZGF 1FG9C 1GPOH 5MP6H 5JW4Q 2X4OB 3V7AE 4OZ4A 2DRUA 1AGCB 1AXSA 2OJEB 2X9YA 3QXDA 4X5WA 1IEAB 2DYPA 4JDZA 1JPGA 2FHCA 1RZGB 4YWGL 3RHWK 2ARJB 5J6GA 1IBGH 3JV6B 2A1WL 3G9VA 1MFEH 3CPLB 2G2RA 1UH4A 3UTSA 4TSAH 3KPSA 4QT5B 4I3SH 2XG5A 5C0IB 3IFNL 1JPSL 1Q1JL 2BZDA 2RR3A 1EMTL 2VXQL 5CEZE 2R39A 1RJYB 3DROB 5FEBA 1E6OH 3VFGL 5I17A 3HTLX 2DM3A 2MSPA 2VZSA 3RAJL 3ZSSA 4TOYL 1U42A 43C9A 3UJIH 5TE6L 4YDIL 4EOWH 1IAIL 3VCLB 2FBOJ 2G60L 2Q76A 3O6MH 2VABB 1OVZA 3QZWA 2XPGA 1FZJB 2OP4H 3TIDA 4L1HA 5IVNA 5TH2A 4I1NB 4PJIB 4KV5F 2Z91A 2ZNWA 4DGVL 3SE3A 1MUJA 2QJDA 3UP1A 5I8CB 2A38A 3RDTC 1TZIA 3FFDB 4QHMA 1PBYA 3SDAC 5E94A 1FIGL 4NOFA 4DEPC 3OXRB 4ZQKA 2HKHH 4NQCA 5DMYA 3TYGL 1UWEL 3QWOB 2YA1A 3MOQA 4Z5RB 3GJFB 4YHIA 1QFHA 4FQ2L 1ITBB 1HSBA 2M26A 5EU5A 4LSDA 4OLYH 5SWSD 2F9BT 5FDWB 2LQRA 2P48B 5F9OL 5I75B 4JFHE 3GGWB 2QL1A 4C56A 1A1MA 1ZSDB 5GJTH 4G3YL 1GL4B 3RUGE 2IBZY 2VE6B 4JM2C 3EFFB 5EDXA 2I24N 8FABA 2EEAA 2NY1D 2ADGA 1FQ9C 4OGXH 3MOBH 5GRVK 3BPOB 5EUOF 4UT6H 4Y2DA 1HWHB 4EIZC 2CIKA 1L0YA 3QIUB 4PJFF 1UB5B 1DSFH 3VXTB 2R1WA 2LFGA 1J12A 4OB5L 3BAEL 2X9WA 1HXMA 3KYMB 1NKOA 3MRQB 1P4LB 5E70A 1KJ2B 5F1SA 4LLWA 1J8HE 1J1PH 4JFDD 1WAAE 5I19H 5HYJA 1LEGA 4DKEH 3FQUA 3BPNB 1PW3A 4QTHB 1DE4A 2BC4B 1YYLL 2IALB 3HAEA 1TJIH 1KN2H 3CFIC 1S7XB 4RFOL 2IH1B 2FEDD 3QZWG 3OKNB 3MRIB 43CAA 3I75B 3TA3D 4WEUD 4YBQC 3WNNA 1AHWB 1J1XL 1A14L 3HZYB 3FQRA 1CFSA 1FVEA 3GI9H 4AEHH 3VXRD 4PREB 3F7YA 2FECL 3CDYA 2DWDA 5DJAB 3JUZA 5C07B 2R8SL 4U49A 3F12B 1DANT 2PYEA 4XPBH 1QA9A 5B3NA 2FH8A 2Q86A 4LHUD 3CFEB 5DEFA 1P9MA 4GO6B 3NCJL 5DS8A 4Z7VE 1ZE3C 3ARDB 1RI8A 2A0LC 1VFBB 2W65A 5I1KH 4PRHA 2FB4H 5D7LA 4LEOA 1A4KA 4HEME 4WENB 4K71C 1OQXA 4EEEA 3IDYB 3MXWL 1FV1A 1FE8L 4LCCA 1UCBH 1VADA 3T3ME 3MNVA 5C0JA 1XGPA 4UT9L 2OSLB 4HS6B 1QO3B 1KIQB 4N0FA 4U0RC 2X4SA 4M00A 2X09A 4NRXB 4Y5VA 1H3PL 5CSBA 4UNTA 1H0DB 3QO1A 3PWNB 4NUGH 2AP2A 3CDGB 3T0BA 4DVRH 1WZKA 3GBLA 1IQWL 1WEJL 2D7QA 2DTMH 3BQUA 2Q20A 4NSKA 5C0ND 1ZVYA 1QPPA 1XH3A 3BP7B 3MRCA 3O2DH 4ELKB 5MHSD 1MHHB 2FBJL 2CMRL 2BVTA 1SJHB 3T2NH 4R96B 1U8OA 2ZCLH 4ZNEE 4NO5B 2YD2A 1PG7X 1H3UA 1ZLSH 2P8LA 2X1OA 3M8OL 1S7RB 3ALXA 4ORGA 3L3KB 4HS8L 4XCFL 3MBXL 1T7WA 4Y16C 1TZGH 3GMPB 3HUJA 3GBMH 3GSUB 3HAEG 3C5JB 1U3ZA 4IDJL 1T5WB 2R23B 3GDBA 4Z7QF 2ZCHL 3DGGA 2DMBA 2ITDB 2JIXD 3DMMC 3O6LH 4PLKC 2IWGA 4XP4H 4ZO8A 4PD4K 2QEJA 5ESVA 2JELL 1ND0A 1FGVH 3P11L 4LKXB 1JGDA 1IC4H 1WF5A 3FO1A 5F7EH 4HQQH 4HIEA 4LVNB 4AMKH 5KAQF 2FGZA 2EDNA 3IFLL 3PV6B 4JZJB 3ULUC 2HJFB 4R97C 1U92B 4XBPB 1V7ML 2VTFA 1NCTA 5IT2L 3ARRA 4R7DB 5CZVH 4HPYL 5HXMA 5J7CC 1FH5L 2Y36H 3QWRA 3UYPA 4L8DB 3DO7A 4KXZI 5F1NB 5BRZB 4XPHH 4EUPH 5IB5A 3UPAA 1BECA 4JG1H 1ZHNB 1HQRA 1NL0L 3BZFB 2V2TA 2BY2A 1Z0NA 2VDQH 1MNUH 2EXYD 5K9JH 4RFEA 3QBTB 5E4EC 5EZIL 3QUZC 2D0HA 1JF5A 4GRLB 5C92A 3K1DA 1F5WA 3OWEA 4MD4A 3U9PL 5I8OL 1O5DT 2X1PA 4MAYC 4ODHH 4M6MH 2UUDH 4KVCL 5IV2A 5L9DH 4FFZL 3PGCA 5CD3A 4LGPB 1SJEA 2YPLD 1R3IH 3NACL 1IGTA 1ACZA 3QXTA 3FQTA 4HH9A 2DQEL 1S8DB 2XQBH 4K3EL 5IK3A 5J9PA 2X41A 4X7TB 2C26A 4KKLC 4EKXA 4OLXL 3FZUD 1Z9MA 2W07A 5SX5H 2DQUH 2ZP0T 1SYVB 4ONFL 3RVVC 1OGAB 5E6IA 5ISZA 1XGRB 5HI3D 1T03H 3ZSTA 2CXGA 2EDDA 4UOW0 3PWPB 4PJEB 1WTLA 1NBVL 2A6JA 4Y5YC 4E42B 3DX9B 1T66C 4Z7WB 1MVUB 2NZ9C 2ZSVA 2H32B 5E9DB 1ZT7A 4P9MH 3S6CA 1X5ZA 1X3DA 4AL8H 4BK4A 4Q9RH 4YDVB 2Q87A 3Q5TA 3LKQA 4P5KB 1NC2D 4XNZC 3ULUH 4OLEA 2X4QB 3CSPA 5HYSB 3F7VB 4RBPH 4K2UH 3MSPA 3ILQD 5CJBA 4QYOA 5FM8A 2HLFC 3PUCA 5AZEH 4GW5A 2H41A 3EHBC 4U1MB 1ZWIB 3N85L 4U1GB 3K80A 3EYSL 1WT5A 5IROA 2OTUB 1EGJH 5IMKB 1DUZA 1OTTC 1BF2A 4QRSB 2AJZA 2IF7A 3MRMA 5D1ZC 5IBUB 3SDXF 1K3ZA 1T4KB 3T4AB 4QRRB 4HUMB 4KMTL 4NHUA 3C60A 4NM8L 4PRIB 4X7DC 5KVEL 5INCB 4JN2A 3CSYA 4XRCA 1UKTA 3ULVE 3BN3B 2P8PB 4QGTA 4WU7A 4AT6B 4HW6A 5E00A 5D7KE 1YJDL 4AG4H 1KTDA 4PLJD 5I1EL 1Q0XL 3KPNB 3O8XA 4Y1AD 3QPXL 4S2SA 1U8IA 4XMPL 3AMLA 4YGVA 4BJLA 4K55A 5B39G 5K9KB 3MUGA 3QFJE 4JJHA 4U1SA 1E4XH 3D39D 3DUUA 4WJ5B 1JRHH 3CXHK 4NNXA 1CICA 3T0EC 4K7FB 4XVSH 4I3RL 3U4EB 1GC1C 3TO2A 2VDLH 5D7JD 1U8MA 4LARL 1F4HA 3D5OF 2JTDA 5EC2A 3NIGF 4Q6IB 5TF1H 3BYTA 1NDMB 3MMEA 2AEIT 1IGYB 5GRXG 1QSZA 1CIDA 5F96L 1I8KA 1KFAL 2YD1A 3CXDL 3FB7B 3LCYA 4XC1L 4NKQB 2ESVA 1X5HA 4IOSD 1NFDA 1KCRH 2ICEA 3TIEB 3RDTD 3B5TA 1ORSB 4OD3H 1YUHA 1Z9SA 3OPZH 3S5LB 2D9QB 1DQDL 3KPLB 4HUUA 5CBAB 4YUEL 5D93C 5BVPH 1ZA3B 3SO5A 5BV7C 1UZ8A 4RDQF 2AS5M 3NCYP 2ZUWA 3VXUB 4PJAF 3HR5A 3LKPA 1KT2A 3UTOA 4UV4L 5EBWA 5ID0A 4JHWL 1A9EB 5JW5A 3GB7A 3UXFA 2J5LB 2X4NB 1KELH 4QRPD 1DANU 3C6LA 2DJSA 5HDQL 4F7CA 2YRPA 1OW0A 5DEGB 4P9HC 1Q9LB 4OAWA 3LQAL 5DD0L 4RAUB 1T83C 2XZQH 4KK8D 4NC0B 5FA3B 4K23L 4CMHC 4XCNB 1FNSL 3D25A 4OD1L 3SO3C 3C09B 4OV6F 3JWOC 1Q0YL 5TDOA 2OMNA 1BJ1H 1E28B 4LLDA 4XP6L 3TZVC 2JB6A 2QR0B 5CP3A 4FABL 1QLFB 4NDMA 1Y6KR 3GEWB 4NT6B 1CFBA 3RI5K 3CUPA 4TQEL 3SGJA 1M6OB 1QRNB 2IAMA 4IRZL 1KJ3L 1ZS8B 1JPFB 4WNQA 4CADA 3NGBB 5IEKB 4FNLH 2PTTB 1A6AA 2OL3A 4XTRC 1GC1H 2IMNA 3TBWA 1ZVSA 2MJWA 5GGQL 1F8TL 1WK0A 1Z2KA 4HJ0D 1U3HA 2BXZA 3SKNA 4RZCA 1T5XA 4YFLI 4YBQD 4PJIE 1FL6B 2GUOA 3AREB 2ADJA 4G8GE 4JO1H 4M93C 2OL3L 3TNMB 2BNRA 4N90D 2JJSC 1CGYA 3BVNA 3MJ9H 4HH8A 4WW1A 4F9PC 1C12B 3MYZA 1F6AB 4NZUL 1M71B 2AK4D 4KQ4H 5EU6B 2VLLA 1AD9A 4EN3D 1BGXL 2WBJD 4HLZH 2P44B 4OLWH 5BV7H 3QCTL 3NA9H 4LPTA 2Z35B 4KRLB 1P7HL 3QQNA 3BT2L 5J6HA 2GSIB 3EBAA 4U1JA 4HGMA 4BZ2H 2IH3B 2BSTB 3WFDH 3P4MB 5I18H 1B4JL 5EG6C 5IW6B 1Z5LB 2A0LD 3BPLC 5DQ9B 3AC0A 4QY8A 5TE7H 3MV7B 2KBGA 4PV8A 3N9GH 3M17A 1L9MA 3U1SL 1MFDH 2DI7A 4P9HH 4MX7B 2ED9A 1UEMA 4EI6B 3TJHD 3L3DA 3SDCC 3B83A 1C8PA 1ED3A 3RP1A 1OPGL 1QBLL 3VD3A 4U1HB 1R3JA 3QISA 2WINB 3JWOH 3T4YA 4UTAL 1M4KA 3VE0A 4EIGB 1VENA 5F6IB 3R1GH 4X7FC 4Q2ZA 5C0BE 5IWLA 1NJ9B 2R69L 3KPTA 5ESQB 5I30L 3QUMH 4PJ5A 4JJ5A 4O2FB 4PS4H 3I50H 5HI4D 4X6CF 4JFFA 2CD0A 2FO1A 1CE6B 3R8QA 2X4OA 4HFWA 3PG2A 2OJEA 1G7IB 3S97C 4PGJA 4QNPE 3HMXH 1RZGA 3CFCL 4H0GA 1IGCL 2AERT 3JV6A 4NQED 4WO4B 1OM3H 3T04D 1Z3GH 4S11A 2BVYA 4Y16D 4ZFZB 3L3OA 3IS0X 3HPLB 1PQZB 2YMXL 4QT5A 1AE6L 3ET9F 4Y4FB 1FSKC 1L7TH 4U31A 1JTOA 5HYIA 2FNBA 1CXKA 1MFBL 5JMOC 1CDCA 1WBXA 5A43C 2FX9H 4G43B 1OAZH 4X9IA 3EDEA 3WFEL 5LKNA 3K8KA 4U6YA 5C07E 1WWWX 3U0WH 2D7MA 1BIIB 1FZJA 4MQSB 4U1IB 4U4BA 5D9SA 4ZUWB 4RGNB 2VZUA 2Q3ZA 3TBVB 2X5PA 1QTYT 5DA0B 5EZLB 1NUNB 1P5UA 4QOKE 3DV6A 3OAUH 1S7UA 1ULVA 3FL7A 4LSQL 5FB8B 4GG6A 5F1OB 4FFVC 1IAKB 1WV7T 2XZAL 3OXRA 5DJZB 4S1QH 3OL2A 1LK3H 3P4OB 4RGOH 3QUZD 3BUTA 3JTSA 4QO1A 4Z5RA 5BCAA 4UU9B 3BP4A 4MQ7A 2EDFA 5CFHA 4MS8C 1G7MA 3VG0L 4MAYD 5D5MA 1EHAA 4NKDA 4H1LH 3C2SA 2V9TA 4MA8H 4YXKL 4OGAD 1SHMA 1NC4D 1AGDA 4C4KT 1NMAL 3QA3A 5IB3B 3ARGB 1HOCB 3MTRA 5TDNA 1DBAH 4TUJA 3LKRB 4PJ9D 4PJGF 1RIUL 4TTGA 1LD9A 3CVIH 3TWCL 2B7DT 3P0YH 2R0ZH 1NSNL 1OAYH 3NCMA 4KKLD 4CVWA 4YDLB 2V7NA 4HWBH 3N1PC 2AAVA 3N1MC 1IGIH 1I3RA 1ZHLB 4MNQA 3O3EA 2BOCA 4MJ5B 4BSJA 3W5MA 3SE8L 2DQTH 4TNVF 3S7GA 4I4WB 1PZ5B 1NH6A 4PJXF 4UV7L 4XBGA 1R3KB 3OKYA 5D2NC 2EEBA 3MRKB 2NZ9D 3MRQA 4XMKL 5I6XB 3LB6C 1JE6A 5SWSB 5GGRA 2VRAA 2YD7A 1Q72L 3QDGD 4RMWA 2WW8A 2ZSWA 2FX7H 5E1HB 1A6PA 3A6BL 1S7XA 1CXHA 2YUXA 1MFCH 3HC4L 5AUMB 3DPBA 1TPXB 3HR6A 1OP9A 1X9QA 2F8OA 3OKNA 3MRIA 3QG7H 5EO1B 3I75A 4KZDH 4K7PH 4OZFH 4H20L 1UGNA 5E6ZA 1AHWA 4NQTA 1TQCC 3LEXB 2UWEB 2HLFD 4XI5C 4PTTB 4O58H 3EHBD 3A67L 3IDXH 4G8EB 2RGSA 5EUKA 2BDNH 5LGJA 1OTTD 4DK6A 4YHZH 1AKJD 3OG6B 5D1ZD 1FFOB 2XYCA 4JDTL 1Q9KA 4HIXH 4MSWB 5IB2A 2VLJE 2OR7A 1RV6X 4TULH 4HUWB 4OCWH 3WO4B 1BMGA 3HFML 3WL9A 5DZLA 1JWSA 1MH5B 4S1RL 2C4FT 1FZOB 4JFDB 1IGMH 3ARDA 1JYXA 5BVJB 4BM7A 4C55A 1VFBA 5IHZB 5FYJU 1KPVB 4XCEB 1LE9A 1OP5K 5CLTA 3MNZA 3H8NA 2AJ3B 3WSQL 1MAMH 5T1DH 5FCSH 1ZT4B 1X44A 5DJ0A 3TM6A 2UVFA 5LQBH 1YMMD 4S1DD 1MCLA 3S35H 1KENL 2CKBH 4YAQA 3D9AL 3T0ED 2OSLA 2VDOL 5I0ZA 4CN1A 1YNKH 4RWYH 4ZFOA 3N50A 5TPWH 3VXRB 5JXEC 1H0DA 3MRJA 3PWNA 3NCEB 4WUKL 4H26B 1RUPL 2HJKB 4PJEE 4CNIB 5IBTH 5F88B 4Z7WE 3I6LE 2AW2A 4NIKB 1N0XH 2WIIB 4ZFOL 3BEWB 3IF1A 5E9DE 4ZAKC 2GSGB 1D9KA 4KK9C 4AQOA 2GITA 4R96A 3HI5L 4WI2A 4NO5A 5EC1A 4UQ2B 4NCDA 1N6UA 4BUGA 3WN5A 4N8CH 3L3KA 3VMPA 2ZWLT 4N1HB 3SQOH 3GSUA 1NCNA 2QQLL 1KCVL 5JLZB 3IKCB 3EW3B 5TGBA 2P43B 1H9VA 3FN0L 4X6EB 3VXNA 2F15A 5F8RC 4KHTL 1DEEA 2YA0A 1BREA 3PGDB 5FUZH 1N5YH 2VAJA 2ICCA 3MODH 4P2OB 3RIFF 1GHFH 5LG1A 1XZ0B 5KVFL 2V5SA 4HGWB 1CLZL 3IJYA 1FYTA 5MENB 5L88H 3MFFA 3NH7L 2F54A 3OKOB 3C8DA 3PV6A 3WXWH 1RY7B 3EOAB 3LKOA 4O2CB 5T1LA 1U92A 3BUYB 4PRIE 4XBPA 3GRWL 1UENA 1NFKA 1OF2A 2ZPKH 2O61B 3AS3A 5ADPH 1J5OL 4TTDC 4R7DA 3LV3A 4L8DA 5F1NA 5BRZA 3S3JA 5EORL 2VO5A 1SBSH 3BHBA 1T80A 2GTWA 3LMJL 1ZLUK 1VGEL 4GAGL 3U6RB 1ZHNA 2FGWL 3BZFA 2EEDA 1FVCA 3TT3H 4YO0B 2GT9A 5EUOB 4LOUC 1V8HA 1U0QA 1MI5E 2DLEA 3V95A 5C0GA 2YZ1A 1HYRC 1YEJH 5TE4H 1G7LB 1LDSA 3KWWA 3RGVC 4GRLA 3SDDA 5IGXH 1CFTB 4J3UA 4DJMA 3X3FH 1RUML 3DUHA 3WUWA 2I25N 4JKWA 4N5EC 3QUXA 1UACH 2Y25A 4XTRD 3MCKB 3VMNA 4HBCL 4F57L 4R90H 1KJMB 2IQAA 3W9EA 1SEQH 2EIZB 4WFFD 2XA8L 1MJ7H 1UZ6F 4Z78B 1JWMB 5D7IF 2DLIA 3CLEH 3AGVA 1BQHA 1LE5A 5IF0B 1N2RB 4ODVL 3UEZA 4NUJB 3ZE0F 4QWWC 1DQLL 1N7ML 4EI5C 4HIHB 3GSOA 4ZDHB 4CVXA 5CEYA 1CVSC 5GSRB 3UO1L 1GGBL 1MREH 5DMIH 15C8L 4UTBH 5BOPA 3PWPA 3O11B 4PRNA 4XNXL 4LLQA 1SM3H 1TTGA 3HZMB 2IPTH 2VDPH 4NQUA 3VXUE 3ZDYE 4LHQB 3WFCH 4J23A 3TN0D 5FO8B 5KJRH 5J11C 1LO5B 2P45B 3C5ZC 3SJVE 1RK0B 2CRZA 4NWUL 5ITBH 4OI8A 1RMFH 4Y2OA 3RWFA 4W4OA 3SDYH 4YDVA 1A64A 6FABL 1CQKA 5KG9B 3BD4A 4G42A 2FEEI 3B2VL 4JHZA 3MLYL 5KVMC 3PWUB 2YPLB 4WUUE 1OD9A 5JR1L 2X4QA 1PEWA 2HWZH 4ZUUA 5FOJA 2HG5B 3U4AA 5HYSA 3SDCD 4J1UB 5BJTB 1JZ4A 3O2VL 1LDPL 1CF8H 4M62L 4PYGA 2Z93B 3QEGL 4U1MA 2W92A 4YEEA 5DMKA 3BO8B 4LVHC 1DUYB 2OTUA 5ANMB 5ICXB 3L1OH 2GJZA 3HZKB 4I2XE 3BIBX 1JGEB 4P59H 3T4AA 3DETD 5JA8B 4O02L 4F3FB 4RNRB 5HHOE 1MAJA 4JRXA 1CI5A 1JJUA 4YNYB 3T1FA 4GFTB 4JQVA 5FYJE 1L6ZA 5INCA 2LU7A 4E41D 2BVQB 3EO1B 2P8PA 3WUWG 4JO2H 3WHE0 3B8SA 4HDIB 3Q48A 5HVHC 3STZB 2XZCH 1A6UH 2YWYA 2HT4C 1EZVX 1NC2B 5EIIA 3UPRB 1BZQK 2VN7A 2C5DC 3SE3C 2YK1L 4H8WC 4YE4L 3KPRD 3ZTNH 5K9KA 5I1AB 1U41A 1ERNA 2N7AA 2XTJE 4QHUA 1FFPA 2C1PB 4WJ5A 2JE8A 1R5IA 5I8EB 2JCCF 4NQXB 1BQHG 4PPTA 4YBLB 1XFPA 1P7QD 2SEBB 4BQCA 4JKMA 1HHKB 5JPNA 3MLSL 3U4EA 1AGBA 1M7DB 3BKYH 1CK0L 3L7EA 1UFUA 4GAJH 2ZG1A 5EOQH 5EU6E 3CMOL 1NMBH 3RWEB 1RJZA 3O41B 4Q6IA 4JHAL 1JHKL 1GAFL 2H1PL 1YYML 3EOBB 3GNML 3TBTB 1NMCC 2A9ML 1N4XL 4RISL 1YQVL 1X5FA 1ZHBA 4KWUA 4YWGH 5IVXE 1JTPA 4QXUL 2A1WH 1A7RL 2DQFB 2EYTA 2D2OA 4AENA 1BHGA 2BHYA 3DI2B 4Y2DC 3VGEA 4Y1AB 1DVFD 5DJ2B 2HT2D 5AG9A 3WKNA 1ZA3A 3IFNH 1JPSH 5DC0A 1Q1JH 4ZS7L 5D2LF 3HRPA 1EMTH 5HYSG 1PG7W 5FV2A 4LIQE 3FFCA 2VXQH 2IFFL 3MV9D 1CCZA 3D39B 2EO9A 3LD8B 3T77B 4M1GL 3VFGH 4OZHA 4NCC1 1GOGA 3LPFA 4K94C 2HFTA 4N0UA 2C7UB 3RAJH 4TOYH 2P5ED 2X4NA 5CD5C 5TE6H 3O3AB 4YDIH 1IAIH 3GK8L 4DZBB 1INQA 1WTGT 2AXJA 2G60H 5DEGA 5IBUG 4ODTL 1PZUB 3PABB 4RAUA 1IGJB 2C4FU 2R1YB 4DGVH 5GZNC 3CCHB 4XCNA 1I8IB 4WRLA 1NGYB 5CEXB 3RKDC 3RDTB 1M05B 2ZNXA 3SDAB 2DI8A 1FIGH 2YS4A 4ZUTB 2QSVA 1YN6B 5F89B 4DEPB 5C6WH 4ZOAA 4XWOD 2OM5A 5K9OA 3TYGH 1UWEH 3O3UN 1EEZB 5EBMB 2W60A 1NGZB 3ZT5A 1FRGL 3PNWA 4TUKL 4H8WH 4WCYL 2EICA 4IS6B 1CD1B 4Y19D 4FQ2H 1RPQA 1QRNA 4LPUA 1GGYA 1G9ML 1BFOB 1EEYB 4X6DA 5IEKA 3V5HB 1CT8A 5F9OH 5I15L 1C7TA 3VFMA 4YR6A 2EDLA 3CD4A 4QRPB 3V6ZA 1JWUA 3FRPA 4G3YH 1WFNA 3ABZA 5LBSL 1P9MC 1DBMH 4RGNE 3V6OE 2FYYA 3ALPA 4XNMB 3D3VD 3GSWB 5KS9F 4XI5D 3T0WA 3VXOA 1A2YA 2XN9A 4LLVB 1T21B 1DDHA 2KDGA 4FXKA 4I48A 4LCYA 1NCCL 2WV3A 1C12A 3CLFL 4AZ8A 1F6AA 4OB5H 1P84J 4AIOA 2K1MA 4MD5B 5L0QC 1IARB 5B8CA 1LWRA 3IDGA 4LCCC 5C09B 5DRNA 4MB3A 4FP8L 3LY6A 4K3JL 3IU3B 4Y5VC 2GSIA 4H25B 3MA7B 1I85C 3MRPA 1HXYA 2A9NL 1FPTL 4N9GB 3IVKB 3SDXB 1Z5LA 3BQUC 1U8LA 1CFQB 1OAXL 1A4JB 1YYLH 3MV7A 2HH0L 2OQJB 5MEOB 4RFOH 5F72S 3SKJL 5I1GL 3QUKB 2N4IA 4WFGD 3TYFB 1LO0L 1OGTB 1J1XH 1J18A 1A14H 3UTTD 1S9WA 4EVNB 1AFVL 3MXVL 5D6CB 2WINA 5JXED 5E4IA 3OXSA 3WJJA 1XGTB 5AWNL 4P2QE 3HA0A 1AH1A 3AROA 2AK4B 2H26A 5C0AE 4ODWA 2ZZUT 3GMLB 3OKMB 4O2FA 2WBJB 4B50A 1XCQB 3HHRB 2GAZB 2YR3A 1RD6A 2BNQE 4KK9D 5T3ZL 3NCJH 1G7IA 3K74B 1QPXA 1Y0LA 4WO4A 4EUPB 3O6KL 4OM0L 1ZA6A 4BH7B 3QXAB 1FZMA 4X8JA 4XPGL 4K71B 3HPLA 4DGYL 1PQZA 5C0FB 1Q8MA 2DIJA 3FRPG 3MXWH 1JV5B 2VNCA 1FE8H 1QSED 3SKMA 4Y4FA 4JPIA 3IFOA 1ONQA 4NN5C 4TSBL 5F7NC 3GSXB 2UWEE 4FN0A 4UT9H 3K81A 2AJUL 4U0RB 4HMEA 3X13B 3IDJA 4MLIA 1H3PH 4FS0A 1CL7L 5CIPA 2M2DA 5F9AC 2DS4A 4G43A 4EDXB 1IQWH 1WEJH 2JJWA 4UMGA 4J3OC 1EHNA 5MEPB 3QIWC 1IKFL 2QSTA 4KDVA 2AJXL 2APFA 4ZUWA 3N1GC 3TBVA 2FBJH 2CMRH 1UM4L 3FONB 5EZLA 2DLTA 4X98B 1P6AB 2Y4SA 3K1KC 4AH2B 3CIQA 3M8OH 5FB8A 3D85D 4HS8H 2EDJA 4XCFH 3MBXH 4HK0A 1X5GA 4Y16B 1OSPL 5MERB 4LOUD 1CGVA 5DJCB 1UXWB 2ZCHH 4L4VE 1Q9OA 2Q6WB 4OZIF 5E5MB 3ES6B 1WWCA 4HULB 1J9CT 1BD2D 3DMMB 3QDMD 3RVTC 1QSFE 5E6IC 4N5ED 2HT3C 4XCYA 1UB6A 2KQNA 2JELH 4PJDA 4X7EC 3P11H 2EIEA 4JFXB 5IB3A 5F44A 4MXQC 2PCPB 3IFLH 1XGQB 5F6HJ 3JZ7A 2J7LA 3G5XB 1UYWL 4R97B 3V0WL 5BMFL 1V7MH 1N8ZB 4XVTH 5LCVL 1CLYL 3SGDI 3FT3B 5IT2H 1OT2A 2O5ZL 4HPYH 1FH5H 4G80A 4RIRB 2DL9A 3Q0HA 2PN5A 1OP5H 2EDOA 4EI5D 3E6HB 4G6ML 4TVSa 2CKNA 1HHJB 1ZHLA 1NL0H 4N8VB 2XWBA 2NX5D 2WMPA 2MQ0A 4JY4A 3RU8L 3BEVB 5EZIH 5E4EB 4I4WA 4GG8A 3QUZB 1WWAX 5FO7B 3MRKA 3IAPA 1IL1A 3U9PH 3C5ZD 4PJHB 4ETYA 1WT5C 5IROC 5I8OH 3MOAL 2MCPL 3TCLA 3KYAA 4MAYB 5DYOA 1P2CB 1NKRA 3AM8C 1EXUB 4KVCH 2X6MA 1GGTA 2YUWA 4FFZH 1NC4B 1YJDC 1C5DA 2AQ2A 5CJOL 5MENE 4D9QD 3G6JB 5EIQA 4PJ9B 3NACH 3RKPA 3LQZA 4BZ1L 2XTLA 2NXZC 2DQEH 4K3EH 5EO1A 3VU2A 1CGSL 3HNSL 3QJHA 3KJ6L 3SHSA 3GJEB 3VFSA 4NKMA 3EO0A 4OLXH 5I76B 4G8EA 4GUPA 1S9VA 5FUOL 3KPSD 4ONFH 3O8XC 5FGBC 3OSKA 5C2UB 3IB4A 2BVPB 4FQPA 3T3PF 3RJQB 1NBVH 2NQCA 3HC0B 3SE4A 1CICC 1E6JL 5EU7E 1A0QL 5AD0B 4PLNC 1B88A 1I1YB 2UY7A 3EYVB 5JHLL 1MH5A 2NY4C 3WNPA 4Q58C 1F00I 2GJ6B 4JFDA 2IG2L 1FNGA 2Q8BL 2IBBA 2ICWB 4X6CB 2HT4D 5FK9B 4OZGA 1KPVA 3T8XA 2X1QA 4XNZB 4UT7L 4XMLL 4O00A 1OP3K 3MJ8B 3TA3A 1NBZB 1ZLUH 3V8OA 3T1WA 1NCAL 4D2NA 3C9NA 5HVWA 3N85H 5D4QA 4NQCD 3VXRA 3EYSH 1W72A 2J8UE 1BZ7A 3EYOA 1AKJB 5D1ZB 4IOFC 5EZJB 4KMTH 3P9MB 1HQ4A 3VH8B 4CNIA 4NM8H 3DSFL 3EYFB 3LQAC 2AK1L 5KVEH 1CFNA 4LHUA 1W72L 4MLSA 3BZDA 2CQVA 1CD9B 1W2KT 1U8KB 3C8KB 3F6LA 2CO7B 4NNYA 1OW0C 4MJID 5EU4B 4UQ2A 1YJDH 5HHMB 3QO0B 5GRUL 4M7KL 5I1EH 1Q0XH 2OLDA 3QPXH 4XMPH 2DKUA 1TCRB 3HLAB 3RL2B 5JLZA 3IKCA 2GHWB 1YMMB 4HIIA 4X6EA 1ZKAA 2R2EB 2ADIB 1UWXH 4OLVL 3REWB 5CSGA 3T0EB 1CR9L 3TNNA 1D5MB 2CLVB 2FWOB 4HKZB 1BEYL 2NY6C 4I3RH 3W5NA 5FCUL 3ARUA 5CD5D 4LARH 3VGHA 4MB4A 3DGCR 5L2JA 3SGJC 2IAMC 1NLBL 3OKOA 3EOAA 1NBYB 1MCEA 5F96H 5HPMA 4FA8A 1KFAH 3CGTA 2NY7L 3CXDH 4JPKL 4KDTA 4OD2A 3S9DB 2EYRA 1F11B 5ERWA 4AEIL 4XC1H 3KLAB 2ADFL 1CDUA 3RKDD 3KJ4B 4Y7MA 1FNHA 3BP6B 3HRZA 3BZEB 1U3HC 4PJGB 1LNUA 1DQDH 3U6RA 4YUEH 2ZUYA 5D93B 5EUOA 4JCLA 4PJ7F 3V5DB 5BV7B 4PJFA 4KJWC 1QBML 4Y89A 1YY9D 3BIKB 1R3LB 3VGBA 5DJ8B 3QRFM 2JIXA 4UV4H 4JHWH 1G7HA 1X6NA 4LEXL 2AQ1A 2HFFB 2VLKD 1JZ5A 5DVLA 3K2MC 2NY2D 3Q5OA 4PJXB 5TFSL 3HG1A 4ELMF 4V2CB 3OAZK 2DWEB 2JKXA 2X4RB 4N0RA 3WLWD 2WWMD 3LQAH 5DD0H 3BH9B 2BSSA 3HC3L 3QSKB 4K23H 1YPZE 4CMHB 4YFDB 1FNSH 4OZIE 3FTGA 2HFEB 5D7LD 4OD1H 3SPVA 4LHUG 1P84K 4NUJA 5GRZA 3B9AA 1Q0YH 3B6SA 3LOWA 1EK3A 2HVJB 4XP6H 4Z77B 1F13A 3NN8A 5H37H 3TZVB 4FABH 5I0DA 5BO1L 1FVDA 5E2TL 2FCBA 4ZD3L 2Z8VC 3QUMB 4WTZA 4IIQC 4TQEH 4IRZH 1KJ3H 1JYNA 1A1OB 5FM5O 1QQDB 1LO5A 1AP2A 1RK0A 3JUYA 4UZGA 4ZTOL 5DRWB 2BVOA 4QRTB 3ULVL 2P5WB 4P23C 4LCUB 1FAKT 3HN3A 1FCGA 2XNAA 1RUKL 5GGQH 1F8TH 1HH9B 1S7VA 2YPLA 4NC1C 4OI7A 4UUJA 3AY4A 4OFYD 3TFKC 3IXAB 4GKSB 2DQJL 4J1UA 2QBWA 4TUOB 3ZT6A 5BJTA 4QHNB 2OL3H 4M93B 4ZPTA 4IMKA 1WBZB 5HI5D 2QADC 4NZUH 4OCYL 1YEDA 3EDJA 4I0PC 3MRNA 1S7TA 5C1MB 1HHGB 1BGXH 2YN5A 3HZKA 1A1NB 3SBWA 3QCTH 5C0EB 4F3FA 4DOHB 2QHRL 3BT2H 1OARL 1EUTA 4FZ8L 1AD0A 1B4JH 3EO1A 4DWHA 3BPLB 3GMMB 4Q9QL 3STZA 3U1SH 3FKUS 5KSVA 3UPRA 4W70A 3O4LE 4LLUA 1XF3B 4PJCE 3FB5A 3SDCB 4JRYD 4WEBL 3WIIL 5I1AA 5HHNB 4HX1B 1OPGH 1QBLH 2C1PA 3NZHL 1A7OL 5KSBB 4NQXA 1D5ZA