3BI9X

Tim-4
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
MSEDTIIGFLGQPVTLPCHYLSWSQSRNSMCWGKGSCPNSKCNAELLRTDGTRIISRKSTKYTLLGKVQFGEVSLTISNTNRGDSGVYCCRIEVPGWFNDVKKNVRLELRRALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell immunoglobulin and mucin domain-containing protein 4
publication title Structures of T Cell Immunoglobulin Mucin Protein 4 Show a Metal-Ion-Dependent Ligand Binding Site where Phosphatidylserine Binds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 21
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2007-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bi9X00
1J88A 1VFBB 1X4ZA 3C60C 2Q8AL 3A6CH 3WKNA 3D39E 2UVFA 4GXVH 5TE7H 4YHOH 1O0VA 3T0EC 2VDKL 1XCQA 1XIWD 3SQOH 4PJGF 1PZ5A 2F19L 3BAEL 3X12A 2RB8A 1TJGH 4JREB 2ZSWA 1EEUA 3QPQC 3T0WA 4F7MA 2YZ1A 1ZLSL 5DR5L 5EOTB 3KYNA 3KPLB 4FQJH 3MREA 4XVSL 3PIQA 5CJXC 5HI5C 4P2OC 4DN4H 1OP9A 5JOFA 4M1CC 4OM1H 4AEIL 3ZE2E 4OLYH 2NY4B 2E7BA 3F7YB 4FFWC 1ADQH 1M05A 2XZCL 2DQFA 3BVNB 5T3ZL 1B0GA 2DLFL 3MBEB 3U46A 3L3JA 4H26A 2YR3A 4S1DD 2F53B 2BY0A 2Z4QB 5EFIB 3DXAE 4OKDA 5LXGH 1Q9WA 5K9JH 3D48R 2EDRA 3UAJD 3BISA 1UFUA 2X4OB 4R2GB 3U7AA 4POZC 4U2YA 2CDFA 1MCRA 3O2WH 1ETZA 3NFPA 4Y1AD 3RL1A 4OV6F 4ZPTB 3T65A 5GJSL 4D0DA 1KIQA 2X6MA 3L95A 1K8DA 1SBSL 5GIRB 5C2BL 1BQHG 2BHZA 3IF1B 1T0NB 1F02I 4GKZA 2NY1D 1JFQL 4JHWH 2IADA 2CK0L 3JVGA 1MY5A 2KKQA 1E28A 2EIBA 5IVXA 5DC9B 5GJTL 2VDLH 3QWOB 2FBOJ 3SE9L 1T1YB 1B6UA 1G7IB 4RGOL 4HKJB 5C9JA 2VDMH 3CZJA 3AU1A 5MERB 3RDTC 4OFIA 4KAQH 4B53A 2V5MA 1V3KA 3AB0C 5FUOL 4UT9L 3WS6A 4PJ8D 1A7PH 2V17L 1YJDL 4OZGF 3FO1B 2OJZH 2Q76A 4IS6A 1F3JA 4YDKH 4W6WB 3HC4H 1OP5K 4AQ1B 3H3PH 5FGCB 4GW5B 2EYSA 2ESVE 3OR6B 2Y06H 2IFGA 3CCHA 4M1DH 4XAWL 2K9UA 3LS5L 3HE7C 3ARBD 4HZLA 3PWVA 4JO1H 4IHOA 3D0VB 4X7TB 4MQXD 4ACPA 3QDHA 3C09C 4HBQA 2LE9A 3FRUB 1LEGB 4RFEB 4OD1H 2RFXB 1EPFA 1WFNA 3DLQR 5CWSA 3MFFA 4P2QE 4U1KA 5D2NC 1ZE3C 1MHEA 4XHQA 5F8QC 4Z7UF 4ODUA 4PJBE 2W0FA 5LWYL 2EE6A 2X4QA 4OCXH 4S1QL 2LV4A 5JXEA 4XCNB 2IGFH 1J5OH 3BYYA 1OAYH 2YK1L 5D5MB 3QNXB 2MOVA 1KCKA 4KGLA 5HVWA 4XCEA 4HCRH 4XZUB 3TJEL 3P2TA 4C56E 4UQ3B 5T1KB 1UM5L 4MA8H 4EXPX 5A40E 1TTGA 1UCBL 3GIZH 4GUPA 2D7QA 4HWEL 1FJ1B 2IANA 3CGTA 3MOAL 3FQRB 4O51B 5DVLA 2EXYD 4UOW0 3PXJA 5BMFH 3P0VL 5D7IF 5IBLD 3S88H 4OF8A 5BRZA 4LARL 1U3HD 2VLLA 3AS2A 5IB1A 3MC0A 1CGWA 4ONFH 4M7ZC 1EFXA 3TBYA 2R23B 5K9OB 4QRTB 6FABH 4CU7A 1VFMA 4I18A 2GK0A 2AJSL 5A43C 2EIEA 3HZMB 1ZLWH 1D9KD 4BZ2L 3RIAK 4JO2H 4LSRH 1ZEAL 3MUHL 4OLZL 5J0BA 3MO1A 3SOBL 5I1GH 3BP6A 5HI4D 5I73C 1EJ6A 2WIIB 5K93A 12E8H 5GGUB 1V5JA 1HHKA 4NQEE 3VXNB 4L5FH 2R69L 4PJCE 4X99B 1JGDA 3IFLL 1NMCB 3FO0L 3V0VB 4HPOL 3PV7A 4LQ1A 3I02A 2BSED 4ODSL 2GTWB 3QJFA 4M7KH 1HDMA 3ES6A 2LAAA 3DSNA 1VPOH 4OCWH 3DO3A 4R7DB 1NFDF 1HINL 2AV1A 4MAYA 4UOW1 4YPGA 4LOUC 1B9ZA 3ISWA 3STZB 5DJCB 2DI7A 1WWCA 1AE6L 1E4JA 2B39A 5F96H 4IOSD 4IRJA 3FQTA 1V3MA 4Y8DC 4HIEA 2NY7L 4W6YB 2VDPH 5KSUB 5A2LH 4QOKD 4N1HB 4OFPA 4JFPA 1NCWH 5JW5B 2CR6A 3MV01 1RK1A 1M6OA 4KJPC 4NQXA 1K3IA 1LP9A 1CG9A 1RJYA 4MB4A 4WI9A 3DUUA 2A6DA 2FH8A 3BWAA 1KC5H 4OZHA 1MJ7L 3MV7D 3AXLB 2HT3C 2BVOA 4Q6IC 3BZEB 2F9BT 4R4NC 2JB6A 4D3CL 4P2RB 2FO4B 3OKLA 4Y2DB 1NPUA 3IETB 3I2CL 3QULB 4O2FB 3V6OA 2AERT 5MEQA 4HT1H 4ZUSA 3F58L 5I18L 1T4KA 3WNLA 5MEOA 1LDPL 5H37H 5I8EA 3MXVH 2FDBP 1QOKA 5F9JB 4PJHE 5FYJE 2XXMB 2MCG1 1D3CA 3TV3H 1N59A 2CKBA 4H88L 4HH9B 4EQ3A 1RUAL 4TSAH 1F3DH 3TWCH 3F5WA 3BQUA 4YLQT 1H3XA 2FD6L 1NBVH 2F15A 3UBXG 4GW4B 1KIRA 1JK8B 3H8NA 1M7XA 1R3LA 4FXGA 3X3GL 3N1QC 4ZD3L 4L9LB 1P6AB 2R56H 4APQD 3ARGC 3D3VB 4ZUVB 1WEJL 5AYQA 4PRIA 4HG4K 4OIIH 2VXVH 3GMMA 5GISH 5B4MD 2ZUUA 5CD3A 4C83A 2HT4C 3CXHK 4KDVA 5I16A 1SYVB 4PV8B 4OCRL 4RDQG 2X89A 2Z91B 1K4CA 4Y5VB 4JHAH 1RZKC 3MRIA 5DUPH 5EG6C 1UH2A 2D9CA 3KXFD 4RRPG 1A7QL 4QXTA 1GOGA 3DYMA 5I1DA 4OD3H 3PXHA 4RZCB 3DBXB 3LSOB 3G9AB 1MCSA 5FK9A 4P2QA 1WIPA 3IT8D 4E42A 3HE6B 3MRGA 3V6ZB 1N2RB 4G43B 2PO6C 4TRPL 4PJBA 2VIRA 3WHXB 3O3EB 5I66A 2A6KB 4L4JA 2E8YA 5SX5K 4ORGB 4QY8A 2XRAL 1U8PB 3FQXA 4XXDA 1JGLL 1K85A 3BT2H 3MJ8A 5T3XL 3RX5A 1I3RA 3BYTA 4PJIE 4TUJB 3GMNA 2UZYB 1RZ8A 5C0DA 2WQRA 1Z0MA 5D1ZD 3W2DL 2VITA 1PQZB 1P2CA 1KULA 3FB5A 3TYGH 1YEHL 2B1HH 3OZ9H 1DQQA 5B8CC 3BIAX 2DMBA 3Q2CA 3ZT6A 1XZ0A 5DVNA 3FFCD 2CKBL 4BKLB 1HKLL 3GM8A 4Z7QF 1NMBH 3MLZL 3CSGA 1XIWA 3EO1B 3S34H 3ZZ1A 3OV6A 1IGJB 5DI8A 2OQJA 1IKNC 1HHJA 2MPAL 4MZ3A 5I0ZA 2AJZB 1HXMA 4X0KB 3ARFC 3QUZA 2VTFA 1DFBH 2VO5A 4RMRA 1OAXH 4I8DA 4V2CB 3SE3A 3QQ3A 5KVEL 2H6PA 4M1GH 1AI1H 1YEEL 1CFVH 5GS1A 4MD4A 5E03A 4XNZB 1TXKA 4NN5B 4BSJA 4QTHA 3SY0A 1RIVH 4NQEA 2X4PA 5DD3H 3TH3T 1ES0B 2DQCL 3SKJL 4JY4A 4PRDB 3QH3B 1RK0A 1I8KA 2FIKB 4JJ5A 3O3DB 3RQ3A 3IXAB 5FM5O 3T3PF 5C0FB 4GAJH 3QDGB 3DUSA 3EDDA 3TNMB 3GSNL 2A74A 3Q6FA 5FV2A 3W5MA 3EIFA 3MRNB 5LGHH 4FQLL 1PD6A 4TYUA 3JWDL 3O0RH 3VA6A 1UH3A 3E1F1 4JN2A 5ICYB 1CLZL 3C5ZD 2BMKA 1WBZB 4N90D 2A9ML 3JTSA 4PYHA 3WEXB 5ESVB 4UU9A 3PL6C 5ID1B 2WWMC 2BZDA 3JV6A 3VXMD 4JB9L 4OKVA 2J8UE 2H3NA 1XGPB 5DJ6B 1YECH 5E2TL 4EUPA 1KPRA 1D5ZA 2WM0A 1I1AA 3L6FA 3R8QA 3VXPA 2OJEB 3WD5L 3ZYJA 2BVPA 1BP3B 4UAOC 5AYUL 4XNXL 1I85A 2OI9B 2PW1A 3O4LB 3TCLA 2E9JA 3BPNB 4JQVC 3TBWA 2ED8A 5GSVB 2X44D 3RNKA 4Y4HD 2V6HA 5DMGC 3C5JA 5ABDE 5F1SA 2XKUA 5ETUB 3VFOB 2MQCA 2BSTB 5C6TL 2G75B 4PJ8A 1X5KA 1NEZB 3H3BC 4GAYA 3QAZB 4I0CC 5HGAB 3DURA 5KANI 5C0EA 1IBGH 4EJ1C 3VXSB 2RGSA 3VFMA 1PG7X 4BYHA 4K23H 5F89B 4HSQA 5J57B 5JHDB 1HI6A 1LNUA 5FA4B 4PJHA 1FYTD 5H35A 1NQBA 5ENWA 3D1MC 1HKFA 3ARBA 4J4PC 4G8GE 5KVFL 3HNSH 4CW1B 3UDWC 1UWEL 1LE9B 3AY4C 4HF5L 4Y16C 4LDOB 4LPYA 2YKLH 3TM6A 2CMRL 3T3MF 2J6EL 2RIKA 3H9SD 2NYYD 1XGUB 4G8IA 1PKQE 4N5ED 2BVEA 3D85B 2C3VA 1AGDB 1BECA 5FUCC 1T5XB 1NGXA 4S2SB 3C2SA 1ZAGA 5DSCB 1DBAH 1ZWIB 4GRLA 3U36A 3W0WB 3WLWC 1YYLH 4JDTH 4R3SA 1I4FA 2YEZB 5DUMH 4HXBH 5D1XD 2ADJB 1AD0B 1CICC 4PJFB 3SDDC 3OHXB 4LPTA 3VD3A 5J7CC 4Q9RH 5BXFB 3O2DA 4J3TA 3KWWA 3P4LA 2FSEA 4D0CB 1OTSD 4ZFZA 4IBLT 5KW9L 4TNWF 1WAAE 5TQ2H 3E2HB 1TZHA 5ICXB 5FYKH 3LKPB 4OFDA 4PY7B 4LEXL 3IDUA 1A9EA 4ZUTB 4Z0XB 3AS3A 5GGQL 4FFYL 4E41B 3TGXA 4X6FB 5J56B 3X13B 1FAIL 1XH3A 2E8ZA 4ODVH 4JFXA 5AG8A 3PP3H 3U0WL 1TMCB 1LO4L 5K9KA 4HS8H 4O02H 3GGWB 1YEJL 1E4XL 3INUH 4A6YB 4C55A 1VESA 3IRPX 5HHME 1ED3A 3DUHA 4QHNA 3D9AH 1AP2A 4PJIA 2QADC 3NZHL 5J12C 3A0OA 1A5FH 2WP3O 3DETD 4RGNB 2VE6B 5F44A 4NSKA 5KSAD 4ZTOL 4MX7A 4KY1H 5TE4L 1D6VH 1LK2A 1NCTA 4NZTL 2M1KA 2Y6SC 4MDJB 5BS0D 1XF5A 4M3JA 5IG7B 1I7ZA 3CFEB 4PJXF 2DLEA 4Z0BL 3DOSA 4J1UA 5HGBA 5F6IC 1IEAA 1N5AB 4WFHD 1EEYA 4HV8A 1KCUH 4PRHB 1FQ9C 1URLA 3TJHC 3I3DA 2AK4D 4HKBA 4JFZH 2DLTA 4Q9BA 1UQSB 3GBNL 4HUMB 2OZ4A 3C5SB 4LKXA 4WCYH 3GSRA 1KJ2L 2XQYK 7CGTA 4HWNA 1J0JA 1JWUB 2OR7A 3ARUA 3T4YB 1IMHC 2EEDA 1F3RB 5TGBA 3BPCB 4NQCD 5INCA 4ZPVB 5BO1L 3NVQA 4Z5RA 5LG1A 3ARYA 1TQCC 4NRYA 2AABH 4ELME 1KJVB 1FGNH 1FNAA 5IW6B 3M1BA 3O2DL 5HYQB 2GJZB 3I75B 4ODTH 4NRZB 4MS8C 4R90L 4WWKB 3E8UH 4I3SL 2AAVA 4XPGH 2E7MA 3MRDB 5E99L 5FO8B 3TBTA 3RY6A 2NY3B 5HD8D 2D03L 4CUCA 4QOKA 3TO4A 1OWRM 3U4EA 8FABB 4NM8H 5CEYA 4DEPC 4L4VB 4WV1B 4YZFE 5FYJU 4FQIH 3V79C 2NW3B 1V3JA 3MNWB 1YEGL 4YFDB 3MLYL 4MXVE 4ERSL 1UZ8B 5FIEA 1FO0B 3OL2A 1IAMA 1MLBA 1CT8B 3V5KB 2PKDA 1XGQB 2J8UA 4LVOC 5E9DE 5H2BB 5EZOH 5D7LE 1T6VN 3KGRA 3CLFL 4KDTA 3FQUA 3WO3B 4XNQA 4YFEA 1JV5A 4MNHA 3W39B 4LPCA 1R5WB 5ANME 3HHRB 2IPTL 3QO0A 3EYUH 1Q8MA 3UYOD 1CDGA 1CLYH 3MOBL 1Z2KA 1GZPB 1Z5LB 5CP7B 3N0PB 5I2IA 4OZ4B 5H37G 1FHGA 2OZ4L 4JKPH 1MHPH 2GI7A 3TVMD 5SWSE 1KIPB 5AD0A 2Y36L 3P11L 3B8SA 3O6KH 5DJDA 1JZ2A 4V2BA 2DBLH 1QEWB 4FQ1H 2H26A 3OAZK 2VLJE 3ET9F 4Q9CA 2LVEA 5IQ7H 1SY6H 4NO5A 2FEEI 3WL9A 3CFKA 1DSFH 2BC4A 3DECA 2FLBT 3S37L 4KI5F 2FCBA 4U6XA 4WW2A 5J1AA 1A3RH 3KXFA 5B39G 1GGBH 5D7JC 1Y6KR 1ACYH 3H9ZA 4GW1A 1QZ1A 2XA8H 4Y2OA 2Y5TA 3MV9E 2A83B 3R0NA 4TUOA 4BH8B 1JUFA 5HPMB 1INQB 1U3YA 3RZCD 2DI8A 4XP5L 4U1JB 2ZCKH 1FN4B 2EYTB 5DJ8A 5HTSA 3AC0A 5JPMA 3QFDB 4OZIE 4WFEE 4C57C 4ZS7L 5F9WC 4JLRB 5EU5B 4OBSA 4HHAA 1ZHKB 4X9BA 1X9QA 3TT3L 1S7UA 3MNVA 4N9OB 4ZFGL 1PDKA 1CGSH 1QUNA 1DP0A 4FS0A 2WUBL 4KRPB 1NGZA 1OAQL 2IALA 4KJQC 1FLRH 3SDXF 3DGGB 1NGWB 4ALAH 4XXCC 4NDMA 1WAAA 3VD5A 1EMTL 4X4XB 1BFSA 5E6IB 4X5WB 3S35X 3OKEA 1OLZA 1YN7B 4PP2B 4HIJB 4RFNB 1CDCA 3CZFB 2BP3A 4HIHB 4IEFB 4Q2ZB 1WQVT 5F3BB 3LVEA 1ONQA 1WTLA 1IGIH 3WNNA 5JO5B 5TF1H 2FGZA 4QNPF 5GRWA 2FH6A 5GQBA 5IB3A 3UMTA 1E4KA 3IVKA 2NY0D 1XCTA 4KKAC 3LN4A 4P5TC 3WIHA 1C5BH 4PJ7E 3MLPA 4JM2F 3GSQA 1T22A 2FB4L 4HIIB 4PIRF 3LS4L 4YHLL 5GZOC 1I9RH 3VRLE 4DZ8A 1MFEL 1XAUA 2VXTH 3EO0A 4LSQL 5I1IL 4A2LA 1JNHB 2OL3L 1J1XH 1D6EA 5TQ0H 3ETBF 5T5NG 4IRZL 3ZKMC 5CP3A 1YMME 4LGPB 3ZYIA 4JVUA 4NFDA 4KVCL 4NGHH 3DV4B 2AKRA 1HHIA 3HCVB 3WFDL 3L3IB 5C09B 3MV8B 4KI5D 4RNRA 3NPSB 3DROA 4OUOA 1OD7A 2DQDH 5GGRB 3CSYB 4GKSB 1T1XA 3WN5C 3WLBA 4LCCB 1DVFB 4J6RH 3TZVA 2X4NA 5IMLB 5FDWB 4HJJL 3ARVA 3HC0B 4HLZG 1L9MA 2P5EB 3O6ML 1JWSB 4C58B 2HKHL 1RZJC 5HDQH 4PGEA 2VXSH 3VGHA 3LV3A 4G80B 1NEZG 5D1QB 1SJEA 4JHZA 3O45A 4LLDB 3EAKA 4OB5L 3K81A 4PJAF 5C0IA 2YPLE 3TIDB 2VZOA 3NOIA 2NZ9C 4NT6A 4JFED 3P9MA 4HWBA 4HBCH 1JF5A 3OAYH 4F7EA 1JF6A 2IC2A 5I1CL 2O61A 5IVNA 3BN3B 3IKCA 3TA3C 3MTRA 4LLMB 5GRYA 3E6HB 2YBRA 3U1SL 3VXOB 5E9DA 3GMRA 5D7LA 4NC1C 3PDGA 4XVJH 5IMOB 5DRWB 3FN3A 4ZUWB 2X5PA 4NO2B 5IVZB 3IDGA 5JW4M 5ANMA 4X6CE 3RWHB 4M7LH 3ZKNC 4JM2D 3PWPD 1V7ML 3MJ9L 1FLTX 1U8HA 5C7XH 1X5HA 2HJFB 4RA0C 3BW9A 1A1NB 4XNYH 1CU4L 4J3VA 3H9SA 3ESVF 5GRUH 5SWSA 3OXSB 3W9EA 3CIQA 3MCKA 3U6RA 2NY6B 1MCPL 2I60H 3A67H 1T2JA 4ENEC 1EAJA 3WFCH 5BV7L 4PFEA 4FTVD 4UINL 3IGAA 1E4WL 3KJ6L 5JMRA 5E00B 1SYSA 3K46A 4O2EA 3VGEA 3DMMB 1DUYA 5D96B 2DWDA 2Q7NA 1G6VK 2Q8AH 3RWGB 4FQXB 4Z9KB 2VDKH 3B5TA 4YIQB 1B4JH 1U91A 4ZFOA 1BVKA 4LLYA 3MRFA 3AM8A 3MV9A 1EUTA 1DBML 2YD4A 1CFSB 3CMOH 1BEYL 1CF8L 4U6YB 4OIAA 2GITB 4MZ2A 4Z7VB 2P45B 3IFPA 3VFWA 3O8XC 1M7DA 1OGTA 2BSRA 3NACH 4OZIA 4XVSH 4X7SL 4MGXA 2IBGA 3VI3E 5E4IA 4GBXC 3QIUD 4NFCA 2ADFL 5E94B 1IGFH 3EJJX 1S7QB 4LBEA 2NNAB 4QGYA 2VR5A 5F70A 4Z76A 4IMLA 4ELKB 5JUEH 1EX0A 3MUGB 4MQ7B 3GJFA 5IHUL 4ZXBD 3FOLB 3VWJD 2JK5B 1OAKL 3H9HA 2X09A 5IB5B 4XPAL 2KZ1B 3U79A 1KJMB 4D0BB 1T1WB 3ILQD 4G6MH 5BS0A 4JQIH 4HWUA 3UTSB 1BVZA 2HJLA 4TSBL 2DTSA 4WJ5A 3AREC 5LVEA 1TCMA 1H3VA 1GGIL 3ZT5A 4EDWH 4XAKD 1BQLL 4QRPD 4B7IA 4EVNA 5IOPB 1KBGH 1TIUA 5GJSH 3BP7A 2DBJA 4JVPA 1SBSH 4WDIA 5C2BH 5KSVB 2WINB 3FZUD 4HGMA 1QA9A 1U36A 2DJ4A 4NQCA 4KMQA 3UEZA 1JFQH 1QLFB 4QRRB 5D6DC 2CK0H 3KVQA 4NO0D 4HX1B 1F2QA 4TOYH 4AEHL 2XZQL 3MRJA 1H5BB 4Z77A 5IV2B 2Y9RT 3OR7A 4JO4H 3SE9H 3RWFA 4PLKC 4YEEA 1ITCA 4RGOH 5GRJL 3HB3D 1OLLA 5E2WL 2DQUL 4Q97A 2P43B 4JPWH 4EN3C 1KN2L 3PHOA 3K3QA 4ZFOL 4TTGA 3QIBB 4LIQH 3BP4B 2V17H 3MGTA 1QSFD 4F9PA 2AXHA 1QRNE 4O00A 4JZOA 1JNNL 5FGBA 4IIQA 1J9CT 4YHIA 2X2YA 1FL5A 2NY2B 3KDMB 2X42A 5DEFB 3UTTB 4P57B 3VWKA 3FMGH 5CEZE 1IC7H 3LS5H 4GG8A 2GY5A 2QEJA 4AL8L 1QFHA 3TYFA 3U7YH 3RI5K 4I5BA 1IGTB 4M5ZL 3L3KB 5E8OA 4NQDD 1XCQB 1KB9J 2NY5C 3CFCL 1PZ5B 1L7TH 1EGJA 2ICEA 5LWYH 4N0CC 2R0ZL 4Y19E 3ROOA 1RI8A 1RURL 1Z6JT 2ZUSA 3LD8B 1RZFH 2ZSWB 5ITFA 4F7MB 2YK1H 4QRSA 4GO6B 2E9WA 3MREB 4D9RE 2G9HA 3PIQB 4HK0A 4IOIA 2CGRH 3FT2A 3TJEH 5JOFB 3TVMA 2R0LH 2VISA 1UM5H 4F58L 1UCBH 3NFNA 4L8SA 2JJTA 3IDIA 3MOAH 1KT2A 1M05B 2DQFB 1B0GB 2DM4A 3U46B 3L3JB 5KZCD 5F7NC 4H26B 2VZTA 1TNNA 3MLRL 3LEYL 1S7SA 1FIGL 1MIMH 4AT6A 5EWIH 1GGTA 3BN9D 5EBMA 1A6VH 5LGKA 2NXYC 3BEWA 3QEHA 4OZFH 4LF3A 3LKNA 2Z93A 2CDFB 2W60A 5C0CD 2AJSH 3LQAL 1ETZB 4EEEA 1YYML 4LPXA 3HRZB 4AM0A 3T65B 3WFEL 1KIQB 2HG5A 2WBJD 4RMWA 1K8DB 3DX8A 1G1CA 2PYEB 4ETYA 5ACZA 1T0MA 1G7QB 4GKZB 5CKGA 1J1PL 2LTQB 2GW5A 4K3DH 4DVRH 3G5YA 3KLHD 1E28B 5HYJE 3BGFB 5CSBA 3VXUD 1IGML 5IVXB 3RP1A 4PLJC 3ZSSA 3IFLH 2ICWJ 4KTEL 3C60D 5C9JB 3FO0H 4HPOH 1WBXB 3T0ED 3DRTA 4ODSH 3WUZA 1RVFL 4CNIA 1BIHA 4CDHA 1HINH 3IDYC 1R5IA 2Q76B 4IS6B 1F3JB 3BUYA 3QPQD 1PLGL 3V5HA 4QCIA 3EYOA 4J3WA 4QYOA 1N6UA 2EYSB 2F54D 3CLEL 5HI5D 3GHEL 3CCHB 4JREC 3O6LH 4P2OD 5H8DA 4M1CD 3I6LD 4N0UE 5TE6L 4X7FC 3VMPA 3EOTL 4IHOB 4OCYL 1F4XL 2QQKH 4FFWD 2NY7H 3SGKA 3UO1H 1Y6MR 3OB8A 3SBWA 4UDTA 4U7SA 5CWSB 1S78C 4U1KB 1CR9H 2I9TA 1T80A 5AAMA 2Z9TA 2NY4C 3EOBA 2W0FB 5DYOA 1P7QD 5EZIL 1MJ7H 2X4QB 3ZYOA 2FECI 3MBEC 5L2KB 3NA9L 2DD8H 2Q6WA 2VR4A 5IMKB 5CJ5A 3HFML 4POZD 4D3CH 5EO9A 4MJIE 1DQLH 3MJ7A 4HZAA 1I7UA 3ELAT 1HH6A 3I2CH 2N1KA 2D7TL 1BD2D 4XCEB 2MMXA 2DS4A 3X14A 2RR3A 3HC3L 4R2GC 4HIXH 3EYVA 5C08D 4WUKL 2IANB 6CGTA 1MI5D 5C0GA 3T1FA 1XR8A 3OKDB 3QDJE 4G6JL 1F58L 3I9GH 4NP4L 1PSKH 2XACC 5IGXL 5EUOB 2PR4H 5BRZB 4O58H 2VLLB 1RHHA 4CN4A 4WUUD 4R26H 5I17A 1CD0A 1MH5A 1J0KA 1S9XA 1ZA3B 3O2VL 3R06A 3X3GH 1EFXB 3TBYB 3QRGH 5DK0A 4ZD3H 3NIGE 1QRNA 1K4DA 2EC8A 4Q74A 1FC2D 2ICWA 3S3SA 1WEJH 4NKMA 5A3IC 2I07A 3VGFA 4JFEA 1VCAA 2IPUK 3EYFA 4DCQB 5F1NA 1YEIH 1IAII 3PJSA 4OCRH 1FG2B 2GT9B 5C0AD 2ED7A 3QPXH 4F57L 1P1ZA 3MO1B 1A7QH 2D31B 3BP6B 3P4OA 5C07E 1V3LA 3HE7D 2I24N 2XN9D 3L7FA 2ARJA 3D39B 5C6WH 1HHKB 1ITBB 3PNWB 4GKOA 4M00A 4TRPH 5L6YL 4LLWB 5T5FH 4OUUB 4Y19A 1JGDB 1NDGB 4ZTPL 1QBAA 1ZLUK 4CADA 3W81A 3I02B 2XRAH 4F7PA 4JM2A 1JGLH 3QJFB 1HDMB 1VDGA 1UGNA 5T3XH 2UY7A 4X8JB 5CGTA 2Z31B 2AV1B 3L5IA 4RWYH 2PUQT 1KPVA 1JL8A 4YPGB 3FRPG 4MHHI 2VDOL 1SM3L 4MD0A 5B22A 2EDHA 3U9UA 5DRXA 3RA7L 3ULVC 4IRJB 5ADOL 3FQTB 3VGDA 4FTVA 1I1CA 2DN7A 4OLVL 4HIEB 5AG9A 4NNYB 2CKBH 5MEND 1HKLH 4JFPB 2ARJQ 2BHYA 1IM3A 2AQ1A 1RK1B 3MLZH 1M6OB 4WIQA 4NQXB 2H9GA 1BBJA 4IOFC 1CG9B 1RJYB 3GZKA 2DDQH 3DUUB 1UA6L 2A6DB 5EN2A 4RFOL 1OF2A 3GMOA 3LKRA 3BWAB 5FGSA 4OZHB 4PUBL 1IQWL 2FHBA 2BVOB 3K74B 5CZKA 3N1FC 1EUUA 4WEMB 5C6PB 2JB6B 2XICA 1NGPL 5IJVA 3OKLB 1WZLA 1FFNA 1RIHL 3KR3L 1QYGL 5T1MA 4YO0A 3QIUA 1YEEH 4F3FA 1X5XA 4XCFH 1UYWH 5MEQB 4X5XA 1R3KA 4S1SH 1QNZL 2EDEA 1P4LA 1T4KB 3NCYS 1UZ6F 1R3IH 5HYJA 1FRGL 4WI7A 5FHAH 3VWJA 1N59B 2HA1A 5TH2A 1JGUH 4POYA 1VA9A 1NMAL 2YPKA 5DFVC 3MA9H 3BQUB 1QVOA 5DK2B 3HKFA 5KOMC 1KIRB 3ARPA 1W8OA 4FQLH 4FXGB 3GIVA 4GOSA 2E6QA 1KCLA 3MRMA 3BESR 4P49A 1HIMH 4X80L 3DIFA 3GMMB 3S97C 1YPZE 3Q5TA 1T83C 4C83B 5I30H 3AAZB 1G7MA 1NMCC 2ESVB 4X6DE 4JKKA 2ZUTA 4MCYA 1CL7H 2OP4L 5HGDA 1U8MA 4G5ZH 4LOUD 4M48L 1QSEE 3P0GB 1K4CB 1JGEA 1EV2E 3W5NA 4HULB 3LMJL 5E2TH 3TC9A 2A1WH 4EDXA 3QJHA 1H15A 3QEQD 4HEPG 4QXTB 3ZE0F 5I1DB 1NC2D 7FABL 1I1FA 4P2QB 4P9HH 4E42B 5AYUH 2AJYL 3MMEA 3IJHA 4PJBB 4U0RB 5CKAA 5L9DH 5I66B 4FZ8H 4KJPD 4U3CA 3QEGL 4WY7H 4QY8B 1IT9L 5C6TH 4XWOC 3QXVA 2BVQA 5GGSA 3FQXB 4XXDB 4MJIA 2UUDK 1N64H 2HT3D 3ZDXE 3MJ8B 4GXUN 3OJDA 4R4ND 3GMNB 1U3JA 4C56B 4PBWD 4PY8I 5CSZA 5IHBA 5C0DB 4YZFF 2VITB 3SKUD 1PEZA 2YD7A 4KJYA 4ZQKA 1T7VA 2KDGA 4M43L 4KK9C 5SWQA 3L9RA 1DQQB 1T5WB 2APTA 4UB0L 1GL4B 3KG5A 4M6MH 4Y2DC 4HF5H 1XZ0B 4D9QD 4LAQL 1QFUL 2ZG1A 3V7MA 4LFHG 3CXHJ 4HLJA 2CDGB 1RUMH 4AEEA 2ZUYA 2VL5A 1Z9SA 5DQJA 4Q9QL 3CJJA 4W4OA 1Z9MA 5DI8B 1HZHL 3T77A 3KPNA 1HHJB 3C08H 4OT1H 1HYSC 1KEGL 2X1PA 4HQQL 3A6BH 3ARGD 1HXMB 4S0SD 5DDHA 1G84A 1N0XL 3QUZB 4L8BA 3TIEA 5KW9H 3WFBL 2HT4D 4R0LA 2H6PB 2ENSA 4L9LC 5GS1B 4LSTL 3G6JE 4RGMB 4MD4B 5JW3H 4OQTL 3C8DA 4QTHB 3SY0B 4NQEB 2X4PB 3N85L 4EUPH 2GCYA 4PJCB 1FNEA 1HEZA 1CLOH 4JY4B 1IGCL 1RK0B 1RZ7H 1I8KB 4EQ2A 4JJ5B 4TULL 3U0WH 5DJYA 3BKYH 4Y5VC 5EOCL 1NCDL 2B4CL 2H1PL 2APVA 3CXDH 2PO6D 3DUSB 5E95B 4PGCA 3ALPA 3Q6FB 2A74B 3VXRE 1LILA 2FEEL 5JHLL 3UPRA 3GMQA 2AXJA 3NZHH 3HE6C 1HHGA 3ARQA 4ZODA 4TN9A 1LD9A 1MWAL 4OAWA 2BMKB 5ID0A 1GVIA 4U1SA 1U8IA 2EE2A 5TE4H 1A1OA 1F4WH 3CFJA 1DL7H 4UU9B 2WBJA 2CPCA 2H2PC 3JV6B 2W9LA 4OKVB 1EO7A 1DBKL 4NM4H 2H3NB 3HG1E 1VGEL 2H8PB 5CD5D 5HYSA 4Z0BH 4W6XB 4JFFD 4EUPB 5T33L 4DK3A 4E0RA 4YXKL 1KPRB 4FG6C 5KSBE 1EO8L 1I1AB 5J6GB 1IL1B 1MELA 1NJ9B 1AIFB 2FJGA 2VSCA 3BH8A 3VXPB 3VFUA 3QUMA 3GBNH 2PW1B 1KJ2H 3TCLB 3TBWB 2DAVA 1QHPA 3TLRA 5D72H 1E27A 2R4SL 2HT2C 3LN5B 5I74B 3C5JB 3SN6N 5IR1B 1UM4H 3QQ9C 3OKKA 1PJ9A 1JPFB 4PJ8B 2DQHL 2QBWA 4UOJA 3DX9A 4GAYB 5IBTH 3CX5K 4ESKA 3DURB 5C0EB 3IJSA 4IRSB 3VG0H 4O2CA 3RVWC 1NUDA 3RX7A 4LSSH 3ARFD 3VFMB 3O2DH 4HS3A 5LJYH 5I19L 1MJ8L 4R90H 3KNBA 2F54A 4I3SH 5CJXA 2Z8SA 4KKBC 1HI6B 5E99H 1LNUB 2OSLA 4PJHB 1ZTXH 2KPNA 2VWEE 2EH8H 5ENWB 5EPMA 3ARBB 4MXQC 1JPTL 1FV1A 4KK6D 4R96B 4LNRA 3RNQA 4R6UA 2R2BA 5D5ME 3D69A 2IBZX 1U8OA 4XB8A 4XNZC 5D7KE 4GRWE 2XZAH 1LO5A 2C3VB 4NN5C 1U95A 2PYFA 1LE5A 3T4AB 1F90L 1P7QA 3F12A 5E2JA 1NGXB 3H42L 1YEGH 3CDGA 1OP3K 3MLYH 4GRLB 3U36B 4M62L 1YPZA 1I7TA 4R3SB 1I4FB 2VQTA 3GBML 1QSEA 2DYPD 3KWWB 2FSEB 1SBBA 2VQ1A 1V8HA 4ZFZB 2FR4A 1XF4A 3PL6D 1TZHB 3MR9B 4GH7B 2FX8L 2Z8RA 1A9EB 2VH5L 1U8QA 1XMWA 2R1XA 1S7TB 2E6JA 1XH3B 2R9HC 4JFXB 2MWCA 5K9KB 2P5WE 2OZ4H 3HAEA 3S96A 1T3FA 2CXGA 2P24A 3O4OB 4PJ9C 3RVXC 3U48A 1U92A 3LPWA 5DMGD 4QHNB 1AP2B 3DARA 4N1EA 1T6WA 4PJIB 1K3ZA 4LHUD 1BZQK 2ERJB 4NC0B 5HY9B 1PAMA 4NPYA 5EIIA 1AH1A 2OI9C 2VAAA 2XI9A 3BPNC 2EEBA 1F6AB 4ZDHA 4NSKB 4AZ8A 1T20A 1KB5A 5C0AA 3LPFA 4RQQA 4AY0A 1XF5B 4G9DA 1KSRA 1V7NL 3NCYP 4MMZC 4UUJB 1I7ZB 1C1EH 2XA3A 4FABL 3QAZC 4J1UB 5HGBB 1IEAB 4MQTB 1EEYB 2IH3A 4HV8B 2XN9A 5FYJL 4J4PD 4HKBB 4KI1A 5BZWA 5IK3A 4XP5H 4EKXA 4LKXB 4Y16D 1QFPA 3GSRB 2EYRA 2VXQL 2I5YL 3OGOE 1IARB 4TUKL 4FZEH 3RIFF 1IKFH 1WBYA 1MAKA 4X6CF 5TGBB 4WI8A 5INCB 3QRFM 4H1LA 4U6HB 1OAQH 1G0YR 3WLWD 1FVCB 4CAGA 2VR9A 3MRCA 1AXTL 4NWTL 4NRYB 1EMTH 3IDNA 5E8DH 1CICD 1QBBA 4NOBA 3SDDD 1T2QL 3MRPA 3M1BB 4X6BA 1QFWH 2AJXL 3PDOA 1QBML 3EZJB 1A7RL 3TBTB 2CRZA 5SX4H 5JORA 1QR1A 5J4MA 3TO4B 3U4EB 1AGBB 3E2HC 4X98A 3VXRA 2J88L 5FKPA 5CEYB 3FJTA 1OGAE 1RFDH 1CXEA 4X9HA 1ORQA 1FH5H 4OIBA 2BSSA 3Q1SL 3MZGB 1SEQL 3W11C 2QADD 3R1GL 5TFSL 1FGVH 1JYNA 2X4RA 2O5XH 2J8UB 3UYRL 2JLLA 3SGDH 1R24A 2B2XL 2QJDA 3FQUB 1MJJA 3CFBA 2MCPL 5KSBA 1JV5B 5DHYA 1UXSA 1AR1C 3BGMA 3F6IA 2H32A 4WTZG 4RGNC 3FOMB 3QO0B 4JM4L 5E8PA 3D3VE 3VU2A 1MCBA 4PTUB 3MLWH 3TJHD 4LDLB 3QFJE 4MJ2A 3CFDA 4KVCH 5EBWA 1KCRL 4LSVL 5I2IB 4PTTA 1T89C 2ITDA 4F33A 5J6HA 3BIKA 4LLQB 4R4BA 1XT5A 5AD0B 1FDLL 4I3RL 3H7BA 4K94C 1RIUH 4CVZB 3KJ4B 4A2MA 4LVNB 4KKNA 5DS8A 1EEZA 3IDMA 2H26B 3O6MH 1LEIA 4S0TD 5A16A 3MYZA 4NO5B 2ATPB 3WL9B 3CFKB 2BC4B 4BFEA 3DNKA 4WW2B 1AJ7L 4MS8D 2W0KA 4RCAA 3LQMA 5EZLA 3UJJL 1VKXA 4CVWA 3QEQA 4H20L 4GW1B 1NC2A 1OB1B 2P8LA 3B2UC 4K3JL 2NW2B 1JUFB 4JRYD 4NIKB 4NNPL 2BDNL 1EXUA 1KLUA 4WWKC 5DJ8B 2B5IB 5JPMB 1CDJA 4GG6E 5IFHL 4HHAB 3JWOC 1JF1A 2NY3C 1ZANL 3MNVB 3S36H 3BZ4B 3RL2A 3WIHH 1NGZB 2IALB 1QHOA 3SDYL 4Q6IA 5FECA 4NDMB 1JPSH 1AO7E 3L5JA 4WV1C 4FRWA 2ZUXA 4XHJC 2Z8VC 3V6BR 3OKEB 1BVLA 1A14L 3BPLB 3LHPL 2GUOA 5A2KH 1MUJA 2YRZA 1HCFX 3CVHA 3F6LA 1G9EA 1UKQA 5JW4N 1V7MH 3NBNA 5DJXA 4JG1L 5CP3H 2P5WA 3JBG7 5I9QB 5DQ9A 1MRDL 5ADPL 2GJ6E 2P49B 4U6VH 5HHMB 5DZNA 5IB3B 2QQQA 5DC4B 1MCPH 2VDQL 3IVKB 1A64A 1UWGH 4HUVA 3MXWL 1XCTB 3LN4B 5BV7H 1XF3A 3BDBA 3GSQB 1UACH 4HC1A 3ARGA 4O4YL 1ZLVH 2E7HA 1T22B 3BFOA 1G9NH 4OGAC 4OSUH 5D71L 3VW3L 4Y0GA 3RGVA 3UROR 4PLOB 2E6PA 5DD5L 2PETA 3IAGC 5IMMB 1D6EB 43C9A 1P9MC 1BEYH 5D7JD 1DEDA 2EE3A 3FO2B 4Y4FA 4X7SH 3SDCA 1U8KA 1HHIB 4HWBH 5FHBL 4M02A 2ZP0T 4EUPG 1F3DJ 2ADFH 4OCSL 2ORBH 3DROB 1WICA 3RWEA 1T1XB 3KPQA 2V2TB 1KOAA 3WLBB 4ELMB 5BVJA 4G9FD 3TZVB 1CDBA 2X4NB 4S10A 5IHUH 1OAKH 2VDRL 1U8NA 3EZ8A 1YZZA 2R39A 4KJQD 2DLIA 4XPAH 3VFSA 4XPFL 3QXUA 4CVXA 3BUTA 2QHRL 4ZSOE 5IIEA 3WHE0 3LV3B 4KV5E 3O45B 4UTAL 4KRPC 4TSBH 1BM3H 1MOEA 2ATKB 5C0IB 3V2AR 3VI4F 1CDIA 2R15A 1BQLH 1UB5A 4NT6B 4L3ED 4MJ4A 5B8CA 1FFRA 1UT9A 2VL4A 3P9MB 3IS1X 4KRLB 4MB3A 5E6IC 5I1AA 1OGAA 4F37F 2HKFH 1Q0XL 2VLMD 4RFNC 3SE4C 2O61B 3V52H 4FMKA 1FCCA 2DQEL 4EI5A 5KBNC 5GZNC 2ICES 3I6GA 3OAUL 2YBRB 3PQYD 4I77L 4KKAD 4P5TD 1BQSA 2A6IA 3ZDZE 4AEHH 2FATH 5E9DB 5DURB 3GMRB 5D2LE 2C1PA 5D7LB 3HR5A 1KYOK 8CGTA 5GZOD 3IDGB 5E2WH 1C5CH 2DQUH 5ANMB 1P7KA 3MJ6A 3UBXI 2Q86A 3G5XA 4ZO8A 3SGEI 5C0JB 3QXDB 3W0WE 1BZ7B 1RZKL 1U6AL 1U8HB 5BCAA 4FMFA 4NCC2 3ZKMD 5FA3A 3ZYZA 4JY6A 1U58A 3BW9B 1IAKA 4JPVL 4PBXA 3N1GC 1A2YA 2W1NA 3WUWG 4HMDA 2VKXA 4V1DE 5SWSB 4FFZL 3SGJC 4I9WE 4NBYB 3MCKB 3U6RB 2ZOKA 3LKSA 2I25N 2Y7QA 1MCOL 5BQ7A 1KFAL 1P4BH 3O11A 4YQXL 2BRRL 1T2XA 1KIUA 3RUGE 1SYSB 4U4BA 4XP6L 3GJFH 3U2SA 5A1AA 2PTTA 2DWDB 3NPSC 2DYPA 4YWGL 1L0QA 3SO3B 3HMWL 1BGXH 3QEUA 1GGUA 4D9LL 3PL6A 2XTJE 2C4XA 4LCCC 1DVFC 4U05A 3KLSA 3MRFB 1RURH 3MV9B 5E4EB 4LCWE 5I8OL 4QWWC 2AP2A 1RU9L 3IFPB 3VFWB 2NZ9D 1M7DB 1OGTB 4CMMB 2BSRB 4OZIB 1MFDL 4GG6A 1XGYL 1U3ZA 3O3AA 2CDEA 5D1QC 1K8IA 4FQHA 4JQVA 3WIIH 1M4KA 1Z9LA 1UENA 2J7LA 3MLUL 3VRIB 4LBEB 3U4BH 4JQXC 5C1MB 4IMLB 3CU1A 4LHUA 5L88L 3HRPA 1AO7A 3GJFB 1H3UA 1N4XL 1PG7L 2Z0BA 4RAUA 3H9HB 1JHLL 2N7AA 1HQRA 4P5KA 4UBDC 1S8DA 3LEYH 4FQ2L 1FIGH 4R7NA 2WUCL 5BVPL 4MQSB 4NFBA 3QO1A 5BS0B 1IAIL 1Q72H 4DKEL 1DEEA 2BNRD 3E3QE 1I8MA 4WJ5B 4P99A 3VH8A 1ORSA 1DBJH 5K9QG 2GJ6A 1YC7A 5AZ2L 3LQAH 3BH9A 1AGFA 3UDWA 1L4IA 1UM6L 1NGYB 4Z7NE 5KVGL 1DQML 1YYMH 2W0LA 4EVNB 4KQ4L 4KVNL 1CFNA 1S7RA 4X4ME 3JSSA 3BP7B 3NN8A 4WDIB 1OAUL 3LH2L 2D2OA 4NQCB 4ENED 5DD1H 4YAQA 5T1DL 5K59E 4YXHL 1A7NH 2AV7B 4HUNB 1J0ZA 3HTLX 3MRJB 1G7PA 1H3PL 1NANH 4JE4B 1MCFA 2BY3A 3OR7B 2NY6C 3RWFB 4LMQE 3SDDA 3OPZH 4XC3L 3VD4A 3RPIA 4MNQD 5KN5B 1YMMB 1NCBL 3PHOB 5DA4A 1EGJH 1RVFH 3GK8L 3NCFB 4YHMH 3DMMC 5D96C 4QHKJ 3X17A 1QD0A 4OGXH 4FQXC 3RWDA 4JZOB 4G7VL 3O8XD 4M7JL 4YHIB 1FL5B 1DBBL 1MFNA 2AXFA 3VWKB 5IT2H 4GBXD 3GJEB 5DZOA 1LO0L 1FE8H 5TE6H 3TYFB 3EOTH 1YEFH 4AMKL 5FO9A 3C6SA 4I5BB 2DL2A 4ZSOA 4LP5A 2JCCE 1AY1L 5ALBH 5E8OB 1IM9D 3QCTH 4HMCA 2YPLB 1W0VA 5EZIH 3ROOB 1AFVL 2AEPL 4K7FA 3NA9H 3ARED 3HPJA 5LQBL 1CZ8H 5ITFB 2ZUWA 4Y5YA 1W0WA 3HZKA 2EDXA 1YEKL 5IWLC 2G9HB 3FKUS 1OD9A 1KJ3L 2D7TH 4NQSB 4PRPD 4HK0B 4IOIB 5F8RC 3FT2B 3E6FB 3HC3H 4JAMA 2CUIA 5C0BD 1MVUA 2VISB 4PR5A 5FV1L 3PGCA 3NFNB 4LPUA 2PW2A 5D2LA 1J0IA 1QP1A 3B9AA 4HGWA 4WUKH 5TDNA 2LABA 3IDIB 3IU3A 4LEOB 1KT2B 1F6LL 4R4FL 3FB6A 5EUKA 2FX7H 4OGYL 4R8WL 1Q9OB 4DN3L 5CZXD 1UWXK 4L9DA 2OTWB 3QUYB 3TPKA 4NZUL 1S7SB 1KEML 2FBJH 4JPIA 4AT6B 4B41A 4ODXA 4PLKD 5KJRH 1INDL 3SJVE 5EBMB 3VFTA 5FEBA 5C70A 3QI9A 3BEWB 2QKIA 3MRQA 4RDQF 3P0YH 4EN3D 1H5BC 1MCKA 3K8KA 4TNVF 4LF3B 1P7HL 1MEXL 2Z93B 3LKNB 4HEME 4XI5D 2XZZA 5GSRA 1MIEH 4WHDA 4JRYA 3K8LA 4BQ6A 2V2XA 4JFYA 2MQ0A 5CBEA 3L7EA 3VE0A 1U2CA 4P23A 2HG5B 1UB6A 1DANU 3QIBC 4K7PH 3DX8B 3P4NA 1D5IL 2XWTA 4F57H 1T0MB 2YXMA 2R29H 3KPSE 1X5JA 1IGYA 2GTZA 2J1KA 1TZGL 5CILL 5FAAA 4WWID 4XPHL 2NY2C 3SCMA 3ARRA 1AKJB 3TEUA 5EU6E 5L6YH 2AK1H 5HHOE 5FCUL 4KMLB 3FQNB 4LCWA 1NL0L 4IDJH 1DTUA 4HKZA 4LSPL 3NCEB 2DQTL 1YDPB 3C6LA 4N0CD 5FF6A 9CGTA 2F5BL 2HRPL 4M8QB 1I9IL 3IDXL 1R5IB 3TPUA 1I9JL 3BUYB 3K2MC 2QSCH 1ZVHA 3V5HB 4KHXL 4F2MA 2VDOH 3EYOB 5AZEH 2HVKA 3LD8C 5GRXG 2D4FA 3C8KA 2VSDA 4WI3A 2P47B 1CGVA 1UADC 2R1YB 3GI8L 5IEKA 3PWLA 5KTEL 1JI1A 2B1AH 1QBLL 2W0PA 5EA0L 4UDTB 5F6HI 2BVUA 2OK0H 3LY6A 5HI3C 1KPUA 4PRBA 4AG4H 1ZT7A 3EOBB 5T3ZD 1TITA 5DYOB 1JYXA 2NPLX 4RFOH 2GSIA 5DT1L 3NCJH 5IFAL 2NXYD 4PUBH 1IQWH 2Q6WB 5D7JA 3RPKA 5F7UA 5JTWA 1BLNB 4X4MA 3D2UA 3GNMH 1NGPH 1K5NB 5EO9B 4OLXL 4QHUA 1TVBA 2VAJA 1I7UB 3KR3H 4RISL 1QYGH 1HH6B 5KS9E 2LU4A 2ZOLA 4RA3A 1RD6A 1MCQA 3X14B 4KMTL 2JIXA 2XG5A 1JRHL 3EYVB 1FRGH 4JRXD 1S9KC 4UT7H 2HP4A 5C0GB 1GAFL 3T1FB 1XR8B 3FONB 3S35L 5DFWH 1WTGT 4JG0H 3B2VH 3EJZC 3GBLA 4DGVL 1NMAH 2ARWA 3UPCA 1GHFL 4J23A 2NLJA 1RHHB 3IB4A 3DI3B 1X4YA 5I17B 5FYLD 1IEHA 5JW4R 4OLUL 4JFOA 2LTQC 1B88A 1S9XB 5C3TA 3R06B 3K8MA 4C54A 3EGSA 3JVGC 5DK0B 3BGFC 1QRNB 4E5XB 1OARH 2ICWB 4NKMB 2YD1A 3ULUE 2I07B 1ZLVK 3EYFB 4ZNCD 1G7JA 3UTZA 3UCRA 4ZOBA 5F1NB 2IAMD 1Z0NA 1EZVX 3QG7L 3RVTC 5DVKA 3PJSB 4DQOL 4P4KB 2QV2A 1KTLA 2V7NA 3WS6C 4M61A 1P1ZB 1YUHA 2K1MA 3S9DB 2BXZA 3PQYA 3ZTNH 4QF1A 1BWMA 5ERWA 7FABH 3L7FB 2ARJB 4GAGL 1MREL 1MPAL 4NJAH 5I75B 1WWWX 4Y19B 1ZT1A 1ZS8A 5E2UL 3P30L 1S78D 1KLGA 1V05A 3QEGH 4CADB 3WO4B 4W70A 1IT9H 1QSZA 2NY4D 4Y7MA 4F7PB 4HKXA 3RAJL 1OP5H 4AJ0A 3MODL 3ULVF 3MBED 2HMIC 1HNFA 4QT5A 3EDEA 2F53D 1EBAA 5D5MF 3EO9H 3HZVA 5ITBL 1KPVB 2YA1A 2R4RL 4XC1H 3U9UB 5DRXB 1L0XA 3MBXL 1NAML 3JUZA 4XMKL 4R2GD 1ZV5A 1D5XA 3DVGA 4UB0H 1BZ9A 4YEFA 3DX6A 4Z7VE 5FYKU 4BK5A 5C0RH 3SJVA 1QFUH 5E2VH 3K80A 4YUEL 1JZ5A 1IM3B 1XEDA 5DVMA 3GSXA 2W9EL 2H9GB 4ONHA 4CVUA 3B9EA 5EN2B 1HZHH 1OF2B 1TJHH 3LKRB 2G60L 2QQNL 3LZFL 3WJLC 4LLUA 1RUKH 1JNLL 4LKCB 5A3ID 1WFTA 1N0XH 4AK1A 5IJVB 1HILB 1IJ9A 1FFNB 3G6AA 3JWNC 2HLFC 2HN7A 1S9WA 2VABA 5I0DA 3JZ7A 2OBGA 4YO0B 4I2XA 3FB8B 4CRPA 4F3FB 1N3NA 2EKJA 5IEHA 3GSUA 5CJQL 5I8KL 4X5XB 1R3KB 1NBYB 1P4LB 4OQTH 5HYJB 3DPBA 5E08L 1G6RA 3N85H 4HMEA 4I0PA 2FYYA 4NJ9H 4EI6A 3ARDA 5EU6A 1RJLA 1IGCH 2V9QA 5HHOA 3CAFA 4URTB 4DVBA 4TULH 5TH2B 1Y18A 5EOCH 2H1PH 3NCBB 4AIOA 1A7OH 4GAFB 5IQ9A 3HMXA 3Q5YA 2IH1B 5LCVL 2R2EA 5E8NA 1PX3A 3GIVB 1MQKH 2I26N 3KYMA 4WHCA 3MRMB 1A21A 1JZ7A 4QRRE 5EBLA 3QCUL 5A2FA 1MWAH 2LQRA 4G3YH 5F7DA 3DIFB 3WDIA 1R6VA 5I15H 5CZVL 3L5HA 4J3OC 2X41A 4MCYB 4HFWA 1U8MB 4ZNEE 5ISZE 4OFKA 1DBKH 4NKIL 1VGEH 3FTGA 1IC1A 4EDXB 3KPRE 1H15B 4YXKH 1NDMB 2VLKE 1DN0B 1EO8H 2Z31C 3ULVD 3MLTA 2EZ0C 1R3JB 1BIIA 3QDME 2EDBA 3MMEB 3IJHB 2NX5E 1BJ1H 4QXGL 4BUGA 5E1AA 4IRJC 3GI9L 4MNQA 5T1KD 3SHSA 2KQMA 4PB9L 1RZJL 1KGCE 4IOFD 1LO3H 3OBAA 5FUZL 2AQ3A 2BVQB 5GGSB 4MJIB 3UC0H 5JPNA 2BNQD 2E9IA 2ZUVA 3K4AA 3KPPA 3JXAA 1KXQE 1E6JL 3FN9A 3O8XA 3VRJA 1DE4B 3MCG1 1U41A 5D9SA 1RUPH 3VGGA 1W72L 1GZQA 2DIAA 2FEDC 1JZ3A 4I48A 4NKQB 4XBEH 5EO0A 3QDJB 4KJYB 5I1HL 4ZQKB 2DTML 5SWQB 4Q0XL 2UZIH 2J8HA 3L9RB 1YY9C 1G6RL 1QFOA 3DRQA 4NUGL 2DQGL 4KH2A 1OT2A 3R4DA 1IM9A 3BO8A 4TNWK 5HDBE 1FVEA 5SWZE 4Z8FL 2VL5B 5DQJB 1FFOA 3NIFE 5EOQL 2F74A 4KKCC 5IB4A 1WK0A 1DDHA 4EZMA 4M62H 3KPNB 4LPVA 3AREA 3AROA 2DRUA 3B5GA 3KLAB 3BQUC 2Y72A 1NCAL 1FC1A 3G04B 3GBMH 3RU8H 4L3CA 2W07A 3BOVA 4JFHE 3M8OH 4YE4H 4R0LB 3L1OL 4F7CB 5C07B 5C0BA 1P84K 1PFCA 2P8MA 4MB5A 3GRWL 3TO2A 3VCLA 3DV6A 4LNVA 4HUWA 4M6NL 2VH5H 2O5YL 5DTFA 4H0GA 4KDWA 2GCYB 1FNEB 1HEZB 5KZCB 4WI5A 1MCJA 3ZE1F 5DJYB 2VQUA 4BK4A 1F45A 4DZBA 5CMAA 4LK4A 4N0FA 2CJUH 3V9FA 3OXRA 3QQ4A 4PGCB 5INDA 4YHNB 4TSCL 3UPRB 4TVPD 4XMPH 2D0GA 2BJML 4XWOD 1HHGB 1LD9B 4U0RC 1OQXA 5GS0C 3VA2C 4ZO6A 1U8IB 1CBVL 1A1OB 1B6DA 3IFOA 5J3HC 3ROLA 4XNMA 5I76B 3PWUA 2YOCA 4FABH 1F5WA 4QRUB 3PV6B 1RMFL 2JE8A 4CJ1A 4LHQB 2FJGB 4KK9D 4P2RD 4Z7WE 3VFUB 3HI5L 3QUMB 4Y2DD 2ZUQB 2E27L 5SX5H 1NLDL 2MHAA 2I5YH 3GFUA 3R0MA 4BFIA 3O6FA 1KV3A 1G7LB 5IBUB 4OFVA 3QZWA 4KFZC 4P9HC 3OKKB 3OX8A 4HK3N 4LU5L 4AIZA 1J8HE 3DX9B 4L4TD 2HTLC 4PS4H 4N8VA 1OY3B 1HYSD 1AXTH 4NWTH 3IJSB 3REWB 1CFTB 1EHNA 4MA3A 1LWRA 1NCCL 3KNBB 2F54B 5DFTA 5DVOA 1D5BB 2AJXH 3V4UL 5F7MC 2EDDA 2V5RA 5EPMB 1A7RH 1I75A 5ACMA 3QUZC 1FV1B 4UQ2A 3RNQB 4LNRB 2UYLA 4G6KL 2WP3T 1MNUL 2R2BB 2FLRT 3SE3C 3WS3B 4OF7A 3OKNA 5GS1C 4HFUL 3TESA 3D69B 5DHVB 1F4HA 1KN4L 4RGMC 4XMLL 3UTPE 3LN9A 3HAEH 1U95B 1WFOA 2PYFB 15C8L 2A0LC 3AS0A 1P7QB 4JKMA 4KUZL 3CDGB 3WSQL 1QKZL 1YPZB 3Q1SH 1I7TB 4H0HB 3P77A 2IANE 2SEBA 1SEQH 4X6DB 3R1GH 4W81A 5J9PB 5TFSH 2ZCHL 3HE6D 1K6QL 5T5NF 3QG6A 2CLVA 5ISZA 1QSEB 1A8JH 2X9YA 2VQ1B 5BRZE 2B2XH 2FR4B 3QUXA 5I1LB 1XF4B 2BHUA 2VLKA 2H2PD 2FJHA 2BVTA 4ONGH 5SV3A 3QDMA 2APWA 3F7PC 4EOWH 5KG9A 1BPVA 1U8QB 4FG6D 5CJ8A 2R1XB 4P46B 3KYAA 3CX5J 3FHQA 3S3JA 3SPVA 1KLFA 4LSVH 1PGRB 3ZKXB 2P8PB 2D0HA 3HAEB 3S96B 1DQJA 1T3FB 3WJJC 4DTGL 4P3CL 5HHPA 4S1RH 3EFDL 1U92B 1I1AC 4OI8A 2NY5L 1DANT 1FDLH 4I3RH 2FO1A 4LP4A 4H1LH 3EFFA 3F7QA 3QQ9D 4CDGC 4NPYB 1I85C 5EIIB 2VAAB 1PYWA 2IAMA 1BFOB 4K8RH 5I74C 1T20B 4MVBC 1FZJA 3RVWD 1KB5B 4P5MA 3RVUC 3BP5A 2J4WL 2YD5A 4RQQB 1AJ7H 3ZDYF 4NBZB 4KROB 4PJ8C 5LAXB 4KKBD 4WFFE 4H20H 3G6DH 4FP8L 1A3QA 2IH3B 4IRSC 2XN9B 3KAAA 1A3LL 5ICZB 4MXQD 3AMLA 5EOTA 5BZWB 3EDFA 5IK3B 5SWZA 3HUJE 2IPKB 1YQVL 1A6UL 3BHBA 4X7DC 1TVDA 1GGYA 3ARBC 5IFHH 4OJFL 1ZA6A 1ZSDA 1ZANH 2MKLC 3RKDC 3GO1L 3BVNA 5TJWK 4MDIA 3T1WA 5MEPA 1CK0H 4XH2A 4JDZA 3MRCB 3SDYH 4PJFF 2Z4QA 3BD3A 3H7LA 3KHOA 3G6JB 3QDGD 4RMTA 25C8L 4X6BB 4GRLC 1R0AL 1A14H 1Z3GL 4MNGE 1ROWA 1LP9E 5F7LB 3PDOB 2H32H 4OZHE 4KXZI 3T2PA 1J05A 4D94A 5T3XE 1QQDA 2HLAA 4JG1H 5L2JA 2VN4A 5JORB 4O5LL 5ADPH 2R9HD 5F1KC 3MACL 4X98B 3NTCH 3VXRB 4NOFA 5FKPB 4BSWA 4YPJA 4KKLC 2WBWB 3MXWH 3V6OE 1G1YA 1CE6A 4PJ9D 5FYLL 3OKMA 5F7YC 3RVXD 3QA3B 4QHLA 4KZDL 2O5ZH 1I3VA 2BSSB 2A9NH 4M4RA 4QKXB 3O9WA 4JZJA 4O4YH 5EC2A 5D71H 2IQ9L 3QWOA 4Y88A 3VW3H 2X4RB 3O4LD 3O4OC 2AS5M 3HG1B 5DUBA 3BKJL 1CGYA 5DD5H 1F4YL 4OZFA 3CFBB 4DAGL 5KSBB 5DHYB 1UXSB 2ERJC 3BGMB 3PABB 3EJYC 4Z7WA 2B0SL 2P4AB 1G9MC 3HI6L 2PTVA 2XWBA 5E8PB 4YDJB 1JZ6A 2D9QB 5C92A 4PRIE 1CS6A 3VXSD 3CFDB 1MCEA 5EBWB 5HVFB 3RBSA 3B9KA 4PJ5D 5FHBH 4GRWH 4P2YA 3QCVL 5F7KC 4PTTB 4OM0H 4M5YL 5JHDD 1MJUL 3MROB 5E5MB 4DGIL 4JR9H 3BIKB 1J8HA 3B4NA 2VLRE 4R4BB 4X4YA 4QRQA 4X7TA 5F1OB 3MRRA 3H7BB 2VDRH 1EEZB 3FRUA 1LEGA 2Y07L 4LQFL 4RFEA 4UZGA 1Q0YL 2F58H 1LEIB 3B3IA 4GXVL 3D85D 2KUTA 3SQOL 4N8CH 5B3JF 4WFGD 4M6OH 5JZ7C 5JDSA 1UVQA 4Z78B 2EO1A 4K2UL 4XCNA 1VKXB 1TJGL 3CVHH 3MLXH 3ECBA 3GSVB 3FB7A 1UXWA 4FQJL 4GRWB 4P9ML 3IFNL 5CAYB 4KZEL 1JJUA 2C7UA 3KYKH 2YA0A 1VEMA 4ZO9A 4HGKC 5DEGB 1UC6A 1ZGLA 1WITA 2YA2A 5HGHB 1ADQL 3RL2B 4E41D 1MFCL 1MAJA 5EU4A 2BNQA 2XV6B 3TO4C 1ZVYA 4HC1H 5FECB 5FCSH 3J8F7 5LXGL 2YD3A 1MCCA 1BVLB 5K9JL 4WO4A 1MUJB 5F7WC 1AR1D 3CVHB 1RZKH 2XKNB 4RGND 4Q6YA 3ULSB 4PJDE 4PJEE 3HZMA 2P5WB 3IYLW 1AGCA 5DQ9B 2O26U 4KDTC 1NKRA 2HFGH 3T2NL 5FYKD 5E1HB 3VFPA 4XX1E 1MCOH 1C7SA 4HUVB 3IKKA 1XF3B 4XPBL 1HWGB 2N56A 2YUXA 4JHWL 4PRHD 2BRQA 4N68A 2X05A 2VYRE 2XY1A 3TFKC 2VDLL 1IAOA 5E6ZA 3RGVB 1NFIA 1T83A 4D9LH 4PGBA 5CGMA 2QR0A 5DRZA 4OGZA 3U7WL 5DMIH 3KJ4C 5DLML 3V0WL 1MQ8A 4LVNC 5E5UB 43C9B 3REVA 5B4MC 1A7PL 3HUJA 4K55A 1RU9H 3ULVL 2DKMA 4YDKL 3HC4L 1MFDH 2X4UB 4Y4FB 3UJTH 3SDCB 4Y1AE 1U8KB 5DJAA 5DJCA 1SMAA 4WW2C 5HDLA 2V2WB 3K2UH 2EC9U 3MRLA 4WWKD 4NQUA 1WT5A 4M1DL 5F93C 4KJWC 3G9VA 3KPQB 5DJ0A 2PXYB 1A22B 2NXZB 3OAZH 1PX4A 5BVJB 3CUPB 2NY3D 2P48B 5C71A 1N4XH 3L5XL 1U8NB 5KSUA 2AEQH 5ESAA 1FL6A 4OD1L 3VFSB 5JW5A 2B5IC 1IRAY 4MNGA 2WUCH 4NNXA 3V8OA 5BVPH 1C12A 4HUXB 4L4VD 1C16B 1IAIH 4XHJD 2WK2A 3QNYB 3ZHKA 3OJVC 4OCXL 4XNUH 4GQ9H 4YBQD 1J5OL 3THML 1UB5B 2FO4A 1OAYL 1DQMH 4Y2DA 4KQ4H 5I1AB 2YPVH 4M3KB 1OGAB 3BPLC 4PJGE 1TETH 4OD2B 5SV4A 4JEGB 4MA8L 1OAUH 3BX7C 4EI5B 4YDLB 3MNZA 4MLSA 2K7PA 4U1LA 5T1DH 4XCCH 3I6GB 2DJUA 4YXHH 1HOCA 5I9QC 3NIDF 2A6IB 1CWVA 4L4TA 2YHGA 1H3PH 2C1PB 4CU8A 3HR5B 1JZ4A 3S88L 2V9TA 4JFQA 1E4KC 4OGAD 3ILPB 1ACZA 4YHZL 1A6ZA 1JK8A 2BNUA 1P7KB 2RAMA 2Q86B 1REIA 6FABL 3GK8H 4ZUVA 1BQUA 3QFJB 5D7SH 4KGJA 3PHQB 1CDHA 5FA3B 4JY6B 1JI2A 3PHSA 1IAKB 3GSOA 1SYVA 1L7IH 4G7VH 4M7JH 5CIPA 1QPPA 4G42A 5DA0B 1GXEA 4JO2L 4LSRL 5DRNB 2Z91A 2VLRA 3EUUA 4Y5VA 2ZOKB 3LKSB 2Y7QB 5I1JH 4WGVB 5I1GL 1BF2A 5BQ7B 1T1ZA 3O11B 4OLWL 3N50A 3DBXA 2D7MA 2WIMA 4TVPL 1ZHNA 3F7RA 3LB6C 4JVWA 3HE6A 3HAEG 1KELL 1DCLA 4L5FL 4WU5A 1AY1H 2ZPKH 3GSNA 1RJCA 2PTTB 2DYPB 1A4JA 3KS0H 5J06A 3PWNA 4NZRL 4WW1B 1U8PA 2AEPH 3TZVC 4XCYA 1G9NC 3CH1B 4CGTA 2HH0H 4KRPD 4OCWL 5B39A 3RX8A 2IFFH 1NKOA 3GUTA 1ERNA 1KYOJ 3IDJA 4GG6B 1YEKH 5E6ID 3QHFH 3O3AB 3V7AE 1A6WH 1K8IB 4FQHB 2YXFA 4K9EH 4CJ0A 2DQIH 2GFBB 5JQ6H 2UWEF 3VXTA 4OZGE 5GZND 2PCPB 4R4FH 1AO7B 4OGYH 1CFQA 4R8WH 3VD9A 3MSPA 5HYFA 1HQRB 4P5KB 3F7VA 1S8DB 4BKLA 2VJXA 1NCWL 3SDAB 1KEMH 4R7NB 1INDH 3QO1B 5MP6H 1D5MB 1PKOA 2YUZA 3LEXA 4PJDA 3SEPA 4PJEA 1DEEB 5DMJB 1KC5L 2D3VA 3C2AL 2VN7A 1I8MB 1OT1A 1ORSB 1FNGA 2GJ6B 4RMVA 1ZGLM 3BH9B 3S36X 1AGFB 5CJOH 4IMKA 5GGVY 1S7RB 4YHYB 1HQ4A 1WZMA 4WEBH 1IC5H 2Q20A 1CIDA 4Z7UE 1MLCB 4GSDL 4HT1L 3RWIA 3C9NB 1D5IH 4PP1C 3VXQA 4YAQB 1FFPA 3RKPA 1CI5A 2J6EA 4WRLA 3TT1H 4Y4KB 5CILH 3BRGC 2J5LB 4XPHH 3VFGL 3IXAA 4QOKE 5ACLA 5C09D 3MV8D 3QDGA 1MRFL 5FCUH 3HA0A 2KZWA 4OF6A 5JNYA 2EIZA 2R56L 1DVFD 3MV7E 2X7LB 2F5BH 5FOJA 1WBZA 4Y1AA 4OIIL 1I9IH 3SO3C 2VXVL 3IDXH 4LGRB 4Z7VF 5D7IE 1EVUA 1I9JH 4QWWD 1MFBH 2P5ED 3RWDB 3QHZL 4KHXH 5D1QD 5DJ6A 3LDBB 1EHLH 5E4EC 4PJ9A 4GKNA 5GS2D 3A6OA 4OD3L 3TH2T 2IMNA 2DMCA 5KTEH 5FO9B 3C6SB 1IEBA 4LRIA 1A1MA 2RBLA 5EA0H 4XP4L 4ZSOB 1OSZB 1NCUA 4UBDD 3QR2A 1W0VB 1O7VA 2BSTA 4K7FB 1NGQL 2M2DA 4YK4B 1NEZA 2JJSA 3C8HA 1I1YB 5CCKH 3WKML 3BT2L 4UTBH 3HPJB 3VXSA 4Y5YB 2EDKA 4PJGA 1W0WB 4PJ5A 2BOCA 4RISH 3HZKB 4FQCH 3DTXA 4C59B 3IS0X 4XRCA 2H41A 4JAMB 3QUKA 1MVUB 1HH9B 3TYGL 4PR5B 3PGCB 5DZLA 2B1HL 2PW2B 5D2LB 1JHKH 3WMSA 3KXFE 4HGWB 3PE9A 1GAFH 1NFDE 3WDHA 1KJ2A 3T0DA 3FB6B 5EUKB 4DGVH 4U1HB 1EA9C 2DI9A 1GHFH 1TQCB 1GCFA 1HN1A 1NMBL 3D85A 3LAFA 4JPIB 2NY6D 4WTXA 3S34L 4BZYA 4OLUH 5JIHA 3VFTB 5DSCA 4M7LT 1ZWIA 1N26A 3QI9B 2H2SC 2QKIB 2YEZA 4N5UA 5MHSD 1AD0A 5GSRB 4V1DB 3DMMD 4KC3B 1DFBL 1SQ2N 5E0QA 1A6AA 4FQXD 4JFYB 5CBEB 1C5DB 3L7EB 4M1GL 3VE0B 4P23B 2ENYA 1CIUA 3VG9B 4PY7A 2XQYG 3P4NB 3TN0D 4ZUTA 1RIVL 3EYSL 3RUGB 1F2XK 1VFAA 4F9PC 2GTZB 4JFDD 5FGBC 1U3HA 4GAGH 1MREH 1WFUA 5J8OA 1I7RA 3SCMB 3FFCE 2XTJB 4GAJL 1GC1H 3VWKC 4A6YA 3KYOB 5E2UH 1XF2A 4Z7OF 4LCWB 4UNUA 4YX2L 4HKZB 4L1HA 3O0RL 2OMBA 4GLRH 3C6LB 5FF6B 2VE6A 3BKCL 2W9DL 1D9KA 3TPUB 5IF0A 4F2MB 4UIMA 2XIDA 2HVKB 2XOTA 2VXUL 5IG7A 4HJ0C 3S5LA 3UTSD 1DLFL 4OZGA 3NIFF 3IJYA 4XMKH 3ARTA 1N5AA 1H9VA 4FN0A 3S7GA 3CC5A 3E0GA 3QDAA 5IEKB 3PWLB 3OG4B 3DJ9A 4U31A 3C5SA 4WNQA 1KCSH 2F5AL 2W9EH 1KPUB 1A0QL 2JJTC 4PRBB 1ZT7B 3WYRA 1L6XA 2G60H 2GSIB 2VB5A 1X5IA 3QUYC 3RWCA 1IBGL 2EECA 2AJUL 3D2UB 2X40A 4N90E 4Z7UA 4QHUB 4L8CA 3K0WA 1TVBB 4NQVA 2ZOLB 4WWKA 2HTKD 3I50L 3VXME 4PGDA 4JZNB 1OL0A 2JIXB 3ZSTA 1YNLH 1TCRB 3UJIL 5E08H 1UJ3A 3HNSL 5DD0H 5I6XB 8FABA 5IVXF 4AQOA 3ZT7A 2NY2D 1ZOXA 2NLJB 2DQJH 3UTTD 4L4VA 5DF0A 4A6YL 3MV7A 4JFOB 1CN4A 2MQ3A 2NW3A 2X1OA 1DBAL 5F71A 3EGSB 5D7IA 4JDTL 4MCZA 1FO0A 4HXBL 2A38A 3O41B 5LGJA 3GHBH 4Q9RL 3ARSA 4L3AA 1G7JB 3UTZB 1DQDL 4Z7QE 3IXTB 4KK8C 1IQDB 4EBQH 5TQ2L 1BBDH 5I1KL 4NKIH 1KTLB 2V7NB 5FYKL 3QIWD 3MLVH 4M61B 4MMXC 3OG6B 1FYTE 1YUHB 4QF1B 2JCCB 4JGUA 5ERWB 2NR6C 2IWGA 1KCVH 1OOAA 1S7VA 2B20A 4NYLA 2A2QT 4K94L 3PP4L 1TVHA 4O02L 4N8PA 3H9SE 5JOPD 5L8KB 1FBIH 3GI9H 1KTKE 4LFHD 1KLGB 4APQA 3H2WA 1QLEL 1RZJH 5GRZA 4BELD 4NCDA 1YEDB 4HKXB 2IJ0C 1QEWA 2P44B 5DK3A 5C0ND 2H45A 1GJIA 2EH7H 3SBWC 4QT5B 4Y5XA 2OL3A 1F8TL 3HZVB 3WBDA 3T3PE 3EHBC 4L8DA 5E8EA 1EBPA 1Q94A 1AQKL 3G08A 1NFDA 3CDYA 4JO3H 3GEWB 3DVGB 1KCUL 4Q0XH 4RBPK 4RWHA 1BZ9B 4J3UA 1G6RH 1CL7I 3JWOL 3RGHA 1INQA 3DX6B 2CLZB 2DQGH 2BK8A 4U1JA 5EUOF 3SKMB 4N0YL 3SJVB 1NFKA 1FN4A 3EJZD 1IC4L 3QFDA 3GSXB 1U8JA 2PYED 1KXTB 3UZEA 4JLRA 4ONHB 5EOQH 4ZYKB 5JLZA 3HMXH 2EC9T 3BSZH 5F9AC 3M17A 3SE8L 4LLUB 3DGGA 1NGWA 3VFRA 1FO0L 3BE1L 4DOHE 2J12B 2AABL 1NCAH 1ZVSA 1FGNL 3DI2B 5D1ZA 5HJ3B 5E6IA 3G6AB 5M94B 4FNLH 1S9WB 1Q9KA 4ODTL 3L1OH 4CBPA 1YN7A 3KPSB 4I2XB 3RVTD 3TNNA 1WUNT 5IP4A 3BRFA 1N3NB 5IEHB 5BS0E 4HIJA 3GSUB 4HIHA 4UI2A 4I0PB 4WFHE 2FYYB 3FFCA 4EI6B 3ARDB 1CD9B 5EU6B 1RJLB 2AK4E 2EIDA 3TF7C 5HHOB 4DVBB 1HHHB 2VRAA 4P4KC 1Y18B 3RTQB 1VB9A 1SHMA 2R8SH 2WNGA 2R2EB 4TSCH 3LEVH 4LPWA 4NQCE 4K7PX 5FFLA 2BJMH 4R97B 5EBLB 3DHJA 3FO9B 4O9HH 5F7DB 3B83A 5I75C 2XFXB 3T3ME 2HMID 2CKNA 2CD0A 3CVIH 2EDOA 5EZOL 3ZE2F 1N5YH 3WO4C 2Y23A 4HFWB 1JNHA 3MJ9A 2APBA 3MRHA 1VACA 3SGJA 3LIZL 2X1WL 3FTGB 3UP1A 5L2KD 1RMFH 5E24E 4MAUL 1CLYL 3MLTB 4KTYA 5CBAA 2YZ8A 2RCSH 1NBQA 5TDOA 4YHKL 2FRGP 3HCVA 2E27H 3H6JA 5C09A 1ZLUH 4JKPL 3MV8A 3VMOA 4F8TA 5E1AB 1MHPL 1VFUA 4MNQB 4DUXA 5JDJA 3H3KA 2X4TA 3C5ZA 1DVFA 4M8VA 1N7ML 1J8KA 3ULUH 2YN5A 5HHVH 4YBHA 5IMLA 1EVTC 5JPNB 4FQ1L 5CEXA 3RFZC 5KS9B 2P5EA 3KPPB 3VXMA 3VRJB 1SY6L 4BQ9A 5IQ7L 3Q6GH 5D9SB 1GZQB 1NCCH 2HLFD 4I48B 4LLDA 4H8WH 1A3RL 1EFXD 4CN1A 1GGBL 1ACYL 4ODWA 1SJHB 5DC0A 5D70L 3DYPA 1GPOH 4G6KH 2R0WL 3DRQB 2VERN 2ZCKL 1X5ZA 4Y4HA 1KN4H 4XMLH 4MJ6A 1IM9B 3DHMA 3CNKA 3BO8B 3S4SB 2DL9A 3B8YA 4PJXE 2UWEA 3QISA 1FFOB 4KUZH 2YN3A 5IB4B 3H9YA 1DDHB 1QKZH 1CGSL 3WXWH 4YDVB 5CLWA 1KENH 3D39D 2ZCHH 4ALAL 1JTTA 3HNVH 5IMOA 5IROA 3ZKQD 4ZUWA 1MHHA 3F8UB 4Z95L 4KHTL 1FYTA 3WIFA 3DYOA 1A9BA 2P8MB 5AWNL 3AUVA 4YH6A 3VCLB 3TO2B 3DV6B 4TTDC 4X8XA 1IGIL 2Z31D 1A1NA 4U2ZA 4UIKH 2EZ0D 5TF1L 1OCWH 5D93B 2BY1A 3NABH 1S3KH 4PJBF 4DZBB 4J8RA 4DTGH 5CMAB 3OXRB 3QQ4B 2PF6A 1QFWM 4IRJD 5I1EH 5CGYC 1WSST 5D1XA 1WZ1H 2NY5H 1IGTA 1NC4B 3OJMB 3DXAD 1YQ2A 1I9RL 4MWFA 1II4E 3RWGA 3T09A 4NKOA 3JV4B 2F19H 4XNMB 1J1XL 3BAEH 1WLHA 3RIFK 4RAVB 3TN0A 1CFSA 3P4MA 3ORJA 4U6YA 2Z35B 1ZLSH 2YUWA 5DR5H 4JFDA 5CHNA 1YY9D 2IBZY 3I6KA 2WLZA 4NGHL 3ARZA 4AEIH 1YQVH 1X6LA 1A6UH 4YDIL 2D7PA 5BOPA 5E94A 4BFIB 1S7QA 2R1WB 3O6FB 2DQDL 2W65A 1FNFA 3QZWB 5B3NA 2V5YA 4OJFH 2UUDH 2XZCH 5T3ZH 2DLFH 4J6RL 4KKCD 4UV4L 2PN5A 5KSAA 2JK5A 4AIZB 4N8VB 5IB5A 1ZKAA 1KJMA 3VFNA 1T1WA 4D0BA 3BQUD 5HDQL 25C8H 3QHTC 4MA3B 1U8LA 5CLTA 5IWLA 3DGCR 4W4OC 3UTSA 1R0AH 5EB9A 4ZUUA 2ZJSL 3SKOB 3WFZA 1A02N 2AK4A 2YD2A 4G6FB 4XVTL 4NN6B 4UQ2B 4PJCF 5K9QI 2UYLB 4JPKL 4OF3A 4DW2L 2ESVD 2VDNL 4R0LC 3D5OF 4HBCL 3MACH 3OKNB 3BEVB 1ZHBA 1I3UA 4KI5E 1X6NA 3OKYA 2ADIB 2WWKO 3G5VB 5KSVA 2OX5A 2NQCA 5FYLH 1EJOL 5K33A 1QLFA 4KZDH 4OTXL 4NHUB 5GJTH 3P77B 2SEBB 4P2QD 1U0QA 4P4RA 4ZOAA 3B43A 4XVJL 2CLVB 1YY8A 5ISZB 2X70A 5GS0D 3QUXB 5FUOH 4ZFFB 3KPRB 4DAGH 2DICA 2VLKB 4UT9H 1PY9A 5J3HD 1YJDH 4ZAKB 4ODBD 5C7XL 3QDMB 5KG9B 3SDXE 2NX5B 4JFEE 1MCNA 4C56D 5GRUL 1QFWI 4PPTA 3KDMA 3QCVH 4UT6L 4XAWH 3UTTA 1DQJB 4M5YH 1MJUH 4L29A 3IAQA 5HHPB 4BSVA 5HDOA 4DGIH 3KLHC 2ZCLL 1Q9LA 1B0WA 2ZUQC 1O5DT 4J7RA 2OMNA 2Y07H 4LQFH 1AC6A 1Q0YH 2E7LA 1PYWB 3IDYB 2HTLD 2IAMB 3L3KA 3CDFA 3BMVA 4QNPE 2NCMA 1FZJB 3TBVA 4P5MB 1TTFA 3BP5B 1B4JL 4S1QH 3QIWA 3X12B 4K2UH 4PJHF 1YA5A 3JV5A 4NHCL 3CMOL 2HFTA 3PWPE 3SGDI 3KYNB 5EDXA 4QXUL 3QUZD 3NACL 4P9MH 5SWZB 3T04D 3IFNH 5DGQA 4PJXA 4JN1L 4I0KA 3BHBB 3MOQA 1TNMA 2HAZA 5BW7C 4KZEH 1IGFL 4HWEH 5CSGA 4XWGL 1ZA6B 1ZSDB 5JUEL 2A0LD 4NQED 3P0VH 1MFCH 4MDIB 4FTVE 2NZIA 5MEPB 1ZHLA 4XH2B 1N6QL 4LARH 4JDZB 1GIGL 1Q9WB 5LBSL 3EYQC 1P53A 4G6ML 4BFGA 4JQIL 1U93A 4KPHL 4TVSa 4WU7A 1OQOA 1BFVL 4EDWL 1J05B 3RZCA 1QQDB 2HLAB 3NFPB 3RL1B 4BZ2H 5L2JB 3AFLA 4DUWA 1KBGL 3HRZA 4D0DB 1ZEAH 4ZMAT 3L95B 3T2NH 4OLZH 2DIJA 1OP3H 2PYEA 4FFVC 3SOBH 4BSWB 4B0MM 2X9XA 5FM4A 2CO6B 4PJAE 1G7QA 2WBKA 5EC1A 1CE6B 2IADB 3V4VL 3OKMB 5C3LD 4XPBH 4QHLB 3BWUC 4WHYH 1JYVA 4P46C 4PJIF 1I1AD 4TOYL 4CMHB 2R69H 3O9WB 4JZJB 5EC2B 35C8L 3ZKXC 5M95B 5IM7A 4JO4L 2RJMA 4D2NA 5DUBB 3AU1B 4LSDA 1WBXA 2FX9L 4RX4D 4MVBD 4DWHA 4JPWL 4OZFB 3RVUD 4XBPA 3EKCA 3U30B 3U7WH 5DLMH 3V0WH 4NZDA 4LIQL 4Z7WB 5IW3A 3UTOA 3H0TA 2XWBB 3ULVH 1G7HA 3QBTB 4IRSD 4QRPE 4XAKE 2FGWL 3B9KB 3RY5A 1AHWA 1AE6H 4KROC 4OF5A 3FMGL 1IC7L 4YBLB 5FYJD 1HWHB 4NWUL 4HZLB 3PWVB 1J8HB 5IB2A 3U7YL 2EO9A 4X4YB 4QRQB 3QSKB 3MRRB 2VKWA 3X11A 3LRSA 3RKDD 3BXNA 1OSPL 4M9OA 3L5XH 1IFHL 2VZVA 3MFFB 1MHEB 3F65A 4F37K 3B3IB 4ODUB 5BZDA 2IPUG 2KBGA 4NO3A 4LVHB 1L7TL 4LSUL 1BJ8A 3RVVC 2QLVB 1S7XA 4GRLD 1UVQB 5JDSB 4LGSB 5L2KA 5JXAL 2C3GA 5EH1A 1RZFL 2FWOA 5IMKA 2ZG2A 4K8RC 3THMH 1QSFE 1NAKL 3ECBB 4DKAA 3FB7B 1UXWB 1S9VA 4GS7B 1FG9C 3BJLA 5I71B 3GKZA 3F58H 2CGRL 5I18H 1P4IL 2R0LL 4LASL 1LDPH 4GUPB 5D4QA 2C7UB 1E6OL 5HHNA 1ZGLB 4KKLD 4H88H 3OKDA 3BPOB 1RUAH 5EU4B 2BNQB 3WJLA 5EORL 5EUOA 2IMMA 5IB1B 1LEKA 1QPXA 3MGAA 3S4SG 2FD6H 1CD1A 1TPXB 1DN2A 4RSVA 2J8UF 1RV6X 1T66C 1MIML 1NUFA 3ESUF 5EWIL 4YHZH 3RDTD 1ZA3A 3AVEA 3BMWA 4NQDE 1A6VL 3GSWA 3MCLL 1XGRA 1NUGA 2CUHA 4WO4B 3SDXA 1CVSC 1KACB 4I18B 1J0HA 2GK0B 3EJYD 4HPYL 4DCQA 3FQWA 1AGCB 1ZXQA 1MVFA 1FG2A 2GT9A 3IAPA 3VFPB 1RSFA 4MSWA 1SJVA 2P42B 2D31A 5EIQA 2DM3A 1H8SA 4OLWH 3Q5OA 4TVPH 4K3DL 4DVRL 2KH2B 3D39A 2W91A 4G7YL 1KELH 3KLDA 3PNWA 3J7HA 5CINL 3NCCB 1IAOB 4LLWA 1NFIB 4OUUA 1NDGA 3N9GL 4PGBB 5F7EL 4PBVC 4NZRH 2QR0B 4WW2F 5DRZB 3ES6B 3PWPA 3MPCA 4N9GA 2C3WA 5JZ7D 3REVB 3I85A 3QT2A 4X8JA 3HUJB 2Z31A 4MAYB 5C0CE 1AXIB 4MLIA 4TPRL 1B90A 5DEZA 2VWEC 3W2DH 5DJAB 3KPTA 4PG9A 3NAAL 1GRWA 3MRLB 4PG2C 5EOCJ 5JR1L 1BHGA 5C9KA 1YEHH 3QWRD 3O6LL 1DR9A 5JIPA 3CK0L 5AAWA 2CQVA 3PG2A 5DJ0B 4PRAA 1MRCL 3DXAA 2QQKL 4LRNL 3WFHA 2GY7B 2L7UA 3NFSL 4NNYA 3UO1L 3TO4D 5ESAB 3VXUE 2AJVL 1FL6B 1WAAF 4UNTA 3QZWG 4KWUA 4MNGB 1LP9B 4NNXB 2EXWC 1CR9L 1C12B 5FO7A 2MPAH 4XTRC 3T0EE 3RZWA 3C2AH 4N8VG 4HD9A 1ZGLP 2DD8L 3BDXA 3L3HA 4OI7A 1DQLL 5KVEH 4PJAA 1J87A 5CIPH 4ZUSB 4GSDH 1BJ1J 5MEOB 1RULL 2F54E 5I8EB 4HIXL 4Y89A 3MRKA 1LVEA 2DQCH 1I8LA 3MNZB 3SKJH 3I6LE 4U1LB 3VD7A 4ZXBA 1HSAA 1HOCB 1MF2L 2CKBB 3FT3A 1FPTL 4L4TB 3I9GL 1PSKL 2CRIA 4QTIL 3VFGH 3F5WB 1QR4A 4JFQB 2PR4L 4O58L 4R9HA 3TFKD 3GSNH 1MRFH 2FZ3A 2R2CA 2RHEA 4R26L 5DK2A 1R3LB 1A6ZB 2BNUB 1J1OL 2MNUA 5JIIA 5GHWL 3JWDH 5F72S 3QRGL 5JIKA 1CLZH 4PRIB 4QRPA 2DKSA 1OAZL 4BM7A 2A9MH 4WTZA 5CD3B 4KUCF 2HFFA 3RGVC 1S7WA 3DVNA 3AAZA 5I16B 2ESVA 2BVYA 1YEIL 3GSOB 1L6ZA 4AH2A 3QHZH 4JB9H 5CIPB 1T7WA 4F80A 4G42B 4OQTA 3MRIB 2EKSA 5CJBA 4B50A 2VLRB 4BUHA 1BD2E 4G8GD 1UG9A 3ZO0A 3QPXL 4NO0A 2QSVA 3WD5H 1T1ZB 5C08E 5FK9B 4KJWD 4ELMF 4HUKB 1MI5E 1VHPA 3MRGB 1ZHNB 4XNXH 4Y4FC 3SDCC 5IJKA 4XP4H 4WU5B 2VIRB 4WVRA