3EGSB

Crystal structure of the hiv-1 broadly neutralizing antibody 2f5 in complex with the gp41 scrambledfp-mper scrhyb3k construct gigafgllgflaagskk-ahx-k656neqelleldkwaslwn671 soaked in ammonium sulfate
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
232
structure length
216
Chain Sequence
b'RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2F5 Fab' light chain
publication title Structural constraints imposed by the conserved fusion peptide on the HIV-1 gp41 epitope recognized by the broadly neutralizing antibody 2F5.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 216
sequence length 232
ec nomenclature
pdb deposition date 2008-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3egsB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3egsB01
5D2LF 3WE6B 4AEIL 3KYNB 4PLJD 2YPLE 4YXKL 1MI5A 4J12A 1F3JB 3KVQA 3UDWA 2WIIB 1ITBB 1MRFL 4IS6B 1P5UA 1CT8B 4KV5F 5M95B 1N5AB 2WM0A 4EDWL 1H9VA 3QDME 1X7QA 1RZKC 5C07A 3PWLB 3MV01 4NRYB 3QUML 4HJ0C 1NC4B 4H8WC 3REWB 1WBXB 5BV7H 4Z78B 3BP4A 3ARYA 1TCRA 3TV3H 2UY6A 2APTA 5BZWA 3QO1A 4WUUA 3D6GA 3WEXB 5IIEB 5DD5L 3BZFA 3FO9B 2QV2A 3EKCA 4NO0D 1EMTL 1DQQA 4LKXA 1CVSC 1IGIL 2OJEB 2VDLH 2AV1B 3ARDC 3KPQB 4PP1D 2D0FA 2P46B 1YEDA 4JFZL 1RUAH 3IF1B 3IU3B 3MCLL 1JPSL 4M4RA 3UJTL 1MAML 5BRZB 3TO2A 4PJ7F 2VXQL 1UB5B 1BIHA 1QRND 3H3PH 3CSGA 1Z9OA 3C8KA 2GFBA 5FGBC 2BOBA 1INEL 1AR2A 2NR6D 1RJCA 1EVTC 3B9VA 5BVPL 1HKFA 5I8OH 1QBBA 3H9HB 4XCNA 5D2LB 3WDJA 1AXTL 3PWVB 4YBLB 2FIRT 2BVPA 1ZT7A 1MCBA 4LLQB 4PB0H 3AS0A 4YHYC 4ZPVA 4HKBA 4LARH 1R3HB 1XIWD 3C5ZA 2VE6A 4PRPA 4LLDB 4OUUA 1KB9J 1Q94A 3IJSB 4P5MA 5IFJB 2X89A 3HE7D 4YPGA 3T65B 2EIZB 4LQFL 1GZQB 5GGUA 5HJ3B 4LPTA 3E8UL 4M8QB 3MMEA 5KVFL 4S2SA 3KDMB 1MWAH 4TRPL 5C9JA 3QIWD 2B5IC 4Y4KB 4DFHA 4K71C 1A14L 4YDKH 3G9AB 4NO2B 5DRXA 3LRGA 3D18A 3PL6C 4PJ7B 5ACMA 1PSKH 3U7YL 3BYTA 2AABL 3IDIB 3O2VH 2R39A 1U8MB 5I1DA 4UV4H 1RJYA 2FH6A 3GMRA 4FZEL 4M6MH 1TJHL 4Z7UF 1BFVL 1WV7T 5F89B 1T4KA 4JJ5A 4X6BB 5EZLB 5IESL 3PNWA 5IT2H 3QEGH 3PIQB 1IAOB 1LK3L 4IRJC 4Z95H 4YWGL 2YD8A 4K23H 4XCCH 4XNYH 1Z5LA 2X40A 3MJ8B 5BS0A 5ID1A 4OQTL 1TZGH 2DTSA 1B0RA 2B2XH 4RGMC 4ODWA 3LD8B 1V3LA 1OWRM 1CFSB 5FGBA 3CSYB 3DPBA 4P46B 5CD5C 1VB9A 2OXGA 3HC4L 5TF0A 1QVOB 1I9RL 1I7RA 1IFHL 1DBJL 3BQUD 3PP4H 3WHXA 2D7PA 3RBSA 2ZPKL 5A2JH 3IKKA 4MNGA 5EO0B 4X7EC 1WAAA 3L5XL 4R96A 4X9GA 3BW9B 4HWZA 2HG5B 1FO0B 3MRMB 5HYIA 2BHZA 5DC4B 1YEIL 2FHFA 2M26A 4S11A 5EULV 3VDAA 3JUYA 2XWBB 5LBSL 3EYVA 1B4JL 3GB7B 1JYWA 2X41A 7CGTA 3P4MA 1SM3L 3OKYA 4KQ4H 4D0CB 4LSUH 2BVOA 4RQQA 2F58H 2R4SL 1SQ2N 2YC1A 5CHNA 2AI0H 1AC6A 1CXKA 4Z7UB 2P7TB 1HDMB 4X5XB 2RR3A 2EDBA 2YRLA 4N90E 4YHNB 3PGCB 4O5LH 2EECA 1S7TB 3FQRA 5FCUH 3L7EA 1I7ZA 3G04B 1T20A 4HK3J 3LMJH 4P5TC 2EO9A 4WY7H 2CQVA 4C56B 4L5FL 4HIHB 5E08L 5GJSH 4CBPA 2K3TA 1EZVY 3MJGX 4XXCA 4J4PD 1XGTA 4JDTL 1FC2D 1MJUH 4OCXL 4YE4L 4GRLD 3QO0A 1UQSA 4MXWH 3MRLA 1F5WA 1HCVA 1WTLA 4JZJA 1UEMA 4PY7A 4R0LC 2GJ6A 2X1PA 3A6BL 4MNQD 5C3TA 4Y8DC 3I2CH 2JK5A 3S3PA 2YA2A 3UTTD 1J0JA 1FP5A 1P2CA 1DEDA 1A3RL 4I0PB 5GGSA 5I19H 2YRPA 2I60H 1F97A 1C08A 2JELL 4PUBH 4Z9KB 3LPFA 3Q2CA 1MH5A 2A6KA 2F54E 4XNMB 3NZ8A 4BQ8A 1IL1B 5D9SA 4YQXL 1CGTA 1JGLH 4Y1AA 2AJZA 4LSSL 5KSAD 4XT1C 5AAWA 4R4NC 3UTOA 4YGVB 3SQBA 5IBLD 4N9GB 4PJCB 5ERWA 4X9HA 4D2NA 5J6GA 1NMBL 2V6HA 5LQBL 3SGJC 2ATKA 1JRHL 3VD7A 4JRXE 4PJ9B 4LCIL 2Z8VC 2W0PA 2BNRA 3OAYH 4EI5D 3P0YL 3NAAL 3MLUL 4LIQH 5IB4B 4ELMA 3PE9A 3WLWC 2IFFL 1OD9A 5C09E 4PJFA 4NZRH 3BH8B 1KPRB 5FM4A 3ECBA 2UYLA 1M7DB 4N1CA 1JFQL 4OD2A 3QFJE 3HG1A 4JO4L 3WLBA 5ILTL 3LQAC 4P5TA 5I15H 2DYPB 3DX8B 1F8TL 2HJFA 1RJLB 4S1DD 4A6YB 1YMMD 3IDMA 4XHJC 4KY1H 2XTJE 3GSUA 4XMKL 3LEYL 5SV4A 3FTGB 4WHYG 4OZIF 5IFHH 2R9HC 4RWHA 4F37F 2C3XA 4FQXA 4OLEA 4X9FA 4RWYL 4YUEH 4R0LA 5A3ID 4NYLB 1YZZA 4HUUB 5HHMD 2K7QA 2AGJL 3UPAA 1A6VL 4KKNA 1DN0B 1MCOH 3MV9E 3NABH 3ARRA 4QOKD 2W38A 4TN9A 2IPTL 3RKDC 1N4XL 1WCBB 2CDFA 5HYFA 4XC3H 3S35L 3HMWH 2BFVL 5KZCB 3O6KL 3D3VE 4ZS6C 4P2QD 4JPIB 5HI3D 1HILA 3M8OL 1YEJH 1XCTA 2VWEE 3O6LL 3BD4A 1ZT4A 5MERA 1UZ6E 5A16A 1B0GA 1I9JL 1N59B 1FAIH 2PCPA 3X3GL 4U7MA 2P5WD 4IIQA 1IGML 3V0VB 4FFWD 1JPGB 2R2EA 3TCLA 1SEQH 3X14A 5IVXF 3L6FA 1ZEAH 4KU1A 2FH8A 3MNZA 4LPUA 1QEWA 1MVUB 3VWKA 2APFA 4XCEB 2I9LB 3VFSA 5JW3H 3BVNA 3BIKA 1HHHB 1MEXL 4ZQKB 2NY3B 5C0IB 5KANG 3X11A 1SBSL 3BIAX 3P11L 4OZIB 1CICB 5D6DC 1A5FH 1NBQA 1CFVL 4EDXB 3GI9H 1N0XL 2PETA 3P0GB 5MP6H 4MCYB 2VSDA 1U93A 1H5BB 2DJSA 5JOFB 5ESVA 1H3PL 3DMMC 4XI5D 2C26A 4OCWL 3BKMH 5DMYA 2GSGA 3QIBB 4YHOH 2VN7A 4PP2B 3L3IB 3R0NA 5TDOB 4M61A 3SDDD 1QKZL 2VLMD 1EERB 1FYHB 2A6IA 2CRMA 3RVWD 5CJQL 1HSBA 2A6DB 2NXYD 3C2AL 3OKNB 2EH8L 2EE9A 4QNPF 1NCBH 2YPKB 1FIEA 1T03L 3FOLA 1NJ9B 4PV8A 2DWDB 1GXEA 5BMFL 5IVXB 1LP9B 4HUWB 5DVNA 1JF5A 3NTCL 4FQQA 2X5PA 1G9ML 1KYOK 43C9A 3V0WL 4AJ0A 3LZFL 5CUSL 3QZWG 3LPWA 4LL9A 3I6LD 5JXEA 3DETD 3QEQA 3DO3A 3D0VA 3KYAA 2DMCA 3GSOA 5HI4D 1L6XA 4NKDA 1YEKH 5A2FA 1GGIH 3OKEA 5C0DB 1N64L 2XXMB 2W0FB 1A7RH 3TN0A 2B4CC 1DQJB 3O3EA 1OGTB 3HNTL 1CD1A 2EYSB 1WIUA 4CAGA 3NACL 5B21A 4F2MA 1QYGH 1I1RA 1WBZA 4OCSH 5DMJB 1JNJA 2J6EH 5ETUA 4JFQA 5D2NC 4L4VE 4XPTH 5LWYH 5KSBF 1YY9C 3RVXC 4TUOB 3KGRA 4NQCD 1T80A 3CGTA 3W0WE 3BRGC 2Y36L 4LPXA 4JHWH 1G1CA 1IAIM 1A4KA 3GO1H 4JFEB 2X10A 1HZHH 1BVLA 3SDAA 3SJVA 3UCRA 2G60L 3O4OB 1F11B 3WHE1 3DMMA 5MEND 4J3XA 2NY5H 4AEFA 4B5EA 3CJJA 1FO0L 4I8DA 3GRWA 1KTLB 3BH9B 1KG0A 4HCRH 4KRPD 5GQBA 1BD2D 4GUPA 3QZWA 3LDBB 1D5BB 1I9IH 4J3VA 4JG1L 3EGSB 1ZHNA 4Y19D 2EZ0D 5GPRA 2AK4B 1WVZA 2VN4A 2H3NA 5F7LB 1Q72H 3OKMA 3KR3L 1KBGH 2ZOLA 3PQYB 4UMGA 1E4KA 1U92B 2BSED 2DB8A 5T3XE 1I4FA 1CS6A 3P4OA 4D9LH 2VIRA 2A9NL 5T3ZE 1QBMH 4EZMA 3ESUF 1PYWB 3F7YB 1S9XA 5E9DA 1E6JH 4KHXH 4OCYL 3VDCA 4M5YL 2XPGB 1EV2E 1JWUB 3RNQB 2XNAA 1C16B 2DI8A 3VG9C 2AXHA 3RI5F 1DP0A 3ZL4L 1RIUH 2M2DA 5FUOH 1TXKA 1I85C 4G42B 3FFCA 2E6PA 3ESVF 1FN4B 5TDNB 4NSKA 4KI5C 3AM8C 3PXJA 3T2NL 1C5CH 5DO2D 2WUCH 4AEHL 5JZ7C 4R2GC 5TF1L 1AGCB 3EDFA 4XTRC 5TPWH 3OBAA 4BSWB 1OSZA 4ZPTB 3SKJL 2XOTA 2NY2B 4F58H 2VDOH 5BVJB 3VRJA 1IM9D 2ARWA 4RDQG 2QR0A 2HJKB 5EC1B 1MIMH 3D9AH 5F88A 5F1NA 2DQGH 3GNMH 5IJVB 2DTMH 2VISA 1TTFA 4ZAKC 5C0ND 2IAND 3P40A 3VXRE 5JDSB 4WU5A 3VFGH 4NPYB 5BJTA 3BPCB 2WWMC 3G5VB 3MRBB 5KN5B 4O00A 2Y7QB 1YNTB 2F54A 4LGSB 2P5EE 1CG9B 5L6YL 3I6KB 4FTVD 1NEUA 5EU6E 1NC2D 1DLFH 4L4TD 4K8RH 2E7CA 1ONQB 2CH8A 2VLKB 2VLRD 1GC1C 3GMMB 3HC0A 5D7LE 5EZIH 3V4PH 5E2VL 1SHMA 1QUNA 2IFGA 3VFRA 2Z0BA 4Y4KD 4MDJB 4B0MM 5HY9A 5IEKB 2R8SH 1NBVH 2JJSC 3QHFH 2CLVB 4LNVA 5GGTL 3ULVF 3EOBA 3MV7A 3OMZA 2GTZA 4A6YL 5E8EA 3OB8A 2X4NA 3QUYA 4KRNA 2HRPL 5KJRL 4PB9H 5F3HB 4JCMA 3MLZH 4ZUVA 5C09A 2HTLD 3FT2A 4POZD 4XGZA 1T1YB 3SGEI 3L1OL 5FO9B 1KEGL 3CFCH 3PHOB 5EOCH 2CRZA 2X1OA 3CX2A 4ZUTB 1FZKB 1K8IA 3FN3A 3MUJA 2EDQA 3UROR 3OAYK 5CZXC 2A77L 5HGAA 2YN5A 5L8KB 3IJYA 4J1UA 4GAJL 1QR4A 3UJIL 3QNYB 4FQ2L 5I9QB 1U3HB 1JPTH 1JTTA 3EO9L 3ZE0F 4O2CA 1HXMA 1I7TA 4R8WH 3A6OA 1T3FA 5SWZB 3RWJA 2C1OB 4BFGA 3S34L 2PXYD 3RWCB 1NCWH 1ZXQA 1UG9A 3NGBB 3G5ZB 4OIIL 1NAMA 4OLUH 5FF6A 1P7KA 3HPJB 3QCUL 3RWEB 1CL7L 3B3IA 2CK0L 4RFNB 1ZTXH 1IAKB 1P9MC 2P8LB 3TNNB 3CK0L 3DUSA 3RQ3A 1CXLA 4NT6A 5BZDA 4ODTL 1TIUA 4KFZC 3N85H 1G6VK 4PY8J 1AQKL 1X4YA 4QGTA 5DK0A 1L7IL 4N0RA 2LVEA 1T2XA 4HLZH 4S0TD 4KK9D 4BSVB 4KDVA 4HMEA 5HI5D 3ZKXC 3QUZC 1VDGA 5DGRA 3HZVA 1G6RA 1UWGL 3T8XB 4HWNA 1RZJH 4YC2B 2AVGA 5C6TH 4QRPB 4XP9L 3S3SA 4DTGH 5HBBA 1YNKH 5E95B 1WC7B 3JWOH 1KLFA 3SBWC 1T5XA 3BGFB 4DCQB 5HHXH 5GRVL 1MJ7L 5JLZB 3BP7A 1T1XB 3SN6N 3D2UB 3S97C 5KG9A 1NGQH 3F58L 2Q8BH 2ICEB 2Z4QA 4NGHL 2LAGB 4EI6B 3HR5B 2RQ8A 1BJ1H 3O4LD 3PP3K 4GW4A 4APQA 1SMAA 1J0ZA 1PZ5B 3T1FA 3IB4A 4PS4L 4F7PB 1IEHA 3NCYP 1GL4B 1K2DB 5D72H 3LKPB 2RBLA 3C2SA 4JG0L 2OXHA 5I73B 4AYFA 1XF3A 1LK2B 2IEPA 1I1CA 4EUPH 4FQHA 5CGYC 3ZE1F 2HFFA 3L3JA 4CVWA 1J05B 1S7VA 4Q9QH 4DVBB 3WFEL 5E24E 4BFBD 4FFVD 4KTYA 3HCVB 2XWTB 3VFUA 4X8JA 1T1WB 1X5GA 2QLVB 5E8PA 3HFML 3QWOB 2FNBA 2N4IA 4HIXL 5E99H 5E2UH 1QQDB 2XA8H 3UBXB 1P9MA 3H3KA 4KKBC 4X0KA 1VCAA 1E4XI 3KYMA 3LY6A 2J88L 4IRSB 3TZVD 3QUZA 5C2UB 4JDZB 5I1EH 3KAAA 4ODHL 3CFKA 5FUCC 4XB7A 4ZTPH 2VABA 4XP4H 3V5HB 2V7NA 5DLML 1IQDB 1VFOA 5CEXB 1T0NA 4HK0B 1Y0LB 4TSAH 4Y5XB 4EIZC 5JHDA 3KJ6H 3K4DA 3MYJB 3MLWH 1FYTE 4LBEB 35C8H 4O2FB 3VJ6A 5DD0H 3JTSB 4YDLB 2OL3H 3P77B 4JFDB 3CDFA 2FWOB 3BAEL 4L4VA 3L3GB 4HWBA 4DZ8A 1MCIA 2YD5A 3GBLA 5SWQA 3W0WA 2DIJA 3QG6A 4MD0A 3L3HA 2FX9L 1JHLL 4HX1B 4YFLI 3U7WL 2RCSH 2JJVA 1JP5A 3GIVA 4F33B 1B6UA 3D5OF 3QDJE 1M05B 1OARH 2E8YA 1NGWA 3FB6B 5IBUB 3U0TA 4NQEB 2HA1A 4RFOH 2X4SB 2GI7A 2BP3A 4RMVA 3VXQB 5ACZA 2BK8A 4LAQH 5F7KC 3RWFA 4KMTL 3LAFA 3TPUA 3LKSB 4PRBA 5EPMA 3TJHC 4R6UA 4RAHA 2EYRB 2R1YB 3QQ4A 3RNKA 3U36B 3GK8H 1ULVA 5FA3A 1G9NH 5L2KB 1V7MH 3WSQH 4FP8H 4JLRA 1U42A 3IDNA 5J13B 4IHOB 4NHCH 4LPWA 4NFDA 4RMWA 4F7CA 3G6JE 2EDRA 4WWKB 1PLGL 3QIUC 5HHOA 3P9LB 4PBXA 5E8DH 1DL7H 5IKCA 1DBML 3L3DA 5AWNL 5DF0A 1TITA 2IQAA 4UINH 4M3JA 1A7PH 1RK0B 3GSVB 5C0RL 2HT4C 5MEPB 3RGVB 2ICES 3BGAA 3FAWA 4PJIF 1A9EA 4CMMA 1WZKA 2R1WA 5DJCA 3ZYIA 2ZOKA 4PTUA 1C5DB 2QQLH 5DEFA 4U1HA 3LN4A 1TQCC 4G8IA 5EIIA 3IAPA 5HDQL 1FL3A 3O6FC 3GBML 2VZ1A 3O0RH 1H3GA 2XQBH 3FQTB 2C9AA 2RFXB 4PY8I 5KOVC 1KIRA 3GSQA 4H1LB 1P6FA 1HQ4A 1S7RA 4JFFD 4G6KL 4F37K 4PJAA 4EDWH 1EFXD 5MEQA 3IFOA 1UWEL 3QUMH 5C0BE 3V2AR 4PG9B 4JQVC 4U6YA 3LVEA 2AP2A 4NKIL 4MA7H 2DQCL 3FAXA 3R1GL 3G6DL 3TT1L 2GTWA 5D1QB 3ARGC 3QCVL 2GSIA 1QLFB 1BFOA 4JGMA 1DQML 2VO5A 3SDXB 1LILA 2ZSWA 5FA4A 2YK1H 2J8HA 2VZTA 4OGYL 1MI5B 3QCTH 1GOFA 3MLSH 1LO5A 3QA3B 4K8RD 1X7QB 5EU6A 1MIEH 4X7TB 4PJIB 1OCWL 3L3OB 3MRDB 1F3RB 1FFQA 3KPRD 3NH7L 3MOQA 1XGYL 4KJQC 3BP4B 5DRNA 5C8JB 1JTPA 4GS7B 5GRXG 3DV6A 3LN9A 4WUUB 5IW1A 1FG2A 4EN3B 1F4XL 1XH3B 5DMKB 1INEH 5LGHH 3SY0B 4MSWB 1YJDH 2VXSH 4NQVA 1C5BL 2XG5A 3CH1A 2VITA 4B41A 3DYOA 4YBQD 1A4JB 3MV11 4QRRE 5DJ2B 2IAMC 5E7FA 1FDLH 3TO2B 4HPYL 2LU3A 3CFDB 3ALPA 3P4NA 1FZJB 1W72H 4ESKA 2Z91A 4UU9B 3ARUA 4RX4D 1LNUB 3MRKA 1GZPA 1YQVL 2ADGB 1JPFA 3E3QE 2YD2A 3JWDC 1MLCB 1DBBH 2GFBB 3I02A 1YEGL 4GAYA 4U6XB 4BZ2L 3AAZB 4FQLH 1MQKH 1NUGA 3FZUD 5F7MC 3BKYL 5L88H 2AJSL 1ZSDA 4FQJH 3E8UH 4RBPH 4WTXA 4NN5B 4WEMB 5KVFH 4JQVA 3QUXC 4ZFOL 1AQDA 2VDQH 1R5VA 3ROLA 4NQTA 2VXVH 1A14H 4Y4FC 2VXUH 4UOJA 3CMOL 3ZTJG 4YR6A 3ARGA 2V7HA 3K46A 3WXVL 2YUWA 5IW6A 2WW8A 4ZPVB 1NSNH 2AABH 1QPPA 3BZEB 2VE6B 5IV2A 3O9WC 1X5XA 1BEYL 1IEBB 4FZEH 5I17A 4OUUB 4H20L 1TJHH 4WW1A 4M7LT 1BFVH 3MRJA 5IESH 4DQOH 4NZJA 1MJ8H 2CIKB 1X5IA 4LDOB 3EOTH 1JNLL 5DRWA 1LK3H 4YWGH 1WAAF 5GGVH 4G5ZL 1A6UL 2W9LA 4KROD 5ELIA 1CCZA 2OCFD 1NGZA 5ENWA 4M03A 2MPAL 4OQTH 3WO4C 4DZBB 5CEZL 1XF5A 2EEAA 5GJTL 5I66B 1BLNA 3JZ7A 4LCWE 1RURL 4OV5B 4GO6B 3D18B 1UCBL 3VWJB 1WISA 1I9RH 4U1JA 1MREH 5J3HC 4JRYB 3ARDB 1RJYB 3TIDA 3DVGA 2ZPKH 3A67L 5DVLA 4G6JL 3EBAA 3VU2A 2HKFL 3OKDB 3V5KA 1ND0B 1CZ8H 3DBXA 2IAMA 3NIDE 1FGNH 2A73A 1YEIH 4S10A 1Z5LB 5C0AE 1G7LA 1Q9LB 5F7DA 3KNBB 5ID1B 2XFXB 2R4RL 4X5WA 4HT1L 4PJXF 3ZKND 1B0RB 5K59E 3ARSA 1RSFA 1T5WA 2G9HB 3WKML 4JN1H 1SM3H 4FABH 1OP9A 3RU8H 2KL6A 4X4XA 5TQ0L 2IPKA 1J88A 3HAEH 4ENEC 3KS0J 2WUBL 3QUXA 3RUGF 4DN3H 2CKBH 4HC1H 1ORQA 3TYGL 5JTWA 3KJ4C 3EYFA 5EO9A 5TFSL 1IJ9A 5CP7B 1QA9B 4FXKB 2Q6WA 3VI3F 3SKMA 4YHYB 1A2YA 5CCKL 2IF7A 4AM0B 1FVCB 3MRRA 4L5FH 4QT5A 5TE4L 2BC4A 5E08H 1TVBA 1KLUA 2DQIH 3QRFM 1T66C 4JDTH 2VDPL 3TNMB 5EZJB 4OCXH 4OBRA 3IDGB 1U8OA 4RAUB 2EIEA 4J6RH 3ARBD 3A6BH 3UZEA 1J12A 5DEGA 4Z76B 4CL7A 1G7PB 4I5BA 1AP2A 2B5IB 1BWMA 1AKJD 2BSTB 4NQDE 3L7EB 2GJZA 4FFZL 3BOVA 1R3JA 3PL6B 3RI5K 4V1DB 2QQKL 5GGSY 3OGOE 4MAYC 5GS3A 2PO6D 2EDDA 2NLJA 4PJXB 2BZDA 2DQJH 1TLKA 2IMNA 5J0BA 1ACYL 2VAAA 4LSDA 4YQXH 5ANMB 1TVHB 1R24A 5DI8A 4LSSH 5FDWB 2W60B 1FYTA 3MRLB 5DUPH 1DLHA 4IRJB 3RUGB 2GJ6B 3UTZA 4MB5A 2C3GA 3BPNC 5T1LB 3KLSA 1JRHH 2A38A 4KZEL 1P2CB 1QBLL 4RGMB 4U31A 3U2SA 1I3RA 1QSEE 3GSNH 3NAAH 1D9KC 1EXUB 4S1RL 2X4TA 1MH5B 4P4KB 4WO4A 2UWEA 4LRNL 1VFAB 3NZ8B 2FBJH 4HULB 3ULVD 4P2OB 2CUHA 3QDJA 2OZ4H 5EWIL 5I16A 2XZAL 4GKNA 1AHWB 1JFQH 3FQWA 1M1SA 1Z6JT 3ZDXE 4PLJC 5HYQB 3FB5A 3VCLA 5IB2A 1IEAB 5ILTH 4LLUA 1A0QH 5JO5A 5ERWB 4NO5A 5LVEA 3MRHB 4X99A 4ZS7H 2NW3A 4UBDC 3FT4B 2ATKB 4XMKH 5KVGL 3FMGL 4PRHE 5GSRB 2VQ1A 4QRPD 4LSQH 4WFFD 3CC5A 3QEUA 5E6IB 2I5YL 3FQUB 4L3ED 4RWYH 5JMOC 3VD4A 5FGCE 4PJFB 4JFOA 1AO7E 1S8DA 4PP1C 1FSKB 1OLZA 3HG1B 3N9GH 5EOCJ 1GPOL 4Z0BL 1XF2B 4N0CD 4YDJB 4P5TB 4MAYA 1N4XH 2SEBA 5EUOF 1CYGA 1HIML 3U83A 3MUY1 4KZDL 3IDMB 3O6KH 5DD3L 4L8SB 4LGPB 2M1KA 1BX2A 3BMWA 3UTQB 4HSQA 3RFZC 2DQFA 3MR9B 1I9JH 2NR6C 3BXNA 3VA6A 1D5IL 4R0LB 4UT9H 4ZSOE 1IKNC 3CU1A 4M1GL 4U1IA 4OZ4A 1D3CA 4NC2B 1NMCC 1RUML 4N5ED 3R0MA 2G2RB 4GG6F 2OSLB 1D9KA 4XCYB 3EOYG 5IP4A 4MJ6B 2O93L 4X98B 3QT2A 1XIWC 1ZHBA 3DUUB 2GK2A 2VLJB 3QWRD 3X3FL 5I8EB 1KTRL 1SBSH 3P11H 4QXUL 3VG0H 5F8RC 1UM4H 4RGNE 2DLFL 4NUJA 1NFIA 1RUPL 2GY5A 3HE7C 4UQ2B 1N0XH 3RWGA 1QFUH 5KTEL 1WITA 5IWLC 3W2DH 4ZODA 3VXUD 2H32A 1KFAH 4Z7WF 3QXWA 1OGAB 4R4BA 3ARFD 4LVOC 5FV2A 4PGBA 1I75A 2C3WA 5FOBA 3L6FB 3QIWC 3MZTA 3MNZB 3RTQA 1H3PH 5TE6H 5EUOB 2EYTA 1TTGA 4WV1C 4X6DA 3UTSE 4DGVH 1WF5A 1LE5A 3VFSB 3U30C 1ZS8B 3BVNB 1OM3L 1XCQB 3MUGA 2PYEB 5C0CE 4NO0A 4LVHB 4UZGA 1QKZH 4HK3N 3T0EE 2YBRB 5JPMA 1NBZA 2CUIA 4KHTH 4PV9B 1T03H 3EOAA 1IM3A 3IGAB 5BMFH 1U93B 2HTKD 3B43A 3P0VH 5GS1C 4QCIB 4LLMA 4GG6B 3NTCH 4TVPE 3OWEA 2Q86A 4LCCB 4PREA 1EA9C 5E2TL 3H9YA 3V0WH 3LZFH 1W2KT 2C7UB 4MNHB 5H2BA 2DM4A 5IW3A 1D6EB 1RY7B 3CVIL 4N0YL 2AV7A 1YPZF 2YEZA 4NQED 4XPGL 1RUKL 4M61B 1CWVA 1Q0XL 4DN4L 1CU4H 3BQUC 1CFNB 5I8KL 3S9DB 5K33A 1G7IB 4Q6IB 1IC5L 3L5IA 4K9EH 2VR5A 1LEGB 1S9WA 3BFOA 4D9RE 4HIIA 3FOLB 3HI1B 5IMKB 4LPVA 4PV8B 5C0EB 5L2KD 1XIWA 1AD9A 4OJFH 3V6FA 2IG2L 3BZ4A 1EHLH 4AH2A 43C9B 4WWKD 1EEZA 1ODAA 1MHCA 2ZCKH 1GCFA 3HE7A 5EORL 3VXME 5E94B 5FYJU 4XP6L 1T7YA 3QEQB 3D0VB 2Y36H 3STLA 1DTUA 4QY8B 2V2TB 3QXAB 2F8XC 1DBAL 1XGUB 2DQDL 1ZVSA 5TE7L 3UC0H 3QIWA 1Z2KA 2ARJQ 3ZE2E 4RBPK 5HYJD 3T1WA 3VXPA 1OAZL 5ISZE 3BPLC 1PY4A 5SWSB 1DVFD 2VH5L 4QO1A 5F9JB 3K7UA 4F2MB 1IGFH 3MRFA 3WIFA 4PGCA 4IBLT 1O7VA 1A1OA 4YJZL 1QSFE 1IAIL 2PYFA 4QWWD 1FFPA 3QG7L 4LCWA 1I1AB 2WIMA 4J4PC 3REVB 4WCYL 2PTVA 1IRAY 1YPZB 4GRLC 3TBVB 2NTFB 5F7EL 1KXVC 1SJVA 2Y23A 2ZNWA 1ZA6A 1A4KB 3KXFD 1P4IH 3KR3H 3HUJE 2NTSP 2ORBL 1KB5A 5DS8A 5GS1A 4KXZI 4NC0B 5DJ6B 1FNSL 2G5BB 3OZ9H 4UIKH 4JANB 3EDJA 3H8NA 1EEYA 4M7ZC 2ENYA 1GSMA 3PWPE 4GRWF 2BERA 5C0AA 2GITB 2D4FA 5AUMA 3BQUA 4GUPB 5ALBL 5DUML 3X13A 3QDHA 4BZ1L 1X5YA 4OCYH 1OP3H 3STZA 3QBTB 3GMNA 5FUZL 5KSAC 4LVNC 1KN4H 5IBLC 2DBJA 3L95A 3R06A 1ZT1A 1C1EL 4WGWB 4YFEA 1I4FB 3T0AA 2MTPA 5ESQA 4RRPG 3C6LD 4EI5C 4I77L 2B1AL 5T1KD 3VRLE 2LE9A 3OPZL 4NNYB 2FB4H 2VLLA 7FABH 5D7JD 1S9XB 5E9DB 3JTTA 3ZDYF 5GSVB 1VESA 4C58B 5BRZE 4I9WE 2XNAB 4GQPH 2DMBA 4V2CB 1N8ZB 1Q1JH 3HPLB 5CINH 1IBGL 3L7FA 3E6FA 1DJSA 1NGYA 4S1DC 4AIZA 3FFCB 2R69L 5D2NB 1YMHA 4NSKB 4NQDA 3HZMA 5J06A 4G8EB 3D39B 4J4PA 1JGEA 4UTAL 4GRWB 5E8NA 1MCLA 1VKXB 4GRLA 5C70A 3C60D 5D2LE 3ULUL 4NNPL 8FABA 4G9DA 1UXWB 4KV5E 5A3IC 1T1ZB 4EKXA 3C5SB 3G5XA 1D5XA 3H9ZA 2Z31A 5I2IB 4ORGB 2VZUA 4QRSB 4LEOA 1NBYA 1DDHA 2QR0B 4MJ5B 4O02L 4W4OA 4KI5F 3H42L 4YH6A 5F1NB 1I7UA 2VISB 3HS0B 3MTRA 2DMKA 5GZOD 1QHOA 2FR4B 1NCAH 3CLEL 4M7JL 3NIFF 2LAAA 5HI3C 5BJTB 2HRPH 4UDUA 5KJRH 4U4BA 1U91A 4PJ5B 5KSAA 4P23D 1LO2L 3TYFB 4ONHA 4P9HC 4XNUH 4W68A 5FYJH 2MKLC 5BXFA 3B9KA 4FFWC 3QXDA 3L1OH 1KEGH 2FJGB 4N8CL 5KW9L 3CIQA 3U4EA 3GMOB 2YSSB 4EI5A 3NFSL 1KJ2H 2YWYA 2A74B 4QHNB 3OTTA 3HC3L 5BV7C 2X7LB 3EOBB 2YD1A 3MV7B 5ICZA 4UB0L 4KJYA 4WEBL 3VWJD 2DIAA 4CN1A 3E2HC 3O8XA 4OCRL 2X4NB 2ADIB 5ECJE 1EK3A 3S4SG 3VG9B 2CJUL 2OS7A 3DGGB 2VC2H 5LXGL 4IDJL 4X7DC 2Q7YA 1BZ7B 5C6PB 1WT5C 1YMMA 2CKNA 2FGWL 2FJHA 2OTUB 4FQIL 2A83A 5CBEA 4DJMA 4TSCL 1IMHC 5I18L 2CK0H 3V6OE 4XI5C 4R2GB 2BCKA 3CK0H 1QNZL 4OT1L 4PJHA 5MHSE 3SDDC 4PJBA 3I50L 1AQKH 3WNPA 3TH4T 1L7IH 4F9PA 1A1MB 3QFDB 3RVWC 1L7TH 2P44B 4WI4A 4WHTB 2NXYC 4D9QD 3MGOA 4HFWA 1HXMB 1UWGH 5IB3B 3OAZK 1MCWM 1TZHA 1YNLH 4WNQA 2FECL 4ZAKB 4U0QB 3DX6A 1MRCL 2AXGB 2X4PA 5FF6B 1NGPL 4Y2DA 4OZHF 3O6ML 2V2WA 4CJ1A 4Z7UE 1FJ1B 4UT7L 1H0DA 1UYWH 3KPOB 3F58H 3DETC 2DN7A 5BZDB 3QNZA 3SPVA 2YS4A 4M5ZH 3S4SA 5HI4C 4GSDH 5DK0B 5GIRB 2MHAA 5I30H 1DBKH 2XZCL 3TBTB 1T0MB 4OGZA 1ZMYA 4C56E 4M4PA 2DD8H 4RNRA 2DBLL 1YEEL 3T2PA 4OGXH 3ZSSA 4JFPB 5EBLA 1AGBA 4KMLB 4PS4H 3B83A 3LQAL 5BQ7A 3DV4B 3PJSB 2EEBA 3UJJL 5AEAA 3WUWB 3VMOA 4JG0H 4ALAH 4KDTA 3K2MC 4LSRL 3DHMA 2AJXH 4ZO7A 5KG9B 1SYSA 1XGRA 2P42B 4UV7H 1MHEA 1KTDB 1AGDA 4F8TA 3WFEH 3T0EA 4U1NB 1WT5A 3C5JA 2FD6L 2DM2A 2F5AL 3RL1B 3EIFA 5DFVD 3RWHA 4POYA 3U6RB 4HIXH 1J86A 1AI1L 5E70A 5BCAA 4DFIA 5T1LD 4IDLA 4KRMB 5T1DL 1I3GL 3F62A 1FNEB 4KRPC 4G3YH 3P3YA 4G8FB 3WIHL 3CLFL 4P4KD 1I8IA 2J88H 2DQTL 4PJCE 4P2OD 5GRZA 2BY1A 4HS3A 2EZ0C 2IH1A 3DX7B 4MD4B 5DJDA 2P8MA 1JV5A 1J87A 3FFDB 1S7WA 4Y0GA 1CK0L 1PKOA 1QHPA 1DSFL 3I3EA 3QUKB 1G0DA 5D7KD 1YEFL 4LRIC 3M45A 4JPKL 5JNYB 4DW2L 1FNFA 5KAQF 4WJ5B 4F57H 3VE0A 3LRHA 1FLRL 1NDMB 5E6ID 4MA3B 2E27H 4JR9H 3VXMA 1NFDF 1BQHB 1WWAX 3ZKXB 3BHBB 5CIPH 3QEHA 3SOBL 1MFDL 4OM1H 1X5ZA 5LCVH 3UBXI 4LLWA 1GGCH 1NCCL 1JHLH 4IEFB 3WFDH 2VABB 5EZOH 5KBNC 1HH9A 2V7NB 3VFWA 4JY5H 5ISZA 5JHDB 4L1HA 4NQCA 1JI2A 1OAYL 5GS2H 4HWUA 5DO2C 1TTUA 1KSRA 4KMTH 1PJ9A 3TH3T 3GRWL 3MV8D 3Q6GL 3CDCA 2V2XA 3T2QA 1FH5L 3RA7L 1NAKH 4U1SA 3NCJL 5AZEL 4KK5D 4PRAA 5TQ2L 2C3VB 5MENA 2DKSA 2VDKL 2GQHA 1P6AB 3QG6B 2A6JA 3MRNA 2NY6D 4OD3L 3TVMA 5IMOA 1PLGH 5T5FH 5C0NC 3V8CA 3GIVB 1BD2A 3DVIA 2NY1D 4GKZA 4I2XB 4HG4J 5EC2A 2WMPA 1DBMH 4PJEF 2BSSB 2V9QA 5DTFA 5AWNH 5IROA 3VGAB 3PWPA 3VFNA 3PWJB 2DQHH 3NA4A 2AJ3A 3TPUB 3WE6A 1S7UA 3KYNA 4JKMA 1F3JA 2WIIA 3AY4C 3OAUL 4IS6A 1CT8A 1NFDB 1U8NB 1N5AA 2EICA 3QQ4B 1RIHL 1OGAD 3PWLA 3QAZC 4NRYA 4QRTB 2B4CL 2VQUA 2BXZA 4LRIA 3REWA 1WBXA 4LLAA 4ACPA 3OR7B 5DEZA 4Z78A 4Q9BA 3NA9L 3QISA 4K7PH 4XBPB 3IDNB 4OZIE 4Y4KC 1PW3A 3SCMB 3OV6A 1EGJH 1FZMB 5HDQH 3WEXA 2L4OA 1NKRA 5HHOB 1HSAB 5IIEA 2C1PB 3CCHA 3FO9A 3VFPB 3GIZH 4M48H 2OJEA 2I26N 2P45B 2AV1A 3KPSD 3KPQA 3U4BL 3QSKB 4LP5A 4CVXB 2HTLC 5KVDL 3IF1A 3IU3A 5DHYB 2E7LC 1OTTD 4POZC 3UTPE 5LG1A 5BRZA 4FQ1L 1CIUA 4NQUA 3T0DA 1HHIA 1Z9SA 4DOHB 4PTUB 1UB5A 2VDMH 5DEFB 4TPRL 1QLEH 1BJMA 1NEZB 4AY0A 2BNQD 3W82A 5EIIB 2E9IA 3K3QA 1DQMH 5E2WL 3SKOB 4PJEB 4RMUA 3WDIA 4JREC 1IM9A 3H9HA 1YDPB 5JW5A 4MMXC 2WQRA 1HQ4B 4FNLL 4O58H 5D2LA 5IVXE 4PRIB 1LP9E 3PWVA 1CLYH 5KS9F 3B2UD 1OCWH 4N0UA 3IFOB 2PXYC 2VL4A 3V52H 1BVKB 3SE8L 4U6YB 1XGYH 2IJ0C 4PPTA 3O2DH 1R3HA 5D8JL 5D7SL 1H15B 3IJSA 5IFJA 2LU4A 3AROA 5GGQL 3T65A 1C5BH 3WNKA 4G7VH 4XVSL 1JN6B 2ZSWB 1RMFH 2EIZA 5HJ3A 4M8QA 3QJFB 3GSRB 5HI5C 2BY0A 3KDMA 1LO5B 5FYJD 4JCLA 2VKWA 4Y4KA 2AJVH 2YRZA 2ZUQC 5DUBB 3QIUB 4NO2A 1MRDL 4PJ7A 5DRNB 3QHZH 4K3DL 3B9DA 3IDIA 1U8MA 4S1QH 4MDIA 1YQVH 4TQEL 3I3BA 3MPCA 4JFEE 4BZ2H 1WFTA 1YEGH 3UPCA 1RVFL 1I1AD 5F89A 1AH1A 3BKYH 3MLRL 4X6BA 4QNPE 2AJSH 4MWFB 2R0ZL 1S9VB 2DQUL 1CGUA 1IAOA 4WFHE 3R8QA 3MJ8A 4X6CF 5KS9B 3DSFH 1QFWL 1TQCB 1KN2L 4LPYA 2BVEA 4UILL 2BMKB 1CFSA 3O6FB 3CSYA 5DJYA 4P46A 1OB1A 2UZXB 3K80A 2ICWB 1QVOA 2AK4E 3V6OA 1GZPB 5GS0D 1JPFB 1PX3A 3PQYE 3U1SL 4LHUD 4JVUA 5EOTB 1K6QL 4G5ZH 5EO0A 1S9KC 2PXYA 3V4UL 3BDBA 3BW9A 2MPAH 2DOCA 2HG5A 3MRMA 4FQCL 4E41B 4FFVC 1NMAH 1BGXH 1CXEA 1K8DB 1IC7H 1GC1L 1RURH 2V7HB 1CDJA 2XWBA 4JHZA 4XWOD 4Z5RA 4JKPH 4W70A 3F7PC 4XX1G 4D0CA 1F90L 4IRZH 1MAKA 5JIIA 5M94B 3IRZA 3A67H 4HHAB 1FQ9C 2FX8L 3DARA 4Z7UA 3RHWK 2HKFH 3TZVC 2IBZX 2P7TA 1HDMA 2W59A 4X5XA 4KPHL 1C12B 3PGCA 4RAVB 2J8UF 4JAMB 3LOWA 4WFGD 1Z0NA 4X6CB 3G04A 2R4RH 5F9OL 4HT1H 3I75B 1S9YA 5T5NF 4C56A 3LEXA 4HDIA 5D1XD 4HIHA 3CD4A 5ICYB 5CP3H 4JGJA 1XGQB 2J4WL 3D39D 4U1JB 1N5YH 5FYLH 1J7VR 2XN9B 2WUBH 1PVHA 5ALCH 5HTSA 3O4LA 2V5YA 2KPNA 3U0PA 5TFSH 3B5TA 3SDYL 3HE6D 3ES6A 2IAMB 2NX5D 2A73B 4I0PA 1UXSA 1CDUA 1G7LB 4NQSB 4YXHL 4OB5L 4D0BB 4MS8D 2CDGB 5FGSA 5F1OB 4YPJA 3DI2B 4XNMA 1OAUL 4CMHC 1F4AA 2WINB 1XF1A 4Z77B 5KOMC 1IL1A 2CR6A 3LKOB 4YBHA 1BWWA 2VLKE 2YD7A 2EO1A 2IPKB 5GRWA 1CR9H 4MJIB 3QUXB 4JHAL 3LEVH 4YGVA 4N9GA 4Y4FB 2QADD 3EYFB 3GJFH 2QQKH 1A2YB 4N5UA 4PJ9A 1NH6A 3MRRB 4GW5B 5DDHB 3O9WB 4D0DB 1TVBB 5IB4A 3CDGB 4OCMC 1YEHH 5J12C 5INCB 4C54A 2VJXA 4E0RB 2Y07L 4W6YB 4I0CC 1YUHB 3TZVA 1MSPA 3BH8A 1KPRA 4LP4A 1NL0H 1U8OB 1M7DA 4P2RB 1F4WL 3WO4B 4HBCL 5GGTA 2DYPA 3UO1L 2FGZA 4XCFL 5HPOA 1RJLA 4HWBL 1R3JB 4AEEA 4S1RH 2PTTB 1WWWX 3FTGA 1MFEL 2O61B 1FCGA 3AU1B 5EWIH 5GS2D 5SWZE 1NCDH 4R90H 4HUUA 4XVJL 1XGPA 1PQZB 3ME0A 4TSBL 3IDXH 1IVLA 2O5ZH 1FFNA 4PJGF 1WCBA 3OGCB 5KVGH 2EIDA 1DQTA 4JPIA 1NLBL 1GHFH 2UWEB 1Q38A 1T22B 1A7OL 1LEKA 3Q5TA 3IVKB 5I16B 3HI6L 2ZKHL 1N59A 1A8JH 3KJ4B 3F7RA 3H9SE 3S36H 4Y2OA 3V0VA 4YIQB 1JPGA 4QRPE 3GMQB 3AS2A 4P3CL 4K8RC 3ZHKA 2VZ3A 1MVUA 4X99B 5CILH 4KZDH 5DD3H 4GBXD 4XCEA 2I9LA 2VXTL 1HHHA 2W1NA 4KVNH 5J11C 1NUNB 3BGMB 4ZQKA 3WFCH 1PD6A 5EFIB 5EU3B 1JIBA 5CEZE 4OZIA 1PG7W 2JB5L 1INDL 2G75B 3MCKA 2FRGP 1JNHA 4EDXA 1Z3GL 4Z7OE 3RVVD 1CXHA 4M1GH 1S8DB 2HH0L 4CNIB 1RUMH 4PLKD 1EBAA 3B5HA 4M7LH 3BUTA 4MCYA 4ODSL 4UTBH 4YBQC 5K9QI 3D69B 5JOFA 2A9ML 4QHLA 3K74B 3AC0A 4PJGB 4LNRB 3UEZA 1F58L 4PGEB 4HUXB 3QIBA 5KVMC 4HQQL 3WCYA 2YR3A 3ARED 1D5ZA 1Q9WB 4PP2A 3F65A 3QULA 3U9PL 5KTEH 4JFFA 2X6MA 3INUL 2V9TA 3LDBC 4OBSA 5D7IF 3BXNB 2A6DA 3FZUC 1KJ3L 3OKNA 5I6XB 1I8LC 3BPNB 5IBTL 2YPKA 3BZDA 4HGMA 3BX7C 4HJGB 3TO4D 4X7FC 1Z9MA 5A40E 3NMEA 3MSPA 1D9KB 8CGTA 4HUWA 4G8GB 3QHTC 4K7PX 4NBZB 1OM3H 4F8QA 3O11B 1ZHBB 3B8SA 3DSNA 4U3HA 2OR8A 1J10A 3PUCA 2W0FA 2HWZL 2DLTA 4ZOBA 3U48A 1J8HE 1DQJA 1OGTA 3RJQB 4R4BB 4KROC 2EYSA 1KIQB 4HS6B 4MQTB 4ONGL 4E5XB 4PGBB 2R0KL 3EDEA 2H6PB 5E2TH 4L8DA 2YPVL 4ETYA 1RZFL 2R29L 4X6DB 1RZJC 4JFDE 5DR5L 5FKAB 3CVIH 4N0YH 4QHKJ 2QSQA 2OMBA 5BO1L 2HN7B 1BREA 2OJZL 3JWOC 3ZE1E 4DN4H 1OVZA 5E00A 1NBZB 1IC5H 3K1KC 5D7IB 3PXHA 4JFEA 3TT3L 1I1FB 2ITDB 2ADFL 5ID0B 1L0YA 3EOAB 3U4AA 1FRGL 1DQDH 1LO4H 5FHBL 1KNOB 2N1KA 4NZUH 1UA6H 4LLMB 4PREB 1QRNB 4O51B 3ZKNC 1KTLA 3BH9A 1IZKA 3AB0C 4KTDL 5H94B 5K9JL 4AMKL 5H2BB 4XP6H 4GMTL 1D5BA 2AV7B 4M00A 3EGSA 2HFTA 5CSZB 1DBAH 2F53D 4OLXH 2DQDH 5TE7H 4CVZB 1NMCB 5JIPA 2AXFA 1HWGB 1X5AA 2HKHH 1OAZH 5I1LB 3K2UL 3PQYA 4NM4H 5L2JA 2B7DT 1U92A 1A6ZB 1S9WB 3T4AB 5AYQA 3BSZL 4QTHB 3FO0H 4HZLA 3GMPA 5CJ8A 2HLAB 3VXOB 2ED9A 4C83B 1IAIH 3SCMD 3QG7H 2H2PD 2WBJD 1MHCB 3H7LA 1PYWA 3F7YA 3I9GL 3QNXA 4N9OB 5KSBA 4F80A 2EDEA 3D0LA 3HRZB 2XPGA 5F7EH 1JWUA 3RNQA 5LKNA 1CIDA 1C16A 3ARBC 4R7DB 2BDNL 1A02N 1MJJB 1I8KB 1N6QL 1JHTB 1RZ7H 3DXAB 3NCEB 1ZHKA 4G42A 3N06B 4M6NH 3TJEH 4WV1B 4LAJH 3S8WA 1FN4A 5C08D 5TDNA 3U30B 3S3JA 3ZSTA 4UUJB 5DQ9B 2ESVB 2MCG1 4W81A 3WIFB 1F4HA 2PO6C 3WS3B 1TJIL 1DUYB 3P4LA 4HS8L 3UPRB 4UT6H 1L9MA 2PYFB 2CDEB 1FFPB 2BRRH 4M43H 4BSWA 4ZPTA 5BVJA 1L9NA 3JWDL 5FYLD 4WIQA 1JYVA 1ZA6B 2WWKO 2V17L 4PRID 5DS8B 5GS1B 5I9QC 4WW2C 1UACL 1HINH 3O2WL 5KVEH 3SDXE 1EEYB 4JGUA 4I77H 5DA4A 5JDSA 3O41B 2WP3O 4ZMAT 3ARZA 4MVBD 4GXUN 3BPCA 3ZT7A 4JZOB 3DRTA 3MRBA 3ELAT 3G5VA 5KN5A 1RIVL 3BQUB 1MI5E 3ULVC 2Y7QA 1YNTA 1CG9A 3STZB 3I6KA 3OJVC 1JGDB 1PKQA 4PJIE 4KQ3H 5C0JB 1ONQA 5D6CB 4I3RL 3W11D 2D9QB 2CGRL 1KJVB 3GMMA 1CF8L 4WUUE 5IVZA 4E42B 2X42A 1WIPA 5IEKA 4MDJA 4Y5YC 5I76A 4CW1B 4XPFH 5I1GL 1G9NC 4YC2C 2CLVA 3KPMB 3ARTA 4UTAH 5J4MA 3VXSD 1J0IA 2DLHA 3ULUH 4NNPH 3BGFC 1OAKL 1HE7A 3CAFA 4GMSL 3UZVB 5F3HA 2EE3A 5E56A 5IQ9B 2EDHA 4OQ1A 1RHHA 3BO8B 3BPLB 4O02H 4QHMB 5EBWB 3D25B 4JEGB 5AG8A 2UZIL 4X9IA 5F96H 1T1YA 3CXHK 1JVKA 1I1YA 3ILPA 4LMQI 2PO6A 4L3CB 1TJGH 5L7XH 3CLEH 4M7JH 5FAAA 4P59H 4GRLB 4M1DH 3F8UB 3CVHB 1CLZL 1XR8B 5I73C 3QNYA 1KPUA 4MNQB 2DM3A 2AERT 4WW2A 2C1OA 3HB3D 3UTTB 1VFMA 1QD0A 4LEOB 1NBYB 4N5EC 1DDHB 4PRPE 4M7ZB 3NFSH 4LASL 4OGAD 2FBOJ 3HPJA 5AZ2L 3RWEA 3HC3H 3L5HA 4WENB 3QRGL 4R26H 2BOCB 1IAKA 4QHKI 3TNNA 5IFAH 3GSWB 9CGTA 5KSAB 4LVNB 5DGQA 4ONHB 2W65B 4BSVA 3W9DB 1F4YL 1IZJA 1EHNA 3KLAB 3ARFC 2Y5EA 2FGWH 5HD8D 3T8XA 5I8CB 3I84A 1FVDA 4TSCH 5I18H 4JRYE 1X5FA 3U4EB 4QRPA 1HKLL 4EI5B 2L7JA 3UBXG 5T33L 1WC7A 4DCQA 3CSBA 3T77B 1X44A 5JLZA 4Y5XC 4JY4B 4KJYB 1T1XA 3I50H 3D2UA 4QHUB 3MC0A 2ICEA 4FFYH 4EI6A 4BELD 3HR5A 2AEQL 2XN9D 5JIHA 5BS0E 4OLWL 1YJDC 3MLYL 3SGDI 1OAXL 1R3KB 2XY2A 1PZ5A 4UDTB 5JQ6H 1H3UA 1Y6MR 1SJEB 2HTKC 1YMMB 4F7PA 1NGPH 3O6MH 4C59B 5GHWL 4XAWH 3LKPA 4UT7H 5C07D 3WL9B 5FM5O 4IM8A 4PJHB 1LK2A 1WAAE 5HHMB 3NOIA 4WHYH 1JK8B 3S36X 2PW1B 2O5YL 4DVBA 2EC9U 4MJID 4HFWB 1YEEH 1SJXA 5JOPE 5C2BH 4QOKB 4EIGB 3EYUL 1T1WA 4JQXA 4ZUWB 4WNQB 4I18B 1CFTB 5IHBA 1QQDA 3UJJH 3QWRA 3UBXA 5J13C 5IBUG 2D9CA 5CBAA 4R9HA 4P2QB 1ACZA 1URLA 2YHGA 4WWKC 4LSRH 4ZNEE 1U8PB 4HKZB 2QKIA 3FN0H 1RJZB 4JM2D 3V4VH 4M3KB 3SPVB 4RIRB 3S4SB 1DFBH 4JDZA 1NFKA 2P5WB 2MHAB 4V1DE 1LE9A 1VADB 2F5AH 4JO1L 4YHLH 3QQ9D 3MOBL 4PJXE 4RMTA 3KYKL 1QBAA 4DEPC 3PDGA 1IQDA 4NN6C 5T1DH 1DVFC 2OBGA 5CEXA 5BV7B 1Y0LA 2E7MA 5ANME 5BQ7B 4Y5XA 3P30L 1JGVH 4YGAB 4O2FA 1OPGL 1RULH 4OTXL 4QWWC 2DQTH 3JTSA 3RUGE 1B90A 4BQBA 2GJ6E 3P77A 4JFDA 3THML 2YMXH 1XGRB 2QSTA 3BP5B 5FK9A 1MHEB 3L3GA 3C5ZD 4Q0XH 3OF6A 4DGIL 3VI3E 4K07A 1Q8MA 5GRUL 2VDRH 3JXAA 1UGNA 3RWHB 1DSFH 3UYRH 4LSVH 4F33A 4DW2H 1X4XA 3FB6A 5CAYB 4NQEA 5TDPA 3IAQA 3IDYC 3SDDB 4J8RB 1FLRH 4HXBH 3VXQA 3CXHJ 4YX2L 3K0WA 5ICXB 4ZXBD 4HFUL 1T89C 4K3GA 3LS4L 5I71B 5IMMB 3LKSA 2NXYB 4H1LG 4J3TA 4Q97A 1DQLL 3PF2A 1F3DH 2XYCA 4JRXB 2EYRA 4HS3B 2R1YA 2IH1B 2JB6A 3U36A 2X09A 1NCCH 2P8MB 1JV5B 1WTGT 5L2KA 4ZO9A 5IM7B 2EDNA 2IMMA 4IHOA 4M6AA 1RV6X 5ESAB 3FB7B 2BXYA 4WWKA 4LEXH 3C6LC 4PJFE 1OAYH 3SKNB 1G7HB 1UM5H 4AL8L 3QFJB 4LSTL 2FSEB 3C8HA 3FHAA 3HG1E 4XNQB 1X9QA 5D7JC 1IC4L 1KELL 3Q6GH 3QDAA 1FH5H 1RK0A 4XH2B 2EDXA 3VMPA 1HXYB 5AZEH 5MEPA 5FYKD 4C4KO 4PJDF 3IT8D 1BFTA 1MQ8A 5E5MB 1F02I 2ICWJ 1MWAB 5FKPB 1C5DA 3J8F7 4BH8B 1HH9B 5HDBF 1KB5L 2MMXA 2WZPD 2Z8RA 1KCRL 4X6EB 4NQCB 1A21A 3C60C 3EO0B 2APVA 3MBXL 2YA1A 3FQTA 4P5KB 4IOIB 2HT3D 2RFXA 4LDLB 5DZLA 4H1LA 4XP5H 3OAUH 1MFCH 4LOUD 1GH7A 1B3JA 1WWBX 2B4CH 3D3VB 5MENB 4X83A 2VLJE 1U95B 3NA9H 2OLDA 3MRNB 1MCRA 5ADOL 2ZUVA 5TGBB 3NCCB 1NPUA 3EZ8A 4L8BB 5IMOB 4KRPB 5GZOC 2CMRL 4H26B 3G5YB 1QLFA 1MCKA 4GKZB 5F1IB 5EC2B 2VDNH 5DQJB 1RU9L 5GISH 3U4BH 4Y19B 4OCLC 4P23C 3VFNB 1S7UB 4PLNC 4HC1A 1KTKE 1Q9OA 5KVDH 4ZD3L 4C57C 5EUOE 3MLPA 3QA3A 3KLHD 4PJDB 3IXTB 4PJIA 4X7TA 3L3OA 1GOGA 2PYEE 3MRDA 4UBDD 2D2OA 5C8JA 5T1KA 6FABH 4G6FD 4DKDC 4EN3A 1ZA3B 5E2WH 1XH3A 5DMKA 4FZ8L 4JFXB 1IKFL 2KZ1B 3VWJC 1KCKA 3SY0A 4MSWA 1P7QD 3CCHB 1UZ8A 3S96A 3BKJL 1G7MA 3ULUD 3N0PB 4W4NA 1IQWL 1BQLH 2J8OA 4FNLH 1JBJA 3PGDB 2MCPH 4GG6E 1CTNA 4FHBD 1A4JA 3CVHL 4YHZL 5FCSH 3SE8H 4Y1AD 2CRIA 1E6OH 5DJ2A 3CFDA 3JV4B 1HHIB 1R3LB 5D8JH 3GBNL 5D7SH 1FZJA 4UU9A 3GFUA 1LO0L 1LNUA 1VEMA 4GH7B 2ADGA 4OLZH 1MLCA 4XVSH 4U6XA 4LF3A 2APBA 3BJ91 1VACB 1OWWA 3AAZA 4EQ3A 5AYUL 1IM9B 2BNRD 2BJML 3ABZA 5JHLL 5C1MB 5JW5B 2AK1H 4J7RA 2DKMA 3WS6A 1JZ4A 4N0UB 1UVQB 2F19H 4B50A 2IANB 4K3DH 3QEQE 3BZEA 4TQEH 1UC6A 3PABB 4NNXA 4OSUL 1IEBA 1RVFH 3KPLB 4M1CD 2KDGA 4X8XA 4O2EB 3MLRH 4FTVB 2R0ZH 2CIKA 1NC2B 4L4TB 1P84K 2LQRA 3DROB 1N7ML 3IYLW 5SWSE 5L9DL 2VLRB 1UH3A 3QAZB 5CJXC 4NBXB 5E6ZA 1N3NA 2DWEB 4DZBA 4FQXD 5I66A 1KN2H 3T4YB 3DXAD 2E5EA 4TULL 4OV5A 3IRPX 2QQNL 1YPZE 3VWJA 2W9DL 4BYHA 4HPOL 2ESVD 1FPTL 1X4ZA 5B3NA 1NAMH 4JRYA 2EDLA 5H37G 1UENA 3ARDA 4MDIB 4HJJH 2X4QB 3U1SH 1MHHB 3SJVE 1K6QH 1ES0B 1S3KH 1FORH 3V4UH 3OKDA 5DD1L 1INQA 3IS0X 2R56H 1ND0A 2X4OB 1MCQA 1GC1H 1Q9LA 2MOVA 5DFVC 1E4XL 3MJ9A 3KNBA 1FZOA 2XFXA 1LO3H 4F9LC 1G6RH 1OW0C 2G9HA 5DJYB 4ERSL 1OB1B 3JBG7 3O3BB 2YPLD 4JREB 4P4KC 4YHML 2R2HB 3VWKD 1SY6A 4R3SB 3QDMD 3FT3B 4P2OC 2FX7L 3VI4F 5JA9A 1JMXA 3MREB 4KPHH 3V7MA 1AHWC 4P9HL 2GT9B 5CP7A 1QA9A 4FXKA 2PXYB 3WMSA 4ZOEA 3O45A 4WUKL 1LD9B 4K9EC 2ICWI 4M02A 4LMQE 4AM0A 1FVCA 4LDEB 1PG7X 1MCCA 1DANT 3NCMA 5E9DE 5FGRA 4ZDHB 4Z5RB 5FM5M 3TNMA 5EZJA 5BV7L 1AE6L 1OP5H 1AC0A 2Q7NA 3IDGA 3UP1A 1RUQL 4RAUA 5E6IC 3SE4C 3TV3L 1LWRA 3NCBB 3V5DB 4ZNEA 4Z76A 3GHEH 1G7PA 1KJMB 3FFCE 4WTZG 5D2NE 1MELA 2ZUQB 1FSKC 2BSTA 4XXDB 4OFYD 3PL6A 4GRWE 3CH8A 4OB5H 4V1DA 4YXHH 3IFLH 4XC1H 2W0LA 2X1XR 4BH7B 1S9YB 3LEXB 4PJXA 3MLVH 1MVFA 4HDIB 1MCEA 5I1HH 4OLYL 3F7VB 5F6HJ 1RZIB 3U9UB 2JF1A 2W9EL 1VFBB 5ANMA 1TVHA 4L8SC 3BEVA 4CDGC 4WI9A 5FDWA 2NY7H 2W60A 4U2YA 1PAMA 4LHQB 4IRJA 3MFFB 2MWCA 3H3PL 3O4LB 4J3UA 4TVPL 3ULSB 4EXKA 4I3GA 3RUGA 3U0PB 1EH9A 2PNDA 4JN2B 1Z0MA 1HHKB 3VXRB 5JXED 4KK5C 3RY4A 5T1LA 3ES6B 5F6IC 1XZ0B 4F9LA 2NY6C 2H2SD 1UXSB 4YZFE 1EXUA 1J1PH 3LKNA 4PJ5E 5DRZB 2P5EB 4G43B 3TN0D 2NY1C 4P4KA 3SE3C 1VFAA 4PB0L 3ZDYE 5LGKA 4HXAH 5CFHA 3T08A 5FM8A 4P2OA 3WIIH 4GLRI 1JNNL 1AHWA 4J2XA 3AGVA 4YLQT 5HYQA 5MEOB 3T0WA 3VMNA 1IEAA 3UO1H 1A6TB 1GYAA 4WTZA 3FCTB 2OYPA 3MRHA 3MV7E 4XMLH 4GAGL 3FT4A 4MQ7B 2PR4H 3RZCD 2J3SA 3EYOA 1VPOH 1IE5A 1G7JA 5GSRA 4JY6A 1MFEH 5D4QA 3SDAD 3QDGB 1N0LA 5E6IA 2C4XA 3FQUA 1JZ8A 2QSCH 4NZDA 4YDKL 1AIFB 3DVNB 4LVHC 3TZVB 1PSKL 1YC7A 4OIBA 3O2VL 3GGWB 2OQJB 3RY5A 3I85A 4KI5E 4UV4L 3OKOB 4M6ML 3LQZB 1XF2A 2Y5TB 4YDJA 3WKNA 1OTTC 5IT2L 5ITBH 1AJ7L 3QEGL 1UFUA 3NIFE 3C6SB 1PFCA 4Z95L 4LCCC 2JIXB 4K23L 4XCCL 4L8SA 1NLBH 3K4ZA 5DVKA 3UTQA 4UNUA 4JO3L 2JE8A 1D6VH 4RZCB 2B2XL 3MR9A 3HI6H 2ZKHH 3F5WB 5T3XH 4XZUB 4MLIA 2BY3A 3VRIB 3OB0K 3H2WA 4Q6IC 1ZLWH 5T3ZH 1XGPB 4ODVH 2G2RA 4PR5A 3ROOB 2OSLA 3B2UC 5J9PB 1FFNB 4XVUD 3HMXA 1NDGA 4XCYA 4CMHB 1J9CT 4MJ6A 4X98A 4WEUD 3DUUA 2VLJA 5I8EA 1JZ5A 2R0LL 2JB5H 1INDH 1WEJL 1U41A 4BQCA 2EE6A 4MXVE 1BIIA 1Z3GH 4UQ2A 5CZKA 5JIKA 1LEKB 1ZK9A 4Z8FH 4BQ6A 5IB1B 3FONB 2I24N 4U1LB 1OGAA 1AGFA 5IQ7L 5M7QA 4NM8L 2X4UB 4LSUL 1OY3B 3H0TA 2F58L 3SGJA 5I1KL 5FFLA 2A9MH 1M7IB 3ZZ1A 4U2ZA 1R5WB 1JL8A 2BVUA 5EUOA 1O5DT 1MFAL 1BZ9B 1ZS8A 2UUDH 2ZCLL 4HQQH 4O5LL 4TOYH 5C86A 5J12B 5FCUL 1XCQA 2PYEA 3WNNA 4P4RB 3KPSA 1HH6B 3LMJL 1U8JA 2YBRA 5HHPB 3MCKB 2RJMA 2Q8AL 1I1AC 1JNHB 5GJSL 2X1QA 4PV9A 4UQ3A 4KH2A 3HZKB 3IGAA 1FE8L 1U8LB 2LABA 1MJUL 1U8IB 4MXWL 3LH2H 4QCIA 2F54D 5JA8B 4U7SA 3TFKD 4GG6A 4LCCA 2EEDA 2ITCB 4QHLB 3ZDZE 5TH2B 3RVUD 2AEIT 2C7UA 4MNHA 1D6EA 3D85D 1A1NA 2Y9RT 3U46B 1D5ZB 3E0GA 4KC3B 3VD5A 3CFBB 4YDIL 3QULB 2I60L 4WI6A 3BESR 1X5JA 5GS0C 4OZFH 4PUBL 4JFFB 1CFNA 2HVKB 1G7IA 4Q6IA 2HWZH 1KCSL 5CWSB 1EFXB 4Z7WA 4JRXD 4OFKA 2GAZB 4ONGH 2A2QT 5FHAH 1LEGA 3QUYD 2R0KH 4DK6A 2NZIA 3HI1A 5IMKA 3TH2T 2HJLB 2C5DC 3N1QC 5C0EA 4P3WA 3WIHA 4YEFA 1RZFH 3RJDA 3EJZD 5C09D 1JGUH 4XWOC 5DHVH 3VW3H 2EC8A 1JI1A 5F6HI 3U7AA 5E94A 1OTUD 2FYYA 5E7BA 4P99A 4LHUG 3QFJD 2Y1VA 4QY8A 2V2TA 3QXAA 4HWEH 4X7SH 3B6SB 4LIQL 3G6JF 3LKQB 1XGUA 5AD0A 2W92A 2Z35A 2D31B 5F71A 5FHBH 1K4CB 4Z18A 2XTJD 5ADPH 5JHDE 3KPRB 5SWSA 5F9JA 5J11B 4GKSB 1KLGB 2VNCA 4L8DB 5K9JH 5D1XC 3L3KA 1ZLSL 4M93C 5D6DA 3L5WA 3PHQB 2WV3A 1I1AA 1V05A 3QYCA 3REVA 1YPZA 4Q2ZB 32C2A 3MLXL 4KY1L 3C87A 3TBVA 3MV9D 4I3SL 5E00B 2NTFA 1R3IH 5EBMB 4K3EL 5IFHL 2EDOA 3UYOD 1BVZA 3K2UH 3HE6C 5DJ6A 4YUEL 2G5BA 4I2XE 1F6AB 3C08L 3BSZH 1HHGB 3LB6D 3D3VD 4JANA 3WHE0 1MCOL 4MS8C 1PX4A 1JZ3A 2XKNB 4RSVA 3NABL 1A6WL 1NANI 2GITA 3ARWA 5CJBA 4Y16D 1F3DJ 3CZFB 1NFDE 3DWTA 4LHUA 2R23B 1YYLL 3HMWL 4CKVX 4GRMB 5CLTA 1YEJL 4BM7A 5F93C 2AXFB 2QADC 2FL5B 2ID5A 4MD5A 5JW4N 4JB9L 5HHOE 1JF6A 5L2JB 2OK0H 1U8HB 5F7HA 3OX8B 4HZLB 3GMPB 4NBYB 4XBGB 4BKLB 1CD8A 1SEQL 4UNTA 5FUCE 3ZTJH 1SMOA 1ZEAL 5CZVL 4APQD 4NNYA 3QNXB 5KSBB 5GGRB 3TPKA 3D0LB 5GSVA 2R1XA 3IU4H 1T7XA 4DAGH 4KROB 1N8ZA 3HPLA 4M62H 4DOHE 1QSZA 5DT1L 4L8CB 1UM6L 4XWGL 1A5FL 2E7HA 1ZHKB 5D1XA 3S88H 5D2NA 4PJEE 4G8EA 3D39A 1ERNA 1JYXA 1VKXA 1TPXB 4M7KL 5HYSB 1MHPH 2LTQC 1QLRB 1UXWA 4PJAE 2QHRH 4OLVH 4PG2C 5C0BB 1T1ZA 1SBBA 3C5SA 4U6VH 4I3RH 5I2IA 2NX5A 4ORGA 3TWCH 4QRSA 4NJAH 4MJ5A 3QPXL 3ZYZA 5J6HA 2ADJA 4AG4H 3QXUA 3HS0A 3AB0B 5DWUH 2FR4A 5E03A 4HUVA 2HRLA 4GMSH 3DRTB 4PJ5A 5HGBB 5JW4R 1MFBH 1KC5L 3B9AA 3TYFA 4UIMB 4Y88A 4JHBA 1RPQA 5IGXL 2ARJB 3FQNB 1M6OB 2B8OT 3HNSH 3CXDH 4O9HL 4EUPB 1PKQB 4WW2F 4IMKC 4MYWB 3EHBD 1OOAA 2FJGA 1YEKL 4XRCB 3GMOA 2YSSA 5IVZB 3VGEA 4L4VD 3GM8A 4NJ9H 5I76B 2A74A 4GBXC 4QHNA 3W0WD 1FIGH 2X7LA 1QACA 2BNUB 2NY4D 4CU8A 2GHWB 3GHBL 2ADIA 1VGEL 4R7NA 2J6EL 3ARBB 5HGDA 3G6AB 5KS9E 1W8NA 1OL0A 3DGGA 3SO5A 3RVVC 2CIIB 4TNVF 1KYOJ 4XPTL 5LWYL 1F2XK 1Q0YL 1ZOXA 5T1MB 3TIEB 1BZ7A 3ZTNL 1AKJB 4OF7A 1I85A 1RHHB 4KUZL 4XBEH 4PLKC 4RA0C 2I9TB 1QO3B 4LASH 4JHWL 2OTUA 2VZVA 4XP1H 4KTEL 3AM8A 3BJLA 1I1YB 3ILPB 2FEDD 3GO1L 2PO6B 1HZHL 3QRGH 3MBEB 3S37H 2K7PA 3WUWG 3MNWA 1I8MB 3AREC 2F8VA 5DJXB 2GK0A 1KCUL 1A1MA 2OL3B 1P53A 3QFDA 3DX9B 4E41E 1FG9C 4ISVB 1KPUB 1TZIB 4WHTA 3DRQB 5K59F 5T3XD 1F4YH 4YXLH 4WW2B 1I9IL 1KGCE 5IB3A 4ZAKA 3TO4C 1QPXA 5T3ZD 5DD6B 2AS5M 1HKLH 2AXGA 2VR4A 5T33H 2NY0B 1Q72L 3MO1B 2J7LA 1KBGL 4RGOH 2PTUA 1FJ1A 1OTSD 3KPOA 1Z9LA 2XACC 3VGDA 1P4BH 4LGRB 4OIAA 4D9LL 1OHQA 3WYRA 4OLWH 5GIRA 1IGTB 1KCVL 3B2VH 3MLYH 3IDUA 5HHNB 3TBTA 1OAXH 1T0MA 3PG2A 4XAKD 5JDJA 2WWKT 4JFPA 3WFZA 4LLYA 4Y5YB 2P24B 4NRZB 1ZLWK 2JJSA 4JFYB 5HHQB 1FVDB 3DV4A 3PJSA 5MI0C 1NGXB 4ZFZB 2WP3T 2XN9E 1IGCH 4TNWF 3Q5OA 3WUWA 1RIUL 3JV5A 4U1MB 5FUOL 4L3EB 4ELKB 3AS1A 4OF3A 2B0SL 1KTDA 3IFPB 3ARPA 1BQHG 2FIKB 3SDCD 1ADQH 3EO1A 1A9BB 5E4EC 1C5CL 4U1NA 5E2JA 5TPWL 3RL1A 2H32H 3U6RA 3VXRD 1CGWA 3MROB 1UKQA 3M17A 2VDOL 5FO7B 1QSVA 4PRNB 4G6AD 2R0WH 5B22A 1FNEA 1MF2L 3D9AL 2P5ED 4G8FA 4ETQA 2DQGL 4M6OH 4OZHA 1Q9KB 5EU6D 2UUDK 5I1CH 5C7XH 1JF1B 1U0QA 4BFIA 3HA0A 3VGAC 5D7LD 3RIAF 3DX7A 1BQUA 4MD4A 3VFGL 4Y89A 3FFDA 1E28B 4Q58C 4PIRF 1DLFL 4K8RL 3QUKA 3WXWL 4WFEE 3N50A 3VH8B 3X12A 5JNYA 1ZE3C 3KPNB 3G08A 4JFHE 5FDYA 5CD3B 4WJ5A 5EZIL 4HAFA 1OPGH 5EIQA 1ITCA 4OTXH 5CBAB 5KAQG 3SCMC 5ITFA 2H2PC 3DJ9A 4J3OC 2WBJC 5KSUB 4PFEA 2E9BA 3QDGD 1NDMA 1OF2B 2QKIB 3WNLA 4P2RE 4EJ1C 4MA3A 3QHFL 3VXUB 5JW4M 2F5BL 4QXGH 4DGIH 1BQHA 3BHBA 1WFUA 3ARFB 4P0DA 1G0YR 1LE9B 3K8KA 3MUZ1 2KH2B 3QH3A 4PD4K 4O4YL 5KSVB 4JO2H 5SV3A 3SBWA 1BZQK 4EBQH 1HCFX 5DHXB 2JIXD 3VXTB 3Q0HA 3CFCL 3BRFA 3H7BA 3BD5A 4GXVH 5EOCL 5F3BA 2BVYA 3KYOB 2XY1A 5FK9B 1QSEB 3OJ2C 4OZGF 5IJKC 2F8OA 2Z92B 2C3VA 4HGWB 4CDHA 4X7CC 4JRWA 2UWEE 1JPTL 1ZWIB 1FV1B 1NEZG 1T2QH 4I2XA 4GW1B 4ONFH 4LSTH 1BBDH 4PJ8B 1W72B 4MVBC 5TDPB 4W6WB 2BSSA 2EDYA 2DAVA 1A7NL 2DLGA 1A64A 3PWJA 1KELH 2RIKA 3T0BA 4U3XA 1NFDA 1U8NA 2YXMA 5B3JF 4PRHB 1TCMA 2JB6B 3W11C 3FKUS 5GGVY 3UX9B 4P57B 4QRTA 3EAKA 1DUZA 1KEMH 3OR7A 5SX4H 4XBPA 3U82B 1CDIA 1WZLA 1KB5H 2O26U 3SCMA 1FZMA 4N8VB 2OTWA 1AO7B 2WBJA 5HDOA 1CGSH 1HSAA 4QF1B 1RZJL 2C1PA 4ZG1A 3VFPA 5C6TL 1AXIB 3ALXA 5B39B 3RY6C 5HHXL 3FO1B 3BDXA 2DJ4A 5HVGB 4CVXA 1KENL 1HYSD 4PJGE 5HYJB 4DEPB 4OZGB 5DHYA 3EUUA 4NN6B 5D70H 3WUZA 3T0VA 1DVFB 5ADOH 1B2WH 1ZANL 2DIBA 2CMRH 3BKCH 1FVEB 1ZGLB 1NEZA 1M4KA 1UT9A 4ZTOL 4TYUA 5CP3A 3FN9A 4P9MH 5EU4A 3SKOA 4PJEA 4PYGA 3SGEH 2VUYA 4Y4HC 1YN7A 1YDPA 4AEIH 4YXKH 2E7BA 3KXFB 4ZD3H 1MRFH 4PRIA 2GY7B 5IHZB 4G8GE 2IADB 3HB3C 4S1SL 3MLTB 1BVKA 1WCQA 2NNAA 4OGAC 2FO4B 2UV3A 4Q9QL 3IDYB 5JORB 4RFEA 4FZ8H 1H15A 4B53A 1W8OA 2VAJA 3DURB 5DD5H 1EMTH 3BN9D 3T3MF 5E99L 3SKUD 1IGIH 5E2UL 1IQWH 5DJ0B 1JN6A 1MUJB 5DJ8B 3CFJB 3IKCB 1YC8A 2CKBB 4JFZH 1Q9OB 1ZVYA 3QJFA 3GSRA 3MCLH 1JPSH 1P69B 4X6DE 3UJTH 2VKXA 4BUHA 5C0CB 1MAMH 5HD8C 4WWID 5DUBA 3VXNA 1FYTD 2VXQH 3QIUA 5EIVA 2VRAA 3C6LB 2IBGA 3GBNH 3MRPB 2NYYD 2J2ZA 1FL6B 1KB9K 5T1KB 3MCG1 4XP4L 4FXGB 5D7IE 1GGTA 3WNOA 3RY6A 5D7JB 4NIKB 5BVPH 4TSAL 1UZ8B 2BJMH 4MWFA 3S96B 1G7MB 1S9VA 5JHLH 2WLZA 3MLWL 3GMLB 1AXTH 4WO4D 5FXCH 5DD0L 1QRNE 3ILQD 5KS9A 3QDJD 1ETZB 2RB8A 3EDKA 5TJWK 2P49B 2WAHA 3MRIA 4DKFL 1MAJA 1U58A 2D0GA 4QEGA 2BMKA 3O6FA 4EVNB 4OUOA 5F7YC 3RBGA 2GIYA 2ICWA 3C60B 3MNVB 3HUJF 4YO0B 5D5MF 1C8PA 3H6JA 4PD4J 3OXSB 1QFWM 4LF3B 2JJUA 3DUHA 3IDJB 3ULVL 5EOTA 4LQFH 4F15B 2ATPB 4RFOL 4Y5VC 4C4KT 4NFCA 4NC1C 2IPUK 4LAQL 4E41A 4TRPH 1ZLVH 1K8DA 3M07A 2X2YA 1KCLA 2KUTA 2W9DH 2BY2A 1I3VA 2IH3A 3DIFB 3U7YH 4HPOH 4ZFFB 3GK8L 3GSNB 3WN5C 1KXTB 1V3KA 2DDQL 2WK2A 1G9NL 1V7ML 2DL9A 2VOTA 4NNXB 4P23B 3WSQL 1J0KA 5GXBB 2ERJC 4HHAA 4JM2C 4NP4L 4ORZC 2OX5A 4G80B 4WHCA 4HKXB 2CUMA 4DK3A 5E8DL 1DL7L 1KF9B 1C12A 4RAVA 1FBIL 5B38B 4YDVB 4JAMA 2JCCA 3QQ9C 3TBYB 1E4XH 4X6CA 1N3NB 4UINL 5DQDL 3FB8A 4OAWB 3ZMRA 2ICCA 3I75A 4YAQA 3E1F1 1FAKT 4AT6B 2CO6B 5T5NG 3DGCR 1E27B 3S37X 5ICYA 4ERSH 3HC4H 2AEPL 1XGQA 4G9FB 4YHMH 5D5MB 1IFHH 3HUJB 1DBJH 3NN8A 4F7EB 2XN9A 3NCFB 5IHLB 3IETB 5F72S 4OM0L 5C0BD 3C5ZC 5A43C 3L5XH 1INQB 4HF5L 2W0KA 2XQBL 1SEBB 5AAMA 4JPVL 4NQSA 5J1SC 4D0BA 1CE1L 3MRGB 1FZOB 1ZV5A 2CDGA 5LBSH 1ZHLB 4H0HB 2WINA 1B4JH 4Z77A 3OKLB 5BOPA 4YNYB 1AE6H 3RPIA 3LKOA 1RUQH 4MA7L 4K7FA 3RTQD 2R4SH 2HFEB 4ZXBC 1T0PB 4Y5VA 3SEPA 4MJIA 1CDGA 4LKCA 3SQOL 1HI6A 4N1EA 2CPCA 5JPNA 4Y4FA 5CJ5A 1F2QA 2DI7A 2J8UA 2YK1L 2YA0A 3QJHB 4QRQB 3O45B 3MGTB 3WN5A 1BBJA 3QCTL 4GW5A 2D03L 5DDHA 3O9WA 4OLYH 4D0DA 3MLSL 1WZMA 1G7QA 1GAFL 2W9EH 3CDGA 1MIEL 4OV6F 5INCA 4E0RA 4JM2A 4YE4H 5EH1A 1YUHA 4BSJA 2HLFD 4TVPH 4I4WB 3HNVL 4QRRD 5DURB 3OJDA 3MQIA 4IJ3C 2YD6A 5A1AA 3CSPA 5LGHL 1XR9B 4P2RA 5IR1B 15C8L 1F13A 1YJDL 2VXSL 3LQMA 4N0FA 4Z0XB 1A3RH 1TNNA 2JELH 3DHJA 3WFBL 5DK2B 2PTTA 1DANU 2A0LD 3MBED 4MNQE 4ZOAA 1RHFA 2O61A 3FQXA 5EU7C 1JNNH 3AU1A 1FDLL 2HFGL 2QHLA 3GM0A 3TBSB 3BEVB 1EAJA 3UTTE 4LFHD 3IXAB 2HT3C 1W72L 2CD0A 1RK1A 3P9MB 4LOUC 2HYMA 1PQZA 5I6XC 1DBBL 4LQ1A 3HLAB 1NMBH 4D8PB 4FQLL 5LQBH 1MQKL 4GAGH 1OSPL 5IEHB 2AKRB 4NFBA 2I27N 5E4IA 5L88L 3OGCA 4FQJL 2V5SA 4LCIH 1N2RA 3P0YH 3QWQB 4OKVB 3LKNB 2VDQL 3MLUH 3O3DB 2VXVL 2D7TL 2NY0D 4WI2A 1EAPB 2VXUL 4ZXBA 5D93C 3VD9A 2IFFH 2I07B 1T22A 3HHRB 3IVKA 1NSNL 2CSPA 4F7TB 1B6DA 3TM6A 5E0QA 4YIQA 5FECB 4JO4H 3GMQA 4LCWD 4XXCC 5DMIL 3KLHC 1F8TH 4DQOL 4CVUA 1MJ8L 2ZSVB 1AJ7H 1MOEA 3EOTL 4Q6YA 4JZJC 5GGVL 3EYOB 4KI1A 3LEYH 3BGMA 1G7JB 4JY6B 5DJAB 3RDTD 4KK6D 5EFIA 5EU3A 4JO3H 2G75A 4FS0A 2XWJB 1BAFL 2EXYD 2L0DA 3ULUC 1RD6A 2R15A 2AGJH 2O5XL 1A6VH 1D5MB 1YMME 5C0AD 1MREL 4CNIA 5F1SA 3DLQR 4TNVK 1JYNA 2IPTH 3D69A 1WK0A 1LVEA 1U6AL 1HEZB 4PJGA 4LNRA 3V6BR 4PGEA 3S35H 1WGOA 1CZ8L 1GGUA 2BFVH 4PJHE 4PJBE 4HUXA 2R0LH 5HHME 1WEJH 1FGNL 1Q9WA 3M8OH 5EO1B 3O6LH 1VERA 4QOKE 3MV8B 12E8L 5JUEL 3JV6A 1A7BA 3I6GB 5IQ7H 3X3GH 1GOHA 4JN1L 4FABL 1IGMH 2XICA 4NM8H 1E4WL 3RU8L 1GJIA 5I1KH 3RGHA 4HJGA 5F6IB 5JMRA 2NY6B 4K94L 2NW2B 3LS5L 4P2QE 4PR5B 1FNGA 2AQ1A 4DN3L 1MFAH 2CKBL 1YY8B 3O3AB 4G8GA 4HC1L 4PJCF 4AENB 2NY1B 2ZCLH 1NDGB 1MEXH 5A2KH 5IOPB 3O11A 3PWUB 1LQSR 1UB6B 2P5WE 4JM4L 1UADC 2B1HL 4M1CC 2Q8AH 1TDQA 1LEIA 1BIIB 1CFVH 3Q1SL 4HMCA 4WI7A 4CU7A 4NQDD 4DKAA 2DQIL 1FE8H 1AGFB 4JZNB 1KIQA 4HS6A 2Y4SA 4E5XA 3H0TB 4FQXC 3E6HA 4ZFGL 4J6RL 2H6PA 4KMQA 4JDVA 3WJLC 4OCWH 2Z31D 5FKAA 1P7QA 3DTXB 2ZZUT 1CDHA 2HN7A 4YDIH 3RX7A 3VFMB 4FG6D 3KPSB 3WFHA 1BJ1J 2PW2B 4TNWK 1U8JB 1KXQE 5IG7B 5CJQH 4Z7VF 5F7WC 1KCSH 2DQJL 2Q3ZA 3C2AH 5D1ZB 5D7IA 4YEEA 2EH8H 1I1FA 2ITDA 4UQ3B 4LVEA 4WU7B 3T2OA 5ID0A 43CAA 4E9LA 3B9EA 1QSED 3EFFB 4NKOA 3WD5L 3CX5K 1KNOA 2FLBT 1EO8L 5DUPL 4HH9A 2VLME 3V9FA 1G9MH 1QRNA 4O51A 5GRJL 1CD9B 2BNQB 5H94A 3BWAB 4IIQC 5CUSH 3B9KD 1T2JA 2JJWA 5FEBA 1A1NB 4PJ8D 5L0QB 4U1GC 1GGBL 1JCKA 3GSNL 3ZKQD 3VWKC 5CSZA 1IKNA 2B39A 1N64H 2QTEA 5DSCB 4CVZA 4F3FB 2FBJL 3HNTH 3EZJB 4Z7WB 5I1LA 3O8XD 3OJMB 2OZ4L 1YYML 3QQ3B 3RIAK 4Z7QE 4PRHD 1A6ZA 3T4AA 3I6LE 3NACH 4QTHA 3MXWL 1RZKL 2HLAA 3VXOA 1ZLSH 4H8WL 3GEWB 4CADB 4C83A 4KKAD 1A0QL 1S7SB 1AO7D 4ZS7L 3RHWF 4CJ0A 5IWLA 3MLXH 2FYYB 2XQYK 4AQ1B 4I3SH 4A2LA 3HRZA 1VEOA 4Z7VB 4K3EH 4LSQL 4R7DA 2XXCB 2IBZY 5AD0B 1MJJA 1JHKL 2G60H 1I8KA 1JHTA 2XKUA 2Z35B 3C08H 4OFDA 3DXAA 3RVTD 1W0WB 3WJLA 4WV1A 3TBWB 4NQCE 5FV1L 1HHJA 3Q5YA 1ZLVK 4UUJA 1FO0H 2ESVA 5DQ9A 1A6WH 1KJ2B 3GJEB 3N9GL 3WS3A 3T0XA 1DUYA 3L3KB 3UPRA 3MJ9L 2CDEA 4H0IA 4HGKC 3L5WB 4XPAL 4JG1H 1YYLH 3VFVB 32C2B 2MFNA 5MENE 4Y2DD 1ORSB 2H8PB 1MLBB 1S78D 1BP3B 2ZCHL 5EU5B 1BOGB 3PP3H 1SY6L 1SYVB 5JXEC 4JB9H 1BD2E 4U6HB 4U05A 5IF0B 4UT9L 4ZUUB 1GIGL 4QTIL 1IGYB 2H2SC 2YWZA 4RGND 2A9NH 4Y19E 3O41A 3TN0C 5CZVH 2YPLA 1LP9F 2VMFA 4JZOA 3HR6A 3QDMA 2AQ2A 1JTOA 2J5LC 3KPPB 3S5LB 4M5YH 4LHUB 4EQ2A 3KPTA 4PJDE 5F9WC 1JGDA 1MCJA 1T04B 1H8NA 5C0JA 3C9NB 3VG0L 5D6CA 2DJUA 1UM4L 3HZYB 5DT1H 1UM6H 4XWGH 1KJVA 3ZL4H 3UTSD 5HYEA 2G5RA 5HDBE 1QFUL 3W2DL 4MD5B 4E42A 5C0CD 1KFAL 4CW1A 1KPVB 3LHPL 2J12B 3RZCC 4FA8A 3KPMA 3T0ED 3MA7B 4HH8A 4NUGL 3T2NH 1WIOA 2BRQA 3SDAC 4AEHH 4M7KH 5TF1H 3BE1L 5TE6L 1BECA 1DE4B 3ZT5A 4DGVL 3SKJH 3EJYD 3PDOB 1UJ3B 3Q6FB 3RP1A 5IQ9A 2R1XB 1ZAGA 4TVPD 3BO8A 3QQNA 5HGHB 4OFYA 4QHMA 5EBWA 3D25A 3QPXH 4HBQA 1G0XA 1UEYA 4KHTL 3V6ZB 4F7MB 4L3CA 5D1XB 1K4DB 4M93B 3P0VL 1A22B 1KC5H 4NRXB 1E4KC 3RAJL 3CVHA 5IK3A 4GFTB 3NPZB 5IGXH 1XR8A 1EHAA 5L6YH 4O9HH 4MNQA 4D9RD 4LCUB 4N0UE 3HE6B 3AXLB 2IANE 4WDIB 3UTTA 3ZKSD 2NX5B 1JZ6A 5E2VH 1CU4L 1JZ7A 3MRCA 3OKKB 5J6HB 2ADJB 3VXMD 4P2YA 2COQA 4XVUC 4I18C 5GGTH 4K9EL 4RRPA 4FTVE 2BOCA 4L4TE 4X4YA 5L8JB 2LV4A 4A6YH 3QI9D 4BFEA 3GHBH 4HUVB 3CX5J 2VLRE 1VGEH 3GSWA 4OJFL 5HGGS 4KRLB 3W5MA 1EHLL 3CZJA 1PEWA 4JKWA 4WHDA