3EGSB

Crystal structure of the hiv-1 broadly neutralizing antibody 2f5 in complex with the gp41 scrambledfp-mper scrhyb3k construct gigafgllgflaagskk-ahx-k656neqelleldkwaslwn671 soaked in ammonium sulfate
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
232
structure length
216
Chain Sequence
RITLKESGPPLVKPTQTLTLTCSFSGFSLSDFGVGVGWIRQPPGKALEWLAIIYSDDDKRYSPSLNTRLTITKDTSKNQVVLVMTRVSPVDTATYFCAHRRGPTGPVNAMDVWGQGITVTISSTSTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2F5 Fab' light chain
publication title Structural constraints imposed by the conserved fusion peptide on the HIV-1 gp41 epitope recognized by the broadly neutralizing antibody 2F5.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 216
sequence length 232
ec nomenclature
pdb deposition date 2008-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3egsB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3egsB01
1U3YA 5FF6B 1I1FA 1OAUH 2AXJA 3ZE2F 1BD2D 1F3JA 2O5YL 3NACL 3S88L 1ND0B 4EQ2A 1P2CB 3LB6C 3EDJA 4PG2C 4WI5A 5FA4B 1HZHH 1RK0A 2VRAA 1GAFH 2APBA 2HFTA 3SKUD 3MLXH 3BP5A 5HY9B 4PJXE 3LS4H 1A6UH 4F3FA 2FSEB 2VITB 3M1BA 2ARJB 1CBVL 5DD1L 4TNWF 3G9AB 4PJAE 3ARBA 2VL4A 3JTTA 4R96B 2CO6B 4LHUD 4GRWH 2PXYB 2R29H 1Z5LB 3OHXA 4NN5B 4Y4FB 5IMKB 4U1SA 4GUPA 4JRXE 4PGJA 4X8XA 2XA8H 5I1CH 4K3GA 1U8QB 1G6RH 1GGYA 3EZJB 3FQNB 4PY8I 4O4YL 4DN3H 4L8CA 2Y07L 4G7YH 3GSNB 3KJ6L 1JHKL 1F3DJ 4EQ3A 1YPZE 1LMKA 4RAHA 1CXFA 3SE3A 3VH8G 4LP5A 4S2SA 5H2BB 4JM2C 4KKLD 2OJZH 1IEBB 2D0FA 3IDYB 1RVFH 1UZ8A 3RWFA 5FUOH 5FGRA 3MJ7A 4Z7OF 3IETA 5EUOE 3TO4C 3M17B 3OAZK 2ZG1A 3KJ4B 1P84J 4GRMB 2AABH 4JJ5B 2P5WB 3DX6A 1DVFD 1L6XA 3O3AB 3B9KA 3CLEH 5C0AB 4FZEH 1QRKA 2AJYL 3U7AA 4H5SA 4HKJB 3PNWA 1JGDA 5IF0A 3SJVB 1J0HA 2FCBA 2P47B 2C4FT 2ITCB 1YYLL 3HC4L 5J7CC 1J05B 3TBSA 4J4PC 4F57H 3EW3B 2X4QA 3ARGD 1G7QB 1G9ML 2ICWJ 3MV9B 3PWPD 2CLZA 2BZDA 1AIFA 4KI5F 1RK1A 1IGIH 2KUTA 3DMMD 1M7IB 3LVEA 2PTVA 4PJDF 3LKQA 3EHBD 4KHTL 1A3QA 4NUGH 2J8UF 2Z8VC 4WI8A 1B0RB 1Q9WA 4YHYC 4OCXH 4GAJL 4MXVF 1J8HD 4Z7WF 1QBLL 3FO0L 3O8XC 3WD5H 3EGSA 4Y19D 1RZKC 4G6AC 1IKFL 4FFWC 4QHKI 2QHRL 1IGYA 4D9RE 4JVUA 3HZVB 5E56A 2WANA 1WZMA 5DMYA 4UT6H 2XZCH 2DQJH 1RJZA 3LH2H 5DZNA 1UM5H 2UYLB 1IC4L 1ZT7B 1C1EL 5E7BA 5FF6A 1JNHB 1KGCD 2P8MB 4JB9L 1MJ8H 3GJFB 5I74B 4FTVE 3X3GL 1ND0A 4JR9L 1P2CA 2GIYA 3QNYB 3JV0A 5HY9A 4R7DB 5KSBE 2BDNH 3FT2B 1SYSA 4LPVA 2FSEA 2OL3L 2ARJA 1HIMH 3BSZL 5DJ6B 2HKHL 2ITDB 5ABDE 3VGAC 3CMOL 2PXYA 4GLRI 1Z5LA 5ICYB 4XVUD 4PREB 2J8UB 4Y4FA 1OVZA 5IMKA 1TVDA 5HYQB 5E5MB 5FHAL 3S3JA 4JM4L 4Z7WB 4ISVA 3LKRB 3QEQE 5E1AB 4ONFH 1JF6A 1V3JA 4YXKH 2VZTA 2VR4A 1HSAB 2A6JB 2X40A 1T66C 1UEYA 1CXIA 3GSNA 2OX5A 5C86A 4OI8A 2ZCHH 1OSPH 2NX5E 5T5NG 3AY4C 1S7TB 1AJ7L 5DURD 5H2BA 5T33H 2A6DA 5HI3D 2WP3O 1IEBA 2XWBB 4J23A 4YBQD 3K2MC 3MBXH 3QDGB 4RMRA 1OL0A 1WF5A 2B1AL 4HS6A 3M17A 1NGZA 1X5YA 5IVNA 1AD0B 1R3IH 3F7QA 4NQCE 4KY1H 2HFFA 4GRMA 4JJ5A 3R8QA 2AEQL 2P5WA 1KLUB 3O3AA 1D7FA 1KELH 3VXUB 2P8LB 5FUCC 1XCQB 5C0AA 1F4AA 5L2JB 2IAMC 2C1PB 5C6PB 3CVIL 3QI9C 4QOKE 3SJVA 4N8VB 5E6YA 3GO1H 4OUUB 2ITCA 4IMKC 4HDIA 1EX0A 4U6VL 2D7QA 3RKDC 3TT1H 1PSKH 3F12B 4QRPD 1G7QA 1I7TB 3JV6A 3MV9A 3ES6A 2MSPA 3MSPA 1HDMB 2QJDA 5KVGH 5EC2B 1G7PA 2MCPH 1M7IA 1BREA 1C16B 4Z0BH 5C0EB 4MJ4A 4X0KB 5IMOB 5CD5D 4G42B 3W0WD 2DWDA 2J6EL 3MRFB 4QGYA 1B0RA 4OCNC 4KWUA 3EYQC 3GI8H 5AYUH 2W0FA 3FFCD 4NCC2 5GGVL 1RIHL 3L3OB 1LO2H 3R0NA 3HZVA 3LEVL 4JRWA 1YQVL 4RGOL 4P2OB 1FGNL 3ESUF 5DF0A 3SGKA 4GRLD 4JO4H 4E0RB 4GG6E 2UYLA 4GS7C 1ZT7A 2DLHA 5L8KB 4YE4L 2ID5A 1F4WH 2GYSA 1TIUA 1DN0B 3SQBA 5FYKU 1JNHA 4S1SL 2Y72A 5GGQH 3GJFA 1REIA 4Y8AA 1QR4A 4MVBD 2DLTA 1NMBH 3MRHB 5D93B 1NAMH 3QNYA 2D4DA 2K9UA 3WUZA 1KTLA 4JREC 4NKOB 4R4BB 3FT2A 3ZHKA 4UUJB 2CKNA 2YD4A 5F1IB 5FM4A 3KYAA 5DJ6A 2ITDA 1IM3B 1U91B 3H9ZA 2VAJA 4PJ5E 3SDYL 5ICYA 1M1SA 2UWEF 4PREA 2XTLA 2J8UA 3S37X 5HPMB 3ZKMC 5BMFL 5E5MA 5HYQA 1YEJL 4MA1C 1TJHL 4PS4L 3LKRA 5E1AA 1A0QL 4D3CH 3ZT5A 2OTUB 1Z3GL 4K3HA 3QAZB 4R4ND 3G6JF 4AEIL 5IG7B 1A6TB 4PUBH 4AEHL 1VDGA 5I76B 2IANA 2B4CL 1QQDB 2P8PA 3AB0B 4JN2B 2NY3D 1CICC 2CD0A 1K3IA 4MJIE 5D2LF 5CZKA 2DKUA 4KKBD 4XVJH 1AD0A 3VXMA 4KUCD 4YK4C 5JOFB 5I1KH 1NDGA 2YZ1A 1KLUA 3AS0A 3IDIB 3M8OH 5L2JA 1IC5H 4OB5H 4YJZL 4QRSA 4FQXD 5FCSH 3QQ9D 4Y5YB 4JRXD 1TPXB 2Z8SA 4NO3A 3NIGF 4OUUA 3DROB 1OOAA 1NC4B 4WFFE 1GHFH 4JFDA 1ZLVK 3GRWL 5MEOB 2N1KA 3F12A 1F3DH 3HNTH 2VOTA 1I7TA 3O2DA 1XFPA 1JPGB 4GBXD 1HDMA 1WCBB 3OKKB 3ZZ1A 1ZGLB 1QFOA 1Q9OB 5EC2A 3TZVC 2AK1L 4M7JH 1C16A 2X44D 1A9EB 2WZPD 5ALCL 5C0EA 4GT7A 3G6JB 4X0KA 5IMOA 3T2NL 5ILTL 5D7JD 3JUYA 4OSUH 4EVNB 1PG7X 4M6OH 1KXTB 4M1CC 3NVQA 3L3OA 4UQ3B 5BXFA 1A7OL 2VDOL 2X4RB 3LN9A 2VLKA 2A38A 4XP9H 4NQDD 1LO3H 1M4KA 3OAYH 3G9VA 3DVFA 4DEPB 1XEDA 4P2OA 4WNQB 4HQQL 3LDBC 3UC0H 4G8IA 3KYKH 3CSYB 3U1SL 3PDDA 5E00B 1G9NL 4P3WA 1BHGA 4KV5E 1ZTXL 2EXYD 2CPCA 4YX2L 3UYRL 1DN0A 4LLMB 4MAUL 4QWWC 2AXFB 3GK8L 5SX4I 2ORBH 1D5IH 1DBKH 3UTPD 1LO5B 3JV5A 1QACA 2FIKB 1ZGLP 3MRHA 5T1LB 2MKWA 1U6AH 4ODTL 4NKOA 2CQVA 1U2CA 4R4BA 4WWID 5C0BB 4UUJA 4RGMC 5D70H 5F1IA 3OXRA 5CILH 5L0QB 1UJ3C 1Q0XH 4LEOB 1IM3A 1U91A 4H20H 3SKNB 5B8CB 3DX7B 5JA8B 4HJGB 4EJ1C 5D1QC 4I3SL 2RB8A 2HT2D 3RP1A 2EC8A 2ZWLT 5F71A 4JDTL 4OZ4A 2AS5M 1F90L 3D2UB 1TETH 2OTUA 5EWIL 1C5BH 3G08A 3R1GH 5DGRA 4W6XB 5IG7A 1A6TA 2C3GA 2WUBL 5I76A 4RBPK 5CMAB 1QQDA 4JPKL 3C5JB 3MXVH 4PJEF 4FTVD 1MCCA 5D7LE 3RWHB 4XWOD 1JGVL 4JN2A 1FZMB 1X6LA 4JO2H 3IFLL 2V7HB 2EDNA 3C8HA 5D72L 1MFNA 1NEZG 3RDTD 2VNCA 1I9IH 5GS0D 5JOFA 2GAZB 3IU4L 1A1NB 4CU8A 2DTMH 3IDIA 3QIWA 4XP5H 5HHOE 3HAEB 1EMTL 1I1CA 2KL6A 4Y5YA 3FQWB 3KYOB 3CUPB 2F54E 4ERSH 1HKFA 4PBWD 5F9WC 3DROA 1NC4A 3QEQD 4U6TA 1P53A 2GUOB 5MEOA 3QDJB 3CSPA 2IPTH 4OD1L 3ARFC 1ZGLM 5TPWL 1JPGA 1WCBA 5E7FA 2VWEC 4D9QD 1W0YT 2YN5A 4Z7UF 1I9JH 1ZGLA 4LPCA 1Q9OA 8FABB 2VR5A 1A9EA 4DCQB 5J11C 3K7UA 4OF7A 5EO1A 4FABL 4CN4A 1PZ5A 3FCTB 2VSDA 4UDTB 3PHOB 2DKSA 5ERWB 4WHTB 5EC1B 1CIUA 4PJBE 4LNVA 3V4UL 4EVNA 1CFSB 4OD3L 4NQCD 3N1PC 4PJEB 4OM0L 2VDQL 5IW1B 1INQB 3HUJF 3LSOB 1UM6H 3BE1L 4LSDA 3IAQA 4UQ3A 5JOPE 1UCBH 5D8JL 3QHFH 4QOKD 3SGJC 5D7SL 1OQOA 1IVLA 1UWXK 3A6CL 4O5LL 3CSYA 3U6RB 4K2UH 5E00A 3OKNA 3D18B 1R5IB 4LLMA 2AXFA 1KB9J 2ED7A 4YBHA 2DQTH 4CVUA 2IF7A 1LO5A 5EZJB 1RZIB 2XQBH 2FIKA 3MCLH 1JNLL 1WEJL 5T1LA 3B6SB 2L0DA 4G6JL 1BZ7B 5A2KH 2OJEA 4HJ0D 5FGBC 5C0BA 5EUKA 1YECL 2W91A 5GJTH 5I1GH 4IRJB 3QG7H 4Z7UB 4Y4KB 1H5BB 4ORGB 4J3TA 3V0WL 2F19L 4OFYA 3SKNA 5EZOH 3T0ED 2YD2A 2YZ8A 5B8CA 4HJGA 3WHE0 1LNUB 4O2CB 4OGXH 4V2BA 2XACC 1MLBB 4XI5C 3L5WB 1U2HA 4IJ3B 3IFPB 1IKNA 4OIBA 3HUJB 3D2UA 4OD2B 3RIFF 4KJQD 3F6IA 2X4UA 4MDIB 4I5BB 4PRBB 3PDGA 1ONQB 5CMAA 5I6XC 3C5JA 3GZKA 3LY6A 5K9JH 3SGEI 1FZMA 2WUCL 5F7EL 4GAGL 4P5KB 3BKYL 1SM3L 2V7HA 3K3QA 5KS9A 1ZVYA 5C08E 5E8NB 3GBNL 4R7NB 1AQDB 2GAZA 1WAAF 4H0HB 1YNLH 1A1NA 1EAPB 5F6HI 2CO7B 4X8JA 1A6PA 1KYOK 3TLRA 4WWKA 5D1ZD 4DKEL 3PJSB 3FQWA 1AR2A 1F4XL 2V7NB 1MFCL 4LPWA 1RFDH 1SEQH 2GUOA 1BJMA 2CXGA 4PJ7E 2WK2A 4UB0L 3TN0B 3QDJA 5JXAL 4LU5L 1YY8B 4CGTA 5JLZB 1B2WL 1N8ZB 4LVHC 1UZ6E 2EDJA 1XGQB 4K23H 2HMIC 4M9OA 8FABA 3QUMB 4DCQA 2EDYA 3FCTA 4XCFH 5I8CB 3DV6A 3PHOA 5GRXG 5ERWA 4WHTA 5IB4B 3DVGB 5EC1A 5EU6D 4OZFB 1CFSA 2GKIA 2PO6C 1KOAA 5KVDL 4APQB 3KPTA 3NA4A 3LSOA 3L5XL 3RVXC 3ZE2E 3TBVB 4F15B 4WIQA 3PABB 2NY7H 2Y9RT 3UJJH 1MFEH 4AEEA 3DO3A 3GSQB 2HRPL 1NCCL 5ETUB 1NCDL 4WFFD 4EOWH 1A64A 1CYGA 1ZA6A 2RJMA 4HWBL 2GEEA 1HXMB 3U6RA 1S78C 5GXBB 3D18A 3RI5F 1R5IA 5FA3B 1HEZA 1IC7L 4L4VE 3BT2L 3O6MH 1TLKA 4NKMB 5EZJA 3DO7B 1FO0B 1RZIA 1U8MB 1JMXA 2ED8A 3B6SA 1BZ7A 1MWAL 1DSFH 1I3UA 3BPNC 4Z8FH 2ZPKH 5I0ZA 5E24E 3I02B 4IRJA 2I07B 3LMJL 1VFUA 3WXVH 1ZHKB 4Y4KA 1B0WA 4JFZH 1KEGH 1H5BA 4ORGA 1KCVL 2BNRB 3MYZA 5F9OL 1MFBH 2HKFH 5KTEH 4HUVB 1LNUA 4O2CA 2WWKO 2H3NB 3TP4A 1CFVL 3SOBH 1MLBA 4WI7A 3L5WA 2X4SA 3BMVA 5I75C 4OD2A 4KXZI 4O00A 5C0CA 4MDIA 1HXYB 1S7XB 4I5BA 1RSFA 2WMPA 3WS3B 1ONQA 2V9QA 3QCUL 4ODXB 3P30L 1UXSB 1TJIL 1JWUB 1LEKB 5SWQB 4P5KA 1A7RH 4JZJC 5EOTB 1YC7A 5MEQB 5MP6H 4LVNC 4EDWL 1E6JL 4PGEA 1TQCB 5E8NA 3ZL4H 1E4XL 4R7NA 1AQDA 4ZXBB 1KIQB 2IC2A 3BFOA 4KGLA 4KI5E 2OR9L 5C0FB 3VE0B 1NUGA 3F7PC 2AEPL 4PJDE 3PJSA 2CR3A 2DM4A 4PBVC 2V7NA 1MHEB 1BVLB 1B4JH 4RIRB 3RAJL 2J8UE 5A2FA 3U2SB 4C58B 3L5IA 4YR6A 3O2DL 1AGBB 4MXVE 3TN0A 2R1YA 2BNQB 4Z7WE 2IQ9H 3WFBL 4X7CC 1QNZL 1N8ZA 4L3CB 2J4WH 1WIUA 4P59H 5AWNH 2FB4L 1X9QA 4F7CA 5D7LD 1MAKA 2VXSL 3P4MB 3QUYB 3UBXG 4QXWA 4TSAL 4AENA 5I8CA 3JWOL 1TNNA 3HR6A 3DLQR 3DVGA 3QDGE 4MQTB 5LWYH 1HHHB 4XNUH 2WLZA 4AIXA 4APQA 1AC6A 5I19H 4JO1L 2BVYA 5CEZE 5IEKB 4LHUG 3QPXL 3GSRA 3TBVA 4CW1A 5LJYH 3DTXB 2ZOKB 3EYVA 3PABA 4KKLC 5E2TH 5HHNB 5KVEL 1YEGH 3ARBD 1FSKB 3L3JB 3VXUE 3NZHH 2F54D 5HBBA 3GSQA 4F8TA 1MCFA 3QBTB 4PRIA 5ETUA 4HAFA 1S5HB 3TNNB 1HXMA 1K8DB 2WLYA 4OLZL 4JG1L 4D9LH 1D5BB 4MS8C 2F5AH 4OQTH 1WFTA 1DVFC 5L88L 4RGNE 4AM0B 3DO7A 3QXUA 3OKDB 4NKMA 3OB0K 2H9GB 2QLVB 1U8MA 5BOPA 2AK4B 1A9BA 5CZVL 1T1YB 4OLYL 3W11C 1H8NA 5GJSL 1UADC 2I07A 1ZHKA 4MD4B 3VFWB 4HT1H 4FQLH 1PQZB 2BNRA 4X6DA 3MGAA 2R0WH 2AXGB 4WEUD 4ZMAT 3F6LA 3RVVD 2H3NA 3TGXA 4OI9A 1XIWD 5T1DH 3BZEB 4X6CB 5L7XH 1WUNT 1AP2B 1HXYA 1S7XA 2Z31B 4P5MB 4OLVH 3WS3A 5MHSD 4CVWA 2BY1A 2ZCLH 2MCG1 4ODXA 3CDCA 3O6LH 3EYUL 1UXSA 4ELMF 3FB6B 3QXWA 4YPJA 5CJBA 1HE7A 1JWUA 1LEKA 5SWQA 4Q9RH 5E1HB 4U1MB 5EOTA 4IS6A 5MEQA 4KKAD 5HHXH 1J1PL 3RGVA 2MWCA 4UTBH 4ZXBA 1KIQA 1KG0B 3ZE0F 5E4EB 4R97B 2APVA 5GRVL 4OV5B 1WLHA 5DT1H 5C0FA 1CCZA 3EIFA 2AW2A 1P6FA 4RA3A 4XAWL 2XKNA 5DLML 1MHEA 3TA3C 2DQCL 5F44A 1KEML 3U2SA 4RIRA 4Y2DD 2UZIL 1AGBA 2EDLA 5HD8D 3G5ZB 4UU9B 2BNQA 1TQBC 2EIEA 2NY1B 1NFIB 5BS0B 2VLJB 4L3CA 3WSQH 1L0YA 1MFAH 1MEXH 3UJIH 4XVUC 2C5DC 4I0PB 4J3WA 4QY8B 1S7VB 3QUYA 5IFJB 3S37H 1KC5H 5FYLL 2C3WA 4JAMA 2P43B 2L7UA 1JF5A 3HI6H 1HHHA 2YD9A 4A6YB 4EI5B 4WO4C 3N9GL 1LO4L 3DVIA 1NGQL 5IEKA 1NANI 5DD3H 2ATPB 3H9SE 1WTGT 3DTXA 2ZOKA 5HI3C 1PLGH 4TNVF 5HHNA 3L3JA 3PUCA 3NFNB 2PXYD 4TOYH 1TZIA 5JHDE 1LDPL 3MFGB 4OLEA 4Y4FD 4PLKD 4MNGB 3TNNA 4HG4K 3V6FB 5DHVB 1XF1A 1EHLL 1UVQB 1DQLH 1H15B 1CL7I 2QQNH 4YFLI 4HWUA 3MRGB 4MA8L 1ETZA 2AGJH 3MODH 3OKDA 2PW2B 2H9GA 2G5BA 3MRDB 5B39G 4LLDB 5DXWA 3DGGB 3OBAA 1S5IL 1MRDH 2O26U 2PTUA 5DS8B 5JDSB 2DQGH 1T1YA 3MACL 3HI1B 1DTUA 3I6LE 5FXCH 3RVUD 1X5JA 2Y25A 3G6JE 3U7YH 3VH8B 15C8H 1JHLL 4LGSB 3THML 4MD4A 5D5MF 4Z95L 5C2UB 3VFWA 3OKMB 4N1CA 1PQZA 4G8EB 2M1KA 1KJ3H 1RUPH 4U7SA 2P5WD 4MYWB 3RTQB 3HI5L 4PJCB 2AXGA 4KPHL 3TCXA 4X98B 5C0AD 3IAPA 3AREA 4E5XB 5C7XL 4ZTOH 5GRUL 2YOCA 1K2DB 3MLWL 3SJVD 4X7SL 4X6CA 2HH0H 2DYPB 2R8SL 1TITA 2YD1A 1PG7H 4DAGH 4JM2B 1AP2A 1SBSL 2HWZL 1IARB 2Z31A 4P5MA 1TVHB 3PGFL 2EC9T 1KIUA 1DBBL 4W68A 1HQ4B 2GTZB 4HH8A 4ODHH 3MV9D 3FB6A 5GS0H 5EPMB 3TO4B 1INDH 3VFNA 4R4FL 3NIGE 4WCYH 4ODWB 3VXSB 4U1MA 5CEXB 4GRLC 1Q38A 2BOBB 4JGMA 3GMQA 4PLJD 3NFPB 3QEUA 5DK0B 2G5RA 2NYYC 1KG0A 3U30B 5FK9B 2FX8L 2UUDH 3ARWA 4V1DA 3TJHC 1NPUA 1IAIM 3I9GL 4MVBC 3V6OC 3QXDB 4JG0H 4OFVA 3L7FB 3QEHA 1UCTA 2VDKL 3WKNA 4C56B 4Y5XC 3S35L 4DVRH 4YUEH 4Z76B 3FN0H 5D5MB 4DKFL 1JRHL 5FB8B 4XVSL 1QBMH 4HBQA 2IPKB 4UU9A 4DGYL 4QO1A 3T2PA 1BVKA 1NFIA 2BNUB 5BS0A 1E4KA 3T77B 3KDMB 1M7XA 5DJYB 4NRZB 5D2NB 4G6KH 4I0PA 5TH2B 1MCIA 1RIUH 4N5ED 4QY8A 1TCMA 5IFJA 1DEDA 4JLRB 1WFOA 5FYJE 3O3EA 4RRPA 4U3XA 4A6YA 1KJ2H 3UTSE 1FYTB 1W0WB 1A2YB 2DWEB 3ZKSD 2W60A 4KTYA 4KI5D 3TJEL 2ZOLB 1K4CB 4FFVD 4MLIA 4TSBH 5T1MB 4JKMA 5C3TA 2IGFH 5CWSB 3O2VH 1I8LC 2FEDD 1CD1B 1R3KB 4FHBD 4LPTA 4MNGA 4YZFF 3V6FA 5DHVA 5I2IB 2PR4L 1UVQA 1F58L 4OAWA 1H15A 1R3JB 2FO4B 4CN1A 3MRGA 1XGYH 1IGTB 4HEME 3D0VB 4KMQA 4PG2A 1ZLUK 3T65B 2YR3A 3DSNA 1NBVH 4LLDA 3VD5A 1OD9A 2IAND 4X6FB 3BEWA 1FYHB 4XT1C 1PYWB 5DS8A 1HYRC 2F9BT 5JDSA 3HE7B 3HI1A 3QDGD 1BQLH 3GSWB 2GJ6B 4I0KA 1OCWL 1YN7B 4X9HA 3VH8A 4D0CB 4XRCB 5CEZD 4J8RA 3OKMA 1DUYB 3VXMD 4PJEE 2CDGB 4JY5L 4NQEB 3RTQA 4PJCA 3VXUD 4UT9L 1CLZL 4X98A 4UINH 3CFIC 3X12A 4BQ6A 4AEFA 1JTPA 4E5XA 3QNZB 2A83B 4WHDA 5D7JC 1K2DA 5IFHL 3V4PH 5HHMB 2DYPA 5JPNA 3HNSH 4O02H 4JM2A 4N0CC 3VGDA 3I2CL 1YUHB 5EN2B 3LD8C 4KKCC 2E9IA 2A73A 1HQ4A 3L3DB 5AG9A 35C8H 1H0DB 5EPMA 3TO4A 1ZEAL 1MJUH 5CEXA 4M8QB 4K3EL 4C4KT 1MIMH 2BOBA 1QBBA 1ORQB 5C9JB 5AD0B 5DK0A 4NQSB 2IAMB 1UB6B 5FK9A 2PETA 1UA6H 4YHZH 4JKPH 4Z7UE 3QXDA 3AUVA 2EDDA 3WXWL 4UILL 4C56A 4QRUB 5HXMA 3VD7A 4JPIB 4J4PA 4N0FB 4G3YH 5FB8A 3U4BH 3BGAA 4R9HA 1OB1B 5MI0C 3NOIA 4K7PL 4P2OD 5F7DB 2IPKA 3BP4B 4KHXL 3MRIB 1MI5A 3HUJE 2BNUA 3IKKA 1NUNB 3T77A 2A74B 2DQDH 1J18A 4NRZA 5AUMB 5T3ZD 3KWWB 4UZGA 4XX1E 5D2NA 4HC1L 5TH2A 2K1MA 2Q6WB 4GRWB 2L4OA 3DYPA 4JFPA 4U05A 4FS0A 4MA7H 2DIJA 4JLRA 3PF2A 4BSWB 4NOBA 3UCRA 2ENSA 3TBWB 1NSNL 3JSSA 4MMXC 2Q20A 3O8XA 4CVZB 4YFEA 1I9EA 2DWEA 4G9FE 1HI6B 4CMMB 3SE9H 4ZS7L 3GBML 2ZOLA 1K4CA 4XWOC 5GSRB 3E8UH 5T1MA 4NSKB 3BZ4B 5DUBB 1CD1A 1R3KA 4GS7B 4GKSB 2W9EL 1FNSL 1N6QH 3RDTC 2D03H 3NPZB 5I2IA 1J1OL 4URTB 5GS0C 2VN7A 4HLZH 4NZTH 1X5AA 4HK0B 1IGTA 1YNKL 1RJLB 1R24B 5DJCB 3D0VA 3L95B 3V5KB 3T65A 4XPGL 4L3AA 4EI6A 1F97A 5HGGS 1YYML 5IT2H 4PJ8C 1NCUA 4JREB 4X6FA 5DD6B 4MB5A 3CMGA 1CDJA 6FABL 5E95B 5EZLB 3GSWA 3R4DA 4GH7B 2IMMA 3DI2B 1VKXA 4PJ9C 4XPHH 4XRCA 1DUYA 1Z6JT 3QP3A 2GJZB 4LSSH 2CDGA 2Z93B 3C8KB 4UNVA 4NQEA 5FKPA 4NNPH 3FN3A 4MA1B 4XC1H 2DI9A 2DM7A 3BKML 3QNZA 2A83A 4Q0XH 2VZSA 5HHQB 3AY4A 1BZ9A 1MELA 1NC4D 4U1JB 2PW1B 1NCNA 1WAAE 1CFQA 3IS1X 3DARA 1YUHA 3PV6B 5JW3L 3WL9B 2M8XA 2JK5B 3L3DA 4U0QB 1H0DA 3RX8A 1GCFA 1UWGH 5HHPB 5J1AB 4X4ME 2VKWA 4M8QA 2ADFH 1BFOB 3I6LD 4IDLA 1ORQA 3TBYB 5AD0A 5C9JA 4F7TA 1I8KB 4I13B 5HI4C 4NQSA 1ITCA 2IAMA 2ZSWB 1UB6A 4MA3A 3QI9A 3MRNB 3KLSA 4P3CH 5JDJA 3KPSB 3TCLB 4K94C 3ECBB 1L0XA 2BNRE 2FJHB 4LCCB 4HJ0C 4CKVX 3FB5A 1T0MB 2H6PB 1A22B 1DEEB 1DQML 3BP4A 4U6XB 2BXZA 3MRIA 3LKOB 1FVCB 2A74A 3TZVB 5AUMA 1TCRA 3KWWA 1EO8H 2AJVH 5C9KA 2Q6WA 2WINA 3DBXA 3L5JA 4KQ4H 4RNRB 3ZTNH 5T1LD 4RFOL 4KJQC 4CVZA 2ERJB 5TGBB 1HINL 3A6OA 4KJPD 1VESA 5C0BD 5DWUH 2F53B 2PCPB 2BSTB 2L7JA 4XC3H 5GSRA 4U2YA 4ALAH 3LDBB 4NSKA 4MNHB 3REVB 2X1PA 3V0AC 4OFYD 5A16B 3DGCR 1PKQB 1D5MB 2NW2B 1WFNA 2EYRA 3Q6GH 1IE5A 3D2UD 4JKKA 4N0UA 4HK0A 3LV3B 4FQJH 1RJLA 3IGAA 4O9HL 3L95A 1JNNH 4AG4L 1N4XL 2BNQE 3V5KA 3RU8L 2H8PB 3C9NA 1UQSB 5DD6A 1Q0YL 2XZQL 2GQHA 4RGMB 3FFDB 2YRZA 5EZLA 4Q6IC 2AV7A 2IBBA 1UJ3B 4YQXL 3ME0A 3NCJH 5T1KB 4FFYH 1FQ9C 4JHWH 5B3JF 2ZUXA 2NNAA 3MLUL 4JY6B 4LSTH 3FQUA 2VLME 2O61B 4GQ9L 1CZ8H 3OKEA 1NEZB 1UKQA 1X5IA 4WUKH 4OLXH 4KVNL 1DBAH 5HHQA 4PP1D 4U1JA 1FJ1B 2PW1A 5CINH 4W81A 5J9PA 4NM4L 3PV6A 1T21A 3QDJD 5ICXA 3WL9A 5DMKB 1NGWA 5TFSH 1CICA 1UACL 3RY4A 5HHPA 5J1AA 1EGJH 1FC1A 1F4HA 4YBLB 2DQEL 1BFVH 1BFOA 1Z0MA 2ADJB 3E0GA 3TBYA 2YK1H 1AQKL 1I8KA 2NR6D 2AK4E 3MV7B 2ED9A 3NGBC 3DURB 3FRUB 5DFVD 4F9LC 5DRZB 1IAIL 3DUUB 2DQUL 3N06B 2CJUL 3HNVL 1AXTL 3IVKB 1HOCB 5F9WB 3BUYB 4Q9BA 3LZFL 1D9KB 1GGCH 2FJHA 3ECBA 4LCCA 4MXQC 4QTHB 1T0MA 4OIIH 1CR9H 2H6PA 1BM3H 1QFWL 5I1IL 4PJGF 5I30L 4XNXH 4U6XA 4HPYH 2UY6A 3PP4H 5DR5H 1X4XA 3LKOA 4M5ZH 1FVCA 2VDPH 3TZVA 4M7KL 5FGCB 4EBQL 2W65B 3O0RH 5J11B 2CR6A 2R9HC 4HLZG 3CZFB 3W81A 1AR1D 1OTTD 3EJYD 4BQCA 1GZPB 3DHJA 2VDNL 5HVHC 5JW4R 5BRZE 1FZKB 5TGBA 25C8H 2XZAH 3TT3L 3ROLB 2BSTA 3E6FB 3O6KH 4IRJD 5CBAA 3B8YA 5J1SC 4FZ8L 3GKWL 1CLOL 4Y4KD 4OJFH 4LEXL 2D7TH 3REVA 1CFTB 4K07A 4WY7L 5A16A 1MY7A 4LOUD 1PKQA 2NW2A 3GSNH 4QEGA 3MV8B 3QCTL 5J6GB 1NCAH 5JQHC 3V4VH 2PKDA 2W07A 4Q9QH 3QRGH 2A1WH 5JORB 1J1XL 3VRLF 1I8IB 1OARH 3GMOA 1MF2L 5HDQL 3BPOC 1B0GB 2CKBL 5BS0E 2H8PA 2EECA 3IB4A 2VLJE 1LEIB 3U83A 3DX8A 4PJGB 5DUPH 3H6JA 3LHPL 4NWUH 3FFDA 1NDMB 3UTTB 1BOGB 3MPCA 4ONGL 1UJ3A 5IJVB 1CGWA 2FGWL 3FRPG 1ZA3B 5T1KA 1CXHA 2YC1B 3I75B 5L9DH 4YHLH 1T89C 5D1QA 4JY6A 5SV3A 4ELME 3PE9A 2O61A 1DFBH 3P9WB 1O5DT 1XF4B 1NEZA 4XB8A 2EDOA 2A2QT 4WDIB 5D6DC 1AI1H 5IBTL 4X4XA 5BJTB 1OM3L 5SX5H 4ZFOL 4JQIL 1ES0A 3ZE0E 2IH3A 3NAAH 5FV2A 4UV4H 2E27H 3TN0D 4KRNA 3EOTL 2J88L 5DMKA 1PEWA 4RFNC 5EBMB 1NMAL 2LU3A 1CU4H 4P49A 2VZ3A 1QHPA 2D3VA 1F5WA 1E4WH 5FYJU 2ZJSL 4F37K 1J86A 3L5HA 5IMLB 3DURA 4C4KO 2XN9B 5JUEH 3E3QE 1CGYA 2N7BA 5D96B 3WN5C 4APQD 5DRZA 3DUUA 4XNZB 5C09A 5A43C 2DBLH 1DQQB 2H32B 4OTXL 2EIDA 3QUZC 3SQOH 4OLWL 3O9WC 4MHHG 3MRJA 4PJCE 1WWCA 4K8RH 2DLFH 3ARFA 2HG5A 4WV1C 1FPTL 1MQKH 4LVHB 3GJFH 5GS3A 3TIEB 3SGDI 4PJIF 5KVFL 2R4SL 2AXHA 1JYWA 4J3UA 5D9SA 4DZBB 1NFKA 3RVVC 3EJZD 5E2WH 4UQ2B 1XIWC 3BZDA 1HSBB 1ZANL 1Z9LA 3ZYZA 1RUKH 2E5EA 1RZKL 2VISB 3CFCL 3BDYH 4QRRB 4RWYL 1T03H 1P7KB 3SKOA 2E6JA 5J4MA 1AHWC 3VXSE 1MPAH 5DC9B 3RWJB 2YBRB 4KRPB 2EDEA 3SGJA 1B9ZA 3E6FA 4HIXL 4YHOH 3IS0X 1TZGL 4YDKH 4TULL 1ZLSL 4MQSB 5GIRB 3FN9A 4NHCH 5TJWK 2BNRD 2EKJA 1G1CA 4MSWB 3ZDXF 3ZSSA 3LQAH 3MV8A 4KKAC 1MJ7L 4O58L 4C56E 4NP4H 1NGXB 4Q2ZB 1IGJB 1KJMB 3QIBB 4WTXA 2R56H 3BXNB 5D5ME 2GITA 2MNUA 2QHLA 5JORA 1I8IA 2O5XH 4LLQA 4NN6C 1B0GA 5EOCH 1YEIH 4G8GA 1LEIA 5CEZH 4CADA 4KDWA 5FGBA 4LCWA 5D2NE 3VFTA 5IEHB 4M6ML 4Y2DC 2FATH 3UX9B 1NDMA 5F7WC 3UTTA 1BOGA 4JPWH 5KJRH 3WFHB 5IJVA 4LKCA 4NHUB 2AJXL 1OSZB 1ZA3A 4KK9D 3U0WL 1DQJB 5TE4H 3QO1B 3RVTD 4S1RH 2YC1A 4NQXB 5EBLA 3J8F7 2JF1A 1SEBB 1FYTE 5IB1B 3N1GC 4JE4B 4ZXBD 3PP3K 3KPQB 4BQBA 1CDCA 3B2UD 5DJAB 3GSOB 2EH8H 1XF4A 2NY6B 2C1OA 3K8MA 5IR1A 5BJTA 1EK3A 3IYLW 5IOPB 1P9MC 1XGPA 3RY5A 4B53A 2ZG3A 1KCRL 2BNQD 4NNXA 1MNUL 1YZZA 2PN5A 4A2MA 2F8XC 5E5RB 5EBMA 1EJOH 2PXYC 3QPQD 4LVNB 1NBQA 1DQDH 3VXPB 4PLKC 1C7SA 3QUYD 4RFEB 4DOHB 4I3GA 3S96B 3VI3F 5C0DB 3FAXA 4RMWA 2I9TB 5IMLA 4MX7B 1OAUL 2XN9A 2GJ6E 5CSGA 2ICWA 1C12B 1L7TH 2E8YA 2IBZX 4MJ6B 1U8HB 5FOJA 1A1MB 4ETYA 2H32A 3HHRB 3PWJB 2EIBA 5D7KE 1GAFL 3MRCB 3WO4C 1BGXH 3IDYC 3MLXL 4NQEE 3VFGH 3D69B 3IJYB 1EO7A 5F88B 1Z0NA 3LS4L 1A6UL 1RIVH 1F3RB 2JCCA 1V7NH 3QDHA 2R0KL 3SDAC 4U31A 4GJTB 1KIRB 3KJ4C 3LRGA 2ATKA 1ZE3C 2ZNWA 4OLUH 4Y1AE 5AZEH 2R29L 2Q86A 1MVUB 5C92A 3GHBL 4DZBA 1LP9F 4L29B 4MQXD 4XP1H 4UQ2A 2XA8L 2FX7H 5I1CL 4PRPA 4QRRA 1G6RL 2VISA 4G8FB 4YZFE 3VRJA 1P7KA 3SGDH 1IGMH 4DN3L 3MNWB 2AK4D 4G7YL 1FV1B 5JZ7D 2YBRA 1OW0C 4X5LA 2ESVA 3MFFB 3TPKA 4OUOA 2OJZL 2EXWD 5HJ3B 1HH6B 3MA9H 3CCHB 2AEIT 4LQFL 5IESH 4NQVB 4QLRA 5FUOL 2WIIB 1EFXB 5C3LD 4GKZB 4YLQT 4MSWA 5CHNB 1HHIB 2IQAB 2EEBA 5C0RH 1Q8MA 2CGRL 1VB9A 1NGXA 4FRWA 1IGJA 1KJMA 4Q2ZA 2BSRB 4GAFB 3L3IB 3BXNA 1SY6H 3CLEL 3U46B 4FZEL 3EFDH 4P5TC 5DJ0A 5LGHH 2W9LA 2Z31D 3QA3B 5EU7E 2X4TB 1U3HC 5IEHA 3NCBB 2ZG2A 2V5YA 4DW2L 4P9HH 3S34H 5JOEA 1OSZA 5KVMC 1DQJA 1FGVL 1LP9B 4PP2B 1KN2H 4NQXA 4YHIB 3BGFB 1SEBA 4K8RC 1AY1H 2OSLB 1IGIL 3NCMA 3KPQA 4ENED 4N5EC 1C7TA 5DJAA 3GSOA 4V1DD 3LQMA 3VGEA 4IOFD 2KDGA 3T1FB 2R2EB 3C5ZB 4FMKA 4OCXL 3L3GA 5DJ8B 4JFXB 1T5XA 4KI5C 1L9NA 3KHOA 3TIDB 2LV4A 4PRAB 2NY1D 3WNLA 5BS0D 4QRQA 2VLJD 4L9LC 3NABH 4JZJA 4X7TB 2FEDC 5DZOA 4LVOC 2VXUH 3GNML 2P5EE 3VXPA 2EE9A 3MREB 2DQJL 3LH2L 4I0PD 4KQ3H 4RFEA 4LASL 1UM5L 5GRYA 4FQCH 2OM5A 3S96A 5C0DA 2X1QA 1HHKA 3O6FC 2I9TA 4TVSa 1WBYB 4MX7A 5EORH 1WSST 4ZOBA 4L4JA 5IMMB 4EI5D 1MJ8L 3LQAC 1C12A 5LCVH 1FDLH 4AQOA 4MJ6A 1U8HA 2PYEE 3UBXA 1UWEH 3PWJA 2P7TB 4FQPA 4FG6D 3MRCA 4P2RE 1CFNB 2V5SA 3IJYA 5T5FH 5I17B 4HH9B 5F88A 2BDNL 3C8DA 1O0VA 1OAYL 4RAVB 4LHUA 4NKIL 3QRFM 2FH6A 1HIML 1A5FH 1KIRA 3K74B 4MD0B 2GW5A 2NY0C 1MVUA 3OB8A 1IZKA 3AS1A 3LB6D 3OR6B 1F8TL 1LDSA 2BHUA 2X5PA 4U7KA 4WO4B 1VGKA 4ONFL 4YXKL 3ULVL 2VC2L 2FD6L 3JBG7 4RX4A 1FV1A 5CD3A 2ZCHL 1YY9C 4RGNC 3MFFA 5B39B 3QH3A 5T33L 3L1OL 2DIAA 2OTPA 4FFZH 5HJ3A 5H94B 1HH6A 3B9VA 3CCHA 3T0DA 3MBXL 1FZJB 4PY7B 2WIIA 1EFXA 5C0JA 3RTQD 4GKZA 3KPSE 4ZUSB 3OTTA 1UKTA 4N8VG 1NLDH 5TE7H 2IQAA 2H26B 3EDFA 1DVFA 4P4KC 1J87A 1R3IL 5IQ9B 4KY1L 4LK4A 5E8EB 2BSRA 2HVKA 1SYVA 3L3IA 4IRZL 2DYPD 5FYJH 3U46A 1QYGH 4JM2D 4UAOB 3IFOB 3K4AA 3QA3A 4ODSH 5BV7B 3GO1L 4M7LT 3H7BA 2Z4QB 5I8KH 3TO4D 3BW9B 2ZKHH 4P2OC 3TT1L 3VXSD 4L8BB 3BKJH 3HAEH 4NGHH 1WVZA 2GSGB 3FOLB 4IM8A 4JFYB 5IKCB 4ODUA 1U8JB 3CXDH 4YHIA 2IALB 5KVGL 4YEEA 4D0DB 2MCPL 3CX5J 3SE8L 2F53E 4Z0BL 1XF3B 1CT8A 4JN1L 2P49B 3S88H 3UJTL 4X9IA 5D93C 2R2EA 4C56D 1EXUA 1VCAA 4UIMB 3UPCA 3N1FC 3MR9A 4JFFB 3GI8L 5AYUL 5DJ8A 4JFXA 1WTLA 3F7YB 2A77H 3TO2B 3TIDA 4PRAA 3EO0B 1LO2L 5DD1H 1CBVH 4X7TA 4LDOB 3HMXH 5DRWA 3DETC 4LGPB 3GJEB 1X5HA 4JO4L 1GGUA 4OF5A 4RISH 2VERN 4S0TD 1U36A 1WBYA 4F80A 1F4WL 3QAZC 3OZ9H 2F15A 4O4YH 1PX3A 3O8XD 1S9XB 5GGQL 1FYTD 2Y07H 1RHHB 1JHKH 4G6AD 3TA3A 4FFWD 4H26B 2UVFA 1NMBL 4PRHB 4ZNEA 1NAML 2P7TA 4M7ZB 4PYGA 2DI8A 2BMKB 1BFSA 3AB0C 5JIPA 1DANT 4P4RB 3WDHA 5HYJE 5I17A 4RAVA 2LFGA 1FE8H 4KUZL 4MD0A 4KJWC 4D94A 3QO0A 4P9HC 5HHVH 1QLEH 5E9DB 3OR6A 1FFRA 4XWGH 4WO4A 1JTOA 3CFJB 5FDYA 4B7LA 1YYLH 4UOW0 4LSPH 1JE6A 3HE7D 1I3RB 1AO7A 3NTCH 1BFTA 2UV3A 2CUMA 2GJ6D 3SDCB 4D8PB 5B39A 4NO5B 5H94A 3MV7E 1G9MH 1BJ1H 5I16B 4JRYB 4WU7B 3LKPB 1RUAH 4PY7A 5D7KD 3PWLA 4CVXA 2BXYA 4NQED 4MWFA 4ZUSA 5IVXB 5HYSG 4TUOA 2GTWA 4PJAB 4XVJL 2H26A 1MHPL 4LAQH 1QD0A 4ELKB 3B5GA 5IQ9A 4MCYB 5F1SA 3VD3A 5M95B 1KNOB 4HMEA 2Z91B 1FORH 4HUWA 5I1KL 5HHMD 1FC2D 4GAJH 3M8OL 1UYWH 2Y7QB 2VWEE 1GC1L 3FO0H 3EJJX 3MLVH 1J5OH 3GMLB 2DQIH 4YIQB 4XMPH 3BKCH 2C4FU 2LAAA 1A7QH 1AGCB 2Z4QA 1R6VA 4LNRB 3BW9A 1U41A 1GHFL 3T4YA 4BZ1H 5FFLA 2AKRA 1AH1A 3ROOB 4L8BA 3ISWA 1BQSA 1VERA 4KRMB 3HNTL 4QNPF 3FOLA 4NRYB 5IKCA 3KS0J 1KV3A 2IALA 4L9DA 1C1EH 4M02A 2IAMD 1A7NL 4D0DA 4JB9H 3QI9D 3FKUS 2C3XA 2OK0H 5GRWA 2APWA 1VEPA 3DV4B 3G5YB 3FFCA 2E9BA 4UIMA 2IWGA 4M6OL 4JFFA 2V2XB 1TTUA 4YHPB 4KJPC 3F7YA 4I77L 3QUMH 3TO2A 1IGFH 2VDRL 5DI8B 1LO3L 3O3DB 5GQBA 4OZFH 3F58L 8CGTA 3GJEA 4WI3A 4Y89A 4KMTH 3UC0L 4WFED 3KYKL 4PJGE 4AT6B 1ADQH 4JM4H 5I1LB 5DC4B 3EYQD 4U33A 3S98A 3UTTE 4LRNH 3V6OA 1IFHH 2EDXA 1D5IL 1S9XA 2XIDA 2Z9TA 5LAXB 1RHHA 3STLB 1DBKL 5DMGC 1G7MB 2YA2A 4H26A 5DJ2A 1AJ7H 4PRHA 2XZZA 5DUMH 3UROR 4S1QH 1U6AL 4Z7VF 5MI0B 2BMKA 2X2YA 3H3BC 1C5CH 1SJEB 5K93A 5JA9A 2OTWB 2R1WA 5CILL 1FO0H 4LL9A 4ZDHB 2P42B 1Q0XL 2VKXA 1T04B 3H42H 2DTSA 3L3KA 4H20L 1U8KB 1KENH 4ZOEA 4OCRH 5IB5B 5E9DA 3VA6A 3CSBA 5IBLC 4PJFF 1FHGA 3C09B 4R26H 5AEAA 3BIAX 1I3RA 4U6VH 2D31B 4D8PA 2DMCA 4NO5A 1MCPL 1I8LA 3MXVL 4OZGB 3BAEH 1F45A 4FP8H 1KB5L 1GIGL 3L9RB 4N9OB 3HAEG 4PJXA 5I16A 2XN9E 3INUH 3LKPA 4WU7A 3HPJB 5KSBB 4JO2L 1FL5A 1H3GA 5IVXA 5INCB 2KH2B 4PJAA 2PTTA 2NR6C 4ELKA 3QDAA 4MCYA 3ZDYF 4OZIF 2WBWB 1QHOA 1EVTC 2DTML 4ZTPL 4XP5L 1EEQA 3ALWA 4PJ8B 5GGVH 3GMLA 4YIQA 1BLNB 1IAII 3TNMA 4ERSL 1GL4B 1AGCA 1JZ7A 4LNRA 2NX5B 4PJ9B 1YPZA 4M93B 3KLDA 4RGOH 3BHBB 3MLZH 5IW3A 4XZUB 5C2BH 4QRRE 5E6IB 1YDPB 1F4YH 3OL2A 1FFNB 2FIRT 1AR1C 1FL3B 3KXFB 1V3MA 3KPSD 3G5YA 2A6KB 2VQUA 4NFBA 4Y16B 2V2XA 2IH1B 4X99B 2XKUA 3MLRH 5IW6B 1UM6L 4Z0XB 4PB0H 1UCBL 4XB7A 5A2LH 2X9YA 1H5BC 5DI8A 3FL7A 4XAKE 1IL1B 3O3DA 3TZVD 2I9LA 3D25B 4U49A 3GBLA 4LOUC 1ITBB 3QNXB 3AVEA 4WTWA 2OR7A 2W0PA 4HUKB 1CGXA 3QFDB 4KROB 3QUXC 3B9DA 4KZDH 3OKLA 1G9MC 3MRKB 3TYFB 3QWRD 3MJ9A 4IJ3C 1TJHH 4PS4H 1NCBH 1RU9H 3FQTB 4K2UL 4AT6A 5DQJB 3NCYS 5I1LA 5K9QG 4M1CD 1A0QH 2A9NH 2ARWA 2CLVB 3WFZA 3Q1SL 3TVMC 1ZLWK 4Q9CA 5LAXA 1FIGH 2B0SL 5D7IF 1G7MA 2XQBL 1IQWH 2F53D 3MCLL 2Q8AH 3RL1B 1XT5A 5ACLA 4TTDC 1HCVA 1SJEA 3MLSL 1X5FA 2RFXB 3B5HA 5GJTL 2YRLA 1ZHLB 5I1GL 3MJGX 2VH5H 3CFDB 4L1HA 1Y18B 4LSRL 1S7QA 4ZDHA 4XX1G 1T04A 4QWWD 2GT9B 2IJ0C 1U8KA 5LG1A 3WEXB 3CGTA 2VR9A 1TZHA 3ZDZE 2PF6A 5IB5A 4BZ2L 4GG6B 1WBXB 4OGXL 3WFDL 4HIJB 3MLTB 3QWOB 3MX0A 2D31A 3F7VB 1B4RA 4DOHE 2FR4A 4LVEA 2ZUYA 5T1KD 4OZGA 3L9RA 3BESR 5K9JL 4M48L 2VDMH 3HPJA 3VCLB 5KSBA 4YNYB 4M7LL 2Z92B 4XBEH 3EDDA 4GSDL 3ULVF 2AK1H 5ALCH 3T2NH 2VZ1A 4PJ5B 3BWUC 4QTIL 5JNYB 4M5YH 1PDKA 3GSVA 4PJ8A 1QO3B 4XHJD 3WKMH 2V5RA 1DLHB 3QEQA 4F15C 1PY9A 5F8RC 1WT5C 2YPLE 2VDOH 1BLNA 4Q6IB 1RFDL 1JZ5A 1K3ZA 2NX5A 4PJ9A 2BOCB 1SEQL 3IRZA 5D71H 3PL6B 1T1ZA 3BHBA 1MIEL 1AC0A 3MCKA 4OZFG 2GK0B 2H1PL 4XZUA 3U0TA 1RZ7L 3G6AA 1YDPA 3U1SH 4AMKL 1G9NH 3MV7D 3PWVB 4AH2B 4MJIB 1FFNA 4K23L 3VFPB 3EJZC 4MAUH 3GK8H 3CH8A 3KXFA 3QEGH 1DCLA 5FCUH 4XCFL 1JIBA 3ULUE 2A6KA 3MGTB 3S35X 1D9KD 3MROB 3VI3E 1I8MB 4DWHA 1S9WA 2IH1A 4X99A 3QYCA 1DZBA 1NAKH 3ARFD 5IW6A 4Z0XA 3RWCB 5I1AB 2NY7L 2ICEB 3UJJL 3V0VB 1MFEL 2F5BH 3S4SG 3D25A 4A6YH 3MLYL 3MNVB 4QHUA 4EOWL 3RBGA 3ILPB 4XNMB 2Z8RA 3TYFA 3FQTA 5DQJA 2CLVA 3KS0H 5FYKE 3BD5A 2YS4A 3DWTA 4KH2A 2C3HA 1LP9E 2WUBH 1P4IL 5DHVH 2CMRH 2G60H 1WC7B 3EDKA 1DSFL 4I48B 5DMJB 1JGVH 2YUZA 4Z8FL 1EEZB 4NQUA 5CJXC 2ZPKL 2RFXA 4YDJB 1ZHLA 3KLAA 4U7MA 3CFDA 4KK9C 1Y18A 4P48A 1JYVA 3LRSB 3MV8D 4WI6A 5D72H 4P57B 3LEYL 3RVTC 4JFZL 3AROA 1TQCC 3C60C 4ZXBC 2GT9A 3WEXA 1KCSH 1MFBL 3B2UC 2HKFL 1OGAE 4GG6A 1WBXA 3QULA 4LMQE 5E8DL 4RMTA 1LK2B 2YPKA 3WLWC 2ZUQB 4HIJA 4EIGB 4Z77B 3KG5A 1VEOA 5DO2D 3CC5B 3QWOA 2Y5TA 4LSVH 3UTTD 2EDQA 43CAB 4DQOL 1DL7H 1T7VA 3F62A 1OTUC 4YHNB 3MBEB 2C7UB 1T1XB 5E03A 1QPPA 3QPQC 3B8SA 3Q6FA 1S9VB 1BAFH 1KF9B 3BN9C 2EEAA 2Z92A 4XI5D 2RCSH 5MP6L 4GKNB 1NGPL 3ZL4L 4PJ5A 3REWB 4LSQL 5JNYA 3V4UH 4JZNB 2J3SA 3VI4F 1QO3A 2AJSH 4XP6H 3DSFH 1DLHA 3QQ4A 2XG5A 1VPOH 3PHSA 1QRNB 4EXKA 3IDJA 5H35B 5D8JH 4Q6IA 2YWZA 1FSKC 1T80A 5CUSL 2X4NB 2FLRT 1NLBH 2BOCA 1R5WB 2BC4A 3PL6A 3KYNB 3MOBH 4BZYA 1FIEA 2GK0A 2B4CC 1MVFA 3O11A 3SCMB 2J4WL 4P59L 3ALXA 5AWNL 5F3BB 1MRFL 2B20A 2B8OT 1KPVB 4M6NH 3PWVA 3MUY1 5F7KC 4MJIA 4AH2A 4HMDA 3ZKXC 2LVEA 4HS8L 3TWCL 3VFPA 2XN9D 3OV6A 3BPCB 4JANB 3GMNB 3Q3GB 1I3VA 3FB7B 4MQ7B 5CSZB 3MGTA 1RJYA 3MROA 2VXVH 5HHOB 1FNEA 4AZ8A 1I8MA 4ZPTB 5KSUA 4K7PX 3VDAA 1YECH 2EYSB 3RWCA 5I1AA 5E2TL 1N5YH 3V0VA 5ADPL 2AP2A 2HMID 3BWAB 3NZHL 4PBXA 4R6UA 3D3VB 3ILPA 5GZOD 1RZFH 4D9LL 5HGBB 3O3UN 2E7MA 4OQTL 3WN5B 2D7MA 4QRRD 3ESVF 1QR1B 2WIMA 1NFDB 3RVXD 4JDZB 2X1OA 4BQ8A 4LLWA 1JI2A 3QUZB 5CS7A 5IHUL 1ACYH 4KRPD 3O9WB 2ESVD 3VFSB 5GS1C 1RY7B 3MNZA 2R0LH 4PJBB 1RZ8B 4YXLH 1QFUH 1WC7A 4QF1A 1CF8H 3MUGB 4I48A 4WV1B 5KSVB 1YEEL 3FHAA 1EEZA 2WUCH 3BP6B 1MREH 5F7EH 4GAGH 4DFIA 1R3HB 4M1GH 3BKYH 1SM3H 2QQKL 4BK5A 5ESAA 2HJKB 1QSFE 1S78D 3LRSA 2QL1A 4FXGB 3EO9H 4PB9H 4GG8B 4MCZB 3QIBD 4JFFE 1VA9A 4R97C 4ENEC 4OT1L 2R0WL 4XAKD 3BRGC 3PGCB 4RDQF 5IV2A 1LK2A 3RJQB 5T1DL 4DKEH 1G9NC 5C07E 3GIZH 4Z77A 1T2XA 1F4XH 1JHTA 2CRYA 1MFCH 5L7XL 2FNBA 4JFEB 2FHFA 3PQYB 4UB0H 3IXAB 3QFJB 3FMGL 5JXAH 2ZCLL 3MBEA 3O6LL 2C7UA 1VADA 1T1XA 1CI5A 2Y23A 3V6OE 4QRTB 1S9VA 2JTDA 4Q9RL 1MUJB 2QKIB 1FLTX 1CVSC 1C08B 1BQHB 3FRPA 4DGIH 1KN4L 4UTBL 3REWA 4PFEA 4AJ0A 2NY6D 4JZNA 4NN6B 4XPTH 1KPRB 3MZTA 4EI5C 2UZXB 4YGVB 3ORJA 1G7IB 4PD4K 2G2RB 4P3DA 2DKMA 5KANG 4Z5RB 4ZAKB 2ZUUA 2X4NA 5DQDH 4V2CB 2HRPH 3HFMH 5KZCB 1NCCH 1T0NB 3KYNA 5AZ2L 4Z9KB 4HWBH 3BP7B 3WSQL 2RR3A 3VMNA 1MFAL 1MEXL 1KPVA 3UJIL 4J3OC 2CSPA 3FQRB 2R0ZH 3T0AA 1IC7H 1CDBA 3BPCA 4JANA 5D6DA 5C08B 3GMNA 3WNKA 3Q3GA 1KC5L 5DEGB 3FB7A 4MQ7A 1V3KA 5CSZA 4JHAL 3FTGB 4YDVB 4ZOCA 4JRYE 3HI6L 4HPOH 4OZHF 1MWAH 1I7ZA 5HHOA 5IQ7H 4Z6AT 5K9OB 5IVXE 4ZPTA 3E3QC 4IOIB 1KULA 5DD3L 2F54A 3NCEB 4KTDL 1PLGL 1UFUA 1H9VA 5BO1H 1KCVH 4PJ7B 1OP5H 4TOYL 3RTQC 3MRBA 5F89B 1RURL 3FZUC 1CFVH 2HLFC 5HGBA 1DQLL 3B43A 3WN5A 2ZSVB 3SKMB 5BW7C 1QR1A 1NFDA 4JDZA 4RX4D 2H2PC 3QUZA 2AGJL 4PJHF 3VG0H 3O9WA 3WO4B 3VFSA 3VFMB 2DL9A 1YNTB 4JVWA 4PJBA 1RZ8A 3QCUH 3JUZA 3MUGA 1YN6B 3ULUD 3P30H 4WV1A 2DQGL 1TJIH 3SDAB 4HKXA 1A6ZB 1EFXD 1R3HA 2VLLA 1J88A 2HJLB 3KPLB 1J7VR 15C8L 4MS8D 2BERA 5K9KB 1E6JH 5F1OB 4FXGA 3W2DH 1E4XH 5CAYB 1RUPL 1XIWA 3U30C 4G6FB 1O7VA 2OR9H 4K3JH 1L9MA 3LIZH 1AHWA 3ZT7A 1ED3B 1DBJL 4RZCB 1GGTA 4LSUH 2HH0L 3W11D 4MAYC 4OF6A 4L4VB 2EDKA 1PG7L 1T3FA 4DAGL 3VD9A 5FYKD 2VXTH 3IXAA 3QFJA 5KOMC 1KIPB 5DGQA 4Z7QF 2JIXB 3WFBH 3SDXF 4ODHL 5GS0L 5B4MC 4QRTA 3FO1B 3OJMB 4F37F 3FO2B 5D2NC 2VXSH 2QKIA 1EUUA 4I0CC 1C08A 3OAZH 1RMFH 1EGJA 3QUKB 2X1WL 2A9MH 3JWOH 1JGEB 3GGWB 4P5TB 4HW6A 3C5ZD 1CE1H 3C5SB 3U4AA 1KPRA 4B5EA 1RUMH 3C2AL 2I60H 1G7IA 5ALBH 4LIQE 1WBZB 4UNTA 1U3HB 3QPXH 2G2RA 4Y2DA 1CGSH 4WUUB 4Z5RA 1NJ9B 4ZAKA 4YUEL 2DDQH 1FFOA 2O5ZH 5ANME 5GGRB 4XXCC 2ZP0T 3BDBA 1A21A 4OGYH 1QBML 1T0NA 3MQIA 1FVEB 4Y4HC 2IG2H 5AAWA 4BFIB 1KFAH 3BP7A 5JW4Q 4OLZH 3O41B 2OP4L 1A6VH 3LCYA 4JG1H 3OGCB 3CK0L 3K46A 4ESKA 2ZUSA 2BHYA 4RMSA 3FQRA 3U9PL 4DZ8B 1V05A 4G6KL 4ZYKB 5HVGB 3UYPA 5JHLH 2M2DA 5L88H 5BZDB 5FA4A 5C08A 4HFUL 4HGKC 1K6QL 1GGBL 5DEGA 4OZGE 5E2UH 4PRDB 3TA3D 4YDVA 4FN0A 5A3ID 1P9MA 5JR1L 1G7LB 1KJ2L 4KVCL 1H3WM 2VITA 3HE7C 3QCVH 5CZVH 4OLYH 4X5WB 1ZT1B 4IOIA 3S5LB 5DRXB 4PJDB 3VXRB 4L9LB 4R96A 4AL8H 4ODVH 5I1EH 3FONB 4LVOB 3HPLB 3S36H 1EZVX 4TSBL 2OZ4H 4UI2A 2LE9A 2IGFL 4PJ7A 4AQ1B 5GRVK 3F7RA 4Z7VE 1JVKA 2DAVA 2C26A 2FZ3B 3MGOB 4N0YH 5F89A 1U8QA 3FQXB 3O6FB 3FQNA 1MSPA 4NCDA 5FM8A 2ZSVA 4WO4D 3SKMA 1DUZB 2X70B 2ILLA 5IROC 1IMHC 1J0ZA 4NC0B 1KUMA 1M6OB 1AO7D 3VFUB 3VFMA 5DDHB 4RMUA 4J3VA 3IDUA 2P44B 3ARPA 4PJFE 1CL7L 4JJHA 3SDAA 1A6ZA 3KXFE 1VACB 2W9DH 1RULL 1UH3A 3IJHB 3UP1A 3CVHL 2NY0B 1JWMB 5K9KA 2P4AB 3WUWB 2YUXA 3AGVA 1BBDL 4CAGA 5BVJB 1WWAX 4HKJA 2HJFB 4UINL 2WSKA 2QR0B 1A14L 1J05A 3RJDA 5I9QB 3GIVB 3I3BA 4RZCA 4XAWH 3V4PL 2ENYA 1OW0A 4L4VA 4RGNB 3ZDYE 2DQCH 3HNSL 4XGZB 1K9TA 1KEMH 3O3BB 3X3FH 4NO0B 3VWKC 2UZIH 3X14B 1KIPA 2JIXA 1JCKA 5EU7C 2GCYB 3FO1A 2FL5B 3H9YA 3FO2A 4HZLB 1MJUL 3R0MA 4P4KB 1YMME 3B3IB 1MIML 4YDIH 2FJFB 3QUKA 1XF2B 4I18C 3WHXB 3AU1B 4JQXC 2DF3A 3GGWA 4P5TA 1FH5H 3T0XA 4JFFD 5L8LB 2ICWI 4JKPL 4YHZL 4YEFA 4WW2F 1WBZA 3U7WL 1U3HA 4F58H 2Q7NA 4WUUA 3CAFA 1NJ9A 1OAKL 1G9EA 5GGRA 4XXDB 5FO7B 2P1YA 3AMKA 1FVEA 4CMHB 1Y6NR 4QYOB 2NYYD 1AD9B 4BFIA 3CFKB 3O41A 2LABA 2P8MA 3OGCA 4LQ1A 3TJHD 1JNJA 4DZ8A 5CIPB 3QDME 4ZYKA 1IEHA 5KG9B 5BZDA 1A8JH 2AVGA 4OBRA 3CLFL 2ADGB 3KPRB 4PRDA 4PRHD 4R7DA 1G7LA 1L6ZA 1S5IH 5ISZB 1JPTH 4NZRL 5IB2B 4YXHL 4X5WA 1JN6B 2WWKT 5DRXA 4PJDA 3VXRA 4L9LA 4WVRA 1MCWM 3THMH 3HPLA 4Z95H 2RGSA 1T2QL 1BJ8A 2APFA 1KT2B 3WNMA 3RGHA 4LRIC 4Z7WA 2F58H 2QQLL 4KPHH 3FQXA 3O6FA 5DMIH 1MFDH 5IGXL 5E9DD 4KK6D 1HSAA 2A6JA 1LO0H 1C5DB 2JJSC 1G0YR 2A0LD 4XPAH 3VW3H 4NZTL 4PTUB 1DUZA 3GEWB 2X70A 2R8SH 1S7TA 4U1GB 3MUZ1 1MJJB 3T0BA 2XWBA 3VFUA 2HWZH 1SBSH 4A2LA 4C59B 2BY2A 4CRPA 3OGOE 5DDHA 3SDCD 3D9AL 2APTA 5IT2L 3JWOC 1S7UB 3QDGA 1FG9C 1TVBB 2GK2A 2W59A 3QIUB 4ZD3H 4JRYD 4BM7A 2XY2A 3U79A 1VACA 3H9SB 3I50L 3IJHA 4L3EB 5ICZB 1XGTB 5I66B 4WEMB 4P2QB 1J9CT 3VXUA 3HR5B 2P8LA 3CFBB 1XCQA 3CU7A 3H9HB 1KYOJ 5JHDB 4NNPL 2C1PA 3DECA 2FX8H 2EDTA 2HJFA 3P11H 4MXWH 4XC1L 5HYSB 4N8VA 4BUHA 3CXHK 4Q0XL 2CH8A 4R3SB 3ULVE 2VDKH 3LPFA 5IM7B 4LCCC 4L8SC 3GFUA 1QFPA 3H0TB 4JFQB 1SMAA 3O3BA 4LLVB 2UWEB 4NO0A 1R0AH 4G5ZH 1QEWB 3NH7H 4BK4A 5E8OB 2EC9U 3X14A 4F7PB 1IGCH 1A4JB 1JFQH 4NC1E 3ELAT 2GCYA 1EO5A 3SE4C 4HZLA 4P4KA 1EDQA 5E08H 3PHQB 3B3IA 1J8KA 4G42A 2ADFL 3MRFA 1XF2A 3RUGF 3WHXA 3AU1A 3GMRB 4QHMB 1ZV5A 5GGSY 1XGRB 3WIIL 5ID1B 3BGMB 4N0CD 2ERJC 1FFPB 2HN7B 4P3CL 4KKCD 4KUCF 5D2LB 4K3DH 3UBXI 2YA0A 1SHMA 3P0VL 1ZLVH 1QKZH 1CLYL 1KPUB 4XXDA 5FO7A 4E0RA 3W9EB 4JFOB 3SY0B 1AD9A 4UDUB 3CFKA 2H32H 2PR4H 2FGZA 1EO8L 4G43B 2AJVL 2KQMA 3UZVB 1JBJA 1UJTA 5KG9A 3C08H 4XP4H 2ADGA 3KPRA 4E41E 4QGTA 4KQ4L 5CGYC 4UV7H 5EUOF 4P46B 5GISH 1W72B 5IB3B 1N3NB 1Y6MR 1Q1JH 1X5ZA 4D9RD 4OI7A 3RUGB 4ALAL 5HPMA 3NA9H 3OKYA 3RHWK 2NY3B 1E0OB 1QRNE 5K33A 1J0JA 5BQ7B 3KGRA 3ARRA 1OWRM 1ZWIB 4PTUA 3P73B 5LKNA 4FQJL 5D4QA 4XHJC 1MJJA 3R8BB 1SY6A 3KPMB 2VE6B 3I2CH 2MTPA 4OF8A 2J5LB 3UTSB 1TVBA 5E6ZA 2W1NA 1R3LB 5HGDB 1N64H 1ZEAH 5HTSA 4JO3L 4YBLC 7FABH 4RMVA 4HUNB 3H9SA 5B22A 4EDXB 4K3EH 1T22B 1GYAA 1XGTA 4FFYL 5I66A 4P2QA 1AE6H 4AK1A 3HR5A 4S10A 3CFBA 5B38G 4U1KB 4LSTL 5JHDA 1SVCP 2BJML 5HYSA 4PJ8D 1CZ8L 3LOWA 2D9CA 2FBJH 4R3SA 1J10A 4WUKL 1QLRB 3NCYP 1DBAL 4NYLB 4NO2B 1D9KC 4BJLA 3H8NA 4EN3C 2EIZB 4JFQA 3D3VE 4LLVA 2UWEA 2V2WB 2NX5D 4PJ9D 3VFVB 5CINL 4X4YB 5E8OA 3IT8D 5EO9B 4HLJA 3OKKA 4K7PH 2MHAB 3VI4E 4F7PA 4KHXH 3WJLA 1ZVSB 5TFSL 3CD4A 1NFDE 1TNMA 4WW1B 4BFGA 2YPVH 1EGJL 1U42A 2HLAB 1T6VN 1VFOA 3G6JA 1BFVL 3PHQA 4HC1H 3KXFD 3TC9A 3IKCB 4HV8B 5HYIA 2YK1L 3MUJA 3GMRA 4QHMA 1XGRA 1T7ZA 5ID1A 3RPIB 4P2YA 3BGMA 1FFPA 4Y16D 2X4RA 2HN7A 3OX8B 5D2LA 1I9RH 2NY5L 2R2BB 4OF3A 5GGSB 5CJQL 2Y1VA 1AGFB 5C6TL 1GGCL 2WBJB 4WNQA 2DM3A 2HFGH 1CR9L 5JMOC 1KPUA 1N0XL 1BM3L 4IIQC 4M43L 3VFOB 4JFOA 3SY0A 1L7IL 5HI4D 2W9EH 3B2VH 1FNSH 3PP4L 4KROD 4M00A 4M5ZL 5F93C 2VDPL 1J1OH 3OJ2C 3O0RL 2BRRH 4FA8A 4JFEE 3PQYE 4K55A 1MAML 3QFJE 1CK0H 2MPAH 1K85A 1YYMH 4X5XB 4MD5B 5DJDB 5DO2C 4LHQB 2RIKA 5KSAC 3A6BL 25C8L 1KSRA 1V5JA 2XZAL 5IB3A 1N3NA 3AAZB 4LEOA 5J0BA 2BSED 1HK6A 3DX7A 5EU5B 5F9AC 4OJFL 4DK6A 4CDGC 4M9PA 4XCNB 2FECL 3K8LA 1PW3A 1UWXH 2FHBA 3QUXB 3GSNL 4WGWB 4AYFA 4HJJH 5F96H 3BKMH 1JMZA 3TVMB 3O4LB 4Q7DA 1ZWIA 3V4VL 3P73A 3ULUH 4M6AA 4Q9QL 2B5IB 3QRGL 1I1AC 2AAVA 5GGVY 4O2FB 3T3MF 3SO3C 1TJGH 2VMFA 3KVQA 3RWHA 2B39A 1NGYB 4HUXB 5GRJL 3OG6B 5EH1A 3UTSA 3ARQA 4JVPA 3K1KC 4WI2A 4HXAH 4G9FB 3GHEH 2VLRE 5ENWB 5HGDA 5FIEA 1JV5B 4FQQB 2IEPA 1LHZA 1EVUA 2DICA 1EEYB 1QUNA 3HAEA 4PJ5D 5L9DL 5J06A 4U1KA 1XR8B 1LVEA 1DFBL 1SJXA 5CEYB 4LCUB 5D96C 5FYKH 4XNZC 4KAQH 3KYOA 3CUPA 4QXTB 3UO1H 2LQRA 4YFLF 4UBDD 1QLRA 1DQTA 4NYLA 1AI1L 3TBTB 3SDDB 1FN4B 4MZ3A 4ZFGH 3VFVA 2E7HA 4X4YA 4F8QA 3PL6D 4UV4L 2MMXA 2E27L 5EO9A 4U4BA 1N26A 2MHAA 3RRQA 3BJ91 3T3PF 1ZVSA 5GGUB 5HGAB 5L6YL 3DOSA 4GO6B 4YC2C 4WW1A 2HT4D 1GSMA 2OL3B 4MJID 1CU4L 3T2OA 5I18L 4UDTA 1VFBB 2SEBB 3M07A 5GZOC 3HMXA 3IKCA 4HV8A 1MCDA 1FLRH 4PJEA 1Q72L 5IW1A 1INQA 3D87B 5JUEL 4DN4H 4TPRH 1MRCH 3OX8A 4KRPC 2DBLL 1U93B 3P2TA 1PAMA 4R8WH 2R2BA 3ARDC 5GGSA 3ULVD 4HULB 4HG4J 5LXGL 3VFOA 4N1EA 1MQKL 2HYMA 1NL0L 4NIKB 3QIBC 4G7VH 4KJYB 3P0YH 1AFVL 4QHNB 3S4SB 1EBAA 4YAQB 4O9HH 5GSVB 4AG4H 4RA0C 4MXQD 4LBEB 1RUKL 3FO9B 1NBYB 5CZXD 4X5XA 3H2WA 2DMKA 2XZQH 1MPAL 4NBXB 4Z7UA 5D7LA 1MCNA 1PVHA 2EE3A 2HAZA 3AAZA 3ZKNC 2NY4B 1LE5B 4J7RA 3AM8C 5EU5A 5T3XE 4YDKL 2OQJB 2R9HD 2XTJB 2XQYK 4Z7OE 4XCNA 3QUXA 4O51B 3IFPA 3TH4T 3HUJA 4GQ9H 1Q9LB 4NP4L 3TVMA 3U0PB 4WUUE 2NY6C 3O4LA 1ORSB 3AS3A 4YO0B 2R56L 2ZUTA 1JWSB 4PRBA 1PG7W 2IBZY 4O2FA 2V9TA 5E0QA 5EIQA 5EOCL 4NM4H 1NGYA 2RBLA 4HUXA 5CEZL 3MBED 2XPGB 4G9FA 4HIIB 3BX7C 1RUQL 1JV5A 5H37H 5KJRL 3V79C 4OCYL 4LPXA 2X4OB 4J2XA 3A67H 4O2EB 5EIVA 3C60B 1ACZA 1JL8A 1EEYA 5TE4L 1EAPA 4S1RL 5E2JA 5BV7H 5GHWH 4Z7QE 1IBGH 5BZWB 2NPLX 3EYOB 3EAKA 1XR8A 1KCUH 4JCMA 2CIIB 4LCUA 5CEYA 1QA9B 2R4RH 4LLAA 3VXRE 2EH8L 4UMGA 4QXTA 2DQUH 1NCWL 2K7PA 4HD9A 4TVPE 1AXTH 1QRND 3LZFH 3TBTA 1FN4A 1CD8A 1V7MH 1YY8A 1CS6A 3MCG1 5JLZA 3UPRB 5CJOH 3TFKC 3SPVB 5IVZB 1XGQA 4KV5F 5HGAA 1WIOA 3SCMD 1EJOL 3QUMA 4M7KH 2WBKA 4YHKL 5DK3A 2IFFH 2JJTC 3HN3A 2SEBA 5IB4A 5KN5B 2QSCH 4OZFA 4TUJB 3WFCL 3OAUH 4XTRD 2QV2A 1KTRL 4I2XB 1WV7T 3G6DH 3RL2B 5HHOD 3FT3B 1ADQA 1A3RL 1WT5A 1L7TL 1LD9B 1U93A 4NJ9H 3S97C 3VFRB 3IDGB 5TF1H 5C6WH 3W9DB 2JB5L 3ULUC 3MRLB 5B21A 3VRIB 5FEBA 3GKWH 1CLOH 5T3ZL 1WAAA 3TM6A 1S7WB 2YMXH 4M62H 3SKJL 3D3VD 3D39B 3ZKXB 2JELL 5ITBH 5FA3A 1JGUH 4OLUL 5AZEL 1J8HE 4X4MA 4NOFA 4QHNA 1FO0A 5TE6H 3S4SA 1BIIB 2NXZC 4XP1L 3QUZD 5GSVA 3VXQB 1MOEA 1MF2H 2FX7L 4MDJB 3O9WD 4LBEA 1SJHB 3FO9A 1MCJA 1NBYA 2DQHH 4OIAA 1JI1A 1IGML 3BYYA 1D6EB 3I02A 3LHPH 2YRPA 2D0HA 3EOAB 5JOPD 1LE5A 4UOW1 2OQJA 5F7HA 5IESL 2EKSB 4HUVA 3BGFC 1KGCE 4TTGA 3W5NA 3CSGA 5F8QC 4O51A 2FJGB 3GSUB 5C0RL 1ZMYA 2D9QB 3PDOB 4EEEA 1ORSA 3H3KA 3IDXH 4YO0A 3C5ZC 1IAOB 2DMBA 1JWSA 5SWSB 3DVNB 5GS1B 2DJUA 1GOGA 5LGHL 4JFED 2CXKA 3PQYD 5DC0A 3L3HB 3QFJD 5BRZB 1F42A 5CJXA 5CP3H 2XPGA 4HIIA 1FCGA 1QBAA 4P9HL 1EUTA 4O2EA 2X42A 3KPRE 4NBZB 3C60A 1N0LA 1TTGA 3HKFA 2NQCA 5TDNB 5LQBH 5ISZE 1AY1L 1Y0LB 5BZWA 3QXAB 4WHYH 3EYOA 3VE0A 2BX5A 1QA9A 1P69B 5C70A 1BVLA 5A3IC 5HYEA 4EUPB 5J13B 4PY8J 4ZAKD 5JO5B 1FNGB 3UPRA 4UIKH 4ZS6C 1HHGB 1WZ1L 5KZCD 2X89A 3SPVA 5IVZA 3P4MA 1S7SB 3DI3B 3VMPA 7CGTA 3OHXB 4KQ3L 3RWGB 4WEBH 4U1SB 5KN5A 5C08D 4FQCL 3EKCA 4X6EB 4ZOAA 3RPKA 4ELMB 1P7QB 3RL2A 1UM4H 2AI0L 2AQ3A 1M7DB 2XNAB 3PG2A 4M61B 5LCVL 1FDLL 1LD9A 4L3EE 4QRPE 1UB5B 4P2QE 5DSCB 1UWEL 3W9DA 5F7MC 3MRLA 3VRIA 1TZGH 3MJ9H 3OR7B 2UZYB 4TULH 2XG4A 1S5HA 1S7WA 5FO9B 1YEKL 5CFHA 1K8DA 1VGEL 2E9JA 1D5BA 3D39A 5IFAH 4K9EH 1A5FL 3LRHA 4O58H 4ETQB 3VG9B 1CWVA 4X7EC 3BPLB 4N5UA 4AM0A 1GGIH 2UWEE 1GPOL 1CG9B 1BIIA 5F6IB 3B9KB 1ODAA 2EZ0C 4CU7A 3VXQA 4UAOC 4MDJA 2AK4A 4H5SB 5BV7C 4LIQH 1XR9B 1OP3K 1RPQA 3U9UB 1D6EA 4M6MH 1FVDB 5LBSH 3SDAD 1IRAY 3X17A 3MMEB 3EOAA 2AJXH 3V7AE 5H37G 4F7EB 4PIRF 4B50A 4LAJH 4CN6A 4QHKJ 1AIFB 5D2LE 3BZEA 4G6FD 5TE7L 4GMSH 4ODBD 2V9RA 3KR3H 1A1OB 3PDOA 3ZSTA 5AYQA 1LEGB 1IAOA 1I85C 4L4VD 2VTFA 5SWSA 4DTGH 5GS1A 1RV6X 4H0GA 4XPFH 1QYGL 3FHQA 4R90L 1CVRA 1KCRH 1UGNA 3EGSB 5J57B 3RX5A 4WGVB 5BRZA 2JIXD 4Y2OA 2ZUWA 2J8OA 2O93L 2DD8H 2ZKHL 3BKJL 4PTTB 3HRPA 3CXDL 5C0IB 4OV5A 2AJUL 5T3XD 3GMMB 1Y0LA 4P5TD 2J1KA 1AGDB 4I4WB 4MAYB 1X7QB 1I75A 4P23B 5DVNA 1U3HD 3RUGE 4M7ZC 4EUPA 4F9PA 1NKRA 4WUUD 3G5ZA 5JO5A 1FNAA 1FNGA 1BWMA 2HFEB 2VLJA 1HHGA 1SYSB 2A77L 2XI9A 5I8OH 2R0KH 1I1RA 4K8RD 1S7SA 4XMKL 3NBNA 4B0MM 3RA7H 3HMXL 1S7VA 3BIBX 3GHBH 4XPBL 3RWGA 4KK6C 4FMFA 1D6VH 2NW3B 4RISL 2A0LC 4Y8DC 4EI5A 4ISVB 3BN3B 1XMWA 4X6EA 4ELMA 1P7QA 3OZ9L 1M7DA 2ATPA 2XNAA 4M61A 1UB5A 3SDCC 3FB8B 3VXRD 5DSCA 4PV8B 5J1TC 3NFNA 5J89A 4XCCH 4TVPD 4HGWB 1K5NB 2A6DB 3JZ7A 3U36B 3OR7A 4OGZA 4LQFH 4Y4HB 5FO9A 3ZMRA 3WFEH 4GXUN 5DVMA 1OTSD 4H1LH 4K94H 4OBSA 1FE8L 3O6FD 3JWDH 4HS6B 1JYNA 1NGZB 4IBLT 4ETQA 2CGRH 4G6ML 3QR2A 2HFFB 1EHNA 1BZQK 1OAZH 3BISA 5E4IA 2PW2A 3MRDA 1T7XA 1CG9A 5HHVL 4NNYB 3DGGA 1QLEL 5SWZB 1OY3B 3K4DA 1CTNA 4HF5L 4NRXB 4XWGL 4X83A 4NQDE 5IVOA 1XR9A 4EKXA 1KACB 3U9UA 12E8H 2VZVA 4LSPL 4HDIB 5FHBH 1FVDA 1UEMA 3NTCL 5BCAA 3MMEA 4CUCA 1N2RB 4DW2H 1L0QA 4EZMA 4G8EA 4LPUA 4IEFB 5E8PB 3T0VA 2NY0D 4F7EA 1FGVH 3JV6B 3ES6B 1W2KT 1RUAL 3UTPE 5IWLC 5EBGA 1G7PB 5BW7A 1LQSR 4LAQL 4WHYG 5EA0H 2HTLC 3FAWA 4Y1AB 1A1OA 2LU4A 2DWDB 1FORL 1LEGA 1INEH 1TVHA 5EOQL 1YY9D 43C9B 4RGND 1ZLUH 1UYWL 2W0FB 5INDB 4NO0D 2E7CA 4CBPA 1OPGL 1FRGH 2GTZA 3MLVL 1J5OL 2DQIL 4XMPL 3BKCL 5MERB 1A7QL 3RVWD 4ODWA 3VXSA 5DD0L 1X44A 4BZ1L 3NFPA 3J7HA 4P4KD 3GNMH 1XZ0B 4I3RL 4LFHG 4PTTA 1YEFL 4LASH 1N6UA 1JZ4A 5C0IA 3GMMA 3L7FA 1AGDA 4I4WA 2OMNA 5KAQF 2OK0L 4MAYA 4K9EC 4QXUH 1NBZB 1X7QA 4P23A 4Z76A 1P4BH 5D5MA 3WNOA 3V52L 3VWKB 1IM9B 5H8DA 4GOSA 3W5MA 1WZKA 1KTLB 4P2CG 1P4LB 3TYGL 2HFEA 2WWMC 3KDMA 1MWAB 3QUML 1OAYH 5DJYA 4NKIH 3UTQB 3O4LE 1IGFL 3C87A 5IK3B 2BFVL 4KDTC 4MHHI 2FLBT 4I18B 2X41A 1RQ5A 3W39B 2YXFA 4TUKH 4KMTL 4FQ2L 2NW3A 1F8TH 1ADQL 3KPRD 1FYTA 1W0WA 1A2YA 3K4ZA 3HC3H 2BCKB 3C09C 4BSVB 3ULVH 4LRNL 5HI5D 2VC2H 1IFHL 2BK8A 2FD6H 5FGSA 4QKXB 5ISZD 2H2SD 3WNPA 3ARZA 3FB8A 4PV8A 2IANB 5DUML 5CWSA 3L1OH 3BH8B 1K5NA 3DETD 4HGWA 4XXCA 3U36A 4D9QE 3E1F1 4S1QL 4PR5B 2P8PB 5C1MB 2HTKD 4Y4HA 1MCSA 1C5CL 3EFFB 5HVWA 4C55A 1R3JA 1A3LH 2FO4A 1X5XA 1FO0L 1XGUB 3QHZH 3H42L 3V2AR 3VXMB 4GMTL 1KENL 2P5EB 4U6YB 1NDGB 4IRZH 1H3PH 4NNYA 4FQIL 4OCRL 5SWZA 4XHQA 1YEHH 4QRSB 1PYWA 4NRXA 3JVGC 1DR9A 1U8PB 3HE7A 2COQA 4NO3B 2GJ6A 4R26L 3QIUD 3VGHA 1YN7A 2Y36L 2PYEB 1EERB 4TQEH 4D0CA 4JFDB 4N0RA 5DD5L 1N2RA 4M93C 3H9SD 1F2QA 1Z9OA 3T3ME 4KJWD 4L3ED 4QT5B 2E7LC 5E6IC 4P2RB 5E8PA 3BAEL 4FP8L 4P2QD 4Z7NF 3INUL 4H88L 5JHDD 1JK8B 3V7MA 1X6NA 3SE8H 2A6IB 1L4IA 1YJDL 2B1HH 4JN1H 4ONOA 5IROA 1BEYL 4Y1AA 3UJTH 4HBCH 5EN2A 4Y16C 43C9A 5INDA 2AJ3B 5BXFB 5MERA 2VLKB 3T0EE 3RFZC 4FOMA 5E5UB 1JGLH 1ZSDB 1XZ0A 3MLZL 4KROC 4G8IB 5C2BL 3ILQD 4HIHB 5TQ2H 4U1IB 1JP5A 4HXBL 1FAIL 5ADOL 3T3PE 1F4YL 4HWBA 3JWDC 4QRUA 4L8SB 1NBZA 4JPIA 4N0FA 1DLFH 2VABB 3VWKA 2XTJE 4OFDA 2G9HB 1IM9A 1OB1A 5F7DA 1T0PB 5GZND 2Y06H 4KK5C 3OKOB 1P4LA 4XVTL 3MLRL 1MWAA 1V8HA 5DYOB 4PB0L 4FQ1L 3UZQA 4Y88A 5KOVC 2FEEI 3UTQA 3OXRB 4KUZH 5IK3A 4H1LG 3RY6C 1NEUA 3C2SA 4BUGA 4I18A 4BSWA 1BECA 3W39A 4JQXA 5FDWB 2XT1B 3TBWA 3V6BR 4L5FL 4KZDL 2FECI 3OF6A 1NCBL 1RU9L 4OZ4B 1IT9H 4R0LC 2A9NL 2BCKA 4BSVA 1HI6A 3E2HC 4CMMA 3G08B 5F1NB 1FIGL 4P46D 4GLRH 3I6GB 1IQWL 4RQQB 2Q8AL 3ABZA 5L2KB 1F13A 4E42B 1MCWW 3BZ4A 5FECB 5DUBA 3P3YA 3ZKQD 1P5VA 3BH8A 3BD3A 4PR5A 1DANU 5A1AA 4GKSA 1PKOA 3EFFA 3QJHB 1SVZA 3HE6C 1WWWX 2VH5L 3STBA 2GY5A 4Q97A 3RWIB 1MHPH 1XGUA 5EULV 3HMWL 5EU6E 1VFMA 1P84K 1R24A 5FUZH 5DJCA 4NC2B 2P5EA 4U6YA 5DMGD 5MENB 1A7PH 3QIWB 2B7DT 1GC1H 1MHHB 4UBDC 5FYJD 1U8PA 4HWNA 3BQUC 1RHFA 1FZOB 3LS5H 1MHCB 3OAYK 3UTSD 1BVZA 4IRSC 5CGMA 4DGVH 2PYEA 3PL6C 4WI9A 2DOCA 4XNYL 1MCBA 1EHXA 2GJZA 4FXKB 4I2XE 2Z93A 3C8KA 4P2RA 1T5WB 4QT5A 2HT4C 2H41A 3NZ8B 4LRIA 1PEZA 5DEZA 5HYJB 2NZIA 2VDML 3VXOB 3OJDB 1JK8A 4XBEL 1F6LL 1A7NH 2JJSA 5IBLD 4ZQKB 2A6IA 2EO1A 5DEFB 4YHMH 4J6RH 5EO1B 4AIOA 3WNNA 1PZ5B 2R2HB 5B38B 4M5YL 4MZ2A 1JPSH 4HUUB 4HCRH 3WKML 3D39E 3MOQA 2JK5A 2AJ3A 4I77H 1LK3H 1NKOA 5JPMB 3ULVC 4YFDB 2VDRH 5D71L 3F58H 1ZSDA 4NWTL 1FNFA 3ETBF 1G84A 4G9DB 4DFHA 4HIHA 4AY0A 4J3XA 2ZSWA 1CXLA 4U1IA 1U58B 3MRNA 4NC1C 3OKNB 1HKLL 3KPSA 4DUWA 3OPZH 5KS9F 3S6CA 3TCLA 3QEGL 3OXSB 5FCUL 4L8SA 1OAQL 4EN3B 4MJ5B 5CZXC 4TSCL 3H3PH 2BVOB 1DEEA 2VABA 4CNIB 3IF1B 2YEZB 2G9HA 2WBJD 2OJEB 1DBMH 1DN2A 3N1MC 3OKOA 1ZK9A 1NAKL 5EUKB 3RZCB 2V5MA 5DYOA 3SE4A 1AXSB 2PUQT 1E4JA 3TH2T 2F5BL 5SWSE 2B2XH 4HWEH 1CDHA 4A6YL 5CP7B 3FOMB 3QWRA 1M05B 1B6UA 3LEXB 4XCEB 5FDWA 5TQ0H 2OZ4A 4RNRA 1QG3A 4LLUB 3VWJB 5JXEA 3TV3H 2ZUQC 5I15L 4M1DH 3ZE1F 2WQRA 4OCWL 3HZMB 4N