2YZ1A

Crystal structure of the ligand-binding domain of murine shps-1/sirp alpha
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
ELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIKWYRGVGQSRLLIYSFTGEHFPRVTNVSDATKRNNMDFSIRISNVTPEDAGTYYCVKFQKGPSEPDTEIQSGGGTEVYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type substrate 1
publication title Structural insight into the specific interaction between murine SHPS-1/SIRP alpha and its ligand CD47
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 21
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yz1A01
4WUUB 3MZTA 2XN9B 1EEZB 3PV7A 1HYRC 3UROR 3QDGA 5DEGB 5DMKB 1CQKA 3JWOL 1TNMA 5E4EC 4PRPD 5F7LB 5L2KA 2EO9A 4AG4L 3ZTJG 3RGHA 1K5NA 3WNOA 1FNSH 3JXAA 5IB5A 1P4IH 3IRZA 2Y5EA 4KRLB 1KJ3L 2Y5TB 2CPCA 4MHHI 3MA9H 4F15C 5FYKD 3RDTA 4ODSL 5E94B 1CFTB 4OIIH 2UZXB 3BPOC 1AXSB 3EJJX 2WAHA 5E6YA 4BFBD 3EKCA 2Y1VA 4LF3B 3L6FB 5IQ9A 1KJVA 3KYOB 5JORB 1CICD 1YMHA 1ZWIB 2P45B 4Q58C 4JZOB 4P9HH 2O5XH 4FXKA 3O0RL 1CG9A 2MKLC 3GSUA 4E42B 1OTUD 4TSBH 4PBVC 12E8H 1MY5A 1UFUA 4XP4L 1TMCB 4ALAH 2FH6A 5D7JD 3EYQD 3STLB 3DYOA 4L8BA 1DQJB 4X4XB 1AFVH 4DOHB 2XZAL 1CLYH 1RAMA 1CIUA 3VFVA 4Y8AA 1GZQA 4OM0H 3RA7H 5FA4B 1F6AB 2K7QA 1FL3A 2W07A 3HB3D 3QULB 1MAKA 2I60L 5T1DH 5KVEL 1C5CH 4XVJL 5H2BA 4RRPG 3EOAA 4JFPB 2ESVD 1KF9B 1WQVT 3SGDH 4KK9D 1IKFL 1OCWL 4NQCB 4RMTA 3UMTA 5D7LD 3GSVA 4LARL 3FCTA 3DRQB 3MFGB 4NRYB 4BSWA 2HJKB 3LDBB 4EIGB 1UYWH 4OLZL 4G9FB 2LV4A 3DROA 3QXUA 4JVPA 4EUPH 1OLZA 5J7CC 3RIAF 3I02A 3O8XC 4OAWB 3QO1B 2R4RH 2MPAH 3D3VE 4ISVA 5D7IA 3RIAK 2NY7H 1G1CA 2VXUH 5C08D 2IPUG 3HNSH 1FYTD 4IRJD 5FECB 2CO7B 2X10A 3H0TA 1QVOB 4ODVL 2VABA 3BH8B 4JFQA 2F74B 2M2DA 3C8KA 4HJ0D 4UINH 3OKNA 1DE4A 3PDDA 3VWKC 2EDYA 3X12A 4L29A 3TJHC 2PXYC 2WUBH 3I85A 3QFJD 5CIPB 3OG4B 3CLFL 1KT2A 3AB0B 1N64L 4JFOA 5KAQF 2AJZA 2VLLB 3AU1A 2ZJSH 3FO1A 4J3XA 3T04D 1NEZG 5IB4B 5JNYA 4HUKB 5GZND 1UT9A 4J3OC 5IG7A 1B0GB 5I66B 2PYFA 3ARGC 4MJIB 1J5OL 3U79A 5HDLA 3MRFA 3UPRB 4ZNEE 1H3PH 4HK0A 3IJYA 1N2RA 4PJFB 2IG2L 4L8SC 4OD2A 2JKXA 3MRHA 2IBZY 1N3NA 4NP4H 3RTQC 2B0SL 4G6FD 4JZNA 3QI9B 3FB7A 3C60B 2J1KA 3PWLA 1V3MA 5IBTH 4YGAB 4JR9H 3DXAA 5IK3A 1AD9B 5DQDL 4ZDHA 5KSAB 3CSYA 1AR1D 1P1ZA 2E27L 5DD5L 2BVYA 4YDIL 1D6VL 2F53A 3IKCA 1ZHKB 3O9WB 3LHPH 4BK5A 2BVPB 4APQA 4UOW0 3IDUA 4XT1C 1WIPA 1R3KA 1QEWA 4KPHH 5EO0B 2V2WB 2AJSH 2V17L 1MRDH 1A1OA 1CXLA 1H0DB 3MBED 3VXRD 2R23B 1HILB 1B6DA 1ZEAH 2AQ1A 4ZPVB 3F6LA 3MLVL 5ESAA 1OP5H 2FATL 2X7LA 4PV9A 4R8WH 4WNQB 3S37H 1CIDA 5FHAH 2A6IB 3FFCD 1TFHA 1LDPL 3BWUC 3BT2L 1IILE 1SHMA 4FNLH 3G5VB 4FQ2H 4IIQB 3X3FH 4M48H 2VIRA 4Y16A 4OCSH 2Q86B 5HHMD 4NHUB 5E70A 2P5WA 5FA3B 2OJEB 3FO0L 4JPWL 5DGQA 3P4OB 3EJYD 4OTXH 3SQOL 3QDHA 4LPTA 3QDJA 1FVEA 3Q6FA 1F02I 4LMQI 2AABH 5BZDB 3BSZH 5I73C 4I48A 5DVLA 4NN5C 3LV3A 4GRWE 1IRAY 1S3KL 5BW7C 2DJSA 4PP2A 1T66C 4Q2ZB 4QXTB 3WHE0 1VGKB 4KHXL 2WV3A 3FTGB 1IEBA 2BNUA 2R1WA 2RQ8A 1S5HA 5GRJH 5KANG 1O5DT 2PYEB 1MCEA 3O3UN 3AGVA 1MJJB 3ARZA 3ARTA 5ID0B 4LKCB 4WFFD 3L5IA 3WCYA 4XH2B 2EKSB 5IT2H 4MDIA 4NZRH 2DQGL 3IDYB 4LBEB 4O4YL 2OZ4L 5C0ND 5J1AB 4PJHF 5EOQH 2HWZH 4Z7WF 3CH1B 2OR9L 1TCRA 3ULVE 1CL7L 4NWUH 3VCLB 4E41A 1CGSH 1M7DA 4JDTH 4HC1H 1MPAH 4XMPL 3LOWA 1NMBH 1LK2A 2XKNB 3U2SA 4OUOA 4NCC2 2CLVB 1TJIH 4O2FA 1FJ1A 2IBBA 1G7PA 3ECBA 5EOTA 1WIOA 1MIMH 3V5HA 1OGTB 4O00A 4MNQD 4U2YA 4PRDB 2JK5B 3U9UB 1FL6B 4Z7UF 3O6FD 2AEIT 1INDH 1X5HA 1RHHA 3GBLA 1T0MB 4MCZB 4Y5YA 4U1SB 3EYFB 3S36H 3BDYH 4KK8D 1S7TA 4F7TA 3K1KC 1CLZL 3CVIH 1YPZF 1HSAB 4U49A 3U7YH 1X5XA 1ZANH 1FH5H 4OKDA 2B4CC 2OZ4A 4D94A 3KG5A 3QXAB 3HUJF 1RFDH 3MLSL 2XKUA 2ZUVA 3SBWA 4P99A 4GSDL 1I9RH 3FN3A 1UM4L 3IVKA 4U6VL 2Z91A 3WHXB 1WFOA 2FECI 1YNLL 5FV1L 4JPIA 2GEEA 1JVKA 1OF2B 4JZJB 2Y23A 1GGUA 2OTWA 1DBML 4BZ1H 4PYHA 4UI2A 1G9MH 1BEYH 2GCYA 4HAGA 5FUCC 4F9LC 2QHRH 4DJMA 1JJUA 5C0FB 4GKNB 5H37H 1SEQL 2I07A 2WK2A 4FABH 1MHHB 4WO4D 4H1LH 1BBJB 3OR7A 3D39B 5D2LB 4ZXBB 5DHVA 4HX1A 1IL1A 4EDXB 1LNUB 3DX8B 2AK4B 1MJUH 2VSCA 1AO7B 3QUYA 4HIIB 3TN0B 3L9RB 1MAMH 2V5TA 3S88H 4ZMAT 3E3QC 1YEJL 4LRIA 2ORBL 1AGEB 1ZT1B 2EEDA 2I26N 5I8EA 3EDJA 2PXYA 2WUCH 5HHQB 3AXLB 4XMKL 1U6AH 5F7YC 3RI5F 3L3IA 4EN3C 3ZT7A 3BP6B 1BX2B 3HI1A 2A9MH 4HDIB 4WW1A 2BVUA 5IKCA 3HC3H 4XTRD 1BF2A 5K9OA 1BWWA 3RI5K 2FHFA 3B4NA 3MV7A 3PDOB 5FUOL 3VGFA 4WGVB 4PJ7E 3HI6L 2BFVH 1C08B 2PETA 1VADA 4KROD 3WNNA 2OSLB 4JFHE 2ZUUA 3GSXA 1NGXA 3SE8L 5C0AD 5EBWB 3MUGA 4QRQA 2XTJE 4YWGH 4WU7A 3RY5A 3TZVD 4F57L 4OFKA 1Z2KA 3C08L 1EEUA 3PWNB 5MENE 1F6FB 3H9ZA 1OW0C 2HT3C 4U1JA 3SQBA 3AREA 3HAEA 3U1SL 3RAJL 4F8QA 4L9LA 3BZ4A 1QQDA 4LIQE 4AIOA 5IEHA 2MQCA 2WINA 4P2YA 2GJZB 3MRPA 1S7QA 4RAHA 2CR3A 4ONGH 5ITBL 5F7DA 2VLJB 1J8HE 1P4LB 4HIHB 1OVZA 3VDAA 5EU4B 3EOBB 1BVKB 1RIHL 1A2YA 4AH2B 3IS1X 2CDEA 2AV7B 3UDWA 3BPNC 2VKWA 3O3BB 3GBML 4EBQH 1QFWL 5A1AA 3MROA 3DV6B 4K2UH 3BZDA 1CLCA 4RZCB 4KJWD 4OF7A 5FAAA 1LEIA 5EN2B 3LKSA 4JDVB 1EFXB 2BNRE 4RGOL 5BRZA 3TJEL 2PTUA 5E6ID 5EC2B 1YECL 1U8OA 1NC2A 4N0UA 2YPLA 1NSNL 5B4MC 1WGOA 1X4ZA 5H94A 3RUGE 1WF5A 3B5TA 2UWEE 4PPTA 3G5ZA 6FABH 4FFWD 3C87A 1BZ7A 1MFDL 3KYKL 1MFNA 4IRSA 4QYOB 3VFPB 2BSSB 2EEBA 4K7PX 2NXYD 4BKLA 4QRSA 4UIMA 1NH6A 5F9JA 4GLRI 2AJYL 2FLBT 4WI5A 4I2XE 2NTFB 4X6DB 5ELIA 4ODXB 4FG6D 1C8PA 1Q72L 3DI2B 3FB8B 4NQED 2XFXB 2DI7A 4JRXA 4JO3H 3MRMA 3T3PF 1A4JB 4AEHH 1HN1A 1INQA 1NCDH 5C0IB 4KTEH 2OK0H 1CI5A 3ARBA 2COQA 5DJ2A 5EZLB 1ETZA 1UEYA 3RKPA 3KR3H 4CNIB 3MQIA 4OZHB 3QUMH 3UX9B 4XVTH 5D5MA 1NAMB 2WIMA 1WZ1H 2Y6SD 1BF8A 3ZE2E 4NM8L 4A6YL 3O2DH 5D70H 2R2HB 5K9QI 5BV7L 1E4KC 2ED9A 3EIFA 2ICCA 3L3DA 5A2JH 4K94L 3RY6C 3WS6C 3V8CA 1ND0B 4X9GA 3OJ2C 4NOFA 2JCCF 3SJVE 4X7CC 2GK0B 4MAYA 3KGRA 3PP4L 4FRWA 1JRHI 4RX4A 1UJ3C 1XR9B 2V6HA 1KIRB 4G5ZL 1I8IB 4OF0A 3KPRD 4TNWF 4TNVF 4RFOL 4LLDB 4S10A 1QSEE 1AHWB 1I85A 3D18B 4P4RA 3VWJC 4KGLA 1S9VB 3LQAL 4JHWL 4P5KB 3IAGC 4TNVK 5KTEL 1FQ9C 1KLUB 5TPWH 4MXQD 3JBG7 4GRLB 3DVGB 1A9EA 3NFPB 5EU5B 4HFUH 5EZOL 4NKDB 1YZZA 1OWWA 1TETL 4UQ2A 4GMSL 5CZKA 3SO5A 4F7MA 4A6YA 1CXEA 5JHLH 5KZCD 4G8EA 1RZJC 2IAMC 2J88L 1RZ7L 2NY1D 3UAJD 3QNZB 4Q6IA 3HR5A 1G7QA 1WWCA 2AEPL 5F1NB 1B90A 2RFXA 2VE6B 2XXMB 5T3XH 1A4KA 2W38A 3MJ7A 3SKMA 3HE6C 1KYOK 4R26L 4J3TA 4LNRA 4KRPC 1I7ZA 1D7FA 1E28B 1IM9B 1J0IA 3KYMA 3EJZD 1T1WB 2NY2B 2QSVA 4F9LA 1JHKL 1VENA 2B1HH 4Q9BA 5C6WH 1JYNA 1NL0L 1MRFH 2GI7A 2D4FA 3WXWL 4ZO8A 3I6GB 2EIZA 4X6CB 1P7KA 3ARFC 3JUYA 4BZYA 2FO1A 3CFDB 2ICEB 3ULVD 3WIHA 3VRJA 4ZS6C 4NQXB 2F54E 2HJLB 5D8JH 3RGVC 4BFGA 4KVCH 3HMXL 3JV6B 4WW2F 7FABL 3UZVB 3ABZA 2XXCB 1UACH 4YHLL 3V95A 3NCEB 4OFDA 2I5YH 5LWYH 5F1KC 3IDIA 3RWIA 4JG0H 2FGWL 5D9SA 3UTSB 5JZ7C 4KHTL 2PW1A 3BUYB 5EBGA 5I1AB 5CZVL 3C6LC 4LQ1A 2W65A 3SDDC 5DMGD 2VTFA 4WFEE 5EA0H 3TNNA 3VMOA 2AXFA 2CH8A 3ZE0F 4M6OL 3QIWA 4I8DA 2HRPH 5EIQA 1R3HA 5FOJA 1BJ8A 2AQ2A 1K9TA 1A0QH 1OTTC 1FNGA 3LCYA 4ZAKB 3N1FC 5FYLL 3JTSB 4OCMC 3C5ZA 3C09C 3PWPE 3REWB 4WEBL 3QWQB 5CP3H 3PGCB 2WANA 4JM2D 4XRCA 1L9NA 2AQ3A 3EO0A 2IMMA 1F3JB 3RVTD 3TBWA 1WCBB 1YY8B 2HJFA 4OF6A 3TO4C 2SEBA 5IESL 4JHZA 3C5SA 43C9B 1JNJA 4UQ3A 3B9KC 2IBZX 4HZLA 5DI8A 4WHYH 2CK0L 2BVOA 3KPOA 2J4WH 1HHJA 1NAKH 2DLFH 2ICWB 5FIEA 4FZEH 5C09D 2QR0A 5TQ0H 1A7BA 4YQXH 3MGOB 3VGHA 1NBYB 4LSUL 5ESVB 4S2SB 2ZOLA 2DQEH 2VUOA 2Y7QB 4OLWL 5DQJB 1RUAL 5J1SC 4XNMA 4PJIF 1ZT7B 4YDKL 3TC9A 3U0TB 4D0BA 1XCTA 5HI4C 5I1DB 1DLFH 1UA6L 4YNYB 2J7LA 1LEKA 2XICA 4D9QD 4W70A 1QFOA 4PJ8D 4QGTA 5IVXA 1BQLL 2X4OB 4LLVB 3GSWB 2X40A 1A7OH 4L5FH 4LSQH 4H25A 2M1KA 5FM5O 4KY1L 5D2NC 4G7YL 3F7VB 3TGXA 1QBMH 5DT1L 3QJHA 4K3JL 2NXZD 2XYCA 3GMNB 1FFPB 4MD0B 5KS9B 1KN4H 5K9JL 4HUUB 1T0NB 1ORSA 2UVEA 4PP1D 4JFDE 4XNYL 1MWAL 4X6EB 3UYPA 1CLOH 2CUHA 1AQDA 1RMFH 2H3NB 2Z93B 3SGKC 4UV7L 3DMMB 5GJSH 1P2CA 1D9KC 1R24A 4FP8H 4YFDB 3BIKB 1HXMB 8CGTA 4OUUB 1KFAH 3FKUS 3QCUL 5D72H 2CLRB 4IS6B 5L9DL 3WSQH 5MEND 4I9WD 3ARYA 3FT3B 5E8EB 1JZ3A 5D6CB 3RBGA 1EUUA 4RGNB 4IRZH 4M00A 4KDWA 2YK1H 5B22A 5SWZB 1YY9D 3JVGC 3LS5H 4JFFE 5CZXD 5CEYB 1OGAA 2W0PA 2K9UA 3MUHL 2CQVA 1IGJB 5FOBB 1JK8B 5DVNA 3H8NA 4N5ED 4JCMA 3ZYIA 4Y5XA 3B2VL 1H8OA 4K3GA 3T0ED 1U41A 1ZVYA 4UDTB 1MWAA 2R4SL 2VXQH 3DARA 1G7IB 1KTDB 1E4JA 3MRQA 3ZDZF 4OZIE 1I8KA 3CFEB 3ILPB 4YUEH 2DDQL 5F6IC 4NQDD 5JW4R 4PB9H 4LLWA 4LPXA 3U7WH 4XP9H 1OAXH 4OLUL 2EKJA 5C9JA 1J0ZA 3BQUB 4M62H 4GO6B 3OPZH 3HG1A 5EDXA 2FD6L 3MRIA 3V0AC 5SX4I 2BMKA 3F65A 3X11B 1ZLWK 3WFCL 4F9PA 3GSQB 3RIFF 4HJGB 2ZUYA 4TTDC 5LQBH 5HGHA 5E24E 4U1MA 4JY4A 3JV5A 2NW3A 4RFNB 4WWKB 5E9DB 3DV4A 3RIFK 2F19L 3IDNA 5C0BA 4PJDA 5F9WC 3C5JA 3IFLL 4NM4H 3O3AA 3VMPA 5CBAA 5T1MB 3WO3B 3OHXA 4RMVA 2FLRT 4FQ1L 4HKJA 4CGTA 1FYHB 4ZFOL 1OT1A 2X4QA 4DKFL 1NCCL 4L1HA 3W82A 3GRWA 1JWMA 3MV9E 1EO8L 4TULH 1EZVY 2MKWA 4JFYA 3WS3A 2CKBH 5DUMH 5AZ2H 4WUKH 4O51B 3RPIB 4FTVA 1PBYA 3SE9L 3PNWB 2X4UB 4X4YB 1F11A 2VXSH 3RX7A 1QKZH 2DQTL 3V4PH 3K74B 4LGSB 2KQMA 2LTQB 3SJVD 4OZFG 1BLNB 2GFBA 3JTTB 3B9DA 3M17B 2EDWA 3LKQA 3LKOA 3I9GH 5I15L 3QDME 1ES0A 1QSED 4TYUA 3UEZA 4GUPB 4NZDA 2ZUQB 4XI5C 1N0LA 3BUTA 4JFEA 3LKNA 4DUXA 4ZFOA 2QADC 5IJVB 3O4LE 2EH7H 4FQXC 3SKNA 4ZOCA 2BC4A 1YEGL 4WHTB 1A6ZA 4Y4HA 1W0VA 1KLFA 4LQFL 3SDDA 4D2NA 1TZIA 4M6NL 4UBDD 1T83C 3QDAA 3FRPG 1WZLA 4ZS7H 1FVDB 1M05B 3MODL 1M7IB 5I1HL 3SDCC 5T5FL 1N6QH 3UTTE 4CW1B 5EORH 2NX5D 4AM0B 3CCHA 5ADOH 1KCVH 3QEHA 4KK5C 4V2BA 35C8L 3U4EA 4DTGL 4UB0L 2J5LC 1HHKB 2R69L 5F1SA 1T5WA 3WD5L 1KEGL 5EZJB 4Q9QH 2HTKD 2ZUSA 3NH7H 3NPSC 5TDPA 1TDQA 5IR1A 3MXVH 3DURA 1QBLH 5ILTL 3DX7B 4KKCD 1UM6L 3U9PH 4PGDA 3LSOA 1UVQB 1RZIA 1UQSA 4ODHH 3KJ4B 4JY6A 2AI0H 5F88B 3T0VA 1A3QA 2IGFH 4JLRA 1H8SA 1MFCL 4LGPB 2W59A 3MUJA 3QHFH 2H32B 1KB9K 1V3JA 4Y1AA 2NY6B 1TVHA 2EIEA 5CP7B 2Z92A 1MCHA 4PJHE 1BM3L 2OL3L 3U36A 1T04A 4DZBA 4Z7WE 2DQIH 4PY7A 5EU6A 3EDFA 1B4JL 1AD0A 3H9HA 5KAQG 1KENL 5KSVA 1GC1L 4YIQA 3MRLB 5HHOD 2NCMA 2OTUB 1JN6B 5I16A 1FO0L 2MSPA 3EYSH 1J0KA 4Z7UE 4ZUUB 3G5XB 1DSFL 1MF2L 4W81A 3PWPD 1NFDA 4Z7VA 2IMNA 5KVGH 5L7XL 4P23A 4HV8B 2IANB 1A6VH 3SGDI 3U6RB 5SX5K 1HXYA 3GMLB 5CEXB 5J3HC 5C07B 2ADIA 2OXGA 1YPZE 1GHFH 1OAUL 2FBJL 3PIQA 4MA3A 3CVHL 1OAYL 3RY4A 2EE3A 1KG0B 1YEKH 4R4FH 3HUJE 1NANH 1OAKH 1SEBB 2VLKE 2XZCL 3OF6D 5HTSA 1OPGH 1J1XL 5DD6A 3T2NH 2G5BB 3BKML 2FEEL 1G7HA 4N0CD 3WBDA 5IB1A 3GKZA 1JGLL 4NCC1 5E6ZA 1DEEA 4LPVA 4OZFB 2O5YL 1KB5B 4M5YL 4QHMB 5L2JB 5HI5C 1AGBB 3KXFE 3V0VA 2YUXA 4JB9L 4YHZL 5HHVL 3SCMB 5SWQB 4RFEB 3F7YB 1NGYA 1H3XA 4X5WB 3WNKA 4FFYL 5IB2B 4GAYA 4OLEA 1NCWH 5DHYA 5MERA 3K2MC 4JANB 4Q74A 3DIFA 3FT2B 3RNQB 3ISWA 1XR8B 3LS4L 2IQ9L 1ZLVK 4OV5A 5A16A 1XGUA 1WAAF 3CVHA 4NRXA 2H9GB 1FIGH 3LEYL 4J12A 3WE6B 4PJ5E 4DN3H 1FBIH 3MREA 4JFDD 1LE9A 1RU9H 3B3IA 3L95A 5I1EH 4HIXL 1QSFB 3L7EB 4MJ6A 5BOZG 5IMMA 2J6EL 5DK0B 5JO5B 1KPUA 3BW9B 1IAIM 1I7RA 2OJZH 1MJ7H 2QQLH 1QLEH 4QOKA 1MRCL 4ELKA 2D7NA 3Q3GA 2YN3A 3WFEL 1XIWA 1N8ZB 5AUMB 1ZK9A 3KPQA 4PRPB 4XX1E 3DX9B 5T3XE 4GBXB 4IEFB 1BJ1H 3HAEH 2FZ3B 3WIFB 1KGCE 4JO1L 3QIBA 4I18C 4FQLL 4KMQA 4M1CD 2YKLL 1PG7L 3UZEA 4B7LA 3W5MA 4F33B 3TFKC 1NMAH 1Z3GH 1PAMA 4G3YH 3KLAB 2EYSA 2F58H 1N0XH 2J6EA 1CICB 2AV1A 3IB4A 1DN2A 5DRZA 1A22B 3TCLA 1U95B 2V7HA 32C2B 5ISZD 3GGWB 3GMRA 3CUPA 4ZFGL 4UAOB 3N06B 3CJJA 4M7KH 1O7SA 5GIRB 1I7UA 2WBJC 5D7JB 4XPAL 2P8PB 1JGEA 5KSBF 1JF1A 1YUHA 4PJ9A 1PLGH 3CFJB 1N59A 2DWDA 3KS0J 1U8IA 1S78D 1AQKL 4DCQA 1BPVA 1YEIH 3WLBB 3R8QA 5E5RB 1RUPL 4G43B 1YYLH 1T03H 4NGHL 2HFFB 4RQQB 4NJAH 5SX5H 1NDMB 1C5BL 1XF3A 2ESVB 3BKYL 1S8DA 2BNQE 5CGTA 4R4NC 3RZCA 4P46A 4X8JB 2HT4D 1J05B 5D7LB 2H8PB 3EOYG 2IH3B 4MNGA 2R2EB 1MUJB 4HS3B 5J0BA 1LK3L 3AS0A 4IDJH 3QDGE 3EHBC 3OKEA 3MV8A 1K4CA 5D1ZD 1NCAL 3FQRB 2NR6C 2VL4A 1NGZB 3ARSA 3T3PE 3OR6B 1IC4H 3LDBC 3RU8H 1I75A 1UZ8A 3FN0L 4POZC 3UJJL 4WU5A 1VHPA 4AY0A 2P8MA 4P4KA 2R0ZH 2GT9B 1IGML 2OR8A 3HNVH 4MDJB 3MGTA 3TM6A 4HIEA 4OZ4B 3MFFA 5C08B 2XQYK 5DDHA 1FYTB 4IRJB 2ADGB 2BHZA 2VWEC 2DQFA 1KB5L 3P9MA 5JHDA 3FJTA 5LGHH 3WJJC 5GGUB 1ZLVH 4JM4H 3VXPA 4ODWA 1ZHNA 4HS8L 1IGYA 2JCCE 4WRLA 4QT5B 4PTUA 5I1CH 1VFAA 1KN2H 3GMQB 1I1CA 3QFJB 4XXDB 5J6HA 1QBAA 1INEH 1FC2D 2CRIA 4AIZB 3ET9F 2V2TB 3ARDB 4OGZA 5ENWA 5IFAH 5IJKA 4ZD3L 5HSFA 5DFVC 4N8CL 5I1LB 4I3SH 1HDMA 2VQ1B 4GMTH 4NC0B 1TVBB 1XF2A 3FMGH 3IRPX 5T1LD 3D0VB 3QBTB 4UNTA 1MCPL 1VB9A 5IHZA 2EDHA 3QWRA 4CN1A 4CN4A 3UTTD 2M26A 4W6XB 2Z9TA 3LRSB 2B4CH 2BY0A 3CMGA 4YHOH 3VXSE 5F7NC 2JJSA 1F58L 5C2BH 4G6FB 5LGJB 1Z9SA 3QG7H 2CO6B 2FX9L 4ETQA 2GTZA 1I7TA 1OAZH 5DTFA 1JGDA 5ANMA 1KBGL 3O2WL 3VFNA 4LCWA 4X6FB 3QI9C 3C60C 4G5ZH 4PG9B 1FZMB 1KJ2L 3LN5A 3GO1L 4GG6A 5KSAC 4I0PD 3SPVA 4NNXA 5AZEH 2R1XB 2WBWB 5ADPH 3A6CH 4QHLB 4N8VB 2JE8A 3MBEB 4JKMA 4QXUH 3VXRB 1T2XA 1X6NA 2DMCA 3O9WC 3LQAH 3TA3A 5F3HA 4RWYL 5KOVC 1RK0B 3D9AL 3O81A 5J6GA 3WIHH 4K3EL 1G6RA 5FYKL 4XVUC 2DAVA 2VN4A 5JOEA 1MAJA 1YNKH 2EEAA 3GB7A 2P24B 2ZCKH 5IF0B 1QFPA 4PJEF 2CXKA 1J86A 1C7TA 5HHMB 2XPGA 4N9GA 3E6FA 4L3EB 3MX0A 4L4TA 1IAIH 2YC1A 3MRDB 5D71L 1Z5LA 1CCZA 1T1YB 4BYHA 5EU7E 4HLJA 4JRWA 5IWLC 4U2ZA 1KJ2A 3Q5OA 4S1RH 3K8LA 1IMHC 4YHPB 5C8JB 3IDJA 4XXCC 1W0YT 2F5BL 4G6AD 2HN7A 4N0YL 2CKNA 4OFYA 4IOFC 3HZYA 5HDQH 4K9EL 2Q76B 3S3SA 3ZE0E 1LILA 4LU5H 4NUJB 4PS4H 3PQYA 4IMKC 2HKFH 2VITA 2XN9A 4L4VE 1EEZA 1IGIH 1LO2L 3JV0A 5CSZB 3U4BH 3GI9H 1YQVL 2C26A 3TPUA 4DKEL 1JL8A 1EBPA 3W81A 3N9GH 4FS0A 5C0GB 1VSCA 4X0KB 4K55A 1H3GA 5HY9A 3UBXG 2D9QB 5FKPB 4OT1H 4GAJL 4JHAL 3IDYC 3IS0X 4LKXB 1ITCA 1A7NL 1YN7A 3K4DA 2B2XH 2VXTL 4PFEA 3GHBL 4F7CB 1D5MB 3U82B 5JPNA 4PJIE 1AY1L 2X4PA 3L6FA 3IFNL 5D96B 1NUDA 3L3OB 4F8TA 4MNQB 1RUMH 4NBXB 2W60B 3O6FB 3WNLA 1ACYL 1N7ML 1HE7A 3WV0A 2ZCLL 5E00A 4AL8H 2QSTA 4OJFH 4XBEH 4P3WA 2XA3A 1B3JA 2ZSVB 3QJFB 2X2YA 1DQJA 4G8GD 1CGXA 4OCRL 4PJAB 1IVLA 3H9SB 1UADC 5DRWB 3VA2C 2R2CA 3KPMA 1AXIB 1F6AA 1YEFL 2P5EA 3DPBA 4HMCA 3IETA 4NQTA 2R9HD 1YC7A 2DLGA 3MC0A 1DQMH 5HYSA 4PJBF 3W11C 4PJGA 1CE6B 2N1KA 3FONB 4X4MA 2FRGP 1QA9A 5TE6L 3MNZB 3MJ9L 3P4NB 5DUBB 4JQIH 2HJKA 1DUYA 5GRUL 1KGCD 2E6PA 2O5ZH 2YBRB 4HPYH 2Z31D 4AIXA 4FQIL 1FFRA 1QFUH 1XCQA 1FHGA 1S7UA 4JZJC 4K94C 2YMXL 4N90E 1Y0LA 2WNGA 5BO1H 4WO4B 5F9DC 4PUBL 4LLYB 4UT6L 4HJJL 5IROA 3CZFA 1M7XA 2HTLD 2VDML 1Q9OB 4FFZL 3ROLA 4EXKA 2NZ9C 3SDAB 5EWIH 3ZDZE 1QVOA 4Y4KA 4N9OB 4PJCF 3GBNH 1D6EA 1J9CT 4FFVD 3QA3B 4KK6C 4IMLB 3CPLB 5L9DH 3IU4L 2FJGA 5FYJH 1H3TA 1HWGB 2D03H 3OGOE 1WBZB 3MJ9A 3F5WB 3GJEA 1EEYB 3DUSB 1U3HA 3L5WB 2OMNA 4KKAD 1F00I 4X7TA 1A3RH 2PN5A 2AEQL 4OD1H 4KV5E 4LSVL 5IB4A 4KROB 1DL7L 4F37F 4XCYA 5I66A 3C8HA 4G7VL 1L7IL 1PKQA 3P0VH 5C0AB 3H9YA 5FYKU 4ACPA 1CR9L 3CU1A 5FK9A 3UPRA 4QXGH 3G6DH 4WDIB 3S98A 4F37K 1X5LA 3WXVL 3QDGD 2IFFL 4Z0BH 3EDKA 1G1YA 5F96L 1F97A 3UBXB 4K8RC 5FCUL 5ID1B 5L2KD 1GOFA 3GRWH 1KXQE 5GS2H 1H9VA 3I75A 5BVPL 4ZTPL 2FJFB 3OKMA 4FQQB 5FUZL 1I9IH 5GGVH 1T7WA 1YMMA 5IMKA 5ACMA 3NA9H 1JTPA 1IBGL 1FN4B 2FECL 4LVHC 4YXKL 2A6KB 1N5YL 4D3CL 1MI5B 5ICZA 2D31A 3RDTD 2ZWLT 3W5NA 4YPGB 2WP3O 5EO0A 2V2WA 4HF5L 4CN6A 4RMSA 2YPKB 1H0DA 4PD4J 3PJSB 2V5MA 4FHBD 2BXYA 3QCTL 2X05A 2ZOKB 1MFAH 2XZQH 4XHQA 3O2VH 4WNQA 3V7MA 5IOPA 2NY5L 3MRGB 5I17B 1KTLB 4MCYA 3G6JA 5E6IB 4EI6B 1AP2B 3GMOB 3DETC 2CUIA 5DD0L 3G5VA 4IIQA 1A02N 4PG2C 2UZYB 4Y4FC 3VI3F 1FNAA 5L8KB 4ODTL 1QG3A 3EYUH 3HPLB 1BOYA 1MLBA 3NAAL 4KDTC 2FWOB 2DYPA 2Q86A 3NZ8A 1T1XB 5C9KA 5EC1A 4JRYA 1A6WL 4MS8D 1JZ4A 3D85B 5FA3A 4CL7A 5ALCH 3EGSA 2X4TB 4D0CA 2NXYB 5ABDE 3FB6B 1U8KB 1V5JA 1ORQB 5E8PA 1A5FL 5BS0E 4M7JL 3TVMA 5BZDA 4WI4A 3IDGB 4PRHA 5ESQB 4CVXB 4NQEB 5TDNB 2DI9A 2JB5L 2JJTC 1HYSD 2X9WA 2QSCH 3SOBL 5BXFB 4NQVB 4XAWH 1CTOA 1LQSR 4HH8A 3TWCL 2EDXA 5CFHA 1MSPA 4XPHH 3IFPA 1GGIH 2DLIA 5TF0A 1RSFA 1BQHG 3QPQD 3W0WE 1I1AA 5MEPA 3DTXA 3HZMA 1T4KB 4U1KA 5EB9A 3G5YB 4H88H 4CBPA 1JF6A 1CGVA 1H3UA 4B50A 4JQVC 4ERSL 5C0CA 2YXMA 1U3YA 1EAJA 1EIBA 4LBEA 1Q1JL 3QEQB 3WEXA 2Z0BA 3VFTB 5K9KB 2WM0A 5D6DA 1XF4A 3GKWH 4MVBC 4XPGH 4R2GD 5HDBF 1Z9OA 3KPRB 3P40A 3HZVB 1TQBB 3QFDB 4QNPF 2PW2B 4Y19A 2DLHA 4GAGL 4OZGA 4HH9B 1U93B 1KIPB 4LCCA 1UB5A 2NY0D 2AS5M 5HYQB 3WDJA 1D5BB 4GQ9H 2O26U 1OGTA 4N0UE 3PV6B 3S35H 1AHWC 4PRDA 4FQCL 4QRPE 4R0LB 4XCCH 2AJUL 5D7KE 5FHBH 3SKJL 3WL9B 4LSRL 1YN6A 3U46B 1FVCB 3SN6N 2IFGA 2ENYA 5KZCB 2FX8L 1UM5H 3MJGX 5E7BA 1TJHH 4GRLC 5GS1B 1JNNL 2NY1B 2P47B 3FQXA 1IARB 4KUCF 4MQ7A 1GGBL 3S3JA 1XGQA 2AJ3A 2YWZA 4XHJC 4MSWA 1RJYB 4RDQF 4G6KH 3UTPE 3DXAD 5DS8A 3INUH 3WHXA 1T20B 5ACZB 2F53D 4NO0A 1OF2A 3NCYS 3V5DB 4DVRL 1EJOL 4APQD 5GS0C 1OY3B 5JIPA 1JGVL 2NY2C 5I6XB 1U92A 4KMTL 1PZ5B 2Q7YB 3PWJA 2R0LL 1CFVL 3BJ91 3ESUF 3GJFB 3FOLA 1T7ZA 4DK6A 1QPPA 1EGJH 2FH8A 3EFDH 1MHHA 3FT4B 3FZUD 4ZXBA 3UP1A 5GXBB 2I27N 4K7PH 2AK4A 1PG7X 1IAKA 2W91A 2LVEA 4D8PB 1EVUA 4BQ9A 1AO7A 1EVTC 2PF6A 3TN0A 4Y16D 4J3WA 3SDXB 1JRHL 2P5WD 5HXMA 3ZL4L 4LEXH 3QIUA 5HHQA 1ZS8A 1WAAE 3UJTH 5L6YH 2UYLB 4TQEL 4HDIA 3MA7A 3QDJD 5FM8A 4C83B 1BIIA 4GKZB 3HMWH 2X5PA 4YX2H 1T6VN 2APXA 2GSIA 1QO3B 4F15B 1E4XH 2VLRE 4YFLI 4ZAKC 3D3VA 4YHZH 4ETYA 1BQHB 1MCLA 1W0WA 1A64A 4G8IB 4GXVL 2A74B 3RHWF 4WTZA 4C4KO 2D4DA 4J3VA 4U1LA 3QZWG 2OMBA 1F4XL 3WJLA 1HHHA 4YDVA 5CLTA 3RHWK 1V7MH 5C09B 3W2DH 5EZIH 1D5ZA 1L0QA 3V52H 5TE7L 3NFSL 1DQLH 1GL4B 1T7VA 1QRNE 2EXWC 2VDOH 4KMLB 4NNPL 2XT1B 4DUWA 1FSKB 2RCSL 4HIHA 1T2QL 3OBAA 3CFKA 3B2UC 3KDMA 3H7BA 3GMMA 1UWEL 2AV7A 3B5HA 4PJ8B 2F8VA 5BZWB 3CLEL 3FQWB 2FB4L 3JWDL 4ZNEA 1MNUH 3E3QE 3BDXA 2YSSB 1T22B 4RGMB 5EN2A 1BAFL 2ADFL 5AWNH 4LP5A 3TH4T 4D0DA 4DFHA 2Q8BH 3VFOB 3QQ4A 4I4WB 1U91B 2B7DT 2VDQL 2DOCA 2NY4D 1J0JA 2FIKA 4QCIA 4I5BA 4P2RE 4XB8A 4PREB 1S9YB 3QISA 2EYTB 3O8XB 3VDBA 2BSSA 2J8UF 2C3VA 3KYNA 1JBJA 1JPSL 4AJ0A 1LE5A 2VC2H 3LB6C 5MP6H 5JW3H 4BH8B 4WTXA 3QWOA 4ODXA 5AD0B 2D0GA 2JF1A 4M7ZB 4P2QE 1FRGL 1R3JA 4ZQKA 4XCFL 4KKBC 5IBLD 1HZHL 3ULUH 1A3LH 4RGNC 4UIKL 4YK4B 4UT9L 2ZPKL 2HT2D 3T0EB 1VACA 3VFSB 1NAMA 4DVBB 3NABH 2ATKA 5F7UA 3QH3A 4HBCL 4NZTH 2VDLL 4PYGA 4C57C 1UXWB 2A1WL 3H3BC 2BOBB 5CD5C 1DBKL 3OKLB 4MAUH 4NQDB 5CKGA 4HWBL 3OZ9H 3QNYB 2OI9B 3PGFL 3ULVL 2YD2A 3MR9B 2DLTA 3QUYD 4H8WC 1JZ5A 3TH2T 1HH9A 1CD0A 3K0WA 1XR9A 1GC1C 1I8IA 4JN2A 5IVXE 2PXYD 1OSZA 4KAQL 2P48B 3W39B 4PY8J 5T33L 1V8HA 1AJ7H 4H20L 1TZHA 3BQUC 4WVRA 3DX6B 4H26A 3O11A 5T5NG 2Q8AH 4MQXC 4NHCH 3WN5C 3T77A 5IV2B 4LPUA 3HI5H 1UKSA 2VDNL 3K2UH 1DFBL 3VD5A 2V7NA 4M1DH 4ZUTA 5IP4A 3MV7D 5IMLA 3VW3L 4U0QB 1R3LB 1IGCL 4R96A 2HVKB 5EU5A 4WWKC 3RKDC 1T7XA 3QZWB 3MLWH 1U9KA 4M9OA 2NMSA 3VE0A 4O2CA 1NANI 3M8OH 2A6JB 5E2VL 1NLDL 3DO7A 4HWBA 1RZKL 5I0DA 3ARED 5A2LH 4LAQL 2AGJL 5C7XL 2FL5B 1IC7H 1BREA 1OSPL 5GGSY 3REVB 1OGAE 4S1SH 3O6KH 1A7QH 1Y18B 4TUJA 3OJVC 2VDKL 3FAXA 3QXDB 3I6GA 2I9LA 5D93B 2E9JA 3RWEB 2HKHL 3BE1L 4X7SH 5HHNA 3OAUL 4KZDH 1G6RH 3WUWA 1FG2B 4PRIE 2LTQC 3L7FB 4LRNL 5I73B 1A6AA 1MHPL 3S7GA 1KELH 4G42B 3VXUB 4I1NB 4L9DA 3LN4B 5BRZD 4FMFA 4EOWL 1DBAL 3V79C 1NC2D 2YPLD 3ZKMC 3V4UH 1L0XA 4PJEE 2ZUQC 3DBXB 3DVNB 2VERN 2YUVA 5FYJE 5TE4L 2NLJA 1A6TA 3RVWC 3R06B 5TDOA 3BWAB 2APVA 3TYGL 1W72H 3BUYA 4C56E 4U6HB 4LVNB 4IRSD 3GO1H 4LPWA 2HLFC 3D48R 1F3DH 5IFJA 4MXWH 5IIEA 5GSRA 2NX5B 3MCG1 25C8L 1X5JA 5SWSE 5C0BE 1MQKH 4PJDE 4PLOB 4LSSH 2VYRE 4PJFF 2BZDA 2PO6A 3JTSA 1RY7B 3QHZH 4H0GA 3DRTB 1J1OL 3WFDL 4QGYA 4WI2A 1WICA 4JRXD 1S7XB 4UOJA 1DDHB 1Y6NR 2Q6WA 1WCBA 4O2EB 5CJQH 3NIGF 2YEZB 5C0EA 1P84K 1QYGH 3ARBD 3LKRB 3T65B 3UJIL 1YEEH 3EOTH 5HGDB 4KZEH 4BELD 4JPVL 3LZFL 5LCVH 4JKPH 4BQ8A 2AJXH 5DO2C 3RVUD 4PGZA 5DJCA 5C0RH 3U30B 2X9YA 4OQ1A 1JPTL 2E6JA 1BMGA 3P2TA 4KTDH 5L88L 3Q6GH 2Y7QA 5DQJA 4XPBH 4RNRA 3OX8B 2IJ0C 2P46B 4IHOB 3J7HA 3P4LA 4KJQC 4MWFB 3QXVA 3NZHL 4MAYD 1BFVL 4FMKA 1F3RB 3SKOA 4RX4D 4EI5C 4M93B 1BFOB 2DL9A 2UZIL 1KPRA 2NY6C 1I9JH 5I9QB 1C1EL 4ODBD 5DJZB 3T4YB 1I1YA 4AZ8A 4YNYA 1QFWM 5I1DA 1LP9B 4Y2DA 4ELMB 4JFXB 4GOSA 3BGMA 1MQ8A 1KPVA 1UWGH 2FEDC 2X4OA 5GGRA 2C4FU 5HHOB 4DQOH 2BSRA 4WFGD 4QRRE 3DSFL 4GS7B 4LPCA 1AC0A 4FOMA 3SGEH 1ZHBB 2IC2A 1U42A 2Q3AA 2VKXA 4KQ3L 4EDWL 1A7RL 2VLRD 2E7LA 2VB5A 3I3EA 1M71B 1I4FB 3DMMA 5I18L 2NYYD 1J8HA 4N0FA 1B0RA 5C6TL 1IJ9A 3VI4F 4X98B 2CLRA 4IS6A 3V9FA 2CDFA 1S7VA 4R7DA 5E8EA 5GGRY 5JPMA 4KVNH 1GAFH 1NC4A 3ZE1F 4YR6B 1CD9B 2EDJA 4FN0A 5I1IH 3EYVB 3CXHK 4ZG1A 2BNRA 1NKOA 1PYWB 1FNSL 1P4IL 4EN3B 2EYRB 4CVWA 1DLHA 5KSBB 3NCYP 2IPUK 3MA9L 1EHXA 2UWEA 3U0WH 1MY7A 4KUZH 3SCMC 4RAVB 4XCNB 4OIIL 5MEQB 1H5BB 3CGTA 4M8QB 1BFTA 3VXOB 5D1QA 4DGIH 1DBBH 4LVEA 4I2XA 3BZFB 3IXAA 1QTYT 2YD5A 4P9HL 1MOEA 4Z7OF 2O5XL 1LDSA 4PJCE 2YS4A 4P2OA 4F2MB 2CLZB 4TSBL 5DRNA 12E8L 4XP6H 1WCQA 4YZFF 5CIPH 4XBGA 4ALAL 3OKDA 3QIWD 4U7SA 4JY5H 2BDNH 4RAUA 3SE4C 1AFVL 4Z78B 1CLYL 3BO8B 1RK1B 5E9DA 3C5ZD 3AY4A 4OM0L 2EDBA 3RA7L 5T1DL 3HC0A 1C5CL 1AXTH 4KGJA 5T1MA 4P2QD 3QEUA 4HUWA 3ZTJH 1N6VA 3CDGA 1U8MA 4HGWA 3KVQA 1P7HL 1MHEA 2YUWA 1QZ1A 4XZUB 2VO5A 3KPPA 5JXEA 3TPKA 1UXSA 5TGBB 4GBXC 1UYWL 1S7RA 1HHGB 4BH7B 1QSEA 4XWGH 1VKXA 1QBBA 2R4RL 2MPAL 1RJZA 2KBGA 2RR3A 2WSKA 5D2LF 4XNXH 5ISZB 4XC1H 2NY7L 5CHNA 3DGGA 4M6AA 1T80A 1CICC 2VXUL 3HNSL 3GUTA 3RNKB 3FAWA 3X13B 3PWVB 1J0HA 3O3DB 3KNBA 4PIRF 1IAII 1VEOA 3I6LE 4UAOC 1OTUC 1J88A 8FABB 4TTGA 4ZFFB 4NO5A 3UPCA 1U8JB 1NGPH 4UINL 5D7JC 1HKFA 3EYQC 4JO4H 4NO3A 3R0NA 2WUBL 4PGCA 4F58H 5JIKA 4BFIB 4XAKE 4XPTH 3CDFA 1Z6JT 1JF5A 2ZJSL 5DZOA 3Q2CA 3HB3C 2V9TA 4YDJB 4JGMA 2H1PH 3L3HB 4JKKA 4YHIB 2ARJA 1H3PL 2ZSWB 4KK9C 5FGCE 5I2IB 5D1ZB 5HYJE 2DI8A 5CILH 1I8LC 2FO4B 4NP4L 3BPCB 2F54A 2FR4B 3KPNB 4PB0H 4M4RA 2P7TA 2Z4QA 3WDHA 3TNMA 4GXUM 3P73B 5IBTL 4JR9L 1WFUA 1OGAD 3DX7A 1DVFA 2CIKB 2DM3A 3VD9A 1YNTB 2R15A 3B83A 2Z8SA 2VZ1A 5J9PB 1UKQA 3LHPL 1BJMA 5JW4Q 4QWWD 3ARQA 1GIGH 4UTBH 3KJ6H 4KPHL 1HINH 3K81A 2AJSL 3GSOB 1VGEH 4YHKH 3Q1SH 1MRDL 1FCCA 3HNTH 4IRJC 2ZG1A 1ZVHA 1ZEAL 5DFWH 3IDMB 2C1OB 4PLJD 4R8WL 3S37L 5FHAL 5J13B 3VH8G 3HG1D 1SJXA 2XIDA 3IAPA 4FNLL 4FQ2L 4HJ0C 4PRNB 5HDBE 1N4XH 5IMOA 3X3FL 4JQXA 1L9MA 2MWCA 3IAQA 4M48L 4PRBA 4U7MA 5ICYA 5HPOA 5DJ6A 2V2XB 3OXRA 5T1LB 4QNPE 3TWCH 4ZPTA 4OCSL 3ARDC 3MRLA 3NN8A 3PABA 5INCA 2BSTA 3W9EA 4ONOA 3VXMB 3MRCB 3W9DB 1U58B 5GZNC 4TSAH 4OTXL 5C0BD 3BZEB 4X6DF 3MOAH 3UTZB 1HHIA 2HLAB 4HV8A 2AABL 2IANA 3MTRA 4PV8B 3BSZL 3T8XA 4V1DB 3U6RA 2BCKA 2BJMH 5CEXA 4PGBB 5DURD 4OKVB 3U0PA 1U0QA 2RGSA 3AAZA 5E95B 5JIHA 5FKAB 5DYOA 7CGTA 5E2TH 3NBNA 5GRJL 2VLME 4Z0XA 2IALB 4OZHF 3ULUE 4CDGC 5IW6A 1LO3H 1AR1C 1R6VA 4NFCA 4FTVD 4HXBH 1DZBA 1WC7B 4AENB 5IT2L 4G8FA 1PVHA 3BP4B 4NZRL 4QHMA 5GHWH 4FZ8H 3MBEC 4ZS6D 1ZA6B 3D69B 4NKIH 4MX7A 1I8MA 2G2RA 3STBA 3VFGH 3RX8A 1LMKA 3F8UB 5C0JA 4I3RH 2YD8A 3EO9H 4J1UA 2HWZL 5EOQL 1PQZB 4BUGA 4NWUL 5HGAB 1CGSL 4JDTL 4HC1L 3S4SG 1MPAL 4JFED 3M45A 1NMBL 3X14A 1TJIL 4CMHB 2E9IA 4Y4HD 3G04A 1MIML 1U8NA 3SDDD 3GIVA 5GZOD 3KPSE 3EJYC 4PJBB 4QTHA 3P4MB 1TQCB 5F9OH 5JLZA 2PCPA 4CDHA 1INDL 5I8CB 2BVQB 1QSFA 5IVZA 4DZ8B 1PY4A 5JO5A 4JFFA 3BEVB 3S36L 3ARVA 2GAZB 2VR9A 1VFBB 3BDYL 4NRZB 1MFBH 1OM3H 3CVIL 4PTTA 3U7YL 1ZANL 1FH5L 4YAQA 4JE4B 5JQ6H 2G9HB 3PHQB 3P9LA 2DD8H 1N8ZA 4K8RH 1AE6H 5AUMA 1RFDL 2YD4A 1ZHLA 1BD2E 1I9RL 1RUQH 1FDLH 4GBXA 2X4SB 1P5UA 4HC1A 2FZ3A 4GW1B 3THMH 4WHYG 3OAZK 4XNQA 4OCYL 1GGYA 3GK8H 3G9AB 5D2NB 4X6BB 4X6CF 5ERWA 4BZ1L 4OGXH 1BGXH 2NNAB 1D5XB 1G9ML 2XOTA 1RIUH 1BEYL 1JI1A 1ZSDA 3T4AB 2QHRL 3V4VH 5C0NC 2ADJA 2GKIA 4OFPA 4Y1AD 3IKKA 3VH8B 3NTCH 4FABL 4MJ5B 5F3BB 32C2A 4TOYH 4Z5RB 1CWVA 5EU6D 3GGWA 3FFDB 1FZKB 2EE6A 5HVGB 4XMLH 2CDGA 4GW5A 5I30H 3STZB 3L5XH 4UDUA 3V7AG 1MJUL 4Y5VA 4OI8A 4OF8A 5EBMB 4P3CH 4OGAD 1JHTB 1LD9A 1R5WA 1MAML 5AYQA 3S88L 2P8PA 1OWRM 1NLBH 4L4TE 4Y89A 2HRLA 1XT5A 3QUXA 5GISH 3UTQB 3PP3K 2WUCL 3O6FC 4QXWA 3CFJA 4G8GB 2AW2A 5FEBA 1U6AL 3S5LA 3SY0B 3V6ZA 3MV9A 2HFGH 1DUZB 2ZG3A 3TBTB 2A9ML 1QR1B 1UB6A 5I8OH 3HC3L 3GSNB 2JJWA 4HUXA 4KK8C 4P23D 1OTSD 3CXDH 1KCRH 2M8XA 1TTUA 2NW2B 4RQQA 5CMAA 5EUOF 5EG6C 3SGJC 2ICES 4RDQG 5TF1H 4WIQA 2CD0A 2BFVL 1JYVA 4WV1B 1MIEH 4F7EB 4FQJH 2J8UE 2RHEA 3H42H 4KKNA 1ZLSH 4HW6A 3VDCA 2IH3A 4WUUE 5DR5H 5F89A 2XN9E 2A0LD 4J3UA 4UNVA 4H1LA 1OP9A 3WFHB 4YWGL 4PLKD 5F6IB 3FQRA 3HLAB 4NFDA 2YPVH 5I19H 2H26B 1U8LA 1RQ5A 3KPLB 3QDMA 4HBQA 5CD3A 1JWSB 1FV1A 1R5VA 4M7LT 4X9HA 1ACZA 1NAMH 2P4AB 3O4LA 5DJAA 1JV5B 4ONGL 2QKIB 3P77B 4G80A 4A2MA 1RVFH 2OXHA 3P0YH 1CGUA 4WO4C 3S4SB 2RAMA 1M4KA 4W4OA 1QHPA 4M02A 4AT6A 1OB1A 3I6LD 1HQRA 2OCFD 4EBQL 3LD8B 3HRZA 5D1XA 5T3ZH 4GKOA 5EPMB 4K2UL 1NDGA 4CJ1A 1S7SA 1XH3B 2L0DA 3RQ3A 5DMIH 1S9WA 1YJDH 4RA3A 4R4BA 5KS9F 1KLGB 4XAKD 5AAWA 2DS4A 4XTRC 1KV3A 3DSNA 4JJ5B 4P59H 1ZA3B 4QHKJ 5HHXH 2DTSA 4DOHE 6FABL 4QOKD 4KROC 4ENED 1A9BA 3IJSA 1XIWD 4ZFZA 3DJ9A 5F71A 3BVNA 4AQ1B 4PGJA 5FM5M 5L2KB 1JI2A 4M5ZH 3TZVC 2C9AA 2J12B 4L8CA 1K5NB 4NQCE 3RJQB 3PL6A 4JO3L 5IB5B 4AEHL 1DJSA 4PJHA 1B9ZA 4NDMA 3OAZH 4Z7WA 1FZMA 5GPRA 1NCDL 4G9FE 3QIBD 4KTEL 4ZUSA 2OK0L 3RDTB 5GS0H 1KEMH 3KR3L 3AM8A 3QUML 4QHLA 5A43C 4XVTL 4N8VA 5CUSH 4WI7A 1WZ1L 3R8BB 5IQ9B 1KJVB 3I3BA 3O2DL 1YMHB 5D70L 5HGGS 1RJLA 2VWEE 4HWNA 4U6YA 4Z7UA 1DQDH 1T6WA 1Q0XH 4FXKB 4CADA 1QD0A 2BHYA 2D2OA 2X89A 2P24A 1OHQA 2Y9RT 4KJWC 5FF6A 4FQXD 4Q0XH 3QXWA 4U1NA 3VGAB 4KDVA 1YPZA 2Y06H 5E6IC 4PJ9D 4L3EA 1TXKA 3PP3H 3QEGH 3TT3H 5E1AB 2WWMD 3VFVB 3HUJA 2H2PD 1GZQB 2VLKA 4HHAA 4J2XA 1IEAA 4FFWC 4LL9A 1FL3B 3BEWA 1T0PB 3HE7A 4NC2B 5TPWL 3EOAB 1E4XI 2NXYC 2VUYA 3QUMA 4MJIE 4K3DH 4KK5D 1WZMA 5GSVB 3RZCD 4P46D 3GSVB 3FCTB 3KXFA 4IOIA 5JHLL 4FG6C 4L1DA 3O2DA 4BSWB 1ZLUK 2VRAA 2YD9A 4PJFE 1KXTB 2IWGA 3MV8D 3DROB 4OF3A 3ULUD 5MI0B 5T3XL 4CJ0A 3I02B 2A83A 5C1MB 2VAAA 5C0GA 1W2KT 1IM3A 1MCIA 4ISVB 5D7IB 4P4KD 2Y6SC 3GIZH 5JA8B 3VXQA 1EHAA 2B1HL 4PJ5A 3P30H 1MRFL 1M6OA 2BK8A 3H0TB 4HKXA 2VABB 2X4RA 1K8IA 2ENSA 5JHDD 4R2GB 3JWDC 4LHJB 1HSBB 3C8KB 1DANU 3F7RA 3OKNB 1DE4B 4U1GB 5KJRH 5D8JL 3X12B 1JHLH 2BY3A 2DWEA 4L29B 3K4AA 4KVCL 3WYRA 2ITCA 1KT2B 1Q94A 4TPRH 5E5MB 4JFOB 1UACL 1HI6B 5C0DA 2AJZB 4Z6AT 3AU1B 3FO1B 3MRBA 1CDHA 5JNYB 5BJTB 5C70A 2I5YL 5LWYL 4O5LH 3QWRD 4MXQC 4R0LC 4R9HA 3LN9A 3MRFB 3ZTNH 4LIQH 4HK0B 3D25A 3L3KA 5CJXC 5EA0L 1N2RB 1K8DA 1UGNA 2HRPL 2J3SA 3F6IA 3H9SA 4S1QH 3MRHB 1A0QL 1WIUA 4JZNB 3FB7B 5GS1C 2NY1C 3UAJC 2E9WA 3PWLB 1EO7A 5DJYA 1M1SA 2PR4H 5JDSA 3DVFA 3DXAB 4ZDHB 3NZHH 3CSYB 1ZTXH 4LCWD 1EAPA 5DJXA 1P1ZB 5CS7A 3MMEA 3FONA 1WFTA 2VN7A 2F53B 4LDLB 3IKCB 5I76B 1WTLA 2PYEE 1JNLH 3EJZC 1NMCB 4NUGH 4APQB 4XWOD 3G08B 2YBRA 4HXAH 4LP4A 5GRVK 1PZUB 1R3KB 5HI5D 2X42A 1NAKL 2DLFL 1A1OB 4FZEL 3OMZA 3TA3D 5TQ0L 4CU7A 4YQXL 5ESAB 4U31A 2J8OA 4PV9B 5I6XC 5T1KB 1QSZA 3ULVC 2DQEL 5AG9A 4KQ3H 2X1WL 1U8QB 4H8WH 4MD4A 2C1PA 2MOVA 3SDAA 4LSDA 1DLFL 2BNQA 4DN4H 2P5WB 1KYOJ 5F1IA 4HS6A 5CJ8A 4OLVH 4L4TD 2W0FB 4WY7H 4IMLA 1A7OL 4L5FL 4LSQL 3QDJB 1FVEB 4Z7OE 5JW4M 2E5EA 1WBZA 1RURH 1QBML 4AEIH 5DMGC 1EEYA 1XGTA 2YD7A 4I48B 4M61B 1KN4L 4OFYD 3IXTB 4YZFE 4I18B 2VZTA 1CLOL 2EC9T 1RMFL 5DHXB 3PQYD 2DQDH 4K7FA 3F58H 1IEBB 2R1WB 2WW8A 3O6MH 4JM2C 1S5HB 1VCAA 5GJSL 2XN9D 2CGRH 1CDJA 4ORGA 5CGMA 3RVTC 4FP8L 5B8CA 1KFAL 1LEGA 5D72L 3TCXA 5DJ0A 1C16A 3WSQL 3ZDYF 3A6BH 4MDIB 2FIRT 4YGVB 4IRZL 2JCCA 4X7EC 2WBJB 2YXFA 2YK1L 3BFOA 4ZOEA 3LS5L 2H6PA 3ULSA 1MI5A 1EUTA 4KI5D 4E41B 4YPGA 5J56B 3OSKA 1M7DB 2FYYB 3VG0H 4Z8FH 1FSKC 2KUTA 3VGEA 1LK2B 2Z35A 3U2SB 2VXQL 4O2FB 3D39E 5D2LE 5CSBA 2HFTA 5EOTB 1ZAGA 4NCDA 1FZOA 1EFQA 1MVUB 4YUEL 2AK4E 3VXSA 4PJ8C 1AO7E 4PB9L 3U7WL 4XP9L 1OAXL 4P5TA 1RHHB 2NTSP 2RBLA 4M62L 2NY4B 3OPZL 4RGMC 4Y5YB 1NBVH 4HKZB 5LXGH 4M43H 1S7TB 4F7TB 4QEGA 4Y0GA 4M6MH 4PP1C 2X4TA 5LQBL 5KVFH 4IJ3B 4LOUD 5J4MA 2P5ED 2W92A 1ZMYA 2DN7A 5DEZA 3O45A 4YXLH 1TPXB 4NWTH 4CVXA 1SJEA 4H0HB 4NM4L 3IVKB 3QUZA 2Z91B 2H41A 3QP3A 4TUKH 1TZGH 4JVWA 3EZJB 2LU3A 4Z7QF 3CIQA 2DJUA 2OTWB 4M7ZC 3RP1A 1HIMH 1SM3H 3LPWA 1NCTA 4HFWA 3PWUA 1YY9C 4BQBA 2QL1A 4JGJA 5CZXC 1KCLA 3S3PA 3D2UA 4TULL 3HC4H 2I07B 3EDEA 3MLZH 2CKBL 4YK4C 4NN6B 4WW2A 4TVSa 5DUML 1VFUA 5AZ2L 4WUKL 4N5EC 1CK0H 3OR7B 5DHVB 4HX1B 1IL1B 3T0EC 2NPLX 4S0TD 2VLJE 2VXSL 2DLEA 3QEQA 1PFCA 1CDGA 1QKZL 1SVZA 5CWSA 3V4PL 3QUYB 2WP3T 2H32H 4OLYL 2VDRH 4S1DD 3KHQA 4Y4KD 3RL2B 1B2WH 5I8EB 4L4JA 1S9XA 1JGUL 2OI9C 3HZVA 1MLCA 5M94B 3I9GL 2MHAB 3EDDA 3HI1B 2X70A 4WW1B 1BIHA 1J12A 1CZ8H 2G75A 5IKCB 4HH9A 1KIPA 2EXYC 4L4VA 3SGEI 1C12A 2EDRA 5K9OB 3RPKA 2ERJC 1U3HD 4XBPA 3PV6A 5KSUA 2EH7L 4MQTB 3MV7B 4XVSH 1VADB 2A77H 4K07A 1QLFA 3GSXB 1B88A 1NGXB 4ZS7L 1QRKA 5IGXH 2CKBA 4LCUA 2JIXA 3MUGB 4QRQB 4OCXH 3X3GH 1N6QL 1E4WH 5EORL 1WK0A 4X6DE 2AXGB 5ADOL 1KCVL 2AAVA 4U1JB 3AREB 1IGFH 2ARWA 3BZ4B 3TBYB 5IM7B 5IEHB 3S36X 4P57A 4Q9QL 1F6LL 1S7QB 1E6JH 3MRPB 4PJIA 1J0YA 3GMPB 3NH7L 3OKOA 5E2WH 1J18A 4BSVB 1IC5H 4M3KB 1YMMD 4KWUA 5F7DB 3MXVL 1QBLL 3ALPA 3H2WA 3O9WD 3U9PL 4OQTH 2E9BA 4OZHE 5JXAH 4OZFH 4YHMH 1A2YB 1U8PA 3O6LH 3GM0A 4ODHL 3V0WH 2AI0L 1WT5A 4U3XA 2IGFL 1Q0YH 4Q7DA 5D93C 4B0MM 3GDBA 3MROB 2EO1A 1P9MA 2W9LA 3QHFL 1LEIB 1I9EA 4P9HC 5BRZB 3CX5J 1CXHA 1A1NB 1U8OB 1NC2B 2YPLB 5H94B 3MNWA 4MA1C 2DQIL 5T3ZE 5HGBA 2DYPD 3G5ZB 4E5XA 4JRYD 2X44D 1BZ7B 2ZUTA 4IRSB 4KI1A 1AH1A 4UUJB 1FAKT 2P44B 3EFFA 5AYUH 4BKLB 1A7PH 5F9JB 4C83A 4U3HA 4LVNC 3EYSL 3TVMD 4PRHD 4GQPH 4LSTH 4HLZG 3B9EA 3ILQD 5KVGL 5MEOB 3CC5A 1FORH 3LMJH 4JRXB 1Q9KB 3MRMB 1A6VL 2LFGA 3BN3B 3ARBB 1GHFL 2HTKC 4NPYA 4X7DC 4YXHH 2PYED 1HKLH 1YEKL 5E03A 5HHPA 1I1AD 4R4FL 5D5MB 5DQ9A 1OAKL 4ODUA 1OPGL 2AKRA 4KKCC 1XF5A 1FNHA 3T2NL 1BBDH 3L3DB 4OGYH 1NEZB 5C0CD 4JREC 4AEEA 3TBSA 3U30C 4LASH 3BD3A 4MAYB 4X6CE 4NKOB 1YA5A 2E7MA 1BZQK 4NIKB 3OB8A 1GRWA 5GJTH 1EK3A 1Y6KR 1GH7A 3FO2B 3MLTA 3FQWA 1NCWL 4M93C 4Y19D 2GITB 5I9QC 1YEDB 3TIEA 1FAIH 4UU9A 1JYWA 5CAYB 1CDCA 4DGYH 1BJ1J 4JN1H 5F6HI 3GHEH 1REIA 1A9EB 1FIGL 1U91A 4NZJA 2X4NA 3UTSE 4DN3L 3L3GA 5IW1A 1FBIL 4GS7C 1GGTA 4K23H 1K4DB 1FE8H 1SJVA 4A6YB 4DWHA 4F7MB 1RU9L 4G8EB 5I1EL 4OCYH 5BV7B 4PREA 4Q6IB 4YFEA 3O8XA 3HR5B 1G7QB 2OJZL 1KB9J 1MJ7L 1Z0NA 2BVTA 2QQLL 1QLEL 1KNOA 2RFXB 5GRXG 2A38A 5JTWA 1RHFA 3MJ7B 3SKMB 2GTWA 4YEFA 4LNRB 3CU7A 1I7ZB 5AD0A 2IEPA 5BOPA 4QHUA 2W9EH 3KYMB 4RISH 4C4KT 5IVOA 4PBXA 3ARRA 1L4IA 2JTDA 5FB8B 4N0CC 3QYCA 4NO0D 4DAGH 1Q9WA 2EIZB 2GQHA 4RSVA 2HYMA 5M7QA 3IJHA 3HZKB 4GT7A 3VWKA 1HH6B 5GQBA 4DVBA 2EIBA 4F3FA 4PGEA 5HVWA 1NMAL 1Z3GL 1UXWA 4ZXBD 4G3YL 2BOBA 2F58L 1N0XL 3ARGA 3K4ZA 3LKPA 3GSRB 3IFOA 4DKAA 2AK4D 3VFWA 3EYOA 3QNYA 4LCIH 5JOPE 3IF1A 1AO7D 5BS0A 3UO1H 1H5BC 3TN0D 5E99H 3IDIB 3RWIB 5D9SB 3L5JA 3PXJA 3T1WA 2PW1B 4L8SA 4M7KL 2LE9A 2W65B 3QIUD 3MO1B 3RTQA 3TNNB 2YD3A 2AXFB 3QIWB 4MJ4A 3QG6B 4X99A 1PLGL 5GRZA 4PJXF 4DEPC 2BVEA 5B3NA 2QEJA 1FNGB 2BXZA 4PJAF 2F9BT 4M03A 3W0WA 3C5ZB 5KS9E 4BJLA 2XQBH 5FGBC 1CN4A 4PD4K 1YEIL 4PR5A 1S5IH 4LVHB 3P0GB 4MZ3A 4XRCB 1YYLL 1T03L 1O7VA 3DWTA 2WBKA 3D3VD 4NJAL 2HJFB 2SEBB 4M1GH 3RWDB 3C5SB 3PG2A 4UQ3B 3F62A 2A6JA 4HZLB 5DI8B 4HWEH 1IE5A 2BVOB 3KPOB 1X5KA 4IDJL 3H3PL 1EERB 3WFBH 1FIEA 2IQAA 4RGNE 2XWJA 4Y4FB 2ZOLB 1G7JA 2FL5A 3FQUB 3MRKB 1IAOA 5SWZE 1IC4L 4M1CC 3RU8L 4XNMB 3DUUA 1PSKH 4D0BB 4QRPA 3OJDA 1XCTB 4AQOA 2R0ZL 3HNVL 43CAA 4LHUA 1LEKB 1IGTA 5ETUB 1XMWA 4U1HA 1T1ZB 3L7FA 2R0WH 5F97E 4ZSOB 4H25B 5LGHL 5BW7A 3NGBB 4ONFH 3VXUA 1P53A 3QJHB 4JM4L 4DW2H 1JPFA 5I1CL 2VJXA 5ITFA 2R56H 1KN2L 1HQ4A 1ORSB 1VEMA 2EDFA 1INEL 2MJWA 3DBXA 1S78C 5IFAL 3V2AR 3BWAA 4I3SL 3BH9A 4GMTL 1BQUA 3X17A 3FMGL 4U6HA 5I1JH 4QTIH 1U8HB 2IH1B 1R24B 5DMJB 5FDWB 3MLUH 5KANI 5E9DE 1OD9A 3RVVD 4BUHA 3LEVH 4LLUA 5B3JF 2B4CL 2HT4C 5CGYD 4YHOL 1G7MA 5F21B 2CIIB 5C2BL 1OT2A 1EHNA 3QG7L 5A40E 3P11L 5D1ZC 1KTKE 1DDHA 1OAZL 2VZVA 4D9RE 1B6UA 5INDA 2R29H 4GRMA 3JWNC 1MCDA 4OB5H 3I50H 3V8OA 2LU4A 4Y5XB 2VH5H 4Z77A 3V6FA 1MWAB 4YDLC 3WIIH 2H2SD 5AZEL 5KG9A 3C2SA 3MRQB 3TT1H 1AI1H 5ADPL 3A6CL 1WAAA 4QXUL 1F90H 1GVIA 4TNWK 1ZVSA 2XNAA 2YHGA 4IHOA 5FO8A 3HCVB 4LLWB 3WIHL 3CK0H 5F8RC 1UENA 1ONQA 5C9JB 3HG1B 3VA6A 3NCMA 1CU4H 3MRIB 1YNKL 2BMKB 1D3CA 2VLRA 2ZCKL 5ACLA 1MHCA 5J13C 4NSKA 5EFIA 1I1FA 5IBUG 5HGHB 5KW9H 1JIBA 4LDOB 4U0RC 4U1MB 1UZ6F 4FXGB 2ED8A 4JY4B 5JDJA 5EOCH 1BHGA 1IQDB 4YEEA 2NW3B 5IEKB 3BP7B 1IAIL 3DV4B 3LEXA 5GGTA 3IDNB 4AMKH 3C5JB 2DKUA 3FQNA 2MCG1 5CBAB 5DFTA 4S1RL 5TQ2H 3OHXB 3Q48A 3QCVH 4HKJB 3SE3C 1QRNA 5HDQL 5IB3A 3BX7C 5DURB 2X4QB 1I4FA 4LU5L 3T0WA 3TYFB 4CVZA 4PS4L 3L1OH 2HKFL 1YQ2A 5JMRA 3WS3B 1IGIL 1SMAA 3U4BL 3E6HA 3GI9L 1BVLA 4FTVB 3MLXH 4X80H 3N9GL 4I0PC 3VRIA 3ZHLA 1LGVA 3CH8A 3FO9A 4MMZC 1T89C 4URTB 5GGQH 4NN7C 2EDQA 1N5AB 5E8NA 3AVEA 3O3EB 2GFBB 4EN3A 1TLKA 1RULH 4OT1L 4U6XA 4WI3A 4ONHA 5KSBA 4WEMB 4NZUH 3LKOB 3NCCB 4M4PA 2P43B 5IVNA 4P2RA 4YO0A 1G9NC 1KIQA 2B2XL 5MEQA 4JFEB 4OFIA 3LKNB 1ZE3C 5E2JA 4ZFOB 3VGGA 5DD1H 3SKNB 4J4PC 2BC4B 1A6ZB 2BRQA 1G0DA 4Y4HB 3TO2A 5EUOB 1J11A 3MCLH 1W0VB 4YLQT 1FFNB 4P5MA 2RIKA 5DD3H 4AEFA 1TZIB 2BSED 1RUML 4NOBA 2VQTA 3R1GH 4P2QA 3OTTA 1MFEH 3VJ6A 4CMHC 1OW0A 3MOQA 3HA0A 4AL8L 1T21A 4OJFL 4XBEL 4J7RA 1TQCC 1IFHH 3CCHB 4G6AC 3QEHB 4Z78A 4MGXA 3LQZB 1X4YA 3BO8A 3U4EB 2PO6D 2A6DA 3S34H 1T5WB 2CRMA 1AGFA 2IANE 4C59B 4X9BA 4J8RA 1UEMA 1EHLH 5C07E 5TDPB 3WLWD 4D9LH 5IR1B 3CFIC 3DURB 3R0MA 1K2DA 1DQML 4PGDB 1YEHH 3TIDA 1JMZA 3LSOB 4ZUWA 1RZIB 1UQSB 3BGAA 1MCQA 4JY6B 4JQIL 2EDLA 3ZDYE 2O5ZL 4HPYL 3ULVF 1HEZA 3V6OC 1PY9A 1QFUL 3KPTA 2R2BB 4Y1AB 2HMID 1TVHB 3FRUB 1JZ6A 1S9KC 1QOKA 5BO1L 3U36B 15C8H 5HVHB 1KTRL 2OQJA 5EU6B 4PY7B 3VXNA 3GJFK 5DWUH 5JOPD 3MRRA 5IBUB 1GGCH 2XA8H 1AD0B 1RZGA 2W0LA 4Y2DD 5JQHC 4JFHD 3O41A 4U05A 3RNKA 5KSVB 2N56A 3S9DB 4YIQB 3RWGA 4RMWA 2APWA 5EWIL 3PWVA 1S7WB 2ZCHH 3SDXF 1IKNC 3GBNL 3WMSA 2XTJD 5HJ3A 1U8JA 4TSCH 4LLQA 5FYJL 3BD5A 4KKLD 2D03L 4ZUVA 1NFDB 4Z7VB 2OP4H 4ZTOH 3MCKA 4Q9RL 4P23B 2QHLA 1A3RL 1HXYB 1QSFE 4JM2F 2ADIB 4OD1L 5DZLA 3PIQB 1BZ9A 3DMMD 3FN9A 1J8HD 4YH6A 1RZJL 3L3HA 4LPYA 1ADQH 1ED3B 2R9HC 3P0VL 2DF3A 1E4KA 2OL3B 4QXGL 3G6DL 3RY6A 2B1AH 4WV1C 3WS6A 5IW3A 1HWHB 1MCFA 3CSBA 4Z0BL 5IB1B 4PRIA 1Z0MA 4PRPE 3MLYH 1DEEB 1UKTA 4G9DA 2E7HA 5EIIA 5JMOC 1NC4D 1NCNA 1UJ3A 1XF1A 1LO0H 2ICWI 2A9NH 3GRWL 4UV4H 2Z31C 4Z7QE 2VZ3A 2BNRD 2AJVH 5EUKA 1FO0B 1I9IL 5GGVL 4PJEA 3NA9L 1EMTH 5GRYA 3VWJA 1YNTA 4GAYB 1TJGL 3O4OB 4MB4A 3WN5B 1OAQH 5FO7A 3V5KA 2HTLC 4R90H 5DHYB 5MERB 3DIFB 3MNVB 4C56A 2WLZA 3ELAT 1F4WL 1JPGA 4YBLC 4OV5B 3EO1B 5D1QD 4F7PA 2FX7H 3CVHB 3IDMA 4NRXB 4WJ5A 1MFAL 5SWSA 1FGVH 2XZQL 2X1QA 1WITA 1T3FA 1VDGA 3O2VL 2IAMA 4FFVC 4EXPX 3MREB 3BQUD 3LD8C 4P2OD 2YWYA 1LE9B 4PRNA 4RIRA 3B3IB 2FJHA 4UOW1 5I1GH 5HYIA 4HMDA 5IMMB 3EYUL 3M1BB 2BY2A 3HE6A 4L3CB 4KKAC 4JO2H 2O93L 4HGMA 1ZT4B 1K6QH 4QOKB 5HPMB 2XG5A 1I3GH 3VXMA 5ALCL 4ELKB 4WWKD 3Q3GB 1AC6A 5E9DD 3D87B 2BHUA 4GH7B 1XIWB 4L8DA 2ZZUT 2ZNWA 3KPQB 1A1MA 3UTZA 2ESVE 3ARFA 2LU7A 4QRUB 4V1DA 5IHUH 1SYSA 1CT8A 5D7LE 4OD3H 2OBGA 2QSCL 4QF1B 1FFQA 4OLYH 4D9RD 5BMFH 4MHHG 1UH3A 4HT1H 5FFLA 5JXED 5EBLA 3QIBB 4XAWL 2Z8VC 3RGVA 2W9DH 1CFNB 2XWTA 1JGUH 4XPHL 5MHSE 2X1XR 1GGIL 1MREH 2MMXA 3IGAA 1FLRH 1E27A 2W0KA 1RI8A 4H88L 2AV1B 5DRZB 3RDTC 3TCLB 4QRRA 4HWZA 1EX0A 2V7HB 3OWEA 3WHE1 2ATPA 2QQKH 2ZNXA 3B8YA 3GMRB 5I74B 3C6LA 1J1PH 3KLHD 3GJFH 3PUCA 5GGVY 3CUPB 2EH8H 5C08E 1FYTE 2NY3D 5J12B 4NQSB 3R4DA 3QR2A 1CBVH 1I7UB 1JGEB 5TJWK 3GKWL 1JF1B 3D6GA 1YUHB 3RUGF 3BOVA 5BCAA 1WSST 4I0KA 4XPGL 1NBZA 1CF8H 1II4E 4YHYB 1N59B 2DWDB 3K3QA 3ETBF 2ZG2A 3BKJH 4DCQB 1IT9H 2YRPA 3JWOC 3QFJE 3VGAC 1OOAA 4P9MH 3TO4A 4HKBA 1CFQA 1SYVA 3LRGA 3MV01 4GQ9L 4LSPH 4MS8C 3HKFA 1A47A 3B9KA 3S35L 2VMFA 4XCCL 4PJBA 5FHBL 1XF3B 4QRTA 4UT7H 5IFHH 3OG6B 3QO0A 1S8DB 3LIZH 2I24N 4YBQD 4HSQA 3BDBA 3RZCB 5CCKH 4P46B 2EZ0D 4JKWA 4WHCA 3VGDA 1NFIA 4MNGB 1UM5L 1VFBA 1TJHL 1RZFH 2R1YA 3OKEB 4JG1H 1A6UH 3MV8B 1K4CB 1HYSC 3PGDA 1C7SA 1VPOH 3NCJH 2O61A 4WWID 1JZ8A 3QRGH 5F7HA 1URLA 2F54D 2QQNH 4EI5B 1YDPA 4Z76A 1FFOA 5LBSH 3QPQC 4G6KL 1EV2E 2YRZA 4CMMA 2Q3ZA 3INUL 5MI0C 1CVRA 5KVDH 3MRNA 2P8MB 4HG4K 1DVFD 2VXVH 5FYJU 3B8SA 3MGTB 4HIEB 3MFFB 5DSCA 1WEJH 5DDHB 4PJCA 5D2NA 2WIIA 4ZO6A 4BM7A 4E0RA 5BVJA 1ZLWH 2DQFB 4JDZB 3P9MB 3VXRE 5JHDB 5GS3A 5LAXA 1B4RA 3S96A 3T4AA 1KJMA 3K7UA 2XRAH 4WFED 5FO9A 3NPZB 3VXPB 4ODWB 5JW5A 1EBAA 1EXUA 1FLTX 1ZHNB 1FP5A 1VFAB 1EGJL 3EFDL 4R2GC 5DRXA 4LLMB 2VZOA 1F4YH 3SGKA 4Z5RA 5ENWB 1D9KA 2JLLA 4K7PL 1HDMB 4U1GC 5KBNC 2NY0C 1XF2B 3MJ8B 3T0DA 5HHME 2MCPH 5DMYA 4L3EE 5IHZB 3MRJB 4QO1A 4LEXL 3UJTL 5L6YL 3JVGA 3TBTA 2XZZA 3VFMB 3HMWL 1FPTH 3OKKA 4N1CA 1C5DA 5CKAA 2JB6A 4P48A 2IAND 4ETQB 2UUDK 3JV4A 2GTZB 4YX2L 1R5IA 1CE1H 3FQTA 3N1MC 5DTFB 1JGDB 4GW4A 3RL1A 3RRQA 2OM5A 5ANMB 2IPKB 3QQ3A 3VFNB 4EVNA 1E4XL 4LCWB 5H35B 3T3MF 4FQHA 3ROOB 5HYSG 3LN5B 3ZKND 4GG6B 1EGJA 1X5FA 1DBJH 1Q9LA 1RZ8A 3SPVB 4NNXB 2GSGA 4WFFE 5JOFA 3VXTA 3HLAA 1V7ML 3CD4A 3W2DL 3TA3B 5CSGA 5EZIL 2FCBA 1XGRA 1U2HA 2VL5B 1NMCC 3V52L 4APQC 5J6GB 1BWMA 1DQLL 5CINH 1P7QA 3T1FA 3RWFA 2VDOL 3GB7B 4U4BA 1J7VR 3FZUC 3L3JA 4J6RH 2XPGB 4N9GB 2R0KH 2GJ6A 1AGCA 1LP9F 4ELMF 1BECA 5T5NF 2ILLA 3B9VA 2YC1B 4Y16C 2ITDA 4OM1H 1MNUL 1WBYA 4MNQE 5EPMA 5KN5A 2DTMH 1KXVC 5HYJA 3MYJA 1KJ2B 5AWNL 4K7PY 3C6SA 4RA0C 2Q8BL 2HN7B 1JP5A 3HZYB 2EDDA 2YOCA 1QSFD 1MJ8H 4I77H 3BN9D 4JFFD 3CFBB 4DKDC 5JUEH 1SY6A 3PQYB 4O02H 4XP1H 4PJAE 2DM2A 2BRRH 1NCBH 3H9SE 2VITB 2DQUH 4QY8B 4L3AA 4NJ9H 1Z9MA 3TPUB 5I1KH 2VC2L 2V5YA 5JW3L 5MP6L 2BOCA 4OCWH 4ZODA 3MOBH 4CU8A 5HY9B 4GBXD 3WKML 3N1PC 3ULUL 1A3LL 2D7PA 2A73A 5I0ZA 5TH2A 1F8TH 3GNMH 3RWHA 4FQXA 1YN7B 4DK3A 2YA0A 5ALBH 4OI7A 2BERA 1JFQH 3NABL 5JPNB 2X4PB 1T83A 4NZTL 1JMXA 5DUPH 1H15A 1OP5K 5FCSH 2HFEA 2UY6A 3CDCA 5DZNA 4ZYKB 4MAUL 5E8OB 3SDCA 3OZ9L 5J57B 5E00B 3CMOH 2HAZA 3OXSA 3C9NA 1AKJA 2KZWA 2DBJA 2Y36H 3QUXD 3MXWH 4Y7MA 4HIJB 5E1AA 1BOGA 1AJ7L 3H3PH 3MV9D 2NY4C 4LCYA 4Y5YC 3KPMB 2D0FA 2Q8AL 2P5EB 2HG5A 3IETB 4NHCL 2PTTA 4NO2B 3HI5L 3K2UL 2UUDH 4M1DL 4IJ3C 3TV3H 5DJ8A 1KULA 5HYSB 1G7LA 4UNUA 5GSVA 4PJGB 5C0AE 3SBWC 3MLWL 1QA9B 2H45A 3SKUD 3NFNA 1JE6A 1X7QA 1TPXC 1LO4H 3D0LB 5B3JE 1DUYB 3M8OL 5JR1H 5IBLC 4TUOA 5MHSD 4U6TA 4MXVF 1XCQB 5DK2B 1S7UB 3QDMD 4HCRH 5E08H 1Y0LB 1EEQA 2HT2C 1IC7L 4NYLA 3E0GA 3CZFB 3O4LD 2VISA 1AIFA 4WFHE 4OZIF 4S1SL 3RWJA 3O6KL 1F3DJ 1MI5E 1A7QL 3PHOA 4NN6C 3ROLB 3KPSA 4ZOBA 1XZ0A 2EICA 1FL5A 4Y4KB 5TFSH 1WBXA 1D6EB 4X7SL 5E4IA 4Q97A 4KZDL 1G6RL 1HSBA 2P8LA 3QUYC 2L7UA 2CUMA 3DYMA 4YC2B 5D1XD 5F72S 2EECA 2FJGB 2FBOJ 4LRIC 1KELL 1X4XA 3TBVA 4HEME 3BPLB 1V3LA 3GJEB 1U3HB 4X7TB 2FSEA 3ARDD 5E5MA 2DRUA 3CFCH 1HI6A 4JHBA 1PW3A 2K7PA 3ARPA 3P11H 3V4UL 5E1HB 3MBXH 1BD2A 5BJTA 1JNHB 3HN3A 4XCYB 5GGTH 1UZ6E 1U2CA 4BFEA 5EU3A 1PKQB 1HOCB 1W72L 5CJOH 1GOGA 2APTA 5FK9B 5B38A 3G6AB 3QPXH 4MXWL 3HS0B 2G60H 3ARXA 3F12A 4HULB 5K59F 1MQKL 4LSSL 1L7TH 1MCWW 3MLRH 4NQEE 2GW5A 3QHZL 2CXGA 3I75B 4X7FC 1E6OH 3EW3B 4QHNA 3PL6D 4XNZB 1MH5A 3OKMB 3FFCB 4MD5A 3AREC 5IMKB 1YMMB 4L9LC 4YHNB 5CJQL 5CBEA 2OX5A 4YE4H 3NIDF 5I76A 1QYGL 4W4NA 5ICZB 1YEEL 3BGFC 3EOTL 4H5SA 2D31B 4KZEL 4YBHA 3G08A 4HPOH 4JKPL 5LCVL 2XWBB 3MSPA 2AJXL 3ES6A 5C0RL 5EO9A 1ZGLA 2V5RA 4KTDL 3Q6GL 5T1KA 3UDWC 3QEQE 1BVZA 3I6KA 5IOPB 2YZ1A 1W72A 4XPBL 3ZZ1A 1G0XA 4MCYB 3G6JB 3F7PC 1CQYA 2X89D 1U8QA 1MEXH 3DGCR 3BMWA 1QLRA 5DEFA 1MLBB 2Y07H 5I8KH 3IU3A 3KPRE 3NIFF 1I9JL 2DYPB 4HK3N 3NZ8B 5EC1B 4JRYB 3QQ9D 4L3ED 1SVCP 2E7BA 2J8UA 3EGSB 2B5IB 1UWGL 3U83A 2W0FA 4D0CB 4WUUA 4X8XA 2VLKD 3L5HA 4DQOL 4NBZB 1I3UA 5DEGA 5E8PB 5DMKA 3HE7D 4IRSC 3TVMB 5I71B 4PRHB 4M61A 1OQOA 5L8JB 3IXTA 4I18A 4MNHB 4KU1A 4LHQB 1XGYH 1UCBH 3KXFD 4MB5A 1EZVX 2Y5TA 1NJ9B 1JTOA 3IFPB 5B39G 1QR4A 4X5XB 1I1AB 5SV4A 1RUKH 2X9XA 4WTZG 5E94A 5MEPB 3VD7A 1CFTA 2ZUXA 1AXSA 3DTXB 3ARBC 3HZMB 4U7KA 4U1KB 3LH2H 5K9QG 4LF3A 5D7SL 3KYOA 5KOMC 5JORA 1ZWIA 4RMRA 3RVUC 2VR4A 1GAFL 4KVNL 2I9TB 2ZUWA 4G6JH 4YGVA 5C0CB 4JZOA 5FM4A 2AXJA 2WBJA 2GUOB 3WEXB 4UILH 5I1IL 4PJ5D 4E42A 5DC4B 3TH3T 1XF4B 2MFNA 3AROA 3KLDA 4TRPH 1IQWH 2F5AH 3STLA 2FYYA 3I2CH 2R8SH 4PJXB 4MAYC 3U0WL 4X4XA 4Y19B 4KUZL 4OZGB 5A3ID 4LCCB 1UB5B 3G9VA 2VDPH 1MVUA 5FA4A 3QULA 1P84J 4DGIL 5A2FA 1DBBL 1I85C 1YN6B 4JFPA 1PGRB 5T3XD 3TESA 3SDXE 1DN0B 4NQCA 1KCUH 4HKZA 5DF0A 3DRQA 4XP6L 4NRYA 3FQXB 4MQ7B 1XGQB 3MYZA 4G9FA 2AJ3B 3H9SD 4JY5L 4MYWB 2BDNL 1JZ7A 4G6MH 1VA9A 4KJYB 4N8PA 5BV7C 4MSWB 4Q6IC 5F7EH 1BP3B 2NYYC 1K3IA 4OAWA 3QO1A 5DS8B 1AXTL 4CRPA 3J8F7 5CEZH 1UH2A 3UYRH 4NO0B 3WJJA 5FECA 4R3SB 1U92B 5C09E 3PWJB 1KCKA 3BH8A 1UWXK 1CFBA 4RWHA 3FOLB 2F74A 3LQAC 5F6HJ 1GYAA 4OLXH 1X3DA 3MACH 3SEPA 4XWGL 4Q9RH 3A67H 5CIPA 1IAKB 3OGCB 4XNXL 2DBLH 2VLLA 4XC1L 4Z7NF 3ZYJA 3SDAD 2HVJB 3BRFA 1B0GA 2BNQD 4Z95H 4D9QE 4MJIA 3RL2A 1RZJH 1SBSH 3BMVA 4MA8H 1R0AH 3QIUB 1ZS8B 2WMPA 4TN9A 2MHAA 3MA7B 3TZVB 4PJFA 2XKSA 1BIIB 4OIAA 3AMKA 3CXHJ 1NGPL 3QI9A 1QNZH 3C60A 3QIWC 1AR2A 4JO4L 2GSIB 4F58L 1AD9A 5KSAA 4XP5H 3D3VB 4XCEB 4XPTL 5B39B 3C5ZC 1MCOH 1W0WB 3KAAA 1ZHKA 4WCYH 4U1LB 3O9WA 1TJGH 5DA0B 3S35X 4MB3A 2H1PL 2BVPA 1HHHB 3N85H 4YDVB 5DLMH 3BI9X 4N5UA 1F4WH 4I9WE 2AXGA 4DGVH 4WI9A 3AUVA 3T2QA 1D5ZB 2R23A 1HILA 5CILL 3TBYA 5IM7A 4ZPVA 2RB8A 3GMPA 5E8DH 4OSUH 2A6IA