2YZ1A

Crystal structure of the ligand-binding domain of murine shps-1/sirp alpha
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
ELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIKWYRGVGQSRLLIYSFTGEHFPRVTNVSDATKRNNMDFSIRISNVTPEDAGTYYCVKFQKGPSEPDTEIQSGGGTEVYVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Tyrosine-protein phosphatase non-receptor type substrate 1
publication title Structural insight into the specific interaction between murine SHPS-1/SIRP alpha and its ligand CD47
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yz1A01
5F9OH 2J1KA 4ODHH 2AJ3B 5GS0D 1FE8H 1XR8B 3TBVB 3B83A 4FQCL 4S10A 5IVXF 5B38A 4HUWA 2JLLA 3D39A 1A4JB 4WHYH 1MCSA 3GBNH 5IP4A 1Q72L 5DJAB 1NMBL 4RQQA 4S0TD 4OLWH 5FGRA 2QQKH 2W0PA 4NN5C 4CVXA 1HDMA 2EDFA 4TNVF 2BVEA 5T33H 4YO0B 1MFCL 1C16B 1W0VB 3QIUC 4IBLT 5IMLB 2CJUH 4MNGE 1IC7L 4ZD3H 4YZFE 1PG7X 1ZT4B 3GUTA 4LLDB 1YEHH 3FTGB 3TPUB 1R3HA 5J13B 4LHUG 3HI1B 5LBSL 4U3XA 1ZT7B 5C07A 3HMXA 5F1NB 3VWKD 4ELMA 3LDBB 3TN0D 3KXFE 3MZGB 3PDOA 5TFSL 4L8DA 3MRNA 2PR4L 1BBJB 4PP2B 4I4WB 2EDEA 4A2LA 1OAKH 4DKFH 1NDGB 3R06B 4KXZH 4UQ3B 1AQKL 3V6FA 1NCCL 3CX2A 4M7ZB 5KG9A 1BAFH 3MUGB 4LAQH 3P3YA 1TTGA 1A7OH 1OGTB 2X4QA 4OD1H 4OLEA 1QFUH 4O51A 1IM3B 1L7IL 3VRLF 3FO0L 3W11C 4Y5VA 5DJZA 5C86A 2KKQA 4PY8I 5CJ8A 4L3EB 3LIZL 1SY6L 5CUSL 3ROOA 2VLRB 4DGVL 2DYPD 5C6TH 3HNTL 3AS3A 4JFPB 1U8KA 4XPAH 1JZ5A 4UV4L 2DKUA 3X13B 2D7OA 3F7QA 4P2YA 2XWJA 1FNSH 1RZIA 3P0VL 2FGWL 1V3MA 4N8VA 4N0UB 1UCTA 1F13A 1S9VB 3WFDH 1TPXB 4F58H 1LEKA 3HZVA 4K3HA 1L4IA 5C0IB 5SX4H 1NCBL 4JO4H 4NQDA 3S98A 5IJVB 1KTLB 4QNPF 3IJHA 5A2IH 1Q9WA 3ARPA 4RAHA 1DFBL 4R7NB 1OPGH 1IQWL 1PVHA 2ZG3A 1BD2B 3CVHB 4CW1A 1IM9B 3F8UB 2R29H 3LS5H 5EPMB 1CDGA 2YUXA 3LKQB 1LK2A 3DX9B 3HZKB 1VGEH 3EYVB 1CICC 3GSRA 4NCC1 4GG6B 1QBLH 3CX5J 5DEFB 1UM5H 3ZYOA 2NW2B 4PBXA 1PW3A 2OQJA 4LKXB 4D0BA 1KLUA 3JWOH 3Q6FB 1S8DB 2BNUB 2QBWA 3GKWH 2BVOB 5LQBH 3NIGE 4PJEF 5J11B 1AHWA 1LEGB 3QULB 3HE6D 4XHJD 1T1ZA 4R3SA 4KDTA 1MH5B 4RGND 2BHYA 5EULV 3U0WH 3VXUB 2A83B 3IJYA 2EE9A 3O4LB 3RZCB 35C8H 2C3XA 3HTLX 2AQ1A 4PRHE 1C5DB 3L3KB 4XNYH 1P7KA 2D7TL 4PUBH 5BW7C 3LMJH 3MLRL 4Y5VC 1MF2H 4HBCH 3LKRB 3HR5A 3EYQD 3MLWL 3HNVH 3I75A 3O6ML 3B9VA 4J6RL 4YDLC 3LCYA 2P43B 1B3JA 5F7NC 1UQSB 5IESL 5INCA 1Y0LA 1TTFA 4HT1H 5GJTL 4IOFC 4Z7WF 1RJLA 4PS4H 4Q2ZB 4X6CB 2FL5A 4NKOB 1NANI 2CUMA 3GMQB 3RVTC 5I74B 1AO7D 3KPNB 1QRKA 3HE7C 5DJ0B 5BV7C 1RZGA 5F3BA 4DKAA 1A5FH 4JZJB 3V0VA 3ARGC 1N5YH 4XAKE 5AWNL 4U1NA 4Y16B 2C26A 4B7IA 5KVEH 3IF1A 5A16A 2NYYD 1YJDL 3OB8A 1WVZA 5EOTB 3T4YA 1A21A 4FQCH 1XF4A 3QQ9D 3WS6C 2EXYC 5TDNA 3GSVA 1JNJA 3RVUD 3O3BA 2R9HD 2BSRB 3TCXA 3L95B 3X3FL 2IBBA 1Q72H 3ARBB 1NMBH 3WHE1 3VWJA 4WUUB 3D6GA 4JFQA 2ED8A 4AIZA 4PJDE 3UTTB 1NBZA 2CR6A 4ONOA 1MFCH 3P9WB 4TVPL 5L2KB 3I3BA 4MA7L 3PGCA 1IC7H 4YR6B 4Y4FC 3PNWA 1ZLWK 1GGBL 3L3GB 4Q58C 4WFGD 4BYHA 1HYSC 4GBXD 1EV2E 5E4IA 5LBSH 5FOBB 1TVDA 4KI1A 3STZA 1VACB 3BUYB 4E0RA 1FFRA 5B21A 3E3QC 5TFSH 4M3KB 1L6XA 3ES6B 2PR4H 2X70B 3MC0A 4BK4A 4NQXA 5A2JH 2UVEA 1KJVA 2PKDA 3O2WL 3MRQB 4Y2DD 2EIZB 3RWEA 1AQKH 3I50L 3TT1L 1NCCH 4BKLB 3PL6A 4P5TD 3PV7A 4JRXA 3FOLB 1K8IA 3L5IA 2W65B 1GH7A 1NGYB 4Z18A 3HC0A 1LO5B 1L7IH 1BJ1J 4ORGB 4V1DB 3ARFA 3CVHL 4L9LC 1A6WL 4PGEB 3WBDA 3LIZH 1SY6H 4JY5H 5CUSH 4DGVH 2X4OB 4IRJB 1ADQL 1VFMA 2R56L 4WHCA 3HNTH 3MJGX 3BEVB 5I2IB 4IMKA 3MFGB 3SDAA 2A6DB 3EFDL 4OD3H 1B0RA 1ZHKA 1R3LB 4UV4H 1WCBA 4URTB 1NFKA 4U1JA 2R2CA 3P0VH 2FGWH 2LV4A 3TBTA 2NTFA 1V5JA 1ZLWH 2H3NB 2VITB 1FAIL 2GCYA 5BOPA 3DHJA 4HFWA 1S7RB 4NQCD 1ZHBA 1MRFL 1NCBH 1XGQB 5BS0E 1ROWA 5MEOA 1I7ZA 3C2AL 1QBML 2WWMC 3OR6A 2Z92B 5SWQB 2DBJA 1M05A 1YA5A 2QQLL 1QZ1A 4YDKL 1JHTB 3QXDA 3VWJC 1DFBH 1HH6B 1A4KB 1CL7I 1U3HB 3PDGA 5F1IA 1EERB 1T80A 3MRKB 4QTHB 3SKNB 4DWHA 4PBVC 3KPSA 1K4CB 2H32B 1AGCB 1QNZL 3QNYB 4Y4KB 3ALPA 3L3IB 5HHPA 4JM2B 1J0YA 2PW1A 5HGAA 5HHXL 3KYNB 5HJ3B 4R4BB 4KRPD 3UTQB 1KT2A 2GY5A 2P5EB 3L3JA 3VFUB 3VFGL 3RNKA 2VISB 3NZ8A 4LCUB 3DRTB 2W0LA 4G6FD 5JW5A 5F7HA 3SDXB 1F90L 1AR1D 3MFFA 3BP5B 1FRGL 3E6FA 3ULUH 4WUKL 5FYJL 2X10A 4ZFFB 5J9PA 4OB5L 1IRAY 3DBXA 5B39A 3WO4B 5H94B 3B8YA 1UKTA 2D7TH 2Z93B 1B6DA 4GLRI 3MLRH 1YDPA 5SWZE 5FO9B 3O6KL 5JZ7D 3KLHC 1U6AH 2Z35A 3NZHL 3MLWH 3VG0L 4U0RB 2M26A 3NCEB 3O6MH 2XOTA 3OXRA 3CFKA 4X7EC 5E1AB 4MCZB 4J6RH 5IESH 3SCMA 3GMRA 4C57C 3CZFB 4KK6D 5J6GA 1HH9A 3R0NA 3SQOL 4YZFF 1QA9B 1NUNB 5FA4A 4DAGL 5T3XE 1A22B 1KIUA 3ULSB 4XCYB 4U6YA 2UWEE 1DLHB 1UB5A 2VL5A 4DKDC 5B8CC 1CD1B 1NFIA 4QRRE 4LHUB 3G5ZB 3U1SH 1BLNB 2F53B 1OSZA 4X6BB 4JRYE 3IKCB 5E5RB 3NAAL 1S7SB 4B5EA 3MBED 1E4XI 1JWSB 3AY4A 5HHMB 4MA7H 3LPFA 3PJSB 3CU1A 3O2DL 5E2JA 1RK0B 1DSFL 2OLDA 5E8NA 1GGBH 2KL6A 4U6VL 3RIAK 4HMDA 2F74A 3QWRA 1CXLA 3B3IB 1TMCB 2FHBA 2FZ3B 1MELA 2V9QA 4KKAC 1LNUB 4R4NC 2ARWA 4U1HA 4BZ2L 1FJ1B 3QI9B 5CLWA 2R2BB 4U6XA 1FSKC 3C09C 1XF5A 4KRLB 3A6BL 2C3HA 3PWVA 4LCWE 5KAQF 2X4RA 2CRYA 2GJZA 12E8H 5IG7A 4MNGB 5EU4A 3VXRA 1QBBA 3O2WH 3OKMA 4WDIB 2EDLA 3I50H 3TT1H 4I3RL 2FECI 4WO4B 5GGVY 5EDXA 1KTRL 4HGWB 5GRXG 1XIWA 4TVPD 1P84K 1S7XB 4OQTL 1P7QD 4HXBH 2WZPD 5BJTA 1NGQL 4GQ9H 1A6WH 4C55A 3VXSE 1FO0B 3H42L 5DGRA 4QGYA 2ADFL 2VLRD 1VFBA 1N6QL 3EZ8A 1PDKA 3GHBL 1ADQH 2R56H 3QRFM 4P2OA 4J3XA 5TGBA 1IAKB 5E6IB 3EFDH 3VXPA 4AYFA 1CGSL 5DR5L 2NMSA 4U1KB 2IJ0C 4XNMB 5EU5A 3BPLB 1BQUA 3C6LB 4WI4A 2YRZA 3O11A 1PJ9A 2YWYA 1KUMA 1BX2A 3NVQA 2F54B 1ORQA 3NIGF 4PJ9A 4RGOL 1JGEA 3MNZA 1VEPA 4OKVB 3C2AH 1QBMH 3DMMB 1MIEL 4DJMA 3MREA 2QQLH 4YDKH 3W5MA 5ETUA 3C8KB 4JPVL 4HKXA 1A1NA 1GZQB 3MRDB 3KYMA 4FA8A 1JGUL 4Y2OA 5BZDA 1NQBA 2C1OB 4B41A 1IM9D 3AY4C 3FN3A 3JWDC 3P73A 3EDKA 3KPQA 3LD8B 4FXKB 2IAMC 2EDWA 3S5LB 4ZAKB 3W0WA 4M6NL 2OL3A 2BCKA 1I7TB 1QNZH 2BNQA 4EZMA 1CT8B 3VRJB 3FO2A 4OJFL 4I48B 5F8RC 5KW9L 4MAYB 2E9IA 3VFNB 4HULB 1U8MB 4WI3A 5EUOA 1XR9A 3FFDB 1D5ZA 1FL3B 1H15B 3VXMA 1MCDA 1S7UB 2A6KA 1AC6A 4J7RA 3VFGH 2H6PA 4N68A 4NRZB 4QHMA 3PQYB 4X5XB 3B9AA 1WZLA 2YD5A 1F90H 5D1XA 4YHIB 1FRGH 5TE6L 1FN4B 2L7JA 3RZCD 4HG4J 3V5HA 4WUKH 5FYJH 1W72B 4LASL 5I8OL 2AJYL 3EBAA 5CLTA 4TYUA 1YEEL 4E42A 5EOCJ 4EBQL 3QUYA 5GGTL 4NUJA 3P4NA 4LOUD 3O6KH 1H8NA 2RFXB 2YA2A 3WHXB 2XYCA 1LO0L 3NZHH 2NY1C 3VG0H 4U2ZA 4U1GC 3LHPL 2NY0B 1A9BA 4OFPA 5HHOB 2FR4B 3L5WA 4PG2A 4ZXBD 4CN1A 3BKJL 3QFJB 1JGLL 4F7MB 3BGFC 3TNMA 5JUEL 3GSQA 4H8WC 4PRHB 1ZMYA 3SQOH 3KS0H 3C8DA 3ZDXF 4DAGH 3QUZA 5TDOB 2Y06H 3ALWA 4PJ9C 5AYQA 3MNWB 4Y16D 4OF8A 1DQJB 1NGPH 5C8JA 3GI9L 5TE4L 2D3VA 2KDGA 1INQB 4CJ1A 2YZ8A 4AIXA 3ARBD 3FB8A 5F9DC 1AIFB 3MV8A 3N06B 3QNXA 3DYPA 4WUUD 3NAAH 3KDMA 3K4AA 2GT9A 1NAMB 1YNLH 4FFYL 3UTTD 4Y89A 2W1NA 5L2KD 2G75A 1JZ8A 3O2DH 1K2DA 2XT1B 4LIQE 1DSFH 4LCYB 4U6VH 2DYPA 4QRTA 1IGCL 3G6DH 3VGDA 3BPOB 4P5MA 4WV1C 3F5WA 4O2EA 3MRPB 3VU2A 1A7RL 3ZDYF 1K3ZA 4XP1L 4BZ2H 1EHAA 2AKRB 3W9EA 5DO2C 4YHNB 1A7BA 5DJDA 2H8PB 5D1XC 5ENWA 1BHGA 3A6BH 3FQUB 3IDNA 4PJDB 4DZBB 4FQ1L 4JVUA 4WHTA 2EEAA 1S7WB 1C5CL 1XH3B 4X7TB 5GGUB 1E4JA 1NMCB 4IRSA 3ZTJH 4Y19E 1VHPA 5ADPL 1RUML 4I3RH 3BRFA 2XWBA 5CEXB 5DXWA 4EVNB 4KTEL 4KJYA 5J3HD 4IS6B 2YEZB 3PGFL 1BBDH 4OQTH 5HPMB 1CFVL 3G5VA 4PG2C 5E70A 1NGQH 4V1DD 2AEPL 5DJYB 2QSTA 1CFQA 1IARB 5DD0H 3H42H 5DTFB 4LCCB 2ADFH 3ZE2F 4IRJD 3GHBH 4HPOH 2FWOA 1UXSA 1CGSH 3TN0C 4XP6L 5J1TC 4CN4A 3HE6A 2MJWA 1KJMB 4XPTH 4BQBA 5ITFA 3FQNA 4RGOH 1KV3A 1P9MA 5A3ID 5E4EB 2ZG2A 4PJFB 1OGAB 2ESVE 1MIEH 1ZXQA 5I1KL 4M9PA 2IPUG 1SEBB 3IAGC 4JPVH 1U3HD 1A3RL 2YZ1A 4QLRA 4G42A 5IQ9A 4HX1A 3WKNA 1JGUH 4OZGE 1MQKH 2HJLB 4RFEB 4UOJA 5H2BB 2RB8A 4E41E 3X14B 2O5YL 3NA4A 3QXAB 5KW9H 4OJFH 5M94B 4LSUL 1J0JA 5MEQA 3LS4L 4M48H 3FL7A 3PGDA 1CXEA 1F4HA 3A6OA 4N0CD 5ICXB 3QG6A 3MQIA 2P5ED 4RGMC 2YSSB 1C12B 5KANG 1QSFA 3VXTA 5GS3A 3CFEB 1IKNC 5IMOB 5TE6H 1KJ2B 5ESQB 4JFDA 2R1YA 3WD5L 5FHAL 3MO1A 4LASH 5D9SB 3RQ3A 5I8OH 5C9JB 4GW4A 1YEEH 2C7UA 3BIAX 2AV1B 5C0FA 2ADJB 2AI0L 4EBQH 5GGTH 5DDHB 2UWEF 3KYOB 2X40A 3OX8A 1L6ZA 4FTVA 5DVOA 1KB9K 1NUDA 4ESKA 1LO0H 1A02N 4R90H 4HCRL 1BF8A 1RZ8B 5JR1L 1B0GB 1K5NB 2DLFL 5IB4A 1QQDA 1GC1L 4XGZB 1UJ3C 1FVEB 4PJCE 4FOMA 3BKJH 3RDTA 1X5YA 5TQ2L 1JGLH 4RAVB 4X9IA 4GBXA 4OD2B 1JBJA 5JUEH 2ATPA 3NCFB 1CXHA 1MSPA 2NY2D 2CMRL 5E8EB 3HE6C 1F4XL 4XHJC 1D5BB 4RGNC 5SWZB 3BX7C 4YIQA 3TBSA 4JAMA 3R1GH 4EOWL 2A77L 5HGHA 5ACZA 1VFAB 1QVOB 4NYLA 3ZYZA 3QEHA 1LO3L 2V17L 4HKJA 2Y5TA 4PTTB 3VD4A 4MDIA 1NBYB 2IPKB 3AM8A 1QFWL 5GGQL 5CHNA 1FQ9C 4Y2DA 5D5MA 3GI9H 5TE4H 1BVKB 2X1PA 1OAZL 3VJ6B 4YHPB 5DUBB 2F53D 4P5TA 3UAJC 3EYQC 4G8FB 2J8UE 5C0ND 1XGTA 2HKHL 5TE7L 3EHBD 5ANMB 3BDBA 4FFYH 2VDQL 1ZLVK 3MCLH 4UBDD 2GITB 1HKFA 1YUHB 5HHMD 5F1KC 3VXOA 2R1XB 3OKLB 2CIIA 2CKBA 2Z8SA 4PGDA 4Z9KB 1IGCH 3I2CL 3V8CA 3BVNB 1EA9C 4L3AA 4Q7DA 3V2AR 1A7RH 4QRRB 5I8CB 2FEEI 2L4OA 4XP1H 5JOFB 3QI9D 3RUGE 3EYOA 3C2SA 3O3DA 4WWKA 2IALA 4RAUA 1KIPA 1CTOA 4XNQB 4Z0BL 1LE5A 4HLZH 1FZJA 4YWGL 3TYGL 3QUXA 2C9AA 3T8XA 4FQ1H 3G6AA 4HIEB 3K80A 3LY6A 4BSVA 3QQ9C 1C5CH 2R9HC 5SV3A 3VDAA 3L7FA 1GPOL 3X11B 5I71C 5IB2B 1RUMH 4UILL 1R0AL 3PIQA 1YEFL 1KPRA 4KTEH 4OF3A 3PWPA 5DRXA 4ZQKB 3MJ8A 3HAEA 3PGFH 4J12A 5IB5B 3MOAL 4IHOB 4QRSB 3KXFD 3U4EA 2XG4A 1CFVH 4TUOB 4YBQC 2AEPH 1TNMA 3BRDA 2YN3A 1FYTA 4LCWB 4XMLL 1ZS8B 3B9KB 4PJHA 2DN7A 4GBXC 3OAZK 4X8XA 4CNIB 1JWUB 3P9LA 1ORSA 5E6ID 2XTLA 1I1FA 2DM2A 1ZLVH 3U0PA 4XP6H 4AMKL 3S35L 3GMOB 2DQHL 3BDXA 3EO1A 5EIIA 3C6LD 1Q94A 3WEXA 1KPUA 4OZIE 1A8JH 2EDXA 3P4OA 1TVHA 1QFOA 4Y2DC 1I3VA 1K8DB 1S9XA 1HIML 3VCLB 3VE0A 3VXSB 3LEVH 1G9EA 4HF5L 2EYRA 4P5TC 4P3DA 4ZO9A 4UNTA 5I1KH 2Z8RA 4OFYD 5F71A 1RAMA 4UU9A 4WI9A 3QCVL 2AJXL 3H8NA 4PJ7E 2W07A 3MGOA 2MCPL 2IMMA 4NQVB 4ZAKD 3T1WA 3QSKB 2O5YH 2CXKA 1G7LB 3D0LA 4NIKB 4WW2A 4MAYD 4LSUH 4M5YL 3OWEA 4LPVA 1LE9B 3QEQA 2DWDB 3LS4H 5BMFL 4HUXA 4O2CB 1WIOA 3EGSA 4ELKA 3RWJA 2VLKB 3PV6B 4UDUB 4OZ4A 3OAZH 4P23B 2MOVA 5EN2B 4ZUVB 1WBYA 4AENA 2YKLH 3U4AA 2P5WA 3P77B 3DJ9A 4BH8B 1T1WA 1HYRC 3O3AA 3ARUA 3D25B 2UYLA 3WD5H 5FHAH 3FQWB 2DQDH 1QPXA 1XR8A 3OJMB 4M3JA 1U8PB 4RBPK 4OF0A 3CDCA 4UT6L 1A4JA 2AI0H 3E0GA 3GSNL 1U8QA 1ZVHA 3M1BB 4NQSB 3P4MB 5BRZB 3HRZB 2E9JA 4HCRH 2NY0D 4N1CA 4PJBF 4S11A 3FB7B 1C16A 2BNRE 2DLFH 1GC1H 1J8KA 5JIPA 5T3XL 3CH1A 5LGHL 1AGBB 3QFJD 5CKGA 4OGYL 5TQ2H 4NCDA 5D7IB 1ZT4A 4KRPC 4LLDA 3CSYA 1J9CT 3FTGA 2HJFB 4XBEL 4HJ0D 1KCRL 3HUJA 4PRHD 4G7YL 1NMAL 3HI1A 1KXTB 5T1MA 2CMRH 3MJ9L 3JTSB 1F4XH 4H1LG 2NXYC 5FB8A 1H3PL 1JRHH 1AR1C 2ZUQC 2A77H 4RMQA 4PG9B 1BBJA 4I4WA 1TZHB 1LO3H 2V17H 8FABB 5DT1L 5GGQH 1QFWH 1F3JB 3CFJB 3G6JF 4YBLB 4FS0A 4UQ3A 1M7DB 5IF0B 1OAZH 1V7ML 4PRIE 5JZ7C 4NRYB 2NX5B 3MUGA 3WJLC 4G6ML 3WFHB 4X6FB 1MFAL 2HKHH 5TE7H 4EQ3A 2ICWB 4NP4L 1IM3A 4RBPH 2Y36L 2VDQH 4XAKD 1DBAL 4OBSA 5CEYB 4BFIB 4L3EA 4FQJL 1HOCB 4G8EB 4NBZB 5DEZA 5FGCB 3B5GA 3QWOA 1J8HE 5F6IB 4WCYL 4MVBD 2ZPKL 3N0PB 1P84J 2RCSL 4NNXA 1BZ9B 4NHCH 1HXMB 1WWCA 4QOKE 4N0UA 1TFHA 3I3EA 1S9VA 4MCYB 5IBTL 4NRXB 4Z0BH 3FFCE 4YWGH 4JFEE 2L7UA 5D1QB 3TYGH 3WIHL 2I5YL 1FGVL 5C0CE 5CD5D 5K59E 1CXIA 2CR3A 1NPUA 3GMPB 2Q6WB 1NUFA 4UILH 3LN5A 3RGVA 1R0AH 5HD8D 3BH8A 4K8RL 3ARQA 4R7NA 1XGRB 2OMBA 3DX8A 3NPSB 3MOAH 5T1LA 1BD2A 1FLRL 2AAVA 3S3SA 3V52H 4X0KB 1UEMA 1MAKA 3RI5K 4GXVL 5EPMA 1MVUA 1IGML 3HG1A 4N90D 4OZGF 3DX9A 5J13C 2YPLB 3EYVA 4GG6A 2PYEB 5DEFA 1AGEB 5JW4N 4G9FE 2Y1VA 3LDBC 4Y19B 2AJVL 1MREL 2FJHB 4AMKH 4Z8FL 2NY7L 1FYHB 3Q6FA 2HFTA 2BNUA 3S35H 2DQHH 5D2LB 1LEGA 1YJDC 4W70A 2D0GA 1WBZB 3DTXB 4OIBA 4QGTA 2G60H 3TH4T 5IB1B 1WEJL 1NCUA 1AXSB 1MH5A 5K9KB 3QR2A 2VXTL 3VXUA 2GJ6E 1Z9MA 3O4LA 4HF5H 4M7ZC 2XV6B 1G6RB 5ID0B 4DCQB 1C5DA 3BE1H 1PZ5B 1S7QB 3QCVH 2AJXH 1OF2A 1T0NB 1UM6L 4I0PB 1GL4B 2ILLA 2SEBB 1B9ZA 4JDTH 2VIRA 2XN9E 5I8EB 4ZYKB 5JOPE 3HNSL 3LKRA 4R4FH 4PYGA 4U1SA 2Y25A 4JO1L 4DVRL 1S9WB 3F12A 3IS1X 1UQSA 4I13B 5FIEA 2EYSB 5K9QG 5KS9E 4M5YH 5KVDL 1JHLL 4I18B 4Y4HA 5BMFH 4XWOD 5EU6E 3ESUF 4NKQB 1T2JA 4X6CA 1TPXC 4PJCF 4NKOA 3GMQA 5EG6C 5DJ0A 5E8DL 5FXCH 3QYCA 1JVKA 1PAMA 3U82B 4S1DD 4DOHB 1YEKL 1KPVB 3LKPB 1JF6A 4NNYA 3RY6C 3IXTB 3V6ZA 1MCBA 5FK9B 3QDJE 4PY7B 2FATL 3UPRA 1BFTA 4P4KD 1FFPB 2V5RA 4UT6H 4H5SB 2BSRA 3GSNH 4K71B 1FVDA 1KIRA 4OF6A 1ZA6B 3ARBA 3G08A 4G8IB 3QPQD 3IDYB 4JHWH 3G5XA 2F8VA 1QHPA 3UTTA 1EGJA 2N56A 1JTTA 5L2KA 2J8UF 2X41A 5LGHH 4OGYH 1HNFA 2WBWB 3L3GA 2GYSA 3D39E 4XBEH 2P8LA 4FFZL 5J11C 3AREB 4G7YH 1NMAH 1QUNA 5FOBA 3CXHJ 4D9LH 5GRJL 1VACA 3OSKA 3MJ9H 3BUYA 1HHJA 3PHQA 2DJUA 4Q9RL 4KZDL 2ERJB 5SWZD 1F2QA 1H3PH 1DN0B 4D0DB 3ZL4L 1R5VA 3RZCC 4H0IA 5GPRA 5E24E 3BD3A 5D1ZB 3RUGF 5DT1H 3FRPA 3DVGB 3DXAB 3MRQA 1IAIL 2BK8A 4OFVA 5C07E 1QO3B 1V7MH 1T83C 1EXUA 4BKLA 4LIQL 5GGRB 4TTGA 1TCMA 4X5WB 1D6VL 2QL1A 3FOLA 4G6MH 2W65A 1AD9B 1MFAH 4H88L 5E8OB 2LFGA 3S96B 3KPRB 5T3XD 4NP4H 1LO5A 1TVBA 2Y36H 3H7LA 4ORGA 3RHWF 3V4VL 1Q38A 4PGEA 3DX6B 4FQJH 3WUZA 5B22A 1FC2D 2X4OA 4IRJA 1CD9B 2DQFA 4QKXB 4WCYH 5I74C 5I2IA 3SO3B 2ZPKH 3TJEH 1R3LA 2H2PD 3EDJA 4QRRD 2RCSH 3CUPB 4JZJC 1JZ6A 2W9DL 1W0WB 4PRBB 3EOBB 4ZMAT 4JRYD 4Y16C 1FFNA 2H3NA 5HGBB 2RQ8A 5IBTH 1OWRM 4LQFL 9CGTA 4RSVA 3S3PA 3PHOB 1WFUA 2I5YH 1FGVH 1XGQA 4PJAF 1OT1A 1P1ZB 4JDZB 4B50A 1I7UB 2Z92A 5SWQA 3ARBC 1UENA 5ADOL 4U7MA 4MD5A 1HH6A 1A4KA 3BGMB 2X4PB 1KCKA 1U3HA 1JPGB 5F8QC 3MRKA 4H20L 4GO6B 1FLRH 3CFIC 4MSWB 3SKNA 5CJ5A 3DGGA 4D9RE 4HFUL 4Z76A 4GXVH 4C56B 2H32A 5T3ZE 4NQDE 1AGCA 1F3DH 1JWMA 3HLAB 4LCWD 4PJ7F 1IGMH 3B9KD 3OJVC 4Y4KA 3VGAB 3MRJB 1ED3B 1HHKB 4JM2A 4NFDA 5IJKA 3VMNA 2E9BA 3G04B 3RWHB 1YNTB 2AJVH 1MREH 3KYNA 4Z7UF 5HJ3A 5IVOA 2ENYA 4J3TA 4PRAA 4Z8FH 3QEUA 5HYJB 2V9RA 2NY7H 2YRPA 3UTQA 1QOKA 3CK0L 5DQ9B 3T0DA 2P5EA 3VFUA 2ZUXA 2VISA 3QUMB 2YMXL 5E5UB 5GQBA 2BVTA 1WEJH 5J6HB 3DRTA 4W6XB 3V9FA 3ARYA 4ZOEA 1CGYA 1U3YA 2JB5L 2DM3A 3SDXA 2VXTH 3WS3B 3VXSD 2V2TB 4K8RD 4YC2B 1P4LB 3WL9A 5E9DE 3N1MC 5J3HC 4ZFFA 3SGKA 1H5BB 1FG2B 3MYJB 4GKZB 5H94A 5FM5M 1KFAL 3GJEB 4N8VG 1UM6H 2OTUA 5E2WH 2DQTL 1A7NL 3FKUS 3HNSH 3BWAA 4RRPA 3E3QE 3DVNA 4HS3B 4OZIB 4IRJC 4JO1H 4DVRH 3T0VA 2VUOA 4CVUA 3WFCL 3WV0A 2PNDA 4K07A 5KVDH 1JHLH 1QKZL 1E6OL 2RJMA 4JFXB 3CZFA 3WYRA 1KNOB 3RZWA 3CNKA 3X17A 1CFNA 3M8OL 4P23D 1QA9A 4MHHG 3F6LA 1LDPL 2DJSA 1I1YB 4NC1C 3W9DB 5A3IC 2D0FA 4NC2B 4D2NA 1YEKH 1GZPB 4XCYA 2Y6SC 1JJUA 3J8F7 4P48A 1FNLA 1RULL 1I3GL 4N9OB 1A6ZB 5EBLA 1RIVL 2FATH 1U3HC 2B1HH 5I1JL 2HH0H 2GFBB 4LHUA 3G5ZA 5CZXD 1INDL 3KYKL 1OSPH 3HA0A 2FJGA 5ABDE 4WEBL 1IMHC 1EDQA 4X6BA 3N1FC 2VAAB 1JZ2A 4H1LB 4UIKL 1C8PA 2EE3A 1S7SA 4HWEL 4Y4KC 4PGZA 1J0ZA 2EKSB 3FB6A 4JM2C 5IJKC 1JWSA 3HMWL 3PJSA 2WUCL 4QHLA 3NBNA 3F7VB 3MRFB 4U6HB 4N0CC 1I8KB 1N8ZB 2NZIA 3BP6B 4FFZH 4R2GB 5F7UA 3OJDA 3B3IA 4JLRB 2FZ3A 5GRJH 1LNUA 1BFVL 2EH7L 1FJ1A 4Q9RH 1DDHB 2R2BA 3JWNC 3UZQA 3LEXB 5FO7A 5FDWA 2OR9L 5IKCB 4YAQB 1EFXD 3ZL4H 5IHLB 5CJBA 1Y18A 3EYUL 3WO4C 3KWWB 4RX4A 1TZGL 3T08A 1IAIH 1WWWX 4OUOA 4WDIA 1X5ZA 3T0EB 4M61A 4WO4A 1D6VH 5T1KB 4HGWA 5K59F 4U0QB 2ARJB 4U0RC 4ZOBA 4H88H 5SWSA 1FZOB 4L3CA 1R24A 3AB0B 3MA7A 3HI6L 1QSVA 5CINL 4N5ED 3DUUB 5L88H 3TIEB 3V4VH 1A7PL 1FO0A 2I07B 3NGBB 3WN5B 3HPLB 3GMMA 3ZHLA 2IFFL 4H26A 4JCLA 5AG9A 4OI8A 4JRXE 1IAOA 3IFPB 4HV8B 4U1KA 2W9DH 4XNMA 4XXCC 1FBIL 1REIA 2P24A 4J4PD 4YH6A 5ID1B 5FV2A 3CCHB 1MRDL 1RZ7L 4LQFH 5GGSB 5D1QD 4QHKJ 4ZG1A 3QEGL 3QUML 2F54A 4ETQB 4OKVA 5KSVB 5ERWA 5I9QB 3DMMA 5E94A 1MWAL 3H7BA 4M02A 5CILL 5LAXA 4PJ5B 5ADOH 4HC1A 5C0NC 3B8SA 5L2JB 4U31A 2JF1A 3C8KA 1EHNA 3O9WB 3EHBC 1GZQA 3MUHL 2EH8L 2C1OA 4UBDC 4C58B 4OM0L 1J1XH 2R1WA 4HFUH 3S5LA 3FFCB 3H9HB 5CIPB 1OT2A 1AGDB 1I7TA 3AFLA 3RBSA 4GQPH 2R0WL 2YPLD 3FZUC 2HRLA 4ORZC 1CE6B 3ZKMD 1CT8A 3VRJA 4I48A 5EIVA 3V0AC 1LP9F 1P53A 1U8MA 4M43H 4Y19D 4QXUL 3QI9C 3FFDA 3V6OA 1FL3A 1TTUA 4FFWD 3UJTL 3BT2L 3CK0H 4PD4J 3KPSE 2PO6A 2DKSA 2YMXH 3BZDA 4NRZA 4NM4L 1YN6B 2WWKT 2PYFB 3PQYA 4MB4A 4X5XA 2IWGA 4Y5XB 2JB5H 3NCYS 3TO4D 4G43B 4Z0XB 1FN4A 4CVZB 2PTTB 3W39A 3IXAB 4WO4C 1W72A 3KJ4B 1S78D 3TYFA 1T20B 2Q1EA 1BQSA 1KFAH 1C5BL 4I0PD 1MCQA 2DQTH 4YFEA 2RFXA 1A7NH 4WU5B 3WHXA 4WTZA 3FQRB 2UZIL 3Q3GB 1XGYL 2FO4A 3BXNB 3MCKB 5HHOA 1AXTL 4X4YB 2FR4A 1QBAA 1I3RB 5E6IC 5EZJB 3WFCH 3QFJA 3WO3B 4KK9D 1QKZH 3D85B 1E6OH 1Y6KR 4F7MA 1XF1A 2EDHA 1BP3B 3BPCB 3BPLC 5CD3B 5T5FL 2VH5L 4FZEL 3C6LC 4PLJD 5DVMA 3M8OH 1GVIA 2GTZB 2R15A 1PEWA 1FLTX 2XN9B 1YN7B 4JFFB 3MNWA 5FKPA 4XB8A 5IBLD 1FHGA 5ACLA 1MIML 5CFHA 4E41D 4EDWL 3K4DA 1RULH 1I3GH 1KBGH 4XP4L 3UEZA 2R0ZL 1RIVH 5KSAA 4YPGB 5DMYA 5KS9B 3ETBF 1I8IA 4M5ZL 4RIRB 5FO8B 1QLFB 2EKJA 5I1JH 2VLJB 3MSPA 1KB5H 1INDH 3KYKH 5EU6B 1CLCA 1U2HA 4RMRA 4WEBH 3LD8C 3SPVA 5D7LE 3RNQA 4ZAKC 4NO0D 4UIKH 3UTOA 1AFVL 3U79A 1ZANH 4HWEH 5DK2B 1NAMA 4JANA 4ELMF 1OAQL 2JJSA 4MAYC 3MRLB 3HMWH 4JVWA 5HHQB 2WUCH 4NFCA 2BERA 3FO9A 4LCYA 1UFUA 3GI8L 3RHWK 3QDJB 4HUKB 3MV7A 2AJSL 4M7KL 2B20A 5FA3B 3MRPA 5F7MC 1DBJL 1BFVH 3MRRB 1JNNL 2EH7H 4P0DA 2EDQA 3CAFA 3JXAA 4GUPA 3JZ7A 2X1XR 3FHQA 4YHNA 3CLEH 2OR9H 2H8PA 1OCWL 1G7IA 4GS7B 1P69B 2E6QA 4LDEB 3D1MC 1O7VA 5D1ZD 4DZBA 1JYVA 1Y6NR 4P49A 1TZGH 1XH3A 4X7TA 5GGUA 2BY1A 4HUWB 5DD1L 3MOBL 5MHSE 5CEXA 3N1QC 3DLQR 2YEZA 2XWTA 3N50A 3NCBB 4RQQB 2WAHA 1UWGL 2NY0C 1EBPA 4CVXB 2AGJL 3HI6H 1HDMB 2X9YA 3N1GC 4GH7B 3DI2B 1X5GA 4H25B 5CINH 2R4RL 5DJYA 5DUPL 4FNLL 2ADGB 1A7PH 4QHKI 3VXRE 1ZHNB 4XX1G 1ZLSL 4LCCA 4HJ0C 1V3LA 3WIFA 4LGSB 4LQ1A 1CXKA 3VD5A 1R3HB 2IFFH 3RPIB 3S4SA 3MLPA 1YEGL 1CGVA 5C07B 4GRWE 1Q9LA 2NLJB 1FBIH 4KC3B 1IEBA 4JHBA 2CRMA 3RVXD 4NWTH 1MCHA 3AU1B 1MRDH 1RZ7H 2XKUA 1RURL 1WJ3A 3QEGH 3QUMH 3TVMA 2M1KA 2AXGB 2VWEC 3WSQH 2PETA 1KCUL 3AS1A 2RHEA 4PJFA 1IFHL 2Z0BA 1OGAA 2Q8AL 1MWAH 4X99A 3V6FB 5FGSA 1PKOA 1N0LA 4P2CG 4CKVX 1SEBA 1BFSA 1EEYA 4QWWC 1GC1C 1CQKA 1WF5A 3X3GH 2HJLA 2C4XA 4OM0H 4TNWF 5MI0B 2BXZA 5CWSA 4C56D 1DBBL 4G6AD 4PTUB 4DW2H 3X14A 3G5YB 3BPOC 2KZ1B 4ZUTA 2R0WH 3ZT5A 4MVBC 3QXAA 3T2OA 2JCCF 3SE8L 1ETZB 4QXUH 4F8TA 4ZFOL 3MUY1 4HUVB 2I27N 4LLQA 2WIMA 1RZIB 3EOYG 3UJTH 3BT2H 1PY4A 1K3IA 4N8VB 4BFBD 2YSSA 5KSUB 4P2RA 3W0WE 3HZVB 4WTWA 4NM4H 1E6JH 5CD5C 2BNQE 1G7PB 3CFEA 1MCFA 1NMCC 5I66B 1KJ2A 3OV6A 1VPOL 3VFMA 5HD8C 1CLOH 4LVOB 5D9SA 32C2B 3MLTB 1MHCA 3VXME 3H0TA 4A6YA 1C5BH 4NOBA 3KYOA 5DEGB 1AGFA 1J1PH 2UZIH 2CQVA 1RZ8A 3I6GB 1LK2B 4YXLL 1B0GA 1AXTH 1K5NA 4XGZA 2ID5A 1FVEA 4N1HB 3GSRB 3RWFB 3DOSA 4FQPA 4NC0B 3S37X 5E9DB 1CVSC 4YHOH 5T5FH 2VH5H 4FZEH 2P44B 1AHWB 1D5BA 4NKMB 3L3DA 4M1GL 4Z7NF 4R3SB 4PJXA 5DI8B 5IHZA 1JTPA 5E4EC 3KPMA 5DD5L 1BEYL 3NIDF 1QVOA 1MIMH 3IJYB 4EDWH 5CP7B 2OSLB 1CQYA 1SYVB 1NBYA 2IPKA 3PDDA 5DJXB 5IVNA 2ZNWA 2YD6A 2R0ZH 5AUMB 4M5ZH 1X6NA 1UZ6E 1BVKA 2Z9TA 4KVCL 3VJ6A 1T3FB 4TSCL 2BC4B 4G8FA 1SVZA 1JI2A 4WY7L 2DQEL 3HR5B 5ANMA 1AFVH 2VO5A 3UYRL 5D72L 1OAQH 5DS8A 5FECB 1NCNA 2GITA 2A2QT 2AW2A 5EZIL 2LVCA 3FT2B 1F45A 4XWOC 1Y0LB 2JK5B 1P6FA 2R1XA 3OKLA 4OI7A 4UOW1 1RJLB 3GI8H 4R2GD 4P5KB 1T6VN 3BVNA 2AJSH 4M7KH 2APTA 3MV8E 1JNNH 2XQBL 2CLZA 5JOFA 5H35B 1L7TL 1RZGB 3BKML 3HMXL 1OCWH 4P4RB 3KYAA 4XNUL 4XNQA 3B2VL 3PXJA 5C3TA 4PLKD 4EI5D 3S35X 1IEAB 4HIEA 5A16B 5HDOA 1X7QB 2CLVB 3IAQA 1KF9B 4NZRL 1XF4B 4UDTB 3GSVB 3X11A 5DD1H 3MOBH 3T0ED 4M9OA 3QPQC 4ZQKA 5T1KD 1CVRA 4JR9L 5EZOH 1UWGH 3GJFB 4JFQB 2AGJH 4QRSA 2QQQA 1FFOB 4TUOA 4FMKA 1Z5LB 4YQXL 4FNLH 1QSEB 4JHZA 1WGOA 3M17B 2VE6B 1ZS8A 3QCTL 3B9KA 4Y88A 3PNWB 5DK3A 4RCAA 2CK2A 1JWUA 2XNAB 5CJXA 5IBUG 3UTPE 3STZB 4WI6A 2ITDB 4E0RB 4XPGL 4M7JL 1QFWM 2CGRL 1MY7A 2V7HB 3TEUA 1TJHL 3BI9X 1J88A 3RPKA 1RURH 2WBJB 3FO1A 4RMVA 1G9MC 3TBWB 1KJVB 1U8IA 2WQ8A 3VCLA 5DJ8A 3VXSA 1Q9OB 1ZHLA 5FYKE 1IFHH 1L9NA 2Q8AH 1LEIA 1J8HD 4JGUA 1XF3A 3PL6B 3GRWA 3ECBB 4JRXB 2ZUWA 3UZEA 3CDGB 3HC0B 4TN9A 4KJPD 4RGNE 3ARFB 3FFCD 1DBBH 2VL4A 4JFED 3FRUB 1JNLH 2F19H 1X5FA 3K74B 4R0LA 1P2CA 2ICWJ 4OLYL 2H2PC 2ZP0T 3SE8H 3SDAB 1LE9A 1EAPB 2DWDA 4LBEA 1B0RB 4UT7L 4F8QA 2VLKA 3PV6A 4UDUA 3TBTB 4P23A 5EN2A 4ZUVA 2OYPA 1Q0YL 1EVTC 1UADC 4BH8A 5KN5B 5LGJA 5MEOB 1VPOH 1I7ZB 4MYWB 4ZUUB 3UROR 5F44A 2YK1L 3OR6B 1KXQE 3ULVE 1WICA 3O4OB 5E7BA 4ODVL 1BREA 3CFCL 3ROLB 4ONFL 2VB5A 5GZND 1QSFE 3SQBA 2XY1A 3L9RA 4JE4B 4JEGB 4KK5D 3IFNL 4Z7QE 4Z7OF 5I16A 3P4MA 3B9KC 5BRZA 2NQCA 3E2HB 4F9PC 1CF8L 3DX7B 2FHFA 2MPAH 3FB7A 4JFDE 4YXLH 5EBWB 5CJXC 4OGZA 5HHPB 2GJ6D 4IDLA 4ODTL 3WNOA 3D85D 5D7IA 5GRWA 2HJFA 3GKZA 3K7UA 4NZJA 4MZ2A 2XI9A 4FTVE 2ITCB 3JTSA 3L3JB 5FCSH 3RKDD 4M1GH 2XN9D 4JFFD 5IROA 5JOPD 4ONHB 5DD5H 1BEYH 4BFEA 4K8RC 1TZHA 1UZ8B 5C0BB 8FABA 5J12B 1U36A 4YXHL 3VFTB 4WFGE 1A6TB 1F3JA 2EIEA 4M8VA 5J9PB 3IRPX 3O0RL 5AG8A 3P11L 1M7DA 4KVCH 5EU6D 5AZEL 4UZGA 3L7EB 4NRYA 2NX5A 3C60B 1YDPB 3NFPA 4WY7H 5JIKA 4XPBL 3UYRH 5D72H 4UB0L 2IBZX 1A64A 2VDOL 4I5BA 5EZIH 5MEPB 5CEYA 4BFIA 4YUEL 4HGMA 5D5ME 1QP1A 1R5IB 1CL7L 3GFUA 1JZ7A 3QDJD 1R5WB 5J6GB 2MFNA 4P23C 3IJSA 2A1WL 2DWEB 2XQBH 1LDSA 1L7TH 5FA4B 2RR3A 2HVKB 1HXMA 5C7XH 4J3VA 4KWUA 5D7LB 3BKMH 4HS6A 2O5ZL 3HMXH 4XNUH 4NRXA 2MMXA 3B2VH 4GRWF 4IJ3B 3P9MB 4G8GA 4U6YB 5E56A 1UB5B 3RWDB 1NFIB 2AJZA 4NZRH 5CZXC 2Q7YB 1XGPB 2Q6WA 2C3VB 4ZOAA 1JGVL 1SJHB 4ZPVB 4CDGC 3D3VA 4U33A 2JKXA 4JR9H 4R6UA 3TLRA 1D5MA 3CVIL 2VZUA 1CBVL 4X0KA 4YQXH 4EN3B 3EFFA 2EDJA 3QCTH 2QKIA 4TNWK 1KN4L 2YPLA 5E8NB 1ZLUK 4NBYB 5IFAL 2PYEA 2LTQB 1MCNA 3NCMA 3PWPE 3MV11 4NWUL 4Y19A 2FJHA 5C07D 2A6JA 4TTDD 4XPGH 4M7JH 4U6XB 2CXGA 5D2LA 1QEWB 4JG1L 4OLXL 3BJLA 2CGRH 3FONA 3QIBA 5I1EL 3DTXA 1WBZA 1TJHH 1FYTE 3ZKXB 4PJHE 5CBAB 1AXSA 1H8SA 4YBLC 4XTRD 2OK0H 5K9KA 1BZ7B 5EU4B 3VXRB 2YUWA 2NY4B 2VUYA 1D7FA 3OKMB 1CFSB 5E7FA 1NANH 2XZZA 4K7FB 1G6RA 4MMXC 5ID0A 4DCQA 1S7QA 3PABB 4KGJA 2NY5C 4I0PA 2X1QA 4N5EC 4BQ6A 2SEBA 5EUOF 1T7ZA 4ZYKA 3N1PC 1CLYL 5BJTB 2CO6B 4U6TA 1WV7T 5GRZA 3T3ME 1NFDE 2R2EB 2CRIA 3QDGB 4K2UL 1S9WA 4ODXA 5F6IC 3VGBA 1GGTA 2ZWLT 4OLYH 4P2OB 3L5XL 1J0KA 2EDRA 2L0DA 1A2YB 1PEZA 2E8ZA 3HAEG 4IOFD 4UT7H 1HSBB 1EFQA 5EU5B 1E4XL 5D1QC 3B4NA 3GIZH 2NZ9D 3STBA 1N59A 3O11B 1IGJA 1Q0YH 1N4XL 4D9RD 1BX2B 5IHBA 1ORQB 5EB9A 4NQDD 3LKPA 5T3ZD 5HDQL 1SBSL 1CGXA 4X6EB 3IXTA 3QEQE 2YK1H 2IH1A 3ARVA 4DUXA 4Y1AE 3MREB 1MCWM 1FFPA 4ODVH 3CFCH 3NPSC 1FZKA 4H5SA 3TO2A 3CX5K 4YK4B 5BZDB 1N2RA 3UXFA 1ZA6A 5F6HJ 3IFNH 3TP4A 2P5WE 4G8IA 5HI3D 1UZ6F 1NCDH 3A0OA 1CF8H 5D2NB 1MCOL 2BCKB 3ZKMC 4J3UA 1D5XA 2BNQB 1J7VR 2FECL 5KBNC 4ODTH 1CIDA 3MRIB 3GM0A 2C3GA 5E9DD 2N1KA 3AREA 3V5KB 1BVLA 2A6KB 5IOPA 3QQ4B 4ETYA 1F6FB 3ZO0A 1DN0A 3TO4C 4D0DA 1RUQH 1DCLA 1I8LA 4KRMB 2UY6A 2C4FU 5ESVB 1OARL 5D1ZA 2QQNL 1O5DT 3DVGA 3N9GH 3T3PE 2K3TA 1NJ9B 1S78C 3DXAA 1RK1B 3HUJE 3O0RH 5KANI 1CCZA 4X98B 4I0PC 2ZUUA 3P11H 4JN1L 1RD6A 5IQ7H 1QO3A 3QUYB 5AZEH 4NUJB 3P4NB 1MNUL 1RVFL 1AD9A 4XPBH 4MS8C 3S96A 5D8JL 3KPRA 1E27B 4UB0H 1PGRB 2VDOH 4I18C 4YUEH 3DX6A 3O6LL 3JWDL 1CL7H 1X4ZA 2IG2L 4PLJC 1EEUA 4TQEH 3TNMB 3MNVA 5DHVH 4HD9A 2W0KA 1UXWA 2A1WH 4PRBA 3QUZB 1JL8A 4KTDL 2O5ZH 3QIWA 5GJSH 3PWJA 1SHMA 4L3EE 5D6CB 3Q0HA 5CMAB 3T2NL 4Z7WA 4K7PL 1P1ZA 3ILPB 4JDZA 5E2UL 4K71C 4RMSA 5IBUB 1KEGL 1IKFL 3QCUL 3LH2L 3IDYC 3FB8B 3BZFB 3MV8B 1U91A 3VWJD 1JPGA 3KDMB 3CVIH 4MXVE 2EE2A 3IAPA 1CBVH 4G5ZL 4ZNEA 4C56A 5HVWA 3HLAA 4DGYL 1IAMA 1ITCA 2PUQT 3AREC 1HHHB 1ED3A 1KN4H 3TESA 4QRTB 1HHKA 1IC5L 1YC7A 4GLRH 4MA1B 3GEWB 4P5MB 5IFAH 4O2EB 3RWHA 4NWUH 4F9LA 2GSGB 5M95B 2ERJC 4MX7A 2WQRA 5HYJA 2JJUA 1BD2E 3W9EB 5DQ9A 1DVFB 4JG1H 4OLXH 1M4KA 5DJDB 1IAIM 2XA8L 5I1EH 5D1ZC 5ENWB 4PYHA 1VGKB 2WBJD 3HG1E 4WI7A 3V7AG 2AXHA 1OP3K 3WNMA 2A73A 2V2TA 4GG6E 4IRSB 3TC9A 1H5BA 1FG2A 3PL6D 4Y8DC 1EHLL 3RY4A 1FH5L 4KJYB 4JRXD 3TBYB 3GJEA 4FRWA 4V2BA 4AG4L 2EDTA 1FL5A 1CLYH 3ARFD 1CFQB 3VXUE 4HS3A 1F00I 3KLHD 2XRAL 3I9GL 3O4LE 1IGIL 5FKAB 3SO3C 4Q74A 4BUHA 4Z7QF 2OL3L 3KPPA 3L5XH 5C09A 3SDAD 1RZJC 3G9AB 1Q9KA 4JFXA 3IFLL 1KNOA 1KYOJ 3RVXC 1G7HA 3U4BL 5F6HI 5E0QA 2COQA 1N4XH 1ZGLA 3W9DA 4L8BB 4O4YH 1I85C 1EUTA 4JO3L 4S2SB 4WFEE 5HDQH 4HIHB 1IEHA 1SBSH 3RL1B 3KPTA 2G9HA 4Z6AT 2ICCA 4X6CE 2GFBA 3PWLB 1OP3H 1DANU 4G42B 3G9VA 3VG9B 1BJ1H 3SE3C 1JV5B 2J6EA 3RX8A 3P2TA 3DI3B 4JPIA 5K9JH 2DLIA 2VAAA 4O5LL 4H1LA 3KPSD 4HEPG 3VGAC 2EKSA 2GIYA 3SKJH 3R4DA 4QHUA 1JK8A 1NCWH 2DQJL 4F9LC 4OCLC 4U6HA 1N8ZA 2ZSWB 3PGDB 3I3DA 4L8CA 2VC2L 2BY0A 5D5MF 3BMWA 2MKWA 1E4KA 3QQ3A 2YD2A 3VXTB 1ONQA 2VXSL 1WIPA 5GHWL 4YC2C 4FHBD 1OARH 2QQNH 1H5BC 3OF6A 3K8KA 3LRHA 1NBVL 4GW4B 4JN1H 5C0FB 4LK4A 3T0EA 5F7FA 1DJSA 2VN4A 3OX8B 4FTVB 5T1KA 2EDBA 1MNUH 1RVFH 2ARJA 1FZOA 2W60B 2R2HB 5D8JH 4CMHB 4ZO6A 2P47B 3TWCL 2NY6D 3TIEA 1WIUA 3ZHDA 3F7YA 3LKSB 3SCMD 3RDTB 5IHUL 3S36X 3O6LH 1HHGB 3JWDH 3HPLA 2IG2H 1A6AB 5DZOA 5BXFB 1N5AB 2ATPB 3IFPA 3NCJL 1SM3L 4HV8A 3TJHD 5IW6A 2EEDA 5C0EB 2EDDA 5ID1A 3CU7A 3O41B 5D7LD 3MLZL 4KTDH 3CCHA 3TBSB 5ACZB 5LG1A 5GGSA 3QEHB 1RZFH 4ETQA 3T2NH 5CHNB 5E2UH 1R3JB 3IS0X 5EOCL 3S7GA 4MB5A 4NN6B 4ZPTB 4F80A 1KEGH 4PJ5A 3QCUH 3LH2H 5L2JA 1CGUA 3O9WA 5B4MC 3BFOA 1OP5K 3MLUH 4GRWH 3P40A 4G5ZH 2JIXB 4EN3D 5CGMA 4NC1E 3H9HA 1FNHA 4DGYH 5CIPA 3SJVA 3VW3L 4HJGB 3LRGA 4R2GC 4GXUN 1NSNH 1DQTA 2CIIB 2CKBB 3K8LA 4OSUL 1CE6A 3MCG1 1IC5H 3BISA 3MUJA 3QWRD 3T3MF 4NO3A 4CRPA 4MAUL 1E4KC 5MHSD 1QFPA 2V5YA 5FYKL 1CDBA 4WWKB 4WW1B 4Y5YB 3D69B 3N85L 4PLKC 3PG2A 1FZJB 4Q6YA 4LRNL 5LGKA 4PY8J 4LPTA 3T8XB 2PYFA 3G6AB 4LSSL 4BSVB 3VXRD 5CEZE 4UTAL 1A1OB 2NY4D 4ENED 4I1NB 5EWIL 4Z0XA 5BCAA 3T0EC 1J87A 2PTTA 3IXAA 1T1YB 3IGAB 4EXPX 4I3GA 4PGCB 5BQ7A 1EHLH 4FQIL 3TF7C 1FH5H 5DRXB 4PRPA 3VXQA 3AB0C 4MJIB 2P5EE 3HAEB 5DJ2B 1XIWD 1RMFL 3TA3A 4AG4H 2I26N 3B43A 1J05A 3IRZA 5LVEA 4WU5A 4HIIB 3FQRA 1CD8A 1DUZB 3Q3GA 3NGBC 3SDXE 3WN5C 3OAUL 1FYTB 3EOTL 2XRAH 3BXNA 3I9GH 4PJHB 1I3RA 2CO7B 3QP3A 2OL3H 4P2OD 1OP5H 1GHFL 5AAMA 1I1FB 4ODBD 3IFLH 2EDYA 3BPCA 4XCNB 3U4BH 1M7IB 3ULVL 3WEXB 3H2WA 1IL1B 1UWEL 1KPUB 3O6FA 4L8SA 1YN7A 3P4OB 4J3OC 4JFFA 2JJWA 4LARL 2E8YA 1TVHB 5D7SL 2AXFA 1S9XB 1B0WA 4XC1L 4JO3H 2XZAH 4ODUB 4PJ9D 4UV7L 5I9QC 1NFDB 4Q9QL 4MQXC 2DICA 2YD9A 1VFOA 2EDNA 1G0XA 5HDLA 1MI5A 2FEEL 4L9DA 2Z91B 4P3DB 4YPGA 4Q6IA 5BZWA 4UU9B 3PF2A 2VZ3A 3SGDI 2VLJA 4XT1C 2BSSB 2J8OA 3DV6B 4KJPC 3MGOB 4O5LH 5CGYD 2VXUL 3SDDB 3MLSL 1KN2H 1T04B 4EUPH 3W0WD 5DK2A 4LSQH 5JLZA 2BNQD 4FG6D 1T7XA 2DQJH 1SJEB 3MRLA 4WW2B 4U7KA 4YXKL 2Z31A 5DHXB 4X7SL 5INDB 3BN3B 4K3JL 3QDJA 4Y1AB 5L8LB 2VC2H 3PWNB 3VXMD 5FA3A 3MRRA 4OZ4B 4RRPG 4JQXA 1WBYB 4Y5XC 5K9QI 1ITBB 2D9QB 4UINL 4UQ2A 4KVNH 2VXSH 4OAWB 1CDJA 5GHWH 3F58L 3O3AB 3BD5A 3H9YA 4P9MH 3KJ4C 1OLZA 1VA9A 4I3SL 1N6VA 3ZKQD 4D3CL 1NBVH 1CGWA 5GZNC 3QUYD 4KK5C 1U8QB 2P45B 3CFBB 2XKSA 4JQVA 4XBPA 1FPTH 1ZVYA 1H3GA 1AJ7H 1UM4L 4H25A 3TWCH 1IZKA 2ADGA 5GGRY 4P9HC 1WCQA 3CH1B 1ZHNA 5IHUH 3U7WL 3CSYB 1X5HA 2X7LA 3HUJB 3RPIA 2CKBL 2OI9B 5T1MB 5SWSE 3RKDC 3NCJH 1SM3H 2NLJA 4WVRA 4EEEA 3DARA 3QUZD 4I9WE 5AZ2L 3FT4B 3MLZH 5FB8B 4GW1B 3AU1A 5IFHL 3C08H 4NQEA 5CS7A 4IMLA 4YEFA 1I9IL 2CPCA 2FIRT 4MXQC 2AXGA 4MJ4A 5CGTA 5EOCH 1KOAA 4AEIL 4WHDA 4P57B 3MV8D 4GG6F 3VGEA 1Z0MA 2Q20A 3RIAF 3MXVL 2F54E 4PTUA 3VW3H 3G5YA 3QWOB 2QADB 2IQ9L 3VI4E 1ETZA 3NIFE 2YA0A 3VFWA 4JQXC 3RL2A 4HUVA 4MAUH 2D4FA 4NNXB 5FYLE 3WCYA 2IPTH 3O8XB 4AH2B 4KFZC 5FYKH 1OAUL 1DVFD 4M6OL 2HKFL 5DGQA 1F42A 3N85H 5KSUA 1X6LA 1JPFB 4LRNH 3ZE1E 1BWWA 1G7PA 3ILQD 4IIQB 1DQQA 4LSSH 2YPKA 2ZKHL 4BA8A 5I66A 4UTAH 2ZOKB 1IGFL 1F4AA 3GSUB 4IRSD 4FQQA 5IV2B 3V6OE 32C2A 3LN5B 3MLTA 3RGVB 4FQIH 3UTPD 3BH8B 2A6IB 3DX8B 4JY6A 5JNYA 1RMFH 5T1LB 4HKZA 1T7WA 3NABL 5DEGA 5KVMC 2FRGP 4FQHB 4X6CF 1KCSL 3PQYE 1U8NB 2AK4B 1MVUB 3OAUH 5DK0B 3EOTH 4N1EA 2FX9L 3HG1B 3I6GA 4LPUA 2MHAB 1CDYA 2V7NB 4QTIL 1JRHI 2RBLA 3CLFL 3RWFA 4TTDC 1GHFH 5FYKD 4APQA 4U3CA 3MPCA 5E9DA 4XP9H 43CAA 1CFTB 4NKMA 3PWUB 4XTRC 5DI8A 3S5LG 4LARH 5HHOE 4LL9A 4DQOL 5D7SH 3UBXG 1UC6A 1OLLA 3BOVA 4UV7H 5T5NG 3IYLW 2MQ0A 3QFJE 2OSLA 5CP7A 1SYVA 5DJXA 2GK2A 1DQDH 1G1CA 5GSVB 1YY8A 5AUMA 5FF6B 1AD0A 2J88L 3K8MA 1T3FA 1OF2B 4OBRA 5MI0C 4HK0A 4EIGB 2BC4A 3MLVL 2VIRB 2D31B 3F7RA 2VXUH 3UAJD 3MLSH 3RJQB 5DWUL 3U30B 4U1SB 4KI5C 4KPHL 3MODL 1QRNA 5FECA 1T66D 3F12B 5L6YL 3VA2C 1AKJB 5CJQL 4OZFH 1WBXA 3FT2A 4ZFZB 2AXJA 4YXKH 2JK5A 3DYOA 4X7SH 2VWEE 3RAJL 4K3JH 4Y4HB 3BZEB 4P5KA 3ULVD 5EUKA 5JW4M 3IVKB 4GAFB 2NZ9C 1JYNA 5B3JE 3OGCB 3LZFL 5H35A 1U8LA 4WTZG 1QSFD 4UINH 4P4RA 3QO1B 3B2UD 3TNNA 3JV5A 1NBQA 4JFDD 3BP4A 1IEAA 4NNYB 1T03L 3V6ZB 3WLWC 1X7QA 4MHHI 2G2RB 2CLVA 4NT6B 2BMKB 3LKNB 4D3CH 2VLMD 3MV7E 4UDTA 3UPRB 3I85A 2IC2A 4HIXL 1RFDL 1FVDB 1KIRB 4FTVD 1PLGL 5HI3C 3G08B 4OIIL 5E8PB 3GJFA 4XCCL 2CKNA 3WFEL 1UM4H 5BVJB 3G5XB 1FFOA 1I9EA 1Z5LA 2HWZL 2QLVB 1QSEA 4YBQD 3M17A 2VE6A 3RDTD 4QRQB 2X1WL 2YBRB 4HWBA 5J56B 2E27L 2P8LB 25C8L 2XNAA 1AHWC 3VI3E 1RJZB 5DYOA 2CKBH 2OP4L 5F7EL 5DLML 1HHJB 2ITDA 3LRSB 3PHQB 4V2CB 4KDTC 2HTKD 4E5XA 5HGGS 5AZ2H 4MJ6B 3OKYA 2V7HA 1R5VB 3WNNA 4X9BA 2A0LD 3V6BR 5IFHH 2WBJA 4N90E 1I9IH 3TBWA 4NZDA 5F7DB 3BWUC 4TULL 1Q9OA 2E7LA 4K9EC 2GK0A 1TDQA 4U1LA 5GGSY 1EXUB 2FB4L 4HZAA 2FX8L 3ECBA 1E4WL 4JM2F 5CZVL 5L7XL 3UDWA 1F3RB 3CDGA 1D6EB 3SKMB 1OTUD 1TVBB 3VRIB 5D7JA 1SYSA 3FO0H 3MXVH 3QRGL 2AS5M 5EBGA 2O5XL 4MJ2A 4ZUSB 3FRUA 1MJJA 3SGEI 1IC1A 4PJFE 4UAOB 1OGAE 2APBA 3O3EB 1P4IL 2IQ9H 2R69L 3CSBA 2DQFB 1PQZB 3SDXF 3GBML 5C08B 4UOW0 1MFNA 1EAPA 3QZWA 4WHYG 3GK8L 5F7YC 5D96B 1OAUH 4M6OH 4WWKD 3T04D 3GDBA 2HKFH 4F3FB 4QY8A 4L4TA 1FFNB 3KG5A 1WAAE 3A67L 2C1PA 1V3KA 3QUXD 3LPWA 4N0RA 3QG7L 2ZKHH 5KN5A 4Q97A 4PB0L 1IGFH 4ZUUA 2XXMB 1JP5A 2DL2A 3QDMA 3S4SG 5DRZB 1GIGL 3SBWA 3PWPD 4MD5B 1IQWH 3LSOB 5D93B 3ROLA 2Q86B 4P2RE 5JORB 2DF3A 3NABH 4YNYA 3DGGB 4Z76B 1KCSH 2VERN 4D9QE 1JWMB 1FYTD 3DX7A 7CGTA 2FX9H 3F6IA 5EBWA 4QTIH 1TITA 2XTJE 3IETB 5GS1B 3QHFL 3BSZL 2ZNXA 4IOIA 4PRAB 1T4KB 3QEUB 2PTVA 5HTSA 5MP6L 2ITCA 2ADIB 4LP4A 5C0RL 2WBJC 4Y8AA 1QYGL 5A2KH 3RU8L 4DQOH 1CG9A 2E7LC 5KTEL 4ONHA 2NXYD 1UZ8A 4P3WA 5C0BA 2DLTA 3WFBL 4XXDB 4DN4L 3V4UL 3PL6C 3VFTA 1A6TA 1BFOA 3WL9B 5F3HB 5JHDA 3EOAB 3UDWC 1RI8A 3WJJA 3S34L 3L7EA 2OTUB 3C60A 3MLVH 3ARFC 4PJXE 1X5LA 2YUZA 3BWAB 3SDDD 4I8DA 5DWUH 5FDYA 2CDFB 3DVNB 3MODH 2EXWD 4TUJB 4MMZC 4PJ8A 1T1XA 4KMQA 5L6YH 4IMKC 3MR9A 5DVLA 3SDAC 2EDKA 5MEPA 5CJQH 1F02I 1EGJL 4GSDL 1R5IA 3QEQD 4HQQL 4JHAL 5GJTH 3RAJH 1D3CA 1NC4B 5JIHA 1MEXL 4LPYA 1R5WA 4Y1AD 3CMOL 3K1KC 5HY9B 1CFNB 3CZJA 2DWEA 3LZFH 5ANME 2HVKA 4HWUA 3QJFA 4KK8C 4NO5A 2YHGA 4RDQG 5D7LA 1JMZA 2P5WD 5EZLA 2IANB 2WIIA 4P2QA 4N0YL 1NEUA 3EDDA 5AWNH 3P9MA 1KTDA 5TH2A 2BXYA 1U95A 1T03H 3O4OC 1YJDH 3C09B 5EBLB 5FFLA 3TZVA 2E9WA 3RWDA 2Q7YA 1XGPA 4OCMC 1TQBB 4HUUB 2C3VA 4Z5RB 1SJHA 4ZPVA 3HKFA 1F97A 1RFDH 2FJGB 3RWGA 1WWAX 2VABB 1PLGH 3X3FH 3E2HC 2BVQA 4OIIH 3OBAA 4LGPB 1TCRB 4QRUB 1L9MA 2QR0B 3FB6B 1XCTB 1CLZL 2HWZH 4LDOB 4I77L 4EN3A 4TVPH 4DKEL 4CAGA 4ODSL 2CD0A 3Q5TA 4QHLB 1D9KB 4LU5L 1Z6JT 3WKML 5F1OB 2MWCA 2CK0L 25C8H 2VSDA 3OJDB 3MGTA 3UMTA 2OP4H 5F7EH 4J8RB 3AVEA 1PYWB 5FO7B 1QEWA 2JTDA 5FDWB 4PJBA 2Q8BL 3VI4F 5J12C 3NIFF 2B5IB 3HZMB 3GM8A 2A38A 5CBAA 3PUCA 3DVFA 1Y18B 2W9LA 2YC1B 2HT3D 1BZ7A 4TULH 2J5LB 3L6FB 1CFSA 4K7FA 4XVTL 3ZE1F 4M61B 2FB4H 4WNQA 2FX8H 1E4WH 4QO1A 3PABA 5L7XH 1FNEA 4HZLA 5SWSB 1DQML 4L3CB 1R24B 4EDXA 3MA7B 2NY6C 5EFIB 1K4DB 4Z77A 2YUVA 2W91A 1KG0A 5C0AB 3QRGH 3SCMC 4L4VB 3CVHH 2O5XH 4PJGB 2R2EA 5CSZA 4L3ED 3G6JA 3QDGA 3VFVA 1MCEA 4U3HA 1K85A 4GAYB 3GMMB 2QADD 4PV8B 2R69H 1HHIB 4H26B 3IU4L 5HPOA 3TJHC 3GBMH 4UT9L 3DUSA 3VD9A 1IAOB 1M6OA 1A2YA 5DUML 5CEZL 2PCPA 1HSBA 2P24B 2DQCL 2XPGA 4IJ3C 1FAIH 3UO1L 3A67H 2YD3A 2EZ0D 1YMME 2XFXA 4F7EA 1MRFH 4PRNA 2VQ1A 3OKDB 3CXDL 4PB0H 4X6EA 5ERWB 3SDCB 2EC8A 5E94B 2X05A 3H7BB 5ISZB 3RGVD 4WFFD 5LAXB 3ZT7A 2NY3B 5AYUL 2VLKE 3WLBA 1B2WL 4M93B 5JA9A 3LPGA 5T1LD 1BD2D 1BWMA 1PSKL 4C59B 2HLFD 4EN3C 2R1WB 2AK4D 1N3NB 5D2NA 4N0FB 5A2FA 3HG1D 2Q87A 3ISWA 3UBXB 4XNXL 2LTQC 3MRIA 1K6QL 5HHXH 3BSZH 4OCNC 2V9TA 3UTSB 1OTSD 3V5KA 3W82A 2R0KL 3BUTA 5MP6H 2NR6D 3QQ4A 3NPZB 3M07A 5C0RH 3ZKXC 5BRZE 2PO6B 1KLGB 3RU8H 2NY4C 4ENEC 5KTEH 3VXUD 1JNHB 1KJ3L 5ESVA 2R23B 3O4LD 3WFBH 3V79C 3RVVD 5D7IE 2H2SD 3V4UH 3W39B 2J8HA 1NJ9A 2WUBL 4OB5H 1RK1A 3D5OF 4X98A 1XIWC 5HDBE 5A2LH 3TYFB 2KH2B 1RUKL 3S34H 3GNML 1PD6A 1F6LL 5C71A 5FHBL 1E27A 2R0LL 2FO4B 3V4PL 1KCLA 3FOMB 3ULUE 3QPXL 4P2OC 1AKJD 3NFSL 4WFED 1JHKL 1EGJH 5IGXL 2W0FB 1NGWB 4GSDH 3GSXB 4HQQH 3BEWB 4JHAH 4PJDF 1NGXB 4Y4HD 1MEXH 3CMOH 1FC1A 2NX5E 5GZOD 3LKOB 5GSRA 3TFKD 4RWYL 3VI3F 1IJ9A 4ZUWB 2OS7A 3HN3A 5FKPB 2YD8A 4M6ML 4N0YH 2KQMA 2DLEA 2EDOA 5D6CA 1P5VA 5CMAA 2NTSP 4J23A 5FGCE 5J1AB 4MNQB 3ILPA 5KSAB 2P49B 3KVQA 4FXGB 4YK4C 1I8IB 2A74A 1MAJA 1KB5A 4YJZL 3B6SB 1AQDB 5CGYC 2CDEA 4N8CL 3SPVB 3BZFA 3RNQB 5D2NC 4MLSA 3CXHK 4FG6C 3W2DL 5I30L 4JANB 3WDHA 3RX5A 4G8GE 1CLZH 1OQOA 4DKEH 5JDSA 4ODSH 4N8PA 3OB0K 4PREB 2UZXB 4LU5H 1NCTA 1HHHA 3FO9B 5CP3A 2CK0H 1FO0L 5DJ6B 4LHJB 3D3VE 3MV7B 5I76B 1WC7B 2O26U 2GSGA 4LRIA 2GY7B 4JKLA 3VMPA 1PKQA 2BRQA 4PJFF 3GSWB 2W38A 1MCWW 2X4UA 1DVFA 3OXSB 4GUPB 4A2MA 3STLA 3VWKB 1G7IB 2PW2B 1VGKA 5HHNB 2YPLE 1YYML 1NC2A 5ACMA 2PYEE 2QTEA 2PF6A 2EO9A 3QUYC 2VZVA 2HG5B 4XVTH 2VZTA 4M8QA 2YWZA 3T0WA 5D2LE 2XWTB 3TBYA 4MA3A 1DQMH 5J0BA 4HC1L 1UWXK 1NL0L 4LPCA 2BRRL 4WU7B 2C4FT 3AAZB 3WIIL 5FYLL 3MYZA 4HAGA 1ZA3B 4PJIB 1F6AA 4O00A 2K9UA 4LLYB 2H32H 5FKAA 5ESAB 3WIFB 1N6QH 2BZDA 5DD6A 1N6UA 3IU4H 3S4SB 5DUMH 5CEZH 3QUZC 5DR5H 4DGIL 1Q9LB 1YEDA 2KPNA 1B6UA 1MUJB 2YPVL 2R8SL 1IEBB 3VD7A 3C9NB 2QHLA 4JREB 1CI5A 1FIEA 2OJEB 4OCXL 4LLWA 3UO1H 3QXUA 3REWA 4R97B 4L8BA 1HILA 5LWYL 1EO5A 3TVMB 1O7SA 4QRPE 4S2SA 4HIHA 3RL1A 43C9B 3CXDH 2Y6SD 2OTWA 4X99B 2VJXA 4NJAL 1G9NC 1DBML 1QLEL 5AYUH 3RI5F 1EEYB 1B2WH 4OM1L 1U0QA 1W72L 3PWLA 4F33B 3UJIL 1JV5A 2DTSA 1PSKH 1X5XA 4NHUB 5EO9B 2E5EA 5CWSB 2AQ2A 1BPVA 4DOHE 4NNPL 4M6NH 4PJAA 3C5ZA 3D18B 1V8HA 5FM8A 4Y4KD 4XNXH 4ZUTB 2MTPA 4JM2D 5CEZD 1UWXH 4LRIC 2JB6B 4YX2L 1MFDL 4NPYB 2ZSWA 1DVFC 1V7NL 4LLQB 2HJKA 3AMLA 2DM7A 2WLYA 1A1MA 5E99L 3K1DA 4P2RB 1VEMA 3ILQC 2J3SA 2QSQA 4QNPE 4IRSC 4LSVL 2Z8WC 1KJ3H 1I4FB 1YPZB 3VFMB 3OQ3B 2WUBH 4Z7UA 5A43C 3KLAB 2XTJB 1MHCB 2AJYH 4AJ0A 3THML 3H0TB 1MFEL 2WINB 4A6YB 1RUKH 4L4JA 2FBOJ 5BO1L 4LEOB 3MRCA 3TCLA 5I73B 1P7HL 3A6CL 3IDJA 3GNMH 3OZ9L 1AGFB 3O45A 2W60A 1DBKL 2YA1A 2R2HA 5FHBH 2R0LH 3LHPH 1T5XB 3U9UA 3V4PH 3QPXH 2YXFA 1V05A 2BVPB 1NAML 3DXAE 2DB8A 3LKSA 1JHKH 5IGXH 1HHGA 1KGCE 4KMLB 1NC4D 1A6AA 3OG6B 2V6HA 4PJEE 5BXFA 1N5AA 3VXNA 4OT1L 4U1MB 1FCCA 3RJDA 3K81A 5HI4D 5C0EA 4HWNA 4ODWB 3KPRE 4QCIB 3L3DB 3O41A 5TJWK 4LAJH 4EIZC 4RWYH 4PJXB 5IHZB 4B0MM 1P9MC 2EC9U 4PFEA 3KPMB 4MA8L 4XVSL 2PXYB 3EYFB 1BVZA 2BSTA 2Q3AA 1GGUA 1LVEA 1N64L 1R3JA 3FN9A 5C0GA 1R3KA 3VG9C 2R39A 4ZPTA 3I6LE 4LHUD 1FE8L 1ND0B 1RY7B 2ZJSL 1JGDB 2OZ4A 2EYTA 3DRQA 4N8CH 1A6VL 1ZV5A 3GBNL 1T66C 3W2DH 5I30H 4DUVA 1JF5A 5DS8B 2JIXA 2E7MA 3OHXA 4Z7WE 1SQ2N 1WWBX 5T33L 4XMPL 4HJGA 2CJUL 5EC2B 5J57B 1U8HB 3ULVC 3DIFA 2V5MA 1FO0H 1DANT 3DV4A 3FZUD 3V7MA 3MBXL 4MJ5A 2CLZB 3MRBB 5E08L 3B2UC 4WW1A 4Z7VB 1LD9A 4Y5YA 3D69A 5I1GL 4ZNEE 4C56E 5IEKB 4HUMB 1J11A 4XVUD 5DJCB 5KSBB 3CGTA 4RX4D 1A1OA 5DFTA 1X3DA 2IFGA 2IADA 1T1YA 3IGAA 2Z4QB 1HWHB 5ADPH 1OAKL 3D0VB 4K7PY 4PGCA 5HYJE 5MENB 1BIHA 4WO4D 4MJIA 4CMHC 5DJ2A 5SWSD 3C6SB 4HC1H 1BAFL 1F4YL 2BRRH 4I9WD 1TQCB 2VRAA 3WIIH 4HIIA 2DLGA 4OD1L 1DUZA 2X4NB 3RDTC 2EE6A 4HUNB 2KUTA 2Y4SA 5L0QB 1Q1JL 2I9LB 1G7JB 4YGVB 2HTKC 4C4KT 4JFZL 4DGIH 3MV9A 4XPAL 2R8SH 4XCNA 1M7IA 1FV1A 2A0LC 4OCXH 1IL1A 3AM8C 2FLRT 3FO1B 4QHNA 2ZSVA 2UZYB 4XNZB 2F54D 5LWYH 1U8IB 4ODUA 4P59L 5JO5B 1TNNA 5DJ8B 1NFDA 4NN6C 1ZHLB 2DKMA 5C09E 5K9OB 3SDCD 3DMMD 4RA0C 4I0CC 1KJ2L 5ISZD 2Z91A 1LEIB 3CSGA 1XF3B 2NY3D 3DSNA 1P6AB 3EJZD 3QO0B 4NJAH 1DBMH 1QLEH 4LNRB 4F57L 4OM1H 1ZWIB 1W72H 1OTUC 1BGXL 1A3RH 5FYLD 4W81A 2BSSA 5D7IF 3UJIH 3DV6A 4X9GA 2I9TB 2GI7A 4KUZL 1VENA 4A6YL 2DDQL 2E7CA 3MGAA 3NCCB 1BIIA 1WFOA 4WRLA 5HDBF 3SDDA 1T04A 4NNPH 4PD4K 2P42B 1YMMB 2R29L 2I60L 1L0XA 1SJEA 4R0LB 1C08B 2BVUA 5E2VL 3ZTJG 1P2CB 4JJ5B 4YX2H 1MFDH 5INDA 1HE7A 1N0XL 4LBEB 3QIUA 4WWKC 1EK3A 1V7NH 4Y1AA 1GOGA 4Y5YC 3PWNA 3VH8G 1MCJA 5E99H 2PO6D 3QUXC 3JBG7 4OZHA 3GKWL 5FYKU 4XAWL 3RP1A 3EO9L 4OAWA 3PQYD 4LSVH 4X6DB 5LGJB 5I0ZA 4G6FB 1LP9A 3BHBB 1BM3L 3OJ2C 4ZSOB 3THMH 1MFEH 1G9ML 3OG4B 2QSVA 5BO1H 3CFBA 2BFVL 3L9RB 3A6CH 3OZ9H 5I16B 1DBKH 3RFZC 4OKDA 5JR1H 5HHOD 2CUIA 3EZJB 3MJ6A 1NAMH 2A9ML 4HKBB 1CDHA 3WUWA 3Q6GL 4QT5A 3T0EE 3LQAC 4GRMA 4HT1L 4OT1H 2NW3B 2ED9A 5KVGL 4MD4B 4QF1A 4ERSL 4TUKL 3T2QA 3FT4A 4EOWH 4GW1A 2PTUA 3MXWL 4MA8H 4XVSH 1U93A 4CUCA 4HJJL 5F9JA 1S7TA 2JJVA 4QXWA 4PV9A 2CLRB 4MNQD 3REVB 5KSAD 3UTZB 1N64H 3EDEA 3NFNB 2XY2A 5EBMB 3NMEA 1MY5A 4ZDHB 3WE6A 1J12A 2ZJSH 2ATKB 2X42A 4LLMA 3SDDC 1DLFL 1A6VH 3NFPB 4P57A 2EXWC 2KBGA 4QWWD 4HIJB 1OM3L 4DN3L 2HT2D 4WW2C 4WEMB 1A9EA 5D2LF 3RTQB 4I5BB 2BY2A 4XMPH 2J2ZA 3MBEB 3I2CH 4BELD 4PJ5E 5DSCB 3MV7D 2RIKA 3IJSB 3MBXH 3EJYD 3MRMB 4AH2A 3O8XA 5E08H 1SVCP 1CICA 2DL9A 3DVIA 4HS6B 5I1GH 4DZ8A 4N9GB 1JPFA 3SJVE 1EUUA 2HFGL 1YECL 4G8GB 4IIQA 4PGBB 2E6PA 1SBBA 2ZOKA 3VGGA 3EKCA 5IMKB 2AJZB 3GSUA 3T0XA 1GPOH 1IGTB 5IV2A 1GAFL 4JY4B 1YEFH 2D7QA 2ZUYA 3D3VB 2A6IA 5IEHB 3QT2A 3TGXA 4K3GA 3GRWL 1D5MB 1F4YH 1EO8L 3LN4B 4CJ0A 1G7QA 3OKOB 4FQHA 4LLVA 1U8NA 2AK4A 5BW7A 5DK0A 3EFFB 4OF5A 4XMLH 1P7QB 1FDLL 4P46B 3JSSA 2QKIB 2MHAA 5IVXB 4G6JL 2V7NA 4RFNB 5C3LD 4NSKA 2OI9C 1KULA 1Q1JH 4JY5L 2VZSA 1RHFA 3LVEA 3C5SA 4PRPE 5IIEB 3CJJA 2A6JB 4JFZH 4OD3L 3V5DB 5EO1B 1CFTA 3BN9C 3FONB 5DRNB 3QIBB 5I1DB 4CVWA 3PWUA 1WK0A 2HT3C 5I1LB 1H3VA 5DRWB 3EO0B 1HIMH 3TVMD 4P59H 3S88L 3HE7A 4DK3A 2HRPL 1OGAD 1JIBA 1MCPL 3ARGA 1KJ2H 4OF7A 5GSVA 1DE4B 4KDWA 4AEEA 4F57H 1E28B 5FF6A 4XI5C 1BGXH 2UUDK 1JMXA 2Y7QB 2D31A 4KUZH 4JFFE 2MCPH 4HLZG 3WS6A 4A6YH 2DDQH 2LU7A 3IDGB 1KEML 2QADC 4ODXB 4AIOA 2I60H 4RNRA 1MI5E 4M6AA 1AKJA 4QRPB 5E2VH 3QNZA 1VKXA 3CDFA 4YE4L 4ZFZA 4HH9B 3O8XC 3S3JA 1N0XH 5IWLA 3BZEA 2VLJE 1N7ML 1LO4L 2HP4A 4Y4FA 3IVKA 3DGCR 2X9XA 5EU7E 4AT6A 3OGCA 2AJUL 5KAQG 4F15B 4P2RD 2EZ0C 4IIQC 1LWRA 1N59B 1U8OA 1IGJB 4XAWH 3EO9H 3DWTA 2V2WA 5IM7A 3FQXB 3QO1A 4D9QD 3U83A 2JCCA 3RGVC 5GIRB 1OWWA 2IH1B 1BM3H 1T2XA 2G2RA 4NT6A 2BMKA 2XTJD 3LKNA 3ULUL 4FN0A 1FZKB 1G9MH 2HLFC 3TO2B 1N2RB 2BFVH 2WANA 3TIDB 3O2VL 5E8PA 15C8L 3ORJA 4EI6A 5BVJA 2AEWA 4OCSL 1U6AL 4GRLB 1D5XB 2UUDH 5T3XH 2NY5L 2A9MH 2J7LA 4QRQA 3Q6GH 2YBRA 1OTSC 3L3HA 4ZXBB 1KCRH 2NR6C 4L9LA 1BVLB 1MQ8A 1RJZA 5IOPB 1MHEB 1YQ2A 5IFJB 3LRSA 5KVGH 2BDNL 3VGHA 1XT5A 4ERSH 4TUKH 4MJ6A 4UIMB 1EZVY 1FFQA 4KKBD 3B9DA 2IF7A 3MXWH 4OQ1A 3RVVC 2H2SC 4HJJH 5J8OA 3QFDA 2PXYD 2HFFB 4LLUB 5F7DA 2N7BA 4L1DA 2GSIB 5F93C 4K55A 5GXBB 4YFDB 3QQNA 4PJEB 5D71L 1PBYA 1U58B 3U30C 1DLFH 3HR6A 3BMVA 4GKNB 3U1SL 2VDLL 4WI5A 1ACZA 1D6EA 3SKMA 3VRIA 4NQEE 1HINL 1OM3H 4DN3H 3SY0B 3KHOA 3I84A 1DBAH 1MJ7L 3MMEB 4ZUSA 3QAZB 4Y4HC 5IWLC 5HGDA 3D48R 4WGVB 3O3EA 3IDXL 5GZOC 3VDBA 3ZDXE 4O58L 1PQZA 3MNVB 5DHVA 1OD7A 1ACYL 5C08A 1UXWB 2Y07L 2OJZL 3TFKC 2YOCA 4WFHD 3ZDZE 4KRNA 4F3FA 4HDIB 3QIWB 5JMRA 4OV5A 3CC5A 3PWJB 3D2UA 3WIHH 2HFGH 5DQJB 1YECH 4KI5E 1EJOL 3QHTC 3GMLA 4JPWL 4Z7WB 1CR9L 4M03A 3X12A 12E8L 3QUKA 5FM4A 1TLKA 3MUZ1 4R26L 3ZKSD 4OZIF 5IR1B 1Q8MA 1GAFH 2BJML 3BYTA 5DRZA 1SJVA 5MEND 4K8RH 3W5NA 2B4CC 1G6RL 4F7PA 4NOFA 3LSOA 1U91B 4JB9L 2Q86A 3GRWH 5JORA 1T89A 1EO8H 3ARDB 4UMGA 2VAJA 3LOWA 1MPAL 4ZS6C 5FUOL 4HXBL 1FDLH 4GQ9L 4G6JH 4I2XB 3ZDYE 2EICA 3IETA 5GS1A 3BO8A 3HS0B 1T5WA 4EXKA 4LMQE 1T4KA 3K2UL 4MX7B 5TQ0L 1X44A 2ADIA 2F8XC 1UVQA 1YZZA 3V0WL 2GTWA 4PRDB 1OAYL 3S88H 2A73B 2HRPH 4XXDA 2DQUL 1EMTL 1MCPH 4W4NA 3NA9L 2E7HA 5A1AA 5F3HA 3EOAA 4J1UB 2YN5A 3VH8B 1WFNA 2OMNA 5B8CA 4BH7A 1FL5B 4UUJA 4EQ2A 4HGKC 3ZE2E 1KEMH 1FL6B 2CDFA 4UAOC 3T0BA 4TUJA 1YMMD 4AQ1B 4K3EL 5EU3B 4F7TB 1WSST 1B90A 5F21B 4YE4H 3KPPB 3QJHA 5C09B 3KGRA 5D96C 1NEZA 4XBGB 4AM0A 2VKWA 1Q9KB 1NC4A 1N7MH 3TT3L 4QYOB 1AP2B 1LO4H 5C2UB 2VLKD 5HY9A 1G7HB 3OR7B 2X89A 2AJUH 1HN1A 2QJDA 5E8DH 5F1SA 4S0SD 1QRNE 2K7QA 4DEPB 1ZSDB 2IANA 4RA3A 1ZGLB 4KQ4L 4PBWD 4YFLI 3ZKND 3P4LA 4OLVL 2G9HB 1PX4A 5HYQA 2BOCA 5D93C 2ZCKL 4JCMA 1T89C 4HUUA 4Z5RA 1RU9L 2VABA 4JPIB 5I15L 3O2VH 1ZT1B 5BRZD 1NAKL 15C8H 1HQ4B 1TCRA 4YBHA 4QRUA 2QR0A 4OCSH 4QHUB 1XCTA 1JK8B 5GS1C 2NY5H 3MTRA 1D9KA 5IVZA 2IPUK 2M8XA 4XMKL 4TNVK 4IOSD 4BQ9A 5C6WH 4L8CB 2HLAA 4J8RA 5CBEB 1BQHA 2BDNH 1PYWA 4S1SL 4KZDH 2NY2B 4HPYL 5HYFA 3QQ3B 1RZJL 4CGTA 1ONQB 1QSEE 3PE9A 4GKOA 2Y06L 3HZMA 3FHAA 4LVHB 2IQAA 3ULUD 2YC1A 3SGKC 1Y6MR 2P7TA 2IH3B 3L6FA 1OAXL 4BSWB 1NGPL 2Z8VC 3PP3K 4K23L 1AH1A 5D71H 5HVFB 3SDYL 4LIQH 2NX5D 2AERT 2JE8A 5EC1B 3HB3D 1F11B 2VDLH 3RX7A 5EFIA 1K4DA 1HINH 1VERA 2WK2A 5C0AA 3RTQD 4L4VA 1MJ7H 1YNLL 1OP9A 3F7YB 4PJGA 3M45A 2FEDD 4GAYA 3IDXH 4PV8A 4BQ8A 5JPNA 1HHIA 2IAMA 4O58H 1XAUA 1ACYH 4LHQB 5HI4C 1DUYB 3G6DL 4OI9A 1TIUA 5I6XB 2Y07H 5IW6B 2OJZH 5ILTL 1RIHL 3H3KA 2FJFB 3FCTB 3U36B 2HVJB 2KZWA 3RWCA 1KIQA 4KH2A 2K1MA 5I1AA 4G8GD 1EJOH 5FUZL 3OKDA 1X4XA 4JPWH 5ALBL 3U0TB 1VSCA 1CR9H 1TQBC 1WZ1L 1QHOA 3SDCA 3RY5A 4R26H 3LV3B 2BJMH <