4DZ8A

Human igg1 fc fragment heterodimer
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
209
structure length
209
Chain Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Generating Bispecific Human IgG1 and IgG2 Antibodies from Any Antibody Pair.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dz8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dz8A01
1T3FB 4NQDB 4LP4A 2HTLC 5DR5L 4G7VH 1QZ1A 3CX5K 5D7LA 1O5DT 2QEJA 4QRPA 2X09A 5FO8B 5HXMA 1Z6JT 4OZ4A 5JA8B 1WFNA 1EO7A 2Y36L 2ZNWA 2ZNXA 4JFZH 3VGAB 4WWKC 5DJ8A 1DBJL 2FNBA 4D0CA 3FB5A 1FVDA 4GAYB 1RFDL 4K8RH 5D71H 1GVIA 2YUZA 4YHPA 5IJKC 3MV9E 1RZIA 2BNRD 5GRZA 2A0LC 5LBSL 1DQTA 3WE6A 1D5ZA 5CD5C 2E27H 3BGMB 3BP5B 1AR1D 2W38A 3IJHA 4J3WA 1KCSH 2NXYD 4LLQA 4PJFE 5D8JH 4O51A 4NKIH 3LCYA 1F97A 1TNMA 1BD2A 2UZYB 3W9DA 5FFLA 3C87A 2R2BA 1NKOA 4JFFE 1LGVA 1C08B 1I3GH 4UUJB 4DGYL 3RGVC 1ZVHA 3HUJB 1JZ2A 3BZ4B 3KDMA 3T0EB 3FMGH 4RGOL 1ZLSL 2QKIB 2HT4D 1QRKA 3SKOB 1IAIM 4NQXA 4KRPC 1H8SA 5EZJB 4YQXL 4NFDA 1C5CL 1F3DJ 4PP1C 1U3HD 1TQCB 2BY0A 4UILH 4L8BB 3RWGA 3QIBD 4DKEL 3TBTA 4KKNA 2GCYB 4UINL 5F71A 5TDPB 3KYMB 3SOBL 5JXAH 2V17H 4BM7A 1FDLL 2BOCA 4WHYG 4LAJH 5F9WC 3ILQD 1HN1A 2VL5B 3L3KA 1VGKA 3OG4B 4LSVH 4EBQL 2HLFD 1AXTH 5J11C 1FBIH 2J8OA 1QYGH 5I74B 1IQWH 2BRRH 3RHWF 5FOJA 5HI5D 2UVFA 3T1FB 4LHUA 2AJUH 1VDGA 3MRDB 2DB8A 4HWNA 1J0KA 2ATPA 1T7WA 4C56D 2HG5A 4UT6L 1EFXB 2VE6B 3FB6A 3DSNA 1HXMA 4LPXA 4YWGL 1Y18A 2GK2A 1AXSA 4KK9D 1I7UA 3D3VA 4WI7A 2YBRB 1OVZA 2R2EB 3I85A 1U3HA 2GAZA 4WFFE 3MJGX 1S7SA 1M71B 4C58B 5KSVA 1QACA 1U58A 1G9ML 3QEQE 4QRRA 5FGCB 1KEGH 3IDGA 5E9DE 1BM3H 1MFDH 7FABL 3WJLA 3PNWB 5DQJA 1A0QL 2VZ1A 5KSAD 1K8IA 4HHAB 3RAJH 1MQKL 1HHIA 1S7UA 2JJTA 2PXYB 25C8H 4OI9A 1DJSA 4ZFZB 4Z7NE 2FIKA 2GI7A 5J1TC 4K3JL 2HFGL 4I3RH 2HP4A 3RUGB 2A6IA 1XCTB 5B38B 5JLZA 4MJIE 3UJJL 2RR3A 2EYTB 5E99H 5TE6H 3OAYH 5JNYA 1G1CA 4WI5A 4Y19A 3MUY1 1T20B 2WBWB 6FABL 5FV2A 3TN0B 4QTHB 5FA4A 3PGCA 1BLNB 3STBA 1I7TB 4WFHE 4MX7A 3REVA 3DUHA 4OZIA 4N9GB 5E2WL 4I9WD 1IMHC 5K59E 5I8EB 5EA0L 2EH8H 3H9HB 1UYWL 4S1DD 3D0LA 4XCCH 5CWSB 3X14B 3U6RA 3WIFA 5DR5H 4DUWA 1XF5B 3I02A 4A2LA 3UX9B 4APQC 4UTBL 1ORQB 3GMMB 2RQ8A 2Y36H 3S96A 3S98A 2E6JA 4H5SB 4U2YA 3KYOB 4ZAKB 3UYOD 2YS4A 2X4UA 5BVJA 2VQUA 4ZPVA 4ZYKB 3UC0H 3C2AL 3S37L 5DDHA 2QR0B 2WQRA 2RB8A 3VXRA 1D5IH 3VFNA 1DANU 5LBSH 4QHKI 4ZOAA 4D8PB 4GFTB 3VGEA 5IMOB 3TA3B 1T83A 3TWCH 4X8XA 3FO0L 1G7MB 3RA7L 3H2WA 1X4XA 1ZHLA 1OP3H 4BQBA 2F5BH 3K3QA 5D2NE 5FYLD 3KR3L 3OKKB 5FYJL 2ARWA 1U0QA 4L4TB 4PUBL 3QHZL 4DGYH 4F7MB 4M43H 2R8SH 2QV2A 1DEDA 3EYFB 3PDOB 2YN5A 1S7QB 1CFQB 4RGOH 1Y0LA 3EO1A 5E1AB 3QDJE 2OI9B 2AJ3B 1P7QD 5B39A 5C0EB 4PP2B 2IAMD 5HJ3A 1UKSA 4YQXH 4AQOA 2D7OA 2EIZA 3GKWL 3QUYC 4JKMA 4XPTL 4DKEH 4UDTA 4ZXBD 4UINH 4BSWA 4QHMB 1FDLH 3OB0H 3HNVL 1R3KB 4EBQH 1FZOA 5HYFA 4F58L 5DYOB 4S1QH 5F7FA 1X5AA 3MXVL 3HAEA 1ZT1A 3ARGB 2QQLH 1WITA 1KCUH 2PYEA 1ZGLA 4YK4B 3M45A 4DGIL 4XWOC 5SX4I 1D9KC 2EDXA 3RPIB 3AAZB 4UT6H 3JUZA 4KUCF 2I60L 4YWGH 1HSAA 1EV2E 1G7PA 3RWDB 3PABB 1P7QA 3H3PL 3MRBA 3GSWB 3ZYOA 5BV7H 5E8OA 1NUNB 4RFEB 4JRXA 1YJDL 2LTQB 1VERA 4ZXBA 4X4ZA 1IKFL 1XGTB 5FYKE 4UBDD 4KDVA 4UOW0 1JNHB 1D5MA 1H3TA 3H9SB 1FZMA 1AGDA 3BQUB 7FABH 1ZGLP 1HXYA 4HKJB 1FIGL 3HFML 1A0QH 5EB9A 2JK5B 2VLKB 5I1CL 4M1DL 1KCRH 3CCHA 3F8UB 3NA9L 2VDLL 3Q3GB 3DV6B 3U7WL 4NZUH 2HFGH 2BY1A 1HYSC 4MHHG 1MWAL 3DX8B 4YXKL 4R4ND 1WC7A 1TCMA 3RVVD 1AQDB 4M7KH 3KPPB 4LF3B 3DHJA 4R97C 4NQVA 1JN6B 3PWLB 3HE6C 1CDIA 6FABH 1WAAE 5JPMA 3P4MA 1HDMA 4X6DE 1B90A 3RZCB 5SV4A 5IMLB 3P9MA 5ICXB 4HK0B 1DCLA 4OUUB 4UV7H 3L3HA 4G6ML 2V7HA 1I8LA 1AKJB 2C3XA 1MCIA 4YDLC 4GW1A 5JW3L 2V9TA 1EHXA 3D85A 3UMTA 1T1XA 2EDWA 1IGCH 3MLWL 1KLGA 2L7JA 3DECA 2D0GA 4LLWA 2D9QB 2AGJH 5DT1L 4UTBH 1OSPL 2AKRA 5E6ID 1FFRA 1NGZA 1VFMA 2HFFB 2YZ1A 3IGAA 3C2AH 3JVGC 3PIQB 4J4PA 5SWSD 4K7FA 1KSRA 3U46A 4HCRL 5LJYH 3SDAC 1HI6B 3FKUS 4UQ3A 3FO0H 2FJHA 4LARH 5BOZG 5F96L 3JWOL 3VFOB 4YE4L 4MDIA 1LK2A 3MYJA 5JO5B 3KR3H 4KKBC 3CFBB 3MPCA 5FYJH 3GHBL 4PUBH 1QFUH 4P2RA 5CSGA 2GITB 1NMBL 5KW9L 5GS3A 3VFWA 3MLRH 4ELME 1R5WA 1S9WA 4MA1C 2EE6A 4MB3A 3QUZD 4XNQB 5E6IA 4FABH 2VN7A 3EYVB 5D1XB 4PJIE 3GKWH 5HGDB 1J88A 4WWID 4MDJB 2VYRE 4XPTH 5SWSA 5GRVL 4U1LA 1WFUA 1KXQE 1LEIB 4AYFA 4JRWA 4XBGA 5FYKU 1H3PL 3O8XD 4KK8D 1FFQA 4YGVB 5A3ID 3THML 5HYJD 1NEZG 3ME0A 4C59B 3SKNB 2P8PB 5ACZA 3BH8A 4FQPA 4NO3B 4NRYB 4WW2C 3MXVH 5F3BA 1J05A 1JE6A 2PO6C 5MHSE 3NMEA 1MCEA 3RWIB 1JYWA 3NIDE 1A3LL 5JR1L 3SBWA 4DGIH 1NCTA 1EEYB 4L8SC 2I60H 4PG9B 4UT7H 4KJYA 5DUPL 1ONQA 1YN7A 1P4IL 3O3DA 3DMMD 5E8NB 2GKIA 4R8WH 5D5MB 1MY7A 1LILA 4GRMB 3Q1SH 4I13B 5EOQL 3NTCL 2XTJC 2FEDC 1IC1A 5F44A 2BDNL 1WZMA 4ODSH 5I76B 1NCCL 4ONHB 4OTXH 4XX1G 1JYVA 5EOTB 1PEWA 1DLHB 5DVMA 3GSVB 1IKFH 3J7HA 2YPVH 3LB6D 1IGTA 2A83A 2VDML 3F7VB 5IHLB 5ECJE 4G8GB 4NN7C 3V0AC 1KG0A 3HFMH 3SO5A 3CIQA 4LKCA 5HI3C 3W9EB 1YEHL 3I6KB 5CKGA 1FNFA 4TUOA 2YRLA 3ARDC 4ZO8A 4OGAD 3U7WH 3NA4A 1ZTXL 2YWZA 2RFXB 4FN0A 4H25B 1MWAH 3LH2L 5CEZH 2WIIA 5JW4N 4JZOB 1NPUA 3DMMA 2PW1A 4Z76B 4OI8A 4BH8A 5C9JB 3O3BB 2FYYB 4FG6D 4XCEB 3QUKA 1OAQL 2YPLB 3SGDH 3V2AR 4DK6A 5TF0A 2D7MA 5JHDA 3ZT7A 2EDEA 3Q0HA 3QFDB 2NZ9D 4G6MH 4RQQA 5D7SH 5HY9A 2HJFA 1FL6B 3I9GL 4MXWH 4LHJB 4D3CH 1JK8B 1OSPH 3B9KB 3TO2B 3ESVF 3CFDA 2VABB 1W0VB 4PREB 1LP9F 4HCRH 3ESUF 5I8CA 1N5AB 3VFRB 3CFEB 4LLVA 5CEXA 1HHKA 3V5KB 1BVKA 5F96H 2ZWLT 4X6EA 1DL7L 4J8RB 3RY4A 1I8MB 2NY2D 1FO0B 1T1ZB 4D94A 1WBXA 5B3JE 2F58H 2EDKA 3D69A 1UWXH 5HHME 1NMBH 2KH2B 2XOTA 3LOWA 4JANB 5C0BE 5EG6C 3IDIA 5F89B 3GSNB 4R7DA 2VDNL 4X6BB 3FQRA 1NDGB 1I9IH 3T2QA 4D0DA 3V6ZA 1F4WH 1LDPL 1NUGA 2FH8A 5CMAB 5T5NF 1UH4A 1A14L 4E42A 1MCJA 3RHWK 4JREC 1IVLA 1BX2B 2R2HA 4V1DD 3NAAL 1HHGA 1OGTB 5L88L 5IOPA 4JG0H 1KLUB 4GQ9H 5DHYB 4NT6B 2HTKC 1CGSH 1RZGA 5LXGL 1BBJA 4LGPB 4WU7B 4K8RC 5FIEA 2CLVB 4FQHA 5FYLL 4MZ2A 1N6UA 3C8DA 4QGTA 3VMPA 2NX5A 4HUVB 2BNQD 1ZLUH 4O2EB 1XH3B 4NQSB 3TVMB 3BO8B 3WN5A 3KXFB 4BSVA 5AWNH 4HFWB 4Q6IA 4QEGA 3MCLH 5BVPL 4XZUA 1A3LH 1IAKA 3OKMB 5I8KL 5EU6A 3WIHA 1JZ8A 4HUNB 5DUPH 1FNGA 1D6VL 5EOQH 3HPJB 1ZLWK 1N59B 5HI4C 3IB4A 4CW1A 1T7VA 3E6HA 3NTCH 2J5LC 4V1DA 4NNYA 3MRHA 4IRJB 1VFAA 3OMZA 3HE7C 4PJEE 4IIQB 4XP5L 4X7TB 3SDXE 2F9BT 4OFYA 4JY6B 1TQBB 4IRSA 1MCPH 1Z3GL 2EEAA 2OBGA 5D2LB 3WFHA 1I7ZA 3ZZ1A 1FAIH 4F15C 3VA2C 3LKSB 3KPSA 1RVFH 1A3QA 1EXUA 3X3GL 1EGJA 3DNKA 4F8TA 1S7TB 3RZWA 4PRPD 5FYJE 4JKKA 2OCFD 4HKZB 3JTTB 3AS1A 1DN0B 3MROB 4XI5D 1AH1A 1ZHBA 3AB0B 3VW3L 3WO3B 5IEHB 4X5WB 4G7YL 5HHOE 2G5BB 1VGEH 5DRXB 1HH6A 3SE9H 1ZT7B 3TPUA 2GJ6D 3ILPA 5IESL 5L0QC 1LO3L 2ZUUA 1U8IB 5IV2B 5HYEA 3GRWA 3ZKSD 2VISB 2X1WL 1EMTL 1CFVL 5FF6A 1OAQH 5J13B 4EJ1C 4Y4FB 4IOIB 1BFOA 1FLTX 4OGYL 1KJMB 3UTQA 4Q9QH 1N4XL 4D9LL 3OGCA 3VE0A 1PKOA 4FQXD 5L8JB 1A1OB 3NZ8B 1PKQE 1LD9A 5IW1B 3I9GH 2EE9A 3MRPA 3IXTA 2R15A 2JJUA 4IS6B 1QFWI 2P49B 2WZPD 4NYLA 5DS8A 5JZ7D 2HKFH 3H8NA 4JO1L 1BBDH 3RWEA 3ULUD 2WIMA 1Q8MA 2GT9B 3QDAA 4RAUA 3RIAF 3JV6A 4O9HL 4R2GC 2V7NB 2GJ6A 4PGDA 3OKDA 5D4QA 4WO4D 3MZGB 5EZLB 3VWKA 3CVHL 3MLUL 1TXKA 4NM8L 2EDBA 3O11B 2P47B 3NFPA 5DJYA 1DL7H 1KYOK 3CC5B 4M4RA 3QDME 2X89A 4JAMB 4Y1AE 1YEJL 4F7EA 2D31A 4N0FB 3P2TA 1UCBL 4WI3A 3O81A 5C09D 5DZOA 2QADD 2W91A 4MNQD 2GFBA 2VDNH 4YHML 4MSWA 5EZOL 3UAJD 1QO3A 1LDPH 4LVHC 1CIDA 1KT2A 2DQFA 2NY0B 3GGWB 3CDGB 4HBCL 3TCXA 1L7IL 3HUJE 5IHUL 1AIFA 3PL6C 5TGBA 4WO4A 4R9HA 1OP5K 5LXGH 2YSSA 3OX8A 3O6FB 1P1ZA 3RNQA 3OV6A 5I75B 3GSRB 4HWZB 5FYLH 3V5DA 5HDOA 5IQ9B 4HIXH 4XAWL 5E2TL 1BMGA 2FX7L 5IP4A 4HH8A 4FFWC 2ESVB 3ZHLA 2BSRA 2R1XB 1F11A 1KENL 1U6AL 4KKCD 4RBPH 3QWOB 5I8KH 4PRNA 5C09A 5KZCD 2CDFB 4MNQA 4IDJL 3E0GA 1MUJB 4M7LT 4DZBB 4G43A 3ARBC 5B21A 5JIPA 3DI3B 1CLYL 1O7VA 1BZ9A 1D6VH 1ULVA 1FZKA 3TO4B 1YECL 4N8VA 1KTLA 1T5XB 5A2LH 1NGWB 2VL4A 4LNVA 4X98A 4F37F 4JM2C 1F42A 1NUDA 1GGYA 4XP5H 2UWEB 1ZHNA 2A73A 1I9RL 4LVEA 4G6JL 2A74B 4QXUL 5T33L 3ULVL 1FFNB 1TFHA 4GS7C 4OKVB 5EN2A 2IH1B 2JCCF 1L6XA 3O2DA 4PGEA 2DJSA 2YUXA 1SY6L 1V5JA 2AJZA 1EUTA 3FRPA 5FUZH 4YC2C 3V4PL 3B8SA 3LKQB 2RIKA 1S8DA 3LPFA 4HAFA 2WUBH 3L7EA 3VFSA 4G8FB 2XNAB 1NJ9B 2E7LA 2W92A 3VFTB 1RURH 5IESH 1ED3B 2GTZB 4LIQL 3W11C 3UTZA 1LO3H 2BNRE 3ARSA 2WP3T 1CFVH 5BV7C 1IRAY 4MCZB 4X80H 1TTUA 3FO9B 5CJOH 1N4XH 3NIFF 4U7MA 5FA3B 4D9LH 5KJRL 3GBNH 3SKJL 2IPKA 4H1LA 2HT3D 3QQ4B 3TJHC 1UG9A 4RCAA 2A38A 2OJEB 1ZAGA 1UM6L 1CLCA 3C6LD 3C5JA 4CMMB 4WI6A 3QUXA 5SWQB 1BWWA 2ICWJ 3NVQA 1T7YA 1OPGH 2C5DC 4JO1H 5IVOA 2GW5A 1JF5A 3WXWH 4NWUL 1CG9B 1ZV5A 2XYCA 3MNVB 5EBMB 1C16B 3UBXB 1JZ3A 2A6JB 1MNUL 4JO4L 1XGRB 1INQB 4O9HH 1I1FA 2FWOA 4FNLH 4FOMA 3WL9B 2HFEB 4G8IA 3CVHH 4P23D 5I1EL 3MLUH 3V52L 1KN2L 4NM8H 1E27B 4KK6D 4U6HA 3MRMB 1UJTA 1PSKL 3DVGB 5FUCC 5I17A 1Q72L 3U79A 2MQ0A 4LFHD 2IAND 1YEJH 3SCMC 2X40A 4X6CF 1G7HA 1UCBH 3CSPA 4DOHE 3EGSB 5DFVD 3D87B 3RWCB 4QWWD 4I4WB 1CD9B 5BW7A 1MJUL 4RNRA 5FUOH 5T1KB 3RVWC 5DSCB 4YHMH 4J3XA 4K71C 5GS0D 2VITA 3SE3C 3RI5K 4C56E 3ARFD 5IROA 5ILTH 3G5VA 5I8OL 1L7IH 2BVUA 4YHLH 4U6XB 5IHUH 1JI1A 2BVPB 4DAGL 2P8LA 1DQML 2VZVA 3QIWD 2I25N 1SEQL 3CAFA 1DQQB 4P23A 4X4XA 1XIWC 5JIHA 4JHAL 3L5JA 4PJXE 5DHVA 2Q8AL 2V2WB 3U30C 1G7JA 4WW1B 3VXPA 4AIZB 5KANI 4XAWH 5E2TH 5E6YA 4B7IA 2CLRB 3EYUL 4KROB 4UZGA 5CLTA 3KS0J 3BIBX 1KENH 3C60D 4MXQC 4JPWL 4OLZL 5DJ2B 5EFIA 4IDJH 3C08L 2HFTA 1GPOL 4Z78A 3PWJA 3K74B 1OAUL 1YNTB 2XFXB 2AV1A 2VDPL 5GXBB 1INDH 1OT1A 3KPLA 4AENA 3HC4H 3QQ3A 1EPFA 5BMFL 4D9QD 1IGJA 3QIWA 2XPGA 4F7TA 3DYOA 3STLA 4KPHH 4NRXA 4KU1A 4ZUUA 2KQNA 4PJAA 4JFEB 1D6EA 2YPKA 3D25A 4Z0XB 1DUZA 1XFPA 1IZJA 4I9WE 2EYRB 2MPAL 1GCFA 1SY6H 3RVTC 3UBXG 1KCKA 1TITA 3PQYB 1DBAL 3V4PH 3H9ZA 1RIVL 4IOFD 4LBEA 3TZVB 2ERJC 1QLEL 4NQDA 1BFVL 4PJBE 4BQCA 5L6YL 4OD3H 4XXCC 1EHAA 4LIQH 2WW8A 5HYSA 1HEZA 4J3VA 4GAYA 5LQBL 4F80A 3V79C 1SVCP 4GBXD 3G5XB 3SKJH 3MV8B 2FR4B 3BGMA 3BP5A 1FL5B 4DVRH 5FYLE 4L9LB 4U1IA 2X5PA 5CZXD 8FABA 4LPCA 5DGRA 4BFBD 4KKAD 4PJ8B 3DHMA 4KAQL 5I2IB 2DWDB 4CDHA 4WEMB 3HS0B 3PDGA 1C08A 4OQTA 4UUJA 4XVTL 2GUOB 4OCLC 3BZ4A 4IMKC 1A3RH 3TPKA 1TNNA 1HNFA 3T0EA 1GXEA 3LN5A 1H3VA 2QKIA 3F6LA 1MNUH 3QAZB 3SKOA 2WUCL 1MRFL 2CUIA 2QJDA 1MRDL 3V52H 4L4VB 1NQBA 1DBKL 3WNMA 4P3DB 3MRRB 4N5EC 4YHYB 1PSKH 1LE9B 1DLFL 3TNNB 4L8BA 3U7AA 1Q72H 1A6VL 3K8LA 3MJ8B 4GBXA 4ZFOL 2GCYA 4JJ5B 5TDPA 3SDCB 3ZKNC 1RULL 5KVGH 1SBSL 3N06B 1VA9A 2VL5A 4P99A 3T3ME 3DRTB 4WTWA 3MJ6A 4WCYL 5HDBF 4DTGL 1JYNA 3T1FA 3VD5A 4Y8AA 3FHQA 3ULUL 3MRDA 5C3TA 1H9VA 3DTXB 2XY1A 5DMGC 1EFXA 1UWGL 3IFPA 4HMEA 1F2XK 5I8OH 2VZUA 3VWJC 3MBEB 1WBZB 3HZVA 1SEQH 1VPOL 2C1PB 3DO7B 4NM4L 3REWB 2OR8A 1URLA 1R3HB 3KJ4B 2YBRA 1NFDF 2R2EA 4JHAH 1MFEL 2AEQH 4PYGA 3V5HB 4EDWH 3IDXL 4NC1E 2Z0BA 3D2UB 3EYUH 1C7SA 2X42A 4RX4D 4Z7UF 5GGRB 1A02N 1G9EA 5HVGB 2HWZL 3AMKA 3WIHH 3O3AB 1UT9A 4LFHG 4OLZH 3PNWA 5E5UB 5CGTA 3C08H 1I3RB 4JO2L 4W81A 3RDTD 5IVXE 1F02I 3I50L 1CXHA 2PXYA 2AEPL 1Q9KA 1WF5A 3T4AB 4ZFZA 2HRLA 2V2XB 1IQDB 3U36A 2MTPA 1KCVL 3O45A 3RUGA 4CU6A 5BMFH 2ADGB 5B38A 3BHBB 3O9WD 1YN6B 2OTPA 3FT3B 1FHGA 3UTSD 4PLKD 3LV3B 3CFCL 1S9KC 2Z8SA 3PGDA 1DBBL 4LPTA 1T20A 4OLXL 3TN0A 2G2RA 1I7TA 1RIHL 1AR1C 4XCNB 1HQ4B 2X41A 3OG6B 5FM8A 4QY8B 2AK4B 4BQ9A 3MBXH 1DBAH 2V2TB 5I8EA 2VXUH 1ZK9A 2FEEI 2XQYK 3H9HA 1W72B 5CLWA 3TJEL 4I0PB 4HS8L 5GS2D 3X14A 3BMWA 1QLEH 3W0WB 5C0AB 1BFVH 3AM8C 5MP6H 3U0TB 4GLRI 1I75A 1S9XA 3C5ZD 5C0NC 1MCOL 4PYHA 4RFNC 2CMRH 3OKNA 1D7FA 4PGZA 4WUUB 5DUML 1FG2B 4Q9RH 1ORQA 2HT4C 3GMMA 4WU5B 3HR5A 4H5SA 4ZAKA 3KYOA 5ETUA 3GRWH 2C3WA 4KTEH 2DBLH 1ND0B 4ZYKA 2J3SA 3S9DB 1INEL 3UTSA 1U3HC 4NHUB 3EHBC 3RIAK 4JZNA 1CGUA 4D8PA 1BF2A 2CRIA 3TA3A 3G5ZB 4OM1L 3SJVB 2VUYA 2Z31D 2DI8A 2PW2B 5FEBA 1JF1B 3WJLC 5KTEL 1GOHA 4KAQH 3OKKA 2ADJB 4L4TA 2H1PH 2ITDB 4PJ7E 5HI5C 4F7MA 2JJTC 3G04B 3EYFA 2CKNA 4FFYL 2PETA 1CFQA 4K9EL 2ZUYA 5E1AA 2WUCH 2AJ3A 4UMGA 4ENED 1NGXB 2HYMA 4KK9C 4PP2A 3P11L 2D03H 2HLAB 5I73C 3MUJA 3PV6A 4B5EA 5AZEL 2P5WD 4NJAL 5F70A 4M48H 1IM3B 4QHMA 5HYJE 4CKVX 1SBSH 5MEND 2EECA 2DAVA 1R3KA 4U3HA 4CRPA 2W9EL 3VI3F 1OF2B 2Z31A 5DYOA 2DL9A 4WCYH 1VKXA 4Y16D 4N9OB 2NY3D 1QTYT 3TIEB 3ARGA 1U8JB 4Y2DD 4DTGH 5KSAC 3KPMB 2NY5C 3VG9B 1EEZB 1B0WA 3ULUH 4EN3B 3NPSC 2JIXB 1NC2B 3CUPA 3S34H 3ZKMD 3RPIA 3AAZA 2IC2A 5D7JD 1DE4B 2ZUWA 4MJ4A 4EXKA 1OW0A 5K9QG 3RWDA 3PABA 3GSWA 4BUGA 1XR9A 3RGHA 3QA3B 4LIQE 2R1YB 5F9AC 4RFEA 4FP8L 4OCSL 1MFEH 4F37K 4C83B 3MA7B 1XGTA 1U8KA 4DKDC 4PJFF 2WM0A 3H9SA 1MOEA 5JUEL 3BQUA 2Z35A 3IDYB 1LP9B 5HPMA 2AEWA 4HKJA 5JHLL 4MQXD 3M8OL 2H32H 4S1DC 5GS0L 4Y2DA 2JK5A 2VLKA 4JO2H 3H7BB 3ZE1E 1T7XA 2YHGA 3FFCB 3I50H 2DJ4A 3Q3GA 3DV6A 2AEPH 4U2ZA 5IFJB 3MRCA 4DN4L 1UADC 1LHZA 3DX8A 3FRUB 1KCVH 5D7JA 4TUJA 1E28B 3BPLB 1FYTD 4OLYH 1AQDA 3HPLB 5DD3L 5JIKA 2GJZA 1RMFL 4OJFL 1JN6A 1A22B 5E2VL 4U1NA 1AO7D 3WFDH 1DBBH 4OCNC 3MOBL 3O2DH 4YEFA 4FQLH 3BZEB 4GJTB 3RZCA 1KELL 2QL1A 4NQED 5IMLA 5ICXA 1BJMA 4HK0A 4OUUA 3MJ9L 1HCFX 5FECB 3O4LD 1AKJA 3PP3K 5T3ZD 1JPGB 4HS8H 1JZ6A 5DRZB 5TH2B 2ZUQC 5DC9B 4PGJA 1MCOH 4EVNB 1R0AH 4MMXC 1ZLVH 2WBJD 4JCMA 5D70L 2Q76A 2HFFA 4L8DB 3GMRB 2D4FA 1FYTA 1HZHH 4IOSD 2IAMC 4MNGB 4PR5B 4YDVB 5DO2D 2VXSH 4H1LH 4ZXBC 3IJSB 3KPRD 2D9CA 4PV9A 1HI6A 3AS2A 4BZ1L 4CN6A 2CGRL 1JWUA 4NZJA 4OM1H 5CBEB 3VFOA 4DFIA 1B3JA 3P0VH 1VFOA 3ZKXB 3VD7A 3CFBA 4P5KB 3TGXA 3SDYL 4LP5A 2SEBB 2ADFL 3W5MA 3MLXL 4P46B 5EORL 2GITA 4GKNA 2NY1B 3ALPA 4Z7VA 5LGJB 1KXVC 2YK1L 3LAFA 2XN9D 4FFYH 4Z7NF 3L3OB 4K9EH 1HHHB 1CK0L 1TZGH 3V4UL 4ODXA 4AT6B 1IFHH 4XNQA 4JRYB 2B1HH 1QEWB 3U0WH 3EYVA 5D1XA 1KLFA 2R0KH 5HGDA 3RTQB 2C4FU 3QI9D 4MDJA 5AZEH 5K9KB 2ZCLH 1C1EH 1V3KA 4NJAH 1OY3B 4UBDC 3BD4A 2BNQE 4KY1L 5EZIL 4YGVA 2H45A 4NC1C 2V9RA 3MLYL 2P8PA 4MNHB 5K59F 1I8LC 5A16B 4N90D 4GRWB 4NO3A 4NRYA 4J6RL 3CVIL 2XY2A 3WFEL 3BMVA 3RWIA 4PJGB 4KRLB 4GMTL 2D7TL 2P4AB 4UNTA 5GGSB 1EH9A 1W72L 4X0KB 4PG9A 5E7FA 1KJ3L 5E8NA 3SGEH 5D5MA 4R4NC 4GRMA 3SDDD 4OAWA 3RVVC 5J4MA 3ZO0A 2CSPA 4F7CA 5DHVH 4FP8H 4YO0B 4OCSH 1H8OA 5I76A 4GKZA 1S3KL 2AXGB 1H15B 4HIIB 1DLHA 3GSVA 3SGJC 1J9CT 5HHXL 1CICB 4LSRL 3F7VA 2IADB 5JXEA 2BVYA 5JUEH 5I71B 4KH2A 4G8GA 3JUYA 3PWPB 4PRPE 4KGJA 2GJJA 4ZS7L 2PYFA 3W9EA 5GS0H 4EUPH 3W82A 2FL5B 4QRQB 5CINH 2JJWA 3UZQA 2C1OB 3P4NB 3C9NB 2R0WL 3F62A 4DN4H 4PJCB 4JFXA 2B39A 2X44D 3DV4B 5E6IC 5C71A 4M7LL 4JZOA 1CGWA 1HCVA 5IT2L 2F19L 5DD3H 1RMFH 4OJFH 4Z76A 4RA3A 5E2VH 4OIIL 2YKLL 4BFGA 4Y5YB 4LKXB 3KPNB 5C9JA 2AXJA 2FYYA 3BFOA 1PLGL 5HYQA 4XCEA 5IWLA 2YPLA 2M8XA 3PWVB 3G6AB 5IVZB 2UWEE 2O5XL 1YY8A 3X13B 1LE5B 5MEOA 3FTGB 4MCYB 1EJOL 3V0VB 3E3QE 2GYSA 3PHSA 4RISL 3SBWC 3STZB 1FNEA 1G7LB 5FHAL 4RGNB 5B22A 5I1IL 4WI2A 1JK8A 1IEBB 3UCRA 5C0GB 5GISH 1GRWA 3ULUE 5D70H 1YC8A 2NY4C 3UDWA 3B9KA 3RVUC 4XPHH 5KG9B 3TO2A 4PJ9D 1HE7A 2OMNA 2IQ9L 3G9AB 2VABA 1W0VA 1BQUA 1VB9A 4PREA 4Y4KB 5C6TL 3RBSA 4P5TB 2HKHL 1GOGA 2J12B 3BEVA 4NQCD 2XQYG 1N5AA 3CFEA 4QXTB 4BZ1H 2XWJB 4OI7A 1OGAB 3P4LA 5DZNA 5DD6B 3O8XC 4LRIA 4MMZC 3T0WA 1MLBA 5E24E 3BE1H 5A3IC 1TETL 3WS3B 1I8MA 1FO0A 3E8UL 1L0XA 1T1ZA 2RCSL 4P9ML 3UJTL 3HC0B 3SDYH 2ADFH 1T22B 3BI9X 4N68A 3WIIH 5LGHL 3MLXH 4P2QB 2YK1H 2JCCB 4JANA 3KLAA 5IG7B 2UUDK 5F89A 3GSNA 4X6BA 1MI5D 1NDGA 1CK0H 4M61B 1NDMB 3V4UH 4EQ2A 2EC9T 1T6WA 5CMAA 1UB5B 4FTVB 3DMMC 4PJ9A 2QSCL 1BX2A 3AU1B 3MRFB 5EO1B 2E7HA 1OGTA 1KLUA 1WAAF 5DHYA 3BKJL 4X6DF 1HSBB 3X3FH 4I0CC 4XPGL 1M6OB 3LB6C 2R69L 3M17A 4KY1H 5EZIH 5C0CB 2HTLD 3VXNB 3AS0A 2Z4QB 2NW3B 1R6VA 4FQJH 2DF3A 4O2EA 1XH3A 3AXLA 4NQSA 3TVMA 3BISA 3KXFA 3CVIH 4HFWA 4H88H 3WFEH 5BS0D 4WWKD 2CIKB 5C70A 4OGAC 3OKMA 4GMTH 2D7TH 3MRIB 5KSBB 3GSUA 3Q6GL 1MI5A 3OKLA 3ZLQC 2A0LD 3LQZA 3T0XA 3U7YL 4E41D 4JY5L 5CD5D 4LSQH 3HPJA 1N59A 4OZGA 4K94C 4IRJA 2HH0L 3CU1A 4IIQA 4ZDHB 4X7TA 4PY8I 4FG6C 2MSPA 2X7LB 3RGVD 2IFFH 4FMFA 1MF2L 2M1KA 5D2LA 4E9LA 2ED9A 1JVKA 1C5BH 1F90L 2EDNA 4YEEA 2Q87A 3LKSA 3TLRA 1UCTA 4FFVC 4ZS7H 1X6NA 5LKNA 4WGVB 1S7TA 3OJMB 2DI7A 4HKZA 1TZHB 3JTTA 3K7UA 1LMKA 1RAMA 3MROA 2OX5A 4ELMF 1IGML 4PP1D 1NFKA 3F7PC 5IEHA 4X5WA 5J57B 4M7LH 2DQIL 2BC4B 3J8F7 1VHPA 2G5BA 3L5WB 2DDQH 5IT2H 3NBNA 1OAKL 2P5ED 3IDMA 1A7NH 1I1YB 4FMKA 5GZND 1ZT7A 2XXCB 1I1AB 4PJIF 4OIIH 2YKLH 5ANMB 3DI2B 5HHPB 2F8XC 1U8IA 5IV2A 2X9XA 2VISA 1S78C 2P46B 1PLGH 4XWGL 1KNOB 1MCWM 3HB3D 4ORZC 4Y4FA 4IOIA 1NGYB 1YEEL 1KJMA 3CU7A 2O5XH 3GSOA 4OLEA 4YFDB 3NCBB 2NY2C 2A2QT 2EXYC 2Q7YB 3WN5C 4K23L 3NZ8A 1X4YA 4JFEE 1EJOH 1B2WL 4Q6IC 1M4KA 4JFHD 2Y72A 4JVUA 4RISH 2Q1EA 3DUSB 4TULL 3SKMA 4IS6A 1FH5L 2Y23A 5FHAH 5I1IH 5GGTA 3MRKA 3S8WA 2W60B 3B8YA 5F1KC 4YHIB 2EDOA 4PB9L 5ALBL 4P4RB 4CADA 3O0RL 5DTFB 3BYTA 1XGUB 2GT9A 2IQ9H 2P5EA 3IU4H 2A6KA 2PKDA 5H35B 3O6KH 2V7NA 3GSQB 3WNOA 1S9YB 4AMKL 4YBHA 5EZLA 3MODL 2DLTA 4K3DL 4NWTL 4IRSC 3T2NH 1J8KA 1A6AA 3O11A 3OSKA 3T77B 2IANE 4LSUL 5E4EC 3ZTNL 3V7AG 5T3ZL 1OLLA 4P9MH 4JAMA 3GI9L 5GS2H 1CYGA 1MIEL 2A9ML 2GEEA 4N0FA 5EOCL 5HDQL 1D3CA 5LGHH 3MV8E 4HUUB 4ONGL 2GQHA 5IQ7L 1GL4B 2H26B 4H0HB 1T2QL 4LLYA 4R3SB 2FBOJ 1JNLL 3CDGA 3GGWA 5D6CB 4NN6B 1Q0YL 4PGBB 5C08D 3VXSB 2N7BA 3BP4B 4LDLB 5HHVL 1MJ8L 3LN4B 2VH5L 2DLHA 4HFUH 3BKJH 2AW2A 4N0RA 1XCQB 2AQ3A 3LQAH 3NACL 4KRPB 3O6FA 4YUEL 2JKXA 2XI9A 3EUUA 3GSRA 4HWZA 4U1GC 4NO0D 3GJFB 4WFED 5IQ9A 2K1MA 3WLBB 4IMLB 5JOFB 4OGXH 4D0BB 3LKOB 1NCAL 4KDWA 1RZKL 3EO0A 1XF4B 4JKPH 4TPRL 4XPFH 1R3JB 2ESVA 2EEBA 5F21B 2R1XA 3WBDA 3L6FB 3QWOA 4JPVL 3VGBA 4X7SL 4J3TA 5ITFB 2CDFA 5FB8B 5D96B 1PG7L 4XI5C 3Q6GH 5J11B 2YEZA 5LWYH 3O6LL 4DZBA 1SJEA 3TT1H 3U7YH 5KS9E 2F53B 1IL1B 2W07A 3MYZA 1T5XA 1NGWA 5C08A 1BZQK 3MACL 4Z9KB 3NFNB 1QPPA 4UNUA 2A74A 1SJHA 3IDJB 1FFNA 1RZFH 2V9QA 4OKVA 5EU4B 2IH1A 1F90H 4HUKB 1UQSA 1P69B 5B3JF 5IUSA 1JGUL 1K5NB 4HUXB 4MVBC 3LKQA 3N1FC 1N3NB 4XHJD 3QISA 3L3JB 3JXAA 1P2CA 1IGMH 3ISWA 5CIPB 2W1NA 3QUYD 1KEML 4G8FA 1NJ9A 5A2KH 5JZ7C 2DQIH 4KJQC 3OAUH 1RSFA 5GRJL 1OAKH 2OMBA 4M4PA 5J12C 3VFTA 5IMMB 3G6DL 3F7YA 1F58L 43C9B 3HZMB 1ED3A 2APXA 5EO9B 1U93B 5I1DB 1KXTB 3QULA 4WO4C 4XWGH 2V5MA 1C8PA 4MCZA 4GAGL 5CILL 1YEEH 3FO9A 3AVEA 3QZWB 4XWOD 5FA3A 5ITBH 4R7NB 4AK1A 4WHTB 4JFQA 3QQ4A 5K33A 3EJZC 4U1KA 1B2WH 1NFDB 2OJEA 1NBZB 4CMMA 2Y06L 4F2MB 4R96B 2QADC 3DVNA 2FSEB 4W4OA 2YWYA 4LCWD 2PUQT 4MQSB 3NOIA 4PB9H 5ALBH 4F33A 3O0RH 5SX4H 4XXDB 4GW4B 5DMIL 1EO8L 1CG9A 5EBMA 1C16A 2CK0L 5C0AE 3UBXA 3VXOB 2A6JA 1DQJB 3L1OL 4PJEF 3WL9A 4APQB 2HFEA 3ALXA 4WHDA 2WINB 3SDXF 4NZTL 2OL3B 3MODH 3ZL4L 4NWTH 3EW3B 4QT5B 3WKML 1CXIA 3DVGA 1HQRA 3IKKA 4LSUH 4ZTOL 4O4YH 3QH3B 5T3ZH 2VLJD 4CVUA 4XB7A 1B4RA 3GI9H 5L2JB 3HI6L 1MIEH 5EOCH 5HDQH 2C3VB 4EEEA 1MFBL 3EGSA 2JB5H 4ONGH 2VAAB 3RWCA 3TNMB 4I4WA 3DOSA 3QDHA 3RIFK 5DSCA 5T1KA 3HE6D 3K46A 1T2QH 3LDBB 3ZHKA 1OSZA 1QFHA 3V7MA 1JNLH 5CJBA 1A6ZA 3VFPA 1Q0YH 2VB5A 1D5XA 1IAOB 3I6LD 3DRQB 4U6XA 5CJ5A 2BVPA 4Q58C 1ES0A 2VH5H 3M1BB 4OD2B 1KPVB 5C1MB 3AFLA 1BQHB 4HXAH 1HINL 2P1YA 3NACH 4XBEL 4YUEH 5MI0B 2GSGA 4WW1A 1P53A 1E6JL 2A6DB 3D18A 4AIZA 2C7UB 2R0LL 1NCAH 2CLRA 3WYRA 1QKZL 3GSXB 3EYOB 4DN3L 1EA9C 3GNML 5DD5L 4YBQC 4X7SH 5DD1L 3QUXC 1NLDH 3MJ7B 1PG7H 5HHNB 1YNTA 3QZWG 1G0DA 2B8OT 2FX8H 5ISZB 3G5YB 4KI1A 4AJ0A 1X5ZA 5D9SB 2DM7A 1D9KB 1GZPB 4QYOB 4RIRB 1QLFB 4P5MB 4JM4L 4JO3L 2HT2D 3L9RB 4UNVA 2OQJB 4NNXB 5I1KL 2BX5A 2YD3A 4Z0XA 3P40A 5H94B 5FGRA 3B43A 1NCDL 4KMTL 4O2CB 4HUMB 3FB8B 1DDHA 3PQYA 3P9LB 4Y4HB 3V6OE 1Q94B 2YD2A 5BW7C 4YIQA 3LEVL 2BVOB 3TZVA 1AHWA 5C6WH 1GHFH 2XA8H 4WJ5B 2F8OA 4AEFA 1NBVL 1H0DB 2K7QA 2UY7A 5GRJH 1P4LB 2DQTL 1ZKAA 4N8CH 4FZ8H 1F58H 2YXMA 3HUJF 1GOFA 1ODAA 4G80B 5KVEL 4HH9A 5E70A 4P23C 1MCQA 5H37G 2PO6D 4KK6C 4HZAA 4QOKD 1DVFB 5CILH 1F6FB 2P7TB 3W39B 2FR4A 2AJVL 4NDMA 1CE1H 1FL5A 1ZHKB 3LEXB 4L9LA 4NUGL 4K55A 2WLYA 4PJ8A 2EO9A 4YAQB 1OOAA 4XRCA 2Y06H 2DWDA 2XTJD 2FEDD 1AFVL 3HS0A 1BQHG 1U8PB 2GUOA 4PJFB 5DI8B 3PGFL 4YDLB 2DYPD 3TM6A 5F1SA 3ARFC 2E9IA 4YX2H 3JBG7 5DMIH 5T1LD 5CHNB 4JFFB 2Z8RA 1NKRA 1IAII 3L1OH 1BOGB 4HV8B 4WY7H 3K2UL 4OLWL 3QIWC 3QXDB 1DP0A 4L4VA 5HI3D 1AGEB 4P3DA 5L9DH 3WKMH 2P5WE 3MRRA 2F74A 3TNNA 4PBXA 3MJ8A 2IBGA 12E8L 5MENE 4JJ5A 4DCQB 5DWUL 3SDCA 1MHPL 2R56H 5KOVC 1UGNA 4Z77A 3F6IA 2HVJB 4HT1L 2Q6WB 3SDAB 3DRTA 2HJLB 3SY0B 1MFBH 3C60C 1KB5A 1J5OH 4CDGC 3WUZA 4KDTA 1Q9OB 1XR8B 4AG4H 1WIUA 2DYPA 1J0YA 5E8DL 1QSED 1RUPL 4IHOB 2AERT 2ZPKL 4LLMB 4RZCA 4HDIB 1AD9A 4S1SH 1A8JH 3MBEA 1WBZA 5IB4A 4NN5B 1WWAX 3DO7A 1HINH 3G9VA 3LRHA 1RUAH 2CJUL 5KN5B 1JRHL 3V5HA 4ZODA 3NCJL 3H0TB 1XGPB 3LHPL 3D2UA 2R0LH 3QT2A 4IRZH 5GGRA 5B8CB 4DN3H 3GNMH 3O3AA 5DD1H 4ZG1A 3HZKB 5DJXA 4LSTL 4IOFC 1MVUB 2NLJB 3CMOL 1I3RA 5JPNB 1W2KT 2JLLA 2XWBB 3MOAL 3QEQB 1WZ1L 1U8OB 4AIXA 1EUUA 4GRWE 3KYKL 5E9DB 3T4AA 3SE8L 3RWFB 3T0EC 2V2XA 1QSEA 4ELKB 5DUBB 1BREA 4PJGE 5E5MB 3I6GA 4NBYB 3DYPA 1BEYL 4JM4H 3BHBA 3BDXA 4HPOL 1AO7E 1FFPB 1YN6A 1LWRA 2KL6A 3FT3A 5E03A 1Z2KA 2EDFA 3OAZK 4MJ5B 1TQCC 4W70A 1YMMD 5E00A 4NQEE 3MZTA 4GBXC 5CEYB 1IGIL 3FAWA 2Y6SC 4GKSA 4XCFL 4KMTH 1KIPB 4MJIB 3R06B 3O4LE 4MS8C 4XCNA 1HQ4A 2PTVA 4RMUA 5CZXC 3TBYA 5ICZB 2XZZA 3OAYK 1OM3H 5T3ZE 4QY8A 2AK4A 5EO0B 2H8PB 1A7RL 2V2TA 5ID1B 5I74C 1MCRA 2IPTH 4I0PA 3BESR 4YNYB 4ZMAT 2DM4A 2XTLA 3W0WA 1HH9B 2PR4L 2DD8L 3EOAB 4UDUB 5ADPL 3PWPE 1NBVH 1PG7X 2HTKD 1UXSB 4HWBL 2JJSA 4WUUA 3ARDB 4XNYL 4PJ5D 3GKZA 4Z0BH 1KGCD 1NL0H 4WU5A 3ARWA 2BZDA 4PJCE 1CU4L 4L3ED 4OT1H 5I15H 3KPRE 3L5HA 4PJXF 5CUSH 3B9VA 1E4KC 1YMMA 5T3XD 3O4OC 2AJVH 1DN2A 1CZ8L 4NKMA 5J1SC 5TDOB 1IM9B 3SJVA 1MFAL 4ZD3H 2PW2A 1MFNA 3IF1B 1WCBA 5HI4D 5F7YC 2ADJA 3OZ9L 4FA8A 4LQ1A 3WHXA 2XN9E 3BPNB 3HE7D 3S4SG 4KI5C 2KKQA 1OP3K 2PXYC 3O6ML 5GSVB 5D2NB 2AXFA 1A7OH 1A9EB 1AGBA 3MRJB 4XNXL 1JHKH 1VACB 1FAKT 3CD4A 3QCVL 4JEGB 2B4CC 1NGXA 4OLWH 1RUML 3WUWB 2OJZH 4L3EA 2HLAA 5A2IH 3RX5A 3QDJB 2ILLA 3TN0C 1JJUA 5DWUH 4E5XB 1IM3A 3NCMA 4GG8B 2BCKB 5ID0B 4N90E 1ADQA 2CKBB 4NPYB 2BXZA 1WFTA 1Z9OA 2WWKT 1GGUA 4O5LH 2EDQA 3TIEA 1U8JA 5DHXB 3KPMA 1FP5A 1EEZA 3RDTC 4PJBF 5EU3A 4KVNL 4EN3A 2JIXA 5E8DH 1NC2A 1T04B 4P2YA 4A6YB 1RUPH 3ELAT 2OSLA 3MRLB 1RV6X 4LK4A 1DE4A 4P2QE 4ZAKC 1KJ2L 3CJJA 3VRJB 4Q6YA 2R1YA 1CT8B 2DKUA 1JRHH 1ZS8B 3MLSL 1IILE 4C83A 3MA7A 3NCJH 3FONA 3KGRA 3TA3C 3LHPH 1YQVH 4CN4A 3FN3A 4EXPX 1MFCH 3FQTB 4EI5D 4LVNC 1LP9A 5EDXA 2ZKHL 3ROLA 4XH2B 1P4BL 3CMOH 2V5SA 2QQKL 1LO5B 3H7BA 3MOAH 3FFCA 2XKNA 5D72H 3KYKH 2VWEC 1QFWH 1X3DA 5IFJA 1T03L 4I2XE 4PS4L 4KQ4L 4X8JB 4POYA 5CP7A 3FRUA 3VJ6A 4O2FA 2ENSA 1BEYH 5KSBE 3Q5TA 4HPOH 2J6EL 3HPLA 4GXUN 4J3SA 3IKCB 1RZ7H 2GK0B 3DGCR 3V7AE 1IBGH 1FNLA 4M5ZL 2FHFA 3BZEA 3LQAC 2AXHA 3T3MF 2BHUA 4EI5A 3UPAA 2Z31C 5FECA 2IH3B 4U31A 1R5IB 5KSUB 4X6DB 3T8XB 1JPGA 3ARGC 1CR9L 5TH2A 4CAGA 4F15B 3PL6D 3WUWG 2PR4H 5ADOL 2DD8H 4XVSL 5ADPH 3MUHL 4EVNA 5F7KC 3CMGA 5A2FA 4JFPA 3VXMD 1E4XL 4XNYH 3DIFB 3V6FB 1DUYB 1G6RA 2BJML 3DXAD 3GMRA 1MCBA 1QNZL 2Z9TA 4ENEC 1G6VK 3AS3A 3QFJB 1IT9H 4MNGA 1CU4H 4PR5A 2ZOKB 4YDVA 4B7LA 5F9JB 4FFWD 4NQCE 2JF1A 2OR7A 1RUQH 2LVEA 2LTQC 4M7JH 3OR6B 4G9FD 2IALB 5L0QB 5GJSL 5K9OB 5ANME 2LU4A 2W9DL 5CBEA 4K2UL 4RGMC 1MFAH 3BQUC 1P7KA 4KTDL 4HC1A 2OXGA 1BAFL 3CH8A 3OZ9H 2NY3C 4P5KA 2DI9A 2RGSA 4JM2D 5SWZB 4Y2OA 4Y2DC 2SEBA 5IVXF 4P46A 3BKCH 5LGJA 2AAVA 4LLDB 4N1EA 5DURD 4PJDE 4TUKH 3L3OA 3VXMA 4NNPL 3OXRB 1TVHA 2O5YL 3HG1D 4AT6A 5D7JC 5HVWA 4JRYA 1BJ8A 1RUMH 4X5XB 2MMXA 5AUMB 5DK2B 1SJVA 4ELMB 4L8CA 1YMHB 2VDQL 4C4KO 5K9KA 1J10A 1T2JA 4G9FA 1N64L 4R2GB 3RWJA 3OTTA 5JORB 1QSFD 4HJJL 2R4SH 4PJIB 1RUKL 4KMQA 4QRUB 5C92A 4MNHA 4P2OD 5BS0E 4HS3B 2YZ8A 3RBGA 3ARED 3ULSB 2ID5A 4KVNH 4Q2ZA 1B4JL 3UTTD 4PG2A 4E41E 5GGSA 4LCYB 5FGSA 3VFMB 5C07D 1KJ2H 3TJHD 2CK2A 3ZYJA 4GXVL 4LVHB 1NUFA 4YO0A 4LSDA 5HBBA 2F54D 2AXGA 2XWTB 2NY7L 1H15A 3MLSH 1LEGB 4HIIA 1CFTB 1QSFA 1CICA 1NC4B 1YDPA 1RJYB 5K9JH 2FX9L 5AG8A 2ZKHH 3HMXA 3MRNA 1MAKA 4P2OA 3ZKQD 4S1RL 2OR9L 3QO0B 3C5SB 1CFBA 4RMQA 1RK0B 2CD0A 2QQKH 3AREA 4QRQA 4PJ7F 5CSZB 1QRNB 3PXJA 2C1OA 4PRID 3C9NA 1T03H 2VQTA 4PS4H 1GH7A 1SVZA 2NNAB 3DV4A 1KACB 1KPRA 5IEKB 1JGEB 1T4KB 1OWRM 2J6EH 3QDGD 3ARBB 5D1XC 3SCMD 3I3BA 5DO2C 1F3JA 1E6OL 4M5ZH 3MX0A 4MJ6B 5FDWB 5BJTA 1IC4L 3ARZA 5BRZB 3PWVA 1Q0XH 3G6AA 5IVZA 4ZNCD 4ZO7A 2NTSP 3GDBA 3MO1B 3CSYB 3X13A 2VR5A 4JFHE 5IJVB 4I3GA 3FTGA 3RY5A 4HJGB 2XQBL 2FBJL 4KK5C 5ADOH 4XVSH 4PV8B 4P2CG 3QEUA 2FGWL 4JFDD 5E56A 3GMPB 4YC2B 1ERNA 5C0GA 2X4PB 1FQ9C 1WWBX 3ARXA 1QNZH 5KG9A 4A6YL 4UOW1 1TJHL 2IPUK 4Y4KA 1KV3A 4P5TA 3BKML 4Q97A 3KJ6L 5SX5K 3KS0H 4QXTA 2XWJA 3MR9A 3O2WL 3QEHA 1HOCB 4OFDA 4XP1H 3L3GB 2W9DH 5ICYB 1OGAA 4K2UH 5JXEC 2D2OA 3ARUA 3WS3A 4KTDH 5BV7B 4NKDA 1BAFH 3LVEA 1B9ZA 4PTTB 3OJDB 5CS7A 5GRWA 1NANH 3FQXB 5F8QC 1T22A 4PRHD 3ZE1F 3PF2A 1QBMH 5IMKA 1ZVSA 2JCCA 5FKAA 5IG7A 4MAYD 4NNPH 4K8RL 2O5YH 2EC8A 2LVCA 1NDMA 3BUTA 4M61A 1UWXK 3QIUD 4FTVA 1OCWL 1IKNA 3OKEA 5HHMB 2E27L 1G84A 2NXZD 5C0BB 1ZA6B 1JPFB 3AU1A 3MRFA 1DQLH 5D8JL 1NH6A 5JW4M 1K2DB 5T3XL 2VDQH 3I75B 2QSVA 3EZJB 4G9DA 3S3JA 1UB6A 1N64H 4DQOL 1HSBA 4XVUC 5IWLC 4HIEB 3WEXA 4Z5RB 5MEQB 1M6OA 3T08A 4LGRB 4R4FL 2JB6B 4XP9L 1ORSB 3FN0L 5C0CA 2QQQA 1RUKH 4KQ3L 1KB5H 3MCKB 4U1SB 1P7HL 3DARA 2Z4QA 4HKBB 4XNMA 1WSST 2YRZA 3FMGL 4PRDB 4Z6AT 1UXWA 5F8RC 2J8UE 1B4JH 3MRIA 3QG7H 15C8L 4JHBA 1ZLUK 3CFKA 3UDWC 3B9KC 4E0RB 4HF5L 3QIUA 1OB1B 4LDOB 2ZCHL 1AQKL 4DW2H 3U2SB 5C0DB 1U3JA 4MXVE 4LSVL 4CN1A 1TZIA 2AABL 2NY7H 4ZDHA 1YEDB 3PP4L 3UJIL 1IQWL 3VGGA 1M7DB 4LRIC 2AJUL 5D1ZD 1RU9L 4OD1H 2XXMB 4U1MB 2FX9H 4PJEB 1XIWB 2IQAB 2H6PA 1Q9WB 2PNDA 4S1RH 4OB5L 3VXUD 3VRIB 1N2RA 4HQQL 3BXNB 1SMAA 1NCWL 1TZHA 1RZJH 5E8EB 4N5ED 4PJHB 2DQUL 1SBBA 1ZVYA 4X6CA 4EIZC 4K3HA 1J8HD 1WEJL 2BC4A 3B83A 4PJ9C 3ZKND 2OXHA 3ZTJH 1I1YA 5CJ8A 1FE8L 5HHPA 1E6OH 1MFDL 4GAJH 5CZVL 4KZDL 4NSKA 2IBZX 4ZSOA 1FRGL 1KNOA 4XPBL 2C3HA 3L7FB 1NGYA 4JDVA 2QHRH 3VCLB 3RAJL 5D1ZA 4P4KB 1L6ZA 5DMGD 5J89A 3SGDI 4QRPD 2Q7YA 1MY5A 2XQBH 3EYSL 3RFZC 4X5LA 2KBGA 1GGCH 1OTSD 2FGWH 4LCWE 2K7PA 3TBVB 3FO1B 2W60A 2W0FB 1H3XA 5DRNB 5E99L 2CDEB 2QQNH 3DX7A 4M9PA 2ERJB 2WLZA 4HZLA 5DTFA 1T21A 3VXTA 1XGUA 5FM5M 4FQIH 3GK8H 3UTPD 1TJHH 1RPQA 4IRJC 3GSQA 4X4YB 2X6MA 4W6XB 1YEIL 4U1HB 3BKMH 4LL9A 2R39A 1DANT 3KJ6H 2Q8BL 3O2WH 4Z18A 4ALAL 3KG5A 5ACMA 2VLJE 3DVFA 3T77A 1GJIA 1RZ8A 4LPWA 5HHQB 2EKSB 1F4XH 3MLPA 4HW6A 5ESQB 3BGFB 1UZ8B 4P57B 1RI8A 3I3EA 4I77H 5GS1C 2FHCA 2CR3A 3UC0L 3QDMB 5CBAA 1A4KA 2QTEA 2H26A 1F4YL 4Y1AB 1D5IL 1QPXA 3AB0C 2AI0L 5DC4B 4R3SA 3RX7A 4HXBH 4M6AA 1P6AB 5C2BL 3I6LE 5BXFB 1OCWH 5DFWH 5D6CA 3WFZA 3TWCL 4PGBA 3VXSA 1UJ3A 3QUMA 2R29H 2ZCKH 5C0JB 1BPVA 4OF8A 5T3XH 2F5BL 1TIUA 4U05A 2X4RB 3N50A 1CXLA 2X2YA 3HKFA 3MV7B 4DQOH 4YBLC 1RJZA 1XCQA 1F8TH 5DMYA 5J13C 1MWAB 4ZNEA 1ADQH 4Y4FC 4R4FH 1TJGL 4LHUD 4XP9H 3FN0H 2UWEF 5C0ND 4M43L 2R8SL 4KQ3H 4ONFH 3GJFA 3LKRB 3WLBA 5JOFA 4IMLA 4QHUB 4ZO6A 1J7VR 1J0ZA 3LKOA 3PDDA 4N0CC 3ZDYE 4LU5H 1WTGT 1FL3B 3L6FA 5ITFA 5DK0B 3D3VD 3TV3L 5FB8A 15C8H 1CXEA 5L2KD 1K6QL 3O3EB 2G60L 3ULUF 4JQXC 4F8QA 3EHBD 1I3VA 2L7UA 4MD0A 5HD8C 4HF5H 1I85A 1S7XB 2F53A 5E08L 1QBLL 2ZCHH 4RBPK 1AQKH 4QRRD 5GZNC 4I48B 3DETD 5D7LB 2NY6B 4I1NB 1PZ5B 1R3LA 4ZUWB 2AABH 4S1QL 3PP4H 2B1AL 3UJIH 3NFNA 4M3JA 3VWJB 5DJ8B 2QQLL 3HB3C 5F7NC 2HAZA 1KCUL 5EU4A 4TNVK 1RU9H 3TFKD 2X1XR 1WZLA 4OB5H 3DGGB 4WDIA 4NP4H 1D5ZB 4HQQH 5JDSB 3HA0A 4HUXA 1YEFL 1NCWH 4MHHI 3LKNA 1N3NA 2MHAB 2WSKA 3L3JA 4O51B 5BV7L 1F6AA 5L2KA 5CIPA 1R3IH 2DQUH 1BD2B 1KJVB 1WT5A 4Y19D 3ZSTA 3W9DB 2R2BB 1TMCB 1WEJH 3DURB 4FXLA 2NY0C 5IFHH 3D0VB 5BZWB 1FE8H 3D39D 43C9A 3KDMB 3HZMA 5EO9A 2EC9U 2VXQH 5CZVH 4KZDH 4QOKE 5I1DA 3PG2A 1FRGH 3CK0H 4HKXB 4YDJB 4ZUSB 4XPBH 5F7EH 1MCSA 1KCRL 1S9VB 3QPQC 4OV5B 3QZWA 4G6FD 4R7NA 2MCPL 4NZUL 4WHTA 5IB1B 2BNRB 3LRGA 3IDNB 3OAZH 2VNCA 1YEKL 1NFDA 3EYSH 4S10A 2XTJE 4JFOB 1NBZA 2J2ZA 4HG4J 2NXYB 4M7KL 4L4JA 1VGKB 2QSTA 4R96A 3VI4E 32C2B 3U9PL 3VXRD 1G6RH 3NN8B 4Z7UA 5DJAB 1K85A 1UWEH 4XXDA 4GW4A 2MCG1 3VXOA 5DZLA 3KLSA 2YR3A 1E4WL 3D39A 2CR6A 4NOFA 3T0VA 2MWCA 1YEIH 2HG5B 4UV7L 2WINA 2APBA 2Q8BH 2VMFA 2OL3A 1HXMB 1A6WL 4GT7A 1MQ8A 1NCUA 3RL2B 4ALAH 2N4IA 1D5BA 1IGCL 1JBJA 5HGBB 5K93A 4Q9CA 1U3HB 2AGJL 2GAZB 1S7SB 5L2JA 3QIBB 2C3VA 4TQEL 3QSKB 5KSVB 2VAAA 3FJTA 4K7PY 2B0SL 4X6FB 4XPAL 1NBYA 2IPUG 1F4YH 3RWHB 1JTOA 5KVFL 2AI0H 4HIJA 2NW2B 4CL7A 5DQJB 5C2BH 3FOMB 4DOHB 1UM4L 1Z5LA 2OZ4L 5L8LB 4LARL 1MEXH 1HHIB 4DWHA 3DRQA 1AE6H 1KBGL 1FFOA 4C56B 3M1BA 4OZHE 4NZRH 1KPVA 2WWMC 1QFUL 4XNZC 1TJGH 2PYED 4OQ1A 1CDCA 3U4BL 3QXVA 2XG5A 4IM8A 1IC7H 1RK1B 3MLRL 5I73B 4ODBD 2C7UA 4XP6L 1X5LA 4R4BB 4HEPG 4RA0C 5FA4B 3PGCB 1TVBB 3GSXA 4OFVA 4PJXB 4TNWF 2G9HB 3S5LA 1C5DB 3REVB 4B50A 5FOBB 1UFUA 4ISVB 4FABL 4YXLL 1MH5B 4M02A 4XHJC 3TV3H 4LCCB 1K6QH 3QO1B 4JRXD 2G60H 4W4OC 1FNSH 3D0LB 3IU3B 3JTSA 5E08H 1KULA 1QBLH 5KSAB 3U6RB 5ISZA 3LKPA 1QR4A 2O26U 4MZ3A 3NPSB 4MD4B 5D9SA 1D9KA 1GZPA 3I02B 2XRAH 4RIRA 1QLFA 1GSMA 3OKOB 3ZHDA 3W5NA 2B1AH 4LSSL 1CFNB 3L9RA 3G6JE 5DFTA 5FO7A 5BVJB 2IBZY 4L3CB 4NIKB 5I1GH 3OWEA 5H94A 4P9HC 3VD4A 1UH2A 4UT7L 3FB8A 3MV9D 2ZG3A 1YEFH 4R8WL 4YXHL 5DEFB 4Y4HA 3Q1SL 1UKTA 2YOCA 5H8DA 5IW6A 1AGCB 4ODSL 4OTXL 4NO2A 4WJ5A 1VCAA 1BZ7A 4PJ5E 3SO3B 1H0DA 1EAPA 3V0WH 1K9TA 2YPVL 1P4LA 4LGSB 3IETA 2YC1A 3BOVA 5FAAA 1OAXL 2DKSA 4PJBB 4N1CA 2FD6L 5C0IB 5T3XE 3K4AA 1MRCL 3D85D 1X5IA 5I9QB 1DVFA 2VSCA 5DD0H 5B39B 2P7TA 5EOCJ 2MCPH 3TT3L 4N0UE 5EBWA 2FHBA 2GHWB 1ZHKA 1YEKH 1NEZB 4BSWB 5CEZL 3MV9A 4LRNH 4J4PD 2VTFA 3ALWA 3U9PH 5AD0B 4U49A 1U8PA 4PJFA 5KS9F 1ZT1B 2YN3A 5DJZB 4GRLD 2ZUQB 4U6VL 4WGWB 4JFFA 4DVBA 1E4WH 3EYQD 4ZOCA 3RRQA 1MCDA 1U36A 4HV8A 1BHGA 1PDKA 3GO1L 2ZSWA 3QXDA 5D7SL 5IB5B 2QLVB 1R24B 1A6WH 1AGEA 4P2RD 4DK3A 3EFFA 1P7QB 4MXWL 1ITBB 3JV5A 2XIDA 2IAMB 2DMKA 3KWWA 4D3CL 3QFJE 1HILA 1SMOA 5ESAA 1JGDB 4DCQA 2GTWA 2HVJA 4PRAB 3D1MC 4ZXBB 2Q6WA 5I19L 4TQEH 3SDAA 4WFFD 3SY0A 4Z7OE 3FOLB 5F7DB 3CDCA 5KAQF 1FZMB 2B0SH 4XPAH 3TZVC 1AHWC 2KPNA 5AAWA 5KVFH 1Q9OA 1P5VA 1U8NB 4P0DA 1BJ1H 1XR8A 4YDKL 1CS6A 5SWZE 1UM4H 4IHOA 2OZ4H 4GRLA 2YUVA 1V3MA 4HDIA 4LCUB 2ARJB 2J7LA 5D7KE 1KBGH 5CJXA 3LD8B 3IRZA 2F58L 2HT2C 2FJFA 2DS4A 1WC7B 4Z7WE 5KN5A 3WFCH 1SYVA 3U4BH 5FGBA 1JZ7A 4DKFL 1G9NH 3H0TA 4XP6H 1XGPA 1I9IL 2NY4D 4L9LC 5F7UA 5JPMB 1F4WL 3RVUD 5B8CA 4PJ8C 2VIRB 4NRZB 5F1OB 1CGVA 4UU9B 1QUNA 1T89A 4YXLH 1ZSDB 4PIRF 3HZKA 5EUOE 1MVUA 2NLJA 5D1QD 5FCUL 4M8VA 4HULB 5JPNA 2XWBA 3QEQA 3EFDH 5B39G 4JG0L 3Q6FB 4GQ9L 1U8OA 5HGGS 4ZS6D 5E9DA 3RWFA 5EU7E 3TP4A 1CGSL 1T1XB 4R6UA 4ELKA 4Y5VA 3QNXB 3QAZC 1KLGB 5E5MA 4LLWB 4PBVC 3EJYC 4GOSA 3H3KA 5IVXB 1PYWB 4MA3B 4JG1H 4OCYL 2Y7QB 1FFPA 3RI5F 4LSSH 2P24B 4OSUL 4MJ5A 5AWNL 3PUCA 4YHYC 3IS1X 4FRWA 3MCLL 2XZAH 5CEYA 1V8HA 2BNUB 4JHWH 1PY4A 3IAPA 3U46B 1KIPA 4MJIA 3R06A 3RU8H 1I1RA 5ICZA 2F5AH 5EO0A 5GGRY 4XTRD 3CVHB 4CVZB 4UQ3B 4YXHH 3GM8A 4ZUVB 4XMLL 3T2PA 5ID1A 4MDIB 1LK2B 4MWFA 3MYJB 2DIBA 4YNYA 5D1QA 4KDTC 1F13A 4M8QB 3HNTH 3LMJL 4UDUA 4U6YB 3LIZL 3AGVA 5TE4L 1UXSA 3DXAE 5DF0A 1MCPL 4LNRB 5CP3H 5JHDD 1QRNE 1OAXH 4H0IA 1FAIL 2RBLA 2CLZB 1R5WB 4ZUTB 4R26H 2FD6H 3P4OB 1RVFL 1MRCH 5E6IB 1I3UA 4QKXB 1U3YA 3RQ3A 3TT3H 1V05A 3A67H 2EXWD 3QRGL 5SWSB 1CDGA 5TDOA 3OJVC 4H8WC 1IM9A 5J9PB 1PEZA 2RHEA 5IIEB 2CRMA 3IF1A 1VGEL 5JMRA 5BRZE 5EULV 3SE9L 5IBLD 2XA3A 3BKYH 3SHSA 5ACZB 3BH8B 1GGBL 2RJMA 3HG1E 5GSVA 3IFOB 5JQ6H 2NYYC 5D2NA 3KHQA 1JI2A 1RZJC 4U6VH 1U41A 1A9EA 3SQOL 2IMNA 5D7IE 4IJ3B 4Q9QL 2VDRH 3GMOB 2N1KA 5IFAH 4PJ7B 1VACA 1U95A 3GO1H 4FFVD 1YN7B 5I0DA 3O3DB 3QUZB 2NY5L 4G6AD 2EDYA 3QDJA 4RRPA 4E5XA 2D7PA 3BX7C 1HHJB 2P44B 5ID0A 4U4BA 5I19H 2HKFL 2CKBA 1BBDL 4N0YL 4NPYA 5SX5H 1IGTB 1Z9MA 2A83B 1MAMH 1A21A 4HWEL 1WGOA 5E2UL 4PGCA 3O8XB 1CN4A 5FYKD 4I0PC 3UTTE 4JDZB 5HYJB 3ZDXE 4YDKH 1J1PL 4LKCB 1S78D 3HLAA 4A6YA 3QUMH 4TUOB 5C07E 2JJSC 3MRLA 1UACH 4M00A 4Q9BA 4BFIB 3WS6A 2NX5D 4W6WB 4UOJA 3VRJA 2EXYD 2CDGA 2F54E 2WIIB 4ODUB 1CT8A 2IF7A 3DMMB 1XGYL 3MC0A 4HJ0C 5EU6D 4YGAB 4BH8B 4DKFH 4Y89A 3RY6A 3LSOA 5E8PB 1L0QA 1IEHA 1CXFA 5FDYA 3FQTA 1CDUA 3PWNB 4XH2A 4N5UA 5FCUH 1GZQB 2FATH 3R1GL 1LO5A 4PRIE 1B88A 5EIIB 1YY9D 2YD1A 5HY9B 4OFYD 2HJFB 5FUCE 4J1UB 3V8OA 3VGHA 2AV7B 2E7BA 4IRSD 1PX4A 1JMZA 2HVKA 4HK3N 4X8JA 2XZCL 3QDGE 1QR1B 1B6UA 4OCYH 1T66C 4HIXL 3KPSD 4OSUH 2YUWA 2GK0A 1OLZA 5IK3B 4LDEB 2DM2A 1P9MC 1NAMA 3EDFA 1IGYB 4MQ7B 1TDQA 1WIPA 2VZ3A 5I8CB 1UZ6F 2EICA 4LLVB 4XNUH 1CDBA 4XMLH 1R5IA 1WAAA 3K0WA 4X6EB 5KSUA 4X6DA 3EDKA 2ITCB 3T8XA 4JFDE 3CNKA 3PE9A 3LMJH 5C2UB 3LIZH 1CD1A 4EN3C 5TE4H 4ZQKA 3DIFA 3D48R 1DUYA 3ES6A 3GUTA 1V7NL 2BSSA 2A1WL 4D0DB 4GG6E 4PJHE 4F3FB 2ZOKA 3CZFB 1ZLVK 4CVWA 5F9JA 1KIRA 4QXWA 1N8ZB 1YNKL 2MOVA 5FUZL 5F9DC 2R2HB 4LPYA 3OR6A 4M93C 2IALA 2OTUB 3QRGH 2WUBL 3LRSA 4U7KA 3BPOC 5K9OA 3PV7A 4MJ2A 5DC0A 2N7AA 1RZGB 2ICES 4PRHE 5H2BB 1HWHB 4FQHB 1RURL 2NY2B 1JWMB 5E6ZA 1GGBH 4LAQH 5F7MC 1A5FL 3B3IA 3VWKD 4GRWF 4BSVB 1E0OB 1OTTC 1CGYA 5HVHB 3OXRA 3M07A 4XZUB 4X80L 1IAKB 1EJ6A 4PJGF 3SQOH 3T0BA 5CJOL 4TVPD 4GMSL 2X89D 3BPLC 3GBNL 3FCTB 1H3UA 2EYSA 4X5XA 3BWAA 2NY5H 5DK2A 1FNGB 3BVNA 4RAHA 4ELMA 3L3DB 1YMHA 4MVBD 1PFCA 1FGVL 4JZJB 3GFUA 2VJXA 4V1DB 5LAXB 4NNYB 4M1GL 5JORA 1VFAB 3B6SB 4G42B 2HJKB 1OPGL 4KJQD 4N0YH 4PJIA 5CGYD 3IVKB 4EI5C 4QRUA 2BOBB 1J87A 2OM5A 3I2CL 4YHKL 4YHNA 5E2UH 3WXWL 4HS3A 4HWEH 3WFHB 1I7ZB 5E4EB 5IGXL 3QWQB 2BNQB 4FNLL 3VD9A 4GW5B 1J1PH 3FT4B 2HN7A 4TNWK 2YD7A 4ODWB 4X4ME 3Q5YA 2Y07L 5EU7C 1L9NA 2ZSVB 5GSRB 1PW3A 4PJCF 3T0DA 1WTLA 3EJZD 1XGYH 4HGKC 4X9IA 1PD6A 2XWTA 3BP6B 5CFHA 2APWA 3TPUB 4JPKH 1CFTA 4WI8A 3ILPB 3RKDC 3NFSL 5FKPA 4WTZA 5FUOL 3WLWC 2RAMA 4JKLA 1RJYA 3VXUE 1YPZE 3MV7E 5ILTL 3BSZL 4Y5XA 1BFOB 5CEZE 43CAA 3QO0A 2IWGA 3C5SA 3OGCB 4M6NH 3VE0B 1NCBL 1TTGA 3LY6A 3R1GH 4YHLL 5CSZA 4P46C 3VFUB 4NCDA 2NY1C 1VSCA 1WLHA 4ZFFA 1X9QA 4PTUB 5DVKA 1LD9B 3UPCA 4OLUL 4JDTH 1BF8A 1J8HE 4PRPB 5J06A 4KTYA 2XZCH 3MCG1 2NNAA 3MA9L 4NYLB 1VENA 5IEKA 1JGEA 1LNUA 3HAEH 1T4KA 1A1MB 4OZFA 4HIHA 4PPTA 4WFGD 4MJ6A 5FDWA 3BD5A 5FYJU 3UBXI 2GJ6B 4PGDB 3OKDB 5D7LE 3D9AL 4P3CL 4QRPE 3IJYB 3MO1A 5DJDB 2DQEL 1INDL 2VLRD 5IJVA 5EIQA 3P0GB 3HC4L 4HJGA 2DICA 4ZFOB 4FQXB 4I5BA 4PV8A 3A6BH 4F7EB 5J3HC 4YHOL 4PG2C 2ZUTA 4KPHL 2NR6C 1AP2B 5GRYA 3GMPA 2VOTA 3WD5L 2VN4A 3IFLH 1FORH 4GKOA 3UTPE 1V7NH 4HMDA 2A1WH 2WP3O 4NFBA 1BD2E 3BW9A 4S0SD 1KT2B 1YNKH 5IB2A 4D2NA 1M7IA 5J12B 4YBQD 1MHCB 3QUXD 4Y8DC 4AH2B 4WUKL 1HOCA 3L3GA 1CICC 5ICYA 5TGBB 4WO4B 2DRUA 1AI1L 1RHFA 5I71C 4B41A 2BP3A 3OX8B 1C12A 4P2OC 4PTTA 1U8LA 3OJDA 3RNQB 2VLRA 3JV4B 4OD3L 3GMLB 3FQXA 3AREC 4B0MM 4D9RD 4ETQB 3RNKB 1A5FH 1NGPH 2DQGL 2Q3ZA 2P48B 3RL1B 1GGIH 4KHTL 5C09B 2QADB 4MNQB 3AC0A 4GMSH 1EFQA 2X70B 3VU2A 5KSBF 2H32B 4HGMA 5C0BA 4DVRL 1JPFA 3MMEB 4X7FC 3HRZB 3GBMH 1KTLB 3I75A 1FGVH 3PHOB 4X98B 3K1KC 4M1GH 3ZT5A 5JQHC 4HIEA 2XZQL 4Z5RA 5MEQA 1JMXA 3X12B 4OGZA 4TSBL 1ORSA 1PVHA 4F9LA 1A3RL 3MCKA 4U1SA 2E8ZA 4HKBA 3I2CH 4YHKH 3U1SH 4PRDA 5EN2B 4K94L 2B20A 1A1NB 5IGXH 4OF5A 3D3VE 3OPZL 4PGEB 1MAJA 5A1AA 3VD3A 5IW3A 4RGNC 3ZMRA 2LE9A 4F9PA 4NC2B 1G7IA 3ZT6A 1FJ1B 4CNIB 2B5IB 2Y07H 5KZCB 1MJ7H 3GMQB 4QRRE 4E0RA 4I3SL 1OB1A 1P6FA 3L7EB 4DEPB 2VKWA 3U2SA 2DLIA 5C0DA 5KVGL 5IKCB 4R0LB 4RMRA 3SGEI 5INDB 1KIQA 3LS4H 4P5TC 4TSCL 2O61B 1H5BA 4FFZH 5HHOD 1YEDA 4HK3J 3NFSH 1YYML 3CFJB 1NAKH 5F6HI 4U1MA 5CJQL 4PJEA 3BSZH 1DEEB 3SDXA 1Q9WA 2A77H 3LS5H 4QHNA 3VRIA 1NCBH 2C9AA 3R0NA 4H1LB 3BRFA 4JR9H 4Y19E 5IBTH 2FJGA 4OLUH 4Z7UE 1JGLL 4PJDF 4X7EC 5E8EA 2NCMA 4OZIE 2AEQL 2KDGA 3MA9H 4EDWL 1IKNC 1ZEAL 3OGOE 4EOWH 2J4WH 1A6UH 3NGBC 1IAIH 3PJSB 3WIHL 5HHOA 1ZGLM 1I1FB 1QBBA 3D9AH 4G8IB 4NQDD 4P3CH 4LLUA 3L7FA 4MD5A 3T3PE 4P4KA 4UIMB 1MREL 4LEOB 4POZC 2DQEH 3W2DH 5I17B 1G9NC 3L5IA 1RIUH 3VXRE 4N8VG 3QG6B 4RSVA 2HMIC 1C7TA 4YHOH 2X4OB 3TBVA 5KVMC 4MAYC 2W0FA 5DRNA 3MQIA 3WD5H 4B53A 2CDEA 1PKQA 3C6LB 3RKPA 4ODHL 3QIUC 4RNRB 1EX0A 4ZTPL 2EZ0D 5FO9B 5E7BA 2NXZC 3HI1B 4QCIB 4JN1L 2ICCA 2AQ1A 3TCLA 3MBXL 4X4YA 1DBMH 1UVQB 5I1LA 1CD8A 2VXUL 2CUHA 4WUKH 1MCNA 4BYHA 1T3FA 3FRPG 1ACZA 5MP6L 1AI1H 4X4XB 4P23B 5I1HL 2EKSA 2Z93B 3RX8A 3OB8A 4H20L 1WV7T 2BY2A 2CMRL 5DHVB 3T0ED 1QHPA 4NCC1 5FO8A 5ESQA 4Q9RL 3T0AA 1XEDA 4P57A 2GIYA 3GRWL 4KTEL 2DBLL 4W4NA 2IANB 3SN6N 4XMPH 1OTUC 5BQ7B 3QDMA 5T5FH 4ZOEA 2DQGH 5HPOA 5AG9A 3UROR 1SYSB 4Y1AA 4KHTH 4G5ZH 4M7ZC 1OD9A 5BXFA 1DSFH 4H0GA 2C4XA 2Y6SD 4J7RA 4PY7B 3WNNA 4EUPB 5FK9B 1SJXA 4MS8D 3FQWB 3P3YA 2BVQB 5C0JA 3ARFB 4HG4K 5C0FB 2VR4A 2PTTB 5GGVL 4H1LG 2X4RA 2PYEE 3MXWL 2H1PL 2XZQH 1MWAA 2ZZUT 4TSBH 1IGJB 3QIWB 3HUJA 5D1ZC 4J23A 4NQUA 3LKRA 3KLHD 2OK0L 4QHUA 1EFXD 4PJAB 4K94H 3K80A 1CDYA 3OPZH 4LOUC 1CI5A 2G75B 4JRXE 1I9EA 4DGVH 5EZJA 5DK0A 3DJ9A 1JL8A 5K9QI 3B2UC 3VI3E 2D03L 3C60B 3QB7C 3P0YH 4TVPL 1XZ0B 3ET9F 4L3AA 4I3SH 3FQUB 1S7XA 3KYMA 5F7WC 4M48L 4PFEA 4I48A 4ZUWA 1PZ5A 4TSCH 5KS9B 4NC0B 5F9OL 3VWJA 2R4RL 1KPUB 3QQ9D 1YYMH 2DKMA 4KI5D 5HYSB 1HEZB 2PXYD 4JPIB 5CJQH 1A6PA 5I30H 3S34L 5FYKH 4LPVA 2VE6A 4FHBD 3DGGA 1FN4B 4HCRA 5JDSA 2Z8WC 2VRAA 4U1IB 1Z0NA 1OTSC 2MHAA 8FABB 1CL7L 2VKXA 1JGLH 3N85L 3BP7B 3JWDL 4XVJL 1KJVA 3B2VL 1BECA 5C7XH 1M71A 3TN0D 2MFNA 3EDDA 3QXAB 1ZEAH 1AD0B 3DURA 3MGTB 4NN6C 4WEBH 4TRPL 3D0VA 1UJ3C 5IF0B 4BQ8A 3KVQA 5BZWA 5INCB 1CVRA 3LN5B 1A4JB 5ALCL 3HMWH 1NAMH 4HKXA 4AEIL 5E5RB 4Z8FL 4YDJA 2MQCA 4ZUSA 1KFAH 1L0YA 1QA9B 4NUJB 1S9VA 4OV5A 4HHAA 4UAOB 1SM3H 5IR1B 1MREH 4UQ2B 3PHQB 1CD0A 3DLQR 5IB1A 1I1CA 2BNRA 2VLMD 3IDNA 4EDXB 4GBXB 4EUPG 4YJZL 3OJ2C 4ZAKD 4QNPE 1XCTA 4JFOA 2CO6B 2J8UF 2DJUA 4OLYL 4WEUD 5DEZA 4WV1B 5D96C 3H3BC 32C2A 2EYTA 3KPQB 3I3DA 3NN8A 3FAXA 3WFDL 3EOTL 4ODHH 3O2DL 5DJAA 1I85C 4FQLL 4QTHA 4ZTPH 1J1OL 1BLNA 5ACLA 3TA3D 1EGJH 3AM8A 1R5VB 4JN1H 4MXVF 4N9GA 5F6IB 2DM3A 4P2RE 1UKQA 5JDJA 3IFPB 3UZEA 4G3YL 4L4TD 1HNGA 3GHEH 4NZDA 5CWSA 3RL2A 3HZVB 4UB0H 5BOPA 2VDKL 5I1HH 1XF5A 5HGBA 3QEGL 4H20H 1R0AL 1AJ7H 3QIBA 3O4OB 3MLZH 1HZHL 5SWSE 2QR0A 4X6FA 1JFQL 3MFGB 3RWHA 1WT5C 2NW2A 2X4TB 2VXSL 3FOMA 4OUOA 5HYSG 5IMOA 1G1YA 2J1KA 4POUB 1G7MA 1Q9KB 5TFSH 4FS0A 3EZ8A 3DETC 3P0VL 4WIQA 1F2QA 5GGVH 4C56A 2C4FT 3U36B 1TPXC 3BIAX 3ARGD 3MXWH 3O45B 3BGAA 3B9EA 3TFKC 1RK1A 3PDOA 2OK0H 1S7QA 3PGDB 2FECL 3HZYB 4R4BA 1TZGL 2G2RB 5GGUB 1IFHL 5KAQG 1CFSB 1TVBA 2B1HL 4PJXA 2G9HA 1C5DA 3P30L 4IEFB 5FOBA 4YPGB 4ISVA 5MEPB 3U0WL 5C0EA 1MH5A 4LCCA 3QO1A 2R0KL 5JMOC 3F58H 5IVNA 1W0WB 4TVPH 1OARH 5C9KA 2DQHH 2ZCLL 3IU3A 2Q86B 1C1EL 5KOMC 5KSAA 4R90L 3RDTB 4DZ8B 1S9XB 5KVDL 3LEYL 3WHE1 4MD4A 3H9SD 4XHQA 3KYNB 3BQUD 3OKNB 1JTPA 3OKOA 4XCYB 1X5XA 5C6PB 1CFNA 5F9OH 3HR5B 1FVEB 2VLKD 2R4RH 5ETUB 4S2SB 3AUVA 4JLRB 1DBJH 3KLDA 3O9WB 4L3CA 5BZDB 1RFDH 3KNBB 5HGHB 3UTSB 4JZNB 3SKUD 5DEFA 3CLEL 3BJ91 1CL7H 3N85H 1SQ2N 3JWDH 3LQMA 4XVJH 4LVNB 3FQNB 1AGCA 3B2VH 1UH3A 4HS6B 3LDBC 4X7DC 5DRWB 2OYPA 4YR6B 5JHDE 3RZCD 2KZ1B 1T83C 2W0PA 4OZFH 4TRPH 4NFCA 2BMKB 1JNHA 2IMMA 3C5ZB 3MUZ1 3HC3L 1ZLSH 4KKLD 4PJBA 1DQDL 5ALCH 5J6GB 1AKJD 4FQCL 4RFOL 4OCRL 5C0IA 3EKCA 4AEIH 4Z8FH 3FZUC 2CRZA 5MI0C 5CINL 1A2YB 1C5CH 5IBUB 3PV6B 1G0XA 3GMNB 3ZDYF 3SOBH 1NEZA 1S5HB 1I8KB 2X05A 3KPPA 1JPST 4LF3A 3RPKA 1VKXB 2Z31B 3PWLA 5AD0A 2LU7A 5B38G 3EOTH 5DJZA 1J1OH 4EI6B 3BEWB 3CUPB 1GAFL 2M2DA 5M94B 1L9MA 1T0MB 3K8MA 4G3YH 5IB5A 1R24A 1EEQA 3T65B 1PBYA 4U0RC 1KN4L 1WISA 1XR9B 2IAMA 2VDKH 3QEGH 1JGDA 4TTDD 3ARTA 2I9LB 5GISL 3CX2A 3NIGE 4PRAA 2DLEA 5DA4A 1V3LA 2P5WB 3CXDL 1U8KB 4XPHL 3UEZA 4EZMA 1G9MH 4Y4HC 3FOLA 5F97E 5MENB 3PIQA 5F7DA 4PD4J 5D1XD 1TCRB 4RGMB 4BZ2L 1JFQH 5J6HB 1JIBA 2Z35B 5HPMB 1U8NA 3ARVA 4Y16B 2NY3B 2E7MA 3EOBB 1KF9B 4Y2DB 2GY7B 2NX5E 1FCGA 1MQKH 3B5TA 1QHOA 4LCUA 2ARJA 4WENB 4WW2F 1ETZB 2I24N 3QQNA 2QHLA 5JO5A 3BE1L 3MRCB 4K3JH 2QSQA 3DX9B 2EEDA 4OQTL 5F88B 5D7JB 3TYGL 5EU6E 4TUJB 4YDIL 2EDDA 1DVFC 4KK5D 2Y1VA 3WIIL 3C09C 3GB7B 3O41B 2GJZB 2E9BA 3UJJH 5IB3B 4UT9L 4KJPD 1N26A 4U1NB 5J1AB 3P9WB 4V1DE 2VIRA 4NRZA 3P30H 3VG0L 3R4DA 4UU9A 1ZSDA 3FB7B 3T2OA 3VI4F 1MJJB 1IZKA 4S11A 5E2WH 4AY0A 1X5HA 4ZPTB 1GIGL 2EE2A 3QHTC 5EA0H 1UYWH 4IBLT 3Q6FA 2AVGA 4XT1C 3X3FL 4RMSA 4R90H 1LEIA 1N5YL 1LEKB 3SE4A 5KVDH 5IBUG 1FSKC 3LEYH 3QNXA 5JXED 3KPSE 3RIFF 4DKAA 1J86A 4G8GD 1PYWA 4MA3A 3SKNA 5IVXA 2Q7NA 4X99B 2Y7QA 4FQJL 1LO4L 2Q76B 2P24A 1LDSA 3GZKA 4AIOA 1FYTB 4H88L 3S37H 1EEYA 2BNUA 1AO7B 3BZDA 5I1JL 3DSFL 3B9AA 3SGJA 4PV9B 3CVHA 4CVZA 4NQEB 3CLEH 4LSQL 4ZUVA 1JWUB 3RA7H 3TBSB 4J4PC 3RJDA 3JWNC 2ED8A 2E9WA 3O4LB 4M8QA 4ONHA 1NMCC 4U6YA 5EOTA 3ABZA 3QHZH 3CXHJ 4XVUD 4HMCA 4GRLC 2YPLD 4Z7VB 4GKNB 5JW4Q 4LNRA 3S7GA 2CRYA 2IFFL 3HC3H 4GAFB 3EYQC 3TIDB 1PZUB 5CJXC 1C5BL 2CLZA 1DQDH 2WBJB 1CGXA 3MRGB 4FQCH 4NN5C 4ODXB 4OCRH 4OZHF 4RFOH 4ZUTA 2D4DA 3P4OA 3X17A 3I6KA 5D93C 5FGBC 4WHYH 3DPBA 2ED7A 5C8JB 4KJWC 5CCKL 2RFXA 4H25A 3KPRB 2CXKA 3B9KD 5TQ2L 5J9PA 5B8CC 2B4CL 5IIEA 1OD7A 2GJ6E 1X44A 2DDQL 3ULVD 1T89C 2B7DT 3HNVH