4DZ8A

Human igg1 fc fragment heterodimer
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
209
structure length
209
Chain Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Generating Bispecific Human IgG1 and IgG2 Antibodies from Any Antibody Pair.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dz8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dz8A01
5DJXB 4FABH 1CVSC 1DUYB 4QRUA 2JJSA 4PRDB 3LQMA 3KJ4C 2HFFB 5A40E 1I7UB 3VRLE 4KKAD 4PBWD 1MCDA 4QXUH 4YZFF 2W0FA 3MRQA 4OZIF 3QO0A 1U2CA 3BKJH 4JFED 2ADFL 2UVFA 3RZCC 1KF9B 3ARDC 5HPMA 4Z7OF 1HWGB 3KYMA 4I18A 5DD3L 3OMZA 5D8JH 1HHHB 4X80H 3MROB 3DIFA 1K5NA 4J6RH 1BF8A 3DUUB 5C9JA 1HQ4A 2RB8A 4YFEA 2GJ6B 1ZVYA 5HHQA 3OAZK 1YEDA 3O6KH 4NQED 1M71A 5F7NC 1G0YR 4Z0XA 4XMLL 4F8TA 3KNBB 5IG7B 2XKNB 1T04B 3C08L 5FA3A 1P1ZB 2L4OA 1X5YA 3ARBA 3UBXG 1DVFB 4NZRH 3KWWA 3IDXL 2AEWA 1K3IA 4E5XB 4LASL 4UT9H 4G6MH 1YQVL 5J6HA 2PW2B 5EU4A 5D2LB 3QI9A 4P3CH 1CF8L 4Z76A 4JQXA 3NCYS 3NA4A 1TZHA 1JRHI 1ZANH 43C9B 2KQNA 4U1SA 2HRPH 3RWHB 3QEUB 4JANB 5LGHH 5DT1L 5BV7H 4M8QA 4K8RD 2PW1A 3FFCB 1GXEA 3FQTB 1SYVB 1EBPA 1S7UA 3HE6D 3RWEA 3LKOB 3MUZ1 5CSZA 4D0BA 5IW1A 1X7QB 1JZ6A 1IQDB 4OCMC 1SJVA 5IQ7H 3MBXL 3IAGC 3MRCB 1KCKA 3UEZA 2HTLC 2L0DA 2MFNA 5LAXA 1R3JB 3TPUB 3AU1B 4XCNA 25C8H 4ZD3H 3UZVB 3W11C 5I2IB 1C1EH 4XZUA 1KCUH 5EOCJ 5CJXC 4HUXB 1CIUA 4KZDL 1DANU 5T1KA 2FIKB 5EZOH 3BISA 5B4MD 1ZA3A 3G6JB 5IVXA 1J88A 2GSGB 3DXAB 3TC9A 4XBGA 4LEOB 1GZQB 4IOSD 5C07D 2VLKE 2P8PB 3RDTC 1B6DA 5D6DC 4KWUA 3W39A 5JPMB 3Q6FB 3OKLB 4O51A 5CUSL 2DN7A 1VPOH 2VIRA 3JV6A 5ACLA 1MY5A 1XT5A 4TTDD 1BZ9B 4RFOH 5F7DB 4OZGF 4M6OL 2A73B 3UTSD 1X5HA 5F72S 1CICA 3E6FA 3MV7D 4W68A 4S11A 1YEEH 1FV1B 1BD2E 3GSNA 1MHPL 3ULVD 5EBMB 3EDDA 3CSYB 4X98A 3L3GA 2F74A 1HKLL 2A1WH 3FQNB 1YPZA 1P7QD 5H94B 3C87A 4R9HA 2VDRH 3WLBA 1HWHB 4Z0BH 2EZ0D 5E00A 4GW4A 4C4KO 2VISB 1U8NB 2NY6D 2AKRB 4FQ2L 4DZBB 3P73A 2W0PA 1A6PA 2R29H 1EJOL 2BP3A 4ZUTB 4FQHB 4OF8A 2XZCL 2VAAB 3P4NB 4LQFL 4F7EA 4FQQB 4XBEL 3MNWB 2AJ3A 1UA6H 4RGMB 2QQKL 3MLSH 4KI5F 2Z91A 2CRIA 2VMFA 1JUFB 1MWAB 5GISL 1GYAA 1N0LA 4Z77B 4R0LA 5HYQB 4JPIB 1D6EB 1BBJA 1YC8A 2Z35A 2R4SH 1VHPA 4QO1A 1BGXL 3C6SB 3CVHL 5INCB 4YC2B 5T5NG 4GRMB 3W0WA 1HSAA 4K3JL 1BM3H 1MY7A 1S7VA 1B3JA 1T21B 5I1CH 1PX4A 3SDYL 4JKPL 4KJYA 4O58L 2YA2A 4L4TA 5F9DC 2MJWA 5ENWA 4YDIH 2F54B 4W81A 1C7SA 4XC3H 4J4PD 3KPPA 2COQA 1UCTA 4ZUUB 1IM9D 3MNZB 3PQYD 3SN6N 1R24A 5GGVL 1T0MB 5I1HL 5C0BA 1RUAL 3T0WA 5F6IC 1QSED 3HG1E 1SEQL 5IT2H 1WC7B 3OR6A 4O4YL 5EOTA 1LEIA 3MJ7A 1F5WA 1YUHA 1F3DH 2OL3A 3GI9L 1JI2A 3H0TB 4Y4KA 5BXFA 1CXFA 1IE5A 4JY6B 3OF6D 4WY7H 3RZCD 5ALBL 1UACH 2G75B 3MJ9A 3O8XB 1W8OA 3BSZL 3FHAA 1XCQA 2HWZH 1XIWC 1UH2A 5GIRA 5DTFA 3E8UL 1HI6B 1U3JA 3FL7A 3RGVA 3CCHA 4EVNA 1D5ZB 4QTIL 4S2SA 5CJQH 2X70A 5B3JE 3O2DA 2P42B 5DLMH 1FVDA 4KY1H 5E08L 3VRIB 3B9DA 1KUMA 5I1KH 1LO2L 4ZO9A 1EHNA 3I6KA 4LDOB 3MRMA 1V8HA 1IGFH 4LSQH 1N3NA 1RZJH 4NUJA 1ZHKB 1CD1B 4MHHG 2VLRA 4TVPD 5HGAA 4L9LC 3LCYA 1HQRA 1HIML 1U2HA 3L3IB 3QUYB 4CVXB 1YMHA 5SWQB 2YS4A 1U36A 3B2VH 3GMOB 2CXKA 5HYJD 3A0OA 4OZFG 1K4CA 5DXWA 1CVRA 1BFVH 3TVMA 1LO0H 1PD6A 1RU9H 3QZWA 4RMQA 2NX5E 1T2QL 4LCCC 1AI1L 4P57B 1R5VB 4H20H 5HGDA 5L2JA 4H5SA 4OFIA 4XPFL 1AGCB 3AY4C 2PCPA 2X1QA 2CH8A 2DTSA 2F8XC 1JIBA 2YC1B 2Z93B 3REVA 4OLWH 4URTB 2YPKA 4EDXB 5I19L 1DQMH 2BSTA 2H1PH 1L7IL 1BECA 4IRSA 3RUGA 2AXGA 3ECBA 1NEZA 4GMSH 1H3TA 5IESH 4G43B 2AJSH 5AEAA 5IB2A 4HXAL 1QTYT 3NA9H 1U6AL 4Y4HB 3RDTD 3FB5A 1MJUH 4ODUB 1EHLH 4P46B 1UWGH 1FORH 4QKXB 1A8JH 3BI9X 4JG1L 4YLQT 3NBNA 3FKUS 1B0GA 1VACA 4HS8H 2AV7A 3CAFA 4PGEA 4M7LL 2AXFA 2FB4H 5I18H 4OM1H 2WLYA 2ZG1A 5IHBA 1KCVH 4JZOA 3L95B 4PRAB 3PJSB 2ARJA 1ND0A 2EXWD 4JJ5B 3CFJB 3GSRA 3GSVB 4GMTL 4K71C 1MVFA 4J23A 2EIDA 4Y16D 2WQ8A 1AFVH 5JW3L 2I26N 5F7LB 4U1KB 2GAZA 4V2CB 4NO0A 4WWKB 2DMCA 1ZLSH 3L7EB 1A3RH 4MQ7B 4NO5A 3BPCA 1FHGA 1U8OB 1UFUA 2WIMA 4X4ME 4U7KA 1OM3L 4MAYC 4WTZA 3L3HB 4Z7QF 4JHWH 5BZDA 4WO4B 4FXGA 2CLZA 3KYKL 4PTUB 2SEBA 3GEWB 1JPTL 3WNOA 2CR3A 2OTWB 3DVGA 4OI9A 1JWSB 2E9BA 4MJ5B 3LKPA 3I50H 3FT4A 3RKDD 3FZUC 1QPPA 2J8UE 2JJUA 1FGNL 2VTFA 2VE6B 1MIEL 4GQPH 4JFDB 1I9RL 4U6VH 1FZMA 4LGRB 4WGWB 1JYWA 1FIEA 1S7XA 5T3XE 5D2NB 3QR2A 3SQOL 3WS6A 35C8L 1SHMA 1PKOA 5DC4B 1OQXA 3WNLA 2BHUA 1NFIB 4ZUVB 1P9MA 7FABL 3QFDA 4PGBA 1G9EA 4HV8A 1TETH 4ZFGL 2WW8A 5BS0E 4X8JA 5E9DA 2EKSB 4CJ1A 2R9HC 5KSUB 5D5MB 3FRPA 3F7YB 1KFAH 3D39B 1NGPH 2WBWB 3HNTH 4PJGE 4PJDE 2X4SA 2V7HB 3UTTB 4QYOB 4H8WC 4BH8B 3K8MA 4LLUB 4B7LA 3HAEH 2G5BA 4MNHA 1OAXL 2EYTB 5JOFA 3C5SA 3VXPA 1E4KC 4TSAH 1BHGA 2XTJD 3WDJA 2QHRL 1IQWH 3HPJB 1FVCA 5SWSD 2A0LD 2WIIA 5IQ7L 4LVHC 1BVLB 2A2QT 3WO4C 5ADOL 3RWCA 3V5KB 3WD5L 4JFHD 4ZD3L 5J56B 3CU1A 4H1LA 3MV9A 1ZKAA 1T03H 2WLZA 5F7FA 1NDMB 4ZPTB 1OARL 1RFDH 3FN3A 5HVGB 3UTPD 5D7IB 4MJ2A 1PLGH 3PWPA 1F4WH 1OL0A 5SWZE 1AGDA 1CFQB 4G6KH 4NUGL 2FLBT 3DYPA 1VA9A 4YXKL 5HYEA 4MD0B 3UJTL 2V9QA 4EI6A 4JY5L 5EU7E 4UDUA 2QSTA 3EOYG 4L3ED 5F88A 4Y8AA 3S35L 3TLRA 2GYSA 4BUHA 4YXLH 5F9JA 3NAAH 5D7LA 4PYHA 2O93L 1AE6L 3UTZA 5D1QC 4LNRA 1U8QB 3MLTB 1AIFA 1U92B 3F7VB 1LWRA 4JFFD 2EIEA 2MTPA 1DQTA 3CDGA 2ZOKA 3EFDL 4XNMA 3QIBA 5ETUB 5GJTH 1MAJA 1T89C 4Z5RA 1EEUA 1NMCC 3BDBA 2XWTB 1FSKB 2ZCKH 3B6SA 3EYUH 3RAJH 4PLNC 3CDYA 4ERSL 3DNKA 2BSSA 4MX7A 4TNVF 3PP4H 1SBSH 1I8IB 2KKQA 4ETQB 5JW5B 3OWEA 1PG7H 5DJZA 4QRTB 2MQ0A 5ESQB 5ILTL 3E3QE 4D94A 1T2JA 2FEEI 4XP6H 1X5FA 1JNNL 1AGEA 5TE6H 4H88H 3GNML 4ALAH 4NZUH 1RIUH 5I8KL 1IRAY 1P2CB 3L7FB 4PLKC 4B50A 1AD0B 4JY4A 1AC0A 5DJ6B 1RURL 4OQTA 4YX2H 1ZWIA 2OCFD 3QUXB 4R97B 5EUOF 4PBVC 1G7LB 5HGHB 4P2RB 1TTFA 3BKML 1C7TA 2XIDA 3DWTA 3RVVC 4F57H 4NYLA 5I1JH 3GMRB 5CILL 2R0WH 4I8DA 1AR1C 4YHYB 5KW9L 1A0QH 3V7AE 3OQ3B 4POZD 5DA4A 3ESVF 4HXBL 5HI4C 1KB5B 4W70A 5I1CL 4NSKA 4LSSL 5DHVA 1F6FB 2ZCHL 3LN4B 5E8NB 4KUZH 1CL7L 2H8PB 4N0YH 3HC3L 1CZ8L 2PYFA 1HOCB 4UT6H 4RA0C 2NPLX 2ZSWA 1OAUL 4HPYH 5D70H 2EE9A 1GOFA 3FT3A 3MRDA 3P4MB 5TFSL 2YR3A 4D0CB 1WISA 1BQUA 1RUQH 3DBXA 4FG6C 5IEKA 3OKDB 4IOIA 2GJJA 5KVDH 3SJVD 3VD9A 1INEH 3FRUB 5TDPA 2HG5A 3QDGE 4NPYA 1ROWA 3O4OB 3CFCH 1ZLWK 5DMIH 2RFXA 1J0JA 2CUIA 5FYKE 3TWCH 5FEBA 3R0NA 4HCRH 32C2A 4BQCA 1J11A 2ED9A 4JR9L 5C0JB 3RWIA 5BMFH 5T1DL 1V5JA 4XP1H 3TYFB 4MXVF 1XFPA 1UWEL 1BPVA 4HPOH 1MCNA 3SEPA 1A1MA 1HXYA 3BGAA 1KLGA 4G7YL 1OGAE 1LNUA 4N0RA 2ATKA 1XR9A 2R56L 3LZFH 2ARJQ 2BNRE 3MMEB 4LLVB 1B0RB 1FG2B 4I3SH 2R9HD 1HH6A 1UADC 1EO8H 2DQUL 2OLDA 4ZOAA 3ZE1E 4HS3A 5CWSB 1Z2KA 3P0VL 4EEEA 3LEYH 3C60D 1KC5H 5FECA 3EYSL 3U4BH 1P5UA 2P5WB 5CZXC 3U9PL 4NRYB 3AREA 4P3WA 4LCWD 1LP9A 3VXOA 1FIGL 3BE1L 2NY4D 2Y7QB 1GGIH 4X6BA 8FABA 5E4EC 1X4YA 4QRUB 3MACH 4JM2C 4LVOC 1DSFL 4WW2C 1UM5L 1OHQA 1CQYA 2W0FB 2EIBA 3AUVA 1JHTA 3ILQC 3SOBL 4Z7NF 4K2UL 3UO1H 3QO0B 1CT8A 1V7ML 1LQSR 3O3AA 3KXFD 3S34L 5HPMB 4QRPA 4F7PA 4OV5B 3KYMB 3VXME 3O4LD 2FECI 2RQ8A 4HAGA 3CDFA 3VH8A 4CAGA 3DIFB 5BRZA 3T0ED 1K5NB 5FDWA 2I07A 5JDSA 3UTOA 5C9JB 5DMGC 5FHAL 3GB7A 3MCLL 5DI8A 3KPLA 3ZL4L 5HHQB 1YEDB 4FQXB 4M7ZB 1RIVH 2DKMA 2E7HA 1M71B 5LBSL 4Z0XB 4EN3A 4ZFOL 1KTRL 4OCXH 4DZ8A 5JW4Q 1A6AA 5FYJH 1CK0H 3QUKA 4KMTH 5DJAB 3MRBB 5GRUH 5ACZA 2DQDH 3KWWB 1OT2A 5DFVD 3KG5A 4OLEA 5D1QD 3RPIB 3GGWA 3LN5A 1W0WA 3S4SA 3QCUL 4QHNA 2Z8RA 2F19H 1M7DB 3PIQB 1ZGLP 1WZ1H 5EU4B 1K8DA 1BQSA 4Z76B 1B4RA 5BVJB 4HWBL 1TZHB 4Q9QL 1JJUA 1ZLVK 4U1SB 5JUEH 2DQJH 2PO6C 5E2TL 4XNZC 3SDAC 3X11A 3I9GL 1C8PA 3DOSA 1D6VL 3RWEB 1S7UB 3E2HC 5CSZB 5IW1B 3SCMC 4X6CA 2BCKA 1ZT4A 1MSPA 5TDNB 4Q9CA 1N6QH 1AQKL 4XMKH 5LAXB 1LK2A 4XCNB 3IFNL 2CO6B 1A21A 4XZUB 1BAFH 1QFWH 4PLKD 1FQ9C 4OCNC 4JO4L 5C0EA 4M1GL 4XBGB 1KEML 4PLJC 4KUCF 4M6MH 4NO2A 2EDOA 3MUHL 5FUOL 1OP3H 4NP4L 4WU7B 4HGWA 1AR1D 4XCCL 4HIXL 2EE3A 4YHML 1A1NB 5HI4D 4MCZA 2IANE 4DOHE 1GIGH 3HZVA 4PRBA 1CLYL 3FTGA 4NHUA 3I6GA 3ZYOA 3LY6A 4GRWH 1CICB 3E6FB 1OAZH 3B43A 1KGCD 3IU3A 1CLZH 2GQHA 3L3GB 4X98B 1Y6KR 3GSUA 1YPZB 2AQ1A 1NCTA 4DFHA 1PY4A 3U7YL 5TF1L 1ORSB 1WT5A 2DQTL 4GW4B 4FG6D 1FLRL 1FYTB 3FJTA 3IJSA 4ONGL 2V17L 3KPSA 5C0CD 3VXSE 3P73B 2CUMA 5D6CB 4K23H 4JQVA 2BNQA 4QF1A 3MLZH 4EBQH 4F7EB 4NO3A 4P2QE 2AJ3B 3N9GL 3P0YH 1MCPL 1MCOH 1H3GA 4PJCB 4F8QA 1BBJB 4R4FH 4ZDHA 4UB0L 1KIUA 3HE7A 5AWNH 4L1DA 4YWGL 4M43H 3VWJD 5ESAA 5FK9B 5MP6L 5KSAC 1DE4A 3RU8H 1ZGLA 1S7VB 4KJPD 2BHZA 3VXUA 3TESA 4L4TB 1EFXD 4WVRA 3ORJA 3MXWL 5ENWB 4CN4A 2XA8H 5I74B 4UIKL 3FAXA 4JO2L 1EA9C 1PYWA 1F3JA 3VI4F 4J8RB 4JRXD 4Y0GA 3EJYC 4DN4H 1NBVL 4PJHB 5CGTA 5MEOA 5JO5A 4I1NB 1GGBL 2C9AA 5FYKL 5C0BB 3RWDA 4FTVA 4ELMF 1CU4L 5EZLA 4JM2D 4GBXA 5EOTB 1LEIB 1YUHB 2OL3B 4BZ2L 4WI4A 3UBXA 3ILQD 5BXFB 4WU5A 3CVIH 4NWTL 1KNOA 3WHXA 2QSQA 5FYKU 1XF2B 3HAEG 3QNYB 3QG7L 2F15A 1EGJH 3JVGC 4XAKD 1QR1A 3L1OL 1QD0A 4BSWA 2JB6A 3VRLF 4S1QL 1M7XA 5GGSA 1BBDL 5GIRB 3OX8A 2B20A 5DMGD 5DTFB 1CYGA 3TNNA 4TULH 3FB6A 1BEYL 4AEFA 3RGVB 3ZTJH 4TPRL 4EVNB 4S2SB 3EOAB 3ROOA 3F65A 2X70B 1VFBB 1G7IA 1WWWX 3K0WA 1VEMA 4A6YB 1FVDB 1XGQA 4CN1A 4JFEA 2ZUQB 3MRMB 1JGVL 2ZUSA 1FL5B 2BMKB 5E8PA 1RAMA 2W1NA 5MHSE 4JFZH 1KTKE 4NUJB 2ICES 2DRUA 2VLRB 3MGTA 5HGAB 3HNVL 1EH9A 1IAIH 1HQRB 3TIDB 3F6IA 1NGYB 1YMHB 2X9WA 5C0RH 2FATL 4X9GA 1PKQE 4WIQA 2ZUTA 5JIIA 4NQEA 4H26B 4MVBC 2PO6D 4I9WD 5EOQH 3H6JA 1T83A 1TENA 3BN3B 3DROA 4G8IB 1ZVSA 1ZLUK 4G9DB 5C0IB 3VWKC 3QZWB 1R3LA 4IRJC 4UZGA 2Y1VA 5JPNA 4PJAA 5L2JB 3SKJL 4H5SB 2F53E 1E4WH 4WFGD 5KOMC 2YUXA 2VDML 4CL7A 3LOWA 2IMMA 2DJUA 2UYLA 2HJKA 2CXGA 4FN0A 4WENB 2EDXA 4P5KB 2OZ4H 4PREA 1B9ZA 4CGTA 3SGDH 2KPNA 2YPKB 2HKFL 1UB5A 4S1DC 4XPTH 4FOMA 1EEYA 3MLVH 4IRSB 3RUGB 2AXGB 3ECBB 1J1PH 1NEZB 2NY3C 2DLGA 3QPXH 3HE6A 5HHXL 4MSWA 4TSBL 4QTHA 2KBGA 1RUML 4F37K 4NQXA 3QDJD 2WUCH 2ZKHH 2DM4A 1QFPA 3FOMA 3NCFB 2ICWI 1IT9L 1B0GB 1VACB 4YHZH 2Y6SD 3VD3A 4XVTL 4L8CA 4PGEB 1I8LC 3LQAL 3KYAA 4DN3L 1I8KB 3OB0H 4QHMA 1LD9A 2RIKA 1Q9LA 5DVOA 2ARJB 3D9AH 4LOUC 2DI9A 1MCWM 5C07A 5FKPA 5DJ0A 3W82A 2M2DA 4OF5A 1F2XK 4KK9D 2Y4SA 2AS5M 4KMLB 4NO0B 1D5XA 1QFWM 4ZNEA 1P84K 3UTSA 1JE6A 5LG1A 3QEGH 4HK0A 3MV7A 1XEDA 3F5WA 5BZDB 4FXGB 2CLZB 4H0IA 2NTFA 1W72A 5F89B 4OCWL 2SEBB 5J6GB 2LU7A 3HC0A 3AGVA 4LQ1A 2MCPH 4PRIA 4WUUD 3UZEA 1P7QA 3BW9A 4XP9L 4F37F 1HCVA 4GAGH 4ODVL 1U8PB 1NCBH 2OR8A 4OZGB 3TBWA 3UPRA 3DVGB 3MOAL 3LKPB 1QSEE 2BK8A 3FT4B 3C6LD 3T77A 1TQCB 5KSAD 4YAQA 4FXLA 3O6LH 1X4ZA 2PKDA 3OV6A 2X4QA 4HJJH 5EU3A 2VDOH 5H2BA 5EORH 1KCSL 4KHXH 5CEZE 4OB5H 4PP2A 4YIQA 2H3NA 2X44D 4L4JA 1RJLB 1R0AL 3EJYD 5JORA 5FYJD 4HV8B 3CJJA 4X8JB 5E9DB 1NC2D 5BO1L 5E2VL 1AO7E 1XF5B 2E6QA 2VDKL 1NCAH 5KS9A 5EULV 1PGRB 4U1JB 3H7BA 5DK0A 3KPRE 1MPAL 4FHBD 4MA8H 2X4SB 4J4PA 1IGCH 4DEPB 2KDGA 3MXVH 1M05A 3L3OA 3GDBA 5FGCB 3WFEH 1IM9A 1KLFA 4MNHB 2N56A 3OAUH 3PQYA 5KAQF 3SE3A 3RHWK 2MHAA 3C5SB 1OTUC 1RZ7L 4XVJH 2Y36L 4OLZL 3TO4A 5IFAH 3WXVH 2XV6B 4OZFA 3LIZH 1ADQL 2VZOA 2WP3T 2BY2A 3MRFB 2AQ3A 3VGAB 2LE9A 4HHAB 4M6NH 3EO1A 3IAQA 2WIIB 5ALCH 5HD8D 5GSVA 2R0KH 3RWCB 3OF6A 5CZVL 2RR3A 3RZCA 3MV9B 3EGSA 3O6FD 1NFKA 2ADIA 2DYPB 4J3XA 4UI2A 3U4AA 2PYEE 5CP3H 2KZWA 3VXQB 2OR7A 3PWPB 5B3JF 4XWGH 1ZE3C 1XGYH 2H2PC 2QADD 3MOBL 1CFTA 1UQSA 5KVEH 4JM4L 3AB0B 5HJ3B 4AG4H 2DIJA 5JXEC 4NN5C 3D3VE 1Q9OB 4Y2DD 4EI6B 1YMME 4Y4FC 1N26A 2WWMD 3WKMH 4UDUB 2PR4H 3OKEA 5F88B 4QOKE 1JI1A 2VDNL 1WZMA 5D1ZD 5F9JB 5D7LB 3VWKD 1JP5A 2P4AB 2XKUA 2RAMA 1NGWA 1NLDL 3UTZB 1P53A 4LNRB 4YC2C 1CFNA 2APFA 5ISZE 3K7UA 3S97C 4A2LA 1FH5H 3CDGB 4G8GB 5DQDL 3RHWF 2ZOKB 3KHOA 3QIBB 5EZIL 1HNGA 4FNLL 1NSNH 3GMLB 4R7DA 4PTTA 3B6SB 4OAWA 5JMOC 2OJZL 4MX7B 2VLME 4C59B 4S1DD 3LN9A 2UY7A 4MZ2A 5HYJA 1MHCA 4LIQH 2NY3D 4NGHL 4Q7DA 5HHPA 2P8LA 3GSXB 4WFHE 2KZ1B 5GS0H 1I85A 3O3BB 2X40A 2MQCA 1QFUL 4NQUA 1ACZA 1IAIM 2YRZA 3W9DA 5TPWL 3V9FA 4UQ3A 4NHCH 2LU4A 4R2GB 4JY4B 2AW2A 5ADPH 5GPRA 1FYHB 2H45A 1DQQA 4F58H 5I30H 3UPAA 3O8XC 1RPQA 2JJVA 2QEJA 3ABZA 4NYLB 1MHEA 1KEGH 2PF6A 5J1SC 3X14A 1E27A 4DUXA 5E5UB 3V5DB 4XH2A 5CIPA 2IBGA 3NGBB 5DHVB 3SE4A 1NCUA 4NT6A 4LSPL 1S5HB 1SY6H 4X4YB 2EDEA 3IT8D 2PYFB 1DVFD 5I1GH 1CE1L 1RULH 1WVZA 1IL1B 1DQJA 1U3ZA 3MRDB 3W9EA 3QNZA 3LEVH 3DBXB 3NPSB 4YDLB 5IEKB 4IOIB 1VKXA 2YEZA 3FOLA 3LHPH 4F80A 4Y16A 1NH6A 2ZUXA 5TDPB 2HG5B 5TE7H 4CMMA 2HVJB 5IB3B 2CSPA 2RFXB 4YDJB 3QXDA 1DBKL 3ARGD 3DX6A 3SQBA 1NCCL 1PAMA 1MAML 3RWIB 3DPBA 3HPLB 4NQCA 2EE2A 4NJ9L 1MJ8H 1MFBH 2OP4H 2X10A 2J8UF 2YKLH 4XCYA 4QRSB 3RL1A 4R4BB 3MREB 1A1MB 1HXYB 4GG6E 3VG0H 5K9KB 2ATKB 1XR9B 2FGWH 2EICA 2ZUVA 3HLAA 5F1SA 3O3UN 1YNLH 1V7NL 2D3VA 4R7NB 4F9PC 5FECB 3L3KA 4Y4HC 1TJGL 4I48A 4JFHE 2WBKA 5EO1A 1FO0H 4P46C 1CD0A 3LB6C 5H8DA 3AREB 4M5YL 5HBBA 4OGAC 1LP9B 2EH8L 1QRNB 4PJ5B 4U1HA 4X6BB 8FABB 4QWWC 4IDJH 2O61A 5CEZL 1S7SA 4PJGF 1FRGH 2GTZA 5CJOH 3HMXH 5IBUB 3TBVB 1E6OH 4WCYL 1JHTB 2APTA 5T3ZE 2OTPA 4L3EE 2ATPB 4UQ2A 4C54A 2G60L 3TV3H 1CT8B 1WBYA 2HRLA 2GKIA 4QRPB 3B8SA 3B9KC 4MA1C 3SDXE 4F7PB 3L5XL 3FO2A 3HI6H 4IDLA 3ILPA 3IFOA 4HT1H 2APWA 1FCGA 4JPVH 5BRZB 1KT2A 2O5YH 4OGXL 4QXTA 5DVMA 3RVWC 2I07B 4OKVB 5I73B 4WWKC 2VITB 5BOPA 5JDSB 3WEXB 3GB7B 3I2CH 5DI8B 3ZTJG 1FNHA 2AEPH 4KVCL 1IJ9A 1F90H 2AK4E 2NY7H 3EAKA 4NRXA 5IB1B 1MFEL 5GHWH 4KRNA 4WO4C 4EN3B 3H9SE 2HTKD 2C3HA 4DZ8B 1H8NA 1MRCH 3QUKB 5EWIL 3WBDA 2F58L 4N0CC 4TRPL 5ANMB 5ACZB 1WFUA 1MCEA 3EHBC 1TZIA 3QIWC 5I6XB 3SO3C 1PW3A 3GGWB 4Y19E 3S4SB 2X4RA 4QHNB 4YUEH 3MRRA 1NMAL 4RQQA 4ZTPL 4QXGH 3MUY1 2ZJSH 4WFFE 3HR6A 5E8EA 4NQTA 2HT3C 4CADA 3RIFF 5D2NC 2F54D 1EERB 1KB5H 4U6YB 3X11B 3GMNA 3OL2A 1MIMH 1CGTA 4MJIE 2R2CA 4WWID 4AJ0A 4N8CL 3OKYA 4JLRA 3EO9H 3U30B 3FQWA 1YC7A 3CZFA 4K3DH 3S96A 2BVQA 2NR6D 3PWVB 4FFZH 4N1CA 3CH1A 3T2PA 2OBGA 2WNGA 5GGSY 5CKGA 1DR9A 1LK2B 3DX8A 1MJ7H 4JFFA 5J3HD 5HGBA 3ULUC 1UXWA 4HLJA 2RCSL 4HKZA 5ICYA 3AY4A 2FHBA 1QSFB 4NN7B 3IFLL 5E6ZA 3RA7L 5C0EB 4JHBA 3DI3B 1N0XL 1N64H 2WSKA 3O8XD 1WSST 3RBGA 4PY8I 4OD3H 4XI5C 3KPQA 1QBLH 4BK5A 5IFJB 4AMKL 3I85A 5E0QA 1Q9WA 2ZPKL 3GJEA 3DSNA 4MCZB 3HZVB 4XCFH 4PRBB 1R5WA 2J5LB 4Y5YA 2VR5A 2D4DA 2VJXA 3FTGB 2JF1A 4KDVA 3I6GB 4WHCA 2DLFL 4ZPVA 2AERT 4LHJB 5CINH 1Z6JT 3B9VA 5I1EL 3QEQD 5IVZB 3QH3A 3RWFA 5I1IL 5K9QG 3IU3B 4LKXA 2FX9L 3IDYB 1NAKL 4P23C 3H3PH 5E2UH 1JRHH 1G6RL 1A7NH 3JWDL 2E6PA 3QUYD 2D7TL 4OCSL 3BKYL 3IJSB 5IGXH 5L2KE 4PBXA 4YXHL 2P49B 3KPSB 3MSPA 4CW1B 4NZTH 1L9NA 1LO4H 1H3PH 4Y88A 3VFSB 4OLXL 4O9HL 2M8XA 3BGMA 5F96H 5GGQH 1SYSA 4AK1A 1VFMA 4XPAH 2AXHA 4XVSH 3EYQD 3TBSA 3VFTB 1NLBL 5FM5M 4OI8A 2EDBA 4OTXH 2A9NH 1O0VA 1TVHB 2VDQL 4W6WB 2VH5H 1T7ZA 4HWNA 4YDKL 2GEEA 4E41E 1CGXA 1FSKC 1URLA 3HE7B 4BFEA 4G80B 2B5IB 3SJVA 1DE4B 3RI5F 1ZHBA 1ITCA 3HC4L 1KCRH 3NCJL 1AD9B 2P24A 4D8PA 3ARRA 2EH7L 3CD4A 1QA9A 1PYWB 5T1MA 3MRPB 2CR6A 4K7FA 9CGTA 1T0NB 4DKEH 2FJGA 5MEOB 4OGAD 5JO5B 1NMBH 5E94A 3D48R 3ZE1F 1TTGA 3T4AA 4GRLD 5F6HI 1MF2H 3A67L 1KJ2B 4PJEE 3MLXL 3QUXC 4R97C 3ZDXE 5EZLB 4GBXB 3RBSA 2X2YA 3KYNA 2HA1A 1XF3A 3OXRA 3UBXB 1ZV5A 4WU5B 4JO3H 1KNOB 2JCCE 1JNLL 3I3DA 4YHYC 3C60A 4RSVA 1FAIH 3QDME 1CXHA 1YY9D 4BSWB 4LCWA 2EYRA 1T0PB 1CL7I 3RWGB 3M8OL 4EDWL 1JGLH 3BAEL 3OX8B 3S7GA 3MLRH 2CGRL 5E95B 2DWEA 3TNNB 4MMZC 3ZDZE 4JZNA 2QQLH 1KJMA 1II4E 3FB6B 3K4AA 2HLFC 5GS0D 4E42B 3LKQA 4G9FE 1E6JL 3UC0H 1EAPA 2DDQL 4WO4D 3U46A 2ADJA 4NKMA 4PJBE 2BJMH 4ONOA 5E99L 1S78C 2P5EA 2X89A 5DURB 3N1PC 4JFEB 4LSUL 4N0CD 5CP7A 4NNYA 3KXFA 2WWKO 3BDXA 1M7IB 1L6XA 5HYSB 3O4LA 1H5BA 2YN5A 3PGCA 5MEPB 3MV8B 5T3ZL 4YPGA 1JYXA 4ZUWB 3T0EA 1FNSL 4M00A 3O4OC 5FM5O 1FPTL 4KPHL 4RMWA 1IGIL 3BEVA 3QQ4A 3CSGA 3NCMA 4JFDD 4N0UA 2VAJA 1XR8A 3QXUA 1CXKA 3VFPB 4NQEB 2DBLL 4ODSL 3WO3B 4KTDH 4PRPE 1ZVSB 2A74B 2OMBA 5I76A 3C5ZA 3VJ6B 4Q6YA 3BD5A 1HKFA 1JPSL 1X5AA 2NNAA 3O2WL 2VXUH 2Z4QB 3BH8B 3QXTA 4GAFB 4OCYL 3IAPA 4YR6A 4HFWA 5B39B 5JPNB 5DWUH 2OQJA 4HWBA 4WUKH 4TUKH 2AAVA 3WSQH 5DQJA 4FA8A 2A83A 3NIFE 1TMCB 4KQ4L 1ETZA 3D39D 1FZOA 1BZ7B 1UB5B 1YEFL 1HN1A 3UTTD 3ZE0E 1BJ1H 1T1XA 4MNGB 4PJ7A 4JZJC 5HYIA 3HE6B 4MSWB 2AABH 3BIAX 4KDTC 2JJSC 1UZ6E 3SGKA 3B2UD 4RNRA 4WI6A 3FOMB 3ROLA 1B6UA 5I8CB 4YFDB 5DUMH 2P8MA 4UAOB 3V4UL 2FJFA 4HWEL 4L8CB 1T5XA 2R0ZL 1DQLH 2C1PB 1T4KA 1T20A 4I18C 2BSED 2VC2H 4KJWD 4QHMB 1LD9B 1QSZA 5DC9B 2RJMA 1Q9LB 2K1MA 1G9MH 1U3YA 4G42A 2YMXH 2W9EL 2BNUB 4WEMB 5C07B 4O02H 5FKPB 5DJ0B 4M93B 1UGNA 1I9JH 2IJ0C 3HFMH 4ELKA 4MDJA 3U2SB 4KH2A 4U6HB 3TA3D 4HF5L 5MENE 4OBRA 3MRHB 3QJHB 2BVPA 3BPLB 4J2XA 1K6QH 1TPXB 2AVGA 3DTXA 3RY4A 3IVKA 1DDHB 4XCEA 1D5XB 2OM5A 2XG4A 5T5FL 4F2MA 1S7QA 3QNXA 2FX7L 1J0YA 3MV7B 3F5WB 5DZLA 4BFGA 3QAZC 1W72B 1RY7B 1IGTB 1FL3A 3HC0B 4PRHA 4DCQA 4M1CC 3BMVA 4QEGA 2YD7A 4PRIB 4R90L 4JG0H 3L3DA 1P7QB 3BW9B 4JQXC 1P6FA 4NKQB 5KVGH 3UPRB 5IM7A 3T77B 5C0CA 4YPJA 1J05B 3GK8L 1QLFB 1RMFL 1I1RA 3HAEA 3NFSH 1U8MB 1IILE 2AEQH 1FE8L 5EU3B 2XKSA 1WEJH 2IPTH 4X7TA 5HY9B 5JIKA 1T6VN 3MYZA 4PP2B 1GGCH 3ELAT 3STLA 4ZFFB 3UX9B 5JORB 5AZEH 3RWJA 4A6YH 5C0AD 4NQSA 3U0TB 3JTTA 4YE4L 1OLLA 4HJGA 2R4RL 1TTUA 3VWJA 4H8WL 3QUXD 4HWZB 4Z95L 2ZUUA 4CUCA 4P2RD 3O9WB 1F8TH 4YHLH 5DD6A 4U6XA 1EFXA 3H7BB 2FBJH 5DK0B 1WBXA 5LCVH 5CEYA 4BFBD 5TQ2H 1OAKH 1Z9SA 1CFVL 4RBPK 3DSFH 2YSSA 1M05B 4JRXA 2KQMA 3PQYB 1MFDH 1W8NA 3NCBB 2MHAB 1R3KB 5C1MB 2WUBL 5JMRA 3TO4B 1CICC 4OD2A 4OZFB 3VGFA 1MQKH 3KLHD 4RMUA 4JM2A 2IH1A 3EO1B 1UCBL 4L4VE 4K7PL 4ODBD 5L9DH 4GKZB 5C09E 2ORBL 3W5MA 1BIIB 3RY6A 3RIAF 3QUML 1NCWH 3MLYH 2VXSH 4Z7VE 3TNMB 3CK0L 2DLIA 4ZYKA 5E7BA 4ELMB 2ADIB 1NBYA 1NUGA 3ZSSA 1Q9KA 4K94H 4XPBH 1WBZA 2WBJD 4HQQL 3LPGA 1UJ3A 4GRWF 4RMVA 4PG9A 3K3QA 3KLAA 3GM8A 3T2NH 4QRRE 2CJUH 2DI8A 3DX9B 5MI0B 3TCLA 4FQLL 4ENED 2DQHH 1I1AD 4M9OA 4LDLB 4N0FA 4UNTA 4R0LC 3OKEB 4OLVL 2BOBA 3THML 3DETC 4WI5A 5DR5L 1YEKH 4HC1L 2BY1A 1LE5B 3QXVA 1WIUA 4QGTA 3FN0H 4WEBH 5IW6B 1CFNB 4RX4A 1RV6X 2UWEE 4M9PA 1BVKB 5LQBL 5GGTH 3MA9L 1DCLA 5I0ZA 3SDDB 4C83A 4R7DB 3AXLA 4PTTB 5HHVH 3OAZH 2EEDA 4JEGB 5FOBB 2P5WD 4F33A 1DL7H 3MUGB 2PO6A 4CU8A 1MHCB 3AC0A 5CBAA 1FNGA 4MNQE 1CS6A 3KJ6H 5C8JA 1F3RB 1MCQA 4PP1C 5HHPB 1J5OL 4C56E 5E8DH 4FFYL 3BPNB 1SEBA 4OZHE 5DJYB 1NAML 2D9QB 4UOW1 2GUOA 5IJKC 4KVNL 3W9DB 2Q86A 4Y4KC 4QXWA 4UQ3B 5ERWA 3MFGB 3T1WA 3P9MA 1DQQB 2R0LL 5C6PB 3OPZH 5KBNC 2X7LA 5GRXG 1HH9A 5IFHL 4L3CB 3CDCA 2EO1A 5I8OL 1OP5H 1OGTA 1E27B 4NQDA 1L7TH 4HG4J 4ODHL 1MRFH 1RZFL 1UWXH 1ZS8A 4XH2B 3GSQA 5CIPB 5A2FA 4ODWA 3QDJA 3MYJB 4HCRA 3RGVC 4FQXD 4MLSA 1S9VB 4G8FA 3TZVB 2AK1L 4IOFC 5FAAA 4E0RA 4K3HA 5K9JL 3V0VA 3IDGB 2ZUQC 1ZTXH 4NOFA 1P4LB 4MLIA 3C2AL 4EXPX 1G0XA 4X7SH 5GRJH 1KIRB 2AGJH 3DX7A 1DQJB 1A4KA 4HBCH 3BP4A 2VWEC 4OUUB 3GRWH 3PXHA 1V3JA 1N4XH 2R1WA 1CGVA 3FOLB 1OLZA 3GMPA 2VLKB 5C0ND 4MQXD 4CN6A 5KTEH 4CMMB 3ZMRA 1TCRB 1HINL 3WFDH 5FKAA 2J1KA 3H7LA 4M02A 4OZ4A 1IC1A 3OZ9H 2Y06H 4XNYH 4UBDC 3VFGH 4NQCB 4AEEA 1GC1H 3PHOA 4NC0B 3SDCB 5FFLA 3QA3B 4FQ1L 4K9EC 5E56A 3RL1B 1WV7T 1U95B 3WMSA 4WUUA 5F7KC 3TBTB 5CMAA 4NNPL 4UIMA 4A2MA 3MR9A 1UM4H 1OY3B 1XGTB 4IRZH 3T1FA 3S36H 2UUDH 3HLAB 4PJFA 3C6LA 5D71L 4IRSC 2B2XH 3S36X 4QHKJ 1BVZA 1I1CA 1IAOA 3DECA 4NM8H 1JGUL 1REIA 5HHMD 3WFBL 3L3KB 4D9RE 3C8HA 4CJ0A 5EO1B 2O5ZL 1MCIA 2QKIB 3PF2A 4P2QA 3VDCA 4G5ZL 4IMLA 3OAYH 4Y1AD 4U1HB 1IAKA 2R1XA 1GHFL 1NC2A 2O61B 3LH2L 3HUJE 1CICD 5DO2D 1KELH 1U58A 1N8ZA 2FEDC 3TO2A 4GKNB 1HZHH 2BVTA 3INUL 1WBYB 1JK8B 2W9DH 2Q8AL 1T7XA 3S98A 4XPGH 3FO2B 1FYTD 1VFUA 2UZIL 1UYWL 3ILPB 3Q48A 4Z7UA 2N7AA 1KT2B 1ZT7A 4QXTB 3UJIL 5BV7B 3R1GL 4HUWB 5EU6E 1TIUA 5INDA 2GK2A 2DM3A 1YNTA 2B0SH 4AENA 4KQ3L 1DEEA 2VUYA 4HW6A 4LLYB 2FLRT 1AXTH 3FN9A 1BP3B 3PUCA 2NQCA 2QSCL 3D18A 1MVUB 3VW3L 3ARFB 5D72L 3N85L 4XP5L 1OTSD 4KZEL 3F58L 3MRLA 4XT1C 3DETD 4JN2A 2JJTA 4OQTH 3VGGA 4IIQA 2FX8H 4KK6C 4D0DB 1TQCC 3O6FA 1J1OH 4GKOA 3MLUH 4Z7WA 3MRRB 2JTDA 1WWBX 3BVNA 1TJIL 1A7OH 1UZ8A 2I5YH 4RDQG 5F3BB 5EUKA 3WS6C 4OCRL 4BZ1H 3GMMA 5DRZB 1LDPL 4KMQA 1QACA 3HNSL 4Y2DA 3IJYB 3EOTH 4ONHB 1RVFL 4JLRB 4GSDH 1G1YA 4N90E 1P9MC 4BSJA 3UP1A 1Q72L 2XRAL 1C5BH 3OG4B 1JGEB 3F7QA 5D1ZA 3OB8A 3HRZA 3VWKA 4MYWB 4PP1D 2GJ6E 5C0BD 4PG2A 3FFDB 3DX8B 5D7KE 1MRDL 1CR9L 4KI5C 3K1KC 4O5LL 3VFOA 2FWOB 4HKZB 5ICYB 3TN0D 3BP5B 4DEPC 5M94B 1Q0YL 4JVUA 3GI8L 2ZCLH 3E6HA 1W0YT 2NYYD 4YHOH 4DGVH 3KPQB 5KVGL 2BY3A 5H37H 3JWOH 1H15B 5D2LE 1TNNA 3EZJB 3QYCA 3O11A 3GJEB 1DUYA 1R6VA 2GT9B 4S10A 1YN7B 4N8PA 2XQBL 1JNHA 2NX5B 5DVNA 1I7UA 4OT1H 1R5WB 3OGCA 3FFCE 3IU4L 4ODTH 4ZPVB 1A3QA 4LSDA 5ESVA 2DD8L 4UINL 1N2RA 1MOEA 2FJHA 3QH3B 5AZEL 1A1OB 2XY1A 1P7KA 1GVIA 3H42L 4LKXB 1HHHA 3CXHJ 2BSRA 4ZS6C 3T3ME 1D9KB 3AB0C 3PNWB 5K33A 4RFEB 3DXAE 1A7PL 5HDBE 1FBIL 3K46A 4JPKL 4X5WA 5IG7A 4DGYH 2XKNA 3BGMB 2W38A 1XGRA 2GFBA 2FNBA 4DAGL 1A9BA 4LAQH 3JBG7 1S8DA 1OTTD 2G9HB 2HT4C 4ONFH 1DVFA 2VXVL 3O2VL 1YEJL 4QHLA 3BMWA 3QIBC 3SE9H 5C08A 4XHQA 1MQKL 3MUJA 3QULA 4PB0L 4X9FA 3PDDA 43C9A 3TT1H 1QO3A 1EGJA 1ZHBB 3RWHA 3QEUA 4JANA 3DGCR 4HFUL 2P24B 3MLYL 1TVBB 4HIHA 3ARGA 5FM8A 5ICXA 1QA9B 2R39A 4XAWH 2DWDB 5J7CC 4J3OC 2EXYC 1DN2A 3MRCA 2FJGB 1JHLL 1R3JA 3NH7H 3TPUA 3AU1A 5E94B 4I0PB 2K7QA 4RISL 2OR9L 5KSVA 1JZ3A 4U0RB 3T4AB 5I2IA 1BQLH 1G9NH 1QNZL 4M4RA 1DJSA 2Y07L 5GRZA 3WJLA 1IZJA 2VDLH 2FEDD 3KYNB 4PJIE 3OXRB 1XF3B 2V5YA 3ZYZA 3SE8H 1YY8B 3PWNB 4ZSOA 2J8UB 3NGBC 2ZSVA 3QFJE 3IB4A 2C4FT 3QB7C 3QZWG 1JZ8A 4LCWB 2EYRB 3AS1A 3Q6FA 4S1RH 1F13A 3OKLA 3G5XB 4LPTA 4NO0D 12E8L 1EZVY 3NIGE 2DWEB 1MCBA 1KJMB 2F54E 4NN6B 1LO3H 1X5KA 3SDXF 5BS0B 1EAPB 5JQ6L 1YA5A 4XC1H 1ZEAL 5DD1L 2P5EB 1PEWA 3GIZL 5CP7B 4NNYB 3NPSC 4YDLC 5EBGA 4HEPG 1NEZG 2FD6H 1A3LL 5H94A 3V6FB 3DMMA 3O4LB 1JMZA 1H5BB 4YPGB 3UPCA 2J6EL 3T0EB 1WTGT 1PZUB 2CKBH 4N5ED 3RTQD 4D9LH 3BEVB 3QQ4B 4KROB 4U1GB 4ZFOB 1BFOB 4LGSB 1YYLL 3CLFH 4J1UA 4FQHA 4N0UB 5C0FA 1XR8B 4X6EA 3O0RL 2VAAA 1L0QA 2AJVH 3M07A 4FQQA 2XZAL 3D0VA 4ZOBA 2PETA 3OKMA 3Q6GH 4JN1L 5JOPD 2E7LC 5FYLH 2VYRE 4Z77A 5I76B 5HYQA 1A7QH 1D6EA 1VFOA 3C5ZB 1CLOH 3OJMB 1DBJH 5GJSH 1YJDC 4FFWD 4YR6B 5IF0A 4HFWB 1VFAB 4ZG1A 2AJXH 3JUYA 1IAMA 3NACH 3QCVH 1MNUL 5DQJB 4YFLF 2A83B 4KI5D 1HSBB 2MPAL 1ETZB 3WIHH 2J4WH 4FZ8L 4PR5A 4HBCL 3V6ZB 5SWZB 3AREC 2BDNL 2IQAB 1T1XB 2A77L 4PJ7B 1KJVA 4ZXBB 4KKLD 1U8IA 1UKSA 4WI7A 4P4RB 1T0MA 1N5YL 3X3FL 1EHXA 3L9RA 1TDQA 1PDKA 4RNRB 1NCDL 4BUGA 2FJFB 1DFBH 1T5XB 4R26H 2Y06L 1SBBA 2JELH 3E1F1 3H0TA 4FQIL 4JO1L 3RVXD 1MFNA 3OJ2C 4HJ0C 4XNUH 3HI5L 1HILB 4G42B 3O8XA 2DYPD 2VLJD 2E9JA 3PWPD 5DVKA 1FGVL 4MDJB 3QIUA 1KG0A 2BVPB 4MWFA 5HI3D 4EN3C 4ZS7H 2H2SC 5GS3A 1WICA 1HE7A 3UJJH 3IVKB 4XCEB 5HDQL 2OSLB 4F2MB 1S7QB 3QNXB 3GM0A 4RGOH 5D7LD 4D3CL 3GHEL 1G9NC 1KJ2H 3KYOB 1WCBA 2HT4D 3QEQA 1QSVA 5I6XC 4FS0A 2LVCA 2EDLA 4M5ZH 4PRHB 4DCQB 4G8GD 4KHTL 1ZHKA 1CD1A 4LEXL 5IOPA 3VFWB 4X9BA 3LPFA 3N1FC 3L3IA 3QUYA 2B8OT 5DRWB 2YWYA 4XP4H 5IM7B 4HMCA 1MCRA 1RZKH 2VXTL 5SWQA 5L88H 1KV3A 2ILLA 2F8VA 3GMOA 3HAEB 2DTML 1H3WM 5C70A 3U0PA 3BFOA 3TBYB 1VCAA 2IMNA 4X7TB 2X4NA 3TP4A 3RKPA 5GGUA 3STLB 1R5VA 3QQ3A 2GK0A 5I16A 2ADFH 3LS4L 3VXRE 1XH3A 3RWJB 4NQSB 5DD3H 3JTTB 5L8KB 1AGCA 2VZVA 1DQDL 3FQUA 3OKOA 4R2GD 3UYRL 3BGFB 2YC1A 3I75A 4NN7C 2Z93A 4JAMA 3FT2A 3LV3A 1J8HD 4KGLA 2GITA 4Z8FL 2Z9TA 2YN3A 5DD6B 1NQBA 1KENL 4U6XB 5CP3A 1WBXB 5CEYB 4G43A 4XMLH 5C0DA 4F9PA 1J1OL 3EUUA 3C08H 2VXQL 4KKBD 1J12A 4PJEF 4Y5XA 3KGRA 4JRXB 3CSBA 4NOBA 4XHJD 1MH5A 3ZDXF 5JLZA 2R69L 4WHDA 3IDXH 3DO3A 1SJHA 4LASH 3RP1A 43CAA 4GRLA 3MNVB 1KTLB 4OD2B 1HHGA 1YQVH 2YD6A 4L8SA 4LPUA 5JHDD 1CF8H 2FGZA 2IH1B 3IDYC 3PWUB 4CDHA 2ZNWA 2BNRB 1IEBA 1ZSDA 1T2XA 5EBWA 3HB3D 3QUZB 5FUZL 4JFPB 3L6FA 5DT1H 3S37L 1WT5C 5DUPL 1C5CL 3GSVA 3ZDZF 4MXQD 2X4UA 1B4JL 1UJTA 4TNWF 4ZUSA 1MWAL 3SKOA 4U1KA 3MBXH 4JQVC 5SX4I 3ULUE 4PJBF 1U8JA 1WBZB 5KANI 1UJ3B 4PG9B 5CCKL 5ID1A 3L7EA 3KLAB 1U8OA 3DARA 4U49A 2AJYL 3TCLB 4KZDH 3AAZA 1E4JA 2ESVE 3D69A 4N0FB 2M1KA 5FB8B 1CGYA 2BOBB 3I3BA 3MRIB 4PD4K 3HE7C 4B7IA 2B5IC 1CDIA 2ITDA 5A2JH 2MNUA 3ZT6A 2YD5A 1NL0L 3BN9C 2IGFL 4C83B 4JFDA 5CUSH 2IH3B 4WFED 2F5AL 1A7RL 1BFSA 5FHBL 4F33B 4M6OH 1D3CA 1NBZA 4TUJA 3ARED 1FNGB 3BHBA 2DQCH 4YHIA 5IHZB 2JIXA 1QRND 4LMQE 3OSKA 4PJ5D 4ZUVA 5C8JB 1PG7W 3NIFF 1MHPH 4CVZB 5CD5C 1SY6A 1HKLH 1SEBB 2EKSA 3JV0A 4GBXC 3QHFL 1X6NA 2PTVA 1F00I 5KSUA 5ITBL 5E7FA 1CD9B 4JRYD 3ZE0F 1OB1B 1RSFA 5D5MA 1WAAA 3F7YA 5C2UB 5EO0A 4UNUA 1DTUA 4FQ2H 2VZ3A 3P9MB 3D39A 3WL9B 4X8XA 3EOBA 5DEZA 3FQXA 3EDEA 4L8DB 1UZ6F 1EJOH 3SE9L 5H37G 2X09A 2NZ9D 2XZCH 3UTTA 1HH9B 5DJDA 4LQFH 1S9XB 1P4IL 4XBEH 5EU5A 1S9YA 2VL4A 5F9OL 2QQKH 5IHUL 4NQDB 2WK2A 2EC9U 2O26U 5L6YL 1ZS8B 5IQ9A 4DK6A 3GSQB 2WQRA 1A5FL 4ODWB 3QDJB 1JN6B 2HH0L 4HWUA 4G8FB 3D87B 4KKAC 4EN3D 2EC8A 3HPJA 2J2ZA 1A6ZB 1BGXH 1JPFB 1JWMB 2YK1L 3CVHH 2BVOA 4E0RB 2IALA 3ARYA 4I2XE 4K3JH 1C5DA 5C6TL 1U41A 3SDYH 4JKPH 3NIDE 4O58H 2W65A 3NZHL 5EFIA 3VGHA 2A9ML 1Z9LA 4OFVA 5FCUL 4ZPTA 4RCAA 3BP4B 1F4YL 2PXYD 3MBEB 4B5EA 5D7IA 5HYFA 2BFVL 3KPOA 2X4PA 3TA3A 3QPQD 3GMPB 5GGVH 1JNJA 1BJ1J 5I1HH 1FO0A 1F6AA 4MD0A 1RUAH 1T83C 4P2RE 4O2FB 3QHZL 2IANB 5IK3A 5EO9B 1SEQH 3IXTB 4DOHB 4O4YH 2CKNA 4OZ4B 3MZTA 3GI9H 1JF6A 3GUTA 3IETA 2YHGA 3WFZA 3MLTA 3PDOA 1D5BA 1JTOA 3HMXA 1B0WA 4WW2F 5ALBH 5J1TC 4WUUB 4UIMB 3SGJA 1IMHC 3MR9B 3BSZH 1T80A 1QSFD 4JCLA 3ZKMD 4HEME 4FFVD 2V7NB 3E8UH 4K8RC 1XAUA 3HE6C 4JRWA 4QTIH 2WAHA 2E6JA 3H9HA 3EZ8A 2DKSA 4YFLI 4QRTA 4UILL 4NBYB 4AM0B 5D9SB 4UOW0 5E08H 4P2QB 4UAOC 1V3MA 3BZEA 4IMLB 5C7XL 1LO2H 15C8L 1IAKB 1ACYL 5C0AA 2R1XB 1OAYL 1P2CA 2XN9D 1MLBA 3QQ9D 3ULSB 1N8ZB 2DBJA 4MS8C 1HIMH 3QUXA 2BXYA 1G7LA 3BRFA 5HGHA 4M3JA 3CFKA 3AMLA 5B8CB 4P9HC 3U36A 5E24E 4YEEA 1Y6MR 4Z7UB 3BPLC 1KB5A 1ZT7B 1TPXC 1JHKL 2YWZA 1B88A 1T2QH 5INDB 3WS3A 1AI1H 1EDQA 4TTDC 3LN4A 5E8NA 4AENB 5HVFB 1DEEB 2HKHL 4XPFH 2H8PA 3NCYP 4LGPB 2VN7A 2A6DB 3ZTNL 3D18B 4Z7VF 5KOVC 3ULVC 3V0AC 4JB9L 2G5RA 3MRLB 1P6AB 2YPVL 4J3WA 4OLUL 3P9WB 5I19H 5DMYA 1L7IH 4MCYB 3VFUB 4IIQB 3C5JA 3L5WA 2GI7A 3OKDA 4H0HB 4HXAH 3SO5A 4XXDA 2JELL 4Z7WB 1BOGB 1U6AH 2YXMA 4MA7L 3LKSA 1L4IA 1MI5D 3BVNB 3V4VL 4MQSB 3DV6B 3A6BL 2WBJA 2QADB 1UZ8B 1DLFL 1PZ5A 5EUKB 3BZDA 4JG1H 2DQIL 1JZ7A 3GMMB 4M7LH 2X4OA 5C0JA 2VZ1A 4Y2DB 1JZ2A 2LFGA 4XNQA 3ULUL 1I1AA 2UWEF 3TYFA 4YBQD 2HAZA 5D1ZB 3HRZB 1Z5LB 2EDFA 1KSRA 4GRWB 3HZMA 1JZ5A 4GMTH 4GBXD 3OGOE 1AJ7L 3CUPB 2FHFA 4L29A 2YD9A 2BC4A 5HHOD 5JW3H 3R06A 1EBAA 4J4PC 5FA4B 1IZKA 1WCQA 1EUUA 5TE4L 4OZHF 2P5WA 3T65B 1OM3H 4NRYA 5B38B 4G8EA 2OJEA 5D1XB 3SE3C 5DEFB 1E4XL 1MHHA 2Y7QA 4FRWA 4PRPA 1LO5A 3KYKH 3TO4C 5DFTA 1JPTH 1IBGL 4XB8A 4KDTA 1JNHB 4UV4L 3ZLQC 2V9RA 3OGCB 4L9DA 4HKBB 5T1LD 5DURD 5ESVB 5EBLA 1FGNH 1N2RB 2Y72A 2FJHB 1MIEH 3KR3L 4OV5A 1P7KB 3TF7C 1I9RH 3K2UL 4NQVA 2BSRB 3MV8D 3SQOH 5J89A 2APXA 35C8H 2VOTA 2B4CL 2IFFL 4G3YL 5JIPA 1N5AA 1YEHL 7FABH 1IM3A 4OV6F 2V5RA 4FQXA 5IVXE 3VI3E 4ZFGH 5MI0C 1QQDA 2IBZY 2EYSA 4X5WB 4WGVB 1JMXA 1XGRB 1Y0LB 2CDGA 2GFBB 1A9BB 4JFXA 1UH4A 1S8DB 2Q6WB 5DJAA 3MRBA 1EEQA 1CXEA 3V0WL 5IMOA 1OP3K 4QHLB 5GS1B 3SGEI 3RPIA 2NXZB 2R8SL 3NFNB 5C08B 1M7DA 3PIQA 4JDTL 3QULB 4G7VL 2DQEH 5BVJA 1OAXH 2DQFB 4D9QE 3DO7A 1JPGA 1QO3B 4LKCB 3C09B 5BVPL 4WRLA 3MCKB 4JREB 2QHRH 5ACMA 4HIHB 5LWYL 1YPZE 3ARGB 5ICXB 1I85C 4K3GA 3BPNC 1K85A 4FXKA 1Y6NR 2LAGB 5TDNA 1X5JA 1W2KT 2YPLA 4PJXF 5ADOH 4GT7A 3WD5H 2LTQB 2DLTA 5KSVB 5HYSG 3BWAA 4OI7A 2BRQA 1OARH 1K2DA 1L9MA 4LLMA 5MEQA 2FHCA 4MS8D 2VDPL 4HH9A 4NUGH 4YXKH 4ZSOB 4RGND 5F1OB 3UJTH 1JYNA 4DUWA 4JY5H 4WU7A 4HUKB 3S35H 1AQDA 1MEXL 5I15L 2ZSVB 3G08B 2I25N 3HUJF 3LKNB 3W0WE 1A1NA 1BFTA 3SE4C 1AE6H 3S35X 2EDYA 1MJJA 2V6HA 4Y1AA 5B39G 4L4TE 4KUCD 2YD3A 4MDIA 4HZLB 3EFDH 1YEGL 2DQCL 2EXWC 2IQ9L 4ERSH 4PRID 5C0BE 1FN4B 1ORSA 3BWUC 4Y16C 2EIZA 1L0YA 1FYTA 3DMMB 3P9LA 3AMKA 2E27L 5ILTH 5FV1L 4R96B 5IROA 5D6CA 1JNNH 4J1UB 3WLWD 5C0FB 3MLWL 3B5TA 3GNMH 5D7SL 4X6EB 5I8KH 1CGUA 3D0VB 3OKMB 3SDCC 1CDYA 1RURH 4PJCA 4U3HA 4L4VA 5EZJB 3BKMH 2GCYB 4NFBA 5IF0B 5CILH 5FK9A 3RKDC 1KIPA 5DHYA 1ZOXA 2W60B 4LARL 5KW9H 4HXBH 5F70A 3O9WD 3K1DA 4LSSH 3EJJX 2PYEB 2ZCHH 4PR5B 1JCKA 1KYOJ 3RVUC 5HVWA 1CL7H 1DBBL 1OWWA 4J8RA 4ZODA 1KJVB 3HC3H 4ZAKD 1CZ8H 1G7HA 4PJHA 3G9AB 2VLRE 1U8IB 4LRIC 4X6DA 1YMMB 2ZUWA 1OAUH 5T33L 5EIIA 4QOKB 1FP5A 3L9RB 5JHLL 3N1GC 3TO4D 2P7TA 5TFSH 4FQJL 5I8EA 1XZ0B 2EEBA 1G7JB 3O41A 4KU1A 1NEUA 4RA3A 3VDAA 5ISZB 5IJKA 3G6DL 1N59B 5FUCC 4ZTOL 5IEHA 3V6BR 1OPGL 3WN5A 3TN0A 1XF2A 5D2LF 1SQ2N 3QNYA 4XVUC 2DICA 5BV7C 3GKWL 1HHKB 3U48A 4JR9H 2BHYA 2FYYB 4N9GB 5T1DH 4P5TD 3QP3A 1UWEH 1KG0B 3D2UD 2XTJC 3QIUB 4GAJL 4MWFB 2XQYG 4HIJA 4APQB 3GFUA 3VD7A 3EOAA 3SKNB 2BRRL 2A0LC 4G7YH 3MOQA 3RUGE 1VFBA 2QHLA 2VZSA 2R56H 3WCYA 3X12B 3JV4A 5LJYH 4TSCL 4A6YA 2DQUH 2V2WA 3T3MF 4DW2L 1WCBB 3EDKA 3QEQB 3P0VH 4PFEA 2LAAA 1FL5A 2BMKA 3EYSH 4GLRI 2OK0L 1A6WL 5HDBF 3U9PH 4OZIA 5IOPB 1CD8A 3SDDD 4F7TA 1QVOB 1Z3GL 4YNYB 3TIDA 3PGDB 1NGYA 1FIGH 3BE1H 5TGBA 2XOTA 2NY5L 4H26A 3RRQA 5JIHA 3WFHA 5GZOC 2QV2A 4G8IA 3U0PB 1DSFH 4G9DA 1UM5H 5C0IA 3CFEA 4X5LA 1J1XL 3SOBH 3WE6A 2X4NB 2J88L 4K2UH 5GGUB 1V7MH 3QQ3B 2GK0B 5I16B 3S34H 1XH3B 3LMJL 4J12A 3OJVC 4AQOA 1NFDF 1XMWA 1DANT 3FQUB 1ORQB 3OKOB 4CVUA 5I17B 4PJ8D 3I75B 4JAMB 3FT2B 4P5KA 3LV3B 1DBAL 2V2TB 5FHAH 4NZJA 3MCLH 4Q0XL 2GITB 3WFCL 4ORGB 3ZL4H 1MCHA 5JXAL 5LBSH 4EXKA 5C0DB 1VGEL 4ZO8A 3IDIB 2HT2D 1YN6A 2JK5B 4Y5XB 3GSNL 3IGAA 3GBLA 5IB5B 1MH5B 5JLZB 2UZXB 3TZVD 4OF6A 4OQ1A 1SJHB 4OF3A 4PJIF 4Y5YC 2KH2B 3VCLA 3P11L 3RQ3A 43CAB 4GRLB 2C3WA 3QCUH 1HHGB 2E7CA 4HMDA 1VEPA 4L8SB 1YDPA 2XWBA 1I8KA 5AZ2L 4HWBH 4Q9QH 3U82B 4XBPB 1IEBB 1PEZA 1JL8A 1ZSDB 4PJXA 5EBWB 3X13B 3L6FB 5GGTA 1UM6L 1ULVA 5E2TH 1PSKL 3I9GH 3Q5YA 3C8KA 1D9KC 3NIGF 4POZC 5E9DE 4FQCL 1D6VH 3NFPA 3LSOB 2X4UB 1KULA 2VLKD 4ZUSB 1K8IB 3SKOB 4ORZC 2YA0A 1U8JB 1MFCL 3UAJD 5I66A 1AQKH 1OOAA 5EC1A 4MA3A 4YHKL 3B5HA 5ID1B 3IFNH 2HVKB 4IBLT 1I1YB 4NQCD 3AAZB 3JTSA 1DBML 3D69B 5F89A 3SDCD 5J6GA 4JO4H 1BD2D 3OXSA 4C4KT 4M1GH 4O2EA 1KEMH 2D2OA 4GAYA 5IMLB 3ZKXB 3OG6B 3SKMB 1U8PA 2ITDB 4OZGA 2EKJA 3VG9B 4M48L 1IC7L 2QQNL 5FUOH 4NP4H 1TXKA 2Q3ZA 3T2QA 4XCCH 4HIXH 1I7TA 4YHMH 4HZAA 4HK3J 3RTQA 2B1HL 1CGSH 4EOWL 4DFIA 2C1OA 4JHAL 1CLYH 3JUZA 3MV9E 2K3TA 5F7MC 1IKFL 3RJQB 4EUPA 1NBZB 4TUJB 1QRKA 2OL3L 3BHBB 3B8YA 1RJLA 4YHIB 3QISA 2JIXB 5GS2H 5LXGL 3PWPE 3H9SB 4U0RC 4DTGL 2I60L 1RJZB 2VB5A 5CJBA 1XF5A 2DQGL 3MJ9L 4HLZH 1QZ1A 4PGCA 3U7YH 5TF1H 2DQTH 4X4XA 4KDWA 1FLRH 1RZJC 4OIAA 4ONGH 2V17H 5EO0B 1B2WL 2B1AL 3C60C 4U1JA 1JF5A 1IFHL 3GRWA 5D7LE 3EOBB 1NGQL 2N7BA 3FQXB 2DM7A 4NBZB 4X9HA 4KGJA 3GBNL 1XCTB 4HH8A 5DJDB 3U6RA 3O2DL 4XVUD 4X7FC 5EU5B 1S9YB 2DQEL 2NY4C 3FONA 4M03A 3N9GH 4MJIB 1MCPH 4YJZL 1KBGL 4XX1E 5IQ9B 4NN6C 3CXHK 2VZTA 4R8WL 4UB0H 1AY1L 1Q1JL 3MRFA 3ZKQD 3MO1A 2BVOB 4YWGH 2IALB 1JFQL 3ARFD 4HHAA 5HDLA 5BJTA 4Z9KB 1CWVA 5MP6H 3HG1D 1A64A 1J9CT 1C5DB 5IIEA 1ITBB 2W65B 1H5BC 1OCWL 3MXWH 3NN8A 5EFIB 1S9WA 2Y5TB 2W0LA 5DK3A 2NXYD 3T0EC 4UIKH 4JO2H 2DYPA 2VLJA 2W59A 3VXQA 4KROC 3WYRA 3KPOB 3Q5OA 1NBVH 2X4PB 3TA3B 1GGBH 5FYKH 5HJ3A 1FO0B 1F6AB 3MRNA 1QP1A 1Q9OA 2QR0A 4TUOB 5EN2A 4K9EL 4ZQKB 5IK3B 1CU4H 5GZOD 3WNPA 3C5ZC 2BX5A 2ERJB 4JDZA 4OD1L 4M7JL 4BZ2H 3GUTB 2J8HA 5DFVC 4CDGC 4AH2B 1E0OB 3IETB 4NWTH 3T0VA 3FMGL 3HKFA 1U3HD 3PDOB 1D5BB 2VN4A 4PGDA 1J0IA 5C92A 2DL2A 3QG7H 4QCIB 4G8GA 1BQHA 3L1OH 4HUUA 3TGXA 3BD4A 3V2AR 3GMLA 4S1QH 3VMPA 1BBDH 4K3EL 2P45B 2Y9RT 3T8XA 1BEYH 3GHBL 5L0QB 4ZXBC 2NY1B 4TPRH 4EIGB 3H9HB 2HMIC 3JZ7A 3SGKC 3GSXA 3O3BA 2C3VA 5KAQG 1JBJA 4YK4B 5AYUL 3BZEB 2NX5D 1QBML 4LP5A 5F1KC 5C0AB 1JGVH 5IBTL 4L8BA 1MLBB 3HNVH 1CFBA 4E41B 2ZZUT 3BKCL 1J8HA 2Y25A 3N50A 4N8VB 2FATH 1CBVL 4G6AD 3CFKB 1U8LB 4M7LT 3BP7A 3U36B 1NFDA 5JR1L 4NWUL 2Q1EA 3V5DA 1D9KD 4CKVX 1VESA 3WS3B 2YZ1A 1KN4L 1WQVT 1S5HA 3SKJH 3REWA 5C0GB 3AROA 4X4YA 2ICWJ 2VDMH 4WFEE 5FO7A 3MRKA 3QWQB 4MAUL 5JHDA 3U7WL 3QUMB 2Y23A 1LP9E 2VZUA 1IL1A 3FO9B 2HKFH 3ULUF 2V2XB 3EYFA 5F9WB 3C5JB 1BX2B 3BT2L 3L5WB 4DKFL 4L5FL 5HHXH 4TSBH 4LSTL 4XXDB 1RUMH 3LKSB 4DQOL 4NFDA 1RUPH 2Q7YA 2WBJB 2HVJA 5IB3A 1PZ5B 4YDJA 5EOCL 1IT9H 2EEAA 4QRPE 3ZHDA 4XVTH 1TJHL 2X4OB 3LQAH 3HPLA 3OJDB 4XNQB 4DN3H 1I1AB 5E1AA 5BRZE 4PJ9A 4BQ9A 4G9FB 2QQQA 4I0PD 2E7LA 4LCYA 1I8MA 4PJBB 4QRSA 4WI9A 4R4BA 3MREA 3BGFC 2P47B 3VWJC 3HZMB 5K9KA 5EC2A 2CUHA 4L29B 3BX7C 4KJPC 4OGZA 3RX8A 2BC4B 5JDJA 3R06B 1H3UA 4R7NA 4OLYL 1UC6A 1MFAL 4X7EC 3ARVA 4JKKA 4WI2A 4KI1A 3GBML 1CIDA 4G8EB 2OJEB 1PQZB 3WXWL 4NKDA 3CX2A 1QRNA 4F9LA 4PJ5A 1MHHB 4OCWH 4PRPB 1LO5B 3QWRA 1T22A 5D93B 5T3XL 5KSBE 1X44A 1AHWB 4XP9H 5BS0D 4ODVH 1Z0MA 1GZPA 3I6LE 3TBVA 3ZKND 3B5GA 4JRYA 3T0DA 1IC5L 1WIOA 3MOAH 3F7PC 2IG2L 4FMFA 2ATPA 4LPCA 2P5ED 4X6CE 2X89D 3RY6C 5EBLB 2Q8BL 1I75A 2A38A 2C3XA 2CMRL 4NQVB 5KVFL 2CK0L 3IS1X 4JFOB 4WV1A 1KCSH 4OKVA 2VITA 4NC1E 1YECH 3WEXA 1UJ3C 4KROD 1R0AH 1GGTA 1N5AB 3BPOB 2MOVA 5JA8B 1IM3B 4F7CB 2DL9A 2WMPA 5CLWA 2DAVA 5IB1A 3NIDF 1QQDB 5BO1H 5E2VH 2EYSB 1QKZL 2VDKH 2CDGB 3O6ML 4R4ND 4JFXB 3U0WL 4P4KD 5L7XL 3C5ZD 3ALWA 3PDGA 5ANMA 3CXDL 3HA0A 4L3AA 2EDQA 5IMOB 4PYGA 3CPLA 1MPAH 1FAKT 4GJTB 2UY6A 1I4FA 2PXYA 4HUVA 3BEWA 1GPOL 1INDL 3DO7B 1JPGB 1RZ7H 1GJIA 2Y36H 4HIIB 4U6YA 5SWZD 5MENB 4OLZH 4EI5D 1KCLA 1ADQH 2BXZA 1VDGA 4ZXBD 5CZKA 1A4JA 3FB8B 3K4DA 4IMKA 2HMID 4KTEL 4FXKB 3PWVA 3PWJB 4OGYL 1FFPB 4UMGA 5I75B 3CFIC 2YPLB 3KPSE 2Z8WC 4V1DE 5CZVH 1PFCA 3TJEL 3BWAB 3BZFB 1HXMA 2BNQE 3T4YB 2D0HA 1K2DB 4GO6B 4LLMB 5MEQB 2IEPA 1CLCA 1QSFA 3RVTC 3EYOA 5E4EB 3MOBH 2X41A 3WIIL 4P9ML 4X7DC 4HH9B 4JM4H 4IJ3B 2Z92B 3P2TA 2CKBA 4LVOB 5HHMB 3JSSA 2DS4A 2P44B 5IFJA 3G5ZB 1AQDB 2VDNH 2R2EB 5FF6A 2DM2A 3LQAC 1CGSL 3IF1B 1MJJB 1NLDH 4Y1AB 2Y6SC 3VXUE 5CBEA 2I9TA 5GS2D 3VXRA 5I0DA 4MDIB 4JQIL 5DQDH 2XN9A 1GGUA 5EZIH 4FNLH 5A1AA 5IVZA 1XGPB 5GZND 5JW4N 4PRHD 3V52L 3S88L 3MBEC 1F58L 4CVWA 1S3KL 2OJZH 1ZVHA 1ONQA 4KRPD 3WIHA 4KK9C 3HCVB 3LS5L 2IFGA 2QJDA 2EIZB 4NGHH 1Q38A 4FTVE 3QRFM 3P9LB 3VFRB 3QQNA 4CW1A 4PUBL 1OAQL 3W5NA 2N4IA 2EDHA 5EUOA 5IV2B 1W0VA 1QFUH 4R3SB 4X99A 3EKCA 1T7YA 3VFSA 3DYOA 1YJDL 3AS3A 4KKNA 5TPWH 4XPHL 3VFTA 5ITFA 4XMPL 4P2OA 3MFFA 1ZAGA 3V7MA 5DD0L 4UV7L 3VFVB 4X7CC 3OHXA 4I77L 4L4VB 1TVHA 4YQXL 2V5TA 5C09B 4G80A 1QFHA 3C6LC 1F2QA 1KIPB 5DHYB 1EO5A 4Z7VB 4S1SL 2NY0D 1MI5A 1AD9A 1T1WB 1PX3A 7CGTA 3O3DA 3KPTA 1UKTA 5CEXA 4HSQA 2Z8VC 3QDGD 3PV7A 1R3IL 4JFEE 4LSPH 2YUWA 4NM4L 3HN3A 3VFNB 2XZZA 1A6UL 2VSDA 5FYKD 2AJZA 3MRPA 1T0NA 1G7HB 4QRRB 2FDBP 3LAFA 1CE1H 1LVEA 1BJ8A 4HLZG 4X6DB 4Z7NE 5EIIB 4KTYA 5F7YC 5SV4A 1AXSB 3DRTA 4FP8L 2P7TB 1KJ2A 5I8EB 4NQEE 3O41B 4WJ5A 5JNYA 1S7TB 1OGAD 1QYGL 1FZKA 4OFYD 2BNRD 5HHOA 3QUZD 3V7AG 5IEHB 4DGIH 3WN5B 3TN0B 1O5DT 4LPVA 1Q0XL 4LHUA 2J3SA 1DBKH 1F4HA 4LPXA 4PJAE 1IGML 1NCCH 1MAMH 4M62L 1FC1A 3DURB 4PGZA 3RWGA 3NTCL 4NJ9H 4MNQB 4HIJB 4R6UA 1LK3L 2ICWA 4E42A 1UXSA 3BD3A 3PGFL 1OD7A 3ETBF 3JV4B 5HD8C 2LABA 4DVRL 2V2WB 1K4DB 2JJTC 5T1LA 1V7NH 4U2ZA 4IIQC 3FO1A 1IGJA 1M7IA 3O6FC 5HYSA 1LEKB 4RX4D 5IVXF 1TJGH 5MEPA 3VI3F 1P5VA 3MV8A 1ZGLM 3VXMD 3BQUD 4ZUWA 3EDJA 2CPCA 5A43C 4OZIB 2QADC 4M5YH 4F7TB 2EH8H 1X6LA 2P43B 2AI0L 1A14L 1I9IL 5TGBB 1I3RA 3VFPA 1ZHNB 3P77A 2D9CA 4Y2DC 5DMKA 5A16B 3WFHB 2WWMC 5CEZH 2A74A 5D7JA 1OSZA 5D1ZC 5C07E 5HGGS 3CFEB 4WCYH 3WE6B 2H32H 3VJ6A 5A2KH 4PG2C 3BH8A 3ZE2E 2Z4QA 5MERA 2G60H 1M6OA 3MA7A 5B39A 3QBTB 1KPVB 1A22B 4YHPA 5J0BA 3L5XH 1WTLA 4AQ1B 4YBLB 1PVHA 4ZNEE 4QRQA 4OGXH 1YPZF 3Q1SL 3UTSE 2W0KA 5FO8B 3MV7E 4I0CC 4CU6A 1BZ7A 4AIZB 3RVTD 4BELD 4KVCH 5EG6C 3ULVE 1E4XI 3GMQA 4MNGA 1MFEH 4YO0A 1SM3L 3CMOL 3G9VA 4NQDD 3QRGL 4RRPG 4TN9A 1YN6B 5EWIH 1LHZA 3IGAB 2F58H 4TRPH 4XNXH 1RUPL 3K8LA 3S5LG 5I8CA 6FABL 3VCLB 2GY7B 3IDMA 3RX7A 3NABL 3V6OA 1NMAH 4ZTPH 2C1PA 1YDPB 2XWBB 4TQEL 3PP3K 3ZSTA 5E2WL 4PJXB 2BNUA 3A6CL 5F1NA 3EO0A 2DI7A 3MBED 3C8KB 4N8CH 1PJ9A 4HKXA 3NFPB 3U2SA 4U6HA 4PY8J 4LSRL 3MRHA 3QJHA 1S7WA 3ZT5A 3T3PE 5KS9E 3P30L 1LDSA 3W2DL 2DMKA 5CGYD 5I66B 1DDHA 5EC1B 2IAND 3BDYL 2ZOLA 4MA3B 2Z31D 4LU5L 5GRWA 1DVFC 1BOYA 2ENYA 4KRMB 1MUJA 2RCSH 3JTSB 5KN5A 4B0MM 5IWLA 5DJCA 3HUJB 3AS2A 1IGTA 3CMGA 3PQYE 3IFLH 3RA7H 3GSWA 3OXSB 1N0XH 4O2EB 4GAYB 4UTBL 1KPUA 4LP4A 2VL5B 3C09C 4AMKH 1OVZA 2ZPKH 3Q3GA 1I7TB 1J05A 3PL6B 1WITA 4ZMAT 1QLFA 3RTQB 4CNIA 3VXSD 1U8MA 3ARGC 4I4WA 1RUKL 1FFNA 1IC4L 2VABA 1G0DA 2C7UB 1CDGA 5EU6B 4Z78B 1NGZA 1FFRA 2C1OB 3MJ8A 2AQ2A 5HY9A 1OQOA 2Z8SA 2DLFH 3BXNB 4EUPB 4JE4B 4PIRF 4UDTB 4P99A 1YECL 4AIXA 2XYCA 4Q58C 4Q9RL 4P2QD 1CG9B 4AEIL 3H9YA 4ZFFA 5I1EH 1OSPL 5E70A 4BH7A 1H3VA 5I1IH 3DJ9A 2XZQL 3CVHA 2FX9H 3U0TA 4KK8D 4PY7A 1NAKH 3P40A 1C08A 2VNCA 1G6RH 3JWDH 3WJLC 3V5HB 4PGCB 1RHFA 2D7TH 3AM8A 4HWZA 4OCSH 3P3YA 4X4XB 2VERN 4OJFL 3BKYH 4CMHB 4YXHH 3O9WA 4HD9A 1DN0B 4EZMA 2FH6A 3WDIA 5C2BH 4PB9L 4OLXH 4O9HH 3GIVA 3N1QC 1BLNA 5SX4H 3U6RB 4HK3N 1NLBH 2R2HA 3FONB 4ZAKA 4F3FB 4TVPE 1H8SA 3TIEB 1R3KA 3DVIA 2DLEA 2F5BL 4DVBA 2VDQH 4KXZH 4YDKH 3H3KA 5LGJA 3O3EA 4P2CG 3X3GL 3MO1B 4KAQL 4MZ3A 3DRQA 5F6HJ 5BJTB 5HYJE 3CX5J 3MGOA 4TOYL 4GKZA 3TJHC 5IIEB 3HC4H 2CRYA 3Q5TA 4KRLB 3V79C 3NCJH 4J3SA 1BIIA 4I3RL 3DMMC 3NN8B 1P7HL 1S9WB 1YEIL 3TNMA 4XWOD 2EH7H 3QCTL 1T5WA 4ELMA 3VD4A 1DEDA 2VLJB 1T7VA 3RUGF 5BW7A 3DYMA 4X4ZA 1I3GL 4P5TA 3BO8A 3TT3L 1JV5A 2YRPA 3D2UA 1OW0A 4MXWL 1YYML 5JW4R 3MRNB 4RGMC 1RIHL 2HTKC 3A67H 2QR0B 3DX9A 5EN2B 3MLXH 5TQ0L 4JDZB 5IBLC 1LE5A 2P1YA 1JNLH 1P69B 1OP5K 5BOZG 1X5GA 1XF1A 5IW6A 4PGDB 5ICZA 1GAFL 4K8RL 3B83A 1UWXK 1NKRA 1F45A 1MREL 1BQHB 1BVKA 4HUUB 1I7RA 4UUJA 3SDDA 5MHSD 3CLEL 3PWLA 3M8OH 4EDWH 3BAEH 2CGRH 5FOBA 4HIEB 3O81A 3MUGA 3T8XB 2CQVA 3VE0B 4J7RA 5D1XD 1E6JH 3U1SL 3FO0L 2DDQH 2NR6C 1RZGB 5E99H 2C3VB 3QXAA 4LSUH 5DJYA 5J3HC 5J12B 4QT5A 4UT7L 3D6GA 4JFQA 4PS4L 2WM0A 5T3ZH 2F53D 4HGMA 4L8BB 5F7EL 4LRNL 4P9HL 3BUYA 4PJ8A 1FNSH 3ARZA 1FPTH 4KPHH 3MRGA 1IGIH 1WLHA 4NQCE 1J8HB 2R1YA 4L3CA 4ODSH 2DBLH 1TQBB 1G6VK 1E28A 4GW1A 4JKLA 3V4PL 3BP7B 1NFDB 3QIUC 3TPKA 1J86A 1K9TA 1W72L 5CHNA 5DJ8B 4APQC 3MYJA 4LCIL 3ULVL 1JPSH 1S9VA 3O2WH 3OKNA 3B9EA 4GXVL 4OCYH 3PXJA 3TZVA 1AKJB 2UUDK 4GXUM 5DDHA 3FB7B 5DUBA 3REWB 2XTLA 3IDGA 4XTRD 3MODL 5KZCB 5FO7B 3MRKB 2C4XA 4XXCC 1P4LA 3JWDC 4KQ4H 5IUSA 5JHDB 2FL5B 1GOHA 3MCG1 4LBEB 1KIRA 5D4QA 1OP9A 2IAMD 2NXZD 1YNKL 2DOCA 1YEFH 4NN5B 4OIBA 4PJIB 4OUUA 1S5IL 3EYFB 3QUYC 5C08D 2YOCA 4U1NA 4Y4FB 2AP2A 5B38G 3OAYK 4RAVA 2XY2A 4NKIL 1N7ML 2VLKA 2VKWA 5FIEA 4DGIL 3QFJB 5EIVA 2Q7YB 1TCRA 5FUCE 4GH7B 3V4UH 3EYQC 3F12A 4Y7MA 1MQ8A 4HWEH 3KS0H 2R0ZH 1NBQA 5E1AB 4PJ9B 1EFQA 3U4EB 3SDCA 1PY9A 3QA3A 4LCYB 4JPWL 4OM0L 1KYOK 1BD2A 1I8MB 1U95A 2W9EH 3TBTA 1TZGL 5EA0L 1XGTA 2XTJE 5EC2B 4BZYA 1QEWB 2MKWA 4HF5H 5IMKA 5SWSE 2O5XH 4O2CB 1CDHA 4G6JL 5DS8A 1R3HB 5EH1A 1KJ3L 2BY0A 5T5FH 4Y5XC 2FSEB 5J06A 1HHJB 4OSUL 2QKIA 2FX7H 3RL2A 3ARDD 4NKDB 1P4BL 3UTPE 5CEZD 3RX5A 4GRLC 4LRIA 1T22B 2YD4A 3D1MC 3LD8B 1D5MB 2VSCA 2I27N 4FQPA 4WDIB 5J9PA 4L8SC 3HMWL 3RFZC 4Z18A 4R90H 4PJDF 5HDOA 1GZPB 1MCKA 1AO7D 4JRYB 4GKNA 5BQ7B 3BRDA 4FZEL 2HJLA 1JK8A 3GK8H 3TJHD 1RMFH 4LSVL 1FE8H 1KN2L 1YY9C 3DMMD 3KPRD 3ARXA 4JFFE 4WV1B 3AFLA 4HUWA 4PGJA 1FZJA 3IFPA 5GS0C 1F97A 4TTGA 4LLYA 1R5IB 3GJFH 1EAJA 4YE4H 3STZA 4Z6AT 3VU2A 3VRJA 1MVUA 2R4RH 3KHQA 4TVPL 3ARFA 3ZKSD 2JB5L 4H8WH 3H2WA 3HG1A 4GQ9L 4Z95H 3KDMA 4XNXL 4WW1A 4OIIL 2MCG1 1FNLA 3ZKXC 3T0XA 5IBLD 4U1IB 3VG9C 2J7LA 3CPLB 3T2OA 1VENA 4D0DA 2D03L 4RWYL 5DD5L 1CFVH 1TVDA 1I4FB 2H9GB 2W92A 4AT6B 2PXYB 4HUVB 4RZCB 1VADA 1S9KC 3BEWB 2HTLD 2BERA 2EDKA 2PYED 2G2RB 5F3BA 5IKCA 3W11D 2WUBH 5DRZA 4P5MA 3IJYA 5K9OA 4P59L 4ONHA 2XA3A 5E5RB 2AJUL 1QLEL 2DKUA 2GW5A 3D3VD 1A4JB 4V2BA 1YMMD 2L7UA 1JGEA 1UCBH 4K7PH 4AEHL 4NJAL 4QOKD 1A2YB 2Y5EA 2ORBH 3FFDA 4K7PX 1U3HA 5DEGA 1FJ1A 3QUMH 4LLAA 1KOAA 5HI5C 1A6VL 1IEAA 1EMTL 1F6LL 1KPRB 3CK0H 5ISZD 1HXMB 2C3GA 2D31A 2FWOA 4KKCC 5AAMA 3BP5A 2FRGP 3EYOB 3ARTA 4HQQH 1D5IL 5F97E 2DJ4A 2CKBB 2WANA 3GO1L 2OXHA 2VLMD 5SX5K 4FQLH 1H15A 3K80A 3B2UC 4M7KL 4OLVH 3QIUD 5FF6B 3THMH 1OWRM 1CDUA 5DR5H 3QWOA 3SJVE 4HC1H 1HK6A 2GT9A 1YN7A 4WFHD 4APQD 3O45B 2NX5A 3B9KB 4MA1B 5CBEB 2I9TB 1FDLL 3VXRB 2IF7A 1J8KA 1T6WA 2XN9B 5LQBH 2H26B 4KJWC 3SGEH 3MA9H 3MJGX 1A1OA 2L7JA 5KJRL 5IHLB 1ONQB 3TA3C 4FABL 1D9KA 5L8JB 2CD0A 2LV4A 3PNWA 1J5OH 3MZGB 4RFEA 4FFYH 5EUOB 4QXUL 4IS6B 1W0VB 3QIWB 5C2BL 4X99B 1LP9F 1NAMH 3SO3B 2BOCA 3BKJL 2ERJC 3SKUD 4KVNH 2G9HA 1C12B 5ITFB 2YUVA 3ME0A 4P2OB 3MFFB 5D8JL 4X80L 4LCWE 1WF5A 2R0LH 4J6RL 3OHXB 1D7FA 3SGJC 3PHQB 3R4DA 5IFHH 2XFXA 5I8OH 3O6KL 2BZDA 1ZK9A 4ODHH 1RZFH 1MI5B 2XG5A 3P4OA 5L0QC 2NY1C 1VSCA 3O3DB 4OFPA 1TVBA 2P5EE 5CEXB 2AK1H 1DLHB 3KXFE 1Z9MA 4NZRL 3R0MA 5K9JH 2DWDA 2AJZB 4YK4C 3O4LE 4UT9L 4G6ML 4ODXA 4X4MA 3T0EE 3C2AH 1EZVX 4I0PA 2ESVB 3GSOB 4P3CL 3DRTB 4N0UE 4OUOA 1ZANL 3RNQB 1XIWD 1ZT1B 2HRPL 4WJ5B 5JNYB 5BV7L 4NDMA 1FZKB 2D0GA 5CD3A 5HHOB 1YY8A 3M17A 3PWNA 2J8UA 1U93B 4TNVK 5KANG 4LHUB 1HINH 5KSBF 1ED3A 3WJJA 2VR4A 1V3LA 25C8L 5DGRA 3G5XA 1C1EL 1KCUL 3HZYA