2ICCA

Extracellular domain of crig
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
GRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-set and immunoglobulin domain-containing protein 4
publication title Structure of C3b in complex with CRIg gives insights into regulation of complement activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iccA00
4R2GC 5JDJA 2HVKB 4IS6B 2COQA 3G5XB 1KC5L 5CZKA 1MAML 2IANE 2KZWA 4HWBL 2Y5TB 4FZEL 4I3RL 1QKZH 2IH1B 2P7TA 5BJTB 2Z31C 1C5DA 2IPUG 2M26A 3WJLA 5HY9B 3MFFB 3NFNA 3GMPB 4OQTH 4GXUM 3SGDH 1BGXL 3TVMD 4LSSL 4ONGH 5JORA 3MRCA 4CVXA 1MEXH 3QA3A 1H5BB 2WIIA 2P46B 2WIMA 3WIHL 5I1KL 3TIEB 3ZHLA 5DMGD 2YEZB 4MNHA 3UTQA 4LPXA 3OKOA 1QZ1A 1T22A 2JB6A 4HT1L 2EEAA 5FECA 1K9TA 4B41A 4Y8AA 3QI9C 4TUOA 2Q6WA 2DJ4A 3SHSA 1OHQA 4LGRB 2B5IC 4Y19B 4HWBA 1OB1A 3GHEH 2R29L 1FVEA 2X09A 3PWLA 2YKLL 2I27N 2X9XA 3Q6FB 3NZ8A 1C08B 3V8OA 3UTSA 2DIAA 4JFED 3T0EC 3LN5B 2EYSB 3VWKA 5FO8B 3SJVB 3FT3B 4OI9A 1QLFB 4LKCB 5HGDA 2AXHA 3WIHA 2ED7A 3CDGA 4GW4B 3MROB 5GIRA 4JGJA 3RWGB 4PJBE 4YHZH 4HKZB 5JOFB 1UCTA 5KTEL 4LNRA 2FX9H 5F88B 4J23A 1QO3B 3MNZA 4UB0H 3UPRB 4JEGB 4EI5C 3TO4A 4BZYA 2ZKHH 3DROA 1MF2L 3ESVF 6FABH 3HCVB 3V0AC 1NCNA 1YY9D 5TFSH 3UZEA 2N4IA 3OB0K 1KFAH 2A1WL 4N0YH 1K85A 2GCYB 2WUCH 4RAUA 5DJZB 2EZ0C 3X13A 2QQKL 5DEGB 3DVNA 3QI9D 2AABL 5D2LF 3O4OB 3QIUD 3JXAA 3L3JA 1H3PH 2HYMA 5CP3A 3UJIL 3VFGL 1YC8A 1G9NH 2A73A 2V2TB 5SX4H 4ZAKB 5EBLA 1HI6B 3PDDA 4ODWA 1TPXC 1FDLL 4NDMA 3CXDH 2R4RH 4FABH 1X5LA 5DMYA 3DMMB 2APTA 3K80A 2C1PB 3TA3A 4HGKC 2D7QA 4HUWA 4G6FB 5LXGH 1KIQA 5HI5D 5EIIA 5HBBA 2QQLL 3AM8A 1FJ1A 4U1IB 3MGOA 4XTRD 4CW1A 1N5AA 4APQA 3PWNB 2FX8H 5IF0A 4EI5D 1MRDL 1OGAA 2JCCF 1TZIA 3GJEA 4R9HA 2XA3A 5F7FA 3OJMB 3TWCH 5I1AA 3C2SA 3KPRE 4XAKD 5T1LD 5KG9B 1A5FL 2ZOKB 1U9KA 1I8MA 3FQTA 5FUZH 4IOIB 2WWKT 4CDGC 2MPAH 1IM3B 3RX7A 4ELMB 3MODL 3NIGF 3EDEA 4HS8L 4FQHB 1ZOXA 2OXGA 1NAMH 5C6PB 2IWGA 1MJ8H 3VFOB 2NNAB 4S1DC 5CJOH 1WLHA 1MLCB 4WI6A 1UACL 5DR5L 5INCB 4PTTA 3IDYB 3HNVL 1KLGA 5CP7A 2H8PA 5E8NB 4YHIB 5H94A 4ERSH 4KK8D 3K2UL 1Z3GL 3KXFA 3VXQA 5A2LH 4PIRF 4TVSa 5EOTB 4JQVC 5HI4C 4YDJB 4AT6B 2GITB 4AZ8A 3ZYOA 1T0PB 3RGVD 2P5WA 1FAIL 2I9TA 1NGQH 5DDHA 2NY2D 1U8KA 3JV5A 2W07A 4YXLL 1JNNH 3KWWA 3NIDF 1IGFH 5A16A 9CGTA 1LEIB 3WFBL 2VR9A 4LRNH 5CINL 4HZLA 1P4IH 3K4ZA 3D85B 3NCFB 4U6YA 3VXRD 3FFCE 1PDKA 5DUML 1AGBA 3R1GH 4L3ED 5FCSH 3C6LD 2FJHA 3EFFB 4MMZC 3ZLQC 4W6XB 1R5VB 1N64H 3UYPA 1AJ7L 1PY4A 3QYCA 3F58H 5AWNL 4CAGA 3DV6B 4U1GC 1K8DA 3DO3A 2O93L 2I07A 4PG2A 4RGOH 1GZPB 2AK1H 4Y5VB 2VO5A 5GRWA 5K9OA 3CFKB 5MENE 5C08D 2AQ3A 4KRMB 4OF8A 4PGDB 1N7ML 3N06B 4ZO9A 1DN0B 4FOMA 5IK3A 3JTTB 4N1CA 1EXUB 5HVFB 4K2UL 1AGDB 1JGUH 4OT1L 3RTQC 3E3QE 2JK5A 4HK0A 5ANMB 5EO9A 4XP4H 3W5NA 4F7PB 5B39A 3GIZH 1G0YR 3BZDA 3M17A 1WZ1L 5INDB 5GRZA 1ZA3B 4OFYD 3EO9L 5D7JC 3U9UA 5MEOB 3NOIA 4MDJB 1E4XI 2EO1A 4P23A 2FBOJ 4ZDHA 3NGBC 4QRTB 1A3RH 2GK2A 5CEZL 2BC4B 2H6PA 3EYVB 1EMTH 3I9GH 4Z0BH 4DFHA 5DFTA 4QXTB 1I7RA 1Y6MR 3T3ME 2F53B 3QNZA 4FFWC 2ZG1A 1K5NB 3BP5B 1MJJA 4NYLA 3ES6A 1P7HL 4R7NA 2R1YB 1UM5L 3N9GH 1S9YA 1JPST 4K8RD 3BIBX 4PJEE 4LSVH 1KELH 4F3FB 1AXIB 4PRPA 3DPBA 3L5IA 4H5SB 4OZHA 3TIDB 4Z7QE 5D1ZD 4LLDB 3NFPA 4ZSOB 3TPUB 1A3LH 4Y4KD 1WAAF 3V0VA 3CMOH 1F5WA 4LEXH 4JG0L 4YDIH 2MQ3A 2A2QT 3T2NL 2EYRB 4UQ3B 4ZUTA 3MACH 2EDLA 4OKDA 3LQZB 3L3HA 5D7JD 4UV4H 4L8SA 5HGAB 1FAKT 4OZGA 2C3GA 1I4FB 4DEPB 3TO2B 1BJ8A 2NYYD 4X6FB 5HVWA 1G7QA 4KTEH 2AV1B 2OXHA 4L4TB 3H42H 3QO0A 3VRIB 4PP2B 1OAYL 1BBJA 3GGWA 2ZOLA 1FRGH 1MHCB 5JOEA 2W9EL 2V17L 5DHYB 4M7ZB 3SE8L 4RZCA 5E7FA 3UAJC 5C9JB 3HG1E 1ITBB 2Z35B 3V6OC 2I26N 4LLQA 4OSUH 3V0WL 4YXKH 3TPKA 4G7YL 5HDBE 4RISL 1HEZA 5EUOB 4G9FA 2XYCA 5T3ZH 3RJQB 3N85H 1T7WA 4MCYA 4H0GA 5BO1L 1KJ2L 3MNVA 3VXNB 2FHCA 4YHKH 4QEGA 1AC6A 3VW3L 1KTRL 1J1PH 2XQYG 3HZYA 1T0NA 2EDYA 5CCKL 5KVGH 2O5XH 4GS7C 4NRZB 3BUYA 4Z78B 2IGFH 2HH0L 2BVPB 1X5YA 4JN1L 5IQ7H 4NT6A 4OLVH 4OCXL 5JLZA 2MQ0A 3IU4H 1YPZE 1S9XA 1B2WH 4BQBA 1T6WA 2F19L 4N8VA 1QPXA 4G8FB 5D7IA 3RDTD 4BH7A 4X5WA 5F7WC 5C6TH 4F2MB 1RZKH 2VXQH 1MH5A 2J12B 4W4OC 1T7YA 1N3NA 1QFWL 3KPQA 3HE7A 3UZVB 4H20L 2OTWB 4WTZA 3B6SB 1R3JB 3GJFB 5D71H 5JXEC 4PJDF 4K3DL 4G6AD 1KJ2A 4TQEH 1WTLA 2G75A 2XA8H 4JFPA 1FNEB 4LCUA 3W39B 4O51A 3KAAA 5HGGS 3RI5F 5JIKA 5I74C 5E6IC 3TBYA 5FGCB 3D25A 1QFUL 3T3PE 1Y6NR 1TCMA 2Q76A 1H3GA 3VFUA 4OKVA 1K8IB 4NO2A 5E9DA 1DBJL 2OP4H 3IDJA 3LEYH 2CIIB 2PTTB 1M71A 2A6JA 2VC2H 3BH8B 1YEKH 4PJCA 1TNNA 1NUFA 4FQLL 4ZD3L 3U83A 3UPAA 5DI8A 4ZXBB 4JFZL 3X12A 1QKZL 3EO1B 2BCKA 3O9WA 4RMRA 4UTAH 1VKXA 4Y2DD 4P5MA 5ICXA 3FB5B 2G60H 4RAVB 1P2CB 3MQIA 4ONGL 1MEXL 4P2QB 2N7AA 4U1LA 3GSWA 2PO6D 3BP6A 1W72B 1JN6A 4OGAD 5C3LD 4Z6AT 3IFNL 5TPWH 4N8CH 3IFPA 4NKQB 5IROA 5D7LB 4HXBH 1JNLH 4XXCC 1MRFH 2IAND 3T0DA 4YO0B 4OGXL 3U2SB 4TULL 1MRCL 4GUPA 3CX5K 1JF1A 5HHOA 4WU5A 5E6ID 4G8EA 1NLBL 1H0DB 2AXGA 3RU8H 3ZT5A 5EB9A 3GHEL 5D4QA 5C09D 1CQYA 2ITDA 3LKNA 5HYJA 4NN6B 1A9BA 5E94B 1I85C 3U48A 3E1F1 1D5IL 4Y4HA 4HIXH 3KPLB 3VRJB 3OKDA 1BIIB 1QA9B 1DSFL 1K4DB 1UZ8A 4FQ2H 1QLEL 2HJFA 4L5FH 5CEYB 2VLJA 1JYXA 3QPXH 4LRIC 3WHE0 4MJIA 5I8CA 4UILH 2GJJA 4RWHA 5F70A 1U8NA 4N8VG 2A6KB 1CD1A 2D4DA 1S7TB 1Q9WA 3BO8B 2LE9A 2Z91A 3EYUL 3RY6C 5IJVB 2XXCB 4UB0L 2PXYB 4PB0L 5IGXL 1JGEA 4R0LA 4JKPH 3PXHA 3CJJA 4K3GA 4NNYB 1RURH 4WTZG 3HAEB 1JZ6A 3IAGC 2Z8VC 4HFWA 1QEWB 3LN4A 1MWAH 3QH3B 1UXSA 4OV5A 4HWZB 4V1DA 1KFAL 4N0YL 1DEEA 1VACB 1F4WL 3IGAB 4POUB 1I3GL 3DOSA 3BWAB 5F71A 2QHRL 5C0BE 2EDJA 4EUPB 1H3PL 3STLB 3EAKA 3K4AA 3FJTA 2CRIA 1G9NL 1N4XL 4G6KH 4HV8B 4M1DH 1ED3A 1HXMB 2R0ZH 2DN7A 4HMDA 1G6VK 4QHUB 1FFNB 4QRSB 2R4RL 4QHMA 3PGFL 3EUUA 2GW5A 4M8QA 4FABL 4M7LT 3NFSH 1NANH 1XR9A 3NH7H 3QEGH 5HPMB 1UT9A 4FN0A 2P8MA 3RBGA 5LXGL 4JPWH 4WU7A 5KSAB 4LVOC 4MLIA 3SDDC 3MXWH 3CDCA 3MRRB 4Y5XA 1UB6B 3MYJA 1I1YB 2DQFB 3WSQL 3IF1A 5D2LE 2FX8L 1IQDA 1IEBB 5JPNA 4NHUA 4M7KH 25C8L 1WZKA 2V7HB 2B2XH 2ADJB 3TWCL 3BDYL 4RA0C 4AENA 2CR6A 4ODBD 3DVIA 3U9PH 4KGJA 4QRQA 1V8HA 1E4JA 1G9MC 4GW1A 3HLAA 2MPAL 1H3WM 4HAGA 3N1QC 2XQBH 4NNXB 2XZQH 4CMMB 1N5YH 3PQYD 4XH2A 4GG6A 2IFFL 1NL0L 3MRKA 3VRJA 5KW9H 5CJOL 1DANT 4MB3A 4PJXF 1TTGA 3BHBB 4MWFA 1RU9H 5I8KH 4ONFL 4MDIA 3LKQB 5LGJA 4TRPH 2IQAB 4ERSL 4PRHB 2JCCE 3DX9B 3ZYJA 2NY0C 3ALXA 4F9PC 1S9KC 2RAMA 2YD4A 3H9SB 2OTPA 1YEIH 1ORSA 1G6RL 2FL5A 4QOKA 4NKIH 1HQRA 3WL9B 3NABL 4CNIA 4M61B 1NGPH 5L2KD 2EIEA 1D5XA 1G1YA 1LMKA 2DWDA 2YS4A 1ZEAH 2DQGH 2X7LB 4CU8A 3W2DH 3MCG1 4GMTH 4YJZL 4KMTH 3VH8B 5DC4B 4LRNL 4WWKA 4L9LB 5C0IB 1FORH 3QO1B 3R1GL 1XMWA 1K2DA 2UY6A 3IB4A 3NA4A 1DBKL 1XF4A 4UUJA 1CVSC 1PG7X 4EN3D 2ADGB 3V5KB 2AEIT 5EZIL 1XGRB 5DURB 1G6RA 5BVPL 2UVEA 1X5IA 4F9LC 5D6CB 1KCKA 3SE4A 3WNKA 4PGEA 4M7JH 4G43A 4ZOAA 4LBEB 3T1FB 3SGKA 2EKSA 5FUOH 2ESVA 4MQXC 5DMKB 2OI9C 3NIDE 3N50A 1MHPL 3MBXL 1BLNB 2GSIA 3QG6A 4JREC 5KN5B 3O4LB 2OM5A 3F7QA 1JGUL 3FRPA 4UIKH 3EGSA 1QFWI 4R3SA 5L88H 2F54B 3JV6A 1T89A 3R8BB 3GIZL 2HKHH 3TZVD 5HI3C 4JDVA 1PZ5B 3QNYA 4JJHA 5GGVH 5TE7H 3QJHA 3P3YA 2YPVL 2YMXH 4NSKB 1D3CA 3SDAD 5C0AD 2E27H 3QFDB 4WFGE 4RMWA 3RAJL 4TVPH 4ETQB 5MEND 3RP1A 4NPYB 1FNFA 3L7EB 4JR9H 1A3RL 3QQ3A 4X99B 2DQUH 3O3AB 3SQOH 5ACMA 3G6DH 2NR6C 4HH8A 2UUDK 1CFTA 4JY5H 4WW1B 4YZFF 4Z7UB 5CKGA 3QUYD 1MCNA 4NQUA 5GRJL 2KBGA 2N56A 3M45A 2IQ9L 4NBXB 3T8XB 3A6BH 2MCPH 2V7NB 1D9KC 2YA0A 2CLRA 4NKMB 3TT1L 2ATPB 1ZTXH 4ODSL 2VWEC 2YRPA 3SGDI 4MJ6B 4HS6A 2XPGA 4OM0H 4LAQL 4LLWB 4IBLT 1IAOA 3ARDB 3KYKH 3P0VH 4U31A 5HYSB 5ITFB 4OTXL 1BP3B 5GJTH 3D3VE 5TJWK 4LSPH 5IHUH 5TF1H 2PN5A 3QUXA 5K9KB 1QFHA 1I9EA 1WEJH 4LEXL 5HI3D 1TZHB 1XCQB 3HE6C 4QTHA 2C5DC 3SCMB 2CRMA 4K07A 1JGDB 5H8DA 3VI4E 4G8GE 1X5AA 2XZZA 2GI7A 5C07D 4FQXB 5HGHA 3V5DB 1DLHA 2CLVB 5GRUH 5D1QB 5EORL 1DQJB 4LARH 1JWMB 4IRSB 1MCHA 4XBGB 4FQ1H 1A6WH 2EYSA 2VLKA 2FBJH 4KTEL 1LP9B 3LAFA 4MXQC 5DC0A 4PJ9B 4LKCA 3L5HA 3H42L 4R4BB 4ZYKB 4POZD 3RPKA 2I60H 3VXSE 1JV5A 1L0QA 1ZHNA 4OQ1A 4NQDB 4GW4A 3N1GC 1HH6B 1FFPB 4Y89A 2XWTA 1J11A 4HKZA 2PKDA 5JOFA 5I0DA 5BZWB 4D94A 4WI3A 3UPRA 2K3TA 1YA5A 3ARFA 1FP5A 3C5SB 5I15H 2ED8A 3SPVB 3LRHA 4OBSA 2A6DA 3FRPG 4U1HB 5BOPA 1OT1A 4YXKL 2YR3A 1S7QA 1UWEL 4RGNB 2FHBA 1WC7A 3P9WB 3MMEA 2J1KA 1VGKA 2EIBA 2Y36H 2X41A 5IB3A 1IGTB 4XNZB 2GCYA 4GOSA 5DJZA 3KLAB 3HE6D 3GSUA 4OD1H 4YIQB 4YHKL 4Y4FB 3FQXA 2AERT 3GMRA 1J1PL 3M8OH 4L3CA 4M02A 3UBXG 1AHWC 3C8KA 2VUOA 5DQ9B 3G6JB 3KLDA 2QSQA 2P4AB 2NY7H 5IQ7L 3IRPX 5IBLC 3QP3A 4E5XA 1LE5A 3NA9H 4WUUB 3ZE2F 5DJ8A 1Z9SA 1KB9J 4HWEL 4XAWH 1SJVA 2ILLA 2FO1A 2BSTB 1SBSH 4XI5C 1JJUA 1EZVY 1JK8A 5EBGA 4I0KA 3RZCB 1C16B 4KJQC 2EE6A 3SDXF 1UA6H 4CADA 1ORQB 5D71L 4M8VA 4OCLC 4F37K 4JRXA 2BVOB 4TQEL 1S7VB 4HIJA 4GMSH 1YYLH 5JW4Q 2XA8L 5D1XC 3DIFB 3VGDA 1MSPA 4EIGB 1FG2A 1U6AL 3MLVL 5FHAH 3I50H 2W0FB 4ODTL 2XTJB 1N26A 5EBMB 4EQ2A 3QCUH 4HFUH 3LKPA 3MBEB 2L7JA 1RZFH 5DD6B 2D2OA 3V5HA 4YGVB 4R8WL 4NC1E 3PWPD 1ZS8A 4BZ1L 1IM3A 4K3EL 5JHDE 1CDIA 5AG8A 4ELMA 4U6XA 2GUOB 4AQ1B 2OR9L 3E2HB 1I1AC 4MSWA 4QXWA 2A83A 1IFHH 1JHTB 2HG5B 3EZ8A 1AD9A 1MLCA 4PJDE 4XBPB 4WIQA 4YHML 4UTAL 4UTBL 1GVIA 1WFOA 5EO0B 5CGMA 1Y18A 4PBVC 4KK6C 2HJKA 3UTOA 4S1SH 3IDUA 1TVBA 4XNMA 2X4NA 2CR3A 4YHIA 1DUYB 1NGYB 5DXWA 5DLML 4N68A 1I8LA 1GYAA 2FSEB 4DCQA 3MFGB 5IMKB 4HX1B 4AT6A 2GITA 4KJPC 2BMKA 4ZUSB 4XPFH 4UNTA 2J6EH 1S9WA 1GGTA 1FFQA 1JNLL 1MRFL 4NQSB 2X1QA 2MOVA 4XWGH 3D5OF 3P73B 3WEXB 5GGSB 3GMOB 2DJUA 3S36H 1EFXB 1FC1A 1XZ0A 4P5KA 4ZPTA 1LEIA 5LWYH 1NMAH 2OLDA 3PGCB 5I75B 2DQIH 3MREB 4KRPB 3QUZC 2Y07H 4F8QA 4I0PD 2PW2A 1OGAE 3R4DA 4OZFH 2FJGB 4PUBH 4KDVA 4HIXL 2ZSVB 1NAMB 5SV3A 5FK9B 1H15A 2W9DL 3VA6A 1R0AH 3DLQR 2ITCA 1I1AD 3FN0H 4FQ2L 4L5FL 4YK4B 4GSDH 3TN0C 1XCTB 1FGVL 1RJYA 5IVXA 3GMMA 5CLWA 4ETYA 3HZMB 4EDXB 4GKOA 2GSGB 4JHZA 3DSNA 1WT5C 3F7PC 4G9DB 4MAYD 3CIQA 3O2DH 4P5TA 3B9VA 3JTTA 3SY0A 3AS0A 1QSFD 2VDOH 3HN3A 5F7KC 2D0HA 3NPZB 3F12B 3IFLH 5ANMA 2IF7A 1Y6KR 3RVTC 3MUHL 5JDSB 1BVKA 4F33A 1MWAL 4Z18A 1RUKH 1T5WA 3SKUD 5GGTH 2WBJC 5L8JB 1PD6A 2D7TH 3GB7A 4UT6H 3MRPB 4KKCD 1LNUB 3MA7A 5IVNA 5MEOA 4Z77B 4MDJA 3LDBB 1L7TH 3TBSB 3BH9B 4QRTA 1QNZL 4KV5F 5HHPB 1XIWA 5A43C 1VEPA 4X7DC 5DHVA 4L8DB 3SOBH 5DMIH 1A47A 1RQ5A 2BNQB 4C59B 1T6VN 5ISZA 3CFBB 1MHEB 5LCVH 5T1KB 3UYRH 1YMHA 5HD8C 5H37G 1KT2A 3TN0D 4MQ7A 3TH4T 3O4OC 1AKJA 3NZHL 2LTQB 3P9MB 5C0BD 4F3FA 3HNTL 2YUWA 5KSBF 1OTSC 4JVWA 3DTXA 4ZAKC 4D3CH 3MJ6A 3FAWA 1S7RA 2NW2A 2YC1B 4DAGH 5FV2A 1HWGB 5IB2B 1YMMD 3BX7C 1LO3H 3DMMC 4GRLB 4HF5L 3O6FC 1AQDA 2DL9A 4RFOL 2WBJD 1LD9B 2EYRA 1KPUA 4S11A 3PP4H 4PV9B 2XZQL 1N5YL 4P46B 1FL5B 5CIPA 2W60A 3KPPB 4U6HA 5FCUH 3VI3F 5HGAA 1V7ML 4B7LA 5EIVA 3OGCA 4QY8B 1Q1JL 5KW9L 3QWOA 2Q8AH 2Y4SA 3D0LA 1U91B 1IZKA 5IJKC 1UWGH 3FCTB 3O8XA 2AV1A 5BRZA 3HC0A 1MCJA 1V5JA 1S78D 4NFCA 3S3JA 3L9RA 1BAFL 1GGBH 5GZOD 4IIQC 1YEIL 3TCLB 5KVMC 4NKIL 4HJGB 4JY6B 1YJDC 1QSED 5IHZB 1ZVHA 2X4RB 4YBLC 1R3KA 3RIAK 5E08H 3L1OH 4FQPA 3W2DL 1A6AB 4QGYA 1BREA 3ULUC 2XACC 3B8SA 3MCKA 4GMTL 5IEKB 3ZO0A 2IAMD 1OLLA 2LFGA 3B9KA 2D9QB 4M7LH 3ILPA 4OZHE 4FNLL 2AJ3A 2XKNA 1EVTC 4PJXE 5EO1B 2ADIB 1FORL 3O6FD 4Q2ZA 5IW1B 1NFDA 3FAXA 4G7VH 2R0LH 4M3JA 4BSVA 4OZIA 4JO4H 1U95A 1G7HA 1U3HA 4KK9D 4JZOA 1OF2A 4NZDA 2ARJB 5CEZE 1CGSH 3N1FC 4NRZA 2JB5L 2C7UA 5I0ZA 4WV1B 2HFGH 1FGNH 3REVB 2GEEA 2XG4A 3BRFA 3MX0A 1V7NL 1T04B 1WWCA 2VDKH 5AAMA 3HZVB 4PR5B 2QL1A 5LKNA 4OZGE 4GLRI 3UMTA 1BFOA 4FRWA 4K8RH 1MFCH 2CKBH 2EEDA 2EDKA 3UCRA 1Q9KA 4UIKL 5L88L 5HYIA 1DLFH 2DRUA 2AEPL 4EIZC 3OX8B 3B3IA 5TE7L 3JWDH 1EZVX 4Z0XA 4KAQL 2A0LD 4M48H 2YMXL 4QRPA 5FV1L 3WLBB 4Y5VC 1NJ9B 1GOHA 1JGVH 4KXZH 4IEFB 2R1WB 2CLZB 4JR9L 4P2OA 3SQOL 4HWUA 4M03A 4UMGA 2BVEA 4O00A 3WO4B 1MLBA 1A7PH 3TYGL 4G6MH 2B7DT 3B8YA 1NGXB 4M5ZL 3MR9B 2Z92A 4QF1A 3O6KH 4AEEA 4I3GA 3PWUA 3CGTA 4NO0B 4W6WB 3FN9A 2MCPL 3TNMB 1RI8A 2AJSL 3BD4A 1AXSB 5M7QA 4HKBA 5EOCJ 3UJTL 2VB5A 4GKZA 4IRJD 2CIKA 4PGBB 1C5CH 3WBDA 1ZVSB 1YN6B 1IQWH 3QBTB 2NY1C 3QIBD 2ERJB 4UDUB 4Y16D 3WMSA 4HIHA 5J3HC 4C56E 3P0VL 1VFBA 4FS0A 3WN5B 4H1LH 2XICA 3PHOA 4PREB 2MJWA 4JKLA 3V6FB 4TNWF 5GJTL 5I71C 1KPRB 4LSPL 3OGOE 4ODVH 5D7IE 3RNQB 3RQ3A 3DETD 3MO1B 4M6NL 5T1DH 3AY4A 1RIVL 1WEJL 3DI3B 3U2SA 4NNPL 3T65B 1S7XB 3P40A 1MCKA 1RIUH 4AIZA 4ZO6A 1T5XB 2B4CL 4DGVH 1I9IL 3KJ4B 3D39A 3QDJB 1P53A 5HXMA 3ULUF 4PRIA 4BQ9A 5I17A 7FABH 1CDGA 1OARL 4PJ7F 4WI2A 1J0IA 5ICZA 2O26U 1SJHB 3FQNA 3RWCA 4TOYH 4CUCA 5CJBA 3R0MA 2YRLA 2N1KA 5BV7B 1WBYA 4LARL 5IB5B 3G08B 1U8PB 3WJLC 12E8H 1BQLL 4FQ1L 4NFDA 3D3VD 3BAEH 5E9DE 5IT2L 1K4DA 2MHAA 1KJ3H 5D72H 2KH2B 1REIA 3VCLA 1IAIH 2I60L 2VDLL 4QRUB 5D96C 1IILE 1BJMA 1A2YA 3MCLL 4NOFA 5LGKA 1H3XA 5FAAA 4F57H 4RFEB 1E0OB 4GBXA 4I0CC 2WWKO 5CLTA 5L0QB 1OPGH 3BO8A 4K3JL 4NQCA 4G8GD 1R5WB 5F8RC 5F9AC 5M94B 2WQ8A 1ZT1A 5D2NA 4MAUH 5KS9A 5MERB 4TTDD 5I15L 4LIQE 5DYOB 3GI8H 4EVNB 4NNYA 1KNOB 5KANI 1F4YH 1WCBA 4PG9B 3TP4A 3GO1H 4X9GA 1GGCL 2EDOA 3LEXB 4CU6A 1JZ5A 3STZB 3ZT7A 2CQVA 4JLRB 4S2SA 5KVEH 1SJEA 4IHOB 3N1PC 2DM3A 2X89A 5SWZE 3C60B 1E6JH 3IGAA 4XNQB 3VXSD 1SEQL 2APVA 1ACZA 5CBAB 1JPSL 4OD1L 1IGIL 2W92A 4CU7A 3VWKC 2C4XA 4UZGA 4YWGL 1HNGA 4NQVA 4OLZH 5GJSH 1KCSH 3Q3GA 5ICZB 3S3SA 1BVLA 3HPJB 5HHOE 5DJAA 1FFNA 1CDHA 3DX6A 4BH8B 5TE6H 4I2XA 1UH2A 3I02B 5EC1A 2BSSB 1KENH 2AGJH 3TLRA 2HWZH 4GH7B 1SBSL 4H8WL 3TM6A 3G6AA 3WCYA 1U2CA 3CFEA 1U8JA 4PS4H 1CL7L 1NC2A 1VB9A 3MRRA 5K59F 1SY6H 4N9GA 4Z95L 1P5VA 2EDHA 4QCIA 2VLJE 1UVQB 2VNCA 1A02N 3SKOA 5ETUB 4OLUL 4XP1H 3IDXH 3PABB 4XCFH 3L3DA 1T66C 3QCUL 4X98B 3KPMA 2IBGA 4PRNA 5IFJA 2VITB 1KTDA 1DQLH 2ZCLH 4PRBB 4U05A 1YEGL 4OD3L 3QEHB 4JO3H 2H26B 3DSFH 5BS0B 2AI0L 3RPIA 1CGTA 2K7QA 3R06A 3UTSD 2DM2A 4D0CB 4ZFGH 1VESA 4LCWB 3VWKD 4NNXA 3W0WB 4CMMA 2XZAH 3VWJA 43C9B 1WWBX 3UP1A 3DRQA 5DTFB 3ZKMC 1B3JA 1KTKE 4G80B 3L95B 3CVHB 4PJHB 2LVCA 4M1GH 1QRNB 15C8H 4KRNA 3QDMB 4BK5A 3VDBA 1VGEL 4S1SL 3VXMB 4OAWB 3WLWC 5GXBB 4OIAA 4PRHA 4RBPK 3MJ9H 5EOCH 3FT4B 3TO4D 5DFVC 5C0EA 1T21A 5SWSA 4H26B 4AK1A 3BOVA 1WFTA 2AK4E 3CH1B 4M61A 1C12A 4B7IA 1OGTB 3QHFH 1E27B 5DGRA 4J3OC 2P5EB 3OJDA 1FCCA 5DO2C 4F7CB 2J3SA 5FM8A 3HAEG 4B53A 5E7BA 3OZ9L 1M7IB 3O41A 3KLSA 1FE8L 4HH9B 4X9BA 2HN7B 4U49A 3VH8A 2H9GA 1X6LA 2CDFB 1NLDH 4L9LA 5C0IA 2YSSB 2Y07L 3RUGB 1M1SA 3LHPL 1CLOH 3E8UH 2BXZA 1CXKA 1HHHA 4OIIL 5FDWA 3MRLB 4U33A 4TNVK 1ZLWH 5DS8B 1RJCA 3LIZH 3MV9E 4KUZH 3O81A 3C5ZB 3V5KA 1BQHA 3OHXA 1R0AL 1FO0B 3FN0L 3TA3D 4GSDL 1EIBA 4RQQA 5D6CA 3ZL4H 1FH5L 4UBDC 4G3YH 5BQ7B 4PB9H 4XCEB 4AMKH 3BZFA 4LBEA 4QYOB 3T1FA 4KZDH 3QIWB 4GG6E 4APQD 5DUPL 3OR7B 2WANA 4NN6C 3O2DL 1BD2B 5EUOF 5KN5A 1BEYL 1HH9A 1JP5A 1RUQL 1OGAD 4WFHE 5E8DH 1CBVL 2JJTC 4RMUA 3QAZB 4WW2B 4X4YB 4FXLA 3OAYH 4YNYA 2JELH 1L7IL 3KYNB 4ZNEA 1RUAH 5HHXH 3P4OA 2C3VA 2Q3AA 1WISA 2D7TL 3AROA 5H35B 1RK1A 2YPLE 3AAZA 3O6LH 1JPTH 3BQUB 4AEIL 3JTSA 4NPYA 1XGTB 2E9JA 4X99A 1PY9A 3O3AA 1S7UA 3WUWB 2KL6A 5DMIL 4QXUH 3BJLA 3AXLA 1KTLB 3BRGC 2YXMA 1WIPA 3ZYIA 1Q94A 3QXDB 1BBDH 2K7PA 5ELIA 1AD0A 2CD0A 2BHUA 4S1QH 1XGYL 3FFDA 3KXFD 5DVLA 4DZBB 5IWLA 2V7NA 5L2JA 1VHPA 4KY1L 1KN2L 1UWXK 5MEQA 5IB4B 5LAXA 1PKOA 3LVEA 2EDFA 5C71A 5J1AB 2P5WD 3V79C 1CS6A 1IGJA 2BK8A 3MV7E 3S35X 2O5ZH 4J4PC 4LLWA 3ARDA 1WZMA 5GSRB 3MUGA 3ZE0E 5GISL 2ESVE 3QB7C 4P23C 4KV5E 1J1OH 3C2AL 3PWVB 3VXTA 1MCCA 1JHLL 3NTCH 5L9DL 2DJSA 4NM8L 1G7LA 5D70L 5DZLA 3V4UL 5CJQL 2EYTB 3VH8G 4MX7B 5KSAC 1ZKAA 3C6SA 3CVIH 3PP4L 3RVWD 4M6MH 1A6UL 4GG8B 1YZZA 4YUEH 1OM3L 1TJIH 4FTVA 4R4FL 3H3KA 5ECJE 2HKFL 2Q8AL 4LPYA 4LPCA 5J6HB 4XBGA 3BSZH 1UWGL 5KSBE 4PJ5B 2A9ML 5FYJL 5C0DB 5CMAB 5IP4A 5D5MA 1BECA 3H9HB 3IJYB 4FQIH 4AG4H 5B4MD 3G5YA 1NMBH 3FQWA 1EVUA 2HTLC 2DI9A 5DVOA 4BELD 5FF6A 2OL3H 1XGPB 1N59A 4K71C 3Q1SH 3L1OL 1NBZB 4JVPA 3RVXC 5CILH 1KYOJ 5TF0A 1FNSH 3BPCA 4C58B 2VJXA 1KIRB 4J6RL 4L8SC 5B8CA 1JF5A 3ARBB 4Q0XH 4XCNA 1UZ6F 4JZJB 2FIRT 3V2AR 1FNAA 4JQXC 1SVCP 1VPOH 2EH7L 4FP8H 4JDTH 1BWWA 4JO4L 3S96A 2DBLH 1NCTA 2RHEA 5DWUH 4GW5A 5TDOB 1HILB 5I1GH 4O5LL 5C08A 4CVWA 2E6QA 2HFGL 1HHKB 1FGNL 4IRZL 4UU9A 4JO1L 4LCYB 4B0MM 2CDGA 4Y19E 5J06A 4P2RB 2Q7NA 3DRTA 3SGJA 1C5BL 2VDKL 4NQEB 1J0JA 5AD0B 1IGMH 4PRPD 1MCOH 3VDCA 4JZNA 1HKLH 4K8RL 3D2UA 3U0WH 1MFCL 4HLZH 4M1CD 3LKRA 1PLGH 3OKLB 2VLKE 3SJVE 1RHHA 1CL7I 3I6GA 4RGMB 5J12B 3MRFA 5IQ9B 2BVOA 4DKAA 5CEZD 4F7TA 4ISVB 3DIFA 4NKDB 5HYSG 1XT5A 3JWDL 4P4KC 5JR1H 5E56A 4M48L 2DQDH 3UTTB 5CKAA 3RVXD 2VE6B 5EN2A 5EBMA 4OLYH 2IEPA 5D9SA 2DMBA 3PL6A 1YC7A 4Z9KB 1AIFB 4M62H 1OTUD 5E8OA 4BSWA 5DD6A 2ZG2A 1JNJA 2FECL 1CU4H 2PTUA 3DI2B 5EBWB 1FZJB 2X1XR 4JFQA 1FFOA 4G6ML 3L3IB 2ADFH 3IETB 5EA0H 3O6KL 2DMCA 4Y88A 4PJFA 3NCYP 4PGCA 2YD9A 1JHTA 2HG5A 3MLRL 5E00B 1D7FA 1J8HA 5IW6A 1BPVA 2FX7H 5FYKE 4U0RC 1CFQA 3QZWB 3QRFM 2NZ9D 4U7KA 1DUYA 1C5CL 1OCWL 4EI6A 2AV7B 2CKNA 5LJYH 2P43B 3O45A 5IMKA 1PQZB 5K9QI 4TPRL 4ODVL 5T1DL 4G9FD 4GRMB 5I6XC 4KKLC 4PP1D 1QD0A 2DWEA 2FR4B 4WJ5B 4ZS6C 1YEEL 1PW3A 4I77H 3GMOA 5EZJB 5MHSE 2NXYD 5CZVL 2JIXA 1KN4L 1EFXA 2DQEH 4JRXE 1TVDA 4TOYL 1VSCA 2XWBA 1IKFL 2FJGA 1RUMH 4YBHA 3EHBD 2DDQH 12E8L 4ZUWA 3VJ6B 1GXEA 4JFEB 4KI5E 1I9RH 1W8OA 5H2BA 3R8QA 5FKAA 1IAIL 2BNUB 2ICWJ 3HE7D 5BW7A 3HZMA 4ELME 2CPCA 1OPGL 1BFVH 5ADOH 1RY7B 4OUOA 1NMCC 2GJ6A 5SWQB 1IEHA 3X14B 3GNMH 3GI8L 4YR6B 4UQ2A 3ULUE 1F4YL 2Y25A 3QQ4A 1A9EA 3FQRB 1YUHB 5IFHH 1XGUB 5FYLE 5C0CA 3KDMA 4XMPL 3QDAA 4PJ9C 4OM1L 2YN3A 4KKLD 5E9DD 3VGBA 2E7LA 1ZGLB 2P42B 1QBLH 4ZS6D 4P57A 1EEZB 4N5EC 4Z7VA 2BJML 3UTZB 3CSYA 3MTRA 3QI9B 4QHNB 3B5HA 4Z77A 1YEFH 4KZEL 4TSBH 3DURB 4OZFB 3JUZA 2B5IB 4PD4K 4ZUUA 4OLZL 5B22A 4RX4A 1KCSL 4X6EB 1RMFH 3ZT6A 3O9WD 1IM9D 2P8LB 4RGNC 5I1CL 5J11C 3L6FA 3CFBA 4M6OH 3T0EB 1HZHH 3HI5H 1KENL 1D5MB 3O2VL 2HWZL 4TUKL 1HN1A 1F11A 4HUMB 4ZOEA 3IAQA 1RZIB 1QBML 3QUKB 5E0QA 5EG6C 1MREH 1YNKH 3P9MA 4GKSB 4Q7DA 5A2JH 1TJGL 1S9VA 2NW3B 3MLWH 3U1SH 4NM4H 4BFGA 1L9NA 2V5SA 2VQTA 5ESAB 5EU7C 5FXCH 3IDXL 4EI5B 5I66B 5HHOD 1AO7A 2YC1A 3EYFB 4XCFL 5GSVA 4C4KT 1X9QA 4WY7L 5ILTH 5I2IB 3EJYC 3ARPA 1G7PA 4Z7UF 32C2A 5HYJD 8CGTA 5AZ2L 1P9MA 5DQJB 1JZ7A 3DSFL 1FYHB 3RZCC 1LD9A 4Y4HD 4N5ED 5ANME 4ZFGL 3ULVL 1H9VA 1ZLSL 1NDGA 1T03H 1XAUA 3UPCA 1KIPB 3WFHA 4G42B 4PLKC 2VLJD 2HT2C 2IMNA 1FYTA 2NXZD 5K59E 4P48A 2VYRE 3V4VL 5TGBA 15C8L 1TPXB 1RUPH 3KNBB 3DUUB 4EEEA 1A0QH 2FNBA 3MLYH 5F1SA 2BDNH 3MJ9L 1U8HA 1FPTL 3TNNB 5EOCL 5GGSY 5I8OH 1WK0A 2H32B 3V4PH 4ZOBA 5AEAA 4HKXB 1MNUH 1IKNA 3QDGA 1KPVB 1G9NC 1WBZB 2F53E 4HS3A 4JFDB 1MAJA 2H3NB 5LGHH 4XBEH 4JM2A 5F96L 5I16A 1GZQA 4V1DD 3HUJB 4JFOA 2VQ1A 4PLJC 3NCBB 1I7TB 2NY2B 4KHTL 2DLIA 5DEFB 3OBAA 2GT9B 4BA8A 4LQ1A 1JIBA 2ZSWA 4NO5B 5TE4H 3KHQA 1U8QB 4NN5B 4WWID 1NLDL 2EXWC 5A2KH 4RIRA 1LP9F 1MIMH 1F13A 3Q48A 3VXRB 1QOKA 5I19H 3ULSA 4HBCL 4ZSOE 4L29B 1KLFA 4L3EB 3C6LB 2ZUTA 2AK4D 4KUZL 3Q5OA 2BP3A 5FO7A 3D0VA 2ZCHL 4OLWH 2X05A 1NPUA 3O2WH 1XR8A 2YK1H 4PLKD 5EWIH 5M95B 5F9OH 5DA4A 1S8DA 1NBYA 4G3YL 5TQ0H 1EAPA 4PB9L 1S5HB 1N6VA 5DRWB 3H0TA 4D8PA 4PR5A 4QHLA 5C6WH 4KRPC 5CZXC 1I3RB 4AEHH 3GMNA 3NAAH 2OQJA 3TC9A 3MUZ1 1U93A 3TJHC 4E0RA 3WYRA 1DJSA 5ACLA 1A7RH 4ZPVA 4D0DA 2XIDA 1WWWX 4L4TE 5AYUH 3RWDB 5C86A 4DOHE 4OCNC 3OX8A 1RUAL 1HDMB 3DNKA 3G6JF 2OJEA 4LEOA 3WLBA 4NCC1 1NUDA 1O5DT 4I5BB 4OF5A 3B9EA 1JPTL 2R9HC 1J18A 2VAAB 4C57C 3GMLA 2EXWD 4KXZI 1T1WB 2EDTA 4N0CC 4NJ9L 3RNKA 3SE4C 2FECI 4QXUL 4LCCA 1NGXA 2HTKD 4JFHE 5EUOE 4ZFFA 2RFXB 2OTUB 1MCRA 4S1QL 3I2CH 3ZTJH 1F3DJ 1CR9L 1P4LB 2PYEA 2DLEA 4OZIE 2L0DA 4K7FA 4QOKD 3LMJL 1UKQA 4U1GB 3ZE1F 3NVQA 1AY1H 3PGDA 1MCWM 3MNWB 4FFVD 2VZVA 1UC6A 3AU1B 3BKMH 2HFEB 4YAQB 4RCAA 2CKBB 1ZHBB 1A7BA 4IOSD 2WZPD 1HHGA 4UDUA 5CD3B 1SJXA 5AUMB 2F5AL 3BD3A 3PDGA 4P59H 4G8IB 4HMCA 5D1ZB 1WVZA 4KTYA 1QSZA 4WWKD 3RTQB 3F5WB 1JE6A 4Y4KB 5CJXC 3EOBA 2YBRB 3NTCL 3D18A 3U0PB 4PJAB 2IALB 3T65A 1JZ4A 3ROLA 3KLHD 1CT8B 4E41A 3DYMA 1T5XA 4BUHA 2UZXB 1ZA6B 5DJYB 2R9HD 1JUFB 4M6ML 4MD5B 4HCRL 4YUEL 5D7JB 4OIBA 5KOVC 4EQ3A 2VLLB 2EDBA 3U46B 2A38A 4OF6A 4ZODA 4FXGA 5C7XH 2FDBP 5IM7A 3KPRA 3NGBB 4G6JH 4XPTH 5E1AB 5IR1A 1CLCA 1Q72L 5FGCE 1FBIL 3DWTA 3BSZL 3MUJA 5ICYA 2ESVD 4LF3A 1XF3B 1X5XA 4JO2L 3RVUC 3W9DA 4AG4L 4PYHA 4NRXA 1IAII 3MLTA 5FUCC 4L3AA 1H3VA 4XP9H 1L6ZA 3ISWA 4QHKI 4DGIL 2NY4C 1DBMH 5AYQA 1MFEL 4Z7OF 2VDPH 1CICA 1G7JB 1UJ3B 1Q0XH 2QQQA 5MEPA 3QWQB 5MERA 3BPLC 2LQRA 4H1LB 5JIHA 3QUML 1NAKH 2GFBB 3E0GA 3SQBA 4R6UA 4HCRA 1S7SB 2RIKA 1FN4B 1F4XH 1INEH 2PW1A 3LY6A 4EDWH 3HZKB 4P2QE 1XF5B 1IC7H 4Q0XL 1B4JH 3O3DB 5SX5H 4ZS7L 3TBTB 4FQCH 5A40E 1J88A 3RVVC 2RCSH 4KROC 5FKPA 2GHWB 3OXSB 5HGBA 5DWUL 1GGYA 2OJZH 5I1JH 4HG4J 2AXFB 3KJ6L 1IGYB 3MLXL 1Z6JT 3D39E 1VADB 4LQFL 3FFCA 3FQUA 1KB5H 3QUMA 3PIQB 3ARFC 1QLRA 1GRWA 4PRDB 5IEHB 1HKLL 3RDTB 5IOPB 2NY4D 1NGZB 3EO0A 1VEMA 1A6VL 3U7YH 3QUXD 2R8SH 1RVFH 4WV1C 5FOBB 2V5YA 2YUVA 3T0BA 1V3JA 1CLYL 1GIGH 5C9KA 1F3JB 3BKCH 3MRGB 3EOAB 1AGFB 4WO4A 5D2NE 4I3SH 1UEMA 4PRBA 5KS9E 3RY5A 2FIKB 2F74B 4I18B 2V6HA 2H26A 2ENSA 4LKXA 4D0CA 43CAB 4KROD 1J5OH 1U36A 4LCWA 4MXWH 5DJ2B 3ZKXB 2RQ8A 2VLKD 2ADFL 2V2WB 3RWHA 3NIFF 5FYJU 5DK2A 43C9A 2F8XC 1MFBL 5DTFA 3S5LA 5BCAA 4GS7B 1P4BH 3CVHA 2EDXA 1UG9A 1F3DH 1ZLUH 5FA4A 3AS3A 1DVFA 1ZGLP 3ARFD 2W9LA 3EJZD 3GBMH 4KFZC 3IXAB 3C9NB 1SYSA 3GEWB 1CGWA 2Q86A 4GKNB 1IC5H 5DJ6A 5HHQB 2XWJB 3GIVB 2PO6B 3CH1A 4I2XE 3KYMA 2EE9A 1SMOA 5CBEB 3QRGH 5AAWA 2DQJL 3U30C 1FLRH 4UT7L 4HIIB 4JFFB 4K9EH 3MRHB 1SM3L 4OI7A 4MZ3A 4XNUL 5HYQB 4XXDB 4E42B 1X44A 5JUEL 2CXKA 2BNRA 2MWCA 5AZEL 5J57B 1EGJH 4XNYH 1KBGH 2IMMA 2QKIB 3FB7B 4HWNA 4LFHG 5I74B 4R4ND 1RZKC 4MA7H 5E6IB 4OZ4A 2DD8L 3PWJB 4DN4L 5C0FA 3FB8B 5E2VH 3RUGA 3BGAA 5C09B 2DTML 4Q6YA 2Q7YA 2UV3A 5JNYA 2CJUL 4QLRA 4D9QE 3WN5C 4BZ2H 2F58L 3ALWA 4XWOC 2DDQL 3ZTNL 4K7PL 3WFZA 2A6IA 1X7QA 2NTFB 4GAGH 1FO0A 5ESVA 3LS5H 4A6YL 1I3VA 3AREA 5EOQL 4HW6A 4XB7A 5DUBB 3FO2B 2ED9A 3BKYH 4XC3L 2NY6C 3MRNA 2ZG3A 4UINH 3MGTB 5MHSD 4R7DA 3REWB 3T2PA 1FIEA 1Q9OA 1BFVL 5ADOL 2VDNH 4JRXD 5KJRH 4C83A 1A1OB 1I7UA 3OR7A 5DHXB 3DHJA 4D9RE 1D5BB 5HHNA 3U4BL 3D87B 4WI7A 3TYFB 1DANU 3RL2A 5BOZG 3FOLA 5IFHL 4PRHE 3L3GA 2EDEA 2OZ4L 4KI5D 1G1CA 4FHBD 4NRYB 4M6AA 3H9SE 1MAMH 5SWSE 1ZSDB 4HWBH 4X4XA 4FZEH 3GI9H 4KDTC 4N1HB 3HG1A 4HK3J 4OLEA 2HVJA 3KR3L 3O11B 4A6YA 5GRVL 1DE4A 4LSSH 1FL6B 3WUWA 3VE0B 1JPGB 3OJ2C 2X40A 3PHQA 4UIMA 5I1KH 5FB8A 3DYPA 2VDRL 2YOCA 2QR0A 1T7XA 5FYLD 4GRWH 4HT1H 4DK6A 2NY6D 2OZ4A 4D0BB 2D9CA 1MREL 5IB4A 2H2SC 4MD0B 5JIIA 3MLWL 1YPZA 2YKLH 4QT5B 5GSRA 3BGMB 2IPKA 3CCHA 4Z76B 5F72S 3OKYA 3OPZH 5IG7B 5ILTL 2E7CA 3KPNB 3ECBA 5FFLA 2GYSA 5CP3H 2RR3A 4MX7A 2VZ3A 2F54E 5HDOA 5KTEH 5J7CC 4NUGL 4NKOB 4PJIA 3I85A 2AQ1A 3INUL 1YY8A 3PQYB 3JZ7A 5IHBA 1QHPA 1AE6H 2X4UA 4LLYB 4HGWB 2MQCA 4ORGA 1OAZL 5ID0A 2CXGA 1UCBL 2NTSP 1P6FA 3P2TA 4TUJB 1U92A 4Y5YA 3QXAA 5J4MA 4P5TD 5EUKB 1QVOB 3V4PL 5J6GB 1T0MB 2A1WH 1WFNA 1DUZB 1X5FA 3QQ9C 4Z7UE 2QQKH 1PVHA 5LGHL 5L2KB 1I8IA 5HHME 3T4AB 1JFQH 4MD4B 3UJIH 3NN8B 4XNXL 3VFGH 4GT7A 4F7EA 5CEXB 3P0GB 1FDLH 3LRSA 5D6DA 3RWJA 2X70B 5F7EL 2VDQH 4ZNCD 4LOUC 4H88L 3MLSH 4OB5H 1DP0A 4HUUA 1XIWD 1XF1A 4NUJB 1FNGB 1F4HA 4J1UA 2FJFB 4O2CA 5KAQF 5ISZD 4HDIB 1F90L 3RY4A 5TDOA 3ZKNC 4QKXB 2QQLH 4JQIH 2LU7A 3B83A 3VA2C 4ZFOB 3WUWG 1HHKA 4MAYA 4WHTA 5LVEA 3ZSSA 3BIAX 2VOTA 1AKJD 2ZNWA 1NDMA 5DJ0A 1HK6A 3VFRA 1QPPA 2GTZA 4HEME 1L0XA 3TBVB 4K7PY 4MS8D 2VL5A 5DJXB 2NY0B 1A5FH 3EOTL 3QQ9D 2ZUWA 1LP9E 3B9KC 4DKFL 5EU3B 2VSDA 2OL3B 3C5ZC 3DARA 2YPKA 3LZFH 1F2QA 3S4SA 3QWRA 4HS8H 4NKDA 4Y1AA 3B43A 3EZJB 3OKKB 3W9EB 3VD7A 5DJDA 1U3HC 3K8KA 2GJZB 4YPGB 1UACH 4U1MB 5I30L 1BZ9B 5C0AB 1ZT4B 2Y9RT 3I84A 5MENB 3K2UH 5BVJA 3K1KC 3S88L 2ICWA 4HUNB 3O8XD 3H3PL 1Z0NA 5BRZD 1A4KA 2IH3B 4JANA 4L4TD 3L7FA 5E6YA 4V2BA 5F1KC 3I2CL 3QUYB 2FLBT 5D7KE 1FAIH 1FZOA 5EDXA 5I1DA 3A0OA 4E9LA 3ILQD 2APBA 4YXLH 3BQUC 5GGVY 2HT3D 4LPTA 4LK4A 3G6JE 4HHAA 3IJHB 2JJSC 3VG0L 5ID1A 2OI9B 4TNVF 1JPFB 4XVUD 5CWSA 3QISA 5DUMH 2Z9TA 4QWWC 1PQZA 3KPSA 3B9KD 3UC0L 3LEVL 2WWMC 1AXTH 4P2OC 2BVQB 4WJ5A 4X80L 2O61A 3VXUB 1AJ7H 3JBG7 1NC4B 4M93C 4Z5RA 5EZJA 5D2LA 2A74B 1U3HD 3QNXB 4PJHF 4WFEE 5FDYA 3BVNA 3H6JA 5IUSA 5C07B 4PJEB 1CG9A 5C7XL 3ZE1E 5FO9B 3BEWB 4J8RB 5DVKA 2DQCL 4X0KA 2XTJE 1OW0A 1BZQK 1R5IB 4K2UH 1O0VA 1HNFA 4WNQA 2H1PH 3LRGA 1YN7A 4UT9H 1U8IB 3BIKB 5ACZB 1IEAB 4W6YB 3X3FL 3H7BB 1CLZH 1RK0B 1DBML 2Z31A 3SDXB 3BP4B 2D03L 4X5XB 3EO9H 4DVBA 5E6ZA 1T1ZB 5A3ID 4PJFE 1Q0XL 3AY4C 3DV4A 1KEGL 3X14A 3CZFA 5DGQA 2JCCA 1X4ZA 4KQ4L 3AS1A 4UAOB 2FWOB 4CJ0A 1XF2B 4QWWD 2AJVH 1AR1D 5CEZH 5IBUB 2OMNA 1F4XL 1FSKC 5T1MB 5CSZA 1TVHB 5C0JB 4P2OD 1IC7L 4RRPG 1B4JL 1V3LA 3M1BA 4X7TA 3V9FA 5KZCD 2H2PD 3GSXB 2RCSL 4MQTB 2WNGA 1HXYB 1P7QA 4H0HB 2R15A 3HE6B 3GZKA 2OJZL 1XGQA 5I1JL 3DURA 3ZDXE 5GGUB 1RZGB 3OKMA 1ZWIB 1MOEA 4Z7OE 3U36B 2P8LA 1KB5L 3SDCC 3OXRB 3T0EA 2B20A 2NX5B 4WW2F 3ARBC 1ZMYA 4X6DB 2B4CC 5IIEA 4JG0H 3BKJH 3QZWG 2F5BL 2PTVA 1EERB 2CDEB 3QUKA 5MI0B 3OAZH 1U8LB 5KSVB 4GKSA 3OQ3B 3WD5L 1RVFL 2BRRL 4WVRA 1NUGA 3V6ZA 4QRRA 2XNAB 3LKSB 1JNHA 1CFNA 3EFDH 3RWFA 3T77A 3WDHA 3EYFA 2AJYH 3D39D 4DFIA 1GPOH 2YD6A 3BXNB 4OUUB 3IFOB 2X1WL 2GJ6E 4FXKA 1M6OB 3P4MB 5DQJA 1ZGLM 1KB5A 3B9DA 1OAYH 4ALAH 4ZUVA 2V17H 3PWPB 4RGMC 3QCVH 3SE8H 2FGWL 1FVCA 3FZUD 3MRMA 2DMKA 4L4VA 2G2RB 5F1IA 5J8OA 3DXAB 2D31B 3P77B 2QHLA 4GBXD 4NFBA 3V0WH 5DRZB 4NQCD 1RV6X 2OCFD 2HLAA 1FNLA 1MHHB 4LSDA 3TNNA 4ZTOL 4P3DB 2H32A 3DX7A 1MJUL 2BNQE 3IDNA 1ZHKA 5BO1H 1KJ2H 4Z7WB 4F15B 1O7VA 4S0SD 3MRIB 4JFDA 3VW3H 1EV2E 4N0UB 2X89D 4KJYB 2B1AL 1Z2KA 3WNNA 5CCKH 4K9EL 3GSNL 2ATKB 4IMLB 4X7FC 1CFSA 4CVZA 2HH0H 1TDQA 3ARGA 4NQXA 1B0GB 5D1XB 3NIFE 5DEFA 3LPFA 1T1YA 4XCYA 4OCXH 4MA7L 3LPWA 3CU1A 1WBXB 3UDWC 2EC8A 3VWJC 2ZP0T 2Y06H 1TENA 3CSGA 3TVMC 1LK2A 5E95B 3WNMA 1OT2A 2JJUA 3GSRB 3THML 3QSKB 4X4ZA 1IMHC 4TSAL 5I1EL 3DUSA 2YN5A 1QFWH 4WDIB 1BF8A 4LIQH 5DMGC 3ZHKA 2VXVH 3WFDL 2VTFA 1KEML 3RL1B 2C1OB 3BUTA 2AEQL 1I1AB 4P4RB 5HTSA 3QEUB 2R2EA 3BKYL 1NC2D 1JWSA 3BW9A 3U6RA 3KYOB 4CRPA 2VDNL 2BSRB 3GSNA 3VDAA 4ELKA 4HUVB 2ICWI 2X4SA 4LHUA 1AGCB 1DBJH 4XRCB 4D9QD 4XP5L 3VFWB 1QSFB 3BYYA 5D93C 2NY5H 1WAAA 4JQVA 4RAHA 4FQLH 3G04B 4ZD3H 3L5WA 4MVBD 3KVQA 4K7PX 4JFZH 4YE4L 2D3VA 2J8UB 1MY7A 3GI9L 4LNVA 2VERN 2YA2A 3QDGE 3VFMB 5DK0B 2R2BA 1D6VH 5D8JL 4LLUB 3DVGB 4Z7NF 3VWJD 3ULVE 4JFYB 2BRQA 2JJWA 1NCCL 1MY5A 4WI9A 1M7DA 3QUZB 4D9RD 1A7NH 3BPOC 4UOJA 1CGVA 1M05B 3IFNH 2HA1A 5IHLB 1EHLL 4PRHD 1NSNL 1YY9C 2QSTA 1MCPL 1P4LA 1T7VA 2K1MA 1AQKH 5SWSD 4OGXH 3TN0B 1DL7H 1NCUA 4TULH 1MRCH 4ODUB 4J3WA 4HIEB 3QIUC 1NLBH 4JY4A 3AU1A 4HULB 4YAQA 3C08L 3WJJC 1T80A 4J3VA 1ZHBA 2QSVA 2DS4A 1ZHLB 2IPTL 5BZDB 3SN6N 3WHE1 3X17A 2QSCL 3OPZL 2VN4A 4NOBA 1D5IH 2J2ZA 4BFIA 1RAMA 1Y0LB 5IMMA 3OR6A 1DSFH 1N2RB 1YMMB 1S7WA 1QLEH 4HK3N 1CT8A 3L5JA 5J1SC 2WBJB 2Q8BH 3EYQD 3O3EB 3HMWH 4HQQL 5HI5C 2OSLA 3U0TB 1RULL 3EYUH 1GH7A 4XTRC 3E6FA 5IWLC 4PB0H 5IGXH 1QQDB 5E1AA 1ZK9A 5JMRA 4HJ0D 1AE6L 5IKCB 1A1MB 5AG9A 1HIMH 5JPMA 4MA3A 3RIFK 3PG2A 5JHDA 3F7YB 4M4RA 1A6ZA 3W82A 3G5ZB 3TBWA 2VXSL 3H9YA 4MJ5B 4YGAB 3GSOB 1F4WH 4PJGB 2GY7B 1I3GH 4U1JB 4ZQKB 3L3KB 1K6QL 3WV0A 2QHRH 3MLUL 4PJDA 5KSUB 1IE5A 2VQUA 1V05A 3VXPA 1QSEB 1JFQL 3RA7L 4X9IA 2PYEE 4LHUG 2C3WA 1N4XH 2GFBA 1T20A 3HB3C 2X4TB 2W0KA 3CUPB 3TV3L 3PGFH 2VDQL 3OKNA 4H0IA 3MLSL 4OB5L 2VLRB 3RWEB 5TH2A 5F9JA 2R1XA 3O3DA 4KK8C 3ROOA 1LO4H 1OSZB 4MNGB 3O6FB 1GL4B 2AJXH 3VFPB 2B39A 4ODXB 1W2KT 4MNQA 1IAKA 4NZTH 5ENWB 2B0SL 3PNWB 4JQIL 3DX8B 3RGVC 2YD7A 5HHMD 5K9JH 2EICA 1OTTD 3HPLA 3WSQH 3HRZB 4E41E 3RWIB 4KU1A 2NY2C 3QDJE 3VFVB 25C8H 2R69H 4XVSH 5JO5A 5F93C 4NN5C 3PIQA 1KF9B 1KG0A 3BDYH 4PRDA 5IEHA 2LABA 4RMTA 3ARDD 3C6LC 4IIQB 1FV1A 3GSQB 1UXWB 3LZFL 1EBAA 5B8CC 2BHYA 1AR2A 3BN3B 3MRQA 4YBLB 2IFFH 3QR2A 2KKQA 1NL0H 1X3DA 1JZ8A 5C3TA 3U7AA 2ZCKL 3LV3B 2EXYD 3HB3D 1RPQA 1KV3A 4GQ9H 4FQXD 3PV6B 3CFDB 4PJ7B 4ONFH 3I75A 3O3BA 4FTVD 2F74A 1ND0B 1JTOA 1URLA 1K4CA 1PG7L 3EYOB 1Q9LA 4EZMA 1KCUL 1P84J 1KACB 5F3BB 1G6RH 4LCIL 2DYPB 1C1EL 2CUIA 4U0QB 3NABH 2V2WA 5EFIA 4M4PA 2DI7A 1F6AB 3EW3B 2AS5M 2FYYA 2EE3A 1B9ZA 1B0RA 5EC2B 5E8EB 1F3RB 3D9AL 1JTPA 2PCPA 4PV8B 4N0RA 3P0YL 1JRHL 2FHFA 2IADA 4YDVB 4XPAH 3QEQB 2R2HA 3QPQC 4PJ8A 1KXQE 5HHQA 1LEGA 4O58L 2XWJA 1PYWA 3QIBB 4Y16B 1N8ZA 4W4OA 2X1OA 3RBSA 1EJOH 1SEBA 2EIZB 1DBKH 1JGLH 3OAUL 2PYFB 3ET9F 1AXTL 2IG2L 3MRDB 4H1LG 3FMGH 3K4DA 4JE4B 5JXEA 3GBNH 4JFFA 4TNWK 5EZIH 1SYVB 5BXFB 5IMLB 3MPCA 5BVPH 5D7KD 1YNTB 1RFDL 5FYJD 4X6CF 4EKXA 1J87A 2AQ2A 1A3QA 1NKRA 1Z9LA 3JV4B 4K8RC 3LOWA 3FB8A 5ITBL 2R23A 3GMQA 5IB1B 1ES0A 3WIIH 1MHPH 3MBXH 2I9LA 1I7ZB 4F58L 4BYHA 5IVZB 3ORJA 8FABB 5D1ZC 2V2XA 5JZ7D 5T33L 1A22B 2H1PL 3MJ8B 1SMAA 1V3KA 3JWDC 4FG6D 4UT9L 1AGEA 1NKOA 4Y4KC 1MVUB 3D3VB 1UQSA 3D2UD 4X6BA 3ARSA 4OLXL 3HUJF 1P7KB 1CLZL 4JPIB 4LCWE 4NJAL 2AEWA 5F3HB 1SHMA 3W0WE 2E5EA 4AYFA 3REWA 2YPVH 2EIDA 2Q87A 5JA9A 4LLVB 1A1OA 4WFED 5IMOB 3RAJH 2ICES 1D5BA 4PJHE 4RNRB 3QPQD 1W0VA 2UWEB 2FB4L 2A9NH 4J3TA 5DZNA 2F9BT 1CF8L 4XMKH 1U8MB 2AJVL 2NY1B 3ZKSD 1YDPB 1YEDA 1RZ7L 3PL6D 2MKLC 5F89B 2NYYC 5EU5B 4C54A 5I71B 1JHKH 1XH3B 1LO5A 2PF6A 3S36X 4CJ1A 1CGXA 5GRJH 4U1NB 5J9PA 4JFXA 4XXCA 2IQ9H 4OGYL 1EEYB 1UJ3C 3TT1H 2P5EE 3PUCA 2X4PA 1OAQH 5IV2A 4ODSH 4M5YH 3ARRA 2Y23A 4F8TA 3MJ7A 4LAQH 1J8HD 2BNRE 4PJXA 5BW7C 2Z93A 1C5DB 1D6EA 1JPGA 2R0WL 1I85A 4YDKH 2XFXB 3NFNB 4OTXH 5JOPE 3RUGE 1LO0L 3MRCB 3QA3B 2WIIB 3BKJL 1U41A 3WO3B 4LRIA 5D96B 3MV8B 5E2JA 1QR4A 3D48R 4KHXH 5EPMA 3IXTA 3IKCA 1ZLUK 4I48A 1HSAB 4MNHB 3UTQB 3LB6D 1KJVA 3RY6A 2NQCA 2O5YH 4QT5A 1RJZA 3OKOB 1T22B 4N9OB 3EFDL 1HHIA 3BGMA 5EORH 1TCRA 2JIXD 1EFXD 2AJYL 1DDHB 4DQOH 4TUOB 1GPOL 4H25B 2Q6WB 4L8BA 4TN9A 3SKNA 1OB1B 1BD2E 1FVEB 4EJ1C 3RDTC 5DJCA 4AM0A 4ALAL 3NZ8B 5E8PB 3UTSB 3MV01 3QCVL 2D7OA 4NKOA 3VWKB 1H3TA 4G6AC 4LP5A 5HGDB 3EKCA 2GTWA 1BZ7A 3CDGB 2HRPL 4U1SA 1A64A 5GIRB 3HI1A 1HYRC 1UM4L 1PEZA 1UWEH 4LNRB 1QP1A 4GRWB 2GJ6D 1G9ML 4I18C 3MNZB 3K8MA 5DD0H 2GKIA 3VD4A 4DVRL 3WKML 3TO4B 4PJAF 3MOBL 1U42A 4WI8A 3ZKXC 2EKJA 2BOBB 5C0CD 1GHFH 1MAKA 3SDDA 3T4AA 4LLAA 5CAYB 1WF5A 3U7WH 5JTWA 2VABA 4RAUB 2QADC 1IBGL 4N90E 4C56A 3BJ91 4Y2DC 2Y06L 4KPHL 4RX4D 1A6PA 4HWEH 4OJFH 4GLRH 2A73B 1EO7A 2PO6C 4ODWB 5EBLB 2FJFA 3IJSA 5J89A 4OGAC 1W0WA 4Y8DC 4NDMB 4FQQA 4HC1H 3GUTA 4JB9L 4LIQL 5H37H 2VXVL 1DCLA 5EULV 5JXAL 3GK8L 3FO1A 4OFPA 4TVPE 3X11A 5FYLH 1U6AH 2B1HL 3MLVH 4ODTH 2CH8A 4PJIE 1KIQB 5EIIB 3N1MC 1RZJL 1FJ1B 3MGOB 3IDIA 2Y7QA 1N5AB 4APQB 2X4QB 5IF0B 4LVNB 3F6LA 1AO7D 4R8WH 1E6OL 4BZ1H 4K3EH 2NY5L 1TZIB 5I1AB 2OR9H 2APXA 5I18L 3OKKA 3SO5A 4AJ0A 1I8MB 3CFCL 2VLMD 1D6VL 1IM9A 2QADD 4YHMH 4UTBH 5JMOC 2WINA 4Q9CA 1ZT4A 1ONQB 5DLMH 4ZO7A 1FYTD 2YD8A 2E3VA 5HHVL 1A7NL 5SWZA 4PTTB 5I8EA 2LV4A 1KLGB 4XP6L 4O02L 1DBBL 2H8PB 4I4WA 5H94B 3IS1X 1MFDH 4KGLA 1AQKL 3KXFB 3VXQB 3GJFK 1DL7L 1S3KL 4KJWD 1U8OA 3L3OA 3QDGD 1FIGL 3HNSH 4JDZB 4JM2D 3CX5J 2R4SL 1WGOA 4R97C 3JV0A 5DA0B 3ULVD 1NEZA 2P5WB 5F8QC 1JRHI 2I9TB 3SE9L 1CXLA 2JKXA 1U8KB 2G5RA 4P2RE 4Z7NE 4NQEE 3KPOA 1KCLA 3KWWB 4ZFZB 4KUCD 5A16B 2G9HA 1F02I 4OBRA 4O2EA 2W9DH 2BVQA 1DQQA 4HZLB 1TQBB 1B4RA 1CXFA 4U6YB 3VXUA 2G5BA 1NC4A 2RGSA 4MLSA 5HJ3A 5GS0D 1AGBB 5T3XE 1FGVH 5I1HL 2FJHB 2Q8BL 4NWUL 3HMWL 5TQ2L 3SGEH 4X4ME 5DHVH 4Y1AE 4AH2A 2CO7B 4FQJL 5DSCB 5FO9A 4J8RA 3UTTE 5FEBA 3BZ4A 1K8DB 2I07B 1HIML 4NC0B 4Q74A 3M07A 5K9OB 3MOAH 3BIKA 2DB8A 3CDYA 4MJ2A 3H7BA 5IK3B 1RK0A 3SDXA 1D9KA 4HK0B 2JK5B 3P9LA 1CDYA 5EO9B 1RZ8A 4KQ3H 4F7MA 1OY3B 3MZTA 5B39B 5LBSH 4OCRL 3M17B 1QNZH 1IL1A 1XF2A 3BE1L 4OD2A 4Q6IA 3JVGC 2AK4A 3U9UB 4NZRL 1TVHA 4B50A 2WQRA 5F6IC 4P23B 4ZDHB 5KVDL 2P24B 2VH5H 1LO4L 5CIPH 3KPSE 3PJSA 3WIFA 4PRAA 2AJXL 3LKOA 4X8JB 1G7IA 4NZTL 2BOCA 2K9UA 2EH8L 3NZHH 3HNTH 1N0XL 5K9JL 2AJZB 2FZ3A 3QNZB 2PYED 1PSKH 3LSOA 3C87A 5C8JA 3DVFA 1MJJB 3FO9A 4NYLB 2Y5EA 3ES6B 5J1TC 3OJVC 1MI5A 4DUWA 2AKRA 1S9YB 2R69L 4XVSL 1FZMA 4LLMA 3I3BA 4XZUA 3FTGA 1KLUA 2EDQA 3MV9A 3D69A 2NLJA 4PRPB 4HF5H 4BQ6A 3CZJA 1DQDH 3I6KA 4RFOH 2X4OA 2CDEA 4JFEE 5DRNA 3BMVA 3NFPB 1H8SA 4EN3C 1NEZG 2M2DA 4JAMA 3V0VB 4PJBF 2XXMB 4QXGL 1I8KA 3VXOA 1LE9A 1V7MH 4E41D 1E4KA 4K71B 4LHJB 4IMKA 1Q1JH 1P69B 3WFEL 4GQ9L 3D6GA 3L3HB 4L8SB 3KPRD 4KVCH 1BAFH 4UDTA 2W65B 3NACH 2FH8A 4OZGB 1SVZA 2XQYK 3ARUA 4R96A 5DD5L 4OCWL 2YPLA 2J5LC 1CXIA 3QO0B 2WMPA 1AHWA 3DXAA 3TZVC 1UH3A 5TDNA 4HPOL 2ZOLB 1CICD 1R24B 1TQCC 3NIGE 1KCRL 3SDAC 4RZCB 1R3LA 4ODHL 1HOCA 3E6HA 1F2XK 4XPAL 4FNLH 4P3DA 3JUYA 3TEUA 4JRYB 4LLQB 1OWRM 3T0EE 2W0PA 3WFCL 2CO6B 1EJOL 1JGLL 5E2WL 3FMGL 3E3QC 3QUYC 2WBKA 3GBNL 4G9FB 2V9QA 2AP2A 2JB5H 4G5ZH 3MV7A 4Q97A 3QJFA 5D1XA 5IBUG 1JL8A 4P4KB 3MNVB 2Z4QA 2NXYB 1V7NH 4P3WA 5I76A 3EDJA 1WBXA 4QRRE 3MZGB 3SBWC 1T0NB 4JHAH 1T2QL 1TLKA 3WIIL 2QBWA 3BUYB 4P9MH 1MVFA 3WS3A 3FFCD 1WZLA 4NT6B 1F00I 1A8JH 5JLZB 1A1NB 1A7OL 1EUTA 1BM3L 1S9XB 4XAKE 5IBTL 3RL1A 4ONHA 4IDJL 5EZLA 2AEPH 4N8VB 4BH7B 2AVGA 5D7IB 3BZEA 4X5WB 3MRBA 3CFJA 4P4RA 3QEUA 4DKDC 1MH5B 5GGRB 1N3NB 4KAQH 1X4XA 2LVEA 3HE7B 3KPQB 3VFTA 3CXHK 2DLFL 4L4VE 4U0RB 2BSRA 4MGXA 4HKJA 3NCJL 5KSBA 3KPTA 2PUQT 1KJ2B 1AGCA 4URTB 2G75B 4JFPB 2A9NL 3UBXA 3ABZA 4XMKL 4O51B 3BI9X 4WO4D 5MP6L 2HVKA 4IS6A 3TYGH 4L1DA 5DFWH 3TBYB 4M5ZH 2VDMH 3D25B 2Q76B 3G5XA 1JHKL 1NGWB 3G04A 2FCBA 3VFUB 1BX2B 1LK3H 4OKVB 2XKSA 4POZC 5I6XB 2Y5TA 4NO2B 5E9DB 4DW2H 2IH1A 5BJTA 3IDJB 4LCWD 4JFDE 5DK0A 2AJSH 4K55A 1M71B 1EFQA 2A6JB 5HY9A 3MFFA 3GMPA 3UJTH 1OAQL 3T4YB 4M5YL 3O0RL 4PJCB 4JFYA 3AREC 5DI8B 5F7LB 3X12B 2KUTA 3QUZA 4UAOC 1H5BA 3MSPA 4XVTL 2GIYA 4NQTA 2WSKA 1M05A 2BCKB 1OP3H 3O9WB 4YDKL 4IJ3B 1VKXB 3TIEA 1EAJA 1DVFD 5ICXB 2FGZA 3VGGA 2YEZA 1F97A 4M6NH 3VXRE 4DGYL 1KOAA 1RIVH 4U1LB 3GSWB 4K23L 1C7SA 4NNPH 3BP6B 4U6VL 2B4CH 4KHXL 1I9IH 3IFPB 2ZUQB 4Y19A 4YHOL 1DTUA 5B21A 1OARH 3QDHA 2O5YL 3WNOA 1WT5A 1NMCB 3Q6FA 4LPWA 4JG1L 1C08A 2BNRD 3PP3H 5GGQL 4DQOL 4GUPB 1JF1B 5HHOB 2DIJA 4G8EB 3LN5A 2BY0A 1BQLH 5FGRA 5FO8A 3SJVA 1N2RA 1PX4A 3FT3A 1QLFA 4LGSB 2ITDB 5IT2H 4HXAL 2XI9A 3LKNB 5FYKL 3MA9L 5HYJB 1DBAL 4NHCH 1A9BB 5ALCH 4GAJL 4LASH 3V8CA 2VDLH 5MI0C 3PF2A 1WAAE 3MROA 2CMRL 3MCLH 3RWGA 4Y4HB 3OKDB 1INDL 2WUBL 4K3JH 5F88A 1QO3A 3ARED 1UZ8B 2HJFB 4GXVH 2VLJB 3WS6C 1FG9C 2NXZB 5IKCA 1HYSD 3BMWA 4MJIB 3A67L 1GGCH 4PBWD 3HCVA 3IKKA 1U8NB 4NCC2 5J11B 1CD1B 1Q9WB 4LMQE 2Z91B 2FEDC 5DD0L 3BGFC 4R0LB 1UM6L 1SEQH 1DR9A 4U1JA 5DEGA 3L3KA 1JPSH 1IGIH 2C3XA 4HFWB 1JYWA 1GHFL 2WP3O 1OQXA 3LN9A 4YWGH 3LN4B 1F58H 4F80A 1UXSB 3U7WL 1DQML 4FZ8H 4PJEF 4V1DB 2V2TA 1G0XA 3HG1D 1DEEB 1V3MA 4ZAKA 1EHAA 1HI6A 4J3XA 4LVHC 3CAFA 3VFSB 1JWUB 1BJ1J 4Z7QF 3SO3B 2VLRA 4OJFL 3DMMA 2C1PA 4H8WH 1ED3B 1GC1H 4F15C 3FHQA 3VFPA 2CUHA 4OI8A 1CL7H 2RJMA 5ENWA 4HC1L 4QHMB 4M8QB 1J9CT 4Y5YC 2C26A 4U1IA 3W11D 4Z95H 3ULUL 4PJAE 1BQUA 3EJJX 3HRZA 3PWNA 4LSUH 3T2OA 5FYLL 4OLUH 4BM7A 3VFVA 2Y72A 4WU7B 4N90D 3MYJB 5JHLL 4IDLA 1X5GA 2FEDD 1YEGH 4I0PC 1IQDB 1FQ9C 4OD3H 5KG9A 5JPNB 2ZOKA 3OMZA 1OAUL 1LEKB 2AI0H 2QJDA 2UZYB 4IOIA 1LO2L 3KGRA 5EU4B 4AENB 4FQHA 5C1MB 4QRQB 3VFOA 2NNAA 4HC1A 3SE3C 4GW1B 3HLAB 5F7NC 4XX1G 5INCA 1LWRA 3CFDA 4PJ7A 1VGEH 5T5NF 5E8NA 3P4LA 4XH2B 1J10A 4MAYC 5GZND 4GG6B 4L8CB 5HDBF 3O3UN 4X6DF 3MRKB 4KTDH 1X5JA 5CGTA 5F3BA 5EOTA 4YDJA 4MWFB 1CTOA 2MNUA 5LGJB 4XVJH 1ADQL 1E28B 1MFDL 1BHGA 1MCFA 1IT9H 1TJHH 3T08A 4MNQE 3OZ9H 3B2UD 2FL5B 4QOKB 4S1RL 3HNSL 4WHYH 1FE8H 1HQRB 4CNIB 4KKCC 3BT2H 2YWYA 1D5XB 3ME0A 1YQ2A 3QEQA 3D85A 4YC2B 2DWDB 3MRJB 3LHPH 1JZ2A 3TH3T 3EFFA 4OIIH 4LGPB 2EIZA 2PYFA 1R5VA 1EUUA 1CD9B 4KKBD 1OD7A 4WWKB 3LH2L 3GM8A 3DV6A 3AFLA 1K2DB 1FH5H 2VISB 5FGSA 1GZPA 3JV4A 1ADQA 4NWTH 1XF4B 4Y5VA 3T0WA 3UBXI 3CFKA 3UO1L 2XY2A 1EHNA 5CD5D 4PGDA 1NCBL 5DUPH 1DN0A 3T3PF 1G6RB 3V6OE 1FL3B 1QR1B 4CVUA 1BEYH 1RUQH 1EXUA 4QGTA 1JVKA 1AGDA 2ARWA 2DAVA 4NQED 4PGEB 1CBVH 4G43B 4Z7WF 2EKSB 3MOAL 2ESVB 1W0YT 3UROR 2NY3D 3AMKA 4F7PA 2CRYA 1K3ZA 5KVFL 1L7IH 2VL4A 2GSIB 5INDA 1ZA3A 5T3XD 3S35L 3ETBF 4UOW0 4KVNH 3OV6A 4AEIH 4KQ3L 3JV6B 3QWRD 1X4YA 2I5YH 4Y1AD 5LBSL 4YHLL 4JDVB 2V5TA 3QJHB 2BC4A 3EYVA 5EU5A 1TZGL 4QXTA 2R0KL 1RIHH 2F53A 4YFLI 1S78C 5FGBC 3O6ML 2VH5L 1XGYH 1B6DA 1K5NA 1YECL 3HHRB 3BP5A 3QQ3B 5GZOC 3NCEB 2R1YA 5L6YL 3MC0A 4YQXL 1EX0A 4KY1H 1CFTB 4LDLB 1KN2H 4JFFE 2HFFB 4WCYL 1PSKL 4H5SA 4POYA 3TIDA 3LD8C 5CJ8A 1YNLL 2CLRB 2XFXA 4LLDA 5GISH 2IAMC 1ZT7B 4ZSOA 3TPUA 5C09E 4HS6B 3C2AH 5F1OB 2EECA 2CSPA 1JHLH 2XPGB 5L9DH 4NM8H 1DQDL 4XC1L 5D70H 3V4UH 5CJQH 1IAOB 2J8UF 3KPSD 3MV8A 2NY4B 4UQ3A 1A4JB 3LQZA 4KK9C 3P11H 1A6UH 1HSAA 4CN6A 3QUXB 2QQNH 3VGFA 1OM3H 3BPLB 4R4FH 2VXTL 1I4FA 4WHDA 2HKFH 1DDHA 4QTHB 3RIFF 4H25A 3TO2A 4KK5C 4X6FA 4QHKJ 2A9MH 5A2IH 5FYJH 5HGHB 1DLHB 4L4TA 3VRIA 4PP2A 4KVCL 4WHCA 3B2VL 3NACL 5E8PA 1MHCA 1IGCH 4R2GD 5DHYA 2UYLB 4KROB 3S97C 1OAKL 2VLKB 1NCWH 4PBXA 5C9JA 1UADC 4YEEA 1IC1A 2Z35A 3SEPA 1JV5B 2Z31D 4YXHL 1ZHNB 2A0LC 5GS1C 2XWTB 4O4YH 4OCSH 4K3HA 2J4WL 4J6RH 5EUOA 3UZQA 3ARFB 5FA3B 1U3JA 2EH7H 4M43L 4Q58C 2A6DB 3RHWF 3HTLX 2MFNA 1JI1A 2BOBA 1LDPH 3VXNA 3FRUB 1S7QB 1WC7B 3MMEB 1VGKB 4O5LH 4G5ZL 5IB3B 4Z78A 1QFPA 2BVPA 1P7QD 4IRZH 3LS4H 3VFNB 3GSUB 4JO1H 1YEJL 2VMFA 3DYOA 4KK5D 4TSCH 3AB0C 3FQXB 1C5BH 4JKMA 3GMRB 5JW3H 4IRJC 4L3CB 1DFBH 3AS2A 3S3PA 4G8FA 4JHAL 4P9ML 3C8KB 4F2MA 2CK0L 3B4NA 3QIBC 4Y16C 4PJGF 3T0ED 2OTWA 4LU5L 4P9HL 3B6SA 3F62A 4E5XB 1R3JA 1LE5B 3VGAB 3GJFA 4K94H 5DJ8B 3DETC 1KULA 2P8PB 3S37L 3H7LA 2DQHH 4WGVB 1FNEA 5IESL 1JK8B 3W39A 1NCAH 5C92A 4CADB 1W72L 4YX2L 3ALPA 3IS0X 3PQYE 3V7AG 5FOJA 4QRRD 1K8IA 4JRXB 4HIJB 2X4QA 3ARGC 1EA9C 3OG4B 1FG2B 2CIIA 2PTTA 5F9WC 1CCZA 1JMZA 3BH8A 2VDML 1TETL 1VFOA 4WUKL 3LKPB 3EDDA 4YHYC 2VUYA 1LK3L 5ERWB 1XFPA 4ZXBA 3U30B 4DW2L 4YHNB 3EO1A 2C3HA 3V5HB 2EZ0D 3MLRH 2VRAA 1ZS8B 4X9HA 5L2KE 2JE8A 3FB5A 4U6XB 4WFGD 4L4VD 1ONQA 4RAVA 1P2CA 4WI5A 1OCWH 4MSWB 4N5UA 4P2QA 4TTDC 4FFYL 2A83B 2APWA 2X10A 1W72A 1AD9B 2XOTA 4K9EC 1Y18B 4TPRH 2HJKB 3DECA 1CGUA 1TVBB 2X4NB 4XNMB 5D7LA 3S7GA 1OOAA 1LGVA 3C09B 1JF6A 1WQVT 1P84K 4YO0A 1YEEH 4YZFE 4DCQB 1N6QL 4JDZA 5CZVH 4JFDD 2NY6B 1KN4H 1CFVL 1H0DA 2BMKB 4JGMA 2VZTA 1S9WB 3OG6B 3BDXA 3ARGD 1IKFH 5E94A 5IFAL 1YQVL 5F1NB 4X7CC 1YYML 3KPLA 1XZ0B 2JJTA 3EOYG 3FB6B 4GFTB 4P5KB 4ZPTB 1BIIA 1QA9A 4ZFZA 1WFUA 5F7UA 4HAFA 1AFVL 2OS7A 5ALCL 2PW2B 4NHCL 5CEYA 1MUJB 4LASL 5E4EC 4PTUB 1B88A 4AEFA 4RFNB 3RGHA 1L6XA 4OV6F 1HINL 2A6KA 1S7TA 5IJVA 3SGEI 1H15B 2J8HA 2ITCB 5DSCA 1ERNA 3F6IA 2PXYA 1VDGA 2XN9B 3OSKA 4GXVL 1RJYB 3GRWH 4S1DD 5IVXB 3GMMB 1AI1H 3HAEA 5C0AE 1QEWA 3T1WA 4XMPH 3QH3A 7CGTA 4OM1H 2VSCA 4LHUD 4HWZA 1ACYL 4P5TB 1VACA 3SY0B 3BWAA 2BJMH 2NPLX 5HI4D 3S34H 1MFAL 1LILA 2IJ0C 4EUPA 1BVKB 2E7BA 4F33B 3STLA 1NBVL 1F58L 4KZEH 2AJUL 2OYPA 4FZ8L 1T5WB 4WTXA 4HV8A 4J4PA 1HXMA 3GB7B 4QHUA 4QRSA 2VKWA 4MMXC 3MA7B 5I1CH 3QFJB 1CZ8L 2P24A 3O2VH 3HC4H 3TO4C 2Q1EA 1XIWB 4TUKH 1GC1L 5HPMA 1MCDA 5DHVB 4X8JA 4NC1C 4OFVA 4XPHL 1QBMH 5KSAA 3HKFA 5ISZB 3WHXB 1UB6A 2AJZA 3VXUE 4NZJA 1I1YA 1TJGH 2DQFA 2XZCH 1YMHB 3VI4F 1IEBA 1KT2B 4LSUL 4MQ7B 2UWEF 4ONOA 5ESQB 2V7HA 1MWAB 4YFDB 1LQSR 3BN9C 4WY7H 5C07E 1AKJB 2ADJA 4MA8H 3MYZA 5AZ2H 5CGYC 3DTXB 3ZE2E 1S7RB 3ULVH 2NW2B 1ZLSH 3RTQD 3A6CL 3V6BR 3TA3C 3HR5B 1AQDB 5FYKU 3SDXE 1QYGL 5GQBA 1Z5LB 2HLFC 3V4VH 1VFAB 1KPUB 2VWEE 3BHBA 3PXJA 2IBZY 3AM8C 3LKQA 4LP4A 5GS0H 5CIPB 2W60B 4U6HB 4DKEL 2IQAA 4APQC 1I1CA 3WXVH 3DX9A 1FPTH 3ARTA 4LVNC 4OFKA 2W65A 1FC2D 3H9SA 3OGCB 4JQXA 4KTDL 3QWOB 5E2TH 2DQTL 3D0LB 3WL9A 1EO8H 5E2UH 4ZG1A 5JHDD 3K3QA 3O8XB 4XVJL 5BRZB 3HC0B 4BUGA 3LQAH 1BOGB 2MKWA 5F96H 4FFWD 3L9RB 4DN3H 1IT9L 1TJHL 1TTFA 4DOHB 2X7LA 1J0YA 2KPNA 2DTSA 1R24A 4KHTH 1JZ3A 3BT2L 2HP4A 1CE1H 3BN9D 3HC3L 3DGGB 1R3KB 5JA8B 3QO1A 5CGYD 1MI5E 4JRYA 1CVRA 2WV3A 4HBCH 2R39A 3MCKB 2NX5E 4EUPG 3B9KB 2ADGA 2V9TA 4X6DE 5B39G 3ILPB 2AJ3B 2ZCHH 2XKNB 1XGRA 3HMXH 1FNHA 4Q2ZB 1HE7A 1NFDB 1OP9A 4P4KA 2P44B 4MNQD 2HLFD 4BSVB 4OZIB 1U95B 2X2YA 5I1LB 4NWTL 1G7HB 3JWNC 4M00A 1U3HB 3ARZA 4JZOB 1OF2B 2DOCA 5DMKA 4GRWF 3JWOL 1BLNA 2C7UB 5EZOL 3O4LA 1TIUA 1A1NA 4P3CL 2F54A 3Q6GH 1TQBC 5BMFH 3GBLA 2VXUH 4PJ8C 1L0YA 5DRXB 1PZ5A 1BFOB 3BPNB 5GGRA 3PWPE 5EU6B 1WICA 1Q9KB 4NSKA 4KVNL 3QFDA 1WJ3A 3RVWC 4ETQA 3FONB 1CDUA 3DXAE 5ADPH 2I5YL 3UAJD 3L7EA 3GDBA 2X9WA 2C4FT 3B3IB 4WEBL 4NJ9H 4BK4A 4PG2C 3G9VA 4Z0XB 4QRPB 3Q0HA 4WW1A 2A77L 4Z7UA 4JJ5B 5IW3A 4LSRL 4R90H 1NGWA 4XPGL 1RIHL 1BX2A 5E5MB 4P2OB 1CR9H 1MPAH 3T8XA 4Z7WE 5B4MC 3LMJH 5KZCB 4NKMA 4M93B 1MLBB 5BV7H 4N0UE 2ATPA 3T4YA 2Z92B 5J0BA 4QF1B 1CD0A 5F9DC 1BOYA 1JYNA 4MJ6A 3PWUB 5HYSA 2F5AH 5ITFA 4HKBB 4OQTL 4GKZB 2CIKB 5K9KA 4PJ8D 1TZHA 3GSVB 1XCQA 4HIHB 1N0LA 1VFBB 3SCMA 2Q3ZA 4UI2A 3PHOB 1JGDA 1H8OA 5JXED 2UY7A 3P11L 4JFFD 4FQXA