2ICCA

Extracellular domain of crig
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
b'GRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-set and immunoglobulin domain-containing protein 4
molecule tags Immune system
source organism Homo sapiens
publication title Structure of C3b in complex with CRIg gives insights into regulation of complement activation.
pubmed doi rcsb
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iccA00
3L3IB 3SJVA 4Y4HD 4L8DA 4I3RH 4OBSA 4A6YA 1T22B 1CR9L 5KSVB 4LVOC 1NGWB 1UYWH 5DC9B 4M1DH 4KDTC 3G5ZB 1YJDH 4K2UL 4AM0A 2CO6B 4NKMB 1XR8B 2CRMA 4Z78B 3B9KD 3BESR 2VXUH 3MODL 1TVHB 2Q20A 4QHUA 1XF2A 3F7VB 4F37K 1VPOL 5I1HH 5E03A 4PUBH 4FFYL 1XGYL 4R26H 5FUOL 2AABL 4KMTH 3CK0H 1E4WL 5KSVA 2DI7A 1SMAA 2EDEA 1SY6H 3MJ9L 4FQ1L 4TNVK 2DM4A 5JXEC 2ICEB 3TVMA 3A6BL 3AB0C 1OGAE 3O3DA 4PJDE 1A1MB 1RZJH 3ARRA 3MLSL 4PGEA 5CEXB 2V17L 4KK9C 1E4KC 4F9LC 3THML 4U6VL 5KS9E 3V7AE 5FCSH 1J18A 1HYSD 1XFPA 5I1EL 3HG1E 2V5YA 2LU3A 1B6DA 3DSFL 4XTRC 5DZNA 2D3VA 4FABL 3TBYB 3BPNC 5HYIA 3CVIL 4JPIB 3VG9C 3OJ2C 1S7TA 2G2RB 4G6KH 5IQ9A 4HWBL 3OF6A 4WU7A 3ZHDA 1U8HA 1IGFH 3MFGB 4GO6B 5GGRA 3L95A 2FEEI 4ZD3H 2DYPA 2ZOLA 2ZCKL 2DKMA 3QIUB 2CKNA 5EA0H 1CDYA 1T0MB 1PW3A 3D87B 4RX4A 3S4SA 2ZUYA 1CICD 3BKJL 2EDWA 4NWTL 3WIHH 5ISZB 4CAGA 2CKBB 3N1GC 1WBZA 1P4BH 2XA8L 1MJ7H 4YXLL 3SGEI 1HCVA 4IOIA 2ZZUT 2Y6SC 2BJMH 2ZG3A 32C2A 3AXLB 3SBWA 5IBLC 1Z3GL 1IKFH 1AD9A 4HW6A 5B22A 5I6XB 2UUDK 4PJ9D 4U1LA 3T65B 4ZTPL 3O4LE 3BD4A 3O4LB 2LFGA 3GIVA 3VMNA 3MOAL 1MWAH 2ATKB 4U0RB 3RGVA 4CNIB 3V0WH 3LKRB 3K46A 4KJQD 4YDVA 5LQBH 1DE4A 4RMTA 4P3CH 5LCVL 4FFZL 1XZ0B 4OIAA 2F74B 4KY1H 1QPXA 4O5LL 4GG6E 4KZEH 4JPWH 4KRMB 1T66C 2QJDA 1GGCH 2A73A 1T89A 2CXGA 4JFZL 4NN5C 3MLZH 3L5WB 3NFPB 2VN7A 4X6BA 4PJBB 2MCPL 5ICXB 4N0FA 2DOCA 2HTLD 3QO1A 4MA8H 3H6JA 1S7RA 4FXLA 3FOLA 1CGTA 3WEXB 4N8CH 4LRIC 5TQ0L 1WBXA 4LCCC 4J3TA 3QEUB 2C1PB 3TH4T 3LKQB 3U9UB 1AXTH 3O6FC 4HIIB 1RUAL 1NEZA 4LQ1A 4PJXB 5FOBA 3VFOB 1HSAA 3MFFB 3TP4A 4F7EA 1F90H 3B5HA 5F7EH 1KG0B 4UOW1 4LLUA 4JLRA 3QULB 5F3BA 2DBLL 4QRRD 2IJ0C 3EJYC 4XAKD 1YA5A 1V3KA 2A2QT 3UJTH 4HG4K 4WGVB 4DJMA 1CDHA 4A2LA 5CSGA 3ULUF 5D7LA 5KSBF 1AP2B 3MRCA 5DJDA 5IK3B 1DUYA 1D5BA 2NY7H 3E2HC 3KNBA 3WE6A 4YHZL 1KGCE 5HJ3A 1KFAH 5TDOB 1MI5A 3IDYC 5DHVB 3W81A 3GMNB 2JF1A 3CDFA 4N8VB 4N1EA 5HSFA 1E6OL 5BOPA 1QHPA 3CFKA 3WDIA 2F19L 1G7HB 5JIIA 2IPKB 4OCXL 5KVDL 1U8OB 5EIIB 4MJ6A 5HXMA 4X98A 5DRXA 1JYXA 1ZGLA 1IEAB 3FFCE 1CFVL 4G6JL 4KUCD 5HHNB 3TBVB 5LKNA 4KKCC 3HPJB 2R0LH 5JMRA 3C2AH 3PQYE 3BQUC 3L9RB 3QPQC 3RPIB 1XF3B 3C5JA 4KROC 4MA7H 3HNSL 1T1YA 5FYLE 3QNZA 5F7MC 4X6DA 3WKML 5I17B 4P5TD 5L2KB 4QRPB 2B5IB 3QO1B 2EKSB 3NCBB 1N2RB 3ZKQD 4ZNEE 5BJTB 2LTQC 3WEXA 3DI2B 4NHCH 2J7LA 2Z31A 3VWKA 4ETQB 3QNXA 3BIBX 3LIZH 2OMNA 2Q86B 4MLSA 2ZOKA 4NCC2 2EDNA 3BRFA 3LPFA 3VXUE 1HH6B 2ADIA 4MSWA 4R7DA 3PE9A 4W6YB 4X6DB 3U2SB 4LGSB 2BC4A 1VKXA 1T04B 2YPKB 4NN6C 3TPUA 4AEFA 4PJFF 1CE1H 3L1OH 5D96C 3JVGC 4ODTL 4UNVA 2VXQL 1GIGL 4HAFA 1T21A 2R8SH 4XHJD 5SX4I 5IVXB 1JZ6A 2D7TL 4FQIH 3QQ4B 2VZ3A 5HGGS 1JTOA 4HKZA 4LEOA 2V2TA 3QAZB 3CD4A 3U2SA 1J0HA 3IDYB 4G42A 4KK6C 3DJ9A 1G6VK 5DJAB 5D1XD 4ZUUA 1UKTA 4YNYB 3MLTA 1G7HA 5JLZB 1K9TA 5JTWA 4KJYB 2W9LA 3T08A 1T7VA 3ARDD 4IRJC 5JW4Q 1ES0A 1Z9SA 4JO1L 1XF5A 2P24A 2P5WE 1BQHB 2XWBB 3BP4B 4KRPB 5JW3H 1QBLL 1ZLVH 4FQJL 3VGDA 2GT9B 4KI5E 4PJEF 1UACH 1IAIM 1ZS8A 2IFFL 2VTFA 3O2WH 4NQVA 3QHFH 2DLHA 2E7LC 3QIWB 2V7HB 1CFQA 5IFAL 4IS6A 3CSGA 1FP5A 5ETUA 2WWMC 4HIJA 2PW2B 3NIGE 3U4EA 3ZT7A 2VLJE 5DSCB 3UTSE 3SQOL 4YGAB 4Y4KA 3GDBA 1X5FA 4NSKB 3VGEA 5CCKL 5FHBH 1DR9A 4PRNA 5E24E 3RWHA 4UZGA 5I66B 5DQ9A 1AKJB 3TV3H 2QL1A 5D1XB 5ITFB 1RUML 2PYEE 2P46B 4R3SB 2V7HA 4AEIH 4JY5H 4GKNA 3KS0J 3H9SD 4UILH 4ZUSA 4ODBD 1UXSA 3I50H 2NY0C 1CQKA 1OHQA 5IROC 1KNOA 1R3JB 2GFBA 2VR9A 4NO2A 4UIMA 5AUMA 4DGVH 1LP9F 3GFUA 2BNRE 1UZ8B 1LK2B 5GSRB 2JB6B 4Z0BH 2OTWA 5E94B 4RGNE 1WFOA 4NBXB 1T03H 4X7TA 2JJSA 4GLRH 3W9DB 4R9HA 4AENA 4H25B 1T0NB 3JV0A 3TN0C 5F9WC 5HHMD 1UXSB 1MIEL 5IHUL 4OSUH 2XN9A 4G6MH 1IM3B 3RWEA 2EYTA 1L7TH 4NKIH 1MRCH 3OR7A 3TPKA 1BWWA 3QCVH 1CFTA 3EFFA 5E8EA 3U4BL 3VA2C 3ZE1F 2VE6A 1HYSC 3DURB 3KLHD 3I02B 2F54E 5DT1H 5DFTA 3CC5B 4LPUA 4HUWB 4Z5RB 1QACA 2Z4QB 2ILLA 3BJLA 2RGSA 4OGAC 1JPTL 4EI5B 3VMPA 4F33B 1QFHA 4WW2B 2IQAA 4DKFH 1TPXC 4G8GE 4UT7L 4AH2A 5ID0B 1DDHB 3ULVD 3LH2L 1FFPA 3TA3B 3QRGL 3T0EC 4UV7H 4LCYA 5DD1H 3KYMB 3HUJE 3EDJA 4Q6IB 2W9EL 5KVGL 4K3JL 1XIWB 2K7QA 4OI8A 1AKJA 3FFDA 1ZGLM 5DXWA 1WZ1L 1OAXH 4MJ5B 5I1AA 1IILE 4P3DA 3VGFA 4X5WB 1KJ2A 5D7KD 4R3SA 5GGRY 5HDBF 4BH7B 1M4KA 4M5ZH 4GKNB 5FUOH 3QDGA 5DS8A 2EICA 3QFDA 1MCQA 4UT9H 3FB5A 3E6FB 4MNHB 4OM1L 4PJ9C 1H8OA 2XTJB 1DUZB 1DANT 1MH5B 2JB5L 1KNOB 1R3JA 1WF5A 5LXGH 4Q9RH 4P5MA 1F2XK 5JXAH 2MQ3A 2QQNL 2WP3T 4YXHH 4YXHL 3HLAA 4LOUC 2WBJB 4YEEA 3PP3H 4XPAH 3VXMA 4QHKI 4WHTA 5DS8B 3REWB 1YC7A 5EUOA 1URLA 1JZ8A 2VMFA 3FB5B 5ILTL 3T2NL 1KIRB 2XQBL 4LRNL 1W8NA 5EU7C 4X7DC 4XHJC 1Z0MA 1YPZF 5D4QA 4LHUA 3E8UH 4TSAH 4L1DA 4H1LG 4QF1B 4I0CC 1MCWW 4YDJB 5DRZB 5HYJA 2QTEA 4OIBA 5EWIH 3UC0H 4HUWA 3OWEA 1EHAA 3ULUC 3IJHB 5E8DL 5MEOA 1RJLA 5IW1A 1A4JB 1P7HL 4NRXB 1G7JB 4D9LL 4PJ5D 2EYSA 3QQ3B 2FJFB 1OGTB 4AEHL 4PP2A 3M1BA 2X4NB 2BZDA 4GRLD 2HKFH 4U1GC 3PWPA 4OV5B 2X4OA 4NDMA 4ACPA 1N64L 1TETH 1L9MA 1JF1B 1UA6L 1QSFB 4QRTB 5DA0B 1IC1A 5BMFH 5LGJA 5FECA 1NFDF 5BMFL 2DQEL 2VXSH 5F1IA 4WTXA 1Z3GH 4TUOA 2FL5A 1A3RH 2IALB 2ICWB 3QFDB 3U7WH 5C08A 1JGEA 5E1HB 4RFNB 3O45A 3CZFB 4G5ZL 4KAQL 5KW9L 5IVXE 1U3ZA 3TO2B 2EC8A 1RY7B 3MMEA 2H3NB 5DK2A 3OZ9L 5IMKB 2FIRT 3LKRA 3QA3B 5IBUB 5ICZB 3OJVC 4MD4A 4H1LH 4M6OH 3IFPB 4LVNB 5HVGB 1KF9B 1UQSA 2EEAA 1ZT1A 3C60D 3DO7B 4O9HH 1UM6L 3QUML 5F44A 2QBWA 3QUMH 2UZXB 1JPGA 1MI5E 3E1F1 2D4FA 3MCLL 4UUJB 2GUOB 4WO4A 4XXCC 1FFNA 4Y8DC 2APVA 1ZVSB 4IMKA 1OTSC 3DV4A 3KXFE 5FO9B 1HYRC 2NX5A 2HLFC 3BT2L 3DOSA 4RNRA 3FFCD 5HHMB 5IFHH 4PS4L 3ILPA 2XA8H 3ULUD 1H5BC 2GJ6A 2GQHA 3LKNA 2P45B 5H35A 3BKMH 3D3VD 3OHXB 1LO2H 4P4KD 4I0PB 4CDHA 2X4SA 3VMOA 5DJ0B 2WUBL 4PJEA 4HWNA 4LKCB 3H42L 2EDHA 3L3HA 1A9BA 2YA1A 3IDJB 3N1QC 4JQXA 2VDOL 3MOAH 2X4OB 4NDMB 5IJVB 3ZZ1A 2J8UB 1UZ6F 1UWGH 4QTHA 4OLVL 2Q6WA 5E2JA 1TIUA 3WS3A 5LQBL 3GSNA 3ARPA 3O6KH 4DKEH 4PRBA 4WFEE 1F3JA 3OHXA 3QIWC 1AGEA 2OP4H 2VLJD 5HHVL 2I9TA 3RIFF 3RVUC 4RFOL 5DHYA 3DMMA 3QXDB 1EJOL 3RUGA 3VGBA 4P4RA 4PB9H 1AGFB 2Q8BH 1A6UH 5F6HI 3NA4A 2H3NA 1NJ9B 5DK2B 5FUZL 1EHLL 3WS3B 3ET9F 1RVFL 3I75A 4K3DH 5D2LB 4YPJA 2KZWA 1CE6B 2GITA 2AJXH 1XEDA 4OCRL 5DMKB 1F58H 1QSEE 2YD5A 5DEGA 5EU6B 3VJ6A 1KLFA 4JY4A 5F3HA 3UPCA 1ZV5A 4QRPE 5MP6H 1XF3A 4P46B 1EHXA 5I18L 1JI2A 5IF0A 2CIKB 3VRJB 5CP3H 1DE4B 3ILPB 2G5BA 4HPOH 3O2DA 4P57B 2P47B 4LOUD 4DQOL 4PLKC 4MQSB 1BZ7A 4CJ1A 1UYWL 4MMXC 1AIFA 3Q5YA 4S0TD 1G9EA 4ZODA 5IWLC 1PYWA 3GMMB 2NQCA 2OTUB 2NX5D 2GJ6D 4BKLB 1VFOA 2UZIL 1B4JL 2CSPA 3MODH 3TVMC 5DUBB 3MNVA 2BNUB 3TN0D 5JPNB 2YK1L 4PJFB 3L3DB 1HOCA 1GC1H 2MKLC 3MJ9H 4UI2A 4J23A 4ZO7A 1X5LA 1MHHB 2XWTB 1FORL 4EN3B 3AXLA 5IVXA 5GRXG 2OTUA 1V8HA 3MGOB 4JFEA 4NNPH 4LKXB 2MCG1 5E4EB 4QYOA 3QCTH 4NNPL 4LSQL 3QZWA 3EFDL 4TVSa 4G42B 4F58L 3OF6D 4U6VH 1NJ9A 4F58H 2YEZA 4WI2A 2QQQA 4D0CA 4FQQA 1BF8A 1UCTA 5I1EH 4Y5XA 2C4XA 4X0KA 3RVXD 3T2PA 4PG2A 4XVTH 1NC2B 3AREB 2AK4A 3JWOH 2GT9A 3QIBA 2QQKL 2OQJA 3NCYS 3QFJD 3KPRE 3QZWB 4EDWH 4EDWL 3NMEA 3S3SA 1D5XB 3IAQA 5BV7C 1N5YL 2YEZB 5HDBE 5K33A 3E0GA 3UTTE 4ZNCD 1CGYA 1DVFB 4JB9H 5L7XH 3ETBF 2GSGB 5B21A 4NO5A 4X98B 5DRXB 1LO3H 4NQCE 4X5XA 3WMSA 3TZVD 4WU5A 2M26A 3RFZC 4NWTH 1WGOA 4YJZL 1I8MA 4U4BA 4PRDB 4UILL 4KQ4H 2XZZA 4Y4KC 5AYUH 3KHOA 5E00B 2UVEA 4HUUA 4X9IA 5IR1A 1FPTL 5EZIL 4R7NA 3IVKB 3MNVB 4OGAD 2OXGA 3WJLC 1J05A 1CL7H 1KTLA 4R4FH 1YEJH 3T09A 4IOFD 4P2QD 4OD2B 2PETA 4GRWH 2R29L 3QCUL 2UY6A 5C70A 2VLKA 4R26L 1TMCB 1LDSA 2AABH 4NJAH 5HHQA 3QUZA 1R5IB 3GNMH 1KENL 4FZEL 2VLRA 4JDTL 1PG7W 5B4MD 5K9QI 5IESL 3DGCR 2X41A 5IESH 1A1NA 1I3GH 1F2QA 3KS0H 5KSUB 4PRHA 3LKPA 3IVKA 2DMBA 4XNUL 1VKXB 3C6LA 1RHFA 5LAXB 4N0YL 4KY1L 2FJGA 1IKNC 4HJGA 3G6DH 4X6FB 3WO4B 2NTSP 1TXKA 5BO1L 3QQ9D 5FM5M 4W4OC 1XAUA 2MFNA 4WIQA 5C8JA 1WIPA 3QT2A 1BAFH 3QDGD 3RA7H 3MLPA 3GHBL 3V5DA 4W81A 1MFAH 2Y36H 1CGWA 4DZBB 1GAFL 4HKZB 1MHCA 2PO6C 3CFCH 2NY3B 3GMPA 4EIZC 4Y4HB 2ZP0T 1J9CT 1ADQH 3ABZA 4AH2B 1GPOL 3Q5OA 2YWYA 4RIRA 2LAGB 4ZO6A 4LIQH 1GH7A 2EDOA 2JIXA 1BQHA 4MGXA 2FZ3A 3MYJB 3KYMA 4LDOB 2Y5EA 1P7KB 5J1AA 4PGJA 1M05A 5B3JE 1F8TH 4Y4FB 3HCVB 4Y4HA 4OLZL 5C0ND 3DUSB 2XN9E 4R7DB 2J3SA 4XNMA 3D9AL 4NO0A 1O7VA 3N06B 4XNZC 5F9WB 1CXKA 2AKRB 3LV3A 3VI3F 4XMLH 4Z76A 1CT8A 2YD2A 2ERJC 4I5BB 3QCVL 1P7QB 1SJVA 3MJ7A 1IAMA 2OZ4L 1XCQB 4PJDF 4R96B 3C6SB 4JHAH 3BPNB 1R3IL 1TJHL 2MQ0A 4GKZA 1NBQA 2AEQL 3TCLB 3UYOD 4ZUSB 3O3UN 3D0VA 2FJGB 2VLME 4IM8A 3ARVA 3C09B 3KHQA 4X6FA 5E99H 1F5WA 4N0RA 4Y2DB 4KJYA 5GS1A 3L7EA 4K7PY 3KPMB 2NY5H 3VXRA 2HTKD 2JB6A 4ISVA 2DJ4A 3MGAA 1E28A 1FVCB 2AQ2A 3SKOA 1PG7L 4CMMB 3EYVA 1FN4B 3OTTA 5I71B 1QRND 3MLZL 1OSPL 4GKZB 3AB0B 1OSPH 3SBWC 3HE6D 4NZUL 3FQRA 3OAUL 1NFDB 3LKOB 2HWZL 3I3DA 2XA3A 4IS6B 5B8CC 2HJLB 4X83A 5DD3L 3LQZB 5D6CB 3QEHB 4S1SH 3PL6B 3KPMA 4GXUN 4FTVD 5KBNC 3HRPA 4HG4J 4OFYA 4Y4KB 3KLAA 4OV5A 5I1IL 1KT2B 1H3TA 2LAAA 5JHLH 3VGAB 1BFVH 3OG4B 4MZ3A 4PJGE 5C0CD 2AV7B 4WDIB 1JGLH 1UM5L 4KDVA 1N7ML 1B3JA 4ZPVA 4BFEA 5C09D 5DJXB 3TVMD 1KIUA 3TA3A 4X6EA 3QAZC 3WLWC 2BNQA 1TITA 2XFXB 1AE6L 4NT6A 5GRYA 4UNUA 2EDDA 4HEPG 2YZ1A 2D7NA 5D7LE 4GBXB 3B2VH 3FMGH 3UX9B 3B2VL 3FMGL 2XI9A 1OAKL 2VZTA 3U36B 3B5TA 1L7IH 4IRSA 5I1JL 3H3PH 4OAWA 1EXUB 3D39D 4JFHE 4TVPL 4MA3B 4OCXH 2H2SD 4LHUG 5CSZA 2FLRT 4PTTB 4YDIL 3ARBC 2VOTA 1OF2B 2HVJB 3BN9D 3P9MB 4GW4A 3SDYH 4XC1H 1T66D 2FH6A 3EFFB 4UTAH 1FCGA 1T1XB 2VE6B 2FWOB 4GBXA 4OLYH 1I7RB 5J1TC 3MA7B 4FZ8L 3VD5A 4OTXL 4X5LA 3SDXE 5HHOE 3O11B 5IB5A 4XWOD 4DOHE 4JN2A 4QKXB 2F54D 4XPTH 3D48R 2X2YA 1WBYA 5E6IC 4C4KO 4H20H 5L0QC 4F8TA 3MBXH 3VFRA 1UXWA 3QI9A 4PJHB 2C3WA 3NCJL 1DQLL 2IWGA 2X4RA 4JY5L 1FE8H 1CDGA 4M6NL 3R8QA 5C0JA 2JJSC 4RFEA 2EEDA 3FRUA 4MJ5A 5I1AB 1S5HB 4I18B 2XQYG 1OM3L 5C0GB 4N9GA 2Q87A 4NKDA 4OZGB 3HPLB 1ZT4A 3FB8A 3L3IA 4OGYH 1RMFH 4O4YH 1Q0YL 3SCMA 3FJTA 1OAYH 3QEQD 1PZ5A 5F7UA 4P5MB 1D5ZB 3O4LA 3MLRH 1AGFA 1YYLL 4H0HB 3VFMB 1IEBA 5EZOL 5GIRB 5SWZE 2H8PA 5C0BE 3OKEB 3FO0L 5GJSL 4NM8L 3LDBC 3DETC 1EXUA 1HQ4A 1MY5A 4YZFF 2YPLD 4KFZC 5FGBC 1B9ZA 1I4FA 5INDA 4MDIA 2CK0H 4Z7WA 2DQJH 1YMHB 4R90L 5D5MB 5F3HB 4MHHI 1Z5LB 2MHAB 3IDUA 1FQ9C 3TYFB 5GS0D 4LLWA 3S96B 1LP9B 3MMEB 4TTDC 5DJCB 1AHWA 1T20A 1KBGL 3CVHB 4YDJA 4HPOL 4N0CC 2AQ1A 5I1GL 4GW5B 4O2CA 1EVUA 3ZSTA 3ILQD 1U8MA 2G5BB 3MRPA 5IHBA 5E1AB 1PEZA 3W0WE 5F70A 5C0IB 1E4JA 1FGVH 1KIQA 4Z7NE 5IB3A 4Z7WB 1M7DB 4P23C 2J4WL 4HLZH 2R9HC 3D6GA 2IANA 2GJ6E 1JJUA 3MV8E 4C83A 4QT5B 2C4FT 3FO2B 5C07E 1R3KA 2NX5B 5IWLA 4FNLH 4RNRB 4WHDA 2NY1C 4K8RH 1GZPB 2ICWI 1IL1B 5JPNA 1S7QB 5D7LD 4M61A 2VDNH 2G75B 1H3GA 3DVNA 4OF7A 4XCFL 5FV2A 1KIQB 5C6PB 1CLZL 1YN6B 4U1HA 1N3NB 3L95B 2BP3A 4YR6B 3P11L 4QHNB 5IK3A 4PJEB 4LSVL 3S34L 1RSFA 1YNKH 1LEGA 4LKCA 2WNGA 4PB0H 3VXSD 4XNQA 2L4OA 1F4XH 3MLVH 2OZ4A 1AGCB 1S7XB 5GGUB 1QG3A 2B1AH 4JANA 1EGJA 4U7MA 4UDTB 1I1CA 3K4AA 1AXSA 1T7WA 2IPKA 4L3EE 3IFPA 1X7QA 3PWLA 4QRUB 4YGVA 5C7XL 4HK0A 3CGTA 1AGEB 5C0RL 5GZNC 5D2NE 5C0RH 3TBVA 1XR9A 4JFDB 1TZHB 3KYNA 5DRWA 3BFOA 1A3QA 5GSVB 3ISWA 1NC2D 4Z8FL 1N5YH 5HHOA 4JRYA 2D03L 4UV4L 3SKNB 1LP9A 1JI1A 1RQ5A 4G7YH 4YHLL 3AUVA 5L7XL 1PEWA 2ADJA 3RWGB 1Q9OB 3ZTJH 1BJMA 4ZOBA 4POZC 3R8BB 2HKFL 3S3JA 1PAMA 2DDQL 2Q7YB 5IHLB 1YY8B 1XR9B 2DDQH 4JFDA 3MBEA 1RJZA 2AJZA 1HHHB 2A9ML 4X99B 3RDTB 1N64H 1TETL 5DD1L 1AQDB 1QEWB 3AY4C 3KXFA 5FGCB 4M62H 2X9XA 5CZXD 3SKNA 3SGKA 3FT3A 1OTUD 2CJUH 4DKDC 3L5WA 3VG9B 4Z77A 3GJFK 4K07A 3HC4L 2BC4B 4K9EH 4KK8D 1KTLB 4ONFH 1B0RA 1A4KA 2LV4A 1S7RB 3NABH 3ULUE 3EO1A 4FQJH 2XTJE 1LHZA 2RJMA 3H9HA 1AIFB 5ALCL 1FHGA 4PRPD 3LN5A 5DFVC 3EYSH 4LSRL 2Q8AL 5F88A 1IJ9A 2BFVL 3S5LA 4LHQB 3CVIH 2DTML 3VFTB 1NUGA 3TT1L 2KPNA 2BNQE 2CPCA 3VXNB 1S8DB 4RMUA 5GGUA 1J1PH 3I2CL 3JTTA 4R0LA 1RI8A 3SQOH 1LE5B 4Z0XB 5EO0B 1QP1A 1J12A 5L8LB 1A7PH 3KJ6H 5IB4B 5DC0A 2RQ8A 4JO2L 4MWFB 1RURL 2XWTA 5D2LA 5C0AE 3WIIL 1OP5H 4L3AA 4QRQB 3U30C 3FL7A 4KUZL 5E6YA 1G1CA 3PGCA 1T1WB 5KSBB 4B7LA 3I50L 1U2HA 4YIQB 1S9YA 3UC0L 4ONHA 5DJ8B 5I30L 4P48A 3B9AA 2I9LB 1IQDB 3D3VB 1IZKA 2ENYA 1FV1A 4DUWA 3CFIC 3DRTB 4I9WD 1YEGH 3UBXI 1YY8A 3ME0A 4OF3A 1A22B 4MQXC 4HGMA 4IOSD 3M45A 3PABA 2BSTA 3TF7C 3L9RA 3QPXL 4NQEB 3T0EE 2RIKA 2DQGH 3NCFB 3HMXL 4GQ9H 2FRGP 3IXTA 3L3KA 1UA6H 1HQRA 3HMWL 3TT3H 3ZYOA 1NMCC 3MLWH 5E6IA 4WY7H 1A2YB 4M7LH 4MAUH 5DDHB 5ESQB 3G6DL 4NO5B 2VLJB 4D9RD 2AKRA 4MXQD 5MHSD 4Z18A 3V5KB 4Z76B 4YK4C 2DBJA 4PY8I 3QBTB 4RRPG 1RAMA 4PGBB 2CD0A 1Q9KB 3D18B 3MUHL 3M17B 5F88B 4GMTH 2W38A 1TVDA 1PQZB 4NZTH 4WWID 5FA4A 5ADOH 2AGJH 1I9IL 3MACH 3GMRA 4X7TB 4FRWA 3MACL 2X5PA 4MA8L 4U0RC 1FC1A 5HYQA 3T77A 1KOAA 3HI6L 4OD2A 4I77H 5DGQA 1GPOH 3ALWA 5AWNH 5EO0A 4ZS7L 2N7AA 4Y2DA 1K4CA 5HDOA 5TE6L 1S9WB 2VLKB 1Q9KA 4PRID 4MXWL 3VXSE 3GM8A 2Y4SA 3VXQB 2OM5A 3H9ZA 1PQZA 1KJ2H 3L5IA 4XVSH 3W2DH 1FLRL 3CIQA 3QQNA 3WSQL 1FN4A 3BPLB 1U8QA 4G3YH 1ED3A 5E70A 3O81A 4OZIB 5FB8B 4F33A 2WBKA 1G9ML 2P4AB 3BZEA 4JZNA 4S1SL 4YNYA 1L0QA 3RY6A 5J13B 4X6CF 4PR5B 5ID0A 1JHTA 3QDJE 3VD4A 3BP5B 3BUYA 3HNTL 1IKFL 3RWCB 2NLJB 2CRZA 5FEBA 5KVFL 5I8OL 1LNUA 4KMLB 5FO7A 2XPGA 4OCYL 1UM5H 1OAQL 4NQVB 5FB8A 6FABL 2BOCA 2L7JA 4L4VB 4A6YH 4ZQKA 5C0EA 3O3AA 4DCQB 5LCVH 2KQMA 5F6IC 3BHBB 1OARH 1WAAA 2PTVA 3BD3A 4X6EB 3V5KA 2NTFB 1OTSD 2L7UA 1HXMA 4NNYA 1M7IB 4LCWD 5DJ2A 3U4AA 4HFWB 3RX7A 2Y5TA 1R5IA 5FO7B 1DL7H 3U6RB 3GJFA 3MGTA 1M05B 1QBAA 3CXHK 5D72H 2V9RA 4PJAA 1IM9D 5F9JB 2E8YA 4YHYB 1I7TA 4P9HC 5HYQB 2KKQA 1NCWH 4IRJB 4D0DA 3JSSA 3VDBA 2QQKH 1GOHA 4DVRL 3KPSD 3Q2CA 3TNNB 4DVRH 4LNRB 1U93B 4KJPD 4KXZH 1LK2A 3F7RA 5ICYA 1R5WA 2NXZB 3IAGC 2O5YH 1MFEL 3LOWA 3MA7A 4F7PA 4P4KB 2VDRH 2CDGA 4IEFB 1EEUA 2PTUA 5GZND 1A3RL 4L3CB 5I8EA 1U6AL 3F7YB 3QUKB 4ZMAT 3BZ4B 3FCTB 1LEKB 4GRWB 3KYKH 1NCBL 1CXIA 3QWQB 1IC4L 1QVOB 2HH0H 4YX2L 1JCKA 4HS3A 2GW5A 2HH0L 1G6RH 4YX2H 3VE0B 2CIIA 4WV1C 4HD9A 2NZ9C 5HHXL 5JNYA 3U48A 1VA9A 4RGMC 5GRZA 3PHOB 5HVFB 4XPHH 4P4KA 4OZGE 4XPHL 4EBQL 1O5DT 4L4VA 2YXFA 5C0GA 2Q76A 3ZDZE 1ZAGA 3KPSB 4KK6D 4YEFA 1A6AA 1QBLH 1U0QA 2V2WA 3RWDB 4XCCH 4X9BA 1FFPB 4E41A 5ACZA 4G6JH 3OGCA 2X9WA 1L0YA 1FORH 1WCBA 3DRQB 5DHVH 5GJSH 4NQCD 5H94A 5A2IH 4MA7L 1ZHLB 4P3DB 5GGVL 3W82A 3H0TB 4XPTL 1K4DB 2AXFB 2DTSA 3P9LA 4D0DB 3DX7B 4Q7DA 1MH5A 1P9MC 3OV6A 4U6XB 3PHSA 5A3IC 3O2DL 2VITA 4LLWB 2HFEA 2HMIC 3VXUA 5CLTA 1V7NL 5E9DB 3X13B 2DQHL 4YZFE 3MRPB 2C3VB 3LZFH 3VI4F 1QO3B 3SE4A 1GGTA 3GJFH 3LKNB 1FNAA 1W8OA 1NGPL 4RFOH 1WTLA 3UTPE 3EYFA 3HI5L 5LG1A 5MEQB 4RQQA 3O3BB 1A6UL 1JPFB 3MROB 1MCPH 1NAML 4FMKA 3VE0A 5JZ7D 1VEPA 4IRSC 4WUUE 2ID5A 3KPQB 3LS5L 5DMYA 1KPRA 2LU7A 4EN3D 2WIIA 1CLZH 4TULH 3IKCA 1IGYA 2CMRH 2EYSB 1CICB 1A6AB 1HWGB 2KQNA 4YR6A 4RSVA 4WNQB 3UZEA 2VJXA 5GGTL 2F53D 1IFHL 2RB8A 4HMEA 1E4XI 5C0FA 5SWZD 3DMMB 4X4ZA 5T3ZL 5CSBA 4QY8B 5KOMC 1WCBB 4JFFA 3W39A 3ULUH 1IE5A 1MPAL 1BZ9B 1EFXD 2A6DA 4HDIA 4Y19D 1I3GL 1JMXA 4DQOH 4NRZA 3IKCB 1HKLL 4J2XA 4PJ9B 5D7JB 3QFJB 3IDGA 4X4XA 1U91A 4PJIB 5DMIH 3X14B 3MOBH 2BERA 5GRUH 3DPBA 1H3PH 4ZS6C 2VDML 1RFDH 3TBWA 1AFVH 1KGCD 5AG8A 4JDVA 3VJ6B 3DVIA 4NUJB 1X9QA 4U31A 3WXWH 3RA7L 1H5BA 4KKLD 3BW9A 4X7EC 1EERB 1QSED 4P46A 1K85A 4G7VH 4RMRA 4FMFA 3TZVB 4PYHA 1F4AA 4QNPF 1KULA 4BZ1H 3C09C 5C09A 5FDWA 4XCFH 2F53B 2FEEL 5SWZB 4PV9B 1LO4L 3TBWB 1TQCC 2QQNH 2ATPA 5CGMA 4H88H 3BPOC 3TN0A 2DQDH 1CDJA 1FFNB 1DANU 1UXWB 5HYSB 1FVEA 5FA3A 2FECL 2P5EA 2Y06H 5D8JL 3HC3L 3QIUC 3AMKA 3RWFA 3TNMB 4FOMA 3IXAB 4TSBL 3RL2B 2FX8L 1A4KB 2HT2D 3MV9D 5C09B 1F11B 2FX8H 1KV3A 3LHPL 5E2WH 4O2FB 5H35B 2FIKA 3VWKC 3HPLA 3OXRB 1C5BH 1YC8A 1GL4B 4TPRH 4WNQA 4C4KT 5EWIL 3BEVB 4QRRB 3SKJH 4Z8FH 5DQDL 1YNLL 3FT4A 1BJ1H 5GXBB 3BYTA 1UADC 4JFFB 3W39B 1I1FB 1WWWX 3H3PL 3DNKA 4GG8B 4NCC1 2Q6WB 4P23A 5I19L 1IEBB 3NZHL 4LLMA 2AEQH 3LPGA 3PWJA 3OXSB 4O2FA 2YD3A 2NY3D 3BMWA 4D0BB 4JHBA 2XRAL 1EK3A 1PKQB 3D69A 1AGDB 2Y07L 1Q94A 1AQKL 2VIRB 1ZLWH 5DHYB 2BXZA 3O2VL 4NQSA 2AEIT 5IG7B 5A40E 3VD9A 1E27A 5FF6B 3CLFH 3S96A 4ENEC 4JANB 4XXDB 3MA9L 1BD2D 1NKOA 1S9YB 5IBUG 3QCUH 1BLNB 3VWJB 5CZVL 4G80B 3D2UD 1FV1B 1F13A 5DQJB 2RHEA 1I7ZB 4XWOC 3RY5A 5D71L 3SDXF 4X5XB 1AGDA 3WDJA 2X6MA 4JDZB 1Z6JT 1KCUH 4NQSB 3WHE0 3P4NB 3PWVA 4OLUH 1RZ7H 4WI3A 3MLWL 5A3ID 4ONOA 4CVUA 3FO2A 4LVOB 2V17H 3T0WA 5IVNA 4AZ8A 4YHPA 1K3IA 4QO1A 1QFWM 4RGND 1FSKC 4MX7A 1Q0YH 5ELIA 4UT6H 3T2NH 5J57B 1LO5A 4QEGA 1CD9B 1OAYL 2DAVA 3UXFA 4S1DC 3X3FL 2AK1L 1ZMYA 3P4NA 1DFBL 1T3FB 2CLRA 3BWAB 4MB4A 2IH3B 5FM8A 5D9SB 4ONGL 3MRFA 3T77B 1P84J 4LLVB 4NOBA 1F4YL 1QR4A 4R6UA 4P5KB 4F15B 2YPLB 1GZQA 5GS0L 1G7IA 4OZHF 3LKSB 5TGBB 3QG6B 1S9VA 3RWJB 3VXQA 3IS0X 4D0BA 5T1MA 5KSAD 2NY4B 3T4AB 4R97C 3PWPE 4I3SL 2NYYD 4HUXB 3C5SB 1MWAB 2IH3A 4I3SH 5D1ZD 4XX1G 4JFYB 1SJHB 1S7WB 3HE7C 4RAUB 2VLRD 4NZDA 5CILL 4NQEE 3T0EB 5C92A 1JNHA 2VDKH 3SJVB 1BD2E 3BZEB 2YWZA 3GK8H 2VISA 4FQQB 2PXYA 1TQBC 3T8XA 3CMOL 1KXVC 3ZDZF 5J0BA 4PGCA 1N59B 4EI5C 4G8EA 1WWCA 2Q8BL 4PB9L 3P77A 3PV6A 3B8YA 3V5HB 4K8RL 2G60L 1T1WA 4LEXH 4ENED 1PFCA 1TJHH 4PJ7F 4WHYG 4GMSH 1KXQE 3VGHA 4A6YL 1RD6A 5JUEH 1I75A 4EOWH 5SX5H 3G08B 4HUVA 4XGZB 3VH8G 1U8JA 3BN3B 1I9JH 4URTB 3TIEA 4HH9A 5KSAB 4G8EB 1VENA 3WFBH 5C0CA 5GGTA 2DJSA 4FG6D 2CR3A 3NPZB 3PABB 2EXWD 3MCLH 4X7SL 4M7JL 5EUOF 4OCLC 1T3FA 2CLRB 4PJAF 1VESA 1CLOL 1N26A 4YBLB 5EFIB 5EPMA 1U8JB 4M8VA 3TCLA 4BZYA 5DDHA 4TUJA 4DUXA 1FL5B 1CD1A 4HKJB 5I1IH 3TNNA 4FQCH 3LB6D 1MFEH 3MBEC 2BMKB 3OB0H 1S7TB 2VL5B 5I9QC 4KVCH 5T1KD 5IJKC 1MVFA 3LN4B 4K7PH 5DR5L 5TPWH 1SJHA 3WNNA 4RAUA 3RZCD 5CD5D 4OI9A 4ALAL 1N4XL 3V52L 2Q3AA 3V7AG 4TSCH 1CD1B 1N0XH 4APQD 3ULVF 3V0VA 5DWUH 3IFNL 3QWOB 2A0LD 1ZKAA 2NY6C 4I48B 4HS3B 1WBZB 5J11C 3DXAE 3SGEH 4K9EL 1G7PA 1U8QB 1KB5H 2WZPD 2XKNA 5AZEH 1JPST 3KPRD 1U58B 1CK0L 4OKVA 1HQRB 2D7QA 2V5TA 3HE6A 4RMSA 2Z0BA 4PR5A 3ZTNL 3ZYIA 2R0LL 4HUNB 4K3EH 4MJ2A 3IGAB 4WI4A 2AEPL 3B2UC 4NSKA 2UWEA 4JHWH 5D1QB 3GMOA 1EDQA 3MLVL 5DQ9B 4X7CC 3OAYH 4UIKH 2EDBA 3UTSD 4HLZG 3UDWC 5EU7E 2R2HB 4ZQKB 4GJTB 3WFDH 4JO2H 4FXKB 5FYLL 3DX7A 3ULVL 5HGDB 5E9DE 1ZANH 5B39B 5INCB 3RI5K 2WBWB 4AIZB 3TO4A 4XP6L 5E08L 1CVRA 4BA8A 1CIUA 5CJOL 1QHOA 1XGTA 3NCEB 4M8QB 2PCPB 3CXDL 5EOQH 3C6SA 4KK5D 3T0BA 2P5WD 5T5FH 1S9KC 1ONQB 3D39E 4XPFH 3TYGL 1JWUA 3NACL 3QEUA 3R06A 3LQAC 5TF1H 1NMBL 4Q9QH 4JZNB 3GNML 3MRKA 2XZAL 2NY4D 4LNRA 2D7TH 4FQIL 1S78D 3S4SG 4J4PC 1MCNA 4DTGH 5CZXC 1FYHB 1BIIA 3T2QA 1EHNA 5BRZB 2JTDA 1RULL 3MV8D 4DOHB 2Y9RT 5JIKA 1AI1L 3NCMA 3HC4H 4BH8A 4EXKA 1CGSL 1TJGH 1P2CA 2DQJL 3WE6B 1S7UA 3C8KA 4AIOA 4U7KA 4U1KB 2OJZL 2NY6D 3F12A 1ZT4B 1F4WL 2HFGH 3GMNA 1BFSA 1EGJL 1NCDH 4U1NB 4Y16B 3DSFH 2NW2B 4QY8A 1D6VH 3O3EB 1PY9A 5D1QA 4NC0B 3GSNH 1OWWA 3HI6H 1FGVL 3OR6B 1B88A 3HPJA 4PG2C 3LZFL 3REVA 5FYKU 2DL9A 2R2HA 3AS1A 4PRIB 5HGAB 2VABA 4POUB 4HV8A 5FKAA 3RY6C 3HR5A 2E9WA 2X4UA 3ECBB 1I1AA 1FLRH 1OB1A 4XTRD 3MQIA 1QFWI 5MI0B 2NMSA 3SPVA 1WJ3A 4DFIA 3TFKD 3EYUH 2EKSA 5F9OL 1JF5A 4F9PA 1HIMH 2YD1A 3UTQB 1BEYL 5LGHH 3IS1X 1A6WL 5JHDE 1JWUB 1M71B 3IRPX 3WHE1 5CFHA 1T80A 3O9WC 5C6TL 1JP5A 4APQC 1KIRA 3C87A 1AC6A 1F4XL 1UVQB 3P2TA 4L3EA 3FO9B 4HSQA 2P43B 2FWOA 1VADA 5B4MC 3Q48A 1QFWL 4L4VD 2Z91B 5FDYA 5A16A 3O6LL 3MR9A 3PHOA 4W4NA 3O6LH 3IDNA 2FO4B 4KJWC 4M61B 4H8WH 4XNUH 2JLLA 3X3GL 1OARL 1LO0H 1INQB 1N8ZB 4L29B 4QRRE 3VRLE 2BSSB 2FB4L 4TPRL 1S7UB 3C8KB 2FLBT 3KPOB 2ZCLH 1OAZH 4OZHE 3U0WH 1XGPA 3OXRA 3EYFB 1HI6A 1WLHA 2EDJA 4YE4L 1GGCL 5EC1B 3VFRB 1DQQB 1KSRA 3U0TA 5FYKH 4KPHH 3SKMA 2DYPD 1OTUC 4TTDD 4PLJC 3OAUH 4XBGA 1A3LL 5JLZA 5CD3B 3EDDA 4G7VL 1TJIH 4DKFL 2XQYK 2WUCL 1MOEA 1TJIL 4BSWA 1CZ8L 1FNEA 3CDCA 4X4YA 4KV5F 3H0TA 4YGVB 4NHUA 1BFOB 4P5TC 4HV8B 1S7VA 1WC7A 5FKAB 3VGAC 2ZUVA 2DWEB 4ODSH 4RZCB 3Q3GA 3U7YH 5D1QD 4PP1D 4XBPB 3SOBL 4DGYL 2YBRA 2D2OA 4H8WC 2JJUA 1SMOA 4Z7UF 3NABL 3FO1A 4Z7OF 2MSPA 5C2BH 5EU6D 3FB7A 1U91B 4PJIA 3N1MC 4XNXH 3X14A 5E2WL 3T0XA 1TTGA 1AD0B 4QNPE 2DWEA 4RZCA 4BSVB 2YD9A 4BQ6A 4J7RA 1UVQA 1IBGL 4X99A 2C3HA 5TE4H 4UUJA 1WCQA 3ZYJA 1PJ9A 35C8L 2IPUK 3BE1L 1AHWB 1SQ2N 1I85A 4Y2DC 1A7PL 1J8KA 5EH1A 4EKXA 5HGHB 5E6ID 2NY5C 1IGYB 3CX5J 5SWZA 1W0YT 1WFNA 3BZFB 3X3FH 4ELME 4HIXH 3G04B 5KANI 4HHAA 3OKMA 3AAZB 1HSBA 4MNGA 4BFGA 3G6JE 1QPPA 3L3HB 3JWOC 3V4UL 4HKXB 5TDNA 4XMKL 5I30H 1MUJB 5FO8A 4CL7A 3GSWA 3HZYA 3N1FC 2IF7A 5GS2H 4D9LH 1UKQA 2G75A 2JCCF 5I1DB 3AS0A 4UTBH 3WD5L 4OM0L 5E2TH 1JZ2A 3CH1B 4IOFC 5T5NG 1DQLH 3T3PF 1S7VB 2OR9H 5H37G 1TQCB 1RUKL 1V7NH 5I16A 5IT2L 4HUXA 3L7FB 2F9BT 3QH3B 3KLHC 4NUJA 4EVNA 5IIEA 1MUJA 3OKDB 2NR6C 4P4RB 5CJXA 1LDPH 1XGUA 2Z92A 4DFHA 1RUPL 4DGIH 5JHLL 1U3HB 1NGPH 4NBZB 3QO0A 5BZWA 3DGGB 4Q6IA 4QRUA 4UT6L 1YEEL 4ZAKA 2N4IA 3ELAT 3EO9H 5KANG 4EEEA 5FAAA 1INDH 1NGZB 5CKAA 2J6EL 4I2XE 4DAGL 4Q2ZA 1NGXB 3RL1B 4M6OL 1CLCA 4N5EC 2ADJB 4Q6YA 1JWSA 4M1GH 3GJEB 4OZHA 1SVCP 1T83C 5GGTH 1SJEA 1DQDH 1MCIA 3FONB 5KN5B 3HLAB 4N9OB 3MJ9A 3G04A 5EBLB 4AEEA 1FO0A 3SDYL 5ISZD 4CU8A 2X7LB 3O9WB 4N8VG 3UTOA 1NGXA 4K94C 4QXTA 4NZJA 4Y7MA 2BNUA 2NW3A 2DLTA 1WZLA 2LABA 5DVNA 4JEGB 3H9YA 1KTDB 3ARZA 3V0AC 1TZIB 4LPXA 5I1DA 1RFDL 3DXAD 3SEPA 1SJEB 1LD9B 5EU5B 3B9KC 3JBG7 4ZTPH 2ZPKL 5I74C 3JTSA 1HILA 3MCKA 3ARSA 2VIRA 1JYNA 2VDNL 5CJBA 4Z7VA 2BSRB 5F7DA 4Y5VC 3DTXB 1C08B 5EZLA 4MB5A 5FF6A 5DD6A 3VA6A 4PJIE 2F8OA 4PD4J 1W72H 1UZ6E 3LEVL 4MXQC 4DGVL 3HE6C 5EOTB 5L2JA 1L6ZA 4PY8J 5EC2B 4NKMA 1G9NC 3H9SB 5HHOD 4EI6A 2FX9L 2LU4A 3FN0H 1BVLA 4U1SB 5DA4A 3DO3A 3I85A 4KKLC 5L88L 3E2HB 5EORH 2C3GA 3GMQB 4K7FA 3RKDD 1I8IA 1YMME 2HRLA 1RVFH 2PN5A 3AU1B 5C0BA 5GGVY 2WLYA 3ZT5A 5TQ0H 2BVPA 4P2OC 3S37L 4FQ2H 1C5BL 4ZO8A 1CD8A 4MHHG 4NO0D 3MV7A 5DURD 3HE7A 1XGQB 4WU5B 3BRDA 2DN7A 2F54B 2KL6A 2VDRL 4G7YL 4PYGA 3GEWB 2PYFB 4K55A 4K94L 3Q0HA 5DRNB 5GISL 3MRHA 3FTGA 2JK5A 1I8IB 1BP3B 1DP0A 1S3KH 3C60C 4K71C 3QFJE 3V52H 5E6IB 1V7ML 4KK9D 2OR7A 2B1HH 3JVGA 2B1HL 3CLEH 5C07D 5EUOE 5I15L 1FGNH 4WI5A 1G9NH 4XP6H 5E08H 2W0PA 3QXVA 5HD8D 1RIVL 5LWYL 1IAOB 1WAAF 2J4WH 1XMWA 3CXDH 5EOQL 5CJ8A 2IMMA 5CAYB 3CNKA 1AFVL 3CFEB 4KRLB 1XH3B 2R4RH 4CVZB 5EIQA 3TO4C 1Y18A 2R2EA 1VFAA 1A1NB 3HUJA 5JZ7C 4JKLA 5EFIA 4BZ2H 4I0PA 4WUKH 3C6LB 4Y8AA 5BS0A 1AR1D 4XP9H 1C12A 1BQLH 2H32B 2XZAH 4JFQB 4HZLB 4FQ1H 4PBXA 4PPTA 4WTZG 3GBMH 4ZFOB 4U2YA 2DTMH 1UB5A 2CO7B 1DSFL 1XCTB 4X4ME 1N59A 3QCTL 2CIIB 1YNKL 2SEBB 4JHWL 4MJIA 3H7BB 4EDXB 3MPCA 3MSPA 3PGDA 3NAAH 1MFNA 1ED3B 4XPAL 5E2UL 4AG4L 4QHLA 4E41D 2AJ3A 4NO3A 4JGJA 5FXCH 5D8JH 5BS0B 2BSED 4G6FB 1YZZA 2BVQA 2H32H 3G08A 3A6CH 3RVWC 3ARFD 4J3WA 2FBOJ 4JM4L 3V0VB 3CFBB 4I3RL 3JWOL 4HMDA 5KSAA 4QOKA 1BZQK 1EVTC 5DVMA 2FNBA 2IPTH 4NWUH 1AH1A 1H0DB 1DLFH 4WO4C 3DRQA 2R39A 1G7PB 4Y88A 5GGSB 4ODUB 5JIHA 4PJGF 2P49B 4UBDC 4KI1A 5TF1L 2VH5H 2HTLC 3RU8L 1RJYB 4U3XA 3BHBA 2FSEB 5FUCE 2BOBA 1FL5A 4HKJA 5T1KA 3SY0B 4F57L 1NC4D 5EBGA 4F57H 4MVBC 3WUWA 2D31A 3S88H 5EG6C 1SYVA 2ORBH 3FOLB 4FQXC 4CVZA 5GJTH 2NYYC 2BDNH 1RK0B 4JVUA 4R4FL 1JRHL 1OL0A 1JRHH 2P8PA 4NKOB 4FXKA 3VWKD 1RJYA 2PW1B 1KEGH 4HIIA 5I1LA 2X1QA 1VFMA 4LARH 4AIZA 1KG0A 3SQBA 3WUWB 2R1WB 3UROR 1CBVH 2EH7H 3MLYH 3BXNB 1HNFA 2IBZY 1FL3B 2CDFB 1ZXQA 5CBAA 4OLUL 5IFAH 3O6FD 3IDNB 4I77L 5DMIL 1B6UA 4KGJA 5JOPE 5HTSA 1UG9A 5SX5K 4PJ8C 1JPSH 4TVPD 5DEZA 3S4SB 3MUGA 2DI9A 2R1WA 3MV9A 4G9FD 4G3YL 2WAHA 4Z7UA 2FDBP 3P30L 2D9CA 3EYUL 4TNWF 5DO2C 4RFNC 5IFHL 3D85D 2ICES 3O4LD 3U46A 4AJ0A 5GGSA 3FFCA 1M6OA 4OD3H 2VQ1B 1ETZB 2AK4E 5D7JA 3IDIA 1VACB 5B3JF 3BP7A 4U1LB 1SM3L 2A74A 4N0UE 5D2NA 2FSEA 4LLQB 2E9IA 5F7EL 1JGDA 5E5MB 4JDVB 3QNZB 5F1NA 4OCYH 3BDYH 2YBRB 3MJ8A 2ADGB 3L3JB 1WAAE 2B20A 3ZDXF 5IHUH 4XNXL 3WL9B 1DN0A 4OJFH 1QRNE 1LE9A 4YHIA 3T3MF 2VABB 4D8PA 1NDMA 5ESAB 4I0KA 1CD0A 4JPWL 1TCMA 1BD2A 5F9AC 3KJ4C 2HN7A 5I75B 4OD1H 4F2MA 1GGYA 3TGXA 3MREA 3MRKB 5JXEA 5DYOA 2YPKA 1T1XA 4IIQC 4HBCL 4NN7B 4ZXBB 4Y5YA 1I7RA 4N5ED 1IGIL 3FAXA 4PJ8B 2JJVA 4RBPK 1QO3A 3LSOA 2OJEB 3AVEA 5E99L 2Y07H 1OOAA 5LGKA 2EC9T 5AWNL 5IVZA 1F02I 1U3HC 2FIKB 1R0AH 2AJYL 3OKMB 5B39G 3VW3H 4TQEH 3RHWF 4Y16A 3SOBH 3LD8B 1N0LA 1OQXA 3GSOA 1AC0A 3VDCA 1FVDA 2IFGA 1DQJA 5DD0H 2J8UE 1IRAY 5BZDA 2EXWC 2I27N 2XN9D 3FRPG 4P2RD 1XF5B 2P24B 3ZL4L 3IFLL 4AQOA 2VQ1A 1F6LL 1YY9C 2QQLH 2I26N 1ZOXA 2QHLA 4OLEA 1MCEA 5HGAA 1NAKL 5IT2H 2HLAA 3IU4H 1ZLWK 5GQBA 5IV2B 2AJVH 5F21B 1X5YA 2AJVL 1XF1A 2BHZA 3OKDA 2WBJD 3G5XB 5FUCC 1UCBL 1XGUB 3SPVB 5FKPB 5JDSB 2IH1A 3VXPB 1UCBH 3RUGE 5JR1H 1P1ZA 2NXYC 3VWJA 3WL9A 1NLDH 4K3GA 4X4YB 2AI0L 4JM2F 4X6CA 3T1FB 5BOZG 3LMJL 1FZMA 5DJZB 5L6YL 4XCEA 2YSSB 1TENA 1VEMA 3E8UL 1F00I 4JVWA 4Y4FA 3R1GH 3MLUH 4MDIB 2W92A 4GW1B 2OLDA 3VFGH 4IMKC 4XNMB 5T3XD 3G6JB 1EEYA 1MHPL 4NM4L 5DLMH 1RZJC 4UDUB 2IG2H 2AXGB 2A83A 2EDRA 2E7CA 3PGFH 3VWKB 5AEAA 3GJEA 1HHJB 4AEHH 3GBLA 3HG1A 2EE6A 3S3PA 2Q86A 2AQ3A 5C71A 3SCMD 1NCUA 4ODWA 3RI5F 4IJ3C 3SDXA 4NYLA 5TDPA 2BCKB 1XT5A 1I1AC 4R4NC 3GI9H 1DBJL 3MJGX 3OX8A 2BVTA 2YPVL 3WHXA 4UBDD 1RUPH 4LGRB 4KH2A 1OTTD 3P4MB 1Y0LA 2YXMA 2FYYB 2HTKC 3HAEH 4BSWB 3HG1B 2R1XB 3DX9B 3WFDL 1FVCA 4U49A 4FXGA 1CDCA 3TV3L 5MEND 1R24A 3I6GA 2PO6B 2DKUA 5JW4M 4I2XA 3FQRB 1D3CA 2IADB 3B9KA 4V1DB 5E6ZA 4YPGA 4EOWL 5AYUL 2VRAA 5HHXH 1CTNA 4MD5A 2E27L 3HZYB 3HE7D 2BRRL 2BJML 3Q1SH 1IAIH 2V9TA 5KS9A 2XG4A 4LLMB 3WFBL 4YAQB 1S78C 1WFUA 1JNNH 4S1QH 4YXKL 1DQDL 5T3ZH 2GYSA 2J8OA 4LCIL 1CF8L 3P9WB 5HI5D 1TTFA 2YUZA 1MCLA 1UH3A 3NIDE 4Z7VF 1A7OL 5HHOB 4FFZH 2HVKB 4S2SA 3GMQA 3QNYB 4OZ4B 1U8NB 5D70H 4NKIL 2BNQB 4QGYA 4KZDH 2W91A 3RWGA 5CBEB 2VDMH 4HH8A 1TNNA 2WWKT 2ED9A 1MFDL 4WJ5B 4HK3J 5K9JH 4UU9B 1RUQL 1FCCA 3IFOA 1BOGB 4NYLB 3O2DH 4MNGB 5GHWL 4IRSB 2HJKB 4DW2H 3MRMA 3IF1A 4O00A 5I9QB 4Z6AT 2DQHH 4MCYB 5FO8B 1ADQL 4GSDH 5KSBE 5IMOA 5IGXH 4BQ8A 4Z9KB 4P2OB 4LIQL 1L4IA 2OTWB 4H88L 2IBBA 4NQDA 5E94A 4J4PA 3U7YL 2P5EE 4K3JH 4RGOH 4Q74A 1F90L 4JZOB 1MSPA 4MQ7B 5TH2A 1EJOH 2VL5A 1ZA6B 3MRMB 1T03L 2OTPA 3FQWA 3LN4A 2IADA 3B9KB 4V1DA 1CFBA 2DD8H 4DKAA 1F3DJ 4GXUM 1KJMA 2XN9B 1T83A 2FJFA 2OI9B 1MIEH 4ZDHA 3SO3C 5F96H 3DVGB 2X4NA 5JXAL 3QI9B 1U9KA 4F7TA 4YHZH 2NY0D 4XMLL 4XP1H 5ERWB 1XCTA 4HC1A 5EU4B 3MXVL 4QCIB 5D7IB 4I18A 4Z7VB 4FQHA 2E8ZA 4EN3C 4NKDB 2HVKA 4OZGA 2AJ3B 4HWZA 1NMCB 1AXIB 3W0WB 3DVGA 5C08E 4QXUL 2DWDB 4PD4K 5TQ2L 4HWBA 1GRWA 2NY4C 3O2VH 3IGAA 4ZUWA 4LP4A 5IOPA 5GIRA 3UAJC 4XMKH 2DQCH 3TBSA 3V5HA 5E8DH 4PGEB 5CEXA 3WKMH 4RGMB 1OP9A 2HFTA 4PLOB 4B41A 3O9WA 2COQA 1HQ4B 4MCZA 4Z7QE 2EIDA 1G0YR 4YHNA 5DD5L 3K4ZA 3EYQC 5D71H 1BM3H 2CH8A 4WFHE 4OM1H 3LS4L 3BI9X 1MJ8L 4LAJH 1MHEB 3Q6GH 3WN5A 4PJCB 2CJUL 2CR6A 3MCKB 3VFSA 1OQOA 4J3OC 1U36A 4NC1E 1UB6B 2EIEA 4RDQF 4NPYA 2GSIA 4DK3A 2MNUA 2AJUL 1U8KA 4FQXA 3EO9L 5C2BL 4QOKE 2W60B 4M1CD 4YHYC 2JCCB 4DN4H 5EBWB 5ISZA 1GGBH 4PLNC 1I1RA 4QTHB 2B2XL 3O41B 3WO3B 4LK4A 4RAHA 4DZ8A 2PYEA 1T0PB 4WFGE 5DQDH 3RJQB 1D6EB 1NFIA 1G7JA 3CX5K 3HUJB 4Q0XL 3WUZA 3PL6C 2CLVB 1JK8B 3RNKB 1ZLVK 1IVLA 2EYRB 1AGBA 5JW3L 3AU1A 2B39A 1Q1JH 1Q9WA 5DC4B 4M93C 2PR4L 4UINL 3MUGB 1UACL 1NSNL 3DARA 4JO4L 2QHRL 5EBWA 3RVVC 3GIVB 5I71C 5B3NA 1QSFA 4JREC 2ARJA 5SWSD 3NIFF 4DZ8B 3E6HB 1N6QL 4ZOEA 4WEBH 1TVHA 1ZSDA 4JKWA 2XKNB 5JXED 3V4UH 1J5OL 3V6ZA 3NN8A 4P2QB 1EH9A 2FBJH 1YDPA 2VUOA 3IDIB 3FB6B 3JZ7A 4PRAA 1FFOA 2A1WH 2P1YA 1CYGA 1YEGL 3RQ3A 5J13C 2X4UB 3BISA 2X4QB 5ABDE 3NCJH 3E6HA 1HXMB 1I7UA 3H2WA 1QNZL 3TA3D 2ENSA 3VRJA 4X6DE 3WN5B 1A7RH 4M5YH 2Y5TB 4PJ5E 3O6KL 4DKEL 1Q38A 4G8GA 4ZUVB 3EYOA 1VFAB 4RCAA 5C0CE 1XIWD 3VH8A 2AJZB 3HI1A 4G9DB 3SHSA 2AJSL 2X10A 3OJMB 3K0WA 4OD1L 4JFZH 4MNQD 4OIIL 4JFFD 2BOBB 4JFQA 5GRWA 1G0XA 4WUUB 3EJYD 2YN3A 1HE7A 2IMNA 5DUPH 3X11A 3FQTB 3D39A 3GHBH 3S36L 2JCCA 2EXYC 2DLGA 4Z77B 2ZUXA 5HDQH 2YD7A 5F3BB 3SE8H 1B0RB 4F9LA 1FJ1B 3EO1B 4JKKA 4BFIB 3MR9B 5E7BA 1ONQA 2CDGB 3FN3A 3P40A 4ONGH 4ZXBD 43C9A 1W72A 4YK4B 4NKOA 4EN3A 5I8EB 4PV8A 1R0AL 1JK8A 3RNKA 2IQ9H 5DURB 1J1OL 3EOBB 5I1LB 2CK0L 3KPOA 4U1JA 4OLWL 1HI6B 4IDLA 2DKSA 25C8H 4XVSL 3UTTD 2Y7QB 2EO1A 2EH8L 3EHBD 1FVDB 3GSNB 2EH8H 4ALAH 4XBGB 1CFSB 1QLRA 4E9LA 5GS0C 5I15H 1BQHG 3QRGH 4JJHA 1OW0A 1FIGL 3EZJB 4F15C 4U1KA 5B8CA 3QQ9C 1JGVH 3DETD 4HWEH 1BFTA 3OGCB 1U3HD 3WIFB 1OP5K 4ONHB 1HCFX 4FNLL 3O3EA 4JCMA 3CU1A 3VFVA 4O51B 4JE4B 1SY6A 3BQUD 3NFNA 4LPWA 5HGBB 1XZ0A 3DRTA 1FZJB 1UJ3C 1ZVYA 3AMLA 1CE6A 2GITB 3B8SA 4LMQE 3QUXA 4N5UA 4NGHH 4KWUA 4YDLC 5DMKA 5LXGL 4G9DA 3HI1B 4P59L 2KBGA 1YQVH 2AEPH 3P9LB 2CDEA 4P99A 1ADQA 1JFQL 4NIKB 2PNDA 1PZUB 1NBZB 5IR1B 2EIZB 3UTPD 3UO1H 4LRIA 3GSQA 3NFPA 1JHLL 3T3ME 1BX2B 1OP3K 3L3JA 3PQYD 4M9PA 5CIPB 4MXVE 4BFIA 4YQXH 5FCUH 4HT1L 1M71A 1SYSB 2XTJD 4KXZI 5D96B 4XI5C 1REIA 3DUUA 3RWHB 2VLRB 3EOBA 4WVRA 5GZOC 1LWRA 2IPTL 1N5AA 4NWUL 3IU4L 1ORQA 4PRHB 2JE8A 4RQQB 4U3CA 4TVPE 4ZFZB 2IC2A 1VADB 5C3TA 3P4OB 4JB9L 2E6JA 2Z8VC 4HJGB 3MV8A 5TE7H 3MLTB 2FYYA 4KMTL 1R3LB 4E42A 4YFLF 1E4WH 2NR6D 4I8DA 4KI5C 2XWBA 4QXGL 2OJEA 1M6OB 1AP2A 3MGOA 3LMJH 1U8LB 2EDFA 1EFQA 5DVLA 1N5AB 3IFNH 1YNTA 1YEIL 4PRPB 1JGDB 3ARED 5CUSL 4MMZC 1CFNB 5CUSH 1U92B 4WWKB 3Q1SL 3I9GH 3THMH 1NBVL 3NZ8A 2ZUSA 1IQWL 2X4PA 1A47A 3QXWA 2Z8RA 3P0GB 3DGGA 4KAQH 4M7LT 1MFBH 4GRWF 4HWUA 4WV1B 1EBPA 3EYSL 2CDEB 3T04D 4XC1L 3QP3A 3RIAK 2FECI 3UDWA 1OLZA 1A0QL 1K2DB 1MFCH 2ESVB 5J7CC 1B4RA 1G7MA 3C8HA 3RJDA 4JFHD 1TVBB 1M1SA 5GPRA 3KWWB 2DM7A 1T4KB 5I17A 3PDOB 4CUCA 3BDBA 4S10A 2HRPL 4QRPA 1A6VH 2MTPA 1UM6H 3LV3B 3OKKB 1KB9J 1DBML 5EA0L 1BAFL 1MY7A 4OCSL 3KPPB 4XRCB 1VGKB 2CGRL 5GRVK 4YFDB 2YD8A 3B43A 5D1XC 1K2DA 4GLRI 5HYJD 1RU9L 2B4CL 3AS2A 2YC1B 5J9PB 4J6RH 1KELL 3RWIB 3QDMA 5B38G 4UDUA 4IRSD 2IEPA 1CGXA 1E6JH 5IMMA 5BZDB 5L2KE 3C60B 1SM3H 2DRUA 4X8JA 1U93A 1U2CA 3OB0K 3BGMA 4NZRH 4Q9QL 1KJVB 3BZFA 1CLYL 4MQ7A 4NNXA 4JGMA 2XZQH 1Q72L 4WW2A 3QDMB 4H8WL 4DTGL 4PJDB 4N0YH 4GXVH 2GY5A 2ORBL 2IH1B 3K8MA 4FQ2L 3VXPA 1A1OB 4EQ3A 4I0PD 5F7FA 3QXUA 2OZ4H 5FYKL 1FNFA 1QLFA 1HHKB 2OK0L 1D9KC 4LHUD 2WK2A 2XICA 5C0AB 7FABL 1MCFA 3HR6A 4CU6A 7FABH 4GAYA 4GW1A 4NRXA 5ADOL 1KJ2B 2VLMD 3LRSB 2EH7L 5IIEB 1T5XA 4K3DL 1T4KA 4J3UA 1W0WB 2I07A 3G6JA 1BBDL 1XGRA 4K7FB 4QXUH 1ACZA 1A1OA 5FHAH 2J88H 5EZJA 3G5YA 1UGNA 2A83B 5T5NF 2WIMA 3MYJA 2XT1B 5IW3A 1NL0H 1PG7H 4RWHA 3GBNL 2P5WB 2VXVH 3PP4H 4N0UA 4QRPD 4TQEL 3ZLQC 1IMHC 4MZ2A 3GIZL 4LSPH 5L0QB 4GAYB 3JXAA 3Q5TA 5FECB 3WSQH 5TDPB 5IP4A 4XVUD 2OL3L 4WHTB 4PJ7B 2DLEA 4APQA 2UV3A 1QFPA 4OZIE 1NH6A 5GRVL 1BEYH 5LGHL 1A7QL 3A6OA 1OF2A 1MJ8H 3P9MA 1NAKH 1NANH 1E0OB 4LHUB 5JHDB 1DSFH 5F7HA 3Q6GL 3CFDA 3EHBC 4PRHD 3O8XC 1V3MA 3A67H 1P4LB 3X17A 4NNXB 1NDGA 1QSFD 5BV7H 4MB3A 1X4XA 3AROA 6FABH 1QFWH 3QEGH 4M48L 3RKDC 5JW5A 2X70B 3K1DA 5CWSB 3VG0H 4IDJL 1TQBB 4PFEA 1NEZG 2W60A 4S11A 5ITBL 1W2KT 4Y2OA 4NJ9L 1S9VB 3S5LG 2HA1A 1MHPH 4HCRL 1KJ3H 4RDQG 4KRPD 1KJ3L 3LEYL 4LF3A 4GBXC 3W9EA 1Y6KR 3GI8H 4QWWD 3T4YB 3W11D 1V3JA 5F1IB 5GGRB 5J12B 3PGFL 4HIHA 3DTXA 1CDBA 3WLBB 2FL5B 4UTBL 3WD5H 2L0DA 2C1OA 4KKNA 4F7TB 4LCYB 2H26A 3STZA 4GUPB 4C56B 1PZ5B 2GEEA 2PKDA 3U0PB 5MI0C 2CKBA 3BKCL 5IMKA 1XIWA 4LF3B 4QCIA 1BREA 4UU9A 4RISL 4Y1AD 4PJ9A 4RISH 4DGIL 4PRHE 3MA9H 4HIHB 2IANE 1G1YA 2WANA 43CAB 1AR2A 3U30B 3NN8B 1MEXH 1AO7D 1U6AH 1QD0A 4OQTL 1LO3L 1UH4A 2EKJA 3CCHA 4WFGD 2H2PC 1T22A 2AP2A 3LAFA 4KTEH 3T65A 3ZKMD 4RBPH 1FBIL 5IMOB 3G5ZA 4M43H 2GUOA 4MAYD 1CBVL 2WBJC 1IC4H 1CXEA 4IIQA 4CNIA 1A7RL 3NOIA 3PDDA 4V1DD 3TBYA 3GSVA 2F54A 1HHIB 4G8FB 1OM3H 5JPMB 2HJFA 1INEL 4L5FH 4OAWB 5T3XH 2GTWB 1DEDA 4OZFA 5F7WC 1T1ZA 1JNNL 2ATPB 3TFKC 3CPLA 1JZ3A 2WMPA 2GTZA 1GHFH 2AI0H 5IVOA 1G7LB 1VEOA 1MF2L 1I9RL 3K1KC 3BT2H 4Y19E 1EA9C 1OD7A 3O2WL 1PX4A 1TCRA 2BVUA 2OL3B 4JN2B 1FJ1A 3T4YA 3QWRD 1A4JA 2ITCA 1J0JA 1WBXB 1F4YH 4XI5D 3DI3B 2A6IB 4X4MA 4PV8B 1P5VA 3GMMA 4ORZC 4P0DA 1CCZA 4QRRA 3CSYB 1JNLL 5BVJA 3PV7A 5HYFA 5MEPB 4XB7A 4CVXA 2NNAA 5BRZD 3CH8A 2Y7QA 4Z7UB 1RUKH 1EEZB 3MXWL 5IQ9B 2SEBA 4PGZA 4W6XB 4RFEB 1LEIA 4X8XA 4OJFL 2HT3D 3UTTB 5F8RC 3PWJB 1FZKA 1YECL 2YPVH 4KI5D 3PIQA 1LK3L 2IALA 3GK8L 3IKKA 3WNKA 1IC5L 4F37F 2J2ZA 1SBSL 1JGUL 4AT6B 1MCHA 1MI5B 4CVXB 1YEEH 4JREB 5HVHB 1EEZA 1IGIH 5CGYD 1D9KB 3KAAA 4G6AC 4LFHD 4TNVF 2G9HB 3B3IB 3V4PL 4OSUL 2PXYC 4X0KB 2VB5A 3QJHB 5K59F 3HZKB 3VD7A 3JV6A 2AK4B 1FH5H 4MJIE 4PRAB 3ZSSA 5L9DH 1LE9B 2AJYH 2NY0B 4OFIA 2OQJB 4AT6A 2YRPA 2Y1VA 4YHIB 1VERA 3RVXC 3DIFA 5B39A 2YUXA 3W2DL 1I7UB 2BY2A 4JPIA 2J8UF 4MQTB 3HMXA 5EDXA 1CICC 1X6LA 3W0WD 3VI4E 5E8OA 3L3DA 4PJ8A 1U95B 4GRMB 1FYTE 3JV6B 1FGNL 4LQFL 4ELMF 1OTTC 2M8XA 5D7LB 2CLVA 3SGDH 3SDAA 4WEUD 1H3PL 3DIFB 3CSYA 2DQCL 1HEZA 1MQKH 4HUUB 4HXBH 1H8NA 2XZCL 1KC5H 1T04A 4PJBA 2R4SL 3ROLB 3DVNB 2CQVA 3TH3T 2V2XA 1BQLL 4NCDA 1GGIL 2PO6D 2M1KA 3A0OA 3V6ZB 1IEAA 4O2EB 3LQMA 4Y2DD 5FM5O 1QBMH 4JG0L 3QIBB 1QSEB 4WTZA 4OF5A 2X05A 3EFDH 4LEOB 1TNMA 3F12B 2HFFA 5BXFA 3OG6B 2UZYB 3QUZD 1GGUA 3RPIA 4Y5VA 1D5XA 1BFVL 3ARYA 1KB5L 4WWKA 1J87A 4XAWH 4XPGH 4ZFGH 4ZAKD 5F89A 4KU1A 3I75B 2CLZB 1CK0H 4PJHF 4XVTL 3IJSB 1ZVHA 3KPLB 1RZIA 4KV5E 2F8XC 4D3CL 4KROB 1EFXA 3P77B 4Y19A 4P2RA 2BY0A 3V6BR 3BP7B 1I1YA 1KPVA 2BSTB 2YSSA 2A74B 1FG2B 3N85H 3V8OA 1B0GA 3MRIB 5E00A 2ADFH 3SCMC 2QSQA 4HCRA 5C6WH 4OGXL 4Q0XH 4JM2C 4OUUA 1A2YA 3VFVB 4UIKL 1J10A 2CLZA 5F7LB 1GVIA 3TEUA 2X09A 1U95A 4GRMA 4HULB 1NUDA 3MRGA 3L3OB 3KYKL 5D2LE 1NDMB 1FYTD 3V7MA 2UYLB 1G6RL 5SWSB 3VFOA 3VDAA 1EO8L 1HEZB 4WEBL 1BIHA 3SE9L 4F7EB 1JNJA 2DQUH 3I6LD 5DEFA 1OAUH 3ZKXC 3SDAD 4P2OD 2FR4A 2VKXA 3I9GL 1N2RA 1UENA 4PUBL 1HOCB 4XNYH 3IDMA 3ZKSD 1UWXK 4L8CB 1NGYB 5DJYA 4LCIH 3J8F7 5IM7B 1DUYB 3D2UA 1C8PA 1L9NA 3V6FB 1S9XB 2BFVH 3B6SA 5DHVA 4JRXA 4PJCE 4PBVC 3U0TB 2APTA 1FNGA 2LVCA 5CP7B 3O8XD 3KPTA 5KAQF 4PJDA 3QUXD 3TM6A 3CFKB 5KJRL 5E2UH 4AG4H 1CFTB 5E8EB 3NCYP 2F58H 2OJZH 3RUGF 4GMTL 4XCNA 2W1NA 2Q3ZA 2XG5A 5KSBA 4LU5L 2W65B 3SE8L 3GMLA 4G6AD 1NMAH 1MLBA 5E9DD 5CP7A 1RU9H 1F6AB 2B2XH 4LPVA 3MRBA 5DJ8A 1CXLA 3P0YH 1SVZA 3G5XA 2HP4A 3GSRA 3F6IA 2EE9A 2Z93B 2GSGA 1H9VA 3HC0A 1J1OH 4JR9L 4NNYB 5DJ2B 2VH5L 4DEPC 1SYSA 4XCNB 25C8L 4JY6A 2DMCA 1F8TL 5F7YC 1JWMA 1MCPL 5I6XC 2VXTL 3BVNA 2AXJA 2E3VA 3D9AH 4WI6A 3RKPA 3HS0A 3N50A 2X44D 1B2WH 5DJXA 4WCYH 4PTUB 4CRPA 2ESVE 1D5IH 2A77L 1D5IL 4N0CD 2NCMA 2R56H 2GI7A 4YO0A 1CG9B 2W9DL 4P2OA 4XRCA 1K8IB 4MQXD 4WI7A 4O58H 4Z7OE 3AS3A 4NUGH 1HINL 4OZIF 4X6CE 4NUGL 4LDEB 3SJVD 3OKYA 1K5NB 1CS6A 3Q6FA 3AY4A 5EUOB 1RZ8B 4V1DE 4WGWB 5I76A 3BGFB 3G5VA 4P3CL 5ID1A 2BXYA 5CSZB 1BBDH 1MLCA 4HXAL 5TQ2H 3C60A 1I9JL 4M6ML 3BP4A 3MOBL 3GRWA 4NJ9H 4ZS7H 3BWUC 4PB0L 1JZ7A 1OAZL 1KJVA 4M3KB 4O02H 5JNYB 4IHOB 4DZBA 4Y1AE 5DUPL 1C16A 3Q6FB 4X7SH 5DD0L 1FNLA 2ESVA 4Y4FC 1RZ8A 1CFQB 4ZFOL 3MRBB 3MNWA 2V2WB 5EUKB 2PW2A 3QB7C 3MRLA 1AY1H 2XACC 3SJVE 1MCSA 3CSPA 5DSCA 3GKWL 2FZ3B 3QO0B 5BZWB 2OSLA 3F7PC 1B4JH 4NT6B 4U05A 5HYEA 4Z95L 5J1AB 4DEPB 4Z78A 2FHCA 1LP9E 1RPQA 2XPGB 3UAJD 1EV2E 4U6YA 4LCWB 3GM0A 1JGLL 3WO4C 2FGWL 4HKBA 3S9DB 3FQXA 8CGTA 2QR0A 4NO0B 1MCRA 2FHBA 3UYRL 4KK5C 4Z7WE 4Y5XC 5HHPB 4NO2B 4U6XA 5AUMB 4JO3H 4MDJB 4OZHB 3MCG1 1XCQA 1GOGA 4WJ5A 4JQVC 2FATL 4MD4B 3IFOB 2NY2B 4LFHG 2B4CC 1JUFA 1QSZA 2OX5A 5DLML 2X89A 3IJHA 5DJ6A 3FQXB 4APQB 2F19H 1FAKT 1MAML 3G5VB 4XCCL 1GHFL 1MFBL 3RTQB 4LASL 5ENWB 2YD4A 2QHRH 3JV4A 4WW1A 4U1MB 1ZVSA 2BY3A 1TZIA 5J1SC 4PJXE 1T20B 1U3YA 5HI4D 1LD9A 1OGAB 5EU5A 1TDQA 3LVEA 4ZOCA 3PG2A 3WNMA 5MHSE 1TCRB 3CC5A 3G6AA 5D93B 4L3CA 3FT2B 5EU3A 3FRUB 5C9JB 5GZOD 1D6EA 2O5XL 1WVZA 4DWHA 2A6IA 2MJWA 2ICWA 1JNLH 5D5ME 1XGRB 3BDXA 2IANB 3WFHA 3NPSC 4Z7UE 4JZJA 1QVOA 5BVJB 3V8CA 4Q6IC 2QQLL 2R0KH 5HYJB 4PLKD 2B4CH 1CXFA 1F97A 1SBBA 3MO1A 1HK6A 3H8NA 3LQAL 1MREH 4JCLA 5F6HJ 4LNVA 2UUDH 5FV1L 1A7BA 4IOIB 4HLJA 1ZHBB 1VPOH 4WW2C 5I1HL 5LBSL 4RGNB 1E4XH 1WC7B 4XWGH 2DJUA 1ZT1B 3DO7A 4S1QL 4N90E 1GIGH 2VAAB 2GHWB 2YUVA 1DQML 1PBYA 4XNQB 5HHPA 4PREA 4GUPA 1YUHA 4FA8A 3HN3A 3BQUB 3QPXH 5L6YH 1IM9A 1XR8A 3MLXH 3V4PH 3EBAA 1D9KA 3MLXL 5HBBA 3TWCH 2D0GA 2P48B 1RJCA 4K7PX 1NC4A 4NM8H 3FOMA 3MLSH 3AGVA 3DBXA 4TYUA 5E1AA 1JYWA 2CMRL 4I4WA 1AD0A 1KCSH 3C9NA 2WV3A 4DVBA 2R15A 3RVUD 3TCXA 3BO8B 4YHML 4U6TA 5L2KD 2AK4D 1RUQH 5F1KC 3BGFC 4JPKL 3TO2A 1FO0L 1UH2A 1I9IH 4LDLB 3OJDA 5I1GH 3O3DB 3T0DA 4FABH 2YA2A 4Q97A 3MXWH 2H9GB 5ICXA 4LVHB 1OCWH 3GI9L 4PJ5B 2EDYA 1OT2A 1S5IH 5MEOB 1X5ZA 1WWBX 4QGTA 1LQSR 4GRLB 3QUYC 1W72B 4HHAB 4EXPX 1PYWB 4FQXB 4P4KC 4LSUL 2XYCA 5D1QC 4ZFOA 3O6FB 4PJBF 3SDAC 1KXTB 4YUEH 2APBA 2G2RA 3WCYA 1BVKB 4P23B 4HJ0D 1GGIH 5B38A 3BIKB 2C9AA 4L4JA 4MJIB 1YMMD 4XBEH 1U3JA 2IAMB 4HK0B 1T6VN 1QSFE 3GRWL 3SDDA 5FM4A 2EYRA 1HHGA 4J8RB 4HQQL 4FQPA 4GAGL 4KRNA 4JRYB 3BQUA 3G9AB 3QIBD 1MAJA 4L9LB 5C08D 3ZHLA 5A2LH 2X89D 5I1CH 4L3ED 3AFLA 5IBTL 5B38B 1LEIB 3GSVB 2ZCHL 1A1MA 1PVHA 2APXA 3N1PC 3FQNB 4G80A 12E8H 4P57A 1BBJB 4HFUL 4YHOL 5D5MF 3KPLA 3C9NB 1P4IL 3HZMB 4O5LH 2GTWA 4LQFH 3STLA 2M2DA 1DCLA 5GRUL 4QHMA 3RZWA 5BW7C 2MHAA 4HCRH 3RUGB 1KN2H 1QYGH 1PLGL 3C5JB 1DJSA 1PLGH 1T1YB 3CVHA 4MJID 3TZVA 2G9HA 2VLLB 2OL3A 4PJ5A 3QEQA 5DD3H 5C0IA 2ZWLT 1RK0A 4HF5L 4PV9A 3MRQA 3LH2H 4I0PC 4GSDL 3PHQA 3F58L 2DYPB 1EO8H 2ZOLB 1V5JA 2X7LA 4FP8H 2O5YL 4HBQA 4JG1L 5FK9A 3VFTA 3UYPA 4D9QE 1FNSL 1HWHB 4QHKJ 4QXTB 1F3DH 3GHEH 4ZS6D 5ANME 2MMXA 3VXTB 3NBNA 4R0LB 2YPLA 2DQIL 3O6ML 2AJUH 4LCWE 1NQBA 1BWMA 1A8JH 2DF3A 5EULV 2Z9TA 5KG9B 3PQYA 4MWFA 2C1PA 4X9HA 5IM7A 4ZOAA 4JKPL 3JTSB 3RGVD 4JFDE 4XH2B 3CZJA 4I18C 3K4DA 3GO1H 4U1JB 4JM2B 3MC0A 5TE4L 1OAKH 5HI3C 1YNLH 1L7IL 4H26B 3MXVH 3NAAL 1TZGL 3NGBC 3ROLA 3NZ8B 4YH6A 5BV7L 3FQNA 5ILTH 3UBXB 4FFVC 3HZKA 1OY3B 3BH8B 3F62A 4XH2A 1CR9H 4QHMB 4JY4B 1AQKH 2WWMD 3NTCH 3X12A 4D94A 3MZTA 4H26A 4HUVB 5C0BB 3CLFL 5IF0B 1KN4L 4IRZL 1Y6NR 5GS0H 4J1UA 3VXSA 1OPGH 2A1WL 5A2JH 3NACH 4MJ6B 4OT1L 1A6TB 2XNAA 3R4DA 5MENA 4XNYL 2YUWA 4BUHA 5CZVH 3MBXL 1JL8A 2Z35A 3MV7E 2NLJA 1MJUH 1R3HB 1EFXB 2EZ0C 3D18A 4M9OA 4Y19B 5SX4H 2EEBA 3I3BA 4JQIL 3ARDC 4X9FA 3U9UA 2Y6SD 5I66A 1AQDA 5KVEL 2WW8A 2ZSWB 4CW1A 1HSAB 3MFFA 3BVNB 5JQHC 4NQDD 1MIMH 1DVFA 4LLUB 1OSZA 4Y5YB 3CMOH 1BPVA 1PGRB 4HC1L 5F8QC 5IMMB 4MNQE 3LRHA 4YO0B 2I24N 4J3SA 1KPUA 3RRQA 3LN5B 4TUKL 4HFWA 5D1ZA 4TUKH 3LSOB 5FGBA 4NZTL 4PJFE 1NCDL 2YD6A 2BVEA 4WFED 3QUYD 3TO4D 5IQ7L 3V5DB 3K2MC 1KTKE 4JFEB 4ELMB 4AMKH 1INDL 4AMKL 3ARQA 3OZ9H 4MD0B 1I7TB 1UWEL 5DEFB 2DQTH 5EO9B 4NQXA 1WEJL 1YN7A 2QADD 1J0YA 3QJFA 3N9GH 5L9DL 4E0RB 5FGSA 3OAYK 5T3ZE 4Y5XB 1U8OA 5EIIA 1QTYT 2VXVL 3PP4L 2I5YH 4JO1H 5J6HA 4R90H 4ISVB 4JR9H 1XIWC 2F5AH 4D2NA 2H41A 2HKHH 3IJYA 3V6FA 3PGCB 3BKJH 2HLAB 1I9RH 1A14H 4OFYD 5C09E 4H0IA 4ZYKB 3QUKA 4ERSH 1JNHB 3P73B 5HY9A 4BFBD 3QJFB 1NAMB 5CILH 5JQ6H 3MNWB 4W4OA 2LQRA 4HIEA 1VGEH 5D6DC 1IC7L 3QUYB 1IC7H 4P2QE 1P7QA 4AIXA 4X6CB 3JWDH 3WFCL 4AYFA 3ARGD 2AEWA 1KC5L 3IYLW 3ROOB 2ZOKB 2DIBA 2ZPKH 2ZSWA 3P4LA 2UYLA 2FGWH 2MQCA 4CW1B 3VFPA 3IXTB 5HD8C 2BNQD 5F9JA 3VXOB 1PSKH 1T2JA 2CUIA 4EUPH 2QR0B 4NQTA 1J05B 1OSZB 2JKXA 2EXYD 1Z9LA 1MRDH 3ZMRA 4ESKA 5INCA 1W72L 1WSST 2PF6A 2VDPL 3IDMB 2VDPH 3ZDYF 2DL2A 1T21B 2AJSH 3KPPA 3QUZB 3MUZ1 4LVNC 2W0FA 2HT4D 1VGKA 1AO7A 1ZWIB 3OKNB 1SYVB 9CGTA 1IGCH 5IHZB 5ITFA 4LGPB 1A7NL 2WBJA 1MRFH 3B6SB 5KSUA 2BCKA 1MAMH 4L4TA 1IT9L 1K4DA 1QQDA 3D85A 1QR1B 5DFWH 1RIHH 4HT1H 3QDME 4WENB 1CZ8H 2HJLA 4PTTA 4X80H 1ITBB 5JIPA 1ES0B 1AHWC 5J6HB 5HDLA 2IBZX 1RUAH 3TBTB 3K2UH 4R96A 3S98A 8FABB 1HDMA 3HHRB 4NRYB 5E4IA 3ESVF 1MHCB 1KB5A 3CAFA 4KJPC 1ZS8B 4K7PL 4TRPL 5GS3A 1CU4H 4OZIA 1UM4H 2VR4A 5GISH 5ID1B 1P2CB 3ULVH 1MLCB 5DGRA 3ZL4H 4ZPVB 4RIRB 2ED8A 1NCBH 2N56A 2QEJA 1AO7E 4L8DB 4A6YB 4EQ2A 2EZ0D 4R8WH 4WI9A 2IAND 3TBTA 4CMMA 2BNRB 2X1XR 2VXUL 1HHKA 1KPRB 4PRNB 1F45A 4HWEL 3ES6A 3HRZA 1WITA 1IQWH 3HCVA 5D1XA 3VD3A 5AZEL 5C07B 3K80A 3FHAA 2GIYA 1T5XB 5J12C 5C9KA 5ADPL 1OW0C 2R4SH 3HS0B 5IUSA 3QPQD 3S8WA 3PL6A 1BVZA 2R0ZL 1DVFC 2JJTA 4LLQA 1GC1L 4OKDA 1MF2H 1BOYA 1NCAL 2BK8A 4NGHL 3T0ED 5DUML 3R1GL 3ARFB 3U6RA 4HDIB 2A6DB 1OT1A 1DEEB 3CUPA 5I75C 3FFDB 3HNSH 1HHIA 4I9WE 4PJAE 1DN0B 4X5WA 3W9DA 1A6VL 3SKUD 4L4TB 2APFA 5J3HC 3RPKA 3T2OA 1CDUA 2GJJA 4Z7QF 1Q0XH 4LSSH 3C6LC 4OCSH 1V05A 2HFGL 5C3LD 4MCYA 3EIFA 2PTTB 3I6LE 4M7KL 3WIIH 5FYLH 2ITDA 1YMHA 3TO4B 4MDJA 4JM4H 2B8OT 5JHDA 4C54A 1JPFA 3EYQD 1J1XH 2R0KL 3ARFA 3OJDB 3B2UD 5E4EC 3ZKXB 3QI9C 3DMMD 3RDTC 5T1DH 5JA8B 2H9GA 1ACYH 4E5XB 4H5SB 2Z4QA 2GJ6B 4WU7B 2P42B 1X44A 5T1LB 5D7IF 3WV0A 4QLRA 2BSSA 3V6OE 1JGUH 5E56A 1CICA 3EW3B 3IAPA 2X4SB 4XP4H 3QEHA 3BPCB 3B9DA 1BF2A 2D4DA 1NAMH 4CDGC 1SY6L 1FVEB 2YA0A 3CFJA 1OGAA 3SDCD 3O6FA 4GQ9L 5HHME 5F9OH 4YXLH 3GB7A 3QIWD 5CEYA 1YEIH 5KTEH 1RZGA 4PGDA 4NRZB 1CXHA