2ICCA

Extracellular domain of crig
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
119
structure length
119
Chain Sequence
GRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of C3b in complex with CRIg gives insights into regulation of complement activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords V-set and immunoglobulin domain-containing protein 4
total genus 26
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2iccA00
2IGFH 5DUBA 1E28A 3WYRA 1YZZA 3O6KL 4D0DB 4MJIA 3QEQD 2P7TB 3M8OH 4V1DD 4JHAL 3J8F7 4FABL 4WTZG 4G5ZL 5IV2B 5TDPA 1T3FA 4P46C 4NO0B 3LN5A 1IT9L 3CC5A 4MJIB 4KRPC 2Y25A 3KLHC 1KF9B 3U7YH 3GSUB 2F74A 3LRSB 1EHXA 2BVEA 3UBXI 1KC5H 3W39B 5L6YL 1BVLB 1GGIH 3OKLB 4OTXL 4WUUB 2YR3A 3BGAA 4PTTB 4NQUA 5IWLA 1QD0A 3VFPB 4G6FB 1T7WA 1CTOA 1I3GH 3ROLB 1K8IA 4ZAKD 2AGJL 4ELMB 1C5DB 2V7HB 4PRIE 5J7CC 1XMWA 1ULVA 4YHPA 4HFUL 1GPOH 2VXSH 5FAAA 4GLRH 4UDTA 3W0WE 1OF2A 2DM2A 2R9HD 5JW3H 4Z95H 2FJFA 5DJDB 4GFTB 1HZHH 2NY4D 2ZUQB 3IXAA 2BY3A 5L2JA 1JE6A 5EZLB 5C07A 3CIQA 1OAZL 3SE9H 3ULSA 4EDXB 4GKSB 1YEFL 3RDTD 1G0XA 2CKBH 3RAJH 5LGKA 3UTTE 4PR5A 5C0BD 4UV4H 3VI4E 1C08A 2RFXA 4Z7UE 4O02L 2V17L 3GJEB 5EIIB 5H2BB 4Z7UB 5SWZD 3O6FA 2DTMH 3WUZA 4LSQL 3ULUL 3BZEB 5TE4L 2JF1A 2DRUA 1B4RA 1RUAH 3U36B 2AI0H 4LHUG 4FZEH 4RFEA 2FZ3A 3NGBB 3UPRB 4C56D 1GC1C 3RZCC 3QUZB 4AMKL 4PJAA 1U8JA 1SEQH 1NQBA 4GBXA 4XCEB 2X4UB 2KUTA 1IQWH 3CUPB 2MPAH 4UIKH 5EU5A 3M17A 1KEGH 3TYGL 3JWOL 3WMSA 4WHTA 4P46D 3VG0H 4XNZC 2YPKB 5CP7A 5FYLD 4BKLB 5IMLA 4XGZB 5FF6A 1ZHBB 3SQOH 4WY7H 2YD3A 3I3EA 2P5ED 4YWGH 4DZBA 5FO8A 4U0RB 4Z76B 4LCIH 5D7KE 1PFCA 1A7PL 1S78D 1YEIL 4H0GA 4OLVH 3FT3B 3OKKA 1EEQA 2Z35B 4ZO7A 4U1JA 1S7RB 3P0VL 1BX2A 5GRXG 1NCBH 3NAAL 5F7HA 4MJ5B 2P48B 2H2SC 3QAZC 2VQ1A 1U95B 4DFIA 4O2FA 1JWMA 5E1HB 5EOTB 3I75B 2KZWA 2PTVA 1DQLH 5BCAA 1F90H 1WZMA 1JZ6A 1P4IL 3I50H 2AEPL 3D3VE 3ESVF 3K8LA 3C5ZA 2AJUL 2MHAA 2VQUA 5JIKA 4ZQKB 1IGIH 4QXGH 2NY5H 4XP4H 4RMSA 4UI2A 2GCYA 3H9HB 1WTLA 5KAQF 3OF6D 1V7NL 3DURB 3KYKL 4RMRA 5SX5H 4OGYL 2XV6B 1RZJH 3BDBA 1K2DA 5EUOB 5AWNH 2DQIL 3LH2H 2ZG2A 3M1BB 1MQ8A 3MPCA 1VGEH 1YQVH 2I07B 3ABZA 1VGKB 4JJHA 3FQUA 4MDJB 4PTUB 4RNRB 1FL6B 1TJGL 2FL5B 1Q1JH 3BVNB 1JWSB 3CSBA 4YBQD 5CSGA 1GSMA 3WLBA 4NKOA 3LKQB 4F58H 2ERJC 1KJMB 1UZ8A 2P8PA 3ZDYE 3TZVB 4M3KB 1V5JA 3GZKA 3ILPB 4KRPB 2VLLB 1VACB 2J6EA 5T3ZH 1MRCH 3WFCH 2YPLD 3RGVD 1T1XA 4S0TD 1TVBA 2AJZA 2HWZL 5I19L 3BRDA 1CD1A 1PD6A 3FHQA 5E9DB 4FXKB 1T22B 2DLGA 3GMNA 4ZTOH 2ESVA 2HJFB 4F9LA 1FL5A 5LG1A 4S2SB 1IC5L 2M1KA 3IFOB 4Q6IC 4R4BA 4OIBA 3STLA 4MQXC 1KYOJ 3DROB 3MRFA 4Y5YC 4F7EB 4UTAL 4KJWD 5ITBL 5E8OA 1Q94B 2NQCA 2O5XL 4IRJB 4NPYB 4JY5L 4OFVA 2I5YL 1NGZB 1DANU 2NY3D 4P2OD 3IU4H 5AUMB 1KN4L 1OT2A 5DJAB 4D3CL 5HYIA 4XX1G 2HJLA 5BZWA 2E9BA 3S5LB 5ENWB 1F4WL 4NHCH 2EYTB 5E7FA 1G1YA 1KJVB 4LBEA 3Q6FB 3KPSE 4RIRB 1BQHB 4JLRB 3JVGA 3EYVA 3GMOA 1QYGH 3WJLC 3GFUA 5K9JL 3WFCL 4C57C 4WW2A 1FCCA 1FPTH 2HAZA 5AUMA 5T1KA 5GIRB 3ZE2E 3Q48A 2ERJB 3L1OL 3QO1B 3TBSB 4UT7L 5CEXB 4JZJA 1NCDH 2B0SL 1IGML 5C6TL 2WSKA 3CK0L 3Q2CA 5ALCL 4IS6B 3WN5C 5F6HJ 1YMHA 4F7EA 1KXTB 5F97E 2Q8AH 4LVHB 2NY0C 3IKKA 2G75A 3CAFA 4NDMA 5D93B 1NKOA 4KROD 3G5YA 5I16A 1C12A 2ESVB 3GMNB 4LCWB 1FFPA 2BK8A 3ULVD 5E2UL 3VFMB 1DQQA 2CXKA 4WO4B 5IOPB 4PJFB 3NACH 3O0RL 5CZXD 4FQXA 2SEBB 5DF0A 4KQ3H 3L5IA 3ILPA 3CMGA 4GBXC 3TCXA 3C60A 2YPLB 3RGVB 3WS6C 1T66D 1EERB 4HLZG 1KJMA 3TFKC 1EJ6A 1UXSA 3TJHD 1UFUA 3TT1L 3E2HB 4QXTB 3ZTNL 2KL6A 2JELH 1M4KA 4KK5D 2JELL 1FL6A 2IAMD 3GBMH 3IJSA 3FQWA 1WFOA 2BC4A 4LU5L 5EUOF 5CD3A 1DUYB 3MRRA 1JPSH 3EYQD 4FQCH 2EIZA 3GBNL 5IUSA 1ADQA 4GW1B 1KELL 2DI8A 3CU7A 2D03H 2AKRB 4O9HH 2NY0B 3DURA 3IFLL 4KTEL 3K8KA 5KS9E 4RWYH 1CDBA 3G5ZB 2KKQA 1LO3H 3QHZL 3P4NB 4RFOL 5CS7A 2J2ZA 1UWXH 1ZA3A 3MRDB 3G9AB 5DSCB 2VDPL 4U1NB 1NCCL 4I2XA 3VXUD 2F8XC 3RWJB 2VXUH 2XZCH 4P5MA 3F12B 3U4BH 5J1TC 4R0LA 4LASH 5EFIA 5AD0B 3C2AH 3NIDE 4FFVC 4QRUA 3D87B 1R3HA 3B9AA 1JWMB 1BFOA 4WVRA 3RJQB 1LNUB 4UINH 3V6ZA 4JQXA 3VRJB 4MX7A 3RWHB 2GSGA 1KG0B 3O3DB 4LVOB 4XP1L 4YGVA 1TIUA 2HKFH 3TH2T 5EC2B 3LVEA 5J6HA 1GOGA 1HIML 4U1JB 1PG7H 1EAJA 4PRBB 4BZYA 1MCOH 2WBWB 4XTRD 5BOZG 2AJYH 3KPRE 1NBZA 4ESKA 1XR9B 3MBXL 1IZJA 5GGSB 4LQFL 4E41B 3BWUC 2CRMA 4N1EA 1KJ2L 2DQHH 4QTHB 5C08E 4M3JA 1N5AA 2YKLL 4Y1AE 5H94B 1RZ7H 5D5ME 1Z3GH 1UWEH 4BKLA 4E9LA 5IMLB 1Z3GL 5E24E 2I60L 3CZFA 4JKKA 3DX6B 1FV1A 1ND0B 3EOTL 5T5NG 1GC1L 2FLBT 3NCMA 2PXYC 4FMFA 2R1WB 2QR0A 1U8JB 3FOMA 4JGMA 3PNWA 4TYUA 2Q76A 2ZUQC 1D5MB 5HJ3A 2BOCB 4X9BA 1E4KA 3VXPB 4L4VD 1VEPA 3C60D 2VWEE 2DLEA 3UPRA 1KLUA 4WI6A 3LS4H 4RFEB 2D0FA 2FX7H 2R2BB 3QG7H 2UZXB 4XHJD 5F8RC 2KPNA 3QZWG 2GY5A 4XP6L 4RGNE 2RIKA 5EU7E 3N85L 5M94B 4N0CC 5EIIA 2ZUYA 4K7FB 5FA3A 1TETH 4Z77A 4GW5A 4NBXB 5LCVH 2D0HA 1KCKA 2ZCHL 4LHQB 5SWZB 4ZFOA 2OXGA 3QDJB 3ULSB 4L3CB 2XN9D 1F4XL 2D7OA 4G6MH 4AIZB 4OV5A 3U48A 5HDLA 4S1QH 2P42B 4LSPL 3S37L 3SY0A 1A64A 1X5ZA 3M07A 4X6EA 1Q8MA 3Q1SH 3X14B 4AEHL 2HLAA 1E4WL 4NO5A 4X7TA 3TYFB 3QEHB 1LDSA 5GRZA 2CO6B 2LE9A 2EXWD 4BZ2L 2Q20A 2DJSA 1QA9B 5D8JH 4HWEH 2MJWA 3QPQC 5B38G 1YEJH 3U1SL 2NY7H 4UU9A 1S5IL 3I6LE 4PYGA 4RMVA 4UIMB 3MZTA 1HIMH 1I3RB 2GAZB 2R0ZL 4PYHA 5IVZA 4X8XA 2Y5EA 5E2WH 4WV1A 2X89D 4YUEH 1BZ9B 5CHNA 3CC5B 3TJEL 1E0OB 1I3GL 3IDJA 4DW2H 4AIXA 2XKNB 1AGFA 5C0RH 4LIQE 1UEMA 4Y2DA 5AAWA 3IB4A 4XCFL 2H32H 4LPVA 3QIWC 4NRZB 1BWMA 4EI5C 5A1AA 5DD5L 3QIUD 3WNMA 4JO4L 2XPGA 1T0MB 3GHBH 4CRPA 2RR3A 3LMJL 4EN3B 4G42A 5I74C 4C59B 2MQCA 3HLAA 1G7MA 1IEAA 1FL3A 5E1AA 1FJ1A 2YA1A 2EYRA 4XX1E 3OL2A 1RK0A 2PYEE 4GSDL 4X9IA 3TT1H 3IVKA 1ODAA 4OLUH 1INEL 1JHLL 2CMRL 3V7MA 4PLNC 1SBSL 3O3AA 4PJCB 4NQCE 4R7NB 3MA9H 1NSNL 1KC5L 3ARFC 4NOFA 1GL4B 4Y16B 5DMJB 3HZMA 4G9DA 4G6JH 5AAMA 1KPVA 5SWSA 4D9QD 2HVKB 3MJGX 4GS7B 5FGBA 1CK0L 3MRIA 4ODUA 3EOAB 1S9WB 4AQOA 1LO3L 1BM3H 3LRGA 3MJ9A 5CJ8A 3L95B 3ECBB 4TRPL 4X4XA 4HWNA 4NUJA 3MBEA 5CWSB 1YN7B 2X1OA 1CWVA 3U0TB 1N2RA 1SMAA 4HXAH 4X4MA 5C9JB 1FFNB 4RMQA 2VUYA 3P4LA 1AP2B 3VFSA 3WXVH 3DO7A 3IYLW 4NJAL 4U49A 3LZFL 4QGYA 4NN7C 1S7QA 4LRNL 5HYJB 3EOBB 3WSQH 2KH2B 3V5HA 4Q6YA 4FFZH 5D93C 3GSOB 4Z0BH 1JZ4A 5FM4A 2VDMH 2D03L 5F44A 4GO6B 3C6LC 5DUML 4LSTL 3WFBL 5EPMA 5F21B 1LVEA 3MMEA 5GGUB 3K4ZA 2WUBL 4GT7A 3M45A 1JGDA 1NPUA 1ZSDB 2YZ1A 2UYLA 4MD4B 3K81A 1CD0A 4CDGC 2DKUA 4G9FE 4RMWA 3BPCB 5AYUH 3I02B 4BYHA 2Z31C 4HWUA 5JORA 3ES6A 3O6FD 5EA0H 2FEDD 1IC7H 5LXGL 4HKXB 4EKXA 4P46A 3MV7E 4ZMAT 1RZKC 4CMMA 2BOBA 4JO3H 1E4KC 4XPFH 2AP2A 1RJCA 5EO9A 1YEDA 2ZUUA 4G7YL 4LPYA 1RHFA 5C0AA 2NX5A 1FBIL 3ZDZF 3DYMA 1I9JL 2BXYA 2WWKT 3MGTB 3SGDH 5K9JH 4Z78B 2XWTB 4HC1H 3OWEA 1KYOK 2D7MA 4MXWH 3MUHL 4XC1H 3PHOA 1H15B 1NC4B 4OF3A 3QXVA 4N90E 4OI7A 2VLKB 3AUVA 1P1ZB 1T2QH 1EO8H 4U7KA 4PRIB 4HJGB 3VFWB 3VWKC 5KZCD 2CUIA 1KIQA 5GGVH 3SE3C 3UO1L 1MHPL 4AY0A 4KK9D 3SGKA 3G08A 4LNRA 1MNUL 3LKOA 4XI5C 3P9MB 2MKWA 4APQD 4J4PC 4FP8H 3H42L 2FEEI 2LV4A 15C8L 5EULV 2MCPH 1ZT4A 4QO1A 2BJML 3ALXA 1I75A 2HRPL 2HYMA 4LKCA 1BIIA 1AGEB 1EAPA 4ZUWB 3T2NH 4A6YL 4F80A 3MNVA 3C8HA 1G7IA 4HIJA 3TT3L 1HWHB 3PIQA 5KSBA 3LB6D 2P5WA 3MNWA 1C8PA 1AJ7H 3MRLB 4QYOA 5C09D 5GRYA 2Q7YA 3G6JB 3H3BC 4FQHB 1U8NB 4QHMB 5INCA 4NRYA 4XCCL 4N8VG 4NQVB 3RVTD 5TE7L 1QRNB 4AG4L 2VUOA 2VMFA 1F2QA 1DFBL 1CDUA 3CXDL 5D96B 4Y4HB 2OM5A 3KAAA 1I9RH 3RX8A 1TTFA 3NFSL 3GI9L 2ORBH 3QWRA 2FEDC 3EO1A 4HQQL 4ODWA 3SO3B 4NQDA 1YEIH 5EOQH 4TNVF 4JRXD 3QT2A 2EDQA 3O6MH 1KIRA 1P7KB 3OAYK 2VITA 3RKDC 4ETQB 4W6YB 1Z5LA 1TQBC 1U3HD 3T2PA 1G0YR 4NM4L 3MJ7B 5IEKB 3NFNA 3BX7C 5I8OH 5BV7B 5DD5H 3FT4A 2JIXB 1NGQL 5DZNA 1I1YB 4DFHA 2XN9A 4IRSB 4MNHA 1F11A 5DQ9A 2PF6A 1VKXB 5IB1A 4P59H 2R0ZH 2OTWB 3ESUF 4RGMB 4YIQA 2R2HA 2VKWA 1IAII 4OZHF 3RTQC 3TJEH 2WWKO 2HN7A 2YKLH 3SJVD 4MB5A 3FZUD 5FYJL 1JYWA 1I8KB 1AXSB 5LJYH 4GRMA 1EO7A 4M7ZC 2ARJB 1CGUA 2DQTH 1OAUH 3TIEB 3WFZA 3MRHA 4AK1A 3MLXL 4JQVC 4M8QA 4WW1B 5J3HC 4PRHB 2XWBA 3F7QA 4YJZL 1F02I 1DEEA 1NEZA 2PETA 4JFQA 3MTRA 1A3LH 3D2UB 1HE7A 4HZLB 3PHQA 1TZIB 2VXQL 4JM2D 4KZEH 2ZSVA 3BWAB 2CLRB 5IKCA 4YZFF 3QG6A 3ZDXE 1M71A 3ARYA 3H6JA 4JFFE 4I0PD 4I8DA 3VG9B 3OQ3B 3KYAA 1FO0H 4D9LL 1TZHA 2IAMA 3HAEH 2ZP0T 3BKMH 1E27A 4XB8A 1IQDA 1U3JA 1MI5A 4M43H 2PR4H 4JHWH 3S36X 5B8CC 3CX5K 5CKGA 2ICEB 5J56B 1DANT 2VDNL 2VLRE 3V6FB 4OZGA 3UDWA 1MCLA 3GSRA 4LSTH 4MWFA 2DM4A 3TN0C 3VGDA 3LEVH 1DE4A 1FFQA 3EZJB 3WHE0 3DWTA 4K3JL 3STBA 3WHXB 3KR3H 3MOBH 4LLMA 5T3ZE 3GBNH 3PABB 1AXTL 4MA8H 1KEML 4EBQL 2VLKD 4L9LA 4XPBL 2DMCA 1PVHA 2K9UA 4KTYA 5FA4B 4OM0H 1PEWA 1KB9J 4LASL 5DUPL 3UJJL 5T1MA 2QSQA 4A6YB 4PGCA 2ZOLA 1DE4B 3ZTJG 1DLFL 4N0YL 3KWWA 3RDTC 4OZGB 3V6FA 3PV6B 3HRPA 1E6JL 3TWCH 4LKXA 3EDKA 1IQDB 2YUWA 3K1KC 5JXAH 2QQKH 4YXLH 3V0AC 3T4AB 3BUYA 3LRHA 3MRCB 1HQ4B 3P30L 1TJHL 1VPOL 3QUXC 2OX5A 4HJJH 5FYJE 4ZD3L 2HFGH 1SJHA 3QG6B 3RA7L 1N3NA 3VDAA 3RA7H 2YUVA 4BM7A 1KCRL 4OB5L 3SGKC 1F6LL 2A9MH 3D2UA 3L6FA 1YNTB 4PJCE 1DEEB 1TQCC 3NPSB 3V52H 4DJMA 4M8QB 3WJLA 4O2CB 2QEJA 4YO0B 1ZGLB 3GSVB 1UH4A 4APQB 2DIBA 2LTQC 3TH3T 1MY5A 2VIRB 3REVB 3BEWB 2VYRE 1YQ2A 1H3TA 1LGVA 1R5IA 5E2UH 1CFNB 2IPUK 1DLFH 1S5HB 5IM7A 1YY8A 2IPKA 5DD3H 4NQDE 2NZ9D 3HI5H 2R2HB 3HI5L 1P4BL 1BF2A 4R26L 3ZKQD 1ZEAH 4D94A 3KGRA 2ESVD 3WKML 5I17B 4JFEB 1U6AL 1VFBB 1U8OA 1E4XL 3W9EB 4OI8A 2BVOA 4U6HB 1I1YA 4TTDC 5GISL 3SGJC 4YHLL 1OL0A 5FECB 5BRZA 1QR1B 1WISA 3FONB 4NQEA 2FYYA 4WI4A 5EU7C 1V3KA 3O9WB 2XWJA 3BKJH 4FQ1L 2NR6D 5JA9A 1JRHL 4K3HA 4LRIA 3DHMA 1EHLH 3G6JF 1BHGA 2RCSH 4PRAA 4NHCL 1HSAB 1GAFH 3CJJA 4NQSB 5T1KD 1NMCC 5EBLB 1VDGA 2ADGB 2Y07L 4OV6F 3RU8L 3PWPD 1U8HA 4ODXA 3RU8H 2GI7A 1S9XB 1LEGB 3NCJL 3IJHB 1P84K 2NY2C 4X5XA 2H41A 3F7VB 4JO4H 1A3RL 5ERWA 1FSKB 1QRNA 1HQRB 2XXCB 3BRGC 4HX1B 1DL7H 1RFDL 3OJDA 4H1LA 3D5OF 3RJDA 3VRIB 1U8NA 4MNQD 3HC0A 3GM0A 4QT5B 2OR7A 1XR8B 4U1SA 3LH2L 5CBAB 4HIJB 4NBZB 2IWGA 3ARXA 4XVSH 4PJFF 3MNVB 4Z9KB 5IBLC 5T5FH 4M48L 1YECL 5FDWB 3VW3L 1AGEA 5EB9A 1RJYA 3HG1B 4ZXBA 4BFEA 1A0QH 3TEUA 1EFXD 3R8QA 2NY0D 3DRTA 2H8PB 1DJSA 4HH8A 2YHGA 5KSAA 1MEXL 4KK8C 3OG4B 4OD1H 3BSZH 4OZGE 4K3DH 5I1JL 2R29H 3LKOB 4CBPA 3QWOB 1EGJL 1FIGL 3QHFH 4N0FB 1MSPA 5ACZB 2F5AH 2Z8WC 5EZOH 3MOAL 4Z7NF 1QLEH 4X6CA 4GMTL 3VFWA 1BLNA 2FHCA 4LCYA 3ZMRA 5C92A 1FDLH 1MCFA 4H8WH 4OQTH 4WFED 3T65B 4GSDH 2WIMA 4OI9A 1UEYA 4UILL 3DX7B 5E4EB 1KJ3H 4WI8A 4Z78A 2ZOKA 4W81A 5I1HL 1JHTB 5C0AB 1Q9LA 2AQ1A 2O5YL 1XAUA 1JWUB 3MV9A 1IL1A 3LQZA 3BP5A 1YEDB 1VEMA 4GBXD 3D85A 2XICA 4FA8A 1TZGH 1N4XH 1WBYB 1BBDH 1BFVL 3VFTB 4I18A 1CXEA 4H88H 4AT6A 4P46B 3T77A 4HKXA 3OF6A 4L9LC 1NGXA 4J3SA 3FB8B 3RZWA 3L3IA 3CXHK 1NC2A 3QDGB 4YPGA 1S78C 5H37H 1SVCP 4EI6A 4WI5A 1ACZA 3DLQR 3O45A 5DJCB 3JTSA 4GXUM 3MCLL 3IGAB 3DX9B 1GYAA 4JVUA 3PQYB 4LFHG 2L7UA 4OCSH 5DRWB 2ICWJ 5GGUA 3ISWA 2QADD 4OZFA 3VXRB 5J6GA 3CDGA 5JHDE 4BH8B 2NLJB 5HHPB 3CSYB 5L2KD 4CNIA 2A6DB 1NGWB 3B8YA 6FABH 1EH9A 1S7XA 4X6DA 2FLRT 3EOBA 4UT6H 3MLPA 1INQB 3O3BA 3FQXA 4TSCH 5E08H 1DL7L 1RFDH 4PJBA 3OXRA 2XYCA 5JXEA 1CFTA 1UWEL 1RIUH 3ARGA 1P7QA 1LEKB 4YXKH 4KJYB 1AGDA 4PJBB 3PP4L 2FWOB 2L7JA 4Z7QF 5GGRY 1DQML 1Z6JT 3RI5F 1R5VB 3FOLB 4RMTA 4JZNA 4WW2F 4NZRH 1DBKH 5E8DH 5FYLL 5HVWA 2YD5A 3L3DA 3DTXB 5D71L 2MCPL 3KYOA 3AXLA 5DRWA 4K8RH 3ARBA 3NOIA 3PQYA 1I9JH 2OXHA 4UB0H 1X7QA 3ME0A 2N1KA 3JTSB 4ZS7L 2Y36L 4DQOL 3GM8A 4XP1H 1HKLH 1U91A 3EDJA 4JO3L 3KPSD 2EYRB 4LLUB 1OTSC 5FK9A 3I6LD 4JHAH 3ZHDA 1G7MB 1IEAB 2HMID 2MKLC 5D5MB 4JFFB 2P4AB 1TDQA 4G42B 3T77B 1BIHA 3VGHA 5F96H 2H2PC 3U9UA 4MJID 2IH1B 2OL3L 4NZTL 1K3IA 4HC1L 3DGCR 1G9EA 1OD9A 3BP5B 4EI5A 4R4FH 5BQ7B 2O26U 4POYA 1KELH 3C9NA 1NCDL 1NFDF 1Q9LB 1CICB 3HNSH 3F58H 1JZ8A 1LILA 1KACB 5LGHH 4MA7L 5I1DA 2AGJH 4QHLA 1J1OL 1U41A 5I76B 1ZLUH 1BLNB 2MPAL 4UIKL 4AEIL 5DO2C 4XBPA 1ZMYA 3WJJA 4UUJB 2FSEB 1MY7A 4UU9B 4B7IA 1NGPH 3HZVB 1A4JA 2NY6B 3WKNA 2OI9B 3HE7A 3HC4H 4HEME 1OGAA 5EN2A 2EXYD 3QEHA 5F71A 1LK2A 2RB8A 2P5EE 1EA9C 1DP0A 3TLRA 5FDWA 4BFIB 3JWNC 3QNXB 5JXED 3HN3A 1SJEA 2IMNA 1QBBA 1H8NA 1AQDB 4AIZA 3U6RB 5F9WB 3AMKA 1VB9A 4PY7A 2FX9L 5LAXA 5CLWA 2NY6C 3PWPE 5JW3L 5FYJD 4BQ9A 3VRIA 3C6LB 4U0QB 4J23A 1IC4H 3MNZA 4HS3A 2UWEE 3OKMA 4Z77B 1R3IH 5FGRA 1IAIM 1JNNL 5FA3B 5LWYL 1WICA 5IWLC 1XGUA 4BJLA 1QVOB 3MBED 1LEGA 3QIBA 5DDHA 4UNVA 1WAAA 3B43A 1U8HB 4X5LA 3KXFA 3QHTC 4MHHI 4NQSA 1HSAA 2DAVA 3LKSA 1WZKA 2XNAB 4FFWD 4HEPG 5F1IA 1EUUA 1A6TA 2DF3A 5SWSD 3MGOA 2XZQH 1RZJL 1KLUB 2YS4A 4M6NH 4J8RA 2W0KA 4KKLC 5HYFA 1KPUB 4HUVA 1CGXA 3PNWB 1T5WB 2FJHA 3NCEB 2QR0B 2GJZB 5LBSL 3FONA 1AE6L 1RULL 4JY4B 1A7RL 5GGTL 3QFJA 1IAOA 1JGLH 3E0GA 1VFBA 1I4FA 5HTSA 1ND0A 3WHE1 1E4WH 3BIKA 3NZ8B 4L8BA 4WJ5A 4JFDB 1SHMA 4CMHC 5FKAB 3PL6A 3TJHC 1GVIA 2HFEA 4BZ2H 4MCYA 2P47B 2Z8RA 1YY8B 3W81A 5IM7B 3VWKA 2IGFL 3BO8B 2MQ3A 5BVJB 1IKNA 3PWUA 1XR9A 4NM8L 2VIRA 5FGCE 3REVA 3SGEI 3SEPA 1DBBH 3SQBA 2J8UA 4WUKH 5I1IL 2OTUB 4ZXBD 4O2CA 4DVRL 1FFRA 4M43L 4Y4FD 2BRRH 3NMEA 1FAIL 2ZG3A 3L6FB 1IAKB 2XG5A 1U8KA 1R3HB 5MHSE 1M7IA 3T0EC 3HPLB 5KW9L 1A6VL 4GLRI 4ZFOL 3VMNA 5D70L 4OLZH 2YPVL 4IMKA 1XEDA 3V8CA 2VL5A 2XTLA 1OP3K 4S1QL 3TA3B 4WNQA 3P4NA 5EORL 4JANA 2H32A 3MOBL 3UTTD 4P2RE 4LKXB 4G80B 3TO4A 4KZEL 3UZVB 3HZKA 3IU3A 1IGIL 1J11A 3LN4A 2ZOLB 1PBYA 1TVHA 3MRRB 5IMMA 1MVUA 4KRPD 5CD3B 3L5XH 3L7FA 1N64L 1QTYT 4YE4L 1ZT1B 1MWAB 2I25N 3AVEA 1FO0L 1L7IL 1T7VA 5FA4A 4L9LB 3LQAH 3SHSA 2IANB 2A73A 5IB5B 4NKDB 3BGFC 4LLQB 4OFPA 4CUCA 1OOAA 4F33A 4TSBL 5F72S 3MQIA 3U2SB 3BGFB 4CN4A 3PWNB 3QI9B 2HT3C 3ZHLA 4J4PD 5KW9H 1IKFH 4NYLA 3RY6C 4Q2ZB 1I1FA 4OD3H 3EOYG 5J0BA 3BW9B 1GGCL 3WDJA 4BZ1L 1IEHA 4YDJB 3BSZL 1OTTD 1FFPB 1ERNA 4LCWA 4RGMC 3IF1A 3GMLA 3P9LB 2DQTL 1NLDH 4JPKL 4X7DC 3MV11 4NDMB 3EYOB 3V6OC 3TESA 5GRUH 3F6IA 2DLFL 1TZIA 3LAFA 2GIYA 4AMKH 5F9OH 4Z7VF 2AAVA 3DVGB 1H3XA 1NEZB 2FNBA 4X7EC 1MCRA 4G6FD 4KKNA 3SGEH 2DQGL 3C8KB 3K80A 4JFEE 4WW2B 5FCUH 3MFFA 2JLLA 1YEJL 1X6NA 4GRMB 2BVUA 3IFLH 5E6YA 3FMGH 2CDFA 4M1GH 3L3OB 1BQHA 3SDXB 2Z92B 4RIRA 5TFSL 3UTSD 3B6SA 3CFKA 3KXFE 1CCZA 4OBRA 4XNXH 3LIZL 1LO5B 2VRAA 3V7AG 3DNKA 5ENWA 4KWUA 4QOKB 1B9ZA 1LDPL 2HG5B 3MUGB 4UQ2B 3O8XB 4YIQB 1N6UA 2CRIA 2Y07H 5DJAA 1VKXA 1MHCA 3QDJD 3MREA 4QRQB 4P23B 2ICWA 2Z4QB 4KI5E 5F9JB 2IAMC 1T7ZA 2JTDA 2CD0A 3O4LB 4KRLB 4KQ3L 2F5AL 4PJIE 2IBZX 4R4BB 4ETQA 5E6IB 3TFKD 2XKSA 3QIBC 4Z8FH 3SDDB 2CR6A 1K4CB 3ARDD 1BQLL 1JUFA 1T22A 4NQDB 1WV7T 5GHWL 2PNDA 4G43B 2D2OA 4RGOH 5CZXC 3S4SB 3L3KB 4PS4L 3F7YB 1IQWL 3G6AA 5EOCJ 1X5FA 4FN0A 1YUHA 2GK2A 3S9DB 3H9SD 4Y2OA 2FIRT 2Z93A 3AREB 4JPVH 2VZ1A 5C0NC 5EIVA 2G9HB 3MRJA 5GS1C 4MNGE 4NKOB 4BQBA 2GUOA 4YHYC 1T1WB 5HI5C 2W9EH 1F58L 3BVNA 4FXLA 4QHMA 3QCTL 4FQHA 5LBSH 4K9EC 4DZ8B 3ZYZA 4QYOB 4C4KO 4FRWA 4N5ED 1JNNH 5LWYH 3TNNB 4OUUB 4OGAD 2A6JA 5EUOA 1W72A 3LV3B 5DTFB 5DA0B 1FZOB 2C9AA 2C1PB 1BF8A 5KG9A 4ONOA 2OQJB 5CGMA 2LABA 1EAPB 4LVEA 4A6YH 2W9LA 3SDCD 1IC7L 3H9HA 2LTQB 3IFPB 5I1AB 3I6GA 2OJZL 1NLBH 1CDCA 1CLZH 3P9MA 5ALCH 5DUMH 1QBML 1XGRB 4MA1C 3WS3B 3IFNL 2QQNH 3CFBB 1ZKAA 3FAWA 2VLMD 5ICYA 2PW2A 4LK4A 1JGLL 1CFSB 1UQSA 3FO9A 2PXYD 5HYJD 4J6RH 3O2DH 4XRCA 4PRDB 4KK6D 4F15B 1YJDH 2H6PA 2GTZB 1H3UA 1NC4A 1H15A 3RPIB 2VR4A 4Y4FC 3R06A 3BDXA 4Q97A 2HRPH 3SN6N 4LGRB 3O6KH 1WWAX 4NO0D 1NCAH 1YMME 4FQLH 3SDAC 4PGJA 1J1OH 1CT8A 2NX5B 3NTCL 5E2VL 3U4BL 1N5YL 4P2CG 1X4XA 4KC3B 1ZTXH 4GRLB 5DRXA 2OZ4H 2BOBB 5IT2L 3T1FB 2JK5A 1UM4L 4YDLB 3RWIA 4UB0L 3LB6C 5SWZE 4XGZA 3IDGA 3HZYB 3AS3A 1Q72H 2OL3A 2BZDA 5JORB 4XPHH 4M93C 3QEQB 2OJZH 3HS0B 3GSNL 3QO0A 2E27H 3BPCA 4JFZH 4KVNH 4XVJL 4IOSD 5CMAB 2UYLB 4MD4A 2B4CC 3T4YA 4JFDD 2DYPB 1T1ZB 3QI9D 3NFPA 2CK0L 1JNLL 1R24A 3PP4H 3TIDB 1A3LL 4U33A 1PYWA 5D7LD 5TDNA 4NNXB 3VG9C 3D3VA 3FB6A 1MCCA 3RKPA 5CIPB 4RCAA 5DQJA 5F3HA 4MJ6A 3NIGF 3BZEA 3ARRA 3ZTJH 4Z7WB 5C0DA 5ISZD 1C1EL 2W9EL 3O6FB 2F54E 3RWFA 3MV8A 4D8PA 3R0MA 3I50L 1GZQB 2AK4E 2RFXB 1FFNA 1C08B 5F3BA 2GJJA 4PR5B 4K9EL 1YN7A 2C5DC 4PP2A 5CWSA 1AD9A 3AS2A 4MA1B 4NGHH 2FJGA 5HGDA 2OBGA 4YDIH 4M7ZB 2ADJA 2FEEL 3X13A 2DICA 1UA6H 4K3JH 3THML 2ENYA 2LVEA 4XPAL 4U1HA 4Y16A 4NBYB 1OTTC 2VL4A 4PJXF 2WV3A 2W60A 1DDHA 3K8MA 4H26B 5F7WC 3MLSL 1IMHC 2PW1A 1KTKE 3V52L 5D7IB 3H9YA 4XNMA 5T1LA 2N7AA 3RQ3A 5C0AD 2VDQH 2Y7QB 3RVXC 2WBJD 4HS6A 2WM0A 4EN3A 1BVLA 4WU5A 3TCLB 1N64H 1VPOH 2F74B 2NNAB 4FFYH 3KPMA 1NCNA 3ZDYF 5HHOB 4ZTOL 5JHDB 4GAGH 3DI3B 43C9A 4M1DL 2BX5A 5JXAL 3ZKSD 5EU6D 4UT9H 4E42B 1JGEA 1WZLA 1VFMA 3TO2B 1BZ9A 4D0DA 2DKSA 5IVZB 3HA0A 2UWEF 3SDDC 2X10A 4JB9L 2EO1A 1I3RA 4GUPB 1PW3A 2R23A 5IQ7H 4L4VE 1A6VH 1N0XH 2W9DH 5L7XL 4PGEA 4JPKH 4N5UA 2PR4L 4JHWL 1QA9A 2Q7NA 5T33L 5CSZB 3MOAH 3ET9F 3IJYA 4TUKL 2ENSA 3BZFA 4LLVB 2M2DA 5CBEA 4NO5B 3D0VA 2Q8BH 4HPYL 5IBLD 4IM8A 5IIEB 3MYJB 5SX5K 3SY0B 3UMTA 1ZVYA 1ONQB 4IDLA 2V2TB 4NC2B 1U93B 4Z95L 2LU3A 3TYGH 4I5BA 1Y6NR 2CK2A 2APFA 1WBZB 1VCAA 4F7MA 1KTRL 2QKIB 5D5MF 2FJGB 3NGBC 1OLZA 3HC3H 1SM3L 5GGVL 1N4XL 5SWZA 4N9GA 4GXVL 1RZKH 3DGGB 4OLXH 2JB5L 4AIOA 3VE0A 3JZ7A 4IHOB 2XQYG 4PJHE 4Z7WA 1EMTL 1JNJA 1A0QL 3PGFH 3NCFB 1IGFH 5FYJH 1OHQA 2WUCL 1YC7A 1PYWB 3N1PC 4C55A 3IDNB 5HVGB 3TIDA 5IBTL 2GITA 1X5XA 5HBBA 5IR1B 2LU7A 1MJUL 5DJ0B 2F5BL 3T4YB 5KS9A 5L2KB 2WNGA 4GQ9L 4N9OB 3QXWA 5DFTA 4ZAKA 3QO0B 1AC6A 2F54A 3DYOA 3MBEC 1WT5A 3WNNA 4G6KH 2PYFB 2BRRL 4N0UA 2OL3B 3RUGB 1YYML 2AK4A 2JCCB 3FL7A 4JFYA 4PJHF 3RWIB 4IIQA 2JK5B 4W6WB 4GRLA 5D9SB 5DRXB 2QSCL 3QISA 4FNLH 1A8JH 4X6BB 3TP4A 1UZ6E 3MROB 1FVEA 3S7GA 2EEDA 4W6XB 4LHUA 1U0QA 4NWTL 4WHCA 3D18B 4ZSOE 1WC7B 4OGZA 4ORGB 5K33A 2ZKHL 4P9HC 1JRHH 5JHDD 2E9WA 2GTZA 1OPGL 2GSGB 3RWHA 3RHWK 1V8HA 4JQIH 1LNUA 5HDQL 1OQXA 2E8YA 3FO9B 3N1MC 4RZCA 2PW2B 5C08A 2OJEB 4XAKE 1BAFL 4QRUB 4Y1AA 4UNTA 4PY8I 3FQTA 4JN1L 3QQNA 4HIXH 3I6GB 2EEBA 4I3GA 5I1AA 4I2XB 2VAAA 4QRRA 5CEZL 3IFPA 4JY6B 5GS2D 1A21A 3QEGH 2VLME 2ARWA 4RBPH 4EVNB 5D1ZB 2OQJA 1TJHH 4X98B 1N7MH 2B4CH 5AG8A 2QSCH 4FNLL 3O81A 1FZOA 3UZQA 4GH7B 2YMXH 4Z7VE 2DI9A 3MXWH 3TNNA 2GJ6A 3QCTH 1HWGB 4XNQB 3FCTA 1TFHA 4FQPA 4LLWA 3VXTA 5BOPA 1MFAH 5F70A 4L4VA 3QUXD 1MWAH 1UXSB 4P2QA 4OFYD 4YK4B 3OAZH 4YHOH 3AREA 4KRNA 1RZGB 3GHEL 4HPOH 4P2RB 3W9DB 2P45B 4FQXB 5HHMB 4BQ6A 4OFIA 4GAJL 4WEBH 5ADPH 4L1HA 3T0WA 3S4SA 2XG4A 5BS0D 1OAXH 2ED7A 3NZHH 1DQQB 3K74B 1NLBL 5JW4M 5HD8C 2PO6D 3FFCD 5IESL 1JUFB 5TFSH 4YR6B 4PV9B 4Y4KB 5FHAL 5TF1L 1TCMA 2R2EB 2G75B 2YK1L 3WKMH 2CIIB 1M7DA 4FQ2H 1P5VA 1LD9A 4HUMB 2HP4A 4X4ZA 2Z4QA 5I8KL 1UG9A 5GQBA 4EUPA 1IARB 4QRQA 4Q6IB 3QO1A 4MMZC 3TBSA 5JOFB 4LOUD 1ZHKB 4D3CH 3O3EA 5EIQA 5SX4H 5K9OA 4H20L 3QCVH 2Z9TA 1GCFA 3C6LD 1E6JH 4FQQB 4LPUA 1CZ8H 4QOKA 1G9MC 3NPSC 2JJTC 3OZ9H 4PJFE 5EZJB 1S7TA 4ZO8A 5EC1B 1L9NA 3CFKB 3UYOD 4BH7A 2Q8BL 2EDDA 2JCCE 1M6OB 4NM4H 4XH2A 2HJLB 3CLFH 3MV7D 1ZT7A 4PS4H 4DVBA 1ZHKA 2AW2A 4HBQA 5KANG 5KVDL 3B8SA 1Q9OB 1ITBB 2B0SH 1NL0L 1VFOA 1CE6B 3P4OA 5D2LA 5DRNA 5J89A 4LSDA 5E8OB 1C5BL 4NKIH 5GJSH 3R4DA 2KBGA 2OMBA 3STLB 5JR1H 4QXUH 1OY3B 1I9RL 5HHXH 4LLDA 1RHHB 5KBNC 1H0DA 3SE3A 3MRNB 3T0ED 1EFQA 1VFAA 4U1MA 1ZOXA 3QCUL 4I1NB 1RUPL 2ID5A 2B1AH 4J3VA 2VH5L 5EU6B 1I1FB 3U4EB 1TVBB 4PG2C 1ZLVK 5HDOA 1URLA 3S98A 2WAHA 5BMFH 1RZGA 3LOWA 5D7KD 3TPUA 2H1PH 4JPIB 5DXWA 2JB6A 3UTZA 3HNTH 2RAMA 2EECA 5FOBA 4LLQA 3WO4C 4HHAB 3LKQA 3WLBB 2IANA 1T4KB 4TNWF 5E8NA 4LPWA 1QFPA 4LLWB 1VGKA 5DLML 2MCG1 5M95B 2GJ6B 3MLRH 1L0XA 3RFZC 1HINH 1OARH 4QHNB 2W91A 1CF8H 2X70B 3H9SB 4KGJA 3KYNB 3BHBB 3V6OA 3TO4B 2K7QA 3KLDA 5TH2A 3A6BL 4JANB 1D9KA 2GCYB 1T83C 3NFSH 2BVPA 3PG2A 4CVZB 3DMMA 5D71H 3T04D 5AEAA 3C2AL 5JPMA 1TTUA 4CL7A 1GIGL 4H5SB 2OJEA 4R2GC 5JZ7D 4PJGA 3I75A 4XWGH 2EH8H 4H8WC 2VQ1B 4HWEL 4AH2B 2J6EL 4JRWA 3BH9B 3QULA 3UBXG 4YNYA 5F89B 1ZLSH 1CZ8L 2GKIA 1A7OH 1L9MA 5DRZB 4NRXA 4RX4A 4F37F 1IE5A 3PWJA 4PD4K 2J8UB 2FX8H 2HT2C 3MRKA 5ICXA 2NXYC 2VC2L 3PWUB 2AK1H 4HD9A 2XZQL 3BO8A 2DQHL 3P3YA 4LDOB 4DZBB 5FO8B 4N8PA 3P2TA 4M7JL 1JPTL 3RTQA 3VMOA 1B0WA 2CQVA 1MFBH 1DFBH 5I71C 2C3HA 3P73B 2F19H 4P99A 3FB5B 5C0CD 2H3NA 4TPRH 1IAOB 2F54B 3QFJB 5HHXL 3MRMB 3M17B 5FYKD 2R4RH 3BH8A 4JG0L 4ZAKB 3C8DA 2OK0H 2X4UA 4D9QE 1KEGL 4JQVA 3KPLA 3VFOB 2Q1EA 5EUKB 2X9YA 2OZ4L 5IR1A 4Y5VB 4G8GB 2BJMH 1NFDE 4AQ1B 4UQ3A 1FO0A 4ODVH 4X99B 4P2YA 4PFEA 3BKCL 1NCWL 4UT9L 5C0JA 2A9NL 4MNGB 1I7UA 3NZHL 4TSAL 5I15H 4HMCA 5L0QB 3UO1H 1BBDL 1BFVH 5HI5D 3SKJH 1EIBA 3VE0B 3QEQE 1UH3A 2WBJC 2R0WL 3DGGA 1AKJA 4LVNC 3DVIA 1YEHL 3DETC 1U8MB 2NXYD 3NCJH 2OYPA 5DEGA 3ZT5A 3C2SA 5EZLA 4F7MB 4PY7B 1OAYH 1A1MA 4MS8D 3D39A 4QY8A 2P44B 2NY1B 3EJYC 2QQQA 3HI6L 5DJDA 3P4MB 3SCMB 1Q0YL 3EGSA 1ZWIB 1H5BA 5IIEA 3CNKA 5DD1H 3K2UH 3VXSA 3TN0B 5TGBA 4YHPB 4EIZC 3BZFB 4PBVC 1ZTXL 3ALWA 4KV5E 5T5FL 4ERSH 5C86A 1E4XH 3VFPA 1LE5B 4W4OC 4FFVD 1CBVH 4Y19D 2DTSA 5IB2B 5JQ6H 1J1XH 2IFFL 1J1XL 3FN9A 1LP9F 2E27L 2D7PA 4YUEL 1YMMB 3Q5OA 3PGCA 1KBGH 1J86A 4OCNC 1BP3B 5A16B 4NO0A 4OAWB 1RSFA 2XN9E 2ZKHH 1JZ5A 2P7TA 1DVFD 3A6OA 3W11D 5HHOA 4S1SL 3OJVC 4OUOA 4PRNB 5T1DH 3KPMB 2ATKB 5DUBB 3OKEB 2XA3A 3WE6A 3HUJA 2PYEB 3GSXA 4ZDHA 4LARH 2ZUSA 1MFNA 4FQJH 4WU5B 4ALAL 3QUKA 3RY5A 2Y7QA 5D2LF 3OB8A 5TF1H 3QUMA 2XY1A 5FK9B 4LLUA 5E9DE 3KYMA 2WINA 4EUPG 1B6DA 4HK3J 4FMKA 1RQ5A 5GISH 5ITBH 4OZIB 2BNQA 3TVMC 1X7QB 1HCVA 3V4VH 1JZ2A 4IRZL 4NN7B 1B0RA 3BKCH 4Q74A 3QUYD 1ZAGA 4QXWA 4YLQT 1CFVH 2CRZA 1H3VA 3RZCA 1YY9D 2YOCA 1X5GA 3NTCH 5E2VH 1N5YH 2EE6A 1F3DH 4LRIC 5HGDB 4XP5H 1R5VA 3FOLA 5TJWK 2AJSL 4EBQH 4MA8L 1R3LB 1NCBL 4KJYA 5F9OL 3WNLA 1CFTB 2NTFA 4CN6A 3MLRL 3D39D 2CKNA 2DKMA 4PGZA 5DK0A 5JIIA 3WSQL 4HULB 1U8LA 1CU4L 4D0BB 3BKML 4PJ5D 5DQJB 5F3HB 2V2WB 1ACYL 3SE4A 3VI3E 2I27N 5D6CB 3NCYS 2J5LB 3HC3L 1FGNL 1KFAH 2NLJA 3D3VB 3FB6B 4KXZI 2UZIL 1WIUA 5D7JC 5TQ0L 3CDGB 1D5BB 4OCYL 1GOFA 1UWGH 2LFGA 5E5RB 2FX8L 4LEOA 1EDQA 3IGAA 4OCWH 4ZD3H 1EHNA 3QZWB 4JRYE 1PSKH 5DJCA 3O45B 3O8XC 4EI6B 3LKRB 3HS0A 3R8BB 3QEQA 5BMFL 5JXEC 1R3JA 2R1YB 2BNUA 4ZXBC 2X1PA 2ZSWB 3S35L 2F53E 1NAMA 1NGXB 2H26B 2ILLA 1FIGH 3GSWB 4AT6B 3JVGC 1WBYA 4MZ3A 4ZNCD 3SKUD 3TBWA 2J8HA 1AGBB 4AEIH 1SYSA 4KZDH 4LP4A 4PJ7E 4HXBL 4RAVB 1IL1B 3LQZB 3TT3H 3W2DH 5EU3B 3VH8A 1TPXB 1FGVL 1JHTA 5BJTA 2XXMB 4L3ED 5DQDH 4R4NC 3SE8H 3WN5A 4HWZA 3BPLC 1JNHA 3EYUL 3RWGA 1MCWW 1G9NH 3ARBC 2H6PB 3RPIA 2COQA 2P8MA 4HMDA 4M1GL 4XRCB 4B7LA 4YWGL 5BS0E 1YEFH 3GMMB 1MCPL 1RURL 5F96L 4KI1A 1MCPH 4N0FA 3JUYA 1UJTA 4JVPA 1JP5A 4YEFA 3KPOA 5D4QA 4I77H 2AJVL 3MLVH 3CH1A 5D2NB 1XIWA 5K93A 1FG2A 2NCMA 4QRSA 3VXNB 4S1RH 4NSKA 5D7JD 3HG1A 5BRZE 5DJ6B 4NQEE 1YMMD 4I0CC 4M1DH 2VISB 1F3JB 4DGIH 4KZDL 4IEFB 1FIEA 1F8TH 2BMKA 3SDCC 1EUTA 1F8TL 1XR8A 3LN9A 3WL9A 4U6YA 4MAYB 1A1OA 4JKPH 4L5FL 1B88A 3QXAB 4Y19B 4P0DA 1A6ZB 4XCCH 3RY4A 1FHGA 3J7HA 4FQ1H 1FORH 4IRSC 1P2CB 1U3YA 1T1WA 2QTEA 3GMRA 5JHLH 3WIFA 4GMSL 5GPRA 2G9HA 3MRJB 2HTKD 4OSUH 3QP3A 5BV7C 2W65B 3B9KD 4K94L 2XZAH 4LSRL 2YPVH 5AZEH 1TXKA 1BD2A 1CL7L 4LDLB 1I8MA 1QPXA 2PTTB 1GAFL 5HPMA 1QRNE 1D6EA 5K9QI 5EBLA 3E2HC 4GKZB 3MJ9L 4PRAB 4XHJC 4Y89A 15C8H 2CIKB 4WTWA 3V0VB 1MWAL 4HAFA 3OZ9L 5DYOA 3VA2C 1K4CA 3B9KA 3O4OB 4POZC 5E6IA 3FHAA 5IT2H 1BEYL 4HIEB 1PZ5A 1BZ7A 3O9WA 2IG2H 1R3IL 1QR1A 4WO4C 3EJZC 1MCEA 1IGTA 4HKZA 5B4MD 5MP6H 3W9EA 1AD0A 5J06A 3QQ3B 3ULUF 1HDMA 3GBML 2NW2B 2NXZC 3NN8B 4RBPK 5I9QB 3SO5A 4I0PA 1I1AD 2HG5A 4O51B 4HKBB 1N59B 3E6FA 3QNZA 1GZPB 1HYSC 4TUOA 1Z0MA 4XVUD 1R5IB 1C7SA 3FQNB 3DX8B 4N0RA 4OLZL 5B3JF 2J12B 2HJKB 4ZPTB 1Q0YH 3QEUB 3B3IB 1VSCA 4JG1L 3GSVA 3C8KA 1A6WH 4PP1D 3VH8G 1KPRB 3OJ2C 1OTSD 1T1YB 4ZNEA 2X2YA 5ID0A 4QTIL 3RWEA 4JRYA 4OGXH 5E6ID 1FZKA 3RUGF 3QUYC 5C0IA 2Z8SA 3MV9E 3G6JE 1U58B 3H42H 3S5LG 1IGCL 4G8EB 4DVRH 5E99L 5CILH 2FDBP 3I6KA 1P69B 4ZUSA 4HH9A 1NCUA 4YDJA 3THMH 3GKWH 2W0FA 5ESVA 5ADPL 2D9QB 2A9NH 1A22B 4RMUA 1ZVSA 2XTJE 3GSNA 1NUNB 1EEYA 5GXBB 2EDKA 2YD8A 1TNNA 3PV6A 3U2SA 5C70A 1XF3A 4DOHB 4F33B 4C56B 4JPWL 1Z9SA 2IPUG 3CZJA 1YEHH 4YBLB 1CVSC 1AO7E 5B39A 1DBJH 5T1MB 5BS0A 4JQXC 3GIVB 1IJ9A 4IMLA 4HUWB 4KTEH 3WD5H 4X6DE 2WUCH 2BHZA 4PJDF 3VXRE 1T2JA 4UOJA 3HI6H 2R15A 3CVHB 3E3QC 4HS8H 4WWKD 5GRJL 3U7AA 4L3EA 2AEPH 3AU1A 5E8DL 4E0RA 2P46B 3P40A 1UC6A 4P2QD 4DGYL 4ELKB 3W0WD 2Q3AA 1BQSA 3KPQB 1QSEA 3HG1E 4JFPB 3TA3A 2GJ6D 1A14L 1T20B 3VGBA 1NJ9A 4ZUSB 3I9GL 4M4PA 4MA3B 2CLRA 3NABL 5IKCB 2VDNH 4G8EA 4ODHH 5BO1H 1I8IA 4XNXL 1IAKA 1OB1A 4Z6AT 4LCIL 3BKYL 3NA9H 1E6OH 3O4LE 3VI4F 3RWEB 4KKCC 1TNMA 1I8LC 1T1YA 3LQAC 5E94A 1S9YB 2OTUA 3Q6GH 2CLZA 2F5BH 2AERT 1CFQB 5C08D 3LZFH 1AXSA 4V1DE 5HGGS 1KCUL 2ITCB 4TUOB 3X11B 4YFLI 3VG0L 3QH3A 1QFWH 4PJ8A 4AM0A 5BW7C 3BXNA 1PG7W 1FNGA 2HFEB 3K2UL 3LKPB 1NMAH 4NN6C 1Q9KB 4K2UL 4CKVX 1P4IH 4PB9L 3NZ8A 1OAKL 1MH5B 4I13B 4IRSA 1AHWB 3EO0A 3ZSTA 1MCSA 2DQGH 4HKZB 4N8VB 2P1YA 2JIXA 2GTWB 5JDSA 5DS8B 4QKXB 3NFNB 5I74B 2EIEA 4HIEA 1DN0B 2IALA 5FGBC 1KPUA 1SMOA 2VITB 4JO2H 5HHOD 8FABB 1F6FB 1MVFA 1KN4H 3EUUA 3B9KB 2AXHA 3OTTA 4LOUC 3PP3H 1RK1A 4IRJD 5IEHB 1S8DB 3EOTH 4QRPB 3JV5A 3GIZH 4UV4L 5DJ8B 4G6ML 4NJ9H 1QSVA 5MEOB 3B9KC 1BMGA 5IBUB 4P57A 1CQKA 3QIBB 5DDHB 3C5SA 4M5YH 1QVOA 4X9FA 3QUML 3QJFA 5EZIH 4YC2B 5JW4R 2XQYK 3OKMB 3WIFB 2XY2A 4NQVA 2J1KA 4PBXA 3G6JA 4IOFD 3QXAA 1C16A 1S5IH 1WWCA 4MAYA 3SJVE 4U6YB 2PCPA 2P5WB 4QLRA 4KROB 4GXVH 1ZA6B 2A0LC 3QNXA 3MXVH 1A7PH 2AK1L 1OTUC 4QNPF 5IMOA 4YHIA 1RV6X 4X80H 4RRPA 3OGCB 3RVUC 1Q0XL 2LAAA 5TF0A 4ZYKB 3QDGE 5L8LB 1I1AC 2X4RA 3CH1B 5D2NA 4F9PA 3QFDA 1OP9A 3CVHL 1KIUA 3HZVA 1AO7A 3V8OA 3HPJA 4LL9A 3Q5TA 1QFUL 3DUUB 1J1PL 4ZS6C 1P6AB 4G9FB 4U0RC 3C87A 4HJGA 5F6IB 1P1ZA 1AR1C 3AGVA 1XGTA 4M4RA 5T1DL 2X7LB 5KVFL 2VDLL 4FQ2L 3RWGB 3PHOB 5ALBL 3VXMB 3LHPH 1RJLA 3EYUH 3OMZA 3CXDH 1MFDL 2BCKA 4LLAA 5BJTB 1L6ZA 4JFZL 3VWJD 4PIRF 1DBBL 4PUBL 1A47A 2FRGP 2R39A 1LQSR 3HRZB 4JRXE 5J1SC 5TPWH 1RI8A 4FG6D 4PJHB 3HI1B 2VDQL 1AIFA 4EOWL 5E7BA 2ZSWA 1YDPB 2DQFA 4O5LL 4K7PY 2R1YA 2VZ3A 3D3VD 4EDWH 2DQCL 4Z5RA 3RTQD 4Y2DD 1AHWC 2EZ0D 3GB7B 4HXAL 1CFVL 2AEQL 4P5KA 4YDVB 5D1XD 1EGJH 3BP6A 1C1EH 4P5TB 2YN5A 1KTLB 1EBPA 1LE9B 3WFDH 3BT2H 2UV3A 2WBJA 5C6TH 1NKRA 5JUEL 3V79C 2A6IA 3L3DB 3GJFK 4JKPL 4OLYH 1FDLL 1I1CA 4H8WL 3W11C 3V5DB 2EYSB 3V5HB 4UILH 4MNQA 1UGNA 4CVXB 5F1NB 2LQRA 2D7TL 3GEWB 4HBCL 5JLZB 4LVOC 1AP2A 3VFSB 4XVJH 1RUPH 2NMSA 3QUYB 3IDYC 4NKIL 4N90D 1Z9MA 5JMOC 4PJ7F 3PDOA 1IM9A 3EFFB 3WLWC 2BNRE 4OZHE 3V4UH 5FOJA 4R97B 4GOSA 3TZVC 3RBSA 2DJ4A 3CSYA 3EOAA 4YXHL 5HHPA 2B1HH 1UZ6F 1T03L 5IJKC 1KPVB 1F13A 2NZIA 2NTSP 1QSED 1NGYB 4RX4D 4UMGA 4HPOL 2NY1D 5EA0L 3DX9A 2C7UB 3WNOA 3QCVL 4P5KB 4YDVA 1B2WL 5EG6C 4H1LH 2ARJQ 3O6LH 2VLJD 4Z5RB 5GSVB 3ZKMC 1NC2B 3QUMB 4X83A 3GGWA 4ZFZA 3FB8A 3VXOA 1IT9H 4ZOBA 3ULVC 4KPHH 1P6FA 3IFNH 4I18B 5L8JB 1L7TH 1FZMA 4F2MA 3UYPA 5JO5B 4R4FL 5LGJA 4NRZA 1JWUA 4M6MH 1R3KB 1MAML 3EHBC 4Y2DB 2I24N 3IDMA 1AGFB 1LDPH 2V9RA 2XTJC 3QJHB 2V5SA 3QRGL 3QDHA 3TVMB 4FQIH 4JO1H 3V7AE 1VA9A 4G9FA 3U82B 2IAND 5CJOH 3CLEL 2JJWA 2E6JA 3WXWH 4FABH 1KB9K 5ESQA 5ACZA 4UIMA 3U9PH 2YA2A 1KCVH 4NOBA 3WBDA 1MLBA 3FTGA 2X4RB 2NZ9C 5MP6L 2VWEC 1KCRH 4OB5H 3MCG1 3OGCA 3X3GH 2CKBA 4X7TB 1P4LB 3S4SG 2HWZH 1BOGB 5HY9B 5I19H 2HLAB 1RJYB 1XCQA 4KPHL 4M5ZL 5HYSG 2Q8AL 2VDRH 4BQ8A 4OKVB 3DO3A 5CEZE 4JG0H 3SCMA 1QBAA 1T04B 1FYTA 5DURB 4O58L 2PCPB 1CF8L 2BXZA 1A4KB 3ZE1E 5MI0B 3Q5YA 2IEPA 4WFFE 1XH3B 1A6WL 5IQ9B 2Q6WB 3SE4C 3GO1L 4DUVA 1SJXA 1U8MA 3AAZA 5IB3A 1AKJB 4DOHE 5F7UA 3F7VA 4P4KB 3EJJX 4NO2B 5ITFA 4K7FA 3H0TA 4OZFH 3S36H 1RIHL 3C5SB 4MCZA 1WFUA 2X4TA 4MNGA 2IFGA 4HGWB 4P3CL 4YXLL 3QQ4A 4TUJB 2EDJA 4QOKD 3K2MC 1S8DA 1MCBA 3E1F1 1DVFC 2W38A 5EUOE 4KDVA 5KSBE 1QSFD 4ODBD 4G8GA 4NQXA 1NANI 4YDLC 5FV1L 4C58B 2IALB 4LEXL 5EUKA 2Y6SC 2XWJB 4JM2A 3FOMB 4Q58C 3NVQA 4KMQA 2GFBA 1AFVL 3OKNB 4N8VA 3ZSSA 1QLFA 4QCIB 3ULUH 5DHVH 4R96B 4F9LC 4S11A 2C3XA 4X6CF 2BNRA 3L3HB 5MEPB 2VZOA 1HILA 2DWEB 4OZHA 3WO3B 5DR5H 1FNGB 5A2IH 2IQ9H 5FXCH 2QSVA 2EH8L 2XQBH 5KOVC 2ITCA 3X11A 3MRPA 5GGSA 5ANME 1ZK9A 4OCSL 5DGQA 1NBZB 1N8ZA 3PWJB 1TMCB 4NRXB 1I1AB 2EDBA 1CG9A 5DHVB 5BVPH 3RVVC 3O3DA 5ABDE 1J0ZA 1FH5L 1JMXA 2PXYB 4XWOC 5EU4B 5J12C 2M26A 3UJIH 5I2IB 1Q0XH 1I8IB 3TO4D 1K4DA 4LCCA 4HBCH 3UYRH 1DQDL 3CGTA 3VFRA 5I71B 1SJHB 2GSIA 1LO4H 4CW1B 3GK8L 2EXYC 1FVDA 3QQ9C 1C5CL 4P5MB 1REIA 1HQ4A 1RUAL 1T6VN 2O61B 1LO0L 2QL1A 3QHZH 4MD5A 1ZA3B 3AM8C 5I1GH 1QSEB 5CAYB 2C3VA 2Z8VC 5EU6E 3P0VH 3KLHD 5EORH 1HXMA 1LP9B 1T0NB 1TPXC 3KYNA 1KCLA 1RJZA 4GW4A 3JSSA 2DD8L 1QZ1A 2FIKB 2EIZB 4LCWD 5CZVH 4EXKA 4IMLB 5EBMA 4OD2B 3KVQA 3BYYA 2X1QA 3MODH 1OAZH 3PF2A 1RURH 3PABA 1YEKL 2VO5A 4R2GB 3WHXA 1OWRM 3WFBH 2JB6B 3UTZB 3C60C 2YPLA 4MWFB 1UWXK 3RGVA 4LHUD 4FP8L 1XF3B 1UA6L 1MRFL 3CFCH 5F7FA 3LQMA 3SBWC 3EIFA 1NAKL 4ODTH 3GSNB 3MACH 1ZVSB 3GRWH 3R1GL 4KHXL 5TQ2H 3RNQB 5IOPA 3UP1A 2HMIC 4WO4A 1Q9WB 1MEXH 2W0FB 4H0IA 4M7JH 1VFAB 3HMWH 3BMWA 1C12B 3FB7A 4LLDB 4FZEL 3G5YB 3BP4A 2XT1B 1RU9H 1NFDB 1FP5A 4NN6B 2NY4C 1QFUH 1TJIH 5DJZA 3PHQB 3BDYL 3SGJA 2EO9A 1YMHB 3FN0H 4K2UH 5C0IB 2I9LB 1EK3A 4JFQB 4L3AA 1HEZB 1T21B 4PRHA 4FQCL 4JZJB 1JJUA 4HF5L 4ZUUB 1MIEH 3K7UA 5GIRA 5AG9A 1MRDH 1ZT7B 5IMKA 3FQNA 4XH2B 3LD8B 1I8KA 5M7QA 5D1QA 4YDKL 1IEBB 4LQ1A 3RZCD 3Q6FA 2HN7B 1GZPA 3QNZB 3QYCA 1EHLL 1N59A 5HYJE 3GKZA 3CMOH 5BZWB 4PJXB 3NN8A 2YN3A 2NW2A 2ITDA 2YD4A 3HKFA 4MNHB 2G2RA 2DQUH 4XNYL 5JOFA 1NGZA 4O58H 3REWB 2KZ1B 4R8WL 3R0NA 3HR5B 1PDKA 1WCBB 1Q94A 3MLZL 3DROA 5HGAA 3EDDA 1PZ5B 1F4WH 3IFOA 3MJ6A 3FFCE 3MCKA 2AXJA 4YR6A 2HJFA 3WIIL 3HE7D 4NHUA 4U6VL 4HIXL 4FXKA 1DVFA 5IESH 4JHBA 5DZLA 3BIAX 3BPOC 1T89C 1JTPA 1FORL 2NYYD 3FT2B 3V5KB 4YFDB 5JPNA 1VACA 4ERSL 2ZWLT 4MVBD 1KIPA 1S3KL 3HR6A 4ZOCA 5KVMC 4M6NL 4PB0H 1JRHI 1J8HD 1UZ8B 3H9SE 3RVWC 1YEEL 43CAB 4YZFE 2FL5A 4Y19A 3SOBH 3HMXA 1A1OB 3WL9B 3WNPA 4NKQB 3BEVB 1KUMA 4MDIA 2E7LA 2VISA 4NQCB 5D1ZA 4EVNA 3P11L 1AH1A 4X7CC 4LKCB 1JCKA 2ZPKH 1QNZH 5C0BA 2FECL 3VXNA 1QBLH 4DKEH 3X3FL 4U6VH 1XIWB 2BY2A 3BDYH 35C8H 3C5ZB 5CFHA 1DR9A 3KPOB 3U7WH 4YHML 3FQTB 4XAKD 4LNRB 5B21A 4NKMA 1PLGH 3PWLA 3T3ME 3MLUL 4RZCB 4O2FB 1KIQB 1INDH 1AKJD 4RAUA 1XCTA 4UDUB 3QIUA 4PJ8C 1SVZA 1YJDL 1FAKT 5I1EL 2V9QA 3UJJH 4JREB 4PUBH 3UROR 2FD6H 5CKAA 4J12A 4HWZB 3D18A 4MAUH 5D7IF 5D72L 3OKKB 3SOBL 4LHUB 1W72L 4LFHD 3GUTB 1UCTA 1Y6MR 4DGYH 1CK0H 2DJUA 1JF1A 4GQ9H 5FO7B 4X6BA 4ORZC 1SYSB 4OQ1A 3ARGD 1OW0A 3ORJA 3HE7C 5T1LD 2H26A 3ARGC 3DMMC 5E8PB 3ZE0F 1S7VA 4PJ5B 2HFGL 3IAGC 1AGCB 2BNUB 2PYFA 1R3JB 2EE2A 3RIFF 1WK0A 5ESAB 2A6KA 1RIUL 5E4IA 4NZUL 3PWPB 4PJAB 3O2VL 2EC9T 3WIHH 5J13C 3MRBB 1YA5A 3QUZA 4DEPB 5EPMB 1G1CA 3IDNA 5LCVL 2YXFA 4UNUA 4LAQL 2B39A 2NPLX 4LSVL 2AJXL 4KI5D 4J3TA 4I77L 3RNKA 2NW3B 1OAQH 3GSOA 2LVCA 3RRQA 5KANI 4S1RL 5E56A 4B41A 5HYJA 3I2CL 3H3PL 1PKQB 1XF4A 4Z7UA 1ED3B 4NNPL 5L0QC 4KJPD 1MPAL 1DBAL 1P53A 2EDHA 1I85A 4L4JA 2MMXA 3U0TA 3V0WH 4F58L 5MENA 3OAZK 4NUJB 5HHQA 1J1PH 4JDVB 1YN6B 4GKSA 4EDXA 5C07B 5E00B 2QKIA 3MRGB 5H35B 1S9WA 1FGVH 1G7HA 4M7KL 2Y4SA 1JIBA 4I5BB 4X9GA 1MIEL 3OAUH 3RZCB 3U7YL 2ZPKL 4PRPB 1U93A 4Z7VB 2D4DA 3KLSA 1ZANH 4CVWA 1WFTA 4NCDA 2F58H 1KJ3L 3OAYH 1QPPA 2CK0H 3IRZA 3O8XD 1RZ7L 1HHHA 2BNQB 1OAUL 1AFVH 4LAQH 1KB5A 3IVKB 2BY0A 2WINB 3CFDB 5HVHC 1FJ1B 2JJVA 2OTPA 3FKUS 1OGTA 1HH6A 1JTOA 1JL8A 3W39A 2FD6L 2X4NA 2XPGB 4KUCD 3LRSA 4TVPH 3WE6B 3OKEA 1AXIB 4Y19E 2P8LB 5GS3A 2WIIA 3X12A 3GJFH 4Z7UF 3KPRB 3IXTA 3T2NL 1JGEB 3BT2L 4R26H 1X5KA 5IHZA 2R69L 4ZSOB 3WIIH 3ZKXB 3ILQC 1AC0A 5F9DC 3CFEA 3PGCB 3T0EA 2BFVH 2P8LA 1E28B 3DJ9A 4QOKE 3L1OH 5I66A 1DQTA 5HVFB 4ODHL 5DJXA 4GMSH 4MXVF 5CUSL 2VDOH 1HH6B 1F45A 1OGTB 4OF7A 3PGFL 4MLSA 5D6DC 2ATPB 4K7PH 25C8L 5J1AA 3GIZL 5T1LB 2WQRA 3RUGE 1LE5A 4TVSa 2YSSA 3FQRA 3MZGB 5D7IA 3VXUA 2PW1B 2APXA 3TYFA 4MYWB 5HI4D 1V3LA 5TGBB 2EDXA 1VERA 5D1ZC 2AV1B 4X6EB 2VXUL 2XZCL 1ZWIA 4PRID 5IF0A 1JZ3A 5MHSD 4FXGA 3MLWL 4U1LA 3P4MA 4P5TD 5FUZH 1G7QB 2X40A 5FB8A 4LDEB 1WVZA 5ECJE 4IRZH 1YN6A 4Z0BL 5DEGB 3TWCL 3QDJA 5HGBA 4XNUH 3BFOA 4XZUB 5C9KA 5MENB 3D6GA 4DN3H 4YHLH 5I1LA 4O02H 5F3BB 3LEXA 1OP5H 2CDEA 1ED3A 5DI8B 3IAQA 2DBJA 3S97C 5EOCH 1I7TA 3MLUH 4FQXD 5C0JB 4XPBH 2IANE 2DBLL 3QDMD 4JDZB 5AYUL 1IKNC 1BJ1J 1KJ2A 5DFVC 4K3EH 1FO0B 4S1SH 1QKZH 5TDNB 1BM3L 1QKZL 1U8PB 4UOW1 2HKHH 4M1CD 3EBAA 4GQPH 1G6RB 3VXME 2AJSH 5IHBA 1ROWA 4NFBA 3MRBA 2DYPA 1TQCB 5B4MC 3PWPA 4I3SL 2X5PA 1V3MA 1D5ZB 2A6KB 5D1XC 3BH8B 1ZEAL 2J88H 4GXUN 1NMBL 4ONHA 1JPSL 4OGAC 4KVCH 4WENB 4TN9A 4HCRL 1U8IB 3L5JA 3ROOA 3P9WB 4BSWB 3HZYA 3CZFB 4QRTB 2MFNA 1PSKL 5DD3L 4IMKC 2DLTA 1Q72L 5E8PA 5F7DB 3D48R 3O11A 3KPSB 1A7BA 1ORQA 5GS0D 3T0DA 2IH3A 4OCYH 3D1MC 2JJUA 3RWCA 5FO7A 4K23H 3U0WH 3JV4A 4EQ3A 3MRKB 5KTEL 4MJIE 2I9TA 4P48A 4LHJB 1GIGH 2IBZY 2BVTA 5F88A 2OR9H 1WAAF 4KI5F 1IBGH 3HMWL 5EBGA 4YHOL 1BFOB 5DUPH 1G7JA 4HWBH 4PJGB 4JZOA 3BD4A 1JPFB 5EFIB 5AD0A 5JTWA 2ED9A 1MLCB 1U92A 3SKMB 5A43C 4M1CC 3N50A 4CAGA 3F12A 3FFDB 3V4PL 1ZHLA 4NFDA 5CEZH 3KJ6H 5DFVD 1BECA 3MRDA 5DSCA 4UT6L 1DBML 3ARFB 2GHWB 3DIFA 3QEGL 1WBXB 3EO9L 3MR9B 4HDIB 2AKRA 5K59F 3TF7C 1OLLA 3GBLA 3KPRD 5KG9B 1CBVL 1FVCB 2X4PB 1DCLA 1NDGB 5E70A 4DUXA 2I5YH 4KMTH 1BBJB 3T0EE 2D9CA 5C0GA 3FQWB 1WZ1L 3E8UL 3TNMB 1H3GA 2RGSA 2R0LL 5KSVA 1EZVY 2VXQH 4U3XA 5C3TA 4HHAA 2E9IA 3CDCA 4UTBH 3GMPA 4HKJB 3TVMD 3C60B 3QIWB 2FATH 5IVOA 4UZGA 1KN2L 3OV6A 5DC9B 1YUHB 1XGQA 3V5KA 1DQLL 4D9LH 1LEIA 2ZJSH 4M6OL 3U4EA 4RQQA 4U1IA 3H2WA 4YXKL 3QIBD 2P43B 4FZ8H 4U1MB 5I1HH 3VJ6B 1JK8A 2APBA 5GZOD 3F5WA 3LEVL 1UVQA 1JMZA 5DK2A 2G60L 3ZT6A 4NZTH 3ZKNC 2OMNA 2BHYA 1YYMH 3BMVA 3CX2A 3FZUC 3OKOA 1G9MH 4M62L 5JQ6L 2WBKA 1DSFH 1ES0A 4P23A 3LDBC 1Q9OA 1DSFL 5AWNL 1JI2A 2HRLA 3REWA 1AR2A 5CEXA 5IJVB 3ILQD 4NNPH 5T1KB 5E2WL 3QWRD 4TVPL 3VWKD 4X5WA 3O8XA 3MCLH 1M6OA 3GMOB 3EYVB 4J1UA 2HT4C 1H3WM 1S7TB 1T6WA 5DD0H 3UC0L 3L3OA 4Y4HC 2ZJSL 4LQFH 4X5WB 3W5MA 2DMKA 2X4OB 5DEFA 4ZFFB 5FCUL 4HG4K 4K94C 5C0CB 1HINL 3FRUA 1CGVA 1HEZA 3AY4A 5CJBA 4N5EC 4YDKH 2VABA 1UB6A 5CD5D 1B4JL 4LLYB 4O9HL 2Z31D 5JR1L 2ZCKH 5AYQA 5HSFA 2R2EA 4S2SA 2W59A 3BN9C 4GKNB 1FL5B 4O2EA 2XZZA 4Y5XC 1HHKA 4M48H 1X3DA 2V5MA 3PE9A 5E9DA 4Q9CA 4HLZH 4TOYL 4JFXB 4KTDL 3UX9B 2CLVA 3KNBA 1XIWC 1AI1L 4OJFL 2VLLA 3VA6A 2DQDH 3QIWA 4GKOA 1GOHA 4LPCA 4OT1L 1XT5A 3VGEA 4HKJA 3GMPB 2P8PB 3MRQB 4NKDA 4P2QB 5BV7L 3UTQB 5DVNA 4EN3D 1BVZA 2QSTA 4OD2A 1ZT1A 2JE8A 3VD9A 3FCTB 2DOCA 2V17H 5C0GB 3WFHB 5KVDH 1K2DB 4RFNC 1NDGA 1OM3L 5FFLA 2FIKA 3TV3H 4PV8A 5D70H 3HZKB 3IU3B 3BP7B 4P2RD 2YRPA 4X98A 4WGWB 4G80A 1JYNA 2HTLD 3ARFA 4YHMH 5KAQG 2I60H 2OCFD 1RUQL 1RZ8A 4NO3B 4MD5B 3AROA 2VAAB 4QRRB 3KPPB 2NR6C 1ZHLB 5HHMD 2FBOJ 2Y23A 3ARFD 3A6CL 2BY1A 4XPTL 1MLCA 2ESVE 3GJFB 3O41B 3HPLA 4L1DA 4LCCB 4JZOB 3Q3GB 1U8KB 5EOTA 5DD6B 1CU4H 3MX0A 1MJ7H 1MFCL 1H8SA 1J18A 5EBWB 3RIFK 4MJ5A 3T0VA 5K9QG 1K5NA 1ZHNB 5ISZA 3O9WC 5F88B 1T7YA 1MIMH 1OAKH 2LU4A 1DUZA 2I9TB 4RDQG 1MCOL 3QIWD 1Y18A 1UM4H 3OSKA 3BN3B 3T09A 1FVEB 3MROA 1U42A 1QHPA 3T2OA 3RWCB 3ARZA 4MCYB 2R2CA 4N0CD 3OKDA 4OZHB 1ORQB 3KPSA 2BNRB 3UTSE 4JFDA 4QRTA 3BIKB 2WW8A 4Y4KC 2AK4B 1U8IA 4R96A 3ZYIA 3WIHL 4QCIA 1MCQA 2V7NB 6CGTA 2XQBL 4ONHB 2NX5D 3RBGA 2Z31A 2X1XR 5CGTA 5L2KA 4ZO6A 4WFGE 4HUVB 3SDXF 4Q0XL 2MNUA 3MLYL 4I18C 2GITB 1NDMA 3TPKA 3U30B 4Y16C 1U8PA 5L88L 1A6TB 1BPVA 5F1IB 3DUSA 5IP4A 1A6UL 4KY1L 4KKAD 3GSNH 4P3DA 4RGND 2Q86A 2AEIT 1QQDA 5CEYB 3IKCB 5KZCB 4X4ME 4X9HA 5C71A 1KTDA 1CD9B 2Y06L 5DI8A 5H2BA 3GJEA 2RCSL 5HXMA 3LEXB 4PREB 2AJVH 3MLVL 5I73C 2X41A 4MVBC 2V2XA 3WCYA 1JGVH 3MNZB 3QB7C 4GG6F 1PAMA 1UXWA 3FAXA 2DL9A 4P23D 1ZANL 4WI2A 2DBLH 1EFXA 2BSTB 2UZYB 5LAXB 1A4KA 2O5XH 2ADIA 1AQDA 4PJEE 5FB8B 4KUZL 4XCFH 1RUQH 2HH0L 1SJEB 1HNFA 4FXGB 3VD5A 3MYJA 4ZPVA 1OF2B 4FTVE 4XCNB 1II4E 3MSPA 4F3FA 3X17A 1SYVA 3VD4A 3MC0A 3BD5A 3QIUC 4LLVA 2CKBB 1C5DA 2V7HA 5HHVL 1OGAB 1D5IH 3VD7A 2EDLA 4I2XE 5A3ID 5F7EH 4XTRC 1NEZG 4HUXA 1A4JB 4ZS6D 5J3HD 5ESQB 3NBNA 1YQVL 5HDQH 3JWDH 4L4TB 5GJTH 5HYQA 1YPZE 5I1KH 3VGAC 1XGPA 1OW0C 3NCCB 4POUB 3GRWA 3EAKA 5KSUA 2W1NA 5GGTH 2XI9A 5IV2A 2ZCKL 2VLJB 3CCHA 3L3JB 3O2WL 4OBSA 5DJYB 3TBTA 4GG6A 43C9B 3KPRA 4JCLA 3C9NB 5T3ZD 2OZ4A 2NNAA 4U3CA 1C5CH 5EO0B 1GGTA 3LHPL 2IH1A 1IVLA 4FQJL 4ALAH 1RD6A 3VXOB 2CDGA 4U6XA 1JYXA 3B2UC 5D5MA 5BW7A 2R56H 4R9HA 5HDBF 5ILTH 2X42A 3CFDA 3S37X 4WI9A 5CSBA 5BV7H 5JW4Q 2D3VA 3QA3B 4RISH 4M9OA 5C6WH 4S0SD 3LSOB 5I8CB 1DDHB 4PJIF 2W60B 3BOVA 3VW3H 4NP4H 2HLFD 1EMTH 1RMFL 3TBYA 1MHHB 3RAJL 3RL1B 2DQIH 3SPVA 4K3EL 5J13B 4GAYB 2AV7A 5GS1B 5H35A 2AI0L 2ADJB 1OSZA 2FHFA 3B2VL 4OM1H 4LSSH 4PRPD 1QFWM 1DBKL 3OGOE 2B2XH 2E6PA 4NC1C 3ZHKA 4PP2B 3QXTA 3QDMA 3HMXL 5KN5A 2D0GA 1GZQA 1LEKA 1GGCH 4KROC 4PJ9A 2UVFA 4HXBH 2QLVB 4HV8B 3ARGB 3MV8B 4D8PB 5C0FA 3OR6A 5JLZA 3P11H 3OXRB 2YBRB 4DKAA 4JR9H 4Y5XB 2C4FU 2RHEA 1F90L 1HHGA 4YE4H 3JV6B 3T1WA 1NGWA 3HNVH 1L6XA 2V6HA 5F6HI 2NW3A 1C7TA 4BH8A 4NNXA 2PO6B 3FFCB 3VXQA 4OZFB 3VXRA 2N56A 4PJIB 2D7TH 4HG4J 3NFPB 1T1ZA 4P5TA 1I7ZB 5SX4I 2DTML 4TVPE 4ZOAA 3BP6B 4NT6A 5CMAA 3KHQA 1QSEE 4HUUB 3QWQB 2FO4B 3EFDH 4BSVA 1AY1L 4JO2L 1CL7I 2DQFB 2JJTA 1AGCA 3U30C 3L3IB 2B2XL 3IDGB 3HI1A 4PJHA 1SQ2N 4JVWA 3T1FA 3VFTA 1NAML 4WGVB 4TUKH 4KQ4L 5I30H 2DM7A 1QLEL 2DYPD 1FBIH 4PJBF 1MJJA 1UM6L 4IBLT 4M5YL 2IJ0C 3T08A 1RZIA 3DVNA 4ZFGL 1U8QB 3D9AH 4I3RH 5FEBA 1SY6H 2VTFA 4YHKH 4HC1A 1QO3B 1IGMH 2X7LA 3VD3A 5JIHA 1EO8L 4LCYB 5IROA 1MAKA 5ILTL 2AABH 4RAUB 4KJPC 3DUUA 1CFSA 1MHPH 1UQSB 2Y5TA 4MS8C 1S7UB 3HPJB 3K0WA 3CFBA 1S7SB 4OZ4A 1AO7B 1YEEH 4AENA 4NKMB 4PG2A 2F15A 5CJOL 3QFDB 3DETD 3QCUH 5CJXC 4ZYKA 4M6AA 1S3KH 3DV6A 4UTBL 4DAGH 4LAJH 3U9PL 3BUTA 2VKXA 1R6VA 4KXZH 4DCQB 3TBVA 1F58H 4NQCA 1QR4A 3WEXB 5KVEH 3CVHH 4X6FA 1PY4A 1ZGLM 1U3ZA 5CBAA 5DTFA 5IFAH 2A6JB 4LVHC 3BRFA 1C16B 1H8OA 5EZOL 4QT5A 4JGUA 3B9VA 2E9JA 4KFZC 43CAA 2B5IC 1S9KC 3ULUC 3WDIA 2GUOB 1S7WA 4GJTB 1HQRA 3C08L 5GRVL 2XKUA 4I9WE 3QXDA 1D9KC 4KKBD 1A2YA 1EO5A 1T83A 1J8HE 4X5XB 3UZEA 4HAGA 4LCUA 2F19L 2Z91A 4FS0A 4JM4H 3VFUB 1KLGB 3I2CH 4P57B 3FT2A 2B8OT 4D0CB 5FO9A 3F7YA 5MEOA 4GRWE 4Y2DC 4L8DA 3ZDZE 1DVFB 5DJ8A 1L4IA 2EH7L 5LQBH 5IG7B 3LD8C 4YBLC 1RK1B 4QTIH 5IEHA 5IVXA 4FQIL 4JO1L 5EO1B 3FO2B 4G7VL 3U79A 2H9GA 5IJKA 1EZVX 4U7MA 5HGAB 5AZ2L 2QHRH 2FYYB 3NPZB 5JDSB 4JQIL 2GTWA 1WCBA 2Y36H 4DQOH 4JJ5A 4XNUL 1B3JA 4HK0A 3EO0B 2EDRA 4MLIA 4XPFL 3H7BA 1MHCB 5I73B 4BK5A 3CSPA 4NC1E 2ICCA 2ITDB 4NQDD 1Q9KA 4TNWK 5MERB 4OIIH 4ACPA 2IPKB 4OCRL 5CCKH 2A74B 4ZODA 3P77B 5CINH 2OLDA 3ARWA 4JPWH 1J0IA 3UTPD 3D0LB 1IEBA 5MEQA 2Z92A 3SDXA 5DVKA 3ZDXF 1HSBA 3GI8H 4DTGL 2EICA 2Q87A 2LAGB 1A6AB 1CFQA 5IMKB 4R97C 2W0LA 4OM0L 4APQA 2C3GA 1J8HB 2YD7A 4XBEH 2D31B 5FM5M 1S9YA 3CDFA 3MXWL 2FB4H 1T21A 4L29A 2A77L 4QEGA 4PGDB 4QHKI 5C09A 3DYPA 1JGUH 1OTUD 4HPYH 1G7PB 2R69H 4JRXA 5MEND 5CILL 5IHUL 3KDMB 1WUNT 2AEQH 3PGDA 3I84A 4H25A 1MELA 3BP4B 2BFVL 1CE1H 3GMLB 2CGRH 3P9LA 5CZVL 1NJ9B 3L7EA 4P2OA 1RZJC 1AQKL 1BOYA 4C54A 4IJ3C 3SQOL 3HC4L 3BUYB 3SDYH 4JFPA 2ZUXA 2YUXA 4Q2ZA 2EDYA 1TQBB 5F1KC 1I9EA 2YRLA 1NUGA 3NH7L 1YNLL 4KJQD 3V95A 4E0RB 4NWTH 4YHZL 1DLHA 3ARDB 4PGCB 2ZCHH 2IC2A 5D1ZD 2O5ZH 3SO3C 4WFFD 5IB5A 3C6SA 3TV3L 5D2LE 2P5WE 1FNEB 5FHBH 4BQCA 1LHZA 25C8H 4KAQL 1MWAA 3FO0H 2WQ8A 2ADFL 4MNQE 3L7FB 4LLMB 1MVUB 3G6DH 2NXZD 2GT9A 3RHWF 4RDQF 4P4KD 1X4YA 3UJTL 5FYJU 4CADA 2OP4L 3UCRA 1T0NA 2ICEA 3ARBD 2P5EB 1X9QA 1EVUA 4NWUH 1KGCE 1A7OL 2NY3B 2GW5A 4OF5A 5FUZL 2VXVH 4YC2C 4R4ND 2VL5B 4P23C 2IQAB 4G6KL 4XXCA 4POZD 1UJ3A 3GSQB 1CXIA 1FVDB 4N68A 1T80A 4IOIB 1HKLL 2C1OA 3I6KB 4ZTPL 3PGDB 1K4DB 2BP3A 3BWAA 4G8IB 1U58A 4HGKC 5E03A 4X8JB 1TETL 1OP3H 1P7QD 1FZKB 4EUPH 2R1XA 4I48A 1CG9B 5DHVA 5DWUL 5GRUL 1IGYB 1KJ2H 1J8HA 1N8ZB 2HJKA 4ZPTA 1S9VA 3DX8A 2VERN 4LSVH 4NN5B 3AY4C 4U3HA 1XGYH 5F7NC 3VWKB 3FO1A 1N6QH 4LSPH 3S37H 3AMLA 3P77A 2VXTH 5JNYA 3E6FB 2DIJA 4G6AD 4R7DB 1HILB 2DWEA 5FKPB 3L3HA 5MEPA 5FKAA 4AEHH 1ZE3C 2W07A 1ZXQA 3CLEH 2BSRA 5C07D 4ZUVB 2DLIA 3H7BB 1J0YA 1QLFB 1UACH 1IRAY 2E3VA 3FRPG 2IBBA 4JJ5B 4PJDB 3L3GA 4IDJH 2GJZA 1FE8H 2NY2B 4JM2B 5FUOH 1Z5LB 4WY7L 4F7TB 1P7KA 3SE9L 1KIRB 4ELMF 5B3NA 2A1WL 2DWDB 4L8SB 1W0VB 3MJ8A 4GKZA 2A1WH 4ZUTB 5DMKA 4YFLF 4TUJA 4J2XA 3K3QA 2X4TB 5T3XD 5HPMB 1WF5A 2M8XA 2PTTA 1GPOL 2VXSL 3VFUA 2AJ3B 3H0TB 3HTLX 4WRLA 3TM6A 1JHKL 3AM8A 4P4KA 2R9HC 1G7LA 1G9NL 3RVVD 4HS3B 1FYTE 3A67H 4AG4H 4NRYB 1CGYA 5H37G 3IDIA 3HNVL 1A6ZA 1OCWH 3T2QA 2OP4H 2ZNXA 3STZB 1FRGL 5CJQL 3U83A 4GG8B 5AZEL 3BZ4A 3U6RA 4R2GD 1YNKL 4WUKL 4OKVA 2FBJH 4X6FB 4WTZA 4G5ZH 2F8VA 5SV4A 3TBVB 2DQEL 5DJ6A 1XCQB 1CR9H 4Z0XA 4CN1A 2VH5H 1LK2B 4NSKB 1T89A 4PJ7B 5EN2B 3VFGH 3DV6B 1FQ9C 4QRSB 1HHIA 1OAYL 3SBWA 4E5XA 2A9ML 4K3DL 5I1JH 1MLBB 4E41D 3FJTA 1AE6H 1KT2B 1RULH 1HI6A 1PQZA 1W72H 4XBGB 3QHFL 4Y8AA 1W0YT 4XVUC 1RIHH 1S7UA 4RWHA 1AJ7L 4XBPB 4D9RE 3GMMA 4LPTA 5JUEH 4Y88A 3D69B 3TVMA 4LGSB 2XIDA 4QHLB 5I0ZA 2P8MB 1Z9OA 4NFCA 1F4YL 1U3HC 5HHVH 5FIEA 3QJHA 4Q0XH 2OL3H 3CX5J 1IILE 3NIGE 2X89A 1QNZL 3IT8D 4HCRH 3B5GA 4PJAF