2FE0A

Nmr structure of smp-1 (small myristoylated protein) from leishmania major
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
131
structure length
131
Chain Sequence
MGCGASSENSSVTYVNGRPTFVGEEVTKGFEKDNGLLFRIVNKKKKQWAYYNDTTQYEMHVLVTFNEDCDIKALGKTKLEQQENGEWVASVVVYPCETEMFIEGRVNGFKSKMDALPLSEEYRQHQAEKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Function, membrane targetting and structure of SMP-1
rcsb
source organism Leishmania major
molecule tags Protein transport, membrane protein
molecule keywords small myristoylated protein 1
total genus 15
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09149 DUF1935 Domain of unknown function (DUF1935)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fe0A01
2NSXA 2WSKA 5I24A 2X2JA 2EEXA 3FW6A 4PSRA 4GQQA 4AEEA 6TAAA 5I5RA 2BHUA 2XIIA 5BRQA 3BMWA 2VUYA 1UASA 1KB3A 1KTBA 1M7XA 2XVGA 3DHUA 1MXDA 2QMKA 4M8UA 2QV4A 3CTTA 3VMNA 2PWGA 2EQDA 3WEOA 1QI4A 1R34A 3K8MA 1CXEA 3BVUA 3EJUA 1OB0A 3VNZA 3WY2A 5E6ZA 4J3SA 7CGTA 2ZUVA 4OJYA 4UQEA 1OSEA 3A24A 3L4YA 4J3UA 1MWOA 1QW9A 4FNPA 2OYKA 5CXPA 3RILA 1RP8A 3CZLA 1KGXA 2EAEA 1XSIA 3EJRA 2IGTA 1CXHA 3DX1A 1R47A 1CXFA 3VX1A 2GVYA 1CPUA 1VFOA 4OGZA 2F7OA 4WF7A 2CXGA 3S2CA 1BVZA 4JFVA 3VGHA 3LX9A 1PAMA 1U30A 2FHFA 1V3MA 3GXTA 7TAAA 4QAWA 1QWUA 1UKQA 3GBEA 2F7QA 2ZE0A 3WFZA 2DH2A 1JI2A 1M53A 1P6WA 1UKTA 3D4ZA 3ZSTA 3K1DA 2XWEA 4LXFA 4UQAA 2X2IA 2E9BA 3A47A 4H8HA 1UD6A 2F7PA 4PEEA 3L4ZA 1UD3A 3WY3A 1HT6A 4JCMA 1CXLA 3D52A 1O7DC 3DX4A 3ZR6A 5CLTA 3BAKA 1QW8A 1XCXA 4PSPA 1A47A 1JFHA 1TMQA 2EJ1A 3L2LA 2GJPA 2WCGA 2EADA 3BSHA 4FNUA 3HJEA 4GO9A 1PS3A 2YKKA 1B0IA 3EDJA 5EMYA 3D51A 4JFSA 3GXPA 4KWUA 1XSKA 1CGUA 4UOQA 3ZT5A 4AYSA 2WC7A 4BZYA 2XVLA 4AYGA 2D2OA 3VGEA 3ECQA 3BH4A 1KXQA 3VMPA 1QWNA 2E4TA 2PWEA 3VSVA 1KWKA 4H8VA 4J3WA 1CGVA 3EJTA 3KWXA 3WDIA 5A6MA 2J25A 3KE0A 1DEDA 5CLWA 1C8QA 3OLGA 1TQWA 3EDFA 2X2HA 1TQUA 3KLKA 1PIFA 1TQSA 1PZ3A 3EDEA 4UOZA 2WKLA 3VSUA 1RP9A 1IV8A 3D50A 4UQCA 1GCYA 1KBBA 4JCLA 1UH4A 1S46A 3FAXA 4GKLA 3UERA 1VB9A 3VM5A 3CV5A 2FH6A 3LPOA 4J28A 2BHZA 1HL9A 1E43A 2PWHA 5A2BA 2Y24A 3BUQA 2XN1A 2F1BA 5KEZA 3IK2A 2WVVB 3L2MA 3D4YA 3GTNA 3ZT7A 1KGUA 1QPKA 1VJSA 1MW1A 2ZX5A 2BY1A 1LWHA 1WO2A 1EO7A 3BVWA 3BLKA 4CN1A 4AIOA 3ZT6A 3DX0A 4UCFA 2BHYA 2ZWZA 1EA9C 3BCDA 3TONA 4X9YA 3W38A 2VNCA 1NM9A 2V3FA 4HP5A 1TQTA 3MI6A 3LRKA 4DO6A 2E8ZA 2WKGA 1BSIA 3A21A 1UKSA 1HTYA 4J3VA 4FNSA 2F18A 1PPIA 3EJSA 1KXVA 4LQ1A 1SMAA 1JAEA 4GO8A 4PCSA 1HNYA 4UQDA 4AEFA 4J3XA 1H3GA 2WVSA 1B2YA 3BUDA 4CGTA 3AXIA 2YOCA 1JI1A 3BLBA 1UD4A 2WSPA 4GI6A 2BY2A 2YFNA 5I0DA 3S5YA 2V3DA 1AQMA 3LXAA 2ZUSA 1JIBA 2EABA 2VT0A 4HOZA 3M07A 1MW3A 4JL1A 5E0FA 4GI8A 2QPSA 2DIEA 2QMJA 5E70A 3BAYA 1BF2A 1UD5A 5A6LA 4FNRA 2WVVA 4H8UA 2YFOA 4OKDA 4UQBA 1G1YA 2EO7A 1OT1A 3ZSSA 3VO0A 3K8LA 2D3NA 3BMVA 3UEQA 1GJWA 1EO5A 4UZSA 4HPHA 1TQVA 3UG3A 1VFMA 1Y7VA 4FLQA 3AJ7A 3L4TA 3OLDA 3WY1A 8CGTA 3VGDA 1QI3A 3HG5A 2Y2WA 3BAXA 4UZUA 1KXTA 2OSXA 3WNPA 2AAAA 2YA2A 2OYMA 1KXHA 3HG2A 4DO5A 2CHNA 5A2AA 3CPUA 1QHOA 4U31A 4FLRA 2GUYA 1V3LA 1EH9A 2BXZA 2Z1KA 3FAWA 3VSTA 2XWDA 3K8KA 1WPCA 1MFVA 3A6OA 3BC9A 1DTUA 1BVNP 3H53A 5E6YA 3CLWA 3BAJA 5E9AA 1R46A 2ZUWA 2OYLA 3VMOA 1JD7A 1ZJAA 4HOXA 1QX1A 5CGTA 1KGWA 1IZJA 3IJ8A 1HVXA 2G3MA 4E2OA 3WELA 2ZWYA 1XH2A 1D7FA 3GXFA 1MXGA 2D0HA 4ATWA 1T0OA 3IGUA 2WCSA 4CN6A 4GI9A 1CYGA 1MW0A 4NXSA 4U3CA 2DH3A 3GBDA 1MW2A 3BVXA 1KBKA 4MB1A 3EDKA 3UCQA 3II1A 3WDHA 1VFUA 3KL3A 2E0PA 1E3XA 1WZAA 2VRKA 1JD9A 2TAAA 2ZX6A 1HXKA 4NXKA 2G3NA 3DDGA 4FNQA 1CGYA 2ZXDA 1XH0A 1J0JA 3WNMA 3CGTA 1I75A 3LPPA 3OLIA 3AXHA 1ODUA 3L4WA 1G94A 1CDGA 3AMLA 1XGZA 3H55A 1XD0A 3A5VA 1AQHA 1J0IA 4HOWA 3LRLA 2BXYA 3CZNA 1WP6A 3AMKA 2NT0A 1E40A 2AMGA 2QLYA 2ZIDA 3HG3A 2F61A 1XV8A 4JFTA 3GXNA 1HX0A 3KL0A 2VR5A 3HG4A 2C7FA 4NZFA 3CZEA 5HDRA 1EHAA 1Z32X 4U2ZA 1PZ2A 3LRMA 4WSKA 1CLVA 4XB3A 1J0KA 1L0PA 1BPLB 2GJRA 4CKQA 1KWGA 2XIBA 3WNKA 3DX3A 1GJUA 1JXJA 1PJ9A 3DDFA 4NI3A 2D73A 4JFUA 4TVUA 4CN4A 1UA7A 1J0HA 2FHBA 4B9YA 1UD2A 1IZKA 3HZ3A 3ZOAA 1MFUA 3DC0A 2PWFA 1VAHA 1XD1A 3A23A 4GIAA 4U33A 2OW7A 5A2CA 1JF6A 1ZS2A 4DO4A 1Q4NX 1RPKA 2YA0A 1PIGA 3OLEA 5DFAA 3UG5A 2ZICA 3TTSA 5I23A 3DHPA 5HXMA 4J7RA 3WY4A 2VRQA 3TV8A 1CGWA 3BVVA 1KCLA 2FE0A 4WSJA 1CIUA 2WANA 1V3KA 2BY3A 2OSYA 3LXCA 2ZX8A 1XCWA 2FHCA 2WPGA 3L4UA 4KMQA 1KCKA 2YIHA 1AVAA 1WZKA 1WZMA 3CC1A 4H2CA 4M56A 1WE5A 3VGFA 3WNOA 2CPUA 1QHPA 3EJPA 1ZJBA 5E1QA 4UNIA 1OT2A 4JL2A 3LXBA 1GVIA 4GINA 9CGTA 1BG9A 2WVUA 3BAIA 3BCFA 3VU2A 3WDJA 1CXKA 1WZLA 1AMYA 3QGVA 1UD8A 2ZX9A 4FNTA 3GXMA 3CZGA 3EDDA 3GXIA 3IJ7A 3WEMA 2DIJA 1HWWA 4AMXA 4J27A 2NT1A 3BUIA 3A22A 1JDAA 2D0GA 1CGXA 3L4VA 2ZUTA 4CVWA 6CGTA 2ZXBA 3H54A 4H7VA 3W37A 2EACA 3VGGA 1NOFA 1JDCA 4UQ9A 3VM7A 3KEHA 1V3JA 5TD4A 3WNLA 4WLCA 1JXKA 2FYVA 5HPOA 3ZQ9A 2PWDA 5DO8A 4JFWA 3TTYA 1DHKA 1OGSA 3BLPX 3UG4A 2F2HA 2Y4SA 1SZNA 3GXDA 3EJQA 4NX0A 3ZR5A 4BA0A 2D3LA 2ZUUA 3VX0A 1JL8A 5BRPA 2WVTA 2ZXAA 1U33A 4FMVA 4W93A 4AIEA 3TOPA 3CZKA 3BSGA 1UA3A 1R75A 4HA1A 4PCTA 1UH3A 2ZX7A 1QI5A 3KLLA 2XN2A 4AMWA 3VNYA 2F7RA 3WN6A 4AW7A 2YJQA 3RIKA 2FH8A 2FGZA 1KTCA 1MVYA 1CGTA 1XH1A 3BUPA 2E8YA 1JDDA 3VGBA 3ZO9A 1BAGA 2OW6A 1CXIA 3S5ZA 2Y5EA 2D0FA 3BUBA 1UOKA 1VIWA 3L4XA 4MAZA 3WENA 3WMSA 1D3CA 4J3TA 4LPCA 1E3ZA 1BLIA 3BAWA 5CGMA 3BVTA 2C8NA 3CZSA 5F7UA 4FLOA 2QPUA 4FLSA 3IJ9A 1JF5A 1JG9A 1UH2A 4U2YA 3DX2A 4OIFA 2F1AA 2YA1A 2BY0A 1TCMA 4GQRA 1PEZA 1G9HA 1SMDA 1R33A 2V3EA 2XVKA 1LWJA 2ALWA 3KL5A 1HL8A 2OSWA 1G5AA 4NZJA 2WNWA 2XN0A 4B9ZA 1XSJA 1W9XA 4X0NA 3WNNA 1JGIA 3A4AA 1U2YA 2ZXQA
chains in the Genus database with same CATH superfamily
1EAOA 4X5XA 2EKJA 2EEXA 1I3UA 4ONFL 3KXFA 5E1GA 4TNWK 3TIEA 4OCRL 1FRGH 2QADB 4HD9A 4ZUUA 4BKLA 1HEHC 4YGVB 4QHNA 3DHUA 5KVEH 1CFSB 4NZ8A 2VLJE 2QMKA 2QZQA 3FQUB 1NJ9A 5LB1A 1RJLB 4O2EA 5JQ6H 1H15B 5MERA 3HKFA 1EFXB 5GZNC 1GPOH 1HHHB 4ZQKB 2H0JA 1KG0B 3MGOB 1A9BB 1IT9L 2J8UB 1OL0A 1EJOH 1I4FA 2DL2A 1UVQB 2J56A 2B1HL 1I1YB 1WIPA 4AGPA 2LT9A 1XB8A 4N86A 4DERA 5KYYB 2PKDA 3DX1A 5I15L 5FUCE 5I76B 4HIQA 4FXGA 3ULUL 3HA0A 3JUYA 1JGUH 4QLRA 1PZSA 2NY1B 2N3JA 4XAKE 3X13A 4N0CC 3MGTB 5E94A 4Z7QE 5JIMA 2V5RA 1AXSA 1PAMA 5I1KL 1UWEL 3AG2B 4IKIA 5AVSB 2E9GA 1GZPB 4NQDE 1LE5B 5AW2B 5E1AB 3OQRA 1CFBA 2A6IB 3UTTA 3MRJB 4IKKA 1AGFB 4PV1C 3FC8A 1QTSA 2VDLL 2WTRB 4PEEA 1UD3A 4PGEB 1BP3B 3W0WD 3KGRA 1BWMA 5CGYD 3NG5A 4LBAA 4N90D 3V0IA 3VQLA 1FI8C 2TSAA 3KCWA 3GJFH 3L8QA 3QNZA 3BD4A 3VFNA 5C0GB 2YRPA 3KLDA 4X5LA 2B0SL 5HDBF 1ZLUH 3V0JA 1B0IA 5HHOD 3M88A 5HDQH 3PGFH 5MENB 1A5FH 4NERA 3GUFA 1HHJB 1KJ3L 2VQ4A 4DK6A 1F56A 4CGUB 3DX6A 4YDKH 4E9QA 5BXFB 1F4YL 2D2OA 4PGCB 1LEGA 4YE4H 1IFHH 4RDBA 4ZO6A 5AAWA 1FA4A 1IGJA 3GSOA 4C83B 2YC1A 2NY4C 1CBJA 3TX4A 1BLNB 4KRMB 1L0XA 3CJJA 1B9ZA 4L1BA 3BEWB 4K15A 2Y7QB 4PRPB 1MRFH 4Y2DA 1QRNA 3F7VB 1S9VB 4I3GA 4HULB 4JRWA 4PB0L 1TQSA 3DX6B 3QG7H 4M43L 4XP6H 3MV8E 3B7UX 4PJFF 4XVOA 3RVXC 3RFZC 4V1DB 3TZVB 2WKLA 3IFNL 2HVBA 5D7LB 4OF6A 4K3GA 2P5WB 4DFHA 3FAXA 1HZKA 5AW8B 3O11B 2YARA 4JHAL 5DD0H 3ZL1A 3BZ4B 4XBGB 4NEHB 4QJ4B 5KS9B 2JQZA 1B4JH 3OSKA 3ROLB 1X4XA 3OKNA 4Q6IA 2EE6A 1MW1A 2ZAGA 5DD0L 2JKLA 4M5SA 1EDQA 3FK3A 4Z7NB 2NYYC 2BNQB 2CO4A 2N0KA 4BUQA 3ISRA 5B1CA 1T1WB 3SDAB 3JVGC 4H8QA 3D0VA 3DK2A 2AXJA 1XF2B 1ZHLA 2Z31B 3LKNA 2HTLD 1MCEA 4OV6F 2W88A 4EI5B 4KK6C 2WQRA 1E7VA 3G9VA 1NM9A 3QJOA 4L0ZA 2XWJA 2XKNB 1YY9D 1BVLB 4KK8C 5DA0B 5ANHA 2YAMA 4BD4A 1PKOA 1U8NA 5I1LB 4QHUB 4UB0H 1KELH 4GUQA 4HUCA 1J48A 3OTTA 1CWVA 3QDAA 1W6WA 3Q44A 2KPNA 3E3QE 3NCMA 2ATAA 4MXWL 4MCZB 2K3HA 3L48A 3SE8H 5KJRL 3CU1A 3VWJD 1G1CA 4H5SA 5GZOC 2E7CA 1Z9SB 2I69A 4GAYA 2HG5A 2FWOB 1IKFH 1ROCA 1G87A 2X28A 5L4JA 4YDJB 4OLZL 5F7HA 5E8PA 1XGRA 1KSRA 2DKSA 3UTPD 1OCWL 3AY2A 3B9VA 1WEJH 4KTDL 1KPUA 1GW6A 1GGIH 2P3YA 5EIIA 2DIEA 3U0TA 4F5CA 3T3ME 1HQRA 4MCZA 1K8DB 1RK1B 1EHKB 1OCWH 2CIIB 4Q6KA 4M5TA 4RFNC 4YHIB 3OX8B 5CZKA 1O5PA 1P5UB 4PYGA 2O6FA 4ZSOE 3H9HB 3HMXL 5I71C 3UX9B 2R23B 3GSWB 4ETQB 4A2EA 2D3NA 5DEJA 1E2WA 2F53D 4B60A 1QATA 2VZUA 3HMXH 4W9JC 1ZHKB 3X1FA 3MNWA 4MXVF 5D8JL 3O2VH 1C08B 3WY1A 1U8MB 1DZBA 4MCMA 5DZPA 4AYFB 3BZDA 1F8TL 4H0GA 4RNRB 1U8LA 3FHEA 1R5VB 2Q76B 3H9SB 2CLZA 3B3BA 4X9HA 4TQPA 4AM0B 4BUHA 2QSVA 4XO8A 1EH9A 1VACB 5KSVA 2XTJC 4C56B 1T1YB 4XC1H 2WGNB 3BGMB 1H3WM 2OJEA 1RZQA 3QXTA 4HPOL 4UT9A 1C08A 4PTUB 4ZFFA 3QYNA 3ARFA 2X4NB 4N5EC 2C4FU 4JR9H 3F6LA 4M5YL 3HB3D 3ASWA 4HPOH 4JPSA 5FGCE 3SGJA 4HCRL 5C8JA 1XF5A 2BX5A 1IFGA 4DP6X 3STLA 5KTEL 1U36A 3JV4B 1G9ML 1JZ3A 2BS8A 1NKRA 1MCRA 1OALA 4ATWA 1MRCL 3HOGA 3RVTD 2WCSA 3MTRA 5H4ZA 3GJEB 4OM0L 4UIMB 1I1RA 2X70A 4ERSH 3PP4L 4AQEB 4HH9B 4N8VB 1FN4B 1E3FA 1IC1A 1MRCH 2FCBA 3C5ZB 4K73A 4R7DB 5ISZA 4AGNA 3PS6A 3D8MA 4GKNA 1T5XA 4NSKB 2B59A 5FUZL 4F9LC 6PCYA 1XH0A 2D03L 2QTVA 4HK0A 3UYOD 4H8WL 4YXKL 3LPPA 1V7ML 2MCAA 3FCBA 4R8WH 1XMWA 3BWZA 5HI5C 1F90H 5D7JC 2GW5A 1CU4L 3WKQA 3DUSA 4FD0A 1BQKA 4G42A 2YMXH 3RUGE 3KR3H 1Q90A 4MJ6B 4N2CA 4N8CL 2DM7A 3TH4T 3QT2A 3L3JA 2HPOA 2B08A 3UTZB 1HE7A 3CZFB 3WMPA 4A39A 2DTSA 1RMFL 2APXA 3GXNA 4X4YB 7FABL 4CA4A 1S4IA 1U3HB 3OKNB 3LD8C 3VFMB 4DZBB 1BPLB 1NFIB 2FVNA 2GIYA 3A4DA 4GP4B 3S35L 3UCRA 3V0WH 1FSKC 1I1AB 1ZTXH 5AOMA 2L04A 1C5CL 5DJ8B 3NRFA 3QC5X 4Z77B 3V95A 1SVCP 2Y7MA 5AB9A 4BSWB 1I1YA 1KXQE 4K3EH 4FNLH 1SNRA 2WHVA 3F85A 4JRYA 1ZTMA 2R1YA 4Z7VB 4Z8FH 1KNOB 1FNAA 3OLEA 3MLTB 5C3TA 5T1JA 1D5IL 3QH3B 5DVLA 2EILB 4NCC2 3MZGB 4Z77A 1A4JB 1X5GA 2PTVA 4PJ5B 1VKXB 4IRZL 2WXLA 3EYVB 1I1AA 1LDPL 2HUEA 5MEND 3U0WL 2A9NH 5C07D 4ZZFA 2Q2EB 5EEXA 3KM1A 3LXUX 3P2DA 1XAKA 4FTVD 2VM9A 5JIHA 5DQDL 3VFOA 1GR7A 5E5MB 4FI8A 1UC6A 1XWVA 3PXLA 4ISVB 3TBYA 3VGFA 4MNGE 4B27A 1GCFA 2DI8A 2RACA 3T8XB 2IAMB 3CDZB 4XOEA 3F5WB 2NZ9C 1DYZA 3ES6B 3F7PC 4PLNC 1MJUL 3WDJA 4JFXB 1JZFA 1IBHA 5E9DE 3DXAE 4OD2A 5ELIA 3N9GH 2Y5TB 3EDDA 5ETUA 3FCGA 2EEFA 4U0RC 4AMXA 4Y4FB 1LQSR 1D9KB 3ORJA 4PJ8D 5CEYA 5FV1L 1TSRA 5JORB 2Z1PA 3G6AB 3N9GL 2OK0L 4PJ9C 5JOPE 3ZUCA 2CO1A 4NENB 5CJXA 4KZDL 3PWPD 5LG1A 2BIQA 4CDGC 4W4NA 1O6VA 2FYVA 1T0PB 4Z7NF 5I8EA 3PABB 2OMWA 5FWRA 2UZIH 4BV1A 2ITCA 1I85C 4EUPB 3Q13A 4F9PC 2OQJA 4NC1E 4XXCA 3GK8H 3FU5A 2CJUL 1LDSA 3FO1B 4W93A 2A77H 1FZOA 3CZJA 4X4MA 4OGQC 5DJDA 3TA4D 3A67H 4I85A 3TOPA 5IJBC 2XWCA 2OP4L 4P23B 4N0FB 3RDTA 5L2JA 5ICZA 5J11C 3SY0B 3E6HA 4K7FA 5IWLA 4W9LC 3SZKC 5CLZA 1A65A 1FV1B 1QLEB 1KB5H 3UTQA 4DOHE 2E56A 3NPSB 3HZKB 3VGBA 5C7XL 1BQLH 3NZSA 4L1SA 2GEQA 1EXUA 2X1WL 2WXFA 4OI7A 5DS8A 1E8YA 1JNHB 3CSTA 2WO2B 3KD4A 4NGHH 1OCZB 1OTSC 5IHBA 5C0EB 3PWLB 4LVEA 4Y2DC 5D2LB 3MNVB 5DYFA 3GIVA 4W9CC 3LRGA 5I1AA 5AL8A 4WO4C 3MCLL 4FF9A 1PGRB 3VRLE 3CZSA 4PIBA 4DUXA 1JG9A 4KH2A 1WBYB 3BRDA 5EA0H 4HWUA 2W07B 1S9YB 2QBWA 3EBIA 1ZE3H 2HJKB 3MLTA 4PBDA 4WNJA 3D18B 5CU5A 3RWFA 4MYPA 4JG1L 2FIKA 3K0WA 2I9TA 4NQSA 1U42A 2JF1A 1MIMH 4AC4A 1L9SA 3MLYH 3M8OH 1IGIL 1YEIH 4XMPH 5D70L 3ZTJG 3PWVA 2R4SH 1T2QL 3CSGA 5EBMB 1NBVL 1YN7A 3UACA 2VMEA 2ODHA 3PL6B 1GTFA 5EV7A 5DJ8A 1UASA 1KLFA 2CLZB 1T2QH 3CFNA 5FIEA 4NKOB 1NBVH 4XCCL 2VABB 4C56D 1YC7A 2EYSA 3UO1L 4QRTA 5T5FH 3US0A 1AHKA 3L3OA 2OTWB 2VCOA 4NCC1 2P5EB 3TZVC 4ZTOL 4MQXD 4ONGL 4IDJL 2IGFH 3HR5B 1CD0A 3MROA 3CZLA 4PJGF 4U4BA 5F9OH 2R0ZH 2NMSA 3O3AB 4J6RL 4YHOL 1J86A 4NPJA 3BZEA 1U9KA 2JK5B 3GHBH 5AG8A 5FYJD 2YR3A 2WKOA 5JPNB 4BCZA 2GY5A 5F9OL 1EO8L 1ZA6A 1ADQH 4P4KA 1CCZA 1CT8A 3AS0A 3C5ZD 1QKZH 3QAZC 1A9EA 2ZE0A 4PRIE 1D5BA 2UX6A 2Z0BA 3QR2A 5FF6B 5BV7B 1WG3A 3PLYA 5BUPA 1JPTL 1E67A 1IQWH 1ZK5A 2HX7A 2PUQT 4K94H 5E8NA 3F7KA 1CFNA 4AENA 4AQZA 3D85D 3WFDH 4EEEA 1G9MH 2UV3A 1TQBB 3B4NA 3H9ZA 3NACH 2OL3B 3HNTH 4Y1TA 4PY7B 3ZR6A 1V27A 4L8SC 2X9YA 3BAKA 2YXFA 3PV6A 4XZUB 2AVGA 5D6CA 5JYLA 2XFXB 4TPRH 4HV8A 2EJ1A 5E4IA 5A2JH 2XNAA 3EW3B 4HK3N 1YMMB 2X7LB 5GGQH 3ZL4L 1SJVA 2BINA 3DOSB 4CMHC 3GDCA 5D1ZB 4RVBA 5I30H 4OZGE 4PWHA 5C0DB 1IAOB 4UTBH 4N2FA 3VH8A 4K8RC 2CNYA 5E51A 3T0BA 5IHZA 3F58H 2AJ3B 4JPKH 3TVMA 1ZSDA 3X1NA 3K4AA 1KWKA 5HD8D 1R5WB 1IAII 1M7IA 1CFTB 1MAML 1IGML 3F58L 5H94A 5A6MA 1XR8B 3H7BA 5TK4A 3KE0A 1LHZA 3DHJA 2DWXA 4BFBD 3LIZH 2NW3A 3SSGA 1MZZA 1ID5I 3WTVA 1BX2B 2HJFB 1IGMH 4WWID 5FUCC 5LAPA 3V5KA 2AERT 5F7AA 2CMRL 5DMJB 5EZPA 1KBGH 1I7RA 4Z7VF 4K23L 2HKFL 5DK0B 2BVPA 4E9SA 5IR1B 2Q8AH 3P30H 3S35H 3APMA 3HE7C 3V0WL 2CMRH 1QQDA 1M71A 6FABL 3L9BA 1GMIA 1RURH 3JYCA 5CBEB 3U2SB 4P2OD 3P4MB 5H2BA 3RUGA 1JYNA 1DSYA 1HSBA 2J4WL 1MFAH 4N0FA 1VJSA 3PF2A 4NQED 5EIIG 5DXWA 3VCLB 3LVTA 2BY1A 4ZW3A 4UNVA 2ETWA 4P5TD 3WIHL 4IKJA 5FUOL 3I9AA 2UUDK 5CZRA 4RGND 3M1OA 2PCFA 1H3XA 4OCYH 1Z9SA 1T83A 3TONA 4HEME 4Y4HA 3NJMA 3X17A 1ODAA 4HP5A 3T1FA 4ZFZA 1G7JB 4DP1X 3IDGB 5HHPA 1TQTA 3F6JA 2M2DA 3R4DA 5E08L 2X9ZA 4PJBA 2H0EA 4WEUD 2CIKB 1KTLA 5IBUB 4XI5C 3R0MA 4Y4FD 1SBSH 2Z93A 3LS5L 3OGCB 4NNXB 3ULAB 2IH3A 5GSVA 5SV4A 5T3ZE 4DETA 3KJ4C 2EICA 3S48A 1B2YA 3LPFA 4Y1AE 3LS5H 4WK0B 2WXMA 4KY1L 4PYHA 4GI6A 1BBJA 3MRDB 1VACA 1ZLVK 4I18A 3UBXI 2HFGH 5IVZB 2G2RA 3P73B 1E5UI 1MJUH 3HBGA 4G43B 2LLNA 4ZUSA 4QJ3B 1GZQA 3P0VL 5CUSH 4G82A 2XV6B 3HI5H 4KKLD 4PP2A 2CIKA 2Y07L 4YOKA 4NHUB 2K9UA 3CDCA 5CP3H 5DR5H 4YVNA 1MSPA 1OLLA 1CI5A 5B7FA 1A4AA 1U2HA 1A3ZA 2ZWKA 3BUTA 2BNRE 4JFEA 3IGLA 2X70B 4D9LL 3MBED 3BGFC 1ACYL 3TBTA 5G5DA 3F7VA 3AJ7A 5JDSA 4JE0A 2FO4A 3BAXA 5DWUH 4APQC 3Q8BA 3BP5B 1NAKH 4ZOEA 2NY6B 2CDFB 4GAFB 4JJOA 1I3VA 4DAGL 5FS5A 1G7LA 5A6IA 2APTA 2VSKB 3B8YA 1QOKA 3MOBL 3OC5A 4QRQA 1ZS8A 1UWFA 5CN3A 3BFQG 1D2OA 2ZYRA 4RA3A 1TTCA 2JKNA 5F7YC 4YSTA 4QF1B 3K8KA 5C0EA 2EO1A 2OL3A 4JPWL 2L7QA 5FHBL 3BAJA 5DO2C 2VRAA 2ZUWA 3MOAL 2OYLA 3O9WD 1N3NA 2HT3C 4JCWA 2COVD 1F45A 3S96B 3VFTA 2P1YA 3C9NA 4R6UA 3NGBB 3NPZB 3VXRE 2V5MA 4OLYL 4M8VA 1Z5YD 3ZKNC 1YEDB 1H3PH 4JQIA 1OO2A 4I13B 4NP4L 1BD2B 2XWJB 4LDEB 5IOPA 3EFOA 5C7ZA 1CLZH 2AJ3A 2ZX6A 4IMKA 3JTTA 5C6TH 3S3DB 2G3NA 5AYTA 1OAQH 2VDPH 1DBKL 1MCOL 4PJXE 5I74B 4CUCA 2WZ6A 2ZXDA 3O0RH 5EC1B 3QFJD 1OEZW 2EDJA 3OJDB 4HHAB 4XOAA 1TO4A 3ZL2A 3U82B 3OAUL 4BCXA 4K8RD 5JHLL 5GGSB 1CDGA 3QW9A 3P3TA 4HUVB 1PG7H 4YVUA 4Q9CA 3MJ8B 5EEVA 2F15A 4U05A 4EOWH 1Y1UA 3PWVB 1QLEH 3MLYL 1DQLL 5BVJB 5ADOH 3PL6A 4L3ED 1ZVYA 5SX4I 4ACTA 5L6YL 1CO1A 1WF5A 2FATL 5DQJB 1FL3B 1RIHL 2WXOA 1UVQA 3KL0A 4YBHA 1XGQB 3FO0H 2ZXEB 4W68A 1AG0A 3Q1SH 1IGYA 1S2EA 1WDAA 2R0WL 3BZEB 2Z7UA 4OUOA 5EBWA 3PNWB 2NYKA 3ARBA 4A6YL 4AL8C 3RY4A 2NY1C 4WV1A 3R18A 4JFUA 3K2UL 1NMBH 3RVVD 3QCTH 3S4SA 4BK5C 2IGFL 1IZKA 4PJ8C 3F84A 1KLGB 4NC0B 2R0ZL 5BUGA 4JHWL 4OJDH 3QUGA 4Y19B 4PWGA 1DJYA 5FHAL 5G4OA 5JQIB 4UTAH 2DMHA 4HFUL 3BD5A 3Q3GB 3TBYB 4OKVB 1D5XA 2WV3A 1GGYA 2SODB 4H1LG 4HAGA 1EO8H 12E8H 3GBNH 2GTWB 1RPKA 1PIGA 1F6AA 4ZI8A 3MUGB 3OB0H 1H8OA 3E9UA 4HWBH 3TNMA 2WBXA 4IJ3B 3ZVVA 5JPMB 3Q1EA 3QUZA 1M05B 1N6QL 2MPAH 3BXNB 4TL5A 3KPRA 4M6OH 1NEPA 4X8JA 1JPTH 4PJEB 5DFVD 3FB6B 4O02B 3IS0X 1MFNA 3FO2A 2ZX8A 2WTOA 4ODTH 5C0DA 4XN2A 4QXTB 4AT6B 8PAZA 1N6QH 4JREC 4WU5A 1AVAA 4UT7L 3BN3B 4KMLB 3OX8A 2JV6A 2QZ5A 4HGKC 2YHGA 1JZHA 5C0CA 3EUUA 3CPLB 1QBLH 4G6AC 4JO5A 4OCXL 4JFOB 3QEHA 4JM2A 2DDQL 3WXWH 5KSUA 1JBJA 1I9RL 2ATPB 4XNMA 2Z4TA 5JPMA 3TBVA 5DD1H 1QBLL 1MWAH 2IEPA 1DQDH 2K6ZA 3K6DA 4KHTL 5TE6H 3GMRA 3ZQWA 1HH6A 2N7BA 5KANI 2ZNWA 3N5AA 1T21A 4OIAA 4QRAA 4JPKL 1X4ZA 5DS8B 1R3KB 4KHTH 3H54A 5I75C 1RZKL 1MAMH 1Z6JT 5FYKU 2AGJL 5D2LA 3VM7A 1K9TA 3B5GA 3GF8A 3K72B 4P2OB 5DC9B 1Z5HA 2JJVA 3QDME 4HUMB 3ERXA 5TGBA 2OI9C 2E76C 1IM9A 2WWKT 2AGJH 5I1LA 5CP3A 2JLLA 4DPCX 1ONQA 4AXWA 5T3ZH 3WYRA 2DWEA 1SXBA 2Q7NA 5AVTB 2QTEA 3V9EA 1RXLA 1HSAA 43C9B 1GGCH 1G9NL 1GZPA 4HCRA 4NZTH 2BP3A 4JO1L 1AIFB 2ZXAA 1G7JA 5J5EA 1XBRA 1PZUB 1A7PH 1XCQB 1CE6A 2CA3A 2J4WH 2E6JA 3LQMA 2VR3A 5DUPL 4DN4L 1A02N 1M9WA 1BFVL 4YC2B 1IGFL 1L9NA 2PCFB 3QNYA 4ZOBA 3U30C 1XH1A 3ARDD 3GRBA 2FBRA 4AEHL 5JO5A 1BFVH 5D1XD 1Y6NR 3ULUE 1MREH 3QCVL 1CXIA 4WK2B 1QNZH 2J5LC 4NN5B 3VGAB 5F0PB 5CM1A 2YMOA 5LBSL 1M6OB 3LH2H 4KHXL 2BSRB 1BV8A 4QRUA 3EOAB 1MREL 1WHOA 1WGOA 3WMSA 1QFWM 1HILA 1MELA 3B9AA 4KGLA 2OR7A 1B9KA 3T08A 5E9DA 5LGJA 1EGJA 4OSUL 3BVTA 2EEDA 4XBPB 3QJTB 4WHCA 3VXTB 4F15C 5AVQB 1NDTA 3ARYA 1XL4A 4AYFA 1NGYA 1FNSL 2H1XA 5GZNA 5I6KA 4ANWA 3UTSE 1YECH 1T03L 1RZ8A 1LWJA 1BMZA 4ISVA 3QVAA 2WWNA 4AQ8C 3F5WA 1ZIAA 4P2RA 3H6AA 1Z1WA 5CCKH 5EC2B 1VADA 2VC2B 5FLVA 4ZUSB 1XEDA 5F0MB 3HI5L 4NQVA 3EF4A 4HMDA 4MD4B 1F58L 4QXUH 3MNWB 4ANKA 2WSKA 2A74B 1M2VA 1UJ3C 2PCPA 3UTQB 1SGKA 4PJ7B 4NQEE 4EPSA 5IESH 1H9DA 4ZMQA 2CBPA 2DQHH 5ANMA 3NQKA 1L3NA 3GLAA 3AU0A 3WUZA 2VUYA 4X8GA 5C3LD 3BX7C 4AKQA 3FFDB 4ANVA 9PCYA 3FCSA 4XNQB 5D6CB 2FGWH 1PVHA 4HUNB 4ZMZA 3I75B 4MAUL 5E6ZA 5HGHA 4O4YH 3L3KA 4OV5B 3VXOA 3O9WB 5TH2A 1LO0L 1OSEA 5T8IA 1BYOA 4JQIH 1OP5H 4AQEA 4IOFD 3MCKB 4S1RL 2HLAB 3N55A 5DHVH 5D2LF 1UACL 1U8CA 4WI8A 2OQJB 4AJVA 1NA8A 2GVYA 5ABAA 1RZFL 3K4ZA 3GEWB 2B39A 1R4XA 4M9PA 1I8MA 1BVZA 2JELL 2E27L 4MJHA 1A1OA 3GO1L 4NRYB 3WUWA 1DCLA 3UZVB 1HKFA 2XPGB 3IKKA 4JGJA 1KUMA 3TV3H 1M3JA 1QPPA 1AQ8A 1YA5A 2DH2A 1M53A 4MJ6A 4BH8B 2YN3A 1I1FA 4WDIA 4NJ9L 2FWUA 3QFJB 5CFAA 5D4HA 4LXFA 1BZ7B 1NJ9B 4AITA 1TFPA 4JNXA 3EYSL 1ETB1 3CHQA 1T5KA 5DRNB 2XRAH 3J7HA 4YGVA 1YEDA 4Y4FA 2Z4QB 4QTIL 4F57H 2A9MH 4ATTA 1LD9B 4J3OC 4G42B 1QW8A 2W8CA 4BSJA 4NWTH 3QDJE 1TCRB 3KPRE 1KF9B 3JZ7A 4YL4A 3CMOH 4O58L 5IJCC 1YYCA 1N6UA 1YYMH 4WTXA 1ESOA 3QB7C 5BPPA 7PCYA 3QZNA 5JW3L 5HDBE 1RPUA 5KS9E 1A4KA 3QC6X 1FZJB 2EIZB 1S5HA 3EYUL 2P24B 32C2B 4GXUM 4UUJB 1MI5D 1U8IA 5EOQH 4DQAA 2JQMA 1A2YB 4AYGA 4Z7NE 4EUPG 1WAAE 1H6UA 4PJ6A 1NAMB 1TLKA 4OFVA 5A16A 2FWSA 2OMUA 4ABQA 2IBGA 2F1EA 3PNWA 5D2NC 3L7EB 5DSCA 4UQ3A 3MRIB 5A7BA 2QSQA 1AI1H 4X50A 3KWXA 3TO4A 4V1DE 4D3CL 1DEDA 1SY6A 4HJJH 5ALCL 4ZS7L 4KUCD 1QUPA 5KUMA 3V4VA 4CILA 1RIHH 3KLKA 2B4CH 4DN3H 1N59A 5G4MA 3OMZA 3WEAA 2YZ1A 1X9UA 1WAEA 3AROA 3PQYE 2ZCHL 4P3DA 4B9IA 2W65A 4GG6F 3VXRD 4A6YH 1AS8A 1NBYB 1WBXA 4KRPB 1WFUA 4LCCA 4PB9H 3ZDXB 4BSVA 1AS6A 4WW2A 4A2MA 1E43A 1KJ2H 4C54A 4FABH 3RP1A 1F3JB 1OAJA 2QSTA 3VFNB 4DW2H 1A1MB 4TUOA 1TZGL 4PRPD 4G9FA 1NMBL 2GBUA 4NKIL 4JM2D 1CUOA 3OJ2C 3WLWD 3B2PA 3SQRA 1Z0NA 2AQ1A 1G7IB 2VZ1A 4LAQH 1NEZA 3QS2A 3FSWA 3O4LE 2IADB 5IV2A 3IPEA 3VB9A 2WLYA 5D7LD 3BCDA 1KDIA 4Y16B 3STZA 3W38A 3NAAL 2VNCA 5I1DA 5CJQL 1P1ZA 4I18B 4MJ5A 4N0RA 5H37H 1CFQB 5EFIB 1BZ9A 4FQQB 4A38A 2E8ZA 2MPAL 1S7VA 1CDBA 3OB8A 4LLQB 2CKBH 3V7MA 3FS9A 4JRFA 3AT0A 3VD5A 5I6NA 4HK0B 4KVCH 3W11D 1DVSA 3EIFA 2R8SL 3CLFL 3MACH 2XBTA 4LLUB 5F7DA 4AIZA 1J5HA 2C3WA 2DIBA 2Z35A 5CIPA 1Z3GH 4B95C 4HBQA 4HH8A 2CO7B 2VGLM 4UV4H 3VD9A 1NCNA 3N0PB 3F00A 1QUNA 2FL5B 3CHXA 4CGTA 5I1IH 4RGMB 1CYWA 1JTOA 4ES8A 2XJLA 2RFXB 2I7OA 5I0DA 4AVKA 1D2PA 2MMXA 5I73B 4IDLA 4X7FC 1JE6A 3DTDA 3RNQB 4ZOCA 2VT0A 3ZBMA 1OKEA 5D1ZI 2AEPH 5TE4H 3FUJA 1NGPL 5E70A 3EH2A 3MFFB 3TIEB 5LG6A 4PJ7A 1XH3B 4LSDA 5B1JA 1BIHA 1NBZB 4X5XB 3Q48A 4DUWA 5KVMC 4LO9A 2YAQA 1MHHB 4KKAD 4PH8A 3RPBA 3IM1A 4OCWH 2F8VA 3ULVD 2MHAB 2K0RA 4IU3B 2ESVE 3MX0B 4OVVA 1HU8A 3CH1A 3GIVB 1CDUA 1U8IB 4PS7A 5EBGA 4F2ME 3GNMH 4UZUA 4IRZA 4KK6D 1AO7B 1KXTA 2ARJQ 3KWWA 3WNPA 3C9NB 4EBQL 4NM4H 5LWYH 2XTJB 1FDLL 4DUVA 5BO0D 2FO1A 3MLZH 1IGTA 2QHLA 1NIEA 5EZOH 1BXAA 1KN4L 1XGUB 3V5HB 1GGCL 1OCRB 3UPAA 2H1LM 3HJ0A 2RB8A 2MHAA 2K3TA 5HGAB 3SD2A 2EXSA 4DKEL 2VLJD 4QO1B 1KJMA 4AUYA 3CH1B 1DTUA 1VCBC 4WTWA 2I9LA 4S0HA 4HLZH 4JDTH 2VLRD 1DLHA 4N9OB 4AKPA 5DRXB 2WY3B 2VH5L 4JG0L 5AB0A 1E8WA 3IDMA 2ZT9C 3DOSA 3ALPA 3LS4L 2YD3A 5SWSB 2PYFA 1TJIH 3RWFB 1JERA 4RESB 4U1GB 4EIZC 3K6IA 2J8HA 2EE3A 4KFZC 1LMIA 1S9YA 1LTXA 3B37A 3QJFB 4M48H 3ULVE 2CUAA 1NFIA 1OGAA 3MNZB 4Y4HB 1DANT 4GEIA 3MGOA 3U25A 1VFUA 1EAQA 3VJ6A 2RA1A 3QI9A 1U93A 5F9WC 3D1MC 1AE6L 1S5IH 4R90L 1CGYA 3G5YB 4R7NA 1Y6KR 5HHNA 1FZJA 2FX8L 4FXKC 2EUWA 1LE9B 5BVPH 3MRHB 1JYVA 2FJGB 5FECB 1L9RA 3THMH 4PBXA 5EFIA 1OAYL 5EIQA 3ZTCC 3P73A 3GMPA 1DQQA 1T4KA 5JNYA 4IRSC 2A74A 4KDTC 5I9QC 1BBJB 1JV2B 3F8UB 2R0KL 4U1MB 4LLWA 4QRPA 4K3JH 1FHGA 5CGBA 2QLYA 2ZIDA 3TH3T 4ODSL 3HG3A 3CDZA 3I3BA 1TITA 5HHXL 1N4XL 3A6BH 4H20H 5IMLB 4RAVB 5IP4A 5F93C 3UTTB 3BH8B 1L6XA 3JWOH 4ODSH 5HHXH 3ZO0A 4HH9A 3SJVD 2WM0A 5AAWC 1NEZB 1USQA 3PHQB 2BCKB 4OH2A 3WIHA 4MAUH 2JVUA 3M17B 1D7DA 4X98B 4OI8A 1ACXA 3NFNB 1TJGL 5DZJA 1A6UH 2D73A 1BEYL 3V4VH 5KJ7E 5GIRB 2EDMA 4NQDB 5E2WH 1KIRB 1XDTT 4CW1A 1GSKA 3QORC 1G0DA 3BFOA 2YGVA 1UACH 1QRKA 1GY1A 4FQXB 1XD1A 2ICWJ 2BW5A 4NO0D 2PO6D 3IE4A 3T09A 2OW7A 5JORA 3VFGL 3C6EA 4MA8H 3DJ9A 3E8UL 1OP5K 3HHSB 5I23A 2VISA 5GGTA 5D9SA 4Z5RB 4Z3HA 2LW3A 2ADGB 4L4TB 3TO4D 3P9LB 4BHUI 2FE0A 5K33A 1NUDA 3SYOA 2FEEL 1U91A 4U1NB 3EHBD 2Q87A 3VE0A 3EH3B 4PJCA 1MUJB 3WTSA 2Y6TE 2EIEA 4LSTL 4MMXB 43CAA 5I6OA 5IMKB 4PJCE 3SKOA 1IO4C 3C87A 4AK1A 1JGVH 3EJPA 1JHLH 1X5FA 4NWTL 5GRVK 5EG6C 4MDRA 4WV1B 2LABA 3GLDA 4JL2A 4RAHA 4U0RB 3NRPA 2ROYA 1R5WA 1KXVC 1MLBB 4HXBH 9CGTA 2YQ2A 3D9AH 2V9TA 5JW3H 3BAIA 5FX3A 3MRLB 3SBPA 3DUHA 3ZMNA 1ZSHA 2YO3A 2LU5A 4L4TA 5D6DC 4F8PA 3U6XS 3WEMA 4N2MA 2R0LL 4F7PA 2Y25A 4HLEA 4FQHB 4LT7A 5JMOC 3EADA 4FQ2H 5GRUL 4AUJA 2H4EA 3FTGB 2RR3A 2V0AA 3LVEA 3IVKB 2AK4A 2R2BB 4NHCL 4ZAKA 3MREA 4QRUB 2O6EA 4NO5B 3KEHA 3J07A 2DQDL 3GQFA 2EINB 1JXKA 1MJ8H 4ODVH 2Z0UA 3RI5F 5IWLC 2CALA 4FFYH 4UAOB 3ECWA 4X7SH 4HBCH 4XC3L 1UWGH 2AV1A 4ZO9A 4A7QA 3CBJB 4ENZA 2ZCHH 2X4SA 2VITA 4GRLC 1OP3H 3O81A 4PM1A 3B3IB 2WNGA 3I6GA 3OKOA 1SXCA 3WS3A 3H3KA 5FXCH 1F42A 4FQHA 1JL8A 3NA9H 3VFUB 3GSUA 1U33A 2AK4B 3ARDC 4LQFL 1JJUA 2BCMA 3NZ8B 2C9AA 3IDYB 1WITA 4W4OC 1QRND 3U36A 4O2CA 5EUOF 1D9KA 2O6CA 1T1YA 2EIKB 2IQAB 3QJUB 1MZYA 4Z7AA 5A43C 3PWUA 3WU1A 4GBXB 1XIWD 4I0PD 1JZJA 5IVXE 3DX8A 1KGIA 3NSFA 1QFWL 3NUKA 4OKVA 2XQBH 3BT2H 3NIFE 4DGIH 3F04A 5IBLD 2R56L 4DP4X 3GI9L 1UA6H 3OZ9L 2FR4A 2XKSA 3JV0A 1N70A 1ZAGA 3UXFA 2EXWD 4MAZA 4R7NB 5EZLA 3QDHA 1QFOA 4XB7A 2E7DA 2XG4B 4XPAH 3TN0B 5I8KH 2XZAL 4R7DA 1E3ZA 5ISZB 3BAWA 4PHXA 2R8SH 3RKDC 4OGYL 4GBXA 3RX9A 5AKSA 2B14A 4NYLB 3CUPB 4UV4L 2EVIA 3DX2A 3RFZB 3OB0K 3TVMB 4RDQF 4DCQA 1G9HA 2FEDC 1NGWA 1AQKH 3QQ3B 5JA9A 2VW6A 2QQQA 5D9SB 1G7LB 2C5DC 3WNJA 2N7AA 4WWOA 4E9TA 1E4XI 3L3IA 2WUCL 1MCFA 2VDNL 4JG9A 1FH2A 3CVCA 2JI1A 3N04A 2F74B 2UVEA 1G7PB 3IXTA 5JDSB 3RNQA 3MRNA 1BIIA 4ELME 3FU8A 3LOWA 3U1SL 3WTUA 2VDNH 1YUHA 3GJFB 1AO7D 3RGVD 5EDXA 4IOFC 2XTJD 4BFOA 5CAYB 4Q89A 4NFCA 1K2DA 2ORBL 4LP5A 4PRIB 1WBYA 4DP0X 4YIQB 3SDAC 5BS0B 4JS7A 1BVKB 3RKDD 4BZ1H 3V5HA 3DPBA 1Z9LA 1ZRUA 3V5DA 2QT6A 2V5YA 1JCKA 2YSSA 4HKBA 4XCEA 4HGMA 1HH9B 5L8JB 5JHDB 1QWHA 2XT1B 4YUEL 1G9NC 4E9XA 1AXTH 3DX9B 1DJSA 2O5ZL 2PR4L 3DTXA 4X4XB 1A6AB 2CDEB 4FNPA 4A7GF 5CXPA 3RY6A 3GKZA 4ZX6A 3MCG1 3C60A 1VFBA 2VXVH 3EJRA 5F72S 1ET8A 4XMTA 3WEBA 2J7LA 2IMNA 2UZXB 2H3KA 4TSCH 2DWEB 4X9BA 4XNXH 2R1XA 4NUJA 1U58A 5FM5O 1OSPL 4AQOA 4FP8L 3F7QA 5FKPB 7TAAA 2MTPA 4QAWA 1RUKH 1Q9WA 2F7QA 3UBFA 3PREA 1JI2A 4N1HB 4L5FH 4GRLD 5EF2A 5T1LB 2UWEB 4WWKD 2AEOA 3L7FA 3T77A 4MA7L 3OV6A 4P3DB 3WY3A 1YEJH 4A7SA 1DJGA 3K71B 4XVJH 3QFDA 2ZCLL 3D52A 5IQLA 3ILQC 2YPLD 2ZSVA 3NCYS 2EDHA 4K3HA 1RLBA 3LJ3A 4TLKA 3PPEA 1P6FA 2QKIC 2MSPA 4XVJL 1UB5A 2ZCLH 5AUMB 1X7SA 1U8HA 3DJZA 4Y2NA 1U4FA 5KVEE 2C34A 3RUGB 1YEFL 5EMYA 2G5BB 1KDJA 2Y7OA 1JZ6A 3GWJA 5DHVB 3RA7L 1KYOK 4FYSA 4OD2B 1SOKA 3P77A 1OCOB 2WWMD 5AZUA 4AM0A 4P49A 1KXQA 1EZLA 2VERN 2ZQKA 1L9QA 2DQEL 4F8NA 1TTRA 3MLSH 1I7ZA 2PXYB 2Y6SD 3DK0A 1GS7A 4OLVL 4ZPVB 3U9PL 1RZ8B 4FI6A 1MFEH 2ZOLA 4JFDD 3U48A 3DBSA 3PFQA 4GH7B 4DK5A 4YSUA 1MWAA 1YQ2A 4GP8B 4G1MA 3N40P 4UM8B 1BFOA 3DVNA 4X5WB 2Y2TA 4Z95L 4ZUWA 2VW4A 4ALAH 4OLVH 1P5UC 4YPJA 5IT2L 5E2UH 3S4SG 1WTGT 3LN4A 3WFCH 5HYJB 4FZEH 1D5XB 5DRNA 1QSFD 1GZQB 1TVHA 4JCLA 1SOXA 1BQRA 3AWGA 3QG7L 4M43H 4DKTA 2C9XA 2A1WL 4MS8D 5EOCL 4YXLH 3GSNB 4N2HA 3PWUB 4FZEL 5LNEA 3OKDA 1N8ZA 1E7UA 3KCPB 2HH0H 2XG5B 1JWUA 1LO4L 2WLNA 3D2UD 2WVVB 1Z5LB 2JCWA 3PWNB 5ALBL 3GTNA 1JWMA 3ZDYF 2ZX5A 4U1JA 3TGXA 1WAAA 2ED7A 3P40A 5IJKC 5AW6B 3OZLA 5DVKA 4NAMA 3Q6GH 1R0AH 3C75A 4AIOA 3UYRL 4AV0A 1TQCC 2BHYA 4FCAA 1DQJA 1Z66A 1URLA 4D0CB 5GS2H 2IAND 2AJXL 2MWCA 2P7TA 1IKOP 3Q6GL 3ETBF 4X6EA 4CVZA 2Z92A 3PJNA 3IRPX 2OMYB 5A3IC 4XE0A 4Z7UE 1EEZB 2ATKA 4N3TA 4YX2H 2RJMA 2CJTA 3CNKA 3ECUA 4BYHA 2FQGA 3P4MA 5H2BB 2K6YA 4UILL 3UBXG 1E28B 4P59L 1P5VA 2AQRA 4JAMB 4NO2B 4U1JB 1WZ1H 3QHZL 3G7TA 4KI1A 4UQDA 2ZXWB 4M8QA 3G5ZB 4L1HA 5I26A 1JGVL 5FYLD 1H3GA 1GXEA 4YE4L 4RH4A 5TK2A 3KXFB 2DJMA 2ENPA 3ULVH 3UJTL 3GBLA 3RU8L 1FL5B 4FQCH 2EXYC 3ZKMD 3LXAA 5DI8A 4JDZB 2EABA 3DPBB 3OHMB 2IWEA 1MRFL 3QWOA 1KTLB 1NCAH 1QR1A 4P5RA 1OAKL 2CK2A 5C09E 3DVGB 3GKWL 3BAYA 1AGDB 1WEJL 2P44B 4ZFZB 3FUNA 4FE9A 4ZQTA 2G2PA 4WU7A 3R06B 3C5XA 2EO7A 3DYMA 2HN7B 1YVLA 2IDCA 1GJWA 3QDGD 3IDGA 3LCYA 5GSRB 1VGEH 2F7IA 3GSWA 5A7EA 2VO5A 1BD2E 3QJFA 4ELMF 4UV7H 1T3FB 4HBCL 4XC3H 2CIIA 1UWGL 4UU9B 3C6LB 5F71A 2NY2D 4XPGH 4BZ1A 2YA2A 3A4FA 4YDVB 3BIKB 4ZW6A 1UJ3A 3GSOB 4DO5A 4PGDB 5GHWH 3FT3B 2VR9A 5CCGE 5CS7A 1QHOA 4LSVL 3QQDB 4NRZB 5GSRA 4OZHF 1AGBA 3IPBA 4JFEB 1KYUA 1WPCA 1CE1L 1EHNA 5IUCA 1T3FA 3FCUB 4BDVB 3KWTA 3TT1L 2BS71 4M7LH 1EK3A 2X12A 5F21B 1CE1H 3BWAB 3RWGB 4NHUA 3RTQB 5I17B 4FULA 2FR4B 3UGUA 3GTVA 4IHBA 2ICEB 3CZUB 2WQVA 3AU1B 3H9SE 1PZCA 4PW9A 5IW1B 4P5MA 3S0PA 5IGXH 3KJ6H 2VDPB 1DL7H 5KVFH 1MW2A 4AH2A 3ARBB 4ZSOB 3B5TA 1P1ZB 5C86A 5EUKB 1XCTA 4ILDA 4IRJA 4D0DA 5C9JB 2OBGA 2OMZB 2YK1L 1VZGA 3II1A 4JDVB 3QXAA 1DL7L 5KVFL 3GIZL 3FBKA 1HXKA 1MHPL 4U1LA 3SDAA 4L3EA 5HGDA 2XNAB 4PRID 4MD5A 3DNKA 4KX7A 4PCYA 3T6ZA 3HZMA 3OWRA 2MJWA 4JKWA 3JYBA 2V17H 4Z18A 3RDTC 3HFFA 3KVDD 4LOFA 3AMLA 1P69B 1AQHA 1S7RB 4NS0A 4YE0A 4D2NA 3X12B 3LRLA 1AZUA 5FOBA 2W91A 3MRNB 4ZAKD 5C0AE 5F89A 4C56E 4GFTB 5C0CB 4HS8H 2XYCA 1M7UA 1XXFC 1AAJA 1SJEB 1CVRA 4PJ9B 3MAWA 3PDOA 1Z32X 1JWMB 3MBEC 4U2ZA 5CSBA 4PJDB 1HQ4B 1NLBL 2DQIH 5LXVA 3WFHB 2F08A 3T0WA 4DEWA 1OM3L 3WNKA 3P3UA 1AZCA 5AOIA 1QRNE 1RHHA 5F7NC 3DDFA 5KW9H 4MJ5B 1ZV2A 1YQVL 1NLBH 2DQIL 3C8KA 3DO7B 4EI5A 3DPDA 3FCTA 1AXIB 3BEVA 3FBQA 3BT0A 2X89D 4GRLB 1NCUA 3QO1B 1OD9A 1C5CH 1JGUL 4GIAA 2NY7H 4ZMPA 4FTVA 5A2CA 1IGTB 1RD6A 4IBUA 1OSPH 4HLZG 2C9UA 1CICC 4OM0H 1BZDA 1NMCC 4MQXC 2YXWA 4LK4A 4XBPA 3IMVA 3S3CB 1CN4A 3QNXB 3ZDXF 4M62H 5HHOB 1GC1L 1SYSB 3SBWA 1OANA 4Q14A 5DQ9A 2XQYK 4L5FL 4AM0Q 1CDCA 3ZJAA 5FUZH 2EYTB 3FONB 4P2CG 4DTGH 2DW5A 3HEIB 3V6OA 2NQDA 3EJZD 4QY8A 2MQCA 3WNOA 4H1LA 1KMGA 3MOQA 3NJVA 1A6TB 1RK1A 2JCCF 4ABWA 4WHYG 4C59B 5IB3A 4YSDA 1AQDB 3SOBH 1X5IA 4NQDA 5AUMA 4HETA 5HTSA 3VU2A 5E1HB 3CXHJ 3P3YA 1T2XA 4RMUA 4FNTA 3QIWA 4B6ZA 3GXIA 2VJXA 3SOBL 3ZHDA 2DLHA 2XLLA 3DVGA 1AR1B 1J0YA 4M00A 1F4YH 2W0KA 3LEXA 4JHBA 4P2OC 5AQ0A 3WKML 2KS0A 3WNIA 4DH2A 4AVIA 1K5NB 2DQEH 3LYRA 2R9HC 1RUAL 4B0MM 4R96A 4XAKD 3LEVL 1UZ6F 3V6BR 4X7TB 4LLWB 3ULUD 2VMFA 2WWOA 5L4FA 2MKWA 1CF1A 2BP8B 2LU4A 5BV7C 2CK0L 4AJ0A 1EEUA 1OGSA 2GJ6A 2Z93B 3OGCA 4NNXA 4TVSa 3UGXA 3VB8A 4Y16A 3STZB 3SKJL 3WV0A 4R96B 4EUPA 4POYA 1JWSB 2EDDA 1OWRM 3UTSB 5FO7B 4P9HC 3MUY1 4IIQC 2NXYC 2VXQA 5E00A 4IRZH 3BWUC 4Z76A 3ESPA 1J8HB 2IWGA 2F7RA 1OIOA 1R0AL 1JPST 4MRCA 1EUTA 2E8YA 4ORZC 2FJUB 3SO3B 2R2EB 5BS0A 4TRPL 2JSFA 3IJYA 1TEFA 1GHFL 2ILLA 4U6VH 3T0EE 1DVFA 4XCYA 1K2DB 4W81A 5TE7H 4GXFA 3TP4A 1DFXA 1LGVA 2WLKA 1IGCL 4F37F 4IBWA 5F1SA 1D3CA 3ETSA 3TBWA 4EN2A 3OSVA 5GISH 3S3BB 2AJVH 4HF5H 3FRUB 3FB7B 1FYTA 3T2NL 5HYQB 3T3MF 4P5TA 3SGEH 4F2EA 1WZ1L 3QHZH 4E5XA 3A4EA 2LTQC 4U2YA 5GISL 1KV7A 2XTLA 5DJXB 4DP9X 2JJUA 3D09A 3M7OA 1CE6B 1HCVA 2PPAA 4O02L 4I9XA 1DVQA 4MASA 4AKOA 5EA0L 2PYEE 3MX0A 4AV4A 3C5SA 3QEUB 2OSWA 4WJ5B 2B1AL 3DSFL 5EUOE 2WYHA 4YFLF 3FUMA 1YEEH 4EZJA 4ZMXA 1M1XB 2JTYA 3DRQA 4ZXBA 5I24A 1P6AB 2X2JA 3WTTA 2O4EA 3CZFA 5TQ2H 3BP7A 3NCBB 1T5WA 3QI9C 4YHKL 3QEQA 3C8KB 3LKQA 4APQA 2WNKA 3IXAA 4Z0XB 1T80A 1NCGA 4QKXB 4OZ4A 5TQ2L 5LGHL 1A7QH 4DOHB 3WFHA 1T1XA 2GB2A 4OZFH 3EOAA 3BVUA 1A22B 4C47A 4TULH 4Q9BA 3O2VL 4ETYA 4F33A 2IGLA 3AQZA 4OF5A 2UX7A 1LWRA 2OYPA 3JBG7 5GGRB 2OYKA 4TULL 3K2IA 2CCWA 2EAEA 1XSIA 1AD0A 5F0JB 4K5MA 5F3FA 3HZYA 1R47A 3T6XA 2AV7B 4ZTOH 3STLB 4GW4A 2XBDA 1MFBL 2HT2D 3MPCA 1NUFA 4XOCA 3TT1H 5DHMC 2KBGA 3SDXF 4JR9L 5IHHA 1UKQA 3WFEL 2M1KA 4ZDHB 3MCLH 4NQUA 3QXAB 3MCYA 5I8OL 1A3QA 4RRPG 4WZ9A 1FE8H 1GGBH 3K1DA 2B3RA 4UNTA 5FEBA 3WFEH 4YDNA 3KPRB 4X8JB 1UD6A 2O1AA 5I8OH 2QLVB 4JFXA 4RMSA 3PXJA 1TU2A 2Y06L 2WQUA 3I6LD 3MJ9A 4GJTB 5PCYA 3S36H 4MZIA 2ZWSA 2QQLL 2Y5TA 3L13A 5ETUB 4AK2A 4F7KA 1GS6X 1WIOA 2DEWX 4NNYB 1RIVH 5GS0C 3PWJB 2Y06H 4OBSA 1MWAB 1OPGH 3S3SA 4GO9A 4B9CA 3QUYB 3DSNB 4ADJA 2H1PL 2X4TB 3ARQA 2FDBP 4JG5A 5CO1A 2D03H 5IM7B 4F2MA 2HTKD 3FT4B 1JMXA 1OPGL 4XPFH 4L4JA 2FUTA 5AOLA 5EH1A 1IKNA 5MP6H 3BDBA 2ZZUT 4D0CA 2B3IA 3ECQA 2PWEA 4OFQA 4MSWA 3QUKA 4JANB 1U3HC 4K4KA 1X4YA 1DJWA 5SWZA 4MVBC 2NY2C 1FYTB 4PJXF 1QVOB 4L9LA 2Y7QA 1AZBA 1H6TA 2BSCA 4PRPA 3M45A 5GQBA 1SN0A 3K81A 4PJ9A 1RMFH 1WBZA 1MIEL 2V37A 2FNWA 2RFXA 1E5BA 5D71L 3JWNH 1M6UA 2ZOKA 4M6NH 5AKRA 3K71A 1UXMA 5GS2D 4YHML 4GRWB 3ATDA 1UH4A 2DLFL 2IV9A 5IMMB 2MIZA 2DWYA 4FEMA 5FKAB 2E47A 4M6NL 1HL9A 2IPKA 4FL4B 5INDB 1EEYB 5KG9B 2YJLA 4PJ5D 1CF8H 4OB5L 2LAAA 1EXUB 3D4YA 3QWOB 4LSUH 5F9DC 5C07B 4WW1B 1F6LL 3ZUNC 5F0LB 4FTVB 4LVHC 4RA0C 1LWHA 4K9JA 4QT5B 2ENYA 4Q2ZA 1GC1C 4L4VD 2ZXGA 2FBJH 3HG1A 3WJMA 2DLGA 4OZGA 3IU3B 4QRFA 2Z31A 2IH9A 3TC9A 4R0LB 2BSTA 4KRPD 4QEGA 2V8LA 5GRYA 4FA6A 4IBZA 3T3PF 1KCUL 4HPYH 3GYRA 5KBMA 1SQMA 4H0LC 1S7XB 4M62L 5TGBB 4G9FB 3A21A 1UKSA 4P5KB 5FA3B 5GGQL 3ZL4H 4RFOL 3A0OA 4KITB 2NX5D 5I19L 3HZYB 3N1GC 4XI5D 4MA1C 1AR1D 5DQDH 1GAFH 1SLWA 3IJEA 2GSGB 3RWJB 1HNYA 3D4GA 3NJIA 4YSOA 1P84K 2J21A 3LAFA 4G11A 2C1OA 4PRIA 1TKWA 4KJQD 3BI9X 4O5LH 2VWEC 4GW1B 4YDJA 3DYOA 5KSBF 1NBQA 3EGXB 5KBPA 3Q5OA 4TUUA 3NZUA 1RJLA 4KY1H 4F7EA 2Z7WA 3OKKB 1R3JA 4L3AA 1FNLA 2HFGL 3RWJA 3C6LA 4AYEC 2KQNA 1GYAA 3MV9E 5F7DB 4AIZB 4PLKD 1RSYA 3OAYK 3X1GA 4ZFOA 3ARGB 2PYFB 3FFCA 4L5FE 3R0NA 3ZDYB 4YXHH 4LCWE 2GIMA 1Q9KB 3U46A 2DYRB 3ZSSA 3B2DC 2P5WD 2HX8A 3NSCA 1RURL 3G6JE 5DA4A 4R7LA 1UGNA 1VFMA 4TVPD 4NUPA 2JLPA 4C4UA 3BH9A 4Z3IA 3IDNA 1SM3H 4X5WA 1OT4A 1DFBH 3B34A 3MLXH 2EXWC 1TTAA 1CC3A 4WEMB 5E7BA 2UZIL 4G1EA 1CR9L 3MRKA 1ACYH 1P7QD 1UADC 4PP2B 1KYFA 1DFBL 3EKCA 1FLRL 1R5VA 2Q76A 3HG2A 4LCYA 4PRAA 5IFHL 3G3LA 4HHGA 4OZFA 5E8EA 2Y5QA 4I3RL 5HD8C 3CFKA 3KR3L 2P49B 3ELQA 3A67L 4JRXE 3QXDB 4HAKA 1KY6A 4LDLB 2ZUXA 5F1IB 3ASNB 2G0LA 3JWOC 3ARTA 2O61B 1R46A 3GSVB 3HPJB 4NRYA 4ICXA 1UG9A 1I1FB 1IAIH 1QX1A 2XFXA 5DEGB 1J11A 1NL0L 2BMKA 4HZ1A 4E0RB 2X7LA 3CDGB 1NBZA 4U6VL 5ID1A 4APQD 1B0RB 4DF9A 5J6SA 2H2PD 3VWJB 1JHTB 5D7LE 2GTZB 1XZWA 1AACA 2J43A 3PHQA 2CBTA 2P7TB 4CVZB 2P8MB 5C08E 1IGJB 2AJVL 5TDNA 1VSCA 4KTEH 4QGYA 4OV5A 4F3FA 2PCXA 3HG0A 2PP7A 4ZQKA 4NXKA 3I6LE 4QRPD 5IHWA 3HUJB 3FQTA 2HLAA 4OFIA 3PL6D 4UT6A 4UUJA 5D7SH 1AR2A 1I4FB 15C8H 5EB9A 5TH2B 1CG9B 4OR1A 1I82A 4DKFH 2HKAA 3C5ZC 2OMVB 3AXHA 1ODUA 4X0KB 3RL1B 1MCOH 1C5BH 5D7SL 1NDMB 1D6EA 4JFFD 2D7TL 4E68A 3T6WA 3TYGH 5DK0A 1A6AA 4Y9GA 1YEIL 5D70H 2WNXA 2X9WA 5ANME 1T20B 3S8WA 3QWRA 4GB9A 1NSNH 1VFBB 3MRBA 5HVHB 1C16A 1VGKB 5J1SC 3WE1A 1AD9A 4D8PB 4PJHE 3W82A 3B2VL 4NZFA 3CZEA 1NSNL 1TZHA 4WSKA 2HUHA 1T1WA 1J8HE 1ZVSB 4PP1C 4PTTB 3PGDB 2EC8A 4CKQA 3DX7B 4KX8A 1L5GA 4I88A 3VD2A 5LCVA 2OI9B 3MVSA 1FIGL 2OAAA 4KV5E 3TA3B 3ARFC 4HG4K 4G8IB 1OP9A 3UO8B 1T6VN 4JY6A 3LNEA 1O75A 3LKRA 1F3JA 5FA4B 2VQ1A 4JLRA 1OQXA 1NCCH 4J6RH 2C9QA 3FTZA 3K2UH 4M7ZC 4GSDL 4OT1L 1T0MB 2GK0A 4OLYH 1A7OH 1OK0A 2LLLA 3SPJA 2CG9X 1NC2B 1Z0MA 3ULSA 5GJSH 4LOUC 3UG5A 4NP4H 3TO2B 3GB7A 3PV6B 4UTAL 1ZT1B 3FT2B 2ARWA 4YDZA 4MJ2A 4AZUA 2RHEA 3BKMH 1CLZL 1KCLA 3CDYA 4G6JH 4EMZA 1JZIA 4ZNEE 3HZVB 3CUPA 1GGBL 1IQWL 2Z31C 4F91B 3BKML 3RWEB 4QPEA 2FHCA 1JPGB 3GMMA 3O0RL 3VI4F 5BRZA 1LEGB 5DTFB 4PS3A 1WZKA 2QQLH 4X6DF 4J8QA 4MYWB 1JWSA 3VFOB 2JH2A 4PR5B 2QSCL 2ZOLB 1RHHB 2JKXA 1DBJL 2X4PB 3HFML 4D9QD 3MNDA 3VG0H 1J5OH 2D7MA 4ETQA 1Z2KA 1OE3A 1XMEB 2H1PH 3D05A 2ZX9A 3RVWD 4HW6A 1HILB 3FRPA 3REVA 1JVOA 2DMKA 3MFFA 5ACLA 1J05A 1NAML 2V4LA 1KTDB 3UMNA 1ND0B 5IQ7H 4Q7DA 3HNVL 5EF3A 2APVA 2EIJB 3CFDA 4ZXBD 3SGEI 3KPNB 3IDXL 1IC7H 4MMYA 2Y7NA 1TYEB 4QXGL 3ARVA 3FMGH 2AEQL 4KKCC 3W37A 3ILPA 2L7EA 3BKJL 2XA8L 5MEQB 5A2KH 1SXNA 3IJSB 3QULB 4XZUA 5CD3B 3LIZL 3EH1A 2BRRH 2ITFA 4LVOC 1I1AD 1J8HA 1A6WL 2VUOA 2XA8H 3BAEH 4L4VB 4HHAA 4JFWA 5EZIL 2I5YH 3GMNB 3QA3B 4XNMB 5AOZA 4KNQA 1FZMA 2F6AA 2HKFH 2XYBA 3S2AA 4QY8B 1MEXL 2GJZA 3BAEL 4J2QA 4TVPE 1XQ4A 3N42B 4CMMA 1DUZB 3HN5A 1MAJA 4KMTH 2I5YL 1NWOA 3ABGA 4GIOA 4PREB 1PCXA 2PETA 1RJCA 3TBCA 3MC0A 3MRBB 4I3SL 2I9LB 1ZT7A 4MNQA 4QHNB 1FC2D 5F1IA 4M03A 4OZGB 1XCTB 4IRJB 3U6RB 4RAUA 2FBJL 1KTCA 4HCIA 5DRZA 4ELMB 2H6PB 3B9KD 1ONQB 4AXWB 2K45A 2GJJA 4G59C 5HHME 4MQ7A 1UOVA 1I7RB 1OV8A 4BINA 5ISZE 2NNRA 2W0PA 3C5SB 3L4XA 5E08H 2NY4B 5J9PB 4Z7IA 1DVUA 1QNZL 4G70B 3S4SB 3ZHNA 5IEHB 5LBSH 5IW6B 4HJSA 4K8RH 4P46C 5I19H 4AYID 5D6DA 1Z9OA 5GGUB 4KKAC 1MWAL 2OZNA 1ZPUA 5HHVH 3EFFA 4GG8B 1WFNA 1LK3L 3P0GB 4UU9A 2BOCA 3PP3H 5DF0A 4YHPB 2WLJA 3WD5H 2VAAB 3RJDA 4ZW5A 4KC3B 5JXED 1SJEA 2XACC 4UYQA 2J3SA 5JA8B 1TLMA 3KH3A 4P2QA 5IB3B 1NEUA 3TIDA 3TN0D 1HQ4A 2WNWA 3KBFA 1LJMA 4KFMA 3D7PA 5JPMC 5E9DB 3IKCA 4KX9A 5AKTA 4FFZH 3RFRA 1Q9OA 1CGSL 3TBTB 4IK7A 1LK2B 1FVEB 3MRQB 4YL9A 5CCKL 3B1UA 5AB1A 4PSRA 4GQQA 1ZWIB 2DTML 1T4WA 2MCPH 1E4WH 3OHXC 3PP3K 2DAVA 3G04B 4PUBH 1TNNA 5EBLA 5TPWH 3L1OL 1T89A 1PSKL 5B22A 3WG7B 1U8LB 2E6PA 4Y16C 2DTMH 2MCPL 5BQ7B 1NMAH 2BCKA 1CQYA 1P1VA 2D7PA 1IM3A 1KB5B 5EZLB 1S3KH 3T5WA 3HNSH 3V4PL 1OTSD 2H8PB 5I8CB 2Y0SA 4D7BA 4UQIM 2QDVA 4X6FB 3RGVB 2JJTA 4DEPC 4P23D 1KTDA 4N25A 2IBZX 1TSHA 1HXMB 2LU7A 4WWPA 1DQIA 1RP8A 4AG4L 3AM8C 2PF6A 4KVPA 3CLEL 1RZ7L 4HSQA 2Z64C 4Y1AB 2A6IA 2OA9A 4GPVA 4FL4C 3HE6C 5HPMB 4P2OA 3NGBC 2ICES 3S2CA 4OZIA 1CFVH 2ICEC 1JMZA 1JGDB 3I02B 3LX9A 1KIPB 1U30A 1DQKA 1FAIL 1KFGA 1W0VA 1ZE3C 4XWOC 1IEBA 1J9CT 2D8KA 1I8LC 2GUOB 4GQ9H 1FN4A 1LEKA 2AXHA 1MUJA 4TQEH 1A7BA 4GW5B 4UQAA 3D33A 1U91B 1FNSH 4Y5YB 2PN5A 1H5BA 1B0RA 4OFYD 3K0YA 2X6MA 1O7DC 4YHLH 4CMHB 4L8CA 2F54E 3N1QC 4MXQD 3NK4A 4PSPA 1TVDA 1GYWA 4X99B 1XAUA 3S5LB 3TBSA 3EYSH 1AYRA 2ZPKL 3OKDB 4KTEL 3L3HB 2CPCA 4XP9L 3RWIB 4JFOA 4HWZA 3H9YA 5EWIH 4OD1H 1YPZA 4QHPA 3S37L 3NIFF 3UPRB 4J5VA 3P9MA 4KXBA 5I1CH 5I0VA 4XP9H 4R3SA 3T2QA 4OD1L 4FFTA 4R84A 1IC0A 2YD5A 5LBVA 2FB4L 3QEUA 3TFBA 1YY8B 3ZTDC 3QDJB 3QIUC 3TYGL 3SZ6A 2Q7AA 4K55A 2HVJB 3L9EA 3OLGA 1TQUA 5JW5B 1LILA 4ZW7A 1ZEAH 1PIFA 3P1VA 4D8PA 4ORGB 2Z8WC 5JIKA 3NIDE 1BZOA 2GITA 3IDIA 4HJJL 3P9MB 4PWIA 3NIGE 4NRZA 1BQHG 3G5ZA 3ATAA 1S46A 1ZVHA 1U8PB 2IQ9L 1L3WA 4KNSA 4OCSL 4W9KC 3NFSL 1DCEA 2AXGB 3GS0A 1J9SA 4JKPL 1J9RA 4NNPH 4Y4HC 1TTUA 3NP4A 4DGYL 1MNNA 3QCTL 1GY2A 1MNUL 1ZT7B 3HE7B 4DK3A 1CICB 5EU3B 1NCBH 3NFSH 1A66A 5GRJH 3D39B 4JN2B 2AS5M 4CN1A 4YSSA 1R3JB 4IEFA 2GBVA 2CHDA 3T04D 1KIQA 1X9RA 2CR6A 2UZPA 3CSFA 4XN7A 1EA9C 4R97C 4G8GE 3LEYH 4YHNB 1XSOA 1K8IA 1ZANL 4QTIH 1O9VA 4Z6AT 1KFAL 3FQ2A 3HUJE 2GFBB 1OGPA 3TYFB 3HE7A 1YYML 2NNXA 5A40E 5CINL 3WHXA 3FQWA 1FFPB 4L1DA 4Y8AA 1OGAE 2DQJL 1UTDA 1UWXH 4B9PA 1X5LA 1PPIA 3EGDB 1S7VB 2LOEA 4HK3J 4NO5A 3CAFA 4P9HH 4TNFA 4RAVA 4GO8A 4PCSA 4UT7H 1T7XA 3BZ5A 5DRXA 1UENA 1JXDA 4CU6A 1TU2B 4KVCL 3NCCB 3BP7B 2QDWA 3AXIA 3CXHK 1CZ8H 1AFVL 2ZJSL 4NUGL 3LD8B 3KG5A 5GSVB 4FG2A 5BMFL 2C9RA 2YPLE 4OCXH 5I1DB 3HMWL 1XIWC 2QVKA 2DDQH 2VABA 2WXGA 3GGWB 4K71B 1JIBA 2K8QA 2WK2A 1VADB 3EGDA 5IW1A 2GSIA 4ZMOA 3QARA 4FYTA 4O51B 4Y1SA 1SOQA 3JQOB 4I77L 5I6LA 3TFKD 3BW9A 4XGZA 4GFXA 3U2IA 1ZXQA 1WCBA 3IDXH 3IDUA 1I3RA 5F96L 5J06A 2GEEA 2C9PA 2ICEA 1TYJA 4GAGH 3GLZA 4HEMA 5T33H 5KVGH 3KXFD 4YFEA 3BKJH 1FORH 3C2SA 3K8LA 3UEQA 1IIKA 1A8ZA 3O11A 1L6ZA 2NNFA 4W70A 4HPHA 4DW2L 3QJZA 2YGNA 1YPZB 4GAGL 2HFFA 5CJOH 5JR1L 3CHOA 3QCUL 3IAGC 2PTTA 2VLJA 3F64A 3PE9A 3L3KB 2GC4C 4L9LB 3BPLB 4KNTA 4OLUH 3K91A 4LAQL 5CJOL 1VPOH 4NYLA 1ZPLA 2AAAA 3RB5A 3CVHB 4LU5H 5INCA 1QPXA 3NJJA 2R29L 4QHKI 5IVXB 3QZWG 5FYKL 2Y36H 1SF3A 1TZOA 4JQVC 1KYAA 4BBWA 2Q3AA 1E8ZA 4PG2A 4PJAA 1NGXA 2R69H 3QDGB 2NY4D 1PX8A 4ZRGA 3UABA 1SUHA 2NNAA 1MG2C 4LU5L 5EUOA 5F7BA 5EZOL 3KGTA 2XWXA 4PVLA 4FG6D 3BP6B 2XWZA 5HGAA 5E6YA 5DVNA 1JUFB 1TDQA 5HI3D 4U4IA 3W39B 2AITA 1LEKB 1EGJH 3UZEC 5CGTA 5IF0A 4ONHA 4E41E 2ZWYA 3PUCA 2VXUH 4KVNL 5DMGD 1X3DA 1UXWA 2N1TE 4JG0H 4KNUA 1T0OA 4HKXA 4KO9A 2OV0A 1A6ZB 1LD9A 4L8BB 1GYVA 4GG6E 5K9OA 1VZHA 4MB1A 3JWDL 3LN5B 5CP7A 1DVZA 1E3XA 4H26B 2F5AL 4HWZB 1WFOA 5JHDA 3CXDL 2X38A 3VRJB 3FN0H 2XV2A 1FGVL 3WNMA 2I25N 2P5EA 1NPJA 3WD5L 1EVTC 4N1CA 2G5BA 4U1IB 3I6GB 2C3VB 5FK9B 5EBLB 1I8KB 3LKOA 1Y6MR 3MLWH 4QRTB 1FGVH 1G7MA 2AV7A 3KYMB 4IBSA 1ML0A 4N0YL 5KYYA 5I71B 3L1EA 3QAQA 2Y69B 1LO2L 5IMMA 3LHAA 4JVUA 1CGSH 2VKXA 3VJ6B 3RZCD 2W65B 5GGRA 3THML 4QXUL 1OAYH 3MBEB 4KJQC 4OJFH 3O9WA 4LOVA 3LIUA 1A6TA 4FZ8L 2NY5H 4S2SB 3LNIA 3CG8A 5J7CC 2GJ6E 3TPUB 2HFEA 4Y1AD 3T3PB 2RTTA 5I0WA 2PLTA 2P8LB 5C70A 1JHKH 2DEYX 4P07A 3A6BL 3CCHA 4H20L 2UVFA 1N8ZB 2ISDA 1J1XH 2X4PA 3V4PH 2GIXA 3BD3A 4IHOA 4OFPA 2A6DB 3KBHE 3MV9D 3FSOA 2FHBA 5HHMB 5EF0A 4X6FA 3RGVA 3K80A 4X6CE 3HZ3A 1ZHLB 4XPTL 4U0QB 1HHJA 1M2VB 2PCPB 2XZQL 1ANUA 2VL5A 3WIFA 3GHEL 5KSBB 5BW7C 3FQXA 1UUSA 3U4BH 4ABVA 2Q1EA 3LNDA 3GO1H 2XZQH 4IS6A 25C8L 2ZKHH 4HUXA 4HYTB 3KPLB 3TASA 3U4BL 5HYQA 3BVVA 1B4LA 2QKSA 3I2CL 5HSFA 1KPVB 5HY9B 1YDPA 3M6DA 1IARB 2CKNA 2WANA 4C57C 3OPZH 5KS9F 2NUPA 3FO1A 1AE6H 4IU2B 4ZX3A 1SXSA 1CDIA 3C8HA 4M7JH 2NQCA 1UB6A 3Q8EA 4HKZA 2B9AA 4F92B 2A9ML 3KYNA 35C8L 2XN9E 2QQNL 1WYJA 4JMXA 3LNGA 2EDWA 3SB3A 3ET9F 3S5LA 3TBSB 3CFCH 5EIIB 2WW8A 4ZFOL 2UY7A 1BG9A 3HMXA 3S37H 2DWSA 1CXKA 4PJ7F 5HDWA 4EDWL 2LFEA 1MCWM 1KULA 2FRGP 4QHMA 3TCTA 1BOYA 5L4IA 4LP4A 1LO5B 1TVBA 2W60A 3D9AL 2WQXA 3BUIA 1FFRA 1QR1B 4EN3C 3VXRB 5I18H 1EANA 4CVWA 3BPOC 1L7IL 3QPKA 5ICXA 2R0LH 1ASQA 2HVKA 2IIJA 3HAEG 4FKKA 4YPGB 5DJ6A 4HUUA 2JKWA 1NOFA 5BOJA 4D3CH 2P8PB 5TD4A 1W72L 5ALCH 1YMHA 3LZFH 1RJZB 3ZMEA 1T20A 1BREA 3VXSA 2NOYA 2A9AA 1CI3M 2X4OB 4DN3L 3P4NB 2VXSH 5FYLH 3TTYA 4WIQA 1FCGA 2H6PA 4NO2A 1D9KD 1RUQH 3II3A 4X4ME 5F7EL 4I5BB 4HIXL 4YWGH 4N2LA 5D4QA 2F58H 1X7QA 2C9SA 1WT5A 1KB9K 4FFYL 2C3HA 4GAAA 3KEDA 1YSOA 4EXKA 3JWDC 2ZD0A 2LR4A 1R9FA 5I1GH 3V7AG 5B8CA 2GFBA 4FMVA 4NNPL 1TJHH 5DYOB 1OD7A 3V52L 5IJVB 4RZKA 2JKIS 5C0BE 2QGDA 4OZGF 5D7IE 3J2PA 2ZWNA 4LCUB 4HUKB 2AI0L 3MJ9H 4P2RE 5JHAA 3RIKA 3QIWB 4JFHE 2F19H 3D39A 1A25A 3LB6D 4LHUA 2NLJA 3BUPA 5E99L 3A6CL 2GYSA 5BV7L 2XQYG 3IFLH 2AI0H 4OF8A 3VG9B 1Z3RA 3N50A 2P9RA 5T1KA 1P7BA 1H3VA 4ZJ9A 1C9SA 5E0QA 1J8RA 3IDJA 3HBQA 1T0MA 4XP4L 3D3VD 4I9WD 4JO4L 4LGRB 3OJDA 1BMWA 3BIBX 2BVQB 5E5LA 3IJSA 3UTSD 3WENA 1JK8A 4N8PA 1EBAA 1T1XB 3BT2L 3O3DB 2YOAA 3SQBA 5MHSD 4HXBL 5H4YA 3OZ9H 3FUKA 3QZOA 2NXZC 2W95A 4R7XA 4ZUTB 2GSMB 4GRWH 4FQXA 4P9HL 4FHBD 5AW4B 1IL1A 3LV3A 2R69A 5F7UA 5EUKA 3FO2B 2QPUA 1H8LA 3NIGF 1Z3GL 2R83A 2KQMA 5B3SB 3QEQD 1M56B 3B9KC 5DTFA 3H4FA 5EPMB 1SQ2N 5FYJH 4XWGH 3U9UA 5L2KD 2HKHL 3P3RA 4BIKA 4HWEH 3S88H 1OB1A 2NY0C 4F7CA 4MDIB 2RCSL 1NGPH 3MA7A 1FFQA 2HJLB 4PJHA 43CAB 4WTZA 4H8WC 4EN3A 2VDOH 2UZYA 3BHBB 4BWWA 3E1ZA 3GMQA 3ZTEA 3TBBA 4DSYA 2CE6A 2YD6A 3NEXA 1FORL 1PQZA 4HJ0C 1G6RB 5AD0B 2EP6A 2SEBB 3CTTA 4G9DB 4I48B 4Y4KA 4XBEL 3X3GH 4BQCA 1QSFE 3QCUH 1F2QA 3APNA 4JFZH 4J3SA 5DJ2A 1N18A 1G7HA 2J73A 2AJSL 2X0VA 3SKUD 1Z9MA 4XBEH 1PAZA 1MWOA 4GKSB 1T5XB 4NSKA 4NN6B 3EG9A 1PKQB 3NRQA 3KPTA 2VE6B 4PV9A 5ICUA 1A9EB 4WF7A 1NCHA 1FZMB 3H56A 4KUZH 3GI9H 3EOYG 4WI7A 2GABA 2DM2A 1O7SA 1U8CB 2LVEA 1S7XA 2BM3A 2PR9A 4QRBA 2YPLA 5EZJB 2A6KB 4B9GA 3UP1A 3SE3A 4KUZL 2VC2H 1QWUA 3RB7A 1RKRA 4LKXA 1JWUB 2XG5A 2X05A 1B4RA 4FMKA 5DT1H 3DIFB 5KYUA 1TQCB 1F4AA 4HS3A 2NUPB 4S1QH 5FFLA 1C16B 1VGKA 2HG0A 2F7PA 1Q0EA 4NWUL 4NCDA 5C07A 1YNKL 2FJGA 5FECA 2WIIA 4JRXA 5JOEA 1JFQL 2FT8A 2J2ZB 4X0KA 5CU9A 1INDL 4HKXB 2VXQL 2VZSA 4Z7UA 1A9VA 1YEJL 3DV6B 4HEPA 4YBQD 5C0AD 2GJPA 1NEZG 1ZGLP 4GEJA 1MLBA 4LNVA 1S7QB 2V5TA 2GQHA 1AJ7H 2LU3A 2DKUA 5ERWB 1BQ5A 3OAWA 4R90H 3FN0L 2OFQA 2IWFA 3P2BA 2DBLH 4N0UB 4HSCX 3QO1A 2FX8H 1WD8A 1TF4A 3UMTA 5HYIA 3ZT5A 3VFWA 2CCVA 1LO5A 2EZ0C 1OM9A 4JDEA 4OCRH 2XVLA 3SOTA 3UAJC 2XOTA 3VGEA 1CDYA 4MAYA 1XX9C 3VI4B 4DZ8A 4IEFB 2YQ3A 2DQUH 1RQ5A 1LO2H 1HHKA 3GSXA 3TIDB 2CM5A 1AZVA 1FVCB 1CGVA 1GPOL 5HHMD 4PJ5A 1VKXA 3H3PH 4FN0A 3DOIA 4J23A 4YNYA 3TPUA 5AALA 5LUMA 1N4XH 4CBPA 2BP0A 4RMRA 5D5MF 5DHYA 5DHEA 1CBVL 5BW7A 3W11C 5KSAD 5ITFA 2WB1A 4Y5YA 3FB6A 4O02A 4WTQA 1GCYA 4K9EH 5KOMC 4HJ0D 1IEAA 1JNLL 1VB9A 2N1KA 4JDEB 5E2UL 3D07A 5D2NA 3W5MA 1PFCA 2P45B 2A83B 2ZKXA 2VR7A 4KTYA 4E41B 4Q97A 3AM8A 1KCSH 3QHTC 3T8MA 5MENE 2B1HH 1T7ZA 3HHMA 4ZUWB 3BPLC 2DQGL 5E2WL 1CT8B 5J56B 3VFSA 4MRBA 2OX5B 4K0OA 4QHKJ 2O72A 4KRPC 3WMQA 2NRDA 4ZMLA 4XNBA 4Z7OB 3CE1A 4LNRB 4P0DA 4O51A 2ZG2A 1SJMA 1AHWA 2N0MA 3DX0A 5DUML 3VFGH 1I31A 3KS0H 3D0AA 1UWEH 1ED3A 3D0VB 5AB2A 1J88A 3EXLA 4PJXA 4Y2OA 2ICCA 2IV8A 1THAA 3UYRH 4V2BA 3SGDI 3HVNA 4E9YA 2OX5A 1FF5A 5EDSA 4HKJB 3VQMA 2I07B 1GTNA 1QTYT 3QFJE 3OPZL 4U3HA 2BLFA 2XX0A 3IBEA 1A5FL 4LSTH 4ANUA 5IFAL 2Q86B 2EDNA 3OBAA 1YEHH 1S8DB 2X10A 3RA7H 1WFIA 3GI8H 4Y9EA 3FYEB 1DEEA 1DSWA 1H5BB 4CSSA 3VXRA 1QUNB 2FL5A 2BJMH 3L9RB 3TESA 5IFAH 2HRPL 2NPLX 2EDRA