2FE0A

Nmr structure of smp-1 (small myristoylated protein) from leishmania major
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
131
structure length
131
Chain Sequence
MGCGASSENSSVTYVNGRPTFVGEEVTKGFEKDNGLLFRIVNKKKKQWAYYNDTTQYEMHVLVTFNEDCDIKALGKTKLEQQENGEWVASVVVYPCETEMFIEGRVNGFKSKMDALPLSEEYRQHQAEKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Function, membrane targetting and structure of SMP-1
rcsb
source organism Leishmania major
molecule tags Protein transport, membrane protein
molecule keywords small myristoylated protein 1
total genus 15
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09149 DUF1935 Domain of unknown function (DUF1935)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fe0A01
2XN2A 4J3VA 1WP6A 4CN1A 1MXDA 3ZO9A 1GJUA 1M53A 4JL2A 1E40A 1U2YA 2Z1KA 1WZLA 2FGZA 3WDHA 3CGTA 4PSRA 4U31A 3DX0A 1RPKA 1IZJA 3A4AA 2XVLA 2YFOA 1MW1A 3WDIA 2F2HA 3WEMA 1JI1A 2OYMA 2EACA 1DEDA 3KEHA 3WY3A 1KCLA 3DHPA 2Y2WA 4GI8A 1D3CA 1XCXA 1HVXA 3FAWA 1UH3A 1UD8A 1EA9C 1H3GA 2VUYA 1PEZA 4UNIA 1I75A 1V3KA 3FAXA 4JFSA 4JFUA 1WE5A 2ZX9A 1GCYA 2ZWZA 4LPCA 2F61A 1PIFA 2XN0A 3KL0A 3GXMA 2F7OA 3GXDA 4HA1A 3DX1A 1BVZA 1CGWA 2TAAA 1O7DC 1VFMA 1UASA 2WNWA 3DC0A 4CGTA 3S2CA 1UD6A 4WF7A 1JL8A 3EJPA 3BH4A 1KXTA 5E6YA 1DTUA 4AYGA 1XSKA 4QAWA 1T0OA 4FLSA 1JXKA 1TQTA 2FHFA 4FNTA 2AAAA 2X2HA 4M8UA 4KMQA 6TAAA 3LPOA 4X0NA 3VMPA 4BA0A 3BVVA 3D52A 3DX2A 1TQWA 2F7QA 2DIJA 3M07A 1CGUA 2E0PA 2EEXA 5BRPA 4XB3A 3CZNA 2C8NA 2EO7A 4HOXA 1MW3A 3GBEA 4OIFA 1BLIA 4WSJA 5E1QA 1G1YA 3BUQA 3GXFA 1XV8A 1S46A 1TQUA 4U3CA 3A6OA 4DO6A 1OB0A 1MWOA 3CZGA 4DO5A 1QWNA 3LRMA 1UD2A 1VAHA 2DH3A 1HX0A 4JFWA 1CYGA 3KE0A 3ZR6A 3WY4A 2ZICA 1GVIA 4OKDA 4UOZA 1CIUA 2ZXBA 1KXVA 3BC9A 5A6MA 2VT0A 4OGZA 1V3MA 2V3FA 1WZMA 3WDJA 2D0HA 3CZLA 4FNRA 1JIBA 1ODUA 4GQQA 2OYLA 2BY2A 3VX1A 4GO8A 4UZUA 1NOFA 2XVKA 3BCDA 3VGGA 1CXLA 2WKLA 3A47A 1EO7A 2X2IA 2ZUSA 1TCMA 1QW8A 3HG4A 2XIBA 2ZUUA 5I23A 3WNPA 1JDAA 3WY2A 1AVAA 2J25A 1MW0A 3EDFA 4AYSA 2WVVB 4FLRA 1JD9A 3BAIA 3BUPA 3UG5A 1HT6A 1KGUA 4UOQA 3BAWA 2BXZA 3BAXA 3KLLA 1HL8A 3RILA 1R33A 1JD7A 3VM7A 2WVVA 3EJUA 3DX4A 3CZEA 2BXYA 2XIIA 4FNSA 4HOWA 2X2JA 5A2CA 3RIKA 2XWEA 3CZKA 2FH8A 3KLKA 2PWFA 3UCQA 4J3UA 1CXFA 3VGFA 2D3NA 3HG5A 3BAJA 3KWXA 2QPSA 2D0FA 3BSHA 4PCTA 3VMNA 1XSIA 3ZT6A 2V3EA 3LXAA 4ATWA 2ZXDA 2VRQA 1UA3A 4J28A 3EJQA 1JF6A 1JFHA 1KGXA 1QI3A 3D50A 2FHBA 3OLDA 3VU2A 1SMDA 2XN1A 3EJTA 3UERA 2IGTA 4DO4A 1RP9A 1VJSA 2ZE0A 2EADA 3WNNA 4JFTA 2OYKA 5HXMA 1BF2A 2D3LA 3TOPA 3L4ZA 4H8HA 3WMSA 5HDRA 1PS3A 2EAEA 3A5VA 1UKSA 1B2YA 2BHUA 4FMVA 5HPOA 2WVUA 1IV8A 4J3TA 2ZX6A 2AMGA 4AEFA 4GQRA 6CGTA 2VNCA 2PWDA 2VR5A 2YIHA 5EMYA 2EABA 1Q4NX 1CGXA 3CC1A 1ZJBA 1G94A 2PWEA 3HJEA 4H8VA 1TQVA 1MFVA 1KCKA 3WELA 3VSTA 2C7FA 2NT0A 1CGVA 1ZS2A 2PWGA 4CKQA 5CGMA 4BZYA 3ZT5A 1QHOA 2ZXQA 3K8KA 1J0KA 2WVTA 2YA1A 1OT1A 1QW9A 1QI4A 4U2ZA 1KXQA 3IGUA 4NXKA 1MFUA 1UH4A 4UQCA 1R46A 3ZQ9A 2Y4SA 5E9AA 3BUDA 1BVNP 2WSPA 2BY3A 1XCWA 1XGZA 3GBDA 3ZOAA 4GINA 2BY1A 3BVWA 1QX1A 5E6ZA 2CXGA 2YA2A 3BUIA 3VGEA 3H54A 2OSYA 3BSGA 2E8ZA 2FHCA 5CLWA 3WN6A 3WEOA 4UQEA 1DHKA 1OT2A 2E8YA 1WPCA 3IJ8A 4H2CA 2F1BA 4NX0A 2F7RA 4AEEA 3L4YA 4MB1A 2BY0A 3WNMA 3VO0A 3A22A 1LWHA 1MW2A 5A6LA 3GTNA 2CHNA 1G9HA 3KL3A 4M56A 7TAAA 3W38A 5I0DA 1XH2A 3TV8A 4HP5A 1QI5A 2G3MA 2GVYA 2ZX8A 3BCFA 3LX9A 3IJ9A 4MAZA 4FNQA 3S5YA 3L2LA 2OW6A 1MXGA 1J0JA 1R34A 5DFAA 1KWKA 3GXNA 4UQAA 1WO2A 1JI2A 2DIEA 3H53A 1AQMA 5DO8A 1UKTA 1CLVA 4PCSA 1UD3A 1V3JA 2D0GA 3BLBA 2VRKA 1TMQA 1PPIA 4LQ1A 4UQDA 3IJ7A 4FLQA 1SMAA 1RP8A 2DH2A 4GKLA 3GXTA 1NM9A 1BPLB 1D7FA 1JDDA 3DHUA 5TD4A 3VSVA 2F1AA 3II1A 4GO9A 3TTSA 3ZR5A 1OGSA 1J0HA 3H55A 4CN6A 3WY1A 2F7PA 3UEQA 3WNOA 3LPPA 3VGDA 2ZXAA 4UCFA 4HPHA 1E3ZA 3S5ZA 1P6WA 3VNZA 3EDEA 1KXHA 1R47A 4U33A 1PZ2A 1UOKA 1A47A 1XD0A 4J27A 5A2BA 2WC7A 1Y7VA 2ZUWA 3BVXA 2ZX7A 4FLOA 1EHAA 2D2OA 3BMVA 2EJ1A 4JL1A 3FW6A 3A21A 4UZSA 2CPUA 4AIEA 2YJQA 2ZUVA 1JF5A 1BAGA 3ECQA 4NZFA 1CPUA 1HTYA 1SZNA 1XSJA 3UG4A 4UQBA 4H7VA 3ZSTA 5BRQA 3BVUA 3DDFA 1KWGA 1UD4A 3AMKA 2FYVA 4NZJA 1HXKA 1IZKA 3OLEA 4PEEA 3BLKA 4FNUA 1HL9A 1J0IA 4GIAA 3K1DA 5F7UA 2ZIDA 1BG9A 1UH2A 5E70A 1V3LA 2G3NA 3KL5A 1R75A 3AMLA 1HWWA 3EDKA 1QPKA 1UKQA 4B9YA 1JXJA 3D4YA 1E3XA 4CVWA 1OSEA 2GUYA 3CLWA 1WZKA 3CTTA 2Y24A 4J7RA 3AJ7A 9CGTA 2WANA 2D73A 1MVYA 2ZWYA 1KBBA 3D51A 3LXCA 1KBKA 1CXIA 1AMYA 2E9BA 3MI6A 2ZUTA 4GI9A 2WCGA 1JGIA 1KTBA 2WCSA 4AMWA 2QV4A 3DX3A 2WVSA 1JG9A 3VX0A 2WKGA 3HG3A 3HG2A 3W37A 3EDDA 1CDGA 1LWJA 1VFOA 3HZ3A 2GJRA 3VNYA 4NI3A 5CLTA 2QMJA 1M7XA 1CGTA 2XWDA 3OLIA 5A2AA 4W93A 1L0PA 3D4ZA 2E4TA 3GXPA 3L4XA 2OSWA 1KGWA 2XVGA 4X9YA 3VM5A 3BUBA 1PZ3A 3L2MA 2FH6A 3VGHA 3EDJA 2YFNA 4WSKA 3TTYA 3CV5A 4J3SA 2ZX5A 4H8UA 4FNPA 1QWUA 3A24A 4LXFA 4AMXA 3ZSSA 2Y5EA 4J3XA 2FE0A 3EJSA 2QPUA 2NT1A 3BAYA 3L4WA 3VGBA 4PSPA 3IK2A 4JCMA 1KB3A 3L4VA 4GI6A 3VMOA 2PWHA 5CGTA 4B9ZA 1QHPA 1W9XA 1XH1A 3CZSA 3A23A 5CXPA 2YOCA 1XH0A 2YA0A 3K8LA 2OSXA 4E2OA 1CGYA 3UG3A 3AXIA 2QLYA 3LRKA 2WPGA 1U33A 3QGVA 1TQSA 4OJYA 4AIOA 5KEZA 1CXKA 1PJ9A 3AXHA 1WZAA 3WENA 8CGTA 5I5RA 3GXIA 2WSKA 3WNKA 1AQHA 2GJPA 2OW7A 3WNLA 1Z32X 4NXSA 1B0IA 3TONA 4U2YA 1VFUA 4TVUA 4UQ9A 1HNYA 1UD5A 5E0FA 3VSUA 3BLPX 1BSIA 3EJRA 1VB9A 2ALWA 2EQDA 1E43A 3LXBA 1JAEA 2BHZA 1XD1A 3CPUA 3BVTA 1PIGA 3LRLA 4JFVA 4J3WA 1KTCA 1U30A 4KWUA 1G5AA 2F18A 2V3DA 3OLGA 3ZT7A 3K8MA 1GJWA 1ZJAA 3L4UA 4AW7A 4HOZA 7CGTA 2QMKA 3BAKA 1C8QA 3L4TA 2BHYA 1PAMA 3BMWA 1UA7A 2NSXA 1EO5A 1CXEA 1CXHA 1VIWA 4JCLA 3DDGA 4CN4A 5I24A 1EH9A 1JDCA 3WFZA 4WLCA 2YKKA
chains in the Genus database with same CATH superfamily
1YPZE 4PJIE 1GJUA 4AYDC 1M53A 4X8XA 3ZDYB 2Y7OA 4TNFA 4Z95H 5F1SA 1IKFH 1ACCA 3PUUA 2X70A 4KTYA 2XVLA 4LPXA 1L9OA 1K85A 1QQDB 1RZIB 1LLAA 3I9GH 3DBSA 4ODXB 1OKEA 3TN0B 5D7LD 2X1WL 4YOKA 4F9LA 2HMID 3FT3B 2DQHL 5F9OL 1EO8H 3ROOA 2UZXA 4LARH 4Y4FC 2LVCA 4OZIE 2VUYA 4X7FC 3K6IA 1V3KA 3QNYB 4IKJA 4PIRF 4W68A 1NLBH 5E56A 4NQXB 2O4EA 4PJHB 4GBXD 4E5XB 2JIXD 5D1ZC 5D2NB 1COBA 3ARFD 1MHHA 4XAKD 2ADIB 5EU6B 1CGWA 4WFHE 5D1ZA 2AQ1A 1NGYA 4MB3A 3PXJA 5JW3H 5HJGA 5LNGA 5IROC 1MCQA 1OM9A 3MLZL 1OALA 3X3GH 4ZXBB 1DQTA 3GK8L 3EHBD 5C2BH 1UD6A 3MACH 4F7PB 5DHVA 2FX9H 5LAXA 1XSKA 5C09B 3BQUC 1N2RA 5TH2A 1CQYA 2A83B 1S5IH 1TQBB 4PJGB 1JRHH 2AERT 2YRBA 5DS2A 1MFCL 2DIJA 4MA1B 4Z7UF 1EHLL 2OZNA 2QBWA 5JW4R 3UBGA 1QNIA 4XB3A 5DK2B 2N3JA 2DQEH 1RZJL 2NY5L 4JFFD 4M5ZL 4KVCH 4MD5B 4PW9A 3Q05A 3NCWA 4PJ7B 2WWMC 1LO0H 1WBYB 3TX4A 3D69B 4JRLA 4N24A 4NO0D 1XGTA 2G9HA 3CBJB 5EU3A 1MLBB 2MRYA 2A6IB 3VCLB 4DO6A 1MWOA 3HFFA 4ZMVA 2ATPA 3POHA 2F8IA 2E9IA 5B39G 1WFTA 4ENED 4JFWA 2M83A 3BKCH 4LVNC 4QHMB 1IM3A 1YEGL 3KE0A 4XCNA 5I1IH 5IW6A 3KGTA 4WKXA 1T2XA 2BIQA 4KXAA 3VA6A 4G7SB 2WBJC 3QPQD 4OGZA 2J6EH 1OF0A 5GZOD 3NJFA 1U8HB 3CZLA 3LEVL 1ZHBA 4PBDA 1RSYA 1A7QL 2DIAA 3R1GL 5C6PB 1JZIA 4BH8A 5IVXF 3V79C 5E7FA 3BPNC 2XVKA 4ANKA 2MKLC 4OB5H 3VCLA 3RPBA 1W16A 4POYA 5LVEA 4L18A 3H9SE 1P7QB 3UYPB 1MLBA 5DJ0B 2WLHA 1L9MA 3TA3D 2MHAA 3O6ML 2F54D 4TRPH 5DC2A 4IRJD 5EWIL 5SV3A 2P5PA 3D69A 4QNPE 1PMYA 1UWEH 2YLHA 4XBEL 1TKWB 2BZDA 5E1GA 2EILB 3JWDC 1BOYA 1XIWD 4UINL 2HKAA 3M8OL 1IKNC 4JAMA 1IVLA 1EXHA 4PJGA 3X12B 3B2DC 1GR7A 4R2GD 4QOKE 1RU9H 3DA0A 3O0RH 5B3JE 3VM7A 5LAXB 4FJZA 5C09A 2A4ZA 4P3CL 4ABQA 4MQXD 4DP4X 1AQKL 3IFOA 3CMOH 4G8GE 4UZGA 1XEDA 3JVFC 1A14L 5A2CA 3B6SA 3O2DA 1ZTMA 3KLKA 4LP4A 3DWTA 5EEVA 1SY6L 2Q1EA 5C0FB 4N2NA 4PV8A 5HGBB 3SPCA 1NSNH 1YG9A 3KWXA 1L7TH 4JCWA 4LZKA 1NCWH 3N5AA 3QIWB 4AJVA 2VMDA 5FO8B 3QCVH 4UTAH 2XTJD 3I74A 4JGMA 2D03H 3MGTA 3IT8D 4IKNA 2VZ1A 2FJGB 5I17A 1AXIB 1YMMD 3C5SA 1N70A 1DANT 2VKXA 4Y5VB 3VRLF 2ZP8A 3VU2A 1SMDA 4M5YL 2AP2A 3PHSA 1T03L 2FEDD 4C4BA 3QJOA 5JR1H 4X99A 3VW3H 4K71B 3KPRD 4LBEB 3QIBA 4B9IA 5IESL 3H2PA 5DWUH 1IGFH 3WN5B 2GFBB 2AABH 5GISH 3TZVC 4FADA 5ADOL 2J20A 2ZG1A 5JIHA 3A5VA 5DJZB 5DJ6A 3MRBB 1CMOA 2YAQA 2YKLL 4M62H 2WVUA 3C8KA 1G7LB 4N6RA 3TIEB 2O6FA 5C97A 1DQML 1ADQH 1EV2E 4XNXH 3UXFA 3GKZA 1R4XA 1UJ3C 1ZJBA 4MJHA 1XFPA 2JXMA 1WICA 1CFQB 4WUKL 5AL0A 4B97A 3FYEB 1PG7W 4KQ3H 4DN3L 1MFVA 5DWUL 1PF3A 3KCPA 4WO4B 5AZEL 3S4SA 2BX5A 3H6AA 4IU2A 5H2BA 2IMMA 4WI8A 5D7KD 4PFEA 2WTRB 4O02L 5CJOL 4MA8L 1WFNA 1Z2KA 4PR5A 4PJAA 1BP3B 2JK5B 4HUXA 5T1KD 1ORSA 3R7QA 3PWNA 2P9RA 5J6HA 5J89A 2ZCLH 4DK5A 5K9QG 4EIUA 2ZWNA 1JZGA 4FYSA 2EICA 4TUOB 1DZ0A 1NCTA 3MXVH 1EUTA 3DJRA 1SDYA 1DDHA 3ARFB 4ZMTA 4PJ9C 4HUVA 3GBDA 1RK7A 2LU3A 1ZE3C 2K6YA 1CCZA 2F8XC 1QX1A 5IGXL 4H4NA 1XL4A 1S78D 3L3KA 4GLRH 4OZIA 3BISA 1I9JH 3H54A 3BSGA 4KKPA 1RJZA 4IIZA 5HYFA 3VFGL 5C6TL 3QIUD 3MOAH 1F00I 1OL0A 3QI9A 3FYIB 4ETQA 4DP5X 1I8IB 1SVBA 3L45A 1F6LL 1CLOL 5DQDH 1FNHA 4LVEA 1QEWA 1MW2A 2NY3B 3SJVB 1ZT7A 4IGBA 3QDGD 5E8NB 4RSVA 3VWKD 1UUNA 2OMBA 5AKSA 2DJSA 2A9NL 3AFLA 4L2YA 2DYPD 3AGWA 4OUOA 4XVJL 3DYPA 4EMZA 3KM1A 2PYFB 3O8XB 4QY8A 5AKTA 2NY1D 5MEQA 4EI5D 4F8LA 1ED3A 3FT1A 3N06B 4G6AC 2GUOB 3B8SA 1M05B 3HI5L 4UM9D 5AYUL 1YEHH 3U36A 1JOIA 1GC1L 1CR9H 2YXVA 3BLBA 3FU5A 1TMQA 1NGPL 2BOCA 5C0ND 1MOEA 1KB5B 4A2DA 4JFDB 4I7ZC 35C8L 2AJZB 3RWIB 1ITCA 3C60C 4HIEA 1DQDH 3IKCA 4OTXH 3V0WL 4Q4IA 4KGLA 4PVMA 3CZJA 3BAEL 4GKLA 4XPAL 4RRPG 4ZMNA 1PFOA 4HUWA 4PD4J 4K2UH 1JS4A 2WXRA 2XDHA 3LH2H 2VWEE 4GO9A 1IFGA 1M3IA 4Q4EA 3KJ4B 4FQ1H 3W56A 1NIBA 1HDMB 1WT5C 1T2JA 3CN3A 3TA3C 2DQ6A 3SQBA 4OH2A 1T21A 4DNLA 4YHML 5I1DA 1CS6A 4U3SA 5E8PB 2EIMB 5GGUA 4GG6B 4WU5B 5IB2B 4N85A 2E7CA 2VLRA 4N8PA 5I0XA 2VDKH 5IMLA 2NY2B 2NQ3A 1NCCH 3OKNB 4PRIB 1XGPB 4NNYB 2D2OA 1WCQA 4U7KA 5DHMC 2X3BA 4I18B 2OZ4A 3WLWC 3HPJA 5FF6B 3GHEH 2EO1A 3LEXB 3B3BA 5I16B 2VDMH 5KSBE 1BAGA 5ITFA 3X13A 4NCC2 1C5BL 4POZC 4JFDD 3W0WA 4PMFA 4WCYL 2APWA 4UT7L 2VC2B 3T0BA 3U0WL 3IDYC 2WZ6A 4M7KH 3HI1B 4NZJA 1YDPA 2R9HD 5H37H 4P5MA 1I85A 1PD6A 1HL9A 5CR8A 1OSYA 4OF8A 3UAJA 5KSAB 4N2IA 3U83A 1AKPA 2IPTL 2KYIA 1KCSL 1GGYA 1ML0A 3CFKB 1AS7A 2Z9TA 1U93B 4L37B 4DGIH 2FLRT 4XMZA 1QFUH 2VIRB 2F74A 4P3DA 4CVWA 3GB7A 2JB5L 2Y24A 5JW3L 5IJVA 1W80A 2UY6A 3SDAB 4LNRB 1DBJL 2DKUA 3MLVH 2YLKA 5FKAB 3Q2VA 5F9JB 4J4PC 4LCYA 3RDTB 1HQ4B 4GI9A 4RDQG 4PJEE 4P59L 2V5MA 3MODL 2BNQB 5CCJA 1IE5A 3QP3A 3VX0A 2EZ0C 2GCYB 2UWEF 4I48A 5GZOA 5DD1L 3ZYOA 2HN7A 3HZ3A 1JGLH 4FP8H 4K7FB 4ODUB 2R23A 2B8OT 4Z7UE 5BVPH 2E7MA 2OSWA 4X4ME 2RHEA 4KI5C 3SN6N 4YHNB 3L2MA 5I6XC 5SWQB 3DIFB 4IMKA 2IF7A 4ABUA 2VJXA 2D7TL 4HMCA 3CNKA 2AV1B 3HAEB 4PLJD 3DI3B 4AYBA 3FUKA 1HHIA 3ERXA 2B4CC 2IC2A 3DGGA 3H8NA 4H1LH 1F4XL 4K3GA 4JFOA 4RMTA 3QE5A 4Q97A 1ULVA 2EDKA 2IDUA 2VKWA 4JPKL 1ASPA 2R0WL 4MCYB 2C3VA 4PRIE 5KZCB 2X4NB 1HJBC 3VA2C 5IMMA 1E65A 2QPUA 1NANH 4Z7NB 3X13B 1AXTH 1BAWA 1MJ7L 3IK2A 4YHLL 1F58H 5F3BA 2DICA 5DUJA 2IG2H 4CA4A 4JREC 4JUTA 1E8ZA 5H4YA 3D2UD 3QJHB 4BSJA 4Z76A 2LT9A 2YPLA 1UACH 5CXPA 5I1KL 4I18A 2Y1VA 2X5PA 4N68A 5EB9A 4AL8L 1NJ9B 4NO0B 3GNML 3HS0B 4JM2A 5JXEC 4AIOA 4N8CH 5HDQH 2V2TB 3IVKB 5HYQA 5IW1B 1PJ9A 1U3JA 4PS4H 3WJMB 3WENA 4WU5A 2IGLA 2AEQH 2B59A 3KLAB 3Q8BA 3FL7A 4MXWL 4U3SB 4QHUB 5E8PA 5JDSA 5E0QA 5BXFA 1S9WB 2V2WB 4JPWH 3K80A 1J5HA 4P23A 4ODVL 5F2FA 3K6SA 2YK1L 3CCHB 4JFPB 2D7PA 2ALWA 2NY7H 2ZOOA 3N6YA 1TUPA 2X6VA 4H26A 5DHVH 1XD1A 1MWAB 1VKXA 3D25B 5EUOE 1ZTXL 3VH8A 3ES6A 1U30A 2ADFL 2B1AH 1GYVA 2ED6A 2V3DA 2B39A 1B2WH 2A6KB 2DMBA 3K8MA 2IADB 2DOCA 2OM5A 2O6DA 4R4NC 4GKSA 2JIXB 2D8KA 2GUOA 2QHLA 4BFGA 4NQED 3C5ZB 4TUKL 3MRLA 1F6AB 1J1OH 1GZHC 1D5IL 4ELKA 1YLBB 3OB0K 1EH9A 1I3RB 2PYFA 3NRFA 4MD4B 5FR3A 4PP2B 3WIAA 5K9OB 2GI7A 2IJ0C 1BQHG 2GSIB 2EYTB 4LHUB 4BK8A 2E6QA 5DJYA 5BRZE 2P8PA 2FO8A 4LSSL 1Q94B 3WS6A 4JL2A 1AHKA 2OJZH 3ZY7A 2FGZA 3DUHA 5D8JL 4NC2B 3SJVA 3MLSH 4YSSA 5SX4H 3TYGL 3DX0A 3SDAD 4ZBJA 4Y9GA 5KBLA 3FQ2A 2F2HA 4GQ9H 1N0XH 2OYMA 2OAAA 1X4YA 1MNUH 3V9EA 2Y2TA 2PPCA 3KEHA 3WY3A 3DHPA 4XX1G 1TU2B 4ZI8A 3EH3B 3NAAH 3TCLA 2H41A 1RJZB 4NNXB 1YEKL 2QSTA 3GSVB 3PF2A 3VD0A 3IXTA 4XXCC 4K9JA 4FJ6A 4EKXA 1BGXL 1QRNA 1BZOA 4OZ4B 5KJ7E 3MLSL 3MUUA 4UMSA 2F61A 1PIFA 2XN0A 3MUJA 2R2BB 3GXMA 4XO3A 1HSBA 3NCBB 2C5DC 3KPLA 5JHLA 3FU3A 1MCIA 5FYKL 2BOBB 2IBGA 3IB4A 2B14A 4MAUH 4F2FA 2WW8A 4AWJC 4HXBL 1LO0L 4ZMLA 4U1GC 2OSLB 4Q6IC 2ICCA 2I9LA 5C0BD 5CD3B 3HRZA 1QBLL 5GQBA 5I6LA 4HUXB 1DTUA 2C3HA 4V1DE 1UT9A 2X2HA 4MB5A 4TN9A 1RZGB 4KKCC 2QQNH 3UL4A 1ZSDB 4GRWH 4KY1H 4NSKB 4HSQA 2ZAIA 3ABZA 4P46B 5EOQL 5KYXA 5EC2A 1YEWA 4LAJH 3W5MA 2MCG1 2DJ4A 2GSGB 5HDOA 1N12A 5KVMC 4DQAA 1XF2A 2YQ3A 2HFGH 4XOCA 3TIEA 1KYFA 3BUQA 3KW7A 1KTKE 4PBXA 1JZ7A 3WHXA 2VSCA 5JHDA 4XCFL 1F4AA 4BEIA 1DN2A 5FKPA 3B2UD 1E4HA 1BXXA 3O4LA 3ZE0E 3DRTB 1ETA1 1AGFB 2HUEA 1EMTL 3CD4A 5LBSH 1ZVSA 3WIFB 3B5GA 1E9OB 5DO2D 1X9RA 4NQDE 2UXGA 4ODBD 1P2CA 3ZDYE 2V3FA 3D85D 4RGNE 3HG1A 2BWIA 3W39A 4XVSL 3FF7A 2NR6C 3T65B 5I17B 2A0LC 3L1FA 1UCTA 5EU6D 3VXTA 2N1KA 4PWIA 4L1BA 2AJSH 2DQGH 2NDGA 3KYKL 4LSPH 4UZUA 2R83A 2WNGA 2VL5B 2P5WE 2PYED 2WKLA 5AG9A 4DEWA 1X7QA 2YXFA 3T4YA 1IGIL 2NCEA 2XZCH 4PWKA 4OGXL 5CZKA 5DZLA 4GRMB 1DBJH 3MLVL 3MXWH 3WBDA 4BM7A 1ZIBA 5L2KD 1Q9OA 4UDUA 1QFUL 1W8OA 4N0YL 4OZGF 4PJDE 2HVBA 1ZTXH 3SQRA 3U79A 2PTTA 1BZ9B 4OCLC 3JYBA 3I02B 2A6DA 3MODH 5L2JA 3CVHL 3DX4A 4ZPTA 3LIZH 4U05A 5DD6A 4ELMB 4G9FD 3PIQA 3GZKA 2GEQA 5ERWA 3GFUA 4IDLA 1JWUB 4PJBF 5DU7A 1HHGB 2XWEA 3QUML 4N0CD 3ML8A 5FK9B 1GYUA 1P7QA 4EQ3A 5SX5K 1Z9MA 2R27A 4I1NB 5LBSL 3O45A 4ZMWA 2VSMB 1YEJH 2VDQH 2W0FA 2OLDA 4CBPA 4G43A 1CD1A 2V3EA 4N8VG 1OGPA 2D7MA 1P1ZB 3APCA 3PL6A 1XGQA 4KKQA 2PR4H 4FXKC 1YC8A 4E0RA 1T0MA 2QVFB 1U8HA 2Z92B 3DBXA 3SBWC 1AC0A 3V4PB 3V4PH 5EORL 4DW2L 1G7QA 1ZGLA 3I3BA 1N59B 2Z93A 4U0RC 5DD3H 3MOBH 4GQPH 4Y9CA 2E86A 3IJHB 3AY4C 3NRQA 4GSUA 3PDDA 4HWUA 4MX7B 1HHKA 4HGKC 3L1GA 2OMUB 5HYSB 1CF8L 1CGSH 1RZFH 4A7VA 3QNXB 4PJGE 2ADYA 2A6IA 1EJ6A 2ESVA 2JJSC 3RVVC 3WNJA 2XRAH 2PWDA 2VN4A 4P5TB 3A4EA 4K5PA 1H8LA 4U1MB 1NL0L 3QUYC 5DD0H 3OPZH 2NXZB 4LDOB 5JNYA 3VXRA 3NCJL 5DK2A 4PWGA 2EO9A 3N1FC 5E1IA 5E1AB 2GI0A 3HJEA 3RY6C 3MA9H 1UXWB 2W9EH 1JPSL 5BV7L 3VSTA 4NUPA 1AD9B 4ZD3H 2A83A 5E4EC 3OQRA 5DHVB 4A2EA 3DYMA 1QVOB 4KQ4H 3U46A 5IB5A 5I15H 2ERJB 1MCWM 3HTLX 4MAYA 5ISZD 2ED9A 5D7JD 2P24B 2HLAB 5D1ZB 5D2NC 2ID5A 4EIGB 4X6EB 1VFAA 3QH3A 2ADIA 2WNXA 2BM3A 1CFBA 3UBXB 2KS0A 1KENL 1RK0B 4YSAA 3I9AA 3ULVC 1QWHA 4DH2A 2H1PH 4UV4H 3E7JA 3DGCR 4FS0A 4Q56A 3TV3H 4Q9QH 1DUZA 4JW3A 5E9DB 1DJSA 1MNNA 3KEDA 4AEEA 3SDXF 3TZVD 3KXFE 1FH5H 3QQ3A 3WNMA 5A6LA 4KK6D 4DHLA 3DJTA 3GGWA 1IBZA 4A55A 1QATA 1YPZF 4X9IA 2ZKHL 1U3HA 1E28B 1VGEL 5GS3A 4ONHB 2MJWA 1NC2A 3F7VA 1V55B 2AGJL 4MAZA 4Y5VC 5EV7A 5F93C 5AD0B 3QO0A 4K3JL 2QHRL 3SD5A 4QRRA 4NN7B 1J0JA 3GMOA 3GRGA 1E4WL 3LS5H 1XHHA 3H4FA 5GGQH 4QR7A 5SWZD 5EUKA 5ENWB 1U8PB 1AQKH 2YAEA 4A2GA 1VDGA 4PHZA 3NBNA 1OF2B 5E08H 1VACA 3LKQA 1YUHA 2DBLH 2RA1A 4YXLL 4TNWF 1EZVY 1NGQH 3ATFA 3WFBH 2GAZB 1JZ5A 4QHLB 3L3OA 4MQXC 4DTGH 4L3FA 5EO1A 1EVTC 1NCBH 1I9IH 3SE4A 4HQQL 5ESVA 1G1KA 1MVUB 1O7SA 3BPNB 2F1AA 4J12A 3MBEC 3HHRB 4G3YH 4Y4KB 3SE8H 4I3RH 2ZP9A 4J3OC 3ZRSA 4U6XB 2LQRA 3P0YH 3LPPA 3VGDA 5FO9B 3U82B 3N55A 5F89A 4ZDHA 4DGYH 3N44B 3FFCA 1G9MC 3HNSH 1LTXA 3SSGA 4NT6B 1K5NB 3UAEA 1P4IH 2JI1A 4N8UA 5LBSA 5C86A 2BMKB 4HC1A 4UT7H 3BEVB 1YEEH 2ZUWA 1TNNA 3UPRA 3JV6A 4YDMA 3HNTL 3S37X 4Z7VA 3QDJB 3KPRB 2ZOUA 5H8DA 3OD3A 4DN4L 2NNXA 5B21A 1KJMB 1G9EA 2WSDA 1WTGT 5K5YA 3EHBB 4NZFA 4Y1AB 1QFHA 4PRNA 5C0BB 1XSJA 4JG9A 2BIOA 1OTTC 3QZLA 3T0EC 2J1WA 3T71A 3BKCL 3CK0L 1WHOA 2H6PB 4IDJH 1KB5L 2A1WH 1WWBX 4LARL 2P4AB 3FT4A 4OLZL 4YIQA 4ZPVA 3RVUD 1SHSA 1HQRB 3LMJH 2P42B 4X4XB 4FKEA 1XGYH 3T0WA 4PV9A 3L3HA 5CLYA 1NKGA 3KW8A 1FFNB 3EADA 3ARVA 1KG0A 3LHPL 4OT1L 2GT9A 4L29B 4XBPA 5E70A 1NMAL 2AEPH 2NRDA 2W59A 1GSKA 3C6LB 3OR7A 5HGHA 1MHEB 4X7EC 1UKQA 2WP3O 3QUKA 4XX5A 1MWAH 2ZCKH 1RJLA 5E4OA 3SYOA 3B56A 4TVPH 3CTTA 3DXAE 5J13B 1XR9B 3P2BA 3B2PA 1U3HD 4PB9L 1E5CA 5FOBB 1OXYA 3TZVB 1H3WM 1A6TA 1MCDA 4XBEH 5GZND 1REIA 4OIIL 4Q14A 1A14H 4Y1SA 2ROYA 3IETB 4R97C 3FFCD 4FF9A 1L5GA 2WYTA 3QZWG 2AANA 2FK9A 4PY7B 3L3GA 5D7LE 4FI6A 1GKEA 1L7IL 1ROWA 4Q2ZA 3QDAA 5F44A 4ZFFA 3ESMA 1GAFH 5CEZH 1AGCA 1DVXA 2WAHA 1ZT4B 5J3HC 1BM7A 3UTQB 3B2VL 1MCKA 3BZDA 1Q0XH 3QXWA 5G5DA 2HFGL 3KJ4C 4XMVA 2XBTA 4ZOEA 1NCGA 1SJHA 3EDJA 1FCGA 3FCBA 5F3HB 3HMWH 3MTXA 5B22A 3WV0A 2B0SH 4LPWA 1CL7H 1OARH 1M2VA 2P7TB 1BEXA 1L6XA 3DIVA 4XMLH 1LE9A 1YC7A 1U95B 5DJDA 3MRIB 1RZFL 5ES4B 4PJ9B 1SNRA 4GUPB 2WINA 3WL9A 2MPAL 4MB4A 3UFIA 4GRWB 3IDIB 4WHTB 1VEPA 3PGFH 3K8LA 2WLMA 4UOW1 2YN3A 3NEEA 1RZKH 3HW7A 3DJ9A 2L04A 4PREB 4ZUWB 1U9KA 1J86A 1JHLL 1MG3C 4K07A 4ZZFA 1QZ1A 2VERN 5JIKA 3BDXA 3DPBA 1KTDB 4NS0A 1CG9A 4NZ8A 3AC0A 2XRAL 2XG5A 3P3UA 4QD2E 1NGWA 3BH9B 4P49A 4MA8H 3AT8A 3WNLA 1YQVH 4Y4KD 3MLTA 3O2DH 4MA1C 1FYTE 3UIZA 4ERSH 3E3QE 4YHZH 1ZS8A 1TLKA 4C4KT 1VB9A 1WFOA 4FEMA 5I19H 2Z31C 4IBTA 5ALBH 2CHWA 3V0EA 3MJ7B 5E95B 3JTTA 4I0CC 3MV8B 3S8GB 1F90L 3QORC 1T20B 4TUUA 2A73A 2IV8A 2J5LB 3K46A 2WZAA 3BX7C 3GLEA 1FYTA 2VDRB 5F1IB 4UM9A 2MCAA 5FM5M 4DKTA 2F1EA 3AS1A 3BMWA 3O8XD 1UA7A 2NSXA 5HHNA 3U0PB 3U9UB 4EPSA 3FSVA 3KJ6L 3UDWC 4QRTA 1DQQA 4Y9EA 2O61B 1A0QH 3C6SB 4KRNA 3MNVB 3LNGA 4DOHB 1QBLH 5AVSB 4EZMA 3EOAB 5EEUA 4HHWA 1E50A 2RGSA 1AFVL 3ARBC 1U2YA 3LQMA 3U48A 5IHZB 3DX7A 3FQXA 3FRUB 3Q8AA 4N2KA 4BDVA 4ZYKA 3S2AA 4GW5A 1XIWA 4BZ2A 4WI4A 5CJ5A 4BFRA 4LLYA 3BW9A 1WC7B 3KPNA 3T3PE 5GXBB 3LV3A 5I6XB 3H56A 2OL3H 4XNYH 1FZMA 1KCLA 4HF5H 3BIKA 4N28A 5FYLE 4JHVA 4OGAD 2CSPA 2UXVA 3JWOC 3T5WA 4L4TE 1WE5A 1DJWA 1M71B 1HCZA 1DYZA 3Q6GL 4ODWA 3FTXA 4QTHB 3ZTCC 3ZX1A 3HBGA 1YN6A 4B96A 1ZHNA 5DK0B 1W91A 4XN4A 2CRZA 2XUWA 4UILH 1CICA 4EXPX 3RWHA 4D2NA 3U0TB 1X5IA 5IMKB 4YBQC 4YZFF 2WNWA 3R18A 1VESA 1KBGH 1YJDC 2WXHA 5LCVL 5CUSL 3D3VA 4G3YL 1XF1A 5GGTA 2F53A 5MERB 1TJIH 2NNAA 4HC1H 5BZDA 4UAOC 2D31B 5AW9B 3KYMA 4FQJL 1DSYA 1H8OA 1AR1C 2ICES 1U8NA 2NY2D 2R56L 4KV5F 5IKCB 2Z91A 4KI5D 4ONGH 5DZ9A 3FCTB 4N90D 2XQYA 1RZJC 3STLB 3EZJB 4L8BA 4NDMB 2CKBB 4X80H 4ONFL 3W9EB 4WTQA 4F9LC 1E6JL 2R2EA 2CU9A 1JTPA 4NPYB 1HKLL 5E94A 5F9AC 2HG5A 2CBMA 2XQ0A 2EEBA 4FL4C 1X9QA 2W95A 4N2BA 3KAAA 3U2IA 3P3RA 3Q3GA 2WMPB 5I71B 2NPLX 2X0WA 5KBMA 2PYEA 4JPVL 4MXWH 3CUPB 4HXAL 2IH1A 5D9SA 1WHPA 4TSCL 5I1GL 1PY4A 1OP3K 4NWTH 1JN6A 3IPBA 1KOAA 3IBOA 3N0PB 4U3XA 3P9WB 4RLDA 4FX5A 5F7DB 5IM7A 3G5YB 2EC9T 2ADJA 4PWHA 2EDRA 5L4JA 1R3LB 1EO7A 4X4YA 1WS8A 2ZSWB 4EN2A 2BVQA 3V0GA 2V17L 1MEXL 4JDEA 1J18A 4DCQB 1ONQB 5EOTA 1A1MA 4RGOL 5BRZD 1GZQA 1XXFC 1RUAL 4YGAB 4JZJC 2PKDA 4LMQE 2C34A 4E41A 1TSRA 3OXRB 4L23A 1IT9H 4UIMA 2XPGA 3LHAA 4FLRA 1X5ZA 4YUEH 1Y18B 1KGUA 1M4KA 2UV3A 3PDGA 4X98B 5D5MB 4JRXE 3PL6C 3IDMA 1OCWH 5F7AA 5DZPA 2JFCA 1ES0A 1OAJA 4MASA 4PJHF 2J4WH 4L8SB 1A4CA 2AKRA 3C6LD 4DP1X 2JKXA 1EFXD 1HZHL 2FEEL 2VC2H 4R7NB 1FNFA 2OFQA 1BZDA 3UBFA 3TT3L 2PWFA 3FQUA 2YQBA 4GMSL 1ERNA 1EXUA 1D9KA 2NTFA 1T22B 4OFKA 5DRNB 4PJ8A 1XF5B 4M8VA 1JHTB 4YQXH 4AYFA 5E4AA 1AOZA 3LXAA 2OMWA 1MFAL 4MNGB 4NQCE 4LSUL 3S34L 3J07A 5IQNA 3QQDB 5DS8B 3SE6A 2HVJB 4ELMF 3D85B 2A77L 1FSKC 2NW3B 2EXWD 1RFDL 3T2QA 2R1YB 3LVTA 3U6RB 2TRHA 4J1UA 1FFOB 2CJUH 3MGOA 4OGYH 2F5AL 2WP3T 2AXHA 2QGDA 1FIGH 2ZQKA 1ZLDA 3FOLA 4G6FD 2EAEA 4K5LA 3CVIL 1MY5A 1HXYB 1ZLWK 4AVKA 3OSVA 1QTPA 3CE1A 4DKEH 4JQVC 3L95A 4NUJB 4GQRA 6CGTA 3CSBA 4W4NA 2EVFA 5CEXB 1QFWI 4PJAF 3H42H 4FKKA 5FW7A 4I77H 5T5FL 5TGBB 2R0LL 3VWJA 2VQUA 1E30A 3GNMH 4WI2A 4HJUA 3RJQB 2YGPA 3SO5A 2PWEA 1IBDA 3HIZA 1NOAA 1QLEH 3D2UB 5C92A 5BO0D 4G8FA 2LTQB 3PQYE 2O5ZL 4BKLB 2C7FA 2HRPH 4M7LH 3Q1SL 1QD0A 5FUCE 2YPLE 3Q8FA 3QO1B 4NQSA 1GGBL 3C8DA 3NSDA 4PB9H 2UVFA 1V8HA 1DLFL 3QUXB 4X6CF 2BFVH 4ZUVA 4BSVA 5CGMA 3S35H 1OSZA 5TE7H 5G4MA 3SKOB 3BP4B 3RWGA 3TVMA 3NH7L 2AZUA 5TE6L 4TVSa 3IU4L 5JYMA 1G7PA 1IGTB 4ZFOA 4KROC 5LDUA 2QR0B 1SHMA 2WCPA 3X1NA 4KTEH 4KKBD 3CU1A 4LSUH 3S34H 1XCWA 4X7TA 4OJEH 3NJVA 1QUNB 1P6AB 1H3PL 3FB7B 4GINA 4F3FB 2UZPA 1PZ5B 1A02N 2CUIA 1F02I 2BNQD 3WFEH 2NX5A 3GIVB 4GIOA 1UENA 4KVNL 1RPQA 2IALB 2NXYC 4L4JA 4XHQA 1U8KA 3WN6A 4AGPA 3G5ZA 3HG0A 4OCYL 3L6FB 4RWYH 3HHSA 2RMNA 1JPEA 2F7RA 3MRNA 1JGEB 3VXRE 5DYFA 3RGHA 1YEKH 4ZJ9A 4ES8A 5HI5D 5LXGH 1UC6A 4D3CH 1OE3A 2X7LA 4BCYA 5CF3A 5CJOH 1AQ8A 4OIBA 1GS7A 4G42A 5HHMB 1WA2X 2F54B 4EUPG 1GYAA 4HP5A 1IC4L 2G3MA 2GVYA 2EXSA 2W38A 3BP4A 3RWGB 4BSVB 3OKDA 3DO3A 2ARWA 4OFVA 3LD8C 3O3DB 4PCSA 1R6VA 4G8FB 4C4UA 4O2CB 3D2UA 3UX9B 3V95A 4AITA 4MCZA 5ALCH 3NYKA 5A3ID 1UADC 2QQLL 1Z3GH 3U0WH 3DX6B 4G72B 4P5TC 4RETB 5DC9B 2VM3A 1OP4A 2OZ4L 1A3ZA 3LKRA 1D7FA 3VG0H 1OGAE 2KQMA 2Y7MA 3L95B 2FO4A 4NKDA 4JRXA 4GY4A 2P26A 4EKJA 1SYSB 3SPGA 5A7EA 5ESAA 4OY9A 4EUPA 5J12C 4G5ZL 4HK0B 3PGDB 1P6WA 3BWAB 1HKLH 5D5MF 3LRHA 3IMTA 4WFHD 4GUOA 4QLWA 5KAQG 1UOKA 1DDTA 3L3JB 4OTXL 3MV9E 1T1YB 2H2SD 4Z3GA 1Y7VA 1BOGB 3N40F 3TFKD 4NAQA 4W81A 3K0YA 4KMTH 3T6WA 3LSOB 2B15A 5AB1A 5EOCH 4K94C 5TQ2L 1MRCH 3RL1B 4UT6L 1AFVH 3NA9H 1E5AA 2IAMD 4GG8B 4J5VA 1IEAB 1PCXA 2X89D 3F7PC 1MZZA 2OMWB 1TTUA 5I8KH 2GIYA 2NTFB 5KZCD 4ZXBD 1N0XL 2BINA 4H0IA 4WI0A 3TWYA 5F7FA 5J0BA 3QSKB 4UB0L 1CLYL 5KVDH 1PD0A 1CDYA 4MA3B 3MNZB 4KH9A 1S7SB 4BWTA 2EVGA 3HB3D 2J73A 2OJZL 1B4RA 2XI9A 4OBRA 4JO3L 3UAJD 3FFOA 2NY1B 2D2CC 3FT2A 4JPQA 4R0LC 2UYLA 1IQWL 1O9VA 2RFXB 2ZKYA 3IMRA 4HHAB 3HHMA 1IAII 2TSBA 3MYJB 1GHFL 1KEGH 4Q9RL 5FUOL 3VRIB 4E41D 1AZBA 1MCLA 3AQXA 5BMFH 3D3VD 4WCYH 3TN0D 1ODAA 5JOEA 4WJ5B 5BZWA 3WLWD 2DMGA 4J23A 2WXOA 4TSAH 1A1MB 2IFGA 4JRYD 3MRMB 1INEH 3UTSD 4NRYA 3LKSB 3MRCB 1KBKA 1I1YA 2A99A 5E9DD 3V7AG 4ZFOL 2WCGA 4F7CB 3P11L 3DX3A 4JKLA 1JG9A 3QXVA 4XZUA 2Y9RT 1CI5A 3KBFA 3QIBC 1CDGA 3DV4B 2PYEB 3QAQA 4JFED 4OCMC 2GTZA 4JHAL 3D4ZA 4YX2L 5J11B 1KN4L 5LN8A 1AKJB 2V9TA 1LD9A 4IBYA 1N3NA 3DNKA 3MA7B 1L0XA 2YFNA 4XODA 1RZKC 1P5VB 5AAPA 5E94B 1O7DE 4A66A 2FIKA 4LXFA 1DFBL 1UEYA 5DSCA 4OCXL 1G7JA 1RVFH 1W6LA 2FE0A 4LNVA 2R7EB 4JFXA 4YE4L 2NT1A 1JMXA 1XGRA 3IF1B 3EHBC 4QRPE 4NDMA 4QRAA 4FA6A 3ELQA 4XMUA 4JVPA 1L9RA 3QJFB 4GG6F 4K94H 4JE4B 4C83B 3GS0A 1LO2H 3ZHDA 4ERSL 3IMUA 4LAQH 2OP4L 2OSXA 4NQUA 3HE6A 4L9LA 4XC3H 3UG3A 4N2HA 5KS9A 2EDYA 1UM5L 3GDCA 3LRKA 1HOCB 3IRZA 4NKMA 1YNLH 1NDTA 3DUSB 3ARXA 2NNAB 3V6FB 2JCCF 3I75B 2NSMA 2PW1B 1ZA3A 1OAUH 3ZL1A 2CJTA 4TL4A 3PGCA 3OKMB 1ZDSA 3DMMB 2EXTA 2I5YH 3ZDXF 1I4FB 2PF6A 5J13C 2VO8A 3CPLA 2ZP0T 4J4PD 4RGNB 2F19L 1EEUA 3MX0B 4ZFZA 4E9VA 3FOMA 2CAKA 2ZJSH 5FYJL 4R7DA 2VDLB 3NOIA 2EDFA 4F92B 3BVTA 3NN8B 4HJJL 2OA9A 2XTJB 2KLRA 2F18A 3ZT7A 1YEDB 3MLRL 2PABA 1H15A 5IOPA 1BQLL 1E9QA 5EU6E 3BIKB 2JI3A 3IM1A 3DO7A 2DDQL 3FH5A 3DVIA 3LV3B 4JMXA 3ZDXE 1PAMA 3TT3H 3TXAA 1C5CL 4DFHA 5A2KH 4LLYB 2Z4QB 1ET8A 2VCOA 2ZXEB 1NSNL 2IDFA 5JW4Q 1DBML 1IJNA 1F1GA 4OF0A 3SGJA 4CSZA 2APXA 2F53D 2FX8H 3QISA 5IBUB 3T8XB 3ZO9A 1IAKA 4N8VA 3ULVH 3MNVA 3V0HA 4RX4D 4K5NA 4X9BA 1NFDE 4PSRA 2QPDB 2R59A 5BUAA 1OOWA 4D3CL 5FC9A 2W0PA 5EN2A 3HN5A 3WDIA 1U8IB 1OE1A 1C5BH 1GGIL 5IK3B 4K3EH 5LLIC 1UWGH 1I7TA 3BESR 5BZZA 4P4KC 3CVIH 3SE9H 3O6FC 5F8QC 2HH0H 3MUHL 5G2NA 4JFUA 4EOWH 1CI3M 1UVQA 3CC5A 1RZQA 4OZFB 5MEND 3F12B 3DROA 4OZHE 3MJ7A 2YKLH 1PQZB 4OVVA 5DQJA 3VI4E 2JQZA 1MREL 1YSOA 5FHAL 2YPVA 2R39A 2LE9A 1EERB 2H26A 3VB8A 5EBWA 5BQ7A 2X41A 4TQHA 2KZBA 4MQ7B 5DJ2A 5J7CC 3MRGA 3T0VA 1FAIL 3CFNA 4WTZG 1OAXL 4YSRA 4F8NA 2YR3A 1UVQB 3CC5B 4OZFA 4WF7A 3MBXH 3RLSA 3EJPA 3WO3B 3VD3A 2X4OB 4F93B 1KTDA 5FYLD 5T33H 1Y6KR 4O02A 1T0OA 3QWNA 4KKRA 4YFDB 1BJ8A 5B3JF 3AUWB 5DMGD 5J3HD 3TBTA 1TEYA 3BVVA 3DX2A 3M07A 4GFXA 1J12A 1BBDL 4WJG3 1DL7H 2DQCH 3HLAB 3CDCA 3GRBA 2CO7B 4HCFA 5CKAA 5DJDB 1ZXQA 5EULV 4WTZA 1DZBA 4JFFB 1IAKB 3L48A 4L1DA 4N8VB 4BYHA 3VRJA 2P7TA 2FQFA 3FTGB 3NFPB 4MBRA 5GRZA 2XFGB 4Z7QE 1SJHB 4GEIA 1G9NL 1ZLSL 5DQ9B 5EDXA 5JORB 2YUWA 4HKZA 1PGRB 2DM3A 4TTDC 4Z18A 3UTQA 2GJ6E 4QYAA 3KPOA 1QYGH 1E9QB 5INCA 2YJLA 1C16B 3UDWA 1YEDA 3QIUC 4XPHH 1KB9K 3BWSA 1N6UA 1W0VB 2KLTA 4OFYD 1UT2A 2V7HB 3SQOL 1AI1L 4PVNA 1EHXA 4MJIB 1SLXA 3N2JA 2C3XA 1J9CT 1IBHA 3LKNA 3DETD 4DP8X 3OQ3B 5DI8A 1B4TA 2CBPA 4HG4K 4PB0H 1JZ6A 5JW4M 1J1XL 2Y5QA 3MBXL 1G7IA 5DEJA 1A6WH 4ZSOA 4H44C 5I6OA 5ABZA 3SGDI 5BOPA 1NCUA 5DCCA 3PGCB 1UG9A 1WYJA 3U6XS 1I3VA 2J25A 4Z7WE 4PJFE 4WIQA 2VZ3A 2VH5L 5HGHB 4MDIA 4ZAKC 1BXUA 5F6HJ 1RPUA 1BBDH 3EYOA 3IN2A 1GZPA 2BSSA 4UOQA 1FQ9C 2QVMA 2IQAB 3BAXA 4HGMA 4NJAL 2FB4H 1ZEAL 2WYIA 4MSWB 4PV9B 5D93C 4JRFA 4YHPA 3RIAF 3HBQA 1HQRA 5IHLB 1QBAA 2BXYA 3QQNA 2Y1AA 2HPOA 2MQCA 3LIZA 5I26A 5DMIH 1CLZL 2H6PA 4MCMA 1J8HE 4A2LA 4G1MA 5EUOB 4CMMA 4EVNA 3SDCC 1NAMH 1XO8A 5IBLD 3WEBA 4NYLB 7PCYA 4OJFH 4A04A 2ED7A 4M7LL 4ZT1A 5ISZB 3SE8L 5J5EA 1AKJA 2FD6H 2UUDK 4HU2A 3HAEH 4M62L 5E2JA 1P7BA 4ISVA 1FE8L 1JF6A 1JFHA 3CLEH 3ABLB 1FORL 4AVIA 3EOTL 4I77L 2E27H 5I71C 2QSQA 2JELL 4ZS6D 1F4XH 4PJ7F 5D71H 3ARBA 4M7JL 5DRZB 3HZKA 2KLSA 4F7CA 5F89B 5I1EH 1YPZB 4FXTA 3MZTA 4LRIA 1I1YB 2BRQA 2Y7QB 1Z5HA 1SXSA 3MRMA 4JRWA 5AVUB 4P5TD 3CVHH 4BK5C 3QZWA 3BO8A 2YPVL 1MCEA 1IAOB 3QJZA 4QRUA 3OMIB 2X4QA 3QHFH 4MVBD 3PWJB 2NSQA 5EZOL 5FOJA 2YEZB 4L5FL 4EEEA 4GLRI 1A6UH 4MJJA 5IVXB 1T5XB 3FO2B 3T2PA 5GS1A 3UMNA 3IMVA 3CMOL 1QP1A 1ZS2A 5IROA 3MLRH 1I9RH 1M7DB 5E03A 1BF8A 2CJSA 5DR5L 1CT8A 4JLRB 4MA3A 4Z1PA 5C71A 5FO7A 4ONHA 3ZMEA 5IFJB 4ZMZA 4WI0B 4UNUA 5EEXA 3QRGL 3KYNA 3GGWB 2P49B 3H4HA 4ZODA 2PP8A 4PLKD 3WI9A 1IUZA 3B7YA 3UJIH 4K15A 3SDXA 1RY7B 1ZT1B 4TL5A 3L1OH 3TA4D 1VEOA 1FG2B 4QWWD 1RD6A 2H4EA 2BERA 3MBWB 4WWPA 4L0ZA 4A2MA 2H1XA 3O6LH 4FQLH 4J8RB 3VXQA 2E8ZA 4TSCH 2CR0A 1G7MB 2A9DA 3FB6B 3UGXA 3FC8A 5E9DA 5I15L 4YHOL 5LGHL 4HSAC 3ARTA 5T3ZE 1S7RA 1AO7A 3NK4A 3QPXL 4JO8A 1C5DA 4PJGF 4CC4C 2YC1B 4Z7OE 4HF5L 1P0SE 1MI5E 3BWAA 2WD0A 2WQVA 1JGUL 4OZGA 2V17H 4HMEA 4HBCL 1Q72H 4LLUA 1YEFL 3I9PA 3TJPA 4XBGA 2YPVH 3IXAB 4LF3B 2WQ8A 3LS4H 4XPGH 4YWGL 1P9MC 1VHPA 1X6LA 3UTZA 1H6EA 4M56A 4JM2F 3TVMC 4FQHA 4XB7A 4AV0A 3DX8B 4KPHL 4QRRD 1S7UB 2BNRD 2PPDA 3BCFA 3LXUX 1K4CA 1KXQE 1OSPH 3S6CA 5IV2B 4OLUL 4PYGA 5FUZL 1NIDA 3N42B 5HHOB 3CMGA 5CMAA 2EDTA 3NZUA 3ZDZE 5DO8A 1KV7A 3TWCL 1FL6A 1HWHB 3D1MC 1NCOA 4I2XA 4HC1L 4DK3A 3RY4A 4Y7OC 3PHQA 3P4MA 3MCG1 1BIIB 1NM9A 4C47A 2YRPA 4S10A 5AVTB 3MRQB 3VSVA 4NAMA 1OE2A 3LEYH 2XPZA 3TTSA 5I0YA 1BQ5A 5HGDB 1F5WA 1Y0LB 2Z8VC 1HHKB 5DMIL 3TEUA 3U4BH 3UEQA 5CJQL 1A3LH 4UCFA 1T7WA 1GOFA 2HRGA 3MRNB 5KBPA 3QQ4A 4MNGE 2F68X 3HE6C 5C2UB 3IPEA 1N59A 3DSNB 1XD0A 3ULUC 5JXAH 3C5JA 2WC7A 1S7RB 2VMFA 3HPLA 1KGJA 1WA1X 2WUBH 3QVAA 3OZKA 3CIAA 3PL6B 5DD1H 5IVNA 1EK3A 3G9VA 2CPUA 1LEIA 2ZUVA 1DBBH 1ZV9A 3FPXA 3HA0A 1J10A 4UF7C 3CSYB 1FG2A 3ARDA 1J11A 1RUPL 4IBVA 1RUKH 1UB5A 4OCSL 5KVGE 3ECQA 3VW3L 3CHRA 1KF9B 1PX4A 3H3PH 4NN5C 4F91B 1IGTA 4ZFOB 2YD7A 1TITA 2G4GA 2J43A 5IFJA 2J1KA 3O2VL 3VTMA 1JWUA 1KN2L 3PIQB 3FUDA 2VDLL 4Z9KB 4EN3D 1OSZB 4RA0C 1HJCA 2Q10A 4HJEA 1CT8B 2D7OA 2PTTB 4NQSB 3Q48A 4H88L 4G9DB 2HH0L 4IYKA 3NDZE 3KYKH 3OZLA 3S35L 4OBSA 4HDIB 3EFOB 1KEML 1U3YA 2HTKD 3VWKB 1W0WA 5I30H 4DUVA 2ZCHH 3FQNA 3HR5B 4R97B 2GB2A 4OV5A 4J7RA 4H8PA 3SE3C 3BO8B 1K3ZA 1WG3A 4ZMAT 3D51A 1MJ8L 1QHQA 1X7QB 2E9BA 4LVHB 4R5TA 4LASH 4HYTB 2WUCH 4FFZH 4XC1L 4AQ8C 4JO4L 4LCWA 3T9WA 4ZMPA 2BVPA 4U1KA 1YPZA 1A64A 1EBPA 1FNSH 2DW5A 4OFQA 4M4PA 1I1AA 1MCNA 1P7QD 3HG2A 3W37A 2CO3A 4WAFA 3A67L 1VFOA 2ZUYA 4V33A 1JBJA 3HG1B 4E9WA 1P2CB 2IG2L 4PBVC 1A9BB 5L2KE 3SO3C 1V5JA 3UPCA 4PG2C 5CZXC 2WQRA 3E38A 1RCYA 3DRTA 3ZHFA 3O4LB 4AI7A 1FN4B 2L7EA 1KLFA 4J3SA 3S8WA 3MLXL 4KC3B 3MUY1 5HYEA 5E9DE 4QOKB 2YBRB 4WY7L 3E8UH 4EVNB 4S1SH 1AE6L 1KB3A 4O2EA 3RIFF 5BVJB 4W9FC 3FSZA 5CSZB 1KZQA 4YMPA 1RLBA 5AAMC 5I66A 4YL9A 4OZHA 4N2EA 4TULH 2JTYA 5CKGA 1ES0B 5FYLL 5EC2B 3R1GH 2WBXA 1I7RA 1VGEH 3TH2T 5I1EL 4MSWA 4X98A 3QWQB 4FXLA 3RVXC 3GIZH 2UX7A 1HILB 3FPYA 3MLXH 3GS4A 1CGSL 3HI5H 2HTKC 2EYRB 3UZVA 3OXRA 2VLJB 1LM8V 3CQPA 3EG9B 4AW4A 4B9KC 4ENZA 5CD3A 4PGDA 4OV6F 2OSLA 4RIRA 1GGCL 4PJXA 2FSEA 3GM8A 1HHJB 3R0NA 4DCQA 2X0UA 4GH7B 2BOBA 4WU7A 1F41A 1TZOA 5D96C 4ZSOB 2B1OA 2JWYA 4TVUA 4XPAH 4HIXH 1WK0A 3PJNA 4EN3C 3QORB 4YDLB 2C3GA 2DM4A 4LGSB 5AOJA 3SPIA 3LQAH 3LN5A 4WI5A 1XDTT 1J05B 3Q2CA 5EUOF 4PUBH 1MDAA 4I87A 3JV4A 4Y5XB 3F83A 3VDBA 4JMNA 3BAKA 5INCB 2G2RB 2XOTA 1KCWA 3L4TA 5CWSA 3Q3GB 5TE4H 8PAZA 4N25A 4KRPD 3V5KA 2GHWB 3GXUB 4A37A 3EF7A 4I89A 5TDPB 4LOVA 4WLCA 5E5MA 3MCYA 3IAGC 4HIHB 4L5FE 3DK2A 3CXFA 4J3VA 4MKMA 2VZOA 1RKRA 4S1RL 1N4XH 2XXMB 5IVOA 4X7SL 5GJSH 2VR7A 4XP9L 4ENEC 1I3RA 5K9OA 5J56B 1HU8A 1V7MH 2RALA 5DHDA 3DOSB 1CFNA 2CO7A 3Q1EA 3WEMA 1JI1A 4BZ2H 1CIDA 2EACA 5CJXA 4EZKA 2WXQA 2VLLB 3QG6A 2ESVE 3FAWA 1MCFA 5BZDB 4FN0A 3W0WE 2A6KA 1EEZB 1X7TA 4XHJD 3MCLH 2NOYA 4OF7A 4YVUA 4TSAL 1HINH 2BHFA 1T83A 1NFAA 3F62A 1BQUA 3QXTA 3G5XA 2ZWZA 1B6UA 1P5UA 4NUMA 1JZFA 4ZTEA 3VQ2C 2OMVA 5H94B 3TEXA 5I8OL 4BZ1L 1GW6A 1ZTXE 5DK0A 4GW4A 4P23B 3RAJH 4ADJA 5EBWB 5BQ7B 4MXVE 1RIVH 1T4KB 1FRGL 2O5XL 4JGUA 5BXFB 1OEZW 4U1LB 2XIDA 1LNUA 3S2CA 4OD2A 1LP9E 4U6VH 4FCAA 5AZEH 3DROB 4FHKA 5DQJB 1B90A 2HJLB 1QACA 3D39D 4JHAH 2DI7A 4JM2D 3UO1L 1TQTA 2UZIH 4P2OC 1FC2D 2QPFA 3HS0A 5K9JL 5AUMB 5KBDA 1FZMB 3WXVL 2WQXA 4XXCA 3IGAB 2NXZD 2VAJA 4R5VA 2OX5B 2EO7A 4GW5B 1U42A 4LDCA 2BS71 1YO4A 2VDKL 3FQXB 1WZ1H 3UC0L 1WAAE 1FVEA 2IXQB 1S46A 4PRPB 1NLDL 5FS5A 1LDSA 2F15A 2E9JA 5D70L 5FPIA 1FVEB 2IXQA 2P5WA 2W5PA 1B6DA 1AY1H 5HHNB 3DIFA 3K72A 3EKCA 4X42A 3RE0A 3SOBH 1KN2H 1KXVA 2X9YA 5IJKA 1MFBL 3II3A 4DGVL 1DSFL 1VPOH 1SOQA 3FONB 4MS6A 2AF2A 1H15B 5IOPB 3RUGF 1XH3B 1T20A 3FQRA 3T8VA 1NLDH 5ILTL 3KPQA 3QZBA 2LTQC 5M7QA 2MMXA 5A2JH 2IBZX 2L7QA 1TZ8A 1LNUB 4HXBH 3MOBL 1IQDB 2IOOA 3C08H 3K2IA 3EJCA 3HG4A 3C2SA 2HJFA 4GSQA 3MLTB 5H94A 2AXWA 3DRQB 4L1SA 3DMMA 2VIRA 4GMTH 3QUMH 3WY2A 2Q3ZA 3L7FB 2Y7SA 4L37A 4A1RA 4HEMA 3G5XB 2P48B 5CN1A 4FFZL 4XN8A 3BT0A 3V6FA 4HEPA 5EA0H 4PREA 1EEZA 2QGCA 4YC2C 5JHDE 4TLTA 1D6VH 2P47B 2VLLA 1EJOH 3QG6B 4ZUTB 1KT2B 4WHTA 3QYCA 1U8QA 4X8GA 4P4KD 1I9EA 4TNWK 4R7LA 4PJ9A 2ICEB 4NO3B 1CFNB 3KWVA 3A4FA 4FTVD 4WI3A 1PSKH 7PAZA 1PX3A 1BBJB 4AGQA 1OTTD 4ACTA 3W0WD 1LE9B 3VGFA 1D5ZA 1PW3A 1VCBC 4B53A 2BCMA 3BAJA 5FHBH 1SYVB 1KTLA 3BSHA 4JG5A 5H37G 5DSCB 2Z8WC 3RNKB 3ZT6A 3VXME 3CH8A 4X6DE 1B4JL 4L0YA 4DZBA 4K7PY 2J6EL 5FF6A 5G5DB 4JFYB 3V5KB 1A4BA 4OGQC 1XGPA 5GHWL 4D9RD 1HZLA 2HAZA 5T1KB 3D50A 2GSMB 2XA8L 2Q6WB 1M56B 2ZG3A 3FTZA 12E8H 1A8ZA 5DD0L 4CC0A 4L48A 3HMXA 1VADA 2XWBB 2YD9A 3HZMB 3JV4B 1OZTG 4L5FH 1SRDA 3NJHA 3Q8CA 3AREB 2ZE0A 4Q2ZB 4A7UA 3O3AA 5GGUB 2Z34A 2NY6B 2OL3L 3QR0A 2OYKA 5KYNA 3FO0H 4PY7A 5F7EL 3VGAB 4GPVA 5JOPE 3WMSA 5C08D 5HDRA 1VRSA 3IETA 1HL4A 1UKSA 3ECVA 5BO1L 1JZ3A 3QORA 3TZVA 4NRYB 4OQTL 2ZX6A 4O2FA 4M93B 2OQJB 2CPCA 4AT6B 1HHJA 1KIQB 1YY8B 5EMYA 2J56A 1RJLB 1UQSA 4WJ5A 1GHFH 3CC1A 5BZWB 1UM5H 4UYQA 4WEBH 4F8QA 2E7LC 1WH0A 4JFDA 2VLJA 1Y1UA 1U21A 4CNIB 1KCKA 5F7EH 2HMIC 2HLFC 1FFNA 1G6VK 4YSPA 1HILA 3S0PA 3LQAL 2RFXA 2OV0A 2IBBA 2VN7A 1CGVA 3CXDH 1ED3B 1WF5A 3K7UA 3FT2B 4X4XA 3K1KC 5MEQB 4IKLA 2ZF9A 3KBEA 3S36X 1J0KA 2COQA 4ZPVB 5D93B 2YA1A 3MC0A 4JHBA 5I66B 1OT1A 4NXKA 3BKMH 4DKFL 1FFTB 4KXCA 3X1BA 3VFUA 4DTGL 3QEHB 1B2WL 4QOKA 2VITB 5E8NA 2YD1A 2H3NB 4HPOH 3E1F1 4NUGH 1AHMA 4M3HA 1KJMA 1T04B 4GAGL 2DY2A 3NABL 1HAWA 2D7NA 1BREA 3ARGD 3KPRA 3K5RA 4FERA 4XX1E 2YA2A 3KG5A 4LCUA 5DO2C 1N8OE 3TYFA 3PAUA 4EDWH 5AW3B 1XB6A 1BECA 4HAGA 3UPRB 3LSOA 3T0XA 4F7EA 4B0MM 1XIWC 1LEKA 3UBXI 4G59C 3KLSA 3MZGB 3VQ1C 3RX8A 1AOHA 1A0QL 3G6JE 3D48R 3I6KB 4KTEL 4N20A 1I1AB 1DVFD 1EIBA 5AQ0A 3A22A 1MSPA 1A6WL 4WSGA 4FFVD 4HUVB 3UTSA 1B9ZA 1G9HA 3EZ8A 3NJNA 4H8QA 2K7PA 4JGJA 3WTVA 4QRSB 2OR9L 3RU8L 5F6IC 2WQSA 7FABH 2FO4B 2ZX8A 1ZXKA 2AQNA 3S5YA 2EXYC 2R2HB 3RJDA 4OV5B 2WJ7A 4B9FA 1DLHA 1R3JB 5D4HA 3QHZL 1RU9L 5DFAA 2E6JA 5HJ3B 3FN0H 3VWKA 2YGOA 5DZOA 1N5YH 2J21A 4IU2B 4JB9L 2W8CA 1QPXA 4KQ4L 3EFOA 2PW2B 4GO6B 2WBJB 2IDCA 4WUUD 4LQ1A 3MNDA 1OOAA 3O6FD 1CLZH 2H32H 2EINB 2X53A 3MV7E 3CFJB 5L88H 3F7VB 2XHNA 1KYDA 1E28A 1FI8C 2QKIB 4J3OG 1RXLA 2BDNL 4Z7VF 5DT1L 5HY9A 2BSBA 2JLLA 3D06A 3QCVL 4AKOA 4UTAL 3NIGB 4G42B 5DJZA 3D33A 1W72H 2ZXAA 4FKHA 1KEMH 4IBSA 3QIBB 3JYCA 4FOMA 4X99B 4EUPH 4XVUD 1C5CH 1P7KA 1TJGH 3BP6B 4L4VD 5ADPL 3T3MF 1BX2A 3DIDA 3Q5OA 3EGXA 4TNEA 1DUZB 1RL1A 2W80C 4JO5A 5L7XL 1S7VA 2J6EA 4BHUA 3SOBL 2FJGA 3C5JB 3ELAT 3LYRA 3GMPB 2EJ1A 3DSNA 4HOMA 3GIVA 2UVEA 5C1MB 3MU3A 4B9GA 5GGVL 5D1XD 4AJYV 4FHJA 3QIWA 2ZAHA 1AI1H 4MRBA 3FB7A 1SZNA 1A66A 4BBWA 4H7VA 5C0FA 1YMHB 3KYAA 1ADWA 2W92A 2HLAA 3QB7C 1FLRH 2DQJL 1NMCB 3O4LD 3QW9A 3K81A 3B6SB 3D18A 1BV8A 2VTFA 4ZOAA 3FB5A 2DQUH 5MI0B 2PETA 2FYVA 5IB5B 1IZKA 4GKNB 3ARSA 3GM0A 3PHQB 2KDGA 3K0WA 3CHOA 3RGVD 3GC3A 2GHZA 3ABMB 3KGSA 3T0DA 1GGIH 4OF3A 3UZEA 4H0HB 4FQXB 1ZA6B 4QMEA 3TS8A 4BK5A 32C2A 1SFHA 3AUVA 1TKWA 1UYWL 3MLYL 2JJVA 3RTQB 3ZE0F 3P54A 1INDL 1RIVL 3O8XC 4RWHA 5CEXA 3NQKA 5FYLH 2NLJB 3T4AC 1WAAF 2RJMA 4FFVC 4IM8A 3ZYIA 2X89A 3AGVA 4I0PD 1HXYA 3QFJD 3IXAA 4LF3A 2EUZA 1JGIA 1KTBA 2OK0H 3GSRA 1G84A 3ZL4H 3FOLB 4OZGB 1EAJA 1WD9A 2XXCB 4AEHH 1G7QB 5C07D 1LWJA 1I7ZB 1JPTL 2IFFL 2NYYD 3IDXH 4I3SH 3U6RA 2DWTA 4MNHA 4WNSA 5AOMA 5MENE 5FCUL 2CG9X 3FB6A 4IJ3C 3D85A 2AQSA 5I1KH 1QFWL 3EH1A 4KNSA 1IM3B 5IQ7L 2XKUA 2B20A 3MBWA 4MNGA 1RUML 3CV5A 2ZAGA 4GRLC 4H8UA 1X5MA 3UTPD 2AS5M 3KDMB 5DRNA 1IM9D 4UT9L 5EU3B 4OCRH 3ZDZF 2G5BA 2L3BA 5FK9A 4HPYL 2KKQA 1HHGA 1NCHA 4N4YB 5ERWB 4KKBC 5CGTA 1W9XA 4JLRA 4MD5A 1OD7A 4R4FL 4OI8A 2HX8A 3R4DA 3ILEA 4M8RA 5TE4L 2YOCA 3SZKC 4W9HC 2YA0A 1BYNA 1CDHA 4L8SA 6PCYA 3P69A 1PZCA 4QTFA 3ZL2A 2BSTB 1TQSA 3IDMB 3FO1A 5D5MA 5KEZA 4H0LC 3UTOA 4UDUB 5F1OB 3FO2A 2X9XA 2KZKA 3QJQB 3TBSA 4DGUA 4X5XA 2X9WA 3NIDB 3B8YA 2X28A 4OQTA 4UIMB 1ZOXA 3THML 4B6ZA 2GJPA 4PHXA 4IIQB 3PWJA 1EZSA 1NFDA 2W81C 2IDQA 4KDVA 4QRQB 4AM0Q 5CCKH 3DARA 3ARED 1ROCA 1WAEA 2A74B 3Q5YA 5DC0A 5EU6A 5C0CE 3SKJL 4JN1H 4TS6A 3MVSA 4HQQH 1T5KA 2IBZY 4D0BB 4Z7IA 4X4YB 3OX8B 2P45B 5KSAC 1XAKA 3G5YA 4G82A 1ESOA 1JGLL 5F7DA 5SWSE 3W81A 5E6IB 2FTAA 1FGNH 4JG0H 1QRND 1MRFL 1T2QL 2X10A 2MQGA 4KHXL 1NGZB 3T2NL 3ROOB 1J8SA 4K7PL 3MKGA 4JFEB 4UM8A 2G4EA 3WIFA 4GB9A 1OW0C 3HMWL 2MOGA 5D7EA 1MFDL 2AK1L 5LKNA 5EU5A 5I24A 4CC1A 4D9LH 3MRFA 2YPLD 3TPUA 3IS0X 5JIIA 2ARJB 3L1OL 3AZUA 3SJVD 4FNLH 1L6PA 2R2EB 4Z8FL 1E4JA 3RVTD 4OCNC 2BC4B 1IZJA 3S3BB 4B9PA 3F8UB 3T04D 4U6HA 2P3YA 3BUTA 3WMPA 3MJ9H 3PJLA 5LN4A 2LAAA 2X0VA 4Y1AE 1ZSDA 1U8NB 4HIPA 4PJ5D 4QPEA 2FD6L 1F2QA 3EYFB 2IQAA 1B4LA 1G4RA 1UD8A 1UH3A 2X1PA 1DBMH 4OZFG 4UQ3B 1KNOB 3QPQC 4Q9CA 3TN0C 1W6WA 1CTOA 4BKTC 4LQFL 1NCAL 1ZE3H 2CO2A 3FCSA 5MERA 1A1OA 3GMQA 2B5IC 2I9LB 1D5BB 1CFSA 4CILA 1HH9B 1IAIL 1R5IB 2ENSA 4J3BA 3TO4C 2ITCB 1BVZA 5DFTA 5CD5C 2IOMA 3H7BA 4JZOA 4R96B 1SJXA 2Z7WA 3SGEI 3KVQA 3VFPB 1ACZA 4TVPE 4HJ0C 4HWZA 2LLLA 2GTWA 3PJSB 3BH4A 4OFIA 5HI3C 3QORD 4K7PH 4MJIA 2AVFA 4QAWA 4IRSC 3V52H 2AAAA 4XI5C 4X6BB 1OB1A 2X6CA 4Z7WF 4L3CB 3EBHA 2NZ9D 2HTLD 3MXVL 2E0PA 1HWGB 2K6ZA 1I8KA 5JORA 1WC7A 2XV3A 4GAYB 3T77A 2NUPB 2YD2A 3BE1H 1TZGL 3VWKC 3AT9A 4M00A 4U6TA 3MLUH 4NPJA 5E8EA 1G1YA 3VWJD 1BXAA 1TLMA 5JQIB 3EO0A 5IROD 4LVNB 4U3CA 4H5SA 4BJLA 4EZJA 5DJYB 3QCTL 4ZMXA 1GGTA 2GSIA 4ZW7A 1KCUL 2AQQA 3D8MA 3WN5C 3APNA 1VAHA 5CZVH 4FQJH 2OMTA 5IOKA 3V4LA 2GBUA 5A1AA 2VZUA 3QJSB 1AZUA 3U9UA 3U0PA 1BZQK 3X1EA 5D1XA 5JA9A 1U91A 2E7HA 4YFEA 4BRJA 1YYLL 1OV8A 2BVEA 5AG8A 3S35X 3WUWA 5EF0A 4H25A 5EEYA 3D25A 1ZMYA 1RUQL 2JMRA 3P0GB 5DVMA 1M9SA 3SKNA 4Z7WA 4AG4H 4H26B 3JTTB 2QHRH 3GPEA 2AGJH 5FDWB 2V9RA 3K6SB 5CSGA 4ZQTA 5DJ2B 3PWLB 4YFLI 1DL7L 5SWZE 4NNPH 5ITBL 2GBAA 1TZIA 1YRKA 5K33A 2P43B 3LHPH 3LS5L 5FB8A 2VXQH 2M8XA 4LHJB 3HE7D 4B3VA 1A7PH 3IVKA 2X6MA 1PKQE 3DPBB 1TJXA 4ORGA 3RWCA 1NJ9A 4ZUWA 2EYSA 4P2OB 3DHJA 2OL3B 2XWRA 3CX5J 4E36A 1UGNA 3WXWH 3CZEA 3S7GA 5HVHB 4I88A 4OF6A 3PREA 3KLHC 4KV5E 2VXUH 3MN8A 4HOWA 1FVCA 2FH8A 3CN0A 2NY0C 4EI5A 1KC5H 5G55A 4IU3A 3RGVB 2QPSA 3B1TA 3STZA 5D2LA 4NLHA 4JFOB 3GHBL 4W4OC 4CW1B 3I6LE 3CG8A 5EC1B 3UO8B 1PFCA 4J6IA 2AV1A 3HAEA 1U8JA 1XR8B 1GW0A 1M6UA 4MQTB 4U1SA 3REWA 4R4BB 4U7SA 3DOIA 4U7MA 3UMTA 4UT6A 2FHBA 3PWVB 4K7FA 5EU7E 3OLDA 3DO7B 5HYIA 1JUFA 2IGTA 3MKKA 4R4FH 1OTUC 1K9TA 4NM4L 2WJ5A 4BIKA 2DLFL 4F80A 1NCCL 4XZ4A 1UXSA 3L4ZA 4FI8A 3SD2A 3T1FB 1N10A 4MXQC 5CP7A 2CO4A 1LYQA 4LCWE 3ARGA 1MLCB 5HPOA 4GT0A 4BXVA 2WXGA 4G7YH 2Z31D 2C7UB 4CDHA 1YA5A 2H0JA 4J4PA 1I4FA 5DA0B 1NPJA 4WWKD 3ZJAA 3H9SD 5FOBA 3N3EA 4XMTA 2AQTA 2QELA 4X0KB 2VXSH 3V0DA 2CE6A 2F5AH 1RIHL 2PW1A 3GBLA 3O2VH 4P9HC 2VZVA 3SCMD 4NKMB 1OAXH 3ATAA 3QDMD 3MJ6A 5HHME 4CMHB 5KSVB 5KN5B 1QLRA 2MEJB 2NX5E 3DKHA 3HE6B 4QOKD 2PR4L 1OPOA 4B60A 4NHCH 1QASA 5EBMA 5IQOA 5FV1L 3WFDH 4OCWH 4YR6A 2Z64C 1KXQA 1T7VA 2HA1A 4N0UA 1DVQA 2Z8SA 1CF1A 2Y4SA 3P4OB 2R7EA 4JFXB 4FXGA 2PLTA 3SBQA 3QAZC 3ZOAA 3VH8G 2H0EA 3PE9A 4Z0BH 3CN4A 3MV01 4L3EA 4FXGC 1N6QH 1HK6A 4Z8FH 1Z9SA 2YMOA 1LD9B 3NG5A 2OSYA 3GSWB 3LH8A 4PRIA 2GTZB 4CAGA 2YUZA 2VLRB 4D9LL 2AJVH 1YMME 4PYHA 1CDCA 1UUSA 3SKUD 4KJPC 5DYOB 1WPCA 4PJXE 1OGTA 1WFIA 1AR1D 5T5NG 3VFSB 3GLDA 3EO1B 4KKZA 1FL5A 5DVLA 2WO4A 4NT6A 5DEGA 2FDBP 3VFRA 4DT2A 5MENA 2IH9A 3KPRE 5D8JH 4P5KA 4OGXH 4J6RH 3IE4A 2G9KA 4TLSA 5GS0L 2RIKA 1VZIA 4KXBA 1EGJA 5DD5L 4QGTA 1E5ZA 4BE6A 7TAAA 4G7RB 1G6RB 4B5EA 1CFVL 1JXDA 4PGEA 4KDWA 4HUWB 1UZ6F 3Q6GH 5K39B 1JPSH 2C9QA 5IB1A 3IKCB 4I8DA 3VFMA 3VYOA 2AJZA 3RWIA 1I53A 1GGBH 2AJ3B 4PV1C 4NFBA 3QS2A 1VACB 3MYJA 1AGEB 4NENA 4IMLA 2M1KA 2CWRA 2VUKA 1THCA 5KVFL 2JKTM 4YO0B 2MTPA 4A7GA 4ETYA 3ETBF 3FQWB 1KIRA 2ATKB 4PPTA 3VD9A 3GXTA 4P5RA 2DMKA 4WTWA 5F0JB 3A3YB 5JIMA 2J4WL 2J2ZB 1II4E 3G3LA 4LVHC 5TD4A 2YD6A 3LY6A 4LLWA 4CVZA 2CNZA 3DMMD 4AX3A 1J0HA 2GBTA 2WXFA 5EHFA 1OP5K 1F45A 4S1DC 2F9BT 2FBJH 1QEWB 5KS9E 3CFCL 4XAWH 4P5SA 3QQ3B 3ARWA 4GS7B 4YDKL 2C4FT 4AE0A 4GG8A 3HVNA 3WTTA 1KZYA 2C9RA 1E4XL 3KPSB 4KUCF 4JO1H 3UGEA 4WHCA 1CYWA 5JZ7D 3PYCA 1E7VA 2DEWX 1XB8A 3TBCA 4NHUB 3K71A 1FF5A 3U9PH 5FUZH 3CX5K 4XXDA 2NY6D 1M9WA 3ARYA 5B8CC 4HD5A 2NY2C 5F72S 1EZUA 1QTYT 1CPUA 5IWLC 2VN3A 3C87A 3ARFA 1H3UA 2JB6A 4OLXH 5AVZB 3S3SA 3WS3A 1SYSA 1VFAB 4TUOA 4XNYL 3KYOA 3I2CH 4NKDB 5JTWA 1KPUA 4Q6IA 4GUCA 4AUJA 3QA3A 1IILE 4WFGD 4WK0B 4X2UA 1HXKA 2OCCB 1TFPA 4JY6A 1KDJA 2CBQA 2E76C 2FX7L 3BQUD 5IREA 3JTSA 5GS0D 3R06B 3BH8A 1FNLA 4I9WE 1K8DB 1UOVA 2EEFA 4FNUA 1EX0A 3S4SB 4LB8A 1QFPA 2DL2A 4WO4A 4YDJA 5B38G 4HH9B 2FATH 2VR6A 3QCUL 5B1KA 1V3LA 4G5AA 3O3DA 2FECI 3QNZB 1CFQA 5D7SL 3IMBA 3WKMH 4PJ5B 4PGZA 1X5FA 1IGIH 1JXJA 1Y6MR 4CJ0A 1YNLL 3EJZC 4DN3H 3VXRB 2RAMA 3GTTA 1TJHH 1WZKA 2NY6C 3IJYA 3TESA 4U1MA 4ZUSA 1UJ3A 3N9GH 3T6XA 4GRLA 1JPFB 2F54A 2E3VA 4AZ8B 2ESVB 3DVFA 4JJHA 1CLCA 3LXCA 1JV5A 5DVNA 4IOFC 3VXRD 2W0LA 1AMYA 5T3XL 2VJ0A 2HJKA 2OMUA 1SXNA 3WN5A 2KUTA 4MX7A 1EDYA 4XNMA 4NQVB 5T1LB 5AWNH 3WHE1 5F0PB 1BAFL 1CB4A 2WKGA 3RG1C 2BZ7A 5C0EB 1J9QA 3HHSB 3B9KC 3L6FA 3SBWA 3B9VA 3A6BL 1SOXA 4XH2A 5A2AA 4W9DC 3MGTB 1SJMA 3NZSA 4G7VL 3SGEH 1ACYL 2V6HA 2ITDB 5DEFA 5FO8A 3E3QC 5F7HA 1FH2A 2ED8A 1JHLH 4F3FA 4N0RA 1EAPA 4MHHI 4FNPA 5ICYB 1R0AL 3O45B 4PV8B 5KTEL 1A22B 1I7UB 5I30L 1NWPA 5D6DA 1YEGH 1X5LA 1FNEB 2XZAL 4PSPA 2EIKB 4E9LA 1F8TH 4RMQA 2XPYA 2R9HC 4M6AA 5EO9A 1HXMB 5FA4A 4Z7NE 1BM3H 1S7QB 2P44B 1VFBA 3A23A 3N0AA 1I1FA 2VXVH 3I02A 3MFGB 4HU8A 4U1GB 4H8WL 4LCCB 3X12A 2FJHA 1RUQH 4OJYA 1S7TB 2NXYD 4LCCA 1M57B 3UABA 4AGLA 1PTZA 4L4TB 1KCRL 5HHPA 1N26A 3WNKA 1VFBB 3QEQB 1N7MH 3DURB 3CXDL 2Y06H 3HN8A 1I1AC 1YNKH 2WK2A 2MHAB 4HCIA 1SPDA 2RQ8A 4Z3EA 1MN4A 4JPSA 3TO2B 4UQ9A 3ETTA 3VSUA 1H3XA 1YUKB 3NJIA 5C0DA 4BH8B 4KXZH 3ZMRA 1R5WA 2ITDA 3BSZH 5IFHH 3LRLA 4MZ2A 2KMWA 3WMQA 4PP1C 3IFNL 2I60H 1IM3D 1U58B 4P46C 3UCRA 4PJBB 3MGOB 4AW7A 3MACL 4CVXA 4KZCA 2R1YA 4XH2B 4GSDH 3VI4F 4DP0X 3ILQC 1U8CA 4LSVH 4QHMA 1VIWA 2AEOA 1MHCA 4XCNB 4KMTL 4KVNH 3S9DB 2ZYHA 1FRGH 2O5XH 4XNMB 3M17A 3K2UH 5IVZB 1CURA 3W2DH 4N5ED 3NIFF 5HHQA 1XF5A 4BRVA 5BS0D 4CN1A 5LNDA 1OPGH 1T22A 1MAML 4AZ8A 5E4IA 1LO3L 5ECGA 5JHDB 3II2A 4GRLB 1XGYL 1NCIA 5A40E 3HC0B 1QRNE 2Y5TA 2YFOA 4R7NA 2WKOA 4A68A 5JHDD 2C4XA 2CCVA 2Z0BA 2AXGA 1PNDA 4ZAKD 3ZHKA 1S2EA 1I75A 4F1SA 1KELL 4FTVE 3R06A 2ZNWA 1AJ7L 3WO4C 3CU7A 2IWGA 1OP5H 2VM9A 4G7YL 4JY6B 3U30B 3HRZB 3QDGE 4YC2B 4EQ2A 4LEXL 3SJVE 4GSXA 3GXDA 3QK0A 4N2LA 2ICWJ 4CJ1A 1JTOA 3LZQA 5IB3B 1A1NB 1YHPA 2TAAA 5ABDE 5IFAL 3HFML 4JDEB 4G6JH 1RHHB 2JB6B 3LZLA 1D7BA 2HRPL 1JP5A 4GW1A 1N0LB 4PWEA 2W9DH 3KCWA 5FLUA 4G8GA 1IE4A 1JL8A 5E00A 1LQSR 3P0YL 1SVZA 2Z8RA 4X4MA 5JLZB 3IXTB 3IAQA 1TQCB 4NHUA 2IH1B 4L9LC 4NNXA 3IJSB 3PL6D 6TAAA 4F7TA 4RSYA 4ZRGA 4M61A 1CGUA 5F1NA 2BLFA 2EEXA 5JQHC 1MUJA 1X5KA 1TTCA 2YOAA 3SBPA 5IQMA 5JMOC 5GIRA 4WGVB 4PWJA 1GPOH 4P2RE 2XICA 1U4EA 1NAKL 4MZIA 1GYCA 4QXGL 4HWEL 1AAJA 3QFDB 2JJWA 3WY4A 3FCTA 4UT6H 4ELKB 2LU5A 1JGVL 4YO0A 4FQQB 5IP4A 3MRLB 3TNNA 5IKCA 2TRYA 2AXJA 2BH0A 2PXYC 2QTVA 2W91A 3TJEL 2R51A 3GMNA 3MRJA 1KPVA 2D31A 3UC0H 3D0VA 5FHAH 2AJ3A 4W70A 4TULL 4JY4B 3O9WB 5D1QE 4YWGH 1LK2B 2VDPL 4JHZA 4CU6A 5BS0A 1MWAA 1NDMA 4FYTA 5K39A 5IHBA 2G2NA 3LAFA 3PFQA 3WXVH 2HFEB 2IWKA 2XV2A 3A6CL 3BQUA 1ZLEA 3RWHB 3VD1A 1JNNH 2HKHL 3QUHA 3QUYB 3I9IA 5GGRA 5JUEL 2AEQL 3HUJF 3QUMA 1T89C 2FBRA 3BT2H 1WISA 4AVHA 5A6IA 3F85A 4U4BA 2MTAA 4ODWB 2VDOL 3GKWL 1VERA 5BS0E 3ROLB 5JDSB 5ALCL 4JM2C 4IHOA 3UG5A 2AEPL 1DVFB