2FE0A

Nmr structure of smp-1 (small myristoylated protein) from leishmania major
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
131
structure length
131
Chain Sequence
MGCGASSENSSVTYVNGRPTFVGEEVTKGFEKDNGLLFRIVNKKKKQWAYYNDTTQYEMHVLVTFNEDCDIKALGKTKLEQQENGEWVASVVVYPCETEMFIEGRVNGFKSKMDALPLSEEYRQHQAEKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport, membrane protein
molecule keywords small myristoylated protein 1
publication title Function, membrane targetting and structure of SMP-1
rcsb
source organism Leishmania major
total genus 15
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09149 DUF1935 Domain of unknown function (DUF1935)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fe0A01
4B9YA 3BMWA 2GVYA 2WSPA 1QX1A 1QWUA 2DH2A 1IZKA 2V3EA 2WVTA 4HA1A 2CHNA 2CPUA 3EDDA 2VUYA 2ZUWA 4J3UA 3FAXA 1H3GA 3BAKA 3BUBA 3VM7A 4U2YA 1KWGA 4TVUA 5TD4A 3L4VA 3WDJA 3QGVA 1PIFA 1PPIA 4FNPA 3BAYA 4WSKA 3KL5A 2E4TA 1NOFA 2F1AA 4JFTA 1TCMA 1JF6A 2F1BA 4J3VA 1QI5A 4LXFA 3L4ZA 1EH9A 2D73A 1BPLB 1TQVA 1MXDA 3EJUA 1RP9A 4CGTA 3BAJA 1S46A 5HPOA 2QPUA 4CVWA 4JFSA 1CGYA 3S5ZA 1UH4A 1MW3A 1EHAA 3GBDA 1CGVA 3BVVA 4OJYA 4UOZA 1KXTA 1KGUA 4LPCA 4H7VA 4E2OA 4WLCA 1E3ZA 2FH8A 1V3MA 3BH4A 4PSRA 1JI1A 1OGSA 4H8VA 1XD1A 4J3TA 3L4TA 3TTSA 4UQAA 5A2BA 1UKTA 3BUIA 4J3XA 3CZKA 3BCFA 1BG9A 2EEXA 2FYVA 2PWDA 1JF5A 5A6LA 1DHKA 5CXPA 4HOZA 2E8ZA 1Y7VA 2F2HA 1QI4A 4MAZA 3IJ9A 4BZYA 3BVTA 3A6OA 4AYSA 1OSEA 4AMXA 1LWHA 2WVVB 1XD0A 5E6ZA 4JFUA 1CXLA 1XH1A 1J0HA 3UG5A 2FE0A 1I75A 3FW6A 1KCLA 3BCDA 1TQTA 2F7PA 4JCLA 2BXYA 2DH3A 3IGUA 4NI3A 1VFUA 1BSIA 3AMKA 1BVZA 2BY2A 1KGXA 1HWWA 1HNYA 2F7OA 2ZX5A 3DDFA 3LRLA 4UQDA 4W93A 2YIHA 5HXMA 2WC7A 2ZXDA 1R75A 3IK2A 3S2CA 3DX1A 2X2HA 1TQUA 1P6WA 3WELA 1WE5A 1R34A 3VGHA 1GJUA 1RP8A 2QMKA 3CZEA 4J3SA 1AQMA 2WPGA 4GI9A 4JCMA 3VGGA 2CXGA 1CXEA 3BVXA 3GBEA 5I24A 1U33A 2EO7A 1QHOA 4JFWA 2D3LA 1G94A 3L2LA 3D4YA 3GXPA 4X0NA 4WSJA 3WY2A 1E3XA 3RIKA 2ZWZA 3OLDA 3OLEA 3HG2A 1JGIA 1WZKA 2BHUA 3D51A 1CDGA 1OT2A 2C7FA 4PSPA 3EJPA 2PWEA 4FLSA 4CKQA 1JDAA 2BY1A 3A23A 4JFVA 1JFHA 3BUDA 3EDJA 3DX4A 5KEZA 2J25A 1M53A 1E43A 3BSGA 2EJ1A 3VMPA 4M8UA 3DHPA 3CZGA 3DDGA 2XVKA 4NX0A 1UD6A 4U31A 1IZJA 2XN1A 1HT6A 3EDEA 5E1QA 1W9XA 4FNSA 1OT1A 1CIUA 5E0FA 1C8QA 3TONA 1CLVA 1QPKA 2ZUUA 2OYKA 2ZX8A 1XSIA 3H53A 3BSHA 3HG5A 4NXKA 2E8YA 5CLWA 3LXBA 1EO7A 3GXNA 3EJTA 1E40A 2QV4A 3WNOA 1ZJBA 2YFOA 4U2ZA 1VFOA 4FNRA 5BRPA 3LXCA 1VAHA 2F7RA 1OB0A 1EO5A 5EMYA 4CN6A 1AMYA 3IJ8A 4FLQA 1MWOA 3WDHA 4AEFA 2EAEA 3A24A 1M7XA 2XWDA 4PCTA 1KTCA 1UOKA 3WEMA 4DO5A 4UQEA 4UOQA 5DO8A 1QI3A 2G3NA 7CGTA 5BRQA 3S5YA 2F61A 3CTTA 1KXHA 4HOXA 5A2AA 1UD8A 3K8LA 4AIEA 2PWGA 2FHFA 1XSJA 3CLWA 3DHUA 4MB1A 5HDRA 2ZXBA 3GXFA 3WN6A 1U2YA 3LXAA 3AJ7A 5F7UA 4GQQA 1GJWA 4AIOA 1PAMA 2NT0A 4KMQA 4GINA 3LRKA 4OKDA 2WVSA 5A2CA 3K8MA 4DO6A 2XN2A 4M56A 3WDIA 1KB3A 1G5AA 1T0OA 5CGTA 4U3CA 2ZIDA 1CPUA 2XWEA 1QWNA 1UKQA 1HVXA 1CXHA 1SMDA 3VGDA 3A47A 4BA0A 4FMVA 1QW8A 3WFZA 3M07A 1D3CA 1KXVA 3FAWA 3BVWA 3VGBA 4LQ1A 3ZT6A 2ALWA 1BAGA 2ZUTA 1KTBA 2WCGA 4H2CA 4J7RA 3RILA 3ECQA 3WY1A 3VSUA 1G9HA 3GXTA 3UG3A 3D52A 1ZJAA 3II1A 3HJEA 5DFAA 3VNZA 3WY3A 1KGWA 2Z1KA 5CLTA 1WZMA 1ZS2A 4OGZA 1PZ2A 3K8KA 2OYMA 4U33A 4HP5A 1JDCA 1UD3A 2ZUSA 5I5RA 2EADA 4GI6A 3BUQA 2BY0A 3OLIA 3VO0A 3A4AA 1JI2A 3EJRA 4GIAA 3VMNA 2FH6A 3BC9A 3BAWA 3W37A 1VFMA 3VSVA 3CZSA 2BHZA 4FNQA 3ZOAA 3UEQA 1V3LA 1KCKA 3BLPX 2YA1A 1XH0A 2OSYA 2QMJA 3BUPA 2OW6A 1UD4A 1JIBA 1XH2A 1EA9C 2ZWYA 1BF2A 1MW2A 4AW7A 1UA7A 1UH2A 4FLOA 4UCFA 4X9YA 3ZT7A 1UA3A 1CGUA 1JD7A 2TAAA 1XSKA 2YJQA 3TTYA 3CZLA 3H54A 3ZQ9A 4HPHA 1XGZA 3EDKA 2ZX6A 4UZUA 3VM5A 3W38A 1HX0A 2GJRA 1MFUA 3KE0A 2BXZA 1JDDA 2PWHA 1PEZA 3CC1A 2E0PA 1JD9A 1TQSA 3GXDA 4J28A 4QAWA 1DTUA 3EJQA 1CXKA 2WVVA 3AMLA 3L4XA 2IGTA 3HG3A 1J0JA 1MXGA 1J0IA 3KL3A 1KXQA 1NM9A 2Y5EA 4PEEA 3KLLA 2GUYA 3VU2A 1TMQA 1UASA 2VT0A 1SZNA 3UCQA 3VX0A 4PCSA 2VRQA 2Y24A 1JAEA 2D2OA 1G1YA 2BHYA 4GO8A 1R46A 6CGTA 1JXKA 2EQDA 1UD5A 1JG9A 2XVLA 3D4ZA 4NZFA 3WNNA 2WSKA 1HTYA 1MW1A 4NZJA 2WKLA 3WNPA 3AXHA 1WO2A 3CGTA 1UKSA 1BVNP 1QW9A 3EDFA 3L4WA 3KEHA 1CGTA 2EABA 2F18A 5E70A 1B2YA 3BLBA 4UQBA 1GCYA 3CPUA 2Y4SA 3EJSA 2G3MA 3ZO9A 3DX2A 3HZ3A 3GXMA 1O7DC 4XB3A 2FGZA 3ZSSA 2ZXAA 2D3NA 1R47A 1PZ3A 3WY4A 4UQCA 3VGEA 4HOWA 1TQWA 2OSXA 2XN0A 1R33A 4FNUA 1WZAA 4CN4A 3ZR6A 2WANA 3ZR5A 1KBKA 3A22A 3DX0A 3ZT5A 3VGFA 4WF7A 1D7FA 2PWFA 4JL2A 4DO4A 2ZUVA 6TAAA 4J3WA 2C8NA 8CGTA 1ODUA 1PIGA 3DC0A 1WP6A 1UD2A 2NT1A 3D50A 3WMSA 1DEDA 3TV8A 3OLGA 4CN1A 1HXKA 2YA2A 3BVUA 2VR5A 2D0HA 3BAXA 3KLKA 4NXSA 3WNKA 3A21A 2Y2WA 2ZXQA 3LPPA 1XV8A 1IV8A 3KL0A 5I0DA 2ZE0A 3GTNA 1PS3A 3VX1A 3UERA 2EACA 2OW7A 1AQHA 2AMGA 3CZNA 3K1DA 3BLKA 1MW0A 1KBBA 2GJPA 2X2IA 4FNTA 2BY3A 4AMWA 4UNIA 2FHCA 5A6MA 1RPKA 2AAAA 4UZSA 4AYGA 2D0GA 3BAIA 4ATWA 3H55A 2X2JA 4H8HA 1CXIA 4GO9A 2OYLA 2OSWA 1U30A 1WPCA 1AVAA 1VIWA 2WVUA 2VNCA 4AEEA 1WZLA 1B0IA 1A47A 3L4YA 1CYGA 3L4UA 3LX9A 3AXIA 4OIFA 2V3FA 3VMOA 3WNLA 4B9ZA 3WENA 1XCXA 1CGXA 1VB9A 4GKLA 4JL1A 2YKKA 5I23A 2D0FA 1BLIA 3A5VA 9CGTA 2WNWA 1LWJA 3L2MA 4FLRA 1JXJA 1L0PA 2ZX7A 2XIIA 5E9AA 2YA0A 1J0KA 2WKGA 7TAAA 3DX3A 1CGWA 4KWUA 2ZICA 1MFVA 1QHPA 2DIEA 1CXFA 2QLYA 1HL8A 1V3JA 3VSTA 3UG4A 2XVGA 3CV5A 2YFNA 2F7QA 2V3DA 1Q4NX 1UH3A 1XCWA 5CGMA 1HL9A 1Z32X 4GI8A 3WNMA 1JL8A 3LRMA 2WCSA 4GQRA 1V3KA 1SMAA 3KWXA 3WEOA 1KWKA 2ZX9A 1PJ9A 4UQ9A 2E9BA 3VNYA 3HG4A 4H8UA 3TOPA 2DIJA 2XIBA 2FHBA 1GVIA 3BMVA 3GXIA 5E6YA 2VRKA 3IJ7A 4J27A 2QPSA 3LPOA 1MVYA 3MI6A 3ZSTA 2YOCA 1VJSA 2NSXA
chains in the Genus database with same CATH superfamily
1AQDB 4OZFH 4JFZL 1QRNA 3VG0H 5E99L 3FNKA 4HC1A 4F7MA 4EBQL 3CVHH 4K8RC 3D2UB 3NTCL 1IEAB 2HVKB 3W0WA 5CZXD 5C8JB 3HE6D 3L6FA 2HSIA 4L4VA 4KKNA 1H15B 2WKOA 2X89A 4JFEB 4Y4KB 4K3GA 4APQA 3AQXA 1WGOA 1IGIH 4ODXA 4W9HC 5GGRB 5IW6A 1T03H 1AHWC 4CMHC 1FZMB 5GZNA 4OZHA 3NFPB 4NOBA 3GSNB 1K6QL 1RZJC 3IDMA 3VXTA 4BFOA 5HI3D 4GAGL 5IHBA 1S46A 2IWKA 1DLHA 2C7UB 3MLUH 5KOMC 3OAUL 1DQJB 2FGWH 2WLLB 1DO6A 4IBQA 1NKGA 1II4E 1WZ1L 3BH9B 3WKQA 4PJIF 4D0BB 5BUAA 4ZMOA 1D5XA 4FYQA 1T5WB 1U3ZA 2DQHH 3KPNA 1F3DJ 3CU1A 1TYRA 3P11H 1SOQA 2O6PA 5GGUA 1XB3A 2QR0A 2HPTA 4AGPA 3C60C 4PJIB 1DANT 5T1LA 4Y16D 1YEWA 2Z7UA 1JWUA 1BZOA 4KV5E 2BK8A 2WWKT 2MH4A 4LMQI 5AW6B 4OCXL 3BCFA 3KPSB 5HD8D 4WO0A 3ELAT 3I9GH 4LNRB 4DGVL 2P8MA 3UBFA 2VN3A 4FA7B 1AHMA 4QUOA 4LRIA 1NC2B 4DEPB 1OZTG 2F1EA 1XSOA 4BZYA 1LMIA 1T0NB 2ZYSA 3MSPA 3TT3L 3UZEC 4I3RL 3ML9A 3SDAC 1FVDB 4L9DA 2AEIT 3MFFB 2RAMA 1GYAA 2NY0C 4EOWL 4J6RL 1BBDL 2WXLA 4JCLA 1NIBA 2CSPA 2K9UA 1NBYB 5FYKU 5I1DB 5I1AB 4DGIH 3GHEL 3GRWA 5GHWL 3PWUA 1E5UI 4QI3A 4UOJA 1JN6B 2WB7A 3O0RH 4JDZA 4NUGL 1X5GA 2VDQL 3F7KA 1TQUA 1TIUA 3V79C 4MXQD 3TYGH 3Q5OA 1IM9B 4YSEA 5ESVA 1ZTXH 1IAMA 1U8MB 2FYYA 2JCCA 2XNAB 1CVSC 1AXSA 2A99A 3F7LA 4HS8L 3IE9A 4XP1H 2WZPD 1B2WH 2J88L 1QHOA 4JFWA 1A5FL 1E9OA 4PTTA 3F7RA 5C92A 4JAMA 2VJ8A 1IM3D 2VDKL 1YN7A 2PW2A 2BJMH 2G5RA 2KC0A 3QNZB 4ODTL 5L4FA 3V7AG 5DUPL 4QTHA 4R2GB 1DJSA 1RZ7H 4H0IA 3NIGE 4NKIL 4PSPA 3SQOL 1Z6JT 4X98B 3TWCL 3FQ2A 2IIJA 5A6IA 1X5LA 4H0HB 3CDYA 5AVWB 1OTTD 3QUZB 2ADIA 4EKJA 2AQNA 5E8DH 1ONQB 1S78D 3OKKA 3VFSB 1LEIB 1A3QA 2K7PA 2OV0A 3S5LA 1U0QA 3FT3A 4AJ0A 4ZTPH 1INEH 5JHLH 2X1PA 3L5JA 4AIZA 3IDXL 4JKKA 5CGYC 5E1QA 5I1IL 2CUHA 3WFEL 5FWRA 2CUIA 4Y5YA 4HBCH 3TLRA 5MEQA 4PJCA 3VXRE 4JY4B 3LYRA 4KJYA 2ZAGA 2ZUUA 5E6SB 4YSQA 2EIKB 2MOVA 1FPTL 1KIUA 4UINL 2CKBH 5C0AB 2E7DA 1UM4L 2KPWA 1DQMH 1VAHA 2F7RA 1CF8H 3UJTL 4XVSL 3GPEA 2GHWB 2J7LA 4JGMA 5B1JA 5BRZE 3JWDC 3WGVB 5EEYA 4I87A 2XWDA 4M7ZB 5JA9A 2B4CH 2IANA 3C5ZD 3MJ6A 4PGBA 1A02N 4HJJL 3RNQB 2B3IA 1GCFA 4ZUSA 4Z7UB 3APDA 1I7ZA 5BRQA 3S5YA 2KZWA 4M62L 3S96A 1KPRB 1KXHA 3FQNA 3S4SG 1I8AA 2VM9A 4UU9B 5DVKA 1NSNH 3A4EA 3CFCH 4N8CL 4GXUM 2CMRH 4MB1A 4PP2B 3I50L 4XP9H 3WS6A 4CSZA 3KPRB 2VXTH 3PV7A 1G0XA 5I74B 2R2HA 1AGFB 1GA2A 4PLOB 4KKBD 3RDTD 3IGKA 4WEUD 4KZEL 3APMA 4I0KA 3T6XA 2UWEF 3HS8A 2VSDA 1OAXL 3NQIA 4FG0A 4N4YB 3V9CA 4WTXA 3VXMA 3Q8CA 3VFRA 3UO1H 3L3IB 1MCPH 1I9IH 1CLZL 2UWEB 5BJTA 4KQ0A 2IGFL 1LP9B 5F7BA 1ZHKB 2KLTA 3NCCB 3QDGA 4LLQA 4LLDA 4NO5B 3TBSA 4IIQC 4HCRH 1JK8B 1DEEB 3RPIA 4DUWA 4G83A 1FN4B 2WCGA 4HIHB 3RWCA 3VI4F 3C75A 4PYGA 1PX8A 4H2CA 4P57B 2OJZH 5JIKA 4IU2A 4C56B 1QG3A 1SYSA 5I0VA 1JP5A 3VI4B 1XGQA 2PR4L 4NQCB 5FW8A 5E56A 2G60L 3NDZE 3HZMB 5E1AB 3CVCA 2X7LB 4HKZA 4OV6F 4EJ1C 3QH3A 5D2NA 2X0UA 5IREA 1IAKA 2ZP9A 2V7NA 2OMZA 3ZYZA 4M5YL 4P2OC 4BH7A 2ED8A 1LL1A 1K2DA 1T1YA 2DWDB 2D7MA 4K71B 5KSVA 4AKPA 3WLBA 2YJLA 3WD5L 4ICWA 3UTTE 1SXCA 2D03L 2YMXL 4U6XB 4X7CC 4ZFOL 1TSRA 3IJSB 3JQOB 4LFHD 2WQWA 4ODVL 4DP6X 1UH2A 2PCYA 4E9WA 3PDOB 1A1NB 4KXAA 5F8RC 3KD4A 4JPIB 5EPMB 5SWSA 5EV7A 1KYOK 1P7QB 3QG6B 4TVPE 3V0JA 3TTYA 1EZSA 1KT2A 1J1XL 1E27B 3KR3L 4UZUA 1FYTE 4X7TA 2XWBB 1M2OA 1WAEA 5AZ2L 2FLBT 2W9LA 3FB7B 3GSNH 1MIEL 2VLJB 1EGJH 3T4AA 3P3UA 4UTAH 1KPUB 1G9NL 1Q0YH 3MJGX 3WTUA 1JD9A 4N2LA 1ZMYA 2B77A 2EE9A 4XP5L 3FH5A 3T0VA 4FQXA 2VH5H 3FUJA 2YUXA 2AABL 1IC0A 3WIFB 4BRVA 3W5MA 1PAZA 1FHNA 4Q8BA 2JKSA 5HBBA 4JDEA 2OFQA 4Q58C 4Z7NF 4N25A 1OK0A 2Y36H 1KEGH 4EZMA 3LZFL 5JMOC 2WIMA 4Z7NB 1M3JA 1NIDA 5CKGA 1DLFL 3FU3A 5F6HJ 3M7FB 2WXFA 3HPJB 4UOW1 1LO5B 1QNZH 2HZHA 2N1KA 1JAEA 1MHEB 1G1YA 3MRPB 1N7ML 3GQFA 1KTKE 3AWGA 3WFHA 5J8OA 3UTSD 5D7SH 4V2BA 1JCKA 4O5LL 1VGKB 5IBTL 5I18L 8FABA 1W0VB 3AXHA 5IFHL 2CM6A 4XT1C 3FO9B 1BVNP 1AQ8A 1A3RH 3FB8B 2EABA 3AG3B 4WI0B 1B2YA 3D25A 4PBVC 3W11D 3ZE0F 1SHXA 4ZMWA 3IMVA 2NTFB 3RRQA 2DL2A 1KG0B 1N5AA 3OPZL 4RMBA 4IRJA 3WJMB 5LNGA 1BYPA 4G6KL 4PJAE 3ZE0B 3RPBA 2VMJA 4M7JL 1TVDA 4HUVA 1I85A 4HD5A 3W5NA 1UCBL 3VGEA 3PQYA 2P5WD 5DC4B 3RG1C 4KZCA 2BP8A 4OD2A 2B59B 4L1LA 4MAYD 4NN5B 1OGPA 4U7SA 4NBZB 2P8LA 4K5LA 3V52H 2EYSA 2VR3A 1MREH 4JL2A 5FCUH 4EMZA 3I6LE 5BVJA 5CJXA 1ZOXA 1I1RA 2FL5A 3D8MA 3K3QA 5F89A 5T5FL 5C07A 1CD0A 5IQMA 1ET7A 3OGCA 2EEBA 3BGAA 3P73B 2GBAA 3ARVA 3UEZA 2WTOA 1EXGA 1E4XL 2B2XH 5FX3A 1PZDA 4B9IA 5J89A 1A2YB 1EEUA 2F53E 2XKNA 2DI7A 2R29L 2N0KA 2YA2A 1S5HB 4ONGL 4P5TD 2PTTA 5D7JD 3IMWA 3N3EA 1JWSA 4BZ2L 1XX9C 2D0HA 4PJEA 4JUSA 5FFOA 3WNKA 3Q9QA 4NQEE 3SKNA 2HFEB 4PWJA 1NOAA 4JRXA 1P1VA 2XXFA 4XVOA 1DQQA 1RVFH 1T1WA 1YEDA 2CR3A 1D5IL 3KJ4B 3OKNB 4LIQE 1OAKH 3UERA 3WL9B 3WLWD 2JIXD 2E47A 2Z8WC 3ETSA 3R06B 7FABL 4OJFL 1JZ4A 4TRPH 4YSTA 5LBSH 3HUJF 5E9NA 5JQIB 1SLUA 3EYQD 1ESOA 5E4EB 4TPRL 1UA6L 1U36A 3EHBB 1B0GB 3F6IA 3BIBX 3FB5A 4B5EA 3EYUH 3HUJB 3SJVB 3T8VA 3D18A 1DL7L 4Y2DD 4U1MA 4KRNA 3L3JB 4B9GA 3TZVA 1LDPL 4G8EA 4R4FH 1JGUH 1GOFA 3UYRL 4TLKA 3SODB 1VIWA 1U58B 2AQSA 1CLCA 3ABZA 1IL1B 3TH4T 4EI5D 4LLVB 1E2ZA 1U8IB 2DBLL 4MNGB 3QQ3B 4LP4A 2AXGB 5FK9B 2LU3A 3WNLA 4AUUA 4F2EA 4F8QA 1NMAH 2C9UA 3D39A 3ETBF 4V1DE 1XCXA 1ZT1B 1H3WM 2VR4A 3SDYH 1A6VH 1DVXA 3HNTL 2WNWA 4QRTB 4FLRA 5A7EA 3U4AA 1R5IB 2QVKA 2ZICA 3MRNB 3PAZA 2A6DB 3GZPA 4FTVE 4D8OA 1TTUA 3U4BL 1YEKL 1IC1A 4EF3A 1KDJA 4P9HH 5AOIA 2VDOL 1PG7H 5GZOA 1RKRA 1Q0XH 3F01A 3QQXA 2O5ZH 2NNAB 4FEMA 1I8KB 4X7SH 1AXIB 3W39A 1J48A 4NSKA 4ZW3A 1VGEL 1ET8A 4NENA 1BLNA 1KTDA 2R23B 1RK1A 3IDUA 3PHOB 4K3DL 4NPKA 3O4LB 2DLIA 2G2PA 4BUQA 3L7FA 4HAGA 4Y1AE 2VRKA 4PS8A 4ZSOB 4N0YH 2GUOA 4L5FE 4F9PC 2EUXA 2HP4A 2R2EB 3UXFA 2FATL 1QFUH 4Y5VB 2APTA 4U4BA 3QEUA 1CU4H 4U1IA 2BOCA 3MNWA 4HA1A 4K5NA 4M1GH 2ZUWA 2J4WH 1BJ1J 1H3GA 3T1FB 5DK2A 3OHXA 3QIUC 4TNFA 1IGJA 3KL5A 5K59E 4OJEH 1W0YT 4H26A 1TCMA 3EZJB 5B21A 1YY9C 4BCYA 1Y0LA 1IFGA 3K71A 4WV1C 1PG7X 3V2AR 3SGEI 3NYKA 2Z31B 2CRMA 4NM8L 3EJUA 4I1PA 3IXTB 1KGIA 1EZVY 2W91A 2YC1A 1PD0A 2JQAA 1B6DA 1NCUA 4OVUA 4WTZG 4I0PA 1HCYA 2AEPL 1QTYT 2NY6B 3E2HB 1DVTA 3OL2A 2V2XA 3X3GL 3U4EB 2Z93B 2GCYB 1CICB 3KGRA 3GHBL 3RUGF 3UDWC 1ZLEA 4G42B 4QXUL 1IGFL 3S2AA 4PY8I 5IV2A 3C8KB 1WS8A 2X4NA 3H3PL 5C6WH 1OOWA 2D7NA 3RUGB 3ZDZF 5EA0H 2M83A 3ZVVA 4TN9A 1BG9A 3GLDA 2FEEL 2QVFB 5E8OB 2FYVA 3MUZ1 4LVEA 3HG0A 5TPWH 3TBWA 3NMEA 5A6LA 3FOMA 2J8UE 3ZDZB 1OPGL 4HS6B 2QZQA 2UY7A 3P1VA 4IK6A 4PRHB 2V17H 3DK0A 3ATDA 2IQAA 3TS8A 2WVVB 4XBPB 5D1XB 4ZW5A 1A7RL 1NCCH 2FT6A 3Q6FB 1J88A 4FMKA 2VLRA 2ZXWB 4NT6B 1J1OH 2XYCA 2J2ZA 1IKOP 2OR9H 4ZD3L 2DQDL 4X99A 1S7UB 1FWXA 4IHBA 4F3FA 4FQIH 1XWVA 1C5DA 2BLFA 3NIDF 3IKKA 3U9PL 2AGJH 5IWLC 1KYOJ 2VQ1A 4RFNB 3QUYC 3IE4A 4PBDA 2AEQL 2ICEC 1EDYA 3ARFC 3OZKA 4Z95L 4MYPA 3NIDB 1U4FA 3T0ED 2AI0L 3CZFA 4JM2F 2E6PA 1F4XL 2MCPL 3N40F 3CZEA 3BWSA 3E7JA 2YEVB 1YN6B 4KJWC 1GYCA 4RIRB 1CFTB 3FQXB 5LGYA 5IK3A 1T7XA 2R56L 2MHAA 4JM2B 2ENYA 3GRWL 1RHHA 3ECBB 1H8SA 5LAXA 4OAWB 3NCFB 1NDMB 1S9XB 4DTGL 3RZCC 3MRCB 5MENB 4WHTA 1SN0A 3E3QE 1NJ9B 4CDHA 1OK8A 2P5ED 3B2VL 2C7FA 4IOIA 3I6KB 3R19A 2OXGA 4WKXA 4PJXF 2F08A 4CAGA 1Q1JH 5IVZB 1WWBX 3I02B 1FNSH 4CC4C 1IEHA 1YAIA 4MMXB 4PJXB 4IU3B 3GSQA 4JQIH 1XF5B 4LL4A 3OAZK 4AGOA 3DHPA 4UM9B 3QHZL 1DCEA 5LO7A 1B4RA 3P40A 3TPKA 4NQVA 3PGDA 2ARWA 3HBQA 1CFMA 3LTVA 1BQLL 3CN4A 4RAUB 3DROB 5F93C 4GLRI 2HRGA 5KVFL 3SCMC 3WBDA 5D2LF 2APVA 1MAJA 3N1QC 5EORL 3JWNC 3AUWB 4XBMA 4HJGA 5D2LB 1OB0A 5DRWA 1JGEA 5MI0B 4E9XA 1HAUA 4IOSA 1DE4B 1NMBL 5DWUH 1MWAB 2R15A 4YDJB 5GPRA 2WLKA 2NCMA 4FP8H 1KGCD 1IUZA 4UUJA 1KCSH 2DYPD 4NBXB 1OEZW 3JT2A 2ITCA 5TE6L 1HKFA 1OGAD 2AV1A 4FI7A 4LSVL 2J21A 3KBHE 1XSJA 2YLKA 3DHUA 3EYOB 4Y9EA 5IHZA 1LK3L 2AJYL 2CIIB 2I9TB 3RWEB 2YHGA 3WN6A 3O81A 1A7PL 3NACH 4HJ0D 4KK8D 5LGJA 4KMQA 1S7WB 2UYLA 3AITA 4DKAA 1FP5A 2EKSB 2HXAA 3BYYA 3ULUF 2YD6A 2EC9T 3LH2H 3TL5A 2DQUL 4YE4H 2CK2A 4BFIB 1Y1UA 5JPNA 4G71B 1DFBH 2V33A 1SMDA 4O2FA 3A47A 5DK0A 3VXNB 3L3DA 3QIWB 3UAJD 2E9GA 1T04A 4GS7C 1LWRA 5D6DC 4KJQC 1ZK9A 5FUCC 1UM6L 2EILB 1MFBL 2R2BB 2PP9A 4XPGH 4U1KA 2AJSL 4UQ3A 3WO4C 4XNXL 1F1AA 5KS9F 3CUPA 1C9SA 5C0IA 5EU6D 4FI8A 2HLFC 4PVNA 4S2SA 5E1GA 5DUMH 4KKCC 1Z5LB 3ABKB 5KS9B 1MHHB 1MH5A 1PZ2A 1T5XB 1JUFA 3AQDA 1G43A 3IMSA 1UWXH 4YHZL 1VCBC 2NQCA 3GZOA 3Q1SH 4YBLC 3NP3A 4NZDA 1CDJA 2BIOA 1HSAB 2X28A 2QKIB 1I8IA 2WXJA 4JDTH 1E6JH 3SBPA 1DQVA 2XFXB 4ADIA 3BFWA 1NBVL 3INUH 3MV8B 5IESH 1VFMA 3UL4A 2XPGB 4XCFL 2BOLA 5L2JB 4Z18A 5GIRA 2DJMA 1D9KB 4F8NA 4R4NC 2F8IA 5I8EB 2YWZA 2X6AA 3I2CL 2QMJA 2B1AL 1ZHLB 5KN5B 4XH2B 2IF7A 2R0KH 1NFDF 2NQDA 2OMWB 2DMGA 4W6WB 1I7UB 4ISVB 5C3IA 1CDBA 4ODUA 1XQ4A 4U1GB 1X7QA 4U1LB 4YQXH 4DKFL 1NFDB 5D72L 2BS8A 2YJQA 1JPTH 3MJ7B 4M5ZL 4AMKL 9PCYA 2N56A 3EJZD 3FK3A 3B2UD 4N28A 2WXKA 2XG5B 4NQDD 2ZF8A 1NUFA 1YUKB 4FXKC 2BM3A 3MROA 4YGAB 1VKXA 1AC0A 1ITCA 1DSFH 4XOEA 2PKDA 1I82A 1RUQL 1WAAE 2ADJA 4L4VD 4XCEB 2OL3A 1FL3B 4L4TE 3O2DA 1JF1B 3CC1A 1BEYL 4ZAKB 2BOBB 2DLFH 2YBGA 4APQD 5GGTH 4QAWA 1X5IA 4O58H 1OP5H 3X1GA 5B39A 5LB1A 3RL2A 2NYYC 5GZND 1WC7A 1WBXB 3SKMA 3AMLA 3JT0A 3QUXC 5DZNA 4EN2A 3VRIA 2J1ZA 3JTTA 1J0IA 3TA4D 1RJYA 2X4TB 5F7YC 3TBTA 4JFOB 3K72B 2A6KB 3CHOA 5KJ7E 5E8NB 4NO2A 3V55A 3VE0A 3ARDA 4PLJC 5IG7B 5G4NA 4D94A 2YSSB 3LPWA 1UT1A 1VFAB 2VLKA 1PW3A 4OF6A 3AS1A 3SDXF 3HBPA 5IIEA 3QYNA 3NJMA 1BM7A 5ACZA 5IB2A 5GS3A 5GS2H 3L3OC 1IEBA 5T1LD 3MRLB 4O2EA 2UZYB 1YJDC 3SDXB 3IDYC 3D0LA 3HLAA 4MCYA 3GSUA 3AY4A 3SE8H 5JW4R 2X1XR 2XQYA 1WBYA 2DQFA 3RWJA 4UQBA 4XRCA 3FU8A 1J8HA 1YPZF 1R3IH 3HMXA 3ZO9A 3IXAA 1P6FA 5J1AB 5AZUA 2NNRA 4WU5B 3OD3A 3X13A 5KBPA 2JCWA 3ARBB 1YPZB 1T2QH 1RERA 2VXSH 3DRTA 2IH3B 4DP7X 5DHYA 3MLUL 2WY3B 5F21B 1DN2A 2FGWL 2X6MA 3FU9A 1H3TA 4KAQH 2XZAH 2IMNA 3QSKB 4QY8B 1D7FA 2PWFA 1HQ4A 4Z7VA 5T8IA 4YR6B 5L2KB 1F56A 5BXFB 4KI5D 4F7CA 4QJ5B 2FSEB 3HNSH 3JZYA 4FFWC 1KDIA 1SEQH 4AENB 4P3CH 4OZGE 3U1SH 3C60B 4AL8C 3GSVA 1BIHA 3ZLQC 3ZJAA 4X4MA 2QL1A 3U7YH 2JKJA 3FUKA 1N4XH 5JQ6H 3LQAH 2CLZA 3VXPA 3U0WH 4KRPD 5EC2A 4W68A 4KQ4H 4Q74A 5IGXL 5JNYB 1E5CA 3FYIB 5E7BA 4HS3A 2Y7QB 1EUTA 1SOKA 1MW0A 4Y88A 4QXVA 3SDAB 4RNRB 4QXGH 3UTPD 3F05A 1OGTB 1HWGB 2FHCA 2VDRB 2HPOA 4AQ1C 4DGIL 4QXTA 3OF6A 1NCBH 2HLFD 3AXLA 3GS4A 2AKRB 4XGZB 2PP8A 2X2JA 3G9AB 1MRDL 1CXIA 3O0RL 3UIYA 4MDIB 5DD5L 3F6JA 3DBXA 1WQVT 2GI7A 3AY2A 3EBHA 4FL4B 3RKDC 3TYGL 5DRZA 1WZLA 2CJTA 2JKNA 1ZTXL 4WJG3 1ULVA 3QJHB 3PIQB 2OQJB 3LKOB 3LH9A 3QJFB 4XP1L 5K9QI 1T22A 2A1WH 4RMWA 4M6MH 3VVVA 4R96A 4B9ZA 4UTCA 3LEVL 5FO9B 5KVGE 1MWAH 1CB4A 1ND0B 3BUTA 4R4ND 3QDHA 2Q76B 1EXUA 1R3JB 2YN5A 4JO2H 5DUBB 5F8QC 5CLYA 2W88A 3RNKA 1QASA 5HDQL 1G0DA 1J0KA 1RZ7L 4TQEH 3WJLA 1GGCH 1FNFA 3HMWH 4YSRA 4WW2F 1Y6NR 2WLZA 2X4PB 1TPXC 2P49B 2L7JA 4W4OA 2M8XA 4S1QH 2J57A 3DGCR 1A6ZB 4WW2B 2IAND 1WRFA 2I60L 4WU7A 3LXUX 1CFQB 1WFIA 3UROR 2WWMD 4AG4H 3L1OH 1A4JB 1ZA3B 4MQTB 4ZTPL 2DTSA 4XI5C 3DXAB 4HF5L 5JA8B 1SBSH 3BRDA 2BVOB 1U8CA 3Q01A 4UAOC 3QYCA 4ZFZA 2J56A 4MD4A 3ULUH 2LTQB 4YAQB 2OA9A 2B39A 2QPSA 3LIZA 1YY8A 1TZAA 1LJMA 1FDLL 3QVAA 5DRNB 2E5EA 2WSPA 3IBOA 2X5PA 1QWUA 5CWSB 2DH2A 2CKBL 4F7TB 1ROCA 2F19H 2G9HB 5L8JB 3VG9C 2NYYD 1UWFA 5E23A 2AW2A 4U2YA 3Q5YA 1DQML 3KWWA 2XPYA 4HEPG 4JB9H 3VJ6A 3QDGD 3ZTNH 5KYXB 2A9BA 4L37B 4JFQA 4LARH 3MV9A 1SUHA 2XX0A 5AYUH 2B4CL 4ESKA 4J4PC 4JY6B 2BZ7A 1MFMA 1MNUH 1QI5A 4HUNB 4N8VA 2PYFA 5CEZH 2HMIC 4IJ3C 3T5WA 4RISH 3KHOA 3LEYH 5HI5C 4GXFA 2GB2A 5TFSL 5FGBA 2GJJA 1RP9A 3OTTA 1NSNL 1HAWA 3AT8A 4OLXH 3N5AA 4JFDB 4LO9A 1S7TB 3ASOB 4JZOA 5DTFB 3GIVB 4P59H 2VXTL 1QKZH 4K9EH 1SLXA 2OTWB 1EVUA 4Z0XB 5AKRA 1EHAA 3TN0B 3EO0B 3QPXH 4DOHB 2RALA 1RUMH 5EIIA 4IEFB 4UOZA 4TLUA 4YC2C 5DC2A 2VQUA 3D85A 1ADQA 4FS0A 4O4YH 5I15L 1YNLL 4EUPB 4WNSA 3MV7D 4CSPA 3FCTA 4X5XB 1MF2H 5AKSA 5C0CD 4H88H 3SPCA 2XICA 3TTSA 4AH2A 1RIVH 4P5RA 4TLTA 3PFQA 4QYAA 2L0DA 5PAZA 2DQGL 1CFSB 4IBSA 5LQBL 2ESVA 1AG0A 5CR8A 4IIQB 4Z5RB 2DQ6A 3MJ9A 4HT1L 2OJZL 4NIKB 4BFJA 5FOBA 4YL9A 2L4OA 1FG2A 5DO2C 2XRAH 2F8VA 3V6FB 3KGSA 4Y2OB 5E6ZA 1MUJA 3QT2A 4FFYA 3V0HA 1IIIA 1XH1A 2QBWA 4LMQE 4ZXBC 4LBAA 2G30A 1S7VA 3MAWA 3BJ91 3HAEA 4PRNB 2VERA 2XZQH 5JR1H 1Z3RA 2W92A 1JWMA 4XXCA 3LRLA 1M71A 3UAAA 1HNYA 2ZKXA 2D31B 3TBBA 3BW9B 3MACH 3PG2A 4IRSD 4JG1H 1XBRA 1SHSA 5GJTH 2CRYA 4P2OB 1P7BA 1PY0A 3VFMB 4OGYH 3RFZA 4AJWA 3MOAH 4OV5B 5HHVH 5IB1A 1SXZA 2QMKA 2XWTA 4JCMA 4U6VH 3WHE1 1CXEA 3CSGA 1ED3A 4CDGC 5AOMA 2C4FU 2WYZA 4PLKC 3RWIB 4WSJA 4G8FA 2BW4A 1XEUA 4PJDE 4K8RH 4ZS7H 3RIKA 5GS0H 3T0EE 3FU0A 3MDJA 4HIXH 3O3BB 2BHUA 1MJJB 3P9MB 4MLIA 2BO0A 1ZY9A 1FVEB 1RJLA 2FAUA 3P9LA 5SWZA 3SOTA 3RY4A 3SGDI 3RP1A 2XZCH 5DZPA 2DYSB 3MRJB 5IUSA 2GSGA 3GSNL 4CVXA 4KUCF 3UTZA 4PJBE 1P5UA 3CDZB 3EOAB 4P23C 4UTAL 2JE8A 1RZJH 2OX5A 4J8RB 1YA5A 3KBEA 1RZFH 1SXBA 2Y23A 4LCIH 5J11B 1JV2A 2RMNA 5ICZB 3BXNB 1FV1A 2X9ZA 2VH5L 4QRFA 2P5EE 5EIQA 4N2AA 1OTUD 4TXVB 1DBAH 3DDGA 5IQ7L 1NL0L 2M1KA 3KG5A 3QFDA 5GGRY 4KDTC 1OTSC 1WTGT 1EWHA 4HSAC 1UTDA 3MNMA 4G1MB 2Y36L 1ORQA 3TONA 1DJHA 3VXUB 4UYQA 4F58L 3DYPA 4JPSA 3EJYD 3MOBL 1DDHA 1E40A 2Z91B 2AK4A 4QAMB 1I8LC 4ELMA 5FB8A 3FHEA 5TTRA 3QRFM 2VL5A 4BK5C 3ME0B 4P5KB 2C3VB 1N6QL 3OSKA 5D7SL 3T0AA 1UXSB 2HVJA 1WWWX 3P0YL 2H5UA 1L6ZA 4KC3B 4UNTA 3IU3A 4KDVA 4JRYA 2HLEB 4PCTA 1ACZA 1A3RL 1Q94A 3KPMB 1DBBL 2KYIA 3FQUA 5DQJA 4Z7WE 4FG6C 4QHUB 1T83A 4G7RB 4A68A 2F61A 4BXVA 5DJ8A 1M1SA 1A7OL 2BSSA 1FIGH 2I26N 1SY6A 2VDRH 3CLWA 1DJIA 1YRKA 4K15A 1C8PA 5FYJH 4KXDA 3LXAA 1RK0A 4FFZA 1KGCE 5HHMB 3ES6A 3LEXB 3PWPB 2HKHH 1UT2A 4KKAD 2DQJH 1E28A 1OGAE 2P46B 1TG8A 5FLUA 3WS3B 5CJBA 3CLEH 1KF9B 1BD2B 1DVFB 1ZS8B 4QT5A 4X6CA 1HHJB 2VR7A 3QEHA 2L7QA 1BVKB 1GGIH 4LK4A 4CW1A 4OU3A 4FA6A 3TZVD 1I1YB 3LIUA 2B2XL 2I7OA 3PWLA 5HJDA 4UDTA 3CDCA 1MCSA 1OD9A 2WNKA 3M1OA 3PP4H 2EIZB 3VCLA 4KY2A 3E3QC 2YPLA 3BJLA 3TVMC 1V7NH 5DFVC 1S4IA 2FJSA 1EO8L 2WD0A 1RZ8A 1IAII 3QQ4A 2KLRA 4OGZA 1OAKL 2OYMA 3WIAA 3OB0H 3SKOB 3V5DB 2CDFA 2BFVL 1K72A 1X44A 4TRPL 4X9GA 2CO2A 3BH8A 4HIJB 5EU6E 4Y7OC 3H0TB 35C8H 3BRGC 3BAWA 1AO7A 2DJUA 4PI0A 3DUUA 5E9DB 5ECJE 5FM4A 5D1QC 4TKWA 1CE1H 1HEZB 1V3LA 2Y1VA 5FUZH 4N0FB 5HYJB 1E8YA 1TZIB 1INQB 4RQQA 1JGUL 4HH9A 2OW6A 1QSEA 1CTMA 2DWEA 2IAMB 3O9WA 5ADOH 3H2PA 4AW4A 3REVB 3VFTA 4P4KD 3GINA 4ZMLA 3VFPB 3BGMB 3UBXA 2X1OA 1NMAL 5E00A 1CYXA 1NGXA 3KCPB 4KTYA 3L3GA 3U6RB 2H26B 4DAGL 3X3FH 1KXQE 3ZQ9A 1QYGH 2BMKB 1A6VL 3QDMD 4MXVE 4NLAA 4YIQA 4DN4L 2FIKB 4A7SA 4OM0H 4WWPA 4XCNB 5EUKA 1WWCA 1OSPH 1MFUA 3SDDC 4YXHL 1A4KA 3OHMB 1A1OB 2DY2A 1JCVA 4PLKD 4WCYL 3ZMRA 4DCQB 3ZK0A 3HR5B 4G9FB 1UWYA 3O3EA 4BFGA 3L13A 3MUJA 4IS6A 4NC1C 4NQDE 1PG7L 3E9UA 3KPOA 1QFWI 1Q0XL 5AW5B 4AXWB 1AI1H 1YDPA 1JNHB 4DZ8B 3BDYH 1IQWL 1HHHB 5AKVA 4OLYH 4L4VE 4X7SL 5FYKH 2JXMB 4EUPH 5C6TH 1OCRB 2ADFL 4U3SB 1A3ZA 3PJNA 3MMEB 1IGCH 1Q9KA 1WT5A 4FABH 4XXDB 3JBG7 2MCAA 3B6SB 4LFHG 2VE6A 1W2KT 5T1KA 1SZNA 3ULVD 4OZHE 4MDRA 3UAFA 1QFUL 5F6IC 1ZLWH 2R7EA 4HV8A 3FTSA 4X6DE 3U79A 2J4WL 4GPVA 4RAVA 4Z78A 4HUKB 2OK0H 4G59C 1G9MC 2VL4A 4H1LG 3H9SD 3KHQA 4OZ4B 2D3JA 3VW3H 1QW9A 5CJOH 4HUMB 4GRLA 2YMOA 3T09A 4E36A 5FKPB 4ZUVB 4LDLB 1BWMA 1F6AA 3NCMA 1XR8A 3UMNA 5IZ7A 3L9RA 4X4XB 1P4LA 4B9KC 3IRCA 3Q9PA 2BNUA 2ARJA 1F2XK 3H9HA 1OE1A 1QP1A 5F1OB 3W2DH 4QWWC 3SD2A 4B53A 3JV4B 3ZR5A 2IOMA 1TTCA 5DF0A 1DJGA 4AC4A 2HKAA 2ZUVA 5J13B 4WNQB 1PKOA 1RZKH 3HMXL 1EK3A 2VR9A 2DMHA 3C5JB 4AOFA 5GSVA 2IG2H 5ALBL 2APWA 2HWZH 3WMSA 2IPUG 4HKJA 1QZNA 2OI9C 5CN3A 1N0XH 3ZDXB 3VH8G 4Y89A 4L1BA 3MNZA 3GB7A 4WO4D 1AR1D 1JTOA 4KI5E 4HFUL 4IIZA 2VB5A 3PABB 4DN3H 1ZIAA 3IDGB 4UT6A 4YDLC 3SYAA 1NUDA 3AQYA 3LKNA 2OW7A 1U3HA 1NCCL 2W9EH 5JXEC 3CZNA 2NY3C 1QLFA 3B3IB 1IE5A 3QXVA 3BLKA 1ZEAL 3DSNB 1K4CA 4MQSB 3OR7A 4K3HA 2GJPA 5EZLA 4HKBA 4M8QB 3WN5C 4OFKA 3LB6C 3RLSA 4LOUD 4UNIA 4ANXA 4F7EA 5J6HA 1HINL 2G0LA 1J5HA 4LGPB 4LLYB 4GBXC 4ELKB 2ODIA 2R4SL 3A6BH 5TF1L 3HE7A 3BP5B 4BSVB 4B7IA 2AGJL 4G8GA 4S0SD 5ANMA 4G6MH 1G7MB 2MQ3A 5LGHL 4DFHA 3LZOA 3PGCA 3QUYB 2P24B 5KBNC 2ICEB 4XHJC 3ARFB 2NQ3A 4XWOC 1IC5H 4OIFA 5L4IA 3IN2A 4XAKD 2OYPA 2YEZA 4JKLA 3HFMH 1DN0B 4KK9C 5CBAB 2EUZA 4LSDA 2HKFH 5F9OL 5DVNA 5D1QD 5I23A 4OBSA 2D0FA 2WLHA 4P05A 3SY6A 1NBZA 1ZTMA 1Z9SB 1DQKA 2P9RA 3UZQA 4AUYA 4JKPH 1FBIH 3FUHA 1CE6A 1R3HB 3FONA 5E5RB 1XTMA 2CO7A 4PJCE 1A6UH 2FJGB 4AQ8A 5DS8A 2LQRA 4FN0A 4IDJL 2IC2A 1XCWA 1T66C 4Y19D 1F97A 4NQUA 4D8PA 4N2FA 2NCEA 4NYLA 2BWQA 5I26A 3RTQA 4MZIA 1IAIL 2VLMD 4JQIL 3DA0A 5E2TL 4M7KL 2EDOA 3HG4A 2Q7NA 4ETYA 1QEXA 4E9LA 4YHPA 4P46D 1BF5A 2IANE 4P2QA 4E5XG 5LLIC 4Z8FH 3CFTA 3VD2A 3NEOA 3BD5A 2YPVA 3RWFB 4KMTH 1LK2A 5BZDB 4XN2A 1J8RA 4QO1A 3MBXH 3FO0L 3QRLA 3B5TA 1YQ2A 4ACPA 2DWYA 5L7XH 1W8OA 5DWUL 3IN0A 4H25A 3O41B 2F1AA 3T2NL 3MLVL 4NC0B 2CR6A 5K9KA 2QELA 3TV3H 3U2JA 3H2WA 3SGKA 4RX4A 1E0OB 4LCUA 4AM0B 3DUSA 5B38A 4HOMA 2R0ZL 1CBVH 1N19A 2FNWA 4KVPA 3QDGE 5FFLA 5I8KH 3T3PE 1N6UA 5HJBA 3NACL 3QFJA 1NCIA 5HGGS 2VW4A 3K6SB 3X11B 1CGVA 3K6IA 4O51A 3DTXA 5IJBC 3ARGC 3CVBA 3LH2L 4UQ2B 3F7YA 2HTKC 3NBNA 3RAJL 2IDFA 4M8RA 3FQWB 1DFBL 2Q3ZA 2DM4A 1OGSA 3SKJH 1E7VA 1XD1A 5AOJA 2IDQA 2ZP8A 3EOYG 3GI9H 3POCA 2CZNA 5FC9A 3GYRA 2BFGA 2NY1D 2N4IA 4XPGL 5IKCA 3C5SA 4GS7B 2XJLA 3CX2A 2EE2A 1NCAL 3MV7E 1QUNB 1BJ1H 3AAZB 3UBXI 3NIGF 4QRRD 4ZTOH 5C0CE 3TP4A 2QSTA 2WLYA 1OY3B 4PJ9B 3GEWB 4ODBD 3WEBA 5DUML 2AVGA 1PSKH 1G1KA 3MYZA 1KCVH 4LF3A 5CFAA 2ATPB 1H0DB 3FN0H 3NIGB 4HUUB 4Y0GA 4AYFA 3UG5A 3UPAA 3Q1SL 3E8VA 1OCWH 5C0JA 1H3PH 3Q0HA 1UG9A 3CPLB 1L7TL 1I1AB 3HS0C 4OFQA 5H35B 4YBLB 2YD4A 4UILH 1CTOA 4JDTL 1E6JL 3L1GA 5E94B 1A9EB 1I3RB 3BQUA 2EDBA 2WC7A 3MJ9L 5IESL 2FR4A 5SWSE 1IC7L 2WWNA 2V9UA 3OX8B 3Q8AA 3IK2A 4G72B 4NNXA 4QDGA 3DTDA 3FQRA 5C08A 5B7FA 1MJUL 5F9AC 1QQDB 5DA0B 2NY2C 1P6WA 2Y72A 4NKMB 5D7KD 2CDEB 3BN9D 3RGVA 3VXRB 1ZE3C 3B2XA 1YNKL 3D2TA 4HXBH 3SE9H 2PN5A 3KVPA 4P0DA 3QCVH 2Y6SC 1DVUA 5GS1A 3WY2A 4YQXL 4W6XB 1KN4H 3OXRB 5AW1B 2E75C 2IWFA 3BEVB 4W9EC 2OLDA 3OLDA 2PO6B 1H6TA 3ARDD 3TGXA 1WZKA 2A73A 1G0YR 4ABWA 4R26L 1R24B 2VLKD 3ARSA 3IDJB 5BRZB 4DK5A 5CP3H 1CC3A 1OT2A 3EJPA 4QHMA 4K94H 4KK6D 2EE3A 1DSFL 4EN3C 3DUHA 3PL6B 3CFBA 2O1AA 3QORA 5CD5C 1ZT4A 2DLFL 4LHUB 1E6OH 5GISH 4DKEL 5KVDL 5GGTL 1QSFD 3KXFA 3HI5H 4UNUA 5TJWK 1AYOA 1MFDH 1UVQB 4UDUB 3ZE2F 1J8HD 1KJ3L 2YD9A 1SM3H 3C6EA 1H8LA 3VFWB 5I66B 5F0JB 3BESR 3SDCA 4YBQC 2WJ5A 4LDEB 4PJ8C 2N1TE 1E4KC 3ZE2B 5E0FA 1PD6A 1NZRA 3QUXB 1RULH 3G5VB 2XC8A 5CLWA 5I5IA 4GKNA 3IGAA 1U8JA 3BAEH 4CJ1A 3ZKNC 1ACXA 2VAAB 4X6EA 1FYHB 1ILUA 4KUZL 2HJKB 1Z3GH 3GBML 1RIUL 1BYOA 1OW0C 3I75A 4Y5XA 4HCGA 4KTDH 4TNEA 1AMYA 2BRRH 3AG4B 2W07A 5FCSH 2RR3A 1JK9A 3CU7A 4ZODA 4JX0A 3GSRA 3L3OB 2OTUB 5I1HH 3QZWB 2P28B 1KFAL 2G5BB 4ONOA 2E7LA 3IDYB 1MRCH 4HSQA 3RHWF 3O4OC 2WLNA 3U2SA 4EZKA 5IM7B 4KO5A 1HSBB 2NDFA 3KH3A 3S4SA 5I19H 1F4YH 5C07E 4ZQKA 3QS3A 3AGVA 1G9NC 2NRDA 3DVNA 2KL6A 5C2BH 1MLBB 3SN6N 3T0BA 4Q14A 2XXCB 1T2QL 1VPOL 2XKSA 1CDYA 1HXMB 3OKOB 3VFGH 4ZUTB 1KBWA 4WZ9A 4LEXH 3PNWB 4X4ZA 4FQ1H 3F8UB 1OB1A 1T2JA 4QTFA 1I1FB 2BC4B 2XN2A 4KAQL 4N6RB 1EFXD 5TDOA 3BPNB 3HPLA 2CK0H 1Y07A 3DK2A 2W8CA 4JRXE 3B9KC 4LBEB 2F7IA 3OF6D 4MMZA 4IMLB 2VJXA 1E5BA 4R3SB 3UTTB 1ID2A 2HN7B 3ZUCA 3HNSL 4N3UA 4WRLA 4OCRL 2XTJE 1SEQL 1D3CA 4P3CL 3TO4A 3U1SL 4Y4HA 4J3OC 3VGBA 2ZXGA 2ALWA 1G7PB 4YHIB 5EZIL 1BAGA 1I53A 4L3CB 5FKAA 1MNNA 5D1ZA 3GMMB 2PUQT 3U7YL 1AQKH 1N4XL 4L9LA 5GRXG 1E5AA 2B5IC 1Z9OA 3RL1A 1KJMA 1HL5A 3V8CA 5FYLD 4BH8B 3O3UN 5DSCB 1X9LA 3GRGA 4JQXA 2XBDA 3I3DA 4HP5A 1AGDB 5AVQB 3DSFH 3FO1A 4KQ3H 3OJMB 4LHQB 2P26A 5CJQH 3EJRA 3T8XB 4H0LC 3KYOB 4RZCB 5ITBL 4D0CA 1XGTB 2DDQL 1N6VA 2V9QA 4LCWB 1OOAA 1NCBL 3ZKXC 4M7LH 4JK0D 4KBPA 4GW4B 1S7QB 4AQ1B 3BLPX 1JS4A 2Y5TA 4YHKL 4YFLI 2HT2C 4PY7A 1V54B 3MZGB 5E8PB 3KJ6L 5IVOA 3O8XD 3MLTA 4GUCA 5IMKA 4Z3JA 1ACCA 5TE7H 4KGLA 4FHJA 1OP3K 1SFHA 3ZRSA 4FLOA 5KYUB 4MNQA 5CMAB 2Z7YA 3GT6A 3BVNA 3JWNH 3PHQB 3P4MA 4GAJH 3WKMH 4GXVL 1TU2A 1IGYA 4HK0B 4HPHA 1T7VA 2ZZUT 3FCSB 4PWIA 3JUZA 4WJ5B 5CCJA 1KENH 3CMOL 2CBQA 2Z35B 3DV4B 3RY6C 2B1HH 4TQEL 4AGNA 4UMGA 2FWLB 3HMWL 1MI5D 5AG8A 3BZ5A 4X5WB 3O2VL 4RFEB 3GSXB 1OARH 3QDME 1ACYH 4HWEL 2F54B 3GD1C 2RGSA 1KCRH 3CDFA 3WE1A 4Q9RH 4Q6YA 4AG4L 3ILQC 3DNKA 3DOSA 1M05A 4YHOL 3V6ZB 3TF7C 3W1ZA 4BA8A 1LEGB 3MUHL 4KH9A 4WI6A 2H6PB 1SEBA 3BHBA 5DEGA 4L1DA 5CD5D 3E38A 2XOTA 3RJOA 2GJZA 1MCDA 4KU1A 3HN5A 3MCG1 4I2XE 1YYCA 3ARUA 2HT4D 4JVWA 2Q6WB 3RVWC 3ARRA 1RD6A 4XMPH 2F53B 2ZD0A 3T8MA 3EGDB 2B0SH 4NO3A 3WNPA 1W80A 4PQXA 3GSWA 3MBEC 3QJOA 4JB9L 4ZRGA 5ES4B 2VAJA 1U95B 3ZTNL 1G7LA 5I1JH 2COQA 4LARL 1FGVL 1F1GA 4HZLA 4NQEB 4FHKA 1ZT7B 3DV6B 4JLRB 3QPKA 4P9MH 2KQNA 3NIFE 3ZKND 5KTEH 3EJSA 4MD0B 1HILA 2YUWA 1N3NA 1NGPH 4G8IA 7PCYA 2CIKB 3H9SE 3O6FA 3OWEA 2ZXAA 3Q1EA 3LSOA 1JHLL 4OLXL 1AD9A 3EF7A 3AREA 3J07A 1V05A 2VDMB 3BI9X 4MNHA 5F88A 4GUQA 1BA9A 4F33B 4P59L 4K9EL 1QKZL 3QEQD 4MD5B 4Q0XL 1HKLH 1KCWA 3QPXL 4WWKD 5EF2A 1DDTA 1RUML 3GLZA 5AW8B 3HVNA 3K2IA 4O4YL 2C8NA 2PW1A 4JFFA 3MPCA 4LGSB 1MF2L 3FSAA 1VA9A 4H88L 5FF6B 2MEJB 4GW5B 1UM5H 1NCJA 2EEAA 1JYNA 5I17A 1X7TA 3QCUH 3MJ8A 4LLWA 5JOFB 2FO4A 4PJHE 1PZUB 5E5MA 3EUDA 4A04A 2BP5M 3PV6B 3QXDB 2C9PA 3E6FB 1LQBC 2HFGL 5DJXA 4FQCH 4TUOA 2ZE0A 1NCTA 5AYQA 1PS3A 5CFHA 1CLYL 2XRAL 4KNQA 4HJ1A 3EH5B 1SLVA 1Z9NA 3EOBB 3GMOA 1F45A 4AWJC 5KBKA 3JWNG 2Z4TA 5KSUA 4FTVB 2JJTA 3HRPA 4S1SH 4FNTA 3PWJA 5CILH 2GTZB 5CJ8A 3W9DA 4JG1L 3MACL 4H44C 2R69H 2HRPH 4POZC 3QCTL 4UT6L 2WBWB 5GJTL 3T08A 3WMQA 4MJJA 5I5MA 2OSWA 1BJMA 3G5XB 3HCVB 2WUBH 4XX5A 5HHVL 1NCDH 3L4UA 4Y1AB 2GEEA 5FDWB 2BPBA 1PZSA 2VSCA 4GRMB 4U6VL 2LU5A 1A1MB 2CPCA 1JYXA 3WUWB 1YUHA 3B56A 5C71A 3CH1B 3T3ME 2WLJA 1VB9A 2P5PA 4ZS7L 5GS0L 4GOSA 2EXYC 1VADA 4HIXL 5K59F 3VWKD 1CUOA 2AK4D 3TA3B 2ZCLH 4PV9B 1JXJA 4HZAA 5C0DB 4TTDC 1A6TA 3VYPA 1E9QB 1X5JA 2GBUA 2PCXA 4XAKE 1QHPA 2AXFB 2DIEA 1DBMH 2OXHB 2XZCL 3H7BB 2G3XA 1REIA 2ICWA 2YFNA 4WUKL 1TKWA 3HE6B 2JI1A 4JKNA 1RZFL 2O61A 2HX9A 3E9TA 2HUHA 4P23B 4Q2ZB 4C54A 5K9OB 4GQRA 4HLZH 1DJZA 2WINA 4MX7A 1DBAL 1T2XA 5ABDE 4TQ8A 1UCTA 2HLAA 3NJNA 3O3AA 5I1AA 4GG6A 2P42B 3GHPA 5C70A 3LDBC 1UUNA 4PGEB 4PUBH 4XO3A 5DEJA 2BRQA 5JXAH 5I16B 2E6JA 2YOCA 4MCMA 4A1RA 2VLME 2AEWA 4X4YB 1DVSA 5IJVA 1NAMB 5EIVA 3MREA 2EH7L 1DJXA 4QRUA 5K1JA 4M1CD 4LPYA 2J8UF 4HX1A 5TD4A 3TU6A 2FJFB 1AZUA 4JKMA 4P4RB 4B0MM 5ID0A 1GW0A 4P8QA 2ZUYA 1CURA 1S7XA 5D1ZI 5H8DA 3OAZH 3BP6A 4Y16B 2JJVA 1QBML 4X80H 3RU8H 2OP4H 1U3NA 4RETB 3BZ4B 2JLLA 5T33H 3I6SA 2XA8L 1CWVA 5EEZA 1G7QA 4XN4A 2WLIA 1GAFH 4PWFA 2VDRL 5KVEH 5HPOA 4G7SB 2AV7B 4A6YA 4WTZA 1ZLUK 3WO3B 5FYJL 2J6EH 1J1PL 2PNDA 1FNGA 1MW3A 3D69B 1RAMA 5I73C 4OVVA 4ZX3A 2HKHL 1LNUA 2D8KA 2DQJL 2ZCKL 2D4FA 5F1NB 4FE9A 1FA4A 2OMYB 1AO7D 1KJ2A 1FO0A 5CN1A 4L3ED 4AV5A 3T71A 4AVHA 2DMCA 3KDMA 1JPSL 2JELH 3CNKA 3FU7B 6FABH 1A7BA 3AS0A 3L48A 3D0VA 3Q2CA 4QRPB 1ETZB 4YHLH 4GUOA 3APCA 4X7EC 4MA8H 4EDXA 3DMMC 1L6PA 3Q2NA 3GZKA 4MJ2A 1NFIA 4ZPVA 5F7HA 3PP4L 1HH9B 3GTVA 5D7HA 4Y5YC 1V7NL 3RFRA 4AMXA 4AKOA 4GKSA 4NWTH 4OLUH 1X9UA 4S1RL 3LVEA 3BIKA 3KS0J 3TVMB 2UZIL 4AY0A 2E74C 5KAQF 2Q8BL 1NDTA 1KCLA 1B0RA 2A5UA 3QZWG 4G1EB 2FX7L 3OG4B 1FL6A 3MV11 4QRRE 4Z7UA 1XL4A 2BY2A 4OCSH 1DR9A 2IPTH 3QA3A 4QHKI 3IFPA 1WA2X 2XT1B 5B1JC 2NR6D 4DT2A 3NCYS 3I6GB 1ZANH 3QIBA 2X2HA 1ZGLM 4IGBC 1CE1L 5FUZL 1WE5A 5TDNA 1R34A 3IKCB 4PREB 1TTFA 1V10A 3KLQA 3WJJA 4HLZG 2EO7A 3AADB 4WFGD 4R83A 5ITFA 1S9WA 1U21A 4GXUN 3BX7C 1ES0A 4HIPA 5EEXA 5EZJA 1XCQB 1LP9A 3JZ7A 2EDXA 4KKLC 2E7BA 5D7KE 5T1KD 1YECL 4POYA 5FO8A 3S8GB 4OCMC 1U4EA 2DICA 3DX9B 1F3JB 3QI9A 5EOCH 4G8AC 4LIQH 1UJ3A 4OM0L 1TJIH 5T3XD 1O75A 1TCRA 1OSPL 3NT0A 1KELL 4JFXA 4FFVD 1KIRA 2BVPA 2FJHA 2MPAH 2EVJA 1PNCA 1H3VA 2GK2A 4HUXA 3SDDB 3TEXA 5KEZA 4JANA 3II2A 4AGQA 2VDMH 1UWEH 2VLKE 5C0BD 1T20B 4M1DH 5E1AA 4WK4B 2NY7L 4IRZA 1IQDB 5AD0B 1AI1L 5CSGA 2XDHA 4KOBA 1NGWA 4L23A 3HR6A 5JQHC 5I30H 5FYKL 1QD0A 5ESQB 4AYBA 2WZAA 1IGCL 1H5BA 4XAWH 3GDCA 4ZOCA 5E4IA 1O7VA 2ATKB 1QSFE 4FABL 1HS6A 1EFQA 4WWOA 3EO1B 3P2BA 5DHVB 4AX3A 3DX7A 5IQ9A 5DMGD 1J8HE 1RUPH 2QADD 1CK0L 5T1DH 1YEHH 5ISZB 5D2NC 2AITA 4OFDA 5ICXB 1AMXA 3LD8C 3ZYOA 4CMMA 5MEPA 4MKMA 5GRWA 1AGCA 1MWOA 5F6IB 2OK0L 1L9NA 4HLEA 2X9YA 4FJ6A 2ZT9C 4N68A 4N9OB 5EN2B 5CCKH 2HRHA 3NH7L 4NZRL 1S7SB 3G6JB 2H1XA 3NA9H 2FK9A 1G6RA 5EU7E 1H9VA 2PXYA 1SJXA 3CHQA 3QP3A 3Q43A 3VFNA 3AM8A 4D9QD 4WEEA 2DWSA 4HWZA 3JVGA 1BQRA 2FHFA 3C6LC 4I88A 4BBWA 2J6WA 1C12A 5B7EA 1GOHA 1K9TA 2PCFB 1GZQA 4JGUA 2NT0A 4X4ME 2P47B 2DTMH 4IOFC 4UAHA 4NPYB 5H37A 1SPDA 3BFQG 4X9BA 1QR4A 3U0PB 5AW0B 1CPUA 3P02A 1GGTA 3MRKB 1RZKL 2X40A 2VRAA 2GPZA 3UADA 2JJSA 5CEXA 5DJZA 4FMVA 4G8GD 1TNNA 1TZHB 3M07A 3H42H 4RCAA 5IEHA 2I9LA 3GJFA 1WHOA 4FQXC 1N0XL 3TIEA 1BOGB 3NK4A 2VW7A 1T89A 2OI9B 1AIFA 4PY8J 1FAIH 5HDOA 1DQLH 3RVUD 3FCGA 2YGOA 5JO5B 5IB5B 4HHAB 4DN3L 1FQ9C 3NJFA 4XODA 3PWVA 4HWBH 4U33A 4ZMTA 3T6ZA 2W9EL 2ZXEB 4YNYB 4DGYH 4YDLB 2J8HA 2Y07H 5I5RA 4KVCH 2AAVA 3QNYA 4L4TB 2GTWA 2VN5A 3DX8B 2Y22A 1S3KH 2FH6A 5FYLE 3L81A 3GMPA 2ICWI 4XMKH 4NZTL 5EOTA 3HC3L 3U1PA 2WOYA 2Q1EA 3Q2LA 3ZOAA 3WTSA 1O9VA 4G9DA 2YEQA 1BQHB 3EF4A 1BAWA 4TNWK 4OCLC 2W9DH 5FEBA 2H1PH 4G6ML 4LPUA 1J05B 4J2XA 2Y25A 2FQFA 1EQWA 3P4NA 4XE0A 2CA3A 3C08L 3UP6A 3N06B 5BOJA 1C5CH 4MCNA 1CVRA 4PIRF 3LN5A 1NAMH 1XO8A 3BGFB 1KN2L 1VCAA 3H7LA 4AVKA 5I8CB 4AW7A 5D71H 1AD0A 2WXMA 3OKDB 1UA7A 4IRJC 3HG1A 4RDBA 2ETWA 4R7DA 3C6SA 4XC3H 4MCZB 5F7KC 1I85C 4P2QD 3P69A 4WAFA 4JO1H 1A2YA 3B8SA 3ZO0A 1ZA6B 1F58L 1FBIL 3TNMA 43C9B 5EEUA 3QULA 2NW2A 3IEAA 5I0DA 3GMLA 1RLBA 1KXTB 1A6UL 4Y4FA 3IDIA 3GZQA 3W3BA 3OKNA 1R17A 3UPRB 3NUKA 4L8CA 3S88L 3R06A 1P5VA 1O6SA 5D96B 2WBJB 1OAUL 3K46A 3L4XA 4U1HA 1MI5E 1GZPA 2X0VA 1U92B 1OLLA 5D93C 2FUTA 5D7LB 1FYTA 1UXWB 3S35X 4PD4K 1BFVL 4Z8FL 4OZGF 1MLCA 4MHHG 4KMTL 2C9SA 4PCSA 2VRQA 2VDQB 4P3WA 4KPHL 3DURB 3MBXL 1R46A 4NIYE 2OZ4H 3D4ZA 5C0NC 4MAYB 2ARJQ 4MNGA 1HTYA 5HHQB 4P2RB 1T21B 3SZKC 2NUPB 4XZUA 2IO5A 5IBLD 3CBRA 4L8DA 3BLBA 2V5TA 4S1DD 3IAGC 5C9JA 3L3HB 2G3MA 5EO1A 1JTPA 1HI6B 3EG9B 4KK5C 5D7JB 5CP7A 1H8OA 3NJGA 5I8KL 2EIEA 3CFDB 3N6YA 3IJHB 1P69B 1TQWA 3N42B 1AHKA 4KHTH 5C0FB 4HU8A 2W65B 5TK4A 5G5DA 1ZPLA 3MBWB 3LNEA 1WGVA 1TQCC 2EXSA 2QTVA 2CO6A 1TJHH 3CXDL 1UXLA 3TM6A 4DW2L 4BK4A 1WDAA 3HB3D 3N91A 4UYPA 3ARGB 4MJHA 1LMKA 3US0A 3C6LD 2AMUA 1XT5A 3SKJL 3QEQE 2FWSA 3SKUD 3MRHB 2XG4B 5C08D 4CN1A 1UZ6E 1CTNA 5IVXE 1VDGA 3U7WH 4Y2DB 4KGJA 1GL4B 2XY1A 3QZBA 3GMQB 3I74A 1W6LA 1Z0NA 4NHUA 4PJAA 5KSAA 3RGVD 2VR5A 4TTGA 4UOW0 1MFAL 1JZHA 4X8XA 3G04A 1CD8A 4ZTOL 1KEMH 5KUKA 2OS7A 4L0PB 4EI5B 3EFOA 4HDIA 1PSKL 1AQHA 1VENA 2B4CC 1KCVL 4YN3A 3FN0L 4QHNA 4WI2A 5EC1A 3IJEB 4AC2A 5DD1L 1KBBA 1OCWL 5JIHA 2WP3T 2R0LH 4ABUA 1M7IA 3DX6A 5FA3B 3VXQA 1U91A 4LKXA 2HCZX 1YNTA 2ZKMX 3QUHA 4PRIA 1R3LB 2ED7A 3OHXC 5EB9A 3VDAA 4BSJA 5BS0A 2D0GA 3QORD 4F2ME 3BUYB 3K80A 4G70B 5CSBA 4EI6A 1KB5A 2F74B 3HRZA 4NCC1 4Z76A 1U30A 1YHPA 5DHVH 3MUGB 4PGJA 1OPOA 3N55A 3DPBA 4WWID 5DJ2B 2MIZA 1MQKL 3SO3C 2F5AH 5K5YA 2A6IB 2NY2B 5DQDL 3SE9L 3GMNB 2WP3O 1AY1L 4FXLA 2NX5D 3MR9B 5IP4A 3P0VL 4HEME 1WIOA 4N26A 3WENA 3MRMA 1KN4L 1I7TB 2PTVA 3B43A 4I0PC 1BLIA 2C34A 1G9MH 4TQIA 3SE4A 5C7XH 2CHXA 3L2MA 4K3JH 5FGSA 4IMKA 1RJZA 3MA9H 4QCIB 4NFCA 4ZT1A 3EFDH 2Y3NA 4K94L 4WEMB 2CCVA 3OKEA 3CDGA 2M26A 1CD1A 2OMVB 3K1KC 5F1IB 1KBGL 1A7QH 1Q4NX 1R5WB 2AK4E 3OVUB 4KTEH 4AQAA 1N12A 4ELME 1XIWC 1BP3B 1P6AB 1V3KA 1MFDL 1E4WH 5DJYB 5GSRB 4Y9FA 4BKTC 4QIRA 1JPEA 4AQZA 4C59B 4GEJA 5FPIA 1SM3L 4HFWA 4HKXA 1K8IA 3GUTA 2JTYA 4JRYE 2XTSA 1RULL 3I9PA 1PDKA 2FEDC 3RX8A 4PJ8B 3TCTA 1JVKA 1V7ML 2VITB 2YZ8A 1NINA 3CBJB 3FH8A 1OM3L 1PCSA 3UTOA 5BPPA 3FUEA 4YK4B 2NOYA 3TH2T 2BSEA 3PF2A 2HB0A 2DJSA 5K9JH 4KROD 3VFOA 5TH2B 1KWGA 1Z3GL 1FF5A 2N01B 5E99H 1WICA 4KTDL 2XQYK 4HEPA 4ZFOB 3NTCH 4RMSA 3LPGA 1OAYH 3WU1A 3KM2A 2GYSA 2EZ0D 4EQ3A 3QE5A 4AEHL 1OSZA 1U8QB 2QPDB 1MJ8H 1NANH 1HHKB 5LCVH 4ZOEA 5EFIA 1NM4A 1TVBA 1LE5B 2GAZA 4X6CE 2QT6A 3FN3A 1F4YL 4Z7QE 5JHDB 1T6BX 3BAJA 4MAUL 1QA9A 4CADA 1K6QH 5BOZG 5CIPA 4ZPTB 4NP9A 1HCFX 2NXZD 3IETA 12E8L 2EDQA 5J6GB 4RGMB 2FBOJ 3VFGL 4K7FA 1DP0A 4LEXL 3QJTB 4MMXA 4K4KA 1BFTA 3VAEA 3PXLA 2OSLA 2NW3A 2YPLE 2AK1L 2HJLA 2CK0L 1WZ1H 2AQ3A 3AS3A 1FVCB 3WTYA 3D3VA 2I85A 5EUOA 4A66A 1PX4A 2GJ6A 1T3FA 5SWQB 4HJUA 3VWJD 3B9KB 3NAAH 4ORGB 4PJDF 4B9JA 4Z23A 4RAUA 5ID1B 3VYNA 4JQVA 4HIIB 3M1BA 1K8DB 4C57C 4P3DB 4WI3A 1AO7E 3UYPB 1X5KA 4L3EE 4DGVH 2HG0A 4M3JA 4PGDA 4DEPC 3QR1A 4MNQD 4M5TA 1KJ2L 1YEJH 5IBUB 5DMKA 4PJBF 5E6IA 3A6CL 5HHOD 1UFGA 2KZ1B 4KO9A 3BPCB 2BNRA 4RDQF 1FZOA 5LXVA 3DSFL 3GBLA 4I3RH 1URLA 1CT8A 4PJBB 4LCCA 4IHOA 2DH3A 1NCWH 4J6RH 3F5WA 5CJQL 1JNNH 3K2MC 3QZLA 5EBLA 2EVGA 3LRGA 1YVLA 1P84K 1B9ZA 3TFKC 4PG9B 2Z0UA 2ZOLB 4FQHA 3MX0B 1X4ZA 3NPZB 4YS4A 1G7JA 2J8UA 5GHWH 1FFPB 1BF8A 2DOCA 4F8TA 4IBVA 1PKQA 3B7TA 1WTLA 3NSXA 2VDQH 4U1NB 5I1LA 4PAZA 3NJIA 4TUKL 1HYRC 4KJPD 2K70A 5TE7L 1GSMA 1XF1A 5J5EA 4L29B 1W72A 3K0WA 3L2LA 4LT7A 4TF4A 5IFAL 4HS8H 4TSAH 4GAJL 4PCYA 1A5FH 3U0TA 1ZLSL 2NNCA 2IEPA 3UFIA 2FZ3A 3LKPB 5MP6L 4ZW6A 1GGBH 4RGNE 5F44A 4Q89A 4QYOB 5DRXB 4M6OH 3DI2B 5ETUA 1KENL 2OMTB 3CFJA 4WFGE 4Z7WF 4C83B 1IT9L 1SFDA 1X5HA 1R3KB 5DUPH 5E8EA 2HJFB 4JFVA 4F1ZA 3IF1A 2BIPA 5FA4A 3QUZC 3OJVC 4PD4J 4YHMH 1M53A 1EBAA 3BSGA 4C4UA 5KYYB 2EJ1A 1OARL 1DSWA 4I4WA 4A7VA 2A4CA 4L1HA 4PWGA 2LT9A 1ACYL 4B7LA 5T3XE 1KCRL 4Q9RL 1KB9K 4YSDA 1WD9A 4FADA 3CSYB 4XMVA 4QLRA 1U42A 1F00I 2QLVB 2LVEA 1PLCA 2X4RB 3GWJA 3IDXH 4UIMB 5C0BE 2YZ1A 3QWOA 1OGAB 3RI5K 4I48A 5F9WC 2PYEB 3EIFA 2VQ4A 4EO5A 4NDMA 2HX7A 2A83B 3TIDA 3QUMB 3REWA 1A6WL 3WNIA 1PYWA 2MNUA 4AV4A 1XBDA 2QEJA 1IM3A 4UINH 1Y18B 5ABAA 5KVGH 2Z4QB 4XMPL 5L9DH 5FECA 1UM4H 4AEFA 1AH1A 1BM3H 3KDPB 4A2DA 2RFXB 3QPQC 3T77A 3RGBA 5A3IC 3HBZA 3K6FA 4HCFA 4L0ZA 2AERT 4ZZFA 2BVQB 2PPCA 5MEOB 4HJJH 4OJDH 1FAKT 4N2DA 4MS8C 3WTXA 1XR9A 2X88A 1HHGA 3V0VB 1MVUA 1WFJA 3UZVA 3RJDA 5F7UA 2G75A 1GJWA 5I74C 4N8CH 4Y4KD 2BOBA 1IFRA 1BG1A 3I50H 3GSOB 3U25A 2WVSA 3IS0X 1J9QA 4M5SA 2VDOB 1HKLL 4ALAL 2YGVA 3WDIA 1G6RL 4S0HA 5D6CA 1JMXA 5CGTA 3GI8L 5ICUA 5DD3L 5D5MA 3IGFA 5FUOH 4F7PA 5CSZA 5ACMA 3G5ZB 1IKNA 2COVD 3FAWA 2X2YA 4NRZB 1D7DA 4K73A 2IGFH 1UM5L 3EW3B 4OZIE 3KYMB 4UB0H 1C16A 2IVFC 3QCUL 5HGDA 5JW5A 3GDBA 1BXXA 4MXVF 3KWUA 5D7IE 2WMPB 4G8GE 5ANME 4FQCL 5DJ6A 5CLTA 5IW1A 1KLUA 1XF3A 3DARA 3MLRH 4B41A 1X7SA 1XXDC 4XP4L 4PP1D 2G0KA 2X9XA 3BDXA 3CQPA 3QO0B 2PR4H 2VW6A 3N44F 4FG2A 4BKSC 4UT9A 1F90L 2ZUSA 5LG1A 3R7RA 3WUZA 3KPSD 1KMGA 2X4SB 3IDNB 3NCXA 4S1SL 3POHA 1XFPA 4GW1A 5CILL 3N44B 3RDTA 5A16A 4JRLA 1QRNB 4DNLA 3THML 1IC4H 1L9PA 1NC2D 1AHWA 4F7MB 2WKOF 2R69L 5LXGL 4K71C 2HRPL 4YVNA 3HNVH 3W0WB 2ITDA 4L4VB 1PY4A 3L6FB 5GRUH 3WV0A 5A2LH 3M46A 2WXQA 3LS4H 4APQB 5FHBH 4OZHF 3FT4A 1NCDL 4ODXB 1UYWL 5IW6B 3L4CA 4JBSA 2D03H 2YMXH 4GH7B 2MQ0A 4X9YA 1JZ2A 4OZHB 3VXOA 1S9VA 2G4EA 3CZUB 3IDMB 3VXTB 3Q5TA 3F7VA 3LN4A 4FKHA 1XGZA 2XU9A 1DLHB 2H7WA 2P44B 4N8PA 3ZKMD 1GYUA 1IM9D 4Y1SA 1OHZA 5A43C 2WBKA 4MB4A 2BH0A 2W94A 1J1XH 2BXZA 1DBML 1D5XB 1PEZA 5AZ2H 4P2QE 4PB0H 4JHZA 2E0PA 2PPDA 5GGUB 1CQKA 4ZMVA 2QR0B 3F6LA 2XWXA 4J28A 5T1LB 1G9NH 4Z3IA 1WCQA 2JB6A 1JWUB 3N1GC 1NGZA 2WO4A 3UZEA 4XVUC 3SDAA 3FTGA 3VD4A 3NSFA 3ALPA 4R2GD 5KWYC 2P8MB 4XNDA 4EKXA 4N2CA 1F11A 4N0CC 5IHLB 4GYBA 3QUZD 1HC1A 4PUBL 4G43A 5JXAL 4R84A 1QTPA 3KYAA 4OGAD 3LDBB 1WAAA 1KCUH 1YSOA 2G4GA 4PVBA 3LZFH 4QKTA 2D2OA 3QXWA 4GO8A 1CYWA 4EIGB 1NDGA 1UD5A 1X3DA 4J3OH 3S0PA 1J5IA 3WIHH 4H1LA 3WNNA 1N7MH 3N9GL 4KI5F 4TVPL 1B4LA 2VZUA 4H8WH 4BWWA 3CCHA 3CIQA 1RSYA 3QFJE 3S3PA 2IBGA 5HI4D 2IJ0C 3PWUB 3KEHA 1NPJA 3KYNA 1WFMA 5IBTH 5I18H 1OAJA 1ND0A 2X70A 1GCYA 5AVZB 1BZEA 4JDZB 1QSZA 1KZQA 2ZYHA 2JCCF 3ARYA 4YDMA 5C0AD 3MRGA 5FHAH 3PJSA 1FFRA 4GSDH 3GXMA 4B3VA 1O7DC 2H3KA 5ESVB 4TMPA 3V4VA 4K23L 1GAFL 2FYYB 2JCCB 3QRGL 5I76A 1AXSB 2A74A 4OQ1A 1X5ZA 2WIIA 4G6KH 2H0FA 2J6EL 4M7JH 2WANA 3TWYA 4W9GC 4X42A 1E9OB 2CBOA 4PTTB 1Z2KA 4JAMB 3VB8A 1YN7B 2FD6L 2PW2B 3O3DA 4QHLA 5F0PB 5I73B 4JE4B 4QTHB 2Q20A 3UTSA 2HH0H 4F92B 4JJ5A 1AS7A 4UBDC 1Q1PA 2JELL 2P80D 3K6DA 3KPRD 3OLGA 6FABL 3L16A 3VH8A 1L3WA 3U9UA 5EZPA 2ADIB 2EO9A 3LOWA 3MLWL 4YHLL 3ZTEA 3LRHA 4MA8L 3STBA 1UWGL 2G5UA 1P84J 1BIIA 3OKKB 3FTYA 4ONGH 2WTRA 3LJ3A 2R39A 3S5LB 1ZVHA 3FT3B 4PJCF 5C08E 1U8KA 4AIZB 1EAPB 3OR6B 4Y5YB 1MCEA 2H0JA 4LOVA 5MEQB 4G6FB 4PJCB 4KJYB 3NRPA 2ZCHH 1N0LA 2RA1A 3KPQA 2P5WA 3UCRA 3EHBC 1KIUB 4OCSL 4G3YL 4DUXA 4C56D 1RPKA 1KY6A 4YDKL 3BAIA 4OI8A 32C2A 1A4AA 4JFDA 4NQCD 2AQTA 2V2WA 1F2QA 3V7AE 1OQOA 2OYLA 4E68A 4AEEA 5T3ZE 3M1CA 5EZOH 3FFCA 2AXWA 4O02A 3QUMH 3V6BR 4PGBB 2IANB 4AE1A 3NFNB 3OMAB 3UYRH 2IBBA 4LAJH 2ZF9A 2VIRA 4P5TA 4ZUSB 3IAQA 4AJYV 3FH7A 1I7ZB 4LSSH 4BIKA 2EUVA 2DBLH 3FTZA 2CNYA 3FQNB 1ETA1 3QZOA 3KXFE 2BVYA 5ADPL 1KB9J 2JIXA 2R2HB 4PJFA 5EU5A 3TJHD 3HNTH 5EOCL 2NX5E 4LIQL 3VFVA 3QNXA 1TJIL 4IYKA 1AZRA 1M7DB 4J3OG 3KNBA 3GM8A 4Q9BA 2MPAL 1A65A 1AGBA 2WM0A 3VXMB 1OO2A 3VFRB 4L8SA 3T3PF 1HL9A 1YEKH 1YG9A 1UWEL 1Z32X 2RBLA 2PXYD 1UADC 3Q3GA 3QDGB 4LLDB 4LLQB 2VDOH 5T1MA 3BN3B 3HHSA 4GFXA 3TBSB 1OWRM 3T3PB 4BK8A 3SZ6A 2WXIA 4Q7DA 5I30L 2DIJA 4ZMNA 1P53A 1GVIA 2EE0A 1W0WA 4U1JA 4E5XA 4XAWL 4IU2B 1Z9LA 1SYSB 2NSXA 5MERA 4PWEA 1XGQB 3VRLE 3VFMA 1RUPL 3K7UA 2F5BL 2HUEA 1BZ9A 5F7MC 2FATH 5B3JF 4HKZB 4K07A 3UTQA 3QH3B 5D2NB 5HTSA 3EFFA 1OSYA 1IAKB 1D7CA 2V7NB 2OMZB 4LLUA 2EP6A 3LD8B 2X44D 4HYTB 4G5AA 4BH7B 3L5WA 3RFZC 4JFTA 4XPFH 3LQZA 1E2WA 2H4EA 1K2DB 1T1YB 3NA9L 5C09A 4ORZC 5KSVB 3WLBB 3SOBL 4TYUA 3SPGA 4KO7A 5HGAA 2Z31C 5C86A 4PBWD 3SEPA 4TQPA 3UMTA 1ECYA 2ZWNA 5HYSG 4ES9A 4NM8H 4HC1H 3QS2A 4HAKA 1QR1A 1B3JA 4WW1A 2D9QB 1S3RA 4XP6H 3S5ZA 2NY6C 3E2HC 3GBDA 2BIIA 1T0MA 2WZ5A 5SWSB 4WNJA 4LPCA 3MYJA 1XGYH 1WBZB 4HW6A 3AW5A 1KT2B 5ELIA 3WMPA 4L5FL 2WTPA 4X7TB 4KXZI 1FJ1A 1JI1A 5C97A 4RMTA 2FWOA 5IMOA 1IGFH 3H42L 5EEVA 2DN7A 3G08A 2R27A 4QJ3B 3T4AB 2PWDA 3H3PH 2APBA 1NUGA 2HAZA 4BWTA 2K8QA 3CHXA 3ZBMA 2YAHA 1QI4A 3NEEA 4LSUL 4OUOA 4XPBH 5EBGA 4FQXB 5CF3A 1Q90A 4H5SA 4R90L 3M45A 1DQLL 1U2HA 3MCLH 3HG1D 2RTTA 3IPBA 4AYSA 3ROOA 3CC5A 1HFUA 3NGBC 4JDEB 4HPOL 3EYSL 4W9DC 5D1XC 4HWBL 1DBJH 3O6MH 4UBDD 1I75A 4J23A 4DGYL 1A7RH 2Y07L 4KVCL 3NVQA 3APNA 4GIOA 3KPMA 4GP5B 2WLMA 1MJ7L 1JOIA 3QXAA 4MNQE 4W93A 1S3KL 2CM5A 4PW3A 3SBQA 4XMKL 2DQDH 3WFHB 5HHOE 2F6AA 5FM5O 5SX5H 1NLDH 4YLBA 1X4YA 2P7TA 2GC7C 4IW4C 5E2UH 2J5LC 2LOEA 1RFDH 1C1EL 2CLRA 4MBOA 2Y1AA 8FABB 2EDLA 4I7ZC 4EE2A 3LCYA 1C5CL 1GJUA 4Z95H 4BCZA 1I31A 4M6NL 4JCWA 2ZOKA 2AI0H 3D25B 3WKNA 3S35L 5JHMA 2WOBA 2YD3A 4JM2C 1OANA 1NCHA 3SJVD 4XTRD 3TJPA 1NANI 1CJYA 4XC3L 3MNVA 4MTMA 4PBXA 1N5AB 3PPEA 4IRJB 3L95B 1FSKC 1WAPA 4RA3A 4E9SA 3GRWH 3OKLA 4F9LC 1I1CA 2GBVA 4HUVB 1UB5A 2OULB 4N22A 3PQYB 4JO1L 2H8PA 2BP8B 3GBNL 4OD2B 5E03A 4DTGH 5DFWH 3A23A 4PTUA 3RE0A 3B2VH 2P8LB 2EYSB 2QJDA 2J25A 3S3DB 4MA3A 2EYTA 3KPPA 3Q6GH 5BVJB 3KS0H 5DJCB 2FL5B 3U4KA 5F89B 2DV6A 5C07B 2CDGA 3OGCB 4V2CB 2DLGA 4JUTA 5L6YL 2YWYA 2K4WA 4PJDA 4K5PA 4PJEF 1OP3H 5LVEA 3BEWA 3QHZH 3T0EA 1CIUA 2PTTB 1JWSB 5DYOA 4BJLA 3MO1A 4PJEB 3C9NA 4WI7A 3H53A 5D93B 3WE6A 3SKNB 1D5BA 4JRXB 1HEZA 1DQQB 1T1WB 1YEDB 3B9AA 1TZIA 1E8WA 2JWYA 4LLMA 2D7PA 5E51A 2NY4D 1NFAA 4PV8A 2XTJB 5EORH 4CU7A 5MI0C 4FLQA 3REVA 4ODSL 2PPFA 2EAEA 2P5EA 5DZOA 3WHE0 2P3YA 3X1EA 1R5VA 3O6LL 2EC8A 3RKPA 3T2OA 5F7EH 5KSBE 4YL4A 1NMBH 1XGPA 4UQEA 3D18B 5J3HC 1D2OA 1SJEA 2H2PC 4U1MB 1ET5A 5F3FA 1TR7A 3TZVB 4G8EB 3D05A 4UI2A 4MZRA 1OCZB 2P48B 2PWGA 1FFNA 4AITA 2ZAIA 4NGHL