2FE0A

Nmr structure of smp-1 (small myristoylated protein) from leishmania major
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
131
structure length
131
Chain Sequence
MGCGASSENSSVTYVNGRPTFVGEEVTKGFEKDNGLLFRIVNKKKKQWAYYNDTTQYEMHVLVTFNEDCDIKALGKTKLEQQENGEWVASVVVYPCETEMFIEGRVNGFKSKMDALPLSEEYRQHQAEKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small myristoylated protein 1
publication title Function, membrane targetting and structure of SMP-1
rcsb
source organism Leishmania major
molecule tags Protein transport, membrane protein
total genus 15
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09149 DUF1935 Domain of unknown function (DUF1935)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fe0A01
6TAAA 1B2YA 2ZX7A 4U3CA 5CGTA 4UOZA 2PWHA 4FLQA 4PSRA 2EABA 2BY3A 4B9ZA 1QWUA 4HA1A 2QMJA 3II1A 1MW1A 1R46A 1VB9A 4KMQA 1UKQA 1BG9A 3H55A 1JAEA 3KL3A 3VSVA 1EH9A 1KXHA 3WNKA 2BHYA 4LPCA 2XN0A 3EDJA 3HG2A 2XIIA 2X2HA 5CLWA 1XH1A 1G5AA 2YKKA 2VRQA 3L4YA 3M07A 1QW8A 3VGFA 3WY1A 3CTTA 1J0JA 4M56A 1J0KA 1XD1A 4J3XA 4OJYA 1KWGA 1LWJA 4AYSA 3RIKA 9CGTA 1QI3A 3K8MA 4HOWA 1JD9A 1IV8A 3AXHA 4OGZA 1AQHA 1WZAA 1G94A 2E4TA 5E70A 1UD3A 4UQBA 3BMVA 1DEDA 2J25A 1KBKA 2DH2A 1V3KA 3KLKA 3S5ZA 1TQTA 4AYGA 2CHNA 2WANA 2ALWA 2FE0A 1VFUA 2ZUTA 3BLKA 1HT6A 5HXMA 2PWGA 3FW6A 4CKQA 3LPOA 5A6LA 3WNPA 2Y2WA 2F1AA 1IZJA 1XSJA 4AW7A 3CZGA 1DHKA 3BC9A 3IJ7A 4NI3A 5CGMA 3WFZA 3TOPA 4JFVA 2DH3A 1S46A 2G3MA 4U2ZA 5I5RA 3WN6A 3BVWA 2YA2A 4H7VA 2FHCA 1U30A 4FMVA 1XCXA 3OLGA 1HX0A 3LXAA 4JCMA 1CYGA 3VMOA 3KE0A 4AIEA 4U2YA 2EEXA 4GQRA 1BVNP 1UA3A 2ZX6A 4LQ1A 3WDJA 3WDIA 4JFTA 4TVUA 2D0FA 1MVYA 3OLIA 3VM7A 1HWWA 7CGTA 3S2CA 3ZQ9A 3WEOA 3BVVA 4JCLA 3UERA 2D73A 2ZUWA 3BUIA 3UG4A 2YA0A 1KWKA 4H2CA 2BHZA 2DIJA 2GUYA 1BPLB 1UD5A 1IZKA 3HG5A 1PPIA 1R47A 1JF6A 3HJEA 4PEEA 1G1YA 3A4AA 3LXBA 1QI5A 3UEQA 1J0HA 4J3WA 1W9XA 2XVLA 1KBBA 2D3NA 3DX3A 4FNRA 1RP8A 1VJSA 1WO2A 2XN1A 2ZXAA 3D4YA 2V3EA 3LRKA 2FH8A 4CVWA 3TTYA 3EJRA 1V3LA 3K8LA 1CPUA 1JI2A 4NXKA 3H54A 2ZUUA 1WP6A 3EJQA 4AIOA 3TV8A 2NT1A 2NT0A 2BHUA 3BVUA 1UOKA 3AMKA 1E3ZA 2XVGA 4FLOA 2EACA 3WENA 4NZJA 1ZS2A 6CGTA 2YFOA 3CZEA 1H3GA 2VR5A 3CZKA 3GTNA 5A6MA 4GI6A 5A2CA 3A5VA 4MAZA 4NZFA 2PWDA 1CLVA 3BAXA 3ZSSA 2E0PA 4J7RA 5I0DA 1JF5A 1TQVA 4FNUA 2Y5EA 2WNWA 1KGUA 1QI4A 1WE5A 1OGSA 2FYVA 2YA1A 3L4ZA 1AQMA 3EDDA 3ECQA 2PWFA 3CLWA 2WSPA 3WY4A 1Z32X 2YJQA 3IGUA 4H8VA 2QPSA 4WF7A 3TONA 1XD0A 4AMXA 1JXKA 4B9YA 3GBDA 3WELA 1O7DC 1SMAA 3CV5A 3VMNA 1RP9A 3EJUA 2EO7A 2WVSA 3AXIA 4BA0A 2QV4A 2Z1KA 2D2OA 3BLPX 5BRPA 4FNQA 1JDAA 2GJPA 2WKGA 3IK2A 4JFSA 4UQAA 5DFAA 1I75A 2NSXA 1R33A 3GBEA 1CGYA 2FGZA 1JI1A 2ZICA 4UQEA 2BXYA 4H8HA 2IGTA 4CN6A 4HP5A 3ZR5A 1WPCA 3GXNA 2XN2A 3CZLA 1KTCA 2ZWYA 1OT1A 4NX0A 4DO4A 1XGZA 2PWEA 1KGWA 3ZT7A 1VIWA 3BCDA 4GI8A 2WKLA 3LRLA 3CPUA 3VX0A 2WC7A 3D51A 1C8QA 3HG4A 1RPKA 1TQWA 2WCSA 2F61A 2WSKA 2C7FA 2X2JA 1OSEA 4X9YA 1CXHA 1JL8A 1HNYA 3WY3A 4PSPA 2WVVA 3BUPA 3A24A 1UKTA 1UH4A 3L4XA 2YFNA 1LWHA 1QPKA 2D0HA 2WPGA 3BMWA 1JGIA 2D3LA 4J3UA 3VMPA 3HG3A 1ZJBA 1UD8A 1KGXA 2VT0A 3BVXA 2GVYA 1Q4NX 1R75A 5I23A 1CGUA 4J28A 3MI6A 3GXTA 7TAAA 1R34A 1BF2A 2BY0A 4UZUA 2OSXA 3VGHA 3WNMA 3CZSA 3BUQA 1EO7A 3BSGA 3VX1A 4BZYA 4NXSA 3L2MA 3K8KA 3BH4A 3D52A 3IJ9A 4GQQA 4FNPA 1WZLA 1V3MA 3GXFA 1MW0A 2ZIDA 4J3TA 3ZOAA 1VFMA 3DDGA 3W38A 1CGTA 1XCWA 3DHPA 3DX1A 2FH6A 2EADA 3LXCA 4JFWA 3VU2A 3ZT6A 1D7FA 3ZT5A 1MWOA 1UKSA 1L0PA 1VFOA 1TQSA 3WNOA 1JG9A 1ZJAA 2Y24A 4ATWA 1CXLA 1PS3A 4PCSA 3UG5A 3GXIA 1PZ2A 4DO6A 2DIEA 4WSJA 2GJRA 5EMYA 2BY1A 3BAJA 3A23A 2AAAA 3VNZA 1UASA 3L4WA 2OYKA 4J3VA 1WZMA 1JD7A 2F7PA 2F7RA 1JIBA 2OYMA 3HZ3A 4CN1A 2F18A 1MXGA 3L4TA 2ZUVA 2OW6A 1HTYA 5E9AA 1KCKA 1KXQA 2ZUSA 1P6WA 4GO9A 1CGWA 2BXZA 2F7OA 2AMGA 2XVKA 3DC0A 1XSKA 2ZXQA 1GJUA 1QWNA 1SMDA 8CGTA 1TCMA 4JL2A 2TAAA 1PIFA 1NM9A 3BAYA 3VNYA 4LXFA 3FAWA 1EHAA 2ZX9A 1HVXA 2VUYA 3GXPA 4UZSA 4DO5A 1M7XA 1WZKA 5F7UA 3UG3A 2V3FA 3KL0A 1MXDA 1HL8A 3BVTA 1GJWA 2XIBA 3D4ZA 1UH2A 5E1QA 4UQDA 3BAWA 3S5YA 3D50A 1CXIA 2D0GA 3EJPA 5DO8A 1G9HA 4AEEA 2F2HA 4HPHA 3ZSTA 1QX1A 1KTBA 2XWEA 3WNNA 1JDDA 1EA9C 3LRMA 1PZ3A 4OIFA 1CXFA 1OT2A 2OSWA 4UOQA 1MW2A 3LPPA 2EJ1A 5A2BA 2EAEA 5BRQA 4HOXA 3EDKA 3BAKA 4JL1A 3GXMA 1ODUA 2VRKA 4KWUA 1XSIA 5E6ZA 5HPOA 1OB0A 3VGDA 2OW7A 1VAHA 4WLCA 2E8ZA 2ZE0A 4UNIA 3EJTA 1UD2A 2WVVB 2C8NA 3A47A 3L4VA 3BAIA 3AJ7A 5I24A 3RILA 3A22A 2YOCA 3WY2A 5KEZA 3EDFA 3CZNA 1DTUA 2WCGA 1Y7VA 1SZNA 3ZO9A 1MW3A 4AEFA 3KWXA 3EDEA 3BLBA 3LX9A 1D3CA 1PJ9A 4OKDA 4UCFA 2F1BA 2XWDA 3L4UA 5HDRA 2QMKA 3DX0A 3BCFA 5A2AA 2Y4SA 3EJSA 1BSIA 3IJ8A 2FHFA 5E0FA 2QPUA 2OSYA 1BVZA 2QLYA 3KEHA 5E6YA 1E3XA 3AMLA 4UQ9A 3ZR6A 4PCTA 3DHUA 3FAXA 1CIUA 1QHOA 3H53A 3QGVA 3VSTA 3VSUA 4J27A 3WMSA 4GO8A 4UQCA 4U31A 1KCLA 1A47A 1UH3A 2CPUA 3BUDA 1CGVA 3GXDA 4GIAA 1QHPA 4M8UA 3A6OA 4W93A 4WSKA 2YIHA 3TTSA 3UCQA 4HOZA 3KL5A 5CXPA 3WNLA 2FHBA 4MB1A 1KXTA 1TMQA 1HXKA 1T0OA 1QW9A 3VGEA 4QAWA 1XV8A 2CXGA 1NOFA 4U33A 3DX2A 2ZWZA 3OLDA 3WDHA 2ZX8A 5CLTA 4GKLA 4FLSA 4CGTA 1TQUA 1MFVA 3CGTA 1JFHA 1B0IA 4GINA 1E40A 1JXJA 2E8YA 2V3DA 3OLEA 5TD4A 1U2YA 4E2OA 2ZXBA 1KB3A 1KXVA 3WEMA 1CXKA 3W37A 3VGGA 1HL9A 3DDFA 1AVAA 1U33A 1GVIA 1UD4A 1XH0A 1E43A 3VO0A 1AMYA 4FNSA 1CDGA 1PAMA 1CXEA 2VNCA 3A21A 3CC1A 3K1DA 4FNTA 2X2IA 3VM5A 4CN4A 1JDCA 4AMWA 1J0IA 3KLLA 1GCYA 1V3JA 2F7QA 2ZX5A 3L2LA 4H8UA 2WVUA 2OYLA 1UA7A 4GI9A 3VGBA 3BSHA 2BY2A 1BLIA 4J3SA 2EQDA 4X0NA 3BUBA 1BAGA 1PEZA 1XH2A 1MFUA 4XB3A 1EO5A 1M53A 3DX4A 1PIGA 1UD6A 2E9BA 4FLRA 2WVTA 2ZXDA 1CGXA 2G3NA 4JFUA
chains in the Genus database with same CATH superfamily
3W82A 4NKDB 5L0QC 1D7CA 1FZMA 4RQQA 5G4OA 1A7NH 2PWHA 5DUML 1DBAL 2XX1A 5E94B 1PCXA 5GRYA 2EILB 1FCGA 1EHNA 1URZA 3SPIA 3DX7A 1WD8A 4TULH 4NYLA 1BQHG 3OAWA 2CA4A 4M8RA 2WSDA 1LJMA 2BSSA 1YPZE 4N2NA 2C9SA 4K94L 3VSVA 2Z8VC 1U8CB 2CBQA 4MS6A 4PWHA 3ARFA 1OGAA 1QQDB 2QQNL 1IFHH 2HPTA 3VFPA 3ROLA 5IMOA 2FATH 5JPMB 3KPSE 5AW5B 5EU4B 1N0LA 4XC1H 2QKSA 1KWGA 1NBZA 2IANB 3RIKA 1T20B 1OE3A 1BOGA 1NCOA 3LZFH 3OZKA 4ERSL 4OGZA 3KWVA 4OGYL 5E70A 1AZBA 2ENYA 3QJFA 3KGUA 5I76A 3K0WA 2RCSL 4M00A 3WL9A 4FHBD 2K9FB 4JQVC 2EDWA 1T22A 3MREA 2ALWA 1R5VB 4LCWB 4R26L 5SWSB 4QXGL 3L9YA 2F58H 1MF2H 3S8WA 1E2ZA 2FQGA 2XWBB 1FG2B 2PWGA 5DVNA 4YXKL 1CE6B 3JWDH 1N68A 1OWRM 3L1OL 4XMVA 4URTB 1X5AA 2CGZA 3JV4B 5DZAA 4N8UA 2EEBA 4QHNB 3TN0C 3TOPA 5D2NA 4U2ZA 1PNCA 5CBEB 4JRYA 2FHCA 5EFIA 3WTWA 5I1DB 1QRND 1CO1A 1KYDA 2CJ3A 2H1LM 3H42H 5FHAH 4F20A 2MKLC 3VTMA 4RA0C 4OZIE 3PWPE 1RH8A 1I8LA 5I5JA 4IOSA 2EUXA 1OAQH 2O6PA 2OX5B 4KKZA 2FWOB 3RUGA 1HEZB 1VSCA 3U79A 4KI5E 4ODHH 4WEBH 3QRGH 5DHXB 3GZOA 1FNLA 1ULVA 2GCYA 3B3IA 2UVFA 1LO0H 3LKNA 2X12A 5LAPA 1HILA 4G42A 4JFTA 4XMPL 3ARDC 4HQQH 1GYAA 1MIEL 3MFFB 4ACTA 3S2CA 3D0AA 1B0WA 4I4WA 3S8GB 4OTXL 4JCLA 2E6QA 1A1OA 2X0VA 5DK2A 1MFMA 4XCEA 2Y7NA 4HEMA 1MAMH 2QPEB 3MRFA 1I53A 5E6IC 1Q9OA 2K3TA 3E6FB 3QYNA 3DVIA 3B7TA 4YGVA 4BK5A 3CVIL 2HLFC 3H9SE 3PGFL 4NKMA 3QNYB 4L18A 4M48L 4ZDHB 3RVWD 3IJEB 2XN1A 1MRFL 1CWVA 4TUUA 2EXYD 4G6FB 4A7GA 3IBEA 3EJRA 2V6HA 3ZZ1A 2ZP0T 1JUFB 3BXNB 2Z6FA 2IMNA 3Q01A 5DZPA 4APQD 3L5JA 3SDXF 3JSSA 4Y19B 1MCOL 5FYJL 4LAJH 4HIHA 1G9NH 1WYJA 3FRUA 3L3IB 3ZZSA 3MNZB 3NG5A 4FNLH 1P7QB 2HTLC 1UOKA 2LU5A 2VMEA 4TSBH 1A7PH 3N0AA 4NFBA 1OSPH 1QO3A 5JHDA 5JLZA 3U2IA 4W4OA 2F08A 4CVUA 4GRMA 2C7UA 4OJDH 1RUMH 2MNJB 2AEOA 1ACZA 2GITB 3UCRA 2OMZB 3QJHB 3ZSSA 5C71A 1YC7A 1DJSA 1JF5A 1OB1B 4YHKH 3WFBL 3GMMA 3HR6A 1MHPH 3UAJC 4B9PA 1VADA 1AXTL 3CHXA 4B9GA 4KOCA 3NACH 1Q9KA 2J2ZB 2OULB 4K7PH 4ONFL 2GBVA 5IMLA 4C83A 5J1SC 4PJ9B 4CDGC 4DAGH 1I8UA 5IB5B 1A0QL 5D93C 2CIIA 4KHXH 4XP6L 5C07A 4MAYD 4PI0A 3FO2B 5HGBB 1SMAA 3BP6B 4KAQL 1RZKL 4XODA 4P9HL 3TESA 2XBTA 1PSKL 2EO7A 3SDAC 5JIKA 5JHDE 2B9AA 5AB2A 1HK6A 1GGTA 5IJKA 1PAZA 5IB2B 3F6LA 1LHZA 2HH0L 2ITFA 4PWGA 1EXHA 1JMZA 4H8WC 2K45A 3RRQA 2GJJA 3IM1A 3HRZB 4AUJA 1KLFA 3MXWH 4X4XA 4G6JH 1SOQA 1SM3H 4UQEA 5IROD 5FO9B 3PAYA 1RV6X 1ACYH 3OKEA 2ZOLA 5F1KC 3WIHA 1TKWA 4Z7AA 4YIQA 1MVFA 4U7KA 2ITEA 4HWZB 4AKOA 3RE0A 2GPZA 4FFZH 2VDPL 5DU7A 4DFHA 4RSYA 4NKOB 4BKSC 1AGBB 2X4UA 1RULH 1KTLB 1UC6A 3WS3B 4TXVB 4PJDF 3GJFK 3H7LA 3MUJA 3HNTH 3LIZH 4MQ7B 5DO2C 1W0VB 4HD9A 4QRBA 2X6BA 1HCVA 3ETBJ 3ULVC 3GM8A 3I02B 3PIQA 4OCLC 1UOLA 4D9QE 4YSSA 5EU5B 1PMYA 3PQYB 1FZJA 1NFDE 3I2CL 3A6CH 2PW2A 3QNZB 4NO3A 3G6JB 4WI9A 1LO3L 1E6JH 1CGUA 1R24A 4GAJL 1BWWA 1IBGL 4FXGB 2NW3A 4BFIA 4GS7B 3RGVC 2R2EB 1OARH 4EQ2A 3KW7A 3ARED 4KV5E 1H5BC 4OZGE 3UJJH 5J6HB 1AANA 2J8UA 1EO7A 5FPIA 2QQKL 3K8KA 5C0BD 4H1LG 1RZ8A 3NCFB 4YS4A 2V33A 4L3CA 4F8TA 1RJZB 3CH1A 4WZ9A 4PS7A 4MJ5A 4DUVA 4X8CA 1FNSL 3EFDH 2FWSA 2XG4B 1I7UB 1H3WM 4K71B 2QEJA 2X28A 5K9KB 1BEXA 3NSYA 1SHWA 2GK0A 3TZVB 2G5BB 3GMQA 1CZ8L 3Q1SH 1FVEB 3IXTA 4LCIH 5D2LE 3AQZA 1T21B 4KROC 4X9GA 3VU2A 3ZT6A 1T7WA 3OX8A 4JJOA 1K8DA 3H3PH 4PRIA 1D7FA 3V5DB 3ZT5A 2NY3D 3FT3B 5DZLA 2IBZX 3VXSB 2BNQA 5LBSH 1NBVH 1Q0YH 3UPRB 2JCWA 3CLFL 4PVLA 4Y4HB 2AJSL 1G6RL 5D4JA 4DUWA 1DUYA 4HKXA 3RPKA 4MD4A 2FX8H 1RQ5A 2AAAA 2R4SL 4DZBA 3L4WA 2XBZA 4O51A 4RWYH 1OP5H 1RK1A 3T6ZA 4BFFA 4GUQA 4M7ZB 4AC4A 1AGDA 4MMZB 5EC1A 2AANA 2VYRE 2WJ5A 4ANWA 1U21A 4X50A 1KG0A 1PZBA 1U2HA 3FU5A 1JGUH 4FFWD 4BKTC 4BWTA 4OBSA 4R4FH 5FYKH 4Z0XA 4IJ3B 4ZZFA 3NJKA 2IPKA 3AXLA 1OAKL 1OD7A 3L08A 4WCYH 5EU6D 3LS4L 4PRIE 4NT6A 4M5ZL 1RZ7H 5D7IF 2IAMB 1JWSA 3ZE2F 2F54B 2H2SC 1BD2E 4NDMA 3RWHA 5I6XC 4JFOB 1YMME 2BRQA 2BNRA 5ELIA 4PIRF 4R5VA 5KS9B 3CFMA 4XXWA 3QW9A 2XY2A 3DK0A 3QR2A 2L7QA 1CDIA 2V5MA 3VXUE 1RXLA 3UTSA 1NGQH 2Y6SC 4M6OH 4UOJA 3P9LB 4JFXA 2FJSA 3O4LE 3MRNB 3Q9QA 4NGHL 3V4VB 4YSDA 3GI9L 4KFZC 1A3RL 1IIIA 2GY5A 2IPUK 1ZHNB 4MLIA 4XP5L 3E80A 5KANI 2A9CA 3MRRA 3DUSB 5DMJB 3OAYH 3HZYB 4M4RB 4WJ5B 3FQUB 3D0VA 2VDKL 4XCNB 4PHXA 1SEQH 3KGSA 1IIKA 3ZTJH 1JK9A 4NQDB 3TJEH 2MOVA 1N8OE 3UBXB 2EDYA 3K5SA 2YK1H 5ES4B 3OAUL 4KWUA 3OJDB 3EAKA 2AEQL 4E42A 2A9MH 4XBEH 1FUNA 3QFDA 3UJIH 1DQQA 2BVOB 4OZFG 4WO4D 1A2YA 3ARGB 4LVOC 2HT2C 3JVGA 4XN9A 3RILA 4EJ1C 4FQQA 2NOYA 3KAAA 3ZO9A 1FO0B 3QHTC 2ADFH 4HC1L 3T9WA 1OZUA 1AC6A 3NCYP 3DPBB 4QD2E 1ICTA 2PP7A 2XZAH 3L3OB 1RU9H 3I85A 4YSQA 1BREA 3D05A 3QUYA 4AK2A 5E0FA 1URIA 1VKXA 3GBMH 2IADB 2R9HD 3GUTA 3T4YB 4JNXA 4ZTPL 5KSBE 1XO8A 4D0CB 1IEAB 2AJXL 4GIOA 2OBGA 2OMXB 1HAWA 2I32A 2R0ZL 2XYCA 4OQTH 4HUUA 3GRBA 2A1WL 4IIQC 3WXVL 4ECNA 4MB4A 4PRAB 3KLSA 3RTQB 1UJ3A 4AIXA 4FQ1H 4ZJ9A 1JZDC 1XB8A 1QR4A 4ZNCD 2YPLA 1NC4A 4JFFE 1IUZA 1K6QH 2NYYD 5FX3A 2ZWZA 1U8MB 3HW7A 1Z9SA 2YAQA 5BZWB 1C5CH 4AOFA 2X1XR 2WBJC 1JFHA 4PI2A 3T2NL 3LD8C 5EUOA 5GRXG 5ITFA 1YJDL 2EH8H 3B1TA 3BAEL 4P46B 5CSBA 4Y4KD 1XIWD 5EO1A 3IAGC 3L81A 4PJHB 5D71H 4BQ6A 3NK4A 3Q5OA 4O2CA 2IFFH 3VD9A 2Q8AH 3SCMD 4P57B 3QPQD 5ILTL 3V7MA 2UX7A 4DN3H 3SDDA 5DEFA 1PAMA 4JHAL 5I74C 1HXMA 2O72A 3CC1A 4FEMA 1MHCA 2COQA 2K1MA 5AUMA 4XH2B 3BFQG 2XJKA 3HUJB 4B5ZA 5KYYA 3FBQA 4KJPC 3IAPA 4PB0L 3EJYD 4EXPX 2OYLA 1G7MB 5FO8B 2QSVA 3BQUC 2QVFB 4LQFL 3IDXL 3QAQA 1GGBH 2ZUXA 4RZCB 1XMWA 2QADC 1MFNA 2X4TB 3UTZA 2Z9TA 3BN3B 4XMKL 4HIEB 4LEBA 4HLEA 1AGEA 4TUJA 2IBZY 4OR1A 5J1AB 1J05A 3FT4B 3VD1A 3TVMB 5C2BH 4JREC 2DBLH 5SV3A 2R69L 4Q89A 4S1RL 1WC7B 1JFQL 2B77A 4PVNA 2VZOA 1BM7A 1CGSH 4X8JA 2YAFA 3IT8D 1RAMA 4QLRA 5J13C 2BSED 3QDJA 1NEUA 1QWUA 4HA1A 2CDFA 5EPMB 2WNXA 3REVA 4P2RA 5LN4A 3KR3L 4XNZB 2XTJE 3V5HB 1V7MH 3IBOA 3VD4A 1Q72H 1UKQA 4Y2OB 2OK0L 4BWUA 1BX2B 1OP3K 5EC2B 1PQZB 3EDJA 2B14A 4D0DA 1VFAB 5MEQA 5AL8A 5ALBL 5JNYB 1EXUA 1BVKA 2B4CL 2X6AA 4L8CA 2A6DA 3HKZA 2C3HA 4XMUA 5ISZA 5J06A 2NY1B 4MKMA 2DLIA 9CGTA 1JZ3A 3FTGA 3EYVA 1MI5B 5LG1A 5A2FA 1OM3H 1KB9J 2E4TA 2O5YL 3TNMA 4BWWA 5E5UB 4UMGA 4BQ9A 5K9QG 2GFBB 1AE6L 4LLQB 5DVOA 5I8KH 3GGWA 2VN7A 1JV2A 2KH2B 3OPZH 2PPCA 4XHJC 1SFDA 3RIFK 4JR9H 3BUYB 5HVHB 3CZFB 4U0RC 1MFEL 1S7UB 2WYHA 3LHAA 2FJHB 2HX7A 1YY9C 3QWRD 2VDLB 4XPTH 2J5WA 3BC9A 3VD3A 2B1HL 2MFNA 1W8NA 3CDGB 4MJIA 3L7FA 3ES6B 1T6WA 4JFVA 5DZNA 3ET9F 4A04A 1B4JH 1CU4L 4WFFD 1KENL 3FPXA 4NZUH 5A3ID 1DQML 5DHMC 1YEKH 4BV1A 4B0MB 2NRDA 3OLGA 4U6YA 4JFYB 4NWTH 5GZND 5TE7H 3VFSB 3NCJL 25C8H 3I6LD 4OCSH 4L4TE 4M6NL 3CU7A 1G7JB 4JVPA 2JELH 3RFZA 4ALAC 5B38G 3CFCL 3AWEA 1BVNP 4ZFFA 2OJEA 3NIDB 4HXAL 2X1QA 4LSTH 4OD1L 5E2JA 3WLBA 5L8JB 4P23D 2A99A 3BPLC 3MV8B 3R06B 4IKLA 1RFDL 2OP4L 4GUPA 2ENJA 3TA3C 3EFOB 1M9SA 4NM4L 3W9EA 1BGXH 1QTPA 3GMLB 2WYZA 4EI5B 1UZ8B 2Y7OA 3SHSA 2OMUB 4AVIA 2AS5M 4ZYKA 3LXBA 4WFED 3VB8A 4JHWL 1DSWA 1S7WA 2BFVL 3N91A 4LCYA 4P3DA 4LGSB 3P4OA 4P3CL 5FM5O 3PWNA 4JS7A 2EXWD 5GGSB 3G9AB 1EIBA 2EYSA 1OK0A 4V1DD 2LGNA 4UDTB 1M1XB 4ZFQA 2ERJB 2MJWA 2Q8BH 3RHWK 3F7YA 1IAKA 5T1KD 2OJZL 2C3VB 3TV8A 3OB0K 2NT0A 1UWEL 1T80A 1HN1A 2BHUA 4KKBD 3F83A 4Y4FA 2CHDA 5LGHL 2FJGB 2VSMB 1SJEA 4O02L 2PTVA 5FYKE 2R2BA 2J7LA 3A5VA 2Y07L 4P2OC 4XT1C 4MNQD 5IIEB 2AAVA 2ZCKL 2ZG1A 2VL5A 2Q87A 4PJ7E 3HB3C 4HHAA 4YNYB 5ERWB 3U4AA 3VFVB 5INDB 2Y5EA 4TRPL 2P5EE 4Q56A 1K8IA 3LN4B 4MB5A 3CVHL 3X1NA 3MROA 3ULSB 4JW3A 4HIXH 1AY1H 2LW3A 4WGWB 5T1MB 1SOSA 4JKMA 5CILH 5EOCJ 1P5UC 1QAWA 4X5WB 1CI3M 2R1WB 1J48A 4LCCC 4B9YA 5KBDA 5F7LB 1LDSA 2FT6A 4AYMC 4YHYB 5DHEA 2ZT9C 4Y1AE 5DA0B 4YDJB 5AQ0A 1RMFL 3NCBB 1SUHA 2H2PC 3NDZE 4AK1A 3UTQA 1V7NH 1MUJA 5HGAB 1E27A 1JDAA 2YPKA 1DQJB 5G4NA 3M17A 2E9GA 2ED6A 5D7LB 3BSZH 2VDRL 2C9UA 2KI6A 2FSEB 5B3SB 4TS6A 4K5PA 1CGYA 2A83A 2X40A 3RX8A 4UQIM 1MKFA 1ZGLA 1AHMA 1RHHA 4MXWH 4AZUA 5ICYB 4ZXBB 5C0RH 4KZDH 3T0EB 1LMKA 1MCWM 3QIBD 3OHXA 4HBCL 5ECGA 1S7XA 2XN2A 1PY0A 3WG7B 1PYWA 3KYOA 4I0PA 3LEVL 4XVUD 4NHUB 1RKRA 3PGCB 1B6DA 2LV4A 2JJSA 3GKWH 4WDIB 5E2VH 3OD3A 4G7VH 5ACZA 2OMWA 1RPKA 1MJJB 2VDPB 5JPNB 1YMHA 3RY4A 4EUPB 2K4AA 4XX1G 3GSOA 3ABZA 5L2JB 2Q5BA 4W9LC 3CFQA 3QPKA 32C2A 4JMXA 4G43A 3OPUA 4KKCD 4D7BA 4RAUA 4RRPM 4RCAA 3CN1A 1S9WB 1WT5A 2I69A 2P8PA 4XVTH 3ROOA 3RX9A 3IJYA 1LTXA 1VGKB 5HHMD 1JGIA 2D3LA 4M5YL 2L7UA 2A6IA 2G75A 3BKJH 5IKCA 2YD4A 1KGXA 2A9AA 1FVDA 4ODVL 3TFBA 3T1FA 3VI4B 1P1ZB 5KSAB 5DUPH 3DX9A 1TTGA 2JCCA 4KJYA 3TBSB 5I5MA 4KQ4H 1ZY9A 5B1CA 1RIUL 4DKAA 3ESMA 3T8XA 4LF3B 2ZNWA 3NVQA 5LAXA 1HL4A 1A4JA 3H0TB 4XO4A 1BFVL 4GLRH 2XN9E 5LXVA 2X3AA 2GAZB 1OTSD 1S9XB 3LPWA 5DHVA 3LQMA 4WI3A 3MJ6A 4ZX4A 1F00I 1GW0A 1Y0LA 3EOYG 1UQSB 3JV5A 4ZUSB 5HDBB 3EXLA 5ID1B 4IKJA 3MCLL 3DDGA 1MJ7L 4U1GC 1CGTA 4B9CA 4BE6A 2FH6A 2EADA 5IMMB 4U1SA 4R90L 1IARB 5CCKH 4ZAKD 4R97B 3QWOA 5EORL 3RL1A 1OF2A 2ZYSA 3OKNA 2ARJA 2DTSA 3IS0X 4FFVD 3L9EA 4PJXB 1L3WA 2Z8SA 4L8BA 5B22A 2RTTA 1WS7A 3QUMA 1KZYA 4QRPA 2GG1A 4YBQD 3NA4A 4YAQA 7PCYA 1D6EA 4TQHA 3RIAK 1LGVA 3H2QA 1KF9B 2XWJA 3QUXD 3BWAB 4JRWA 2ZSVB 3P9MB 4BFBD 5GRVK 4Z77B 2YGOA 1GGIH 1ZWIA 3ZDZB 2WWMD 4JPSA 5EU7E 3B9AA 3V0WL 4WHYH 2IG2H 2F7OA 4PY7A 1N7ML 1G9MC 2HN7A 5BZDA 4BHUI 5TE4L 1TCMA 3DOHA 1NAKH 2BWIA 4W6YB 5TFSL 4NHCL 1WCQA 4UT6H 4K2UH 4WUKL 3VXRD 4HS3B 5DQ9B 4NQSA 3RIFF 1YO4A 4DO5A 3C6LD 5KUKA 3ESPA 2IQ9L 1OIOA 3ARFC 1QOKA 4PJEA 3V6ZB 2N56A 2Q76B 2J1ZA 2DTMH 1EHLH 2XIBA 1MJ8H 5H37A 3BGFB 3PNRB 5K93A 3AM8A 3NH7L 2P26A 2DYSB 5CWSB 2D03L 2HKHH 3O6FD 4DPCX 3QORA 2QPFA 5AVZB 5I75B 2ETWA 2ATPA 2EDMA 3RZCA 4OUUB 4MCYA 5E94A 4M8QA 3VXMD 2CALA 4N5ED 4RX4A 4KI5C 2EJ1A 4MKTA 1YN7A 3LH8A 4MNGA 2GBUA 4N2LA 4P4KD 3RDTD 2H32A 3L3JB 1U8CA 4WJKB 4P5TA 4G9FD 5MEOB 1HHKB 4H44C 5E2TL 1QQDA 3ZBMA 3PWUA 1QRNB 5AOIA 5EU4A 1CT8A 3L4VA 1NCWH 4L23A 5D2NC 4D94A 2IANA 3KBEA 3OHMB 1FN4B 5FGBA 3ULUH 2Q10A 3KWXA 4E9LA 2K4WA 4R7DA 2UZXB 1HHIB 1NCHA 4JDZB 3L4UA 3FQ4A 1I8LC 4M29A 3HNVH 3BWZA 1UB5A 3QH3B 2VITB 4DK6A 1J5IA 4NQED 2FDBP 5DUBA 1R5VA 2Y7QB 3GB7A 1YEDB 1IAIH 1N5AA 5SWSA 4QKTA 2VQ4A 3BN9C 1FG2A 2PCXA 1ZT7B 5E6YA 3RHWF 5KYXB 4H0HB 5HJ3A 1KCWA 2F0CA 4OCNC 2CGRL 4KHTL 5BRZA 1H3XA 3LKSB 2DWDB 1S9YA 4K23H 1DE4B 5DD6B 4A6YA 5JW5B 3SE3A 1F58H 4RGOH 3PJLA 1K9TA 2XACC 4WSKA 1DSYA 1KLGB 4BIKA 2IANE 4TOYL 1RZPA 2WKOF 1U3HA 4ZPTB 5I1DA 1JTTA 3WNLA 4RSVA 1JOIA 3LEYL 3IXAB 1TMQA 1UJTA 4APQB 1MNNA 3QQ9C 5DLML 1JZ5A 1HCZA 3TPKA 3VQLA 4ICXA 1ADQL 2FWOA 3CFTA 3DX2A 1HEZA 2X9ZA 3WTYA 4QNPE 1F3JA 3FULA 4LCWE 1ESOA 1OAJA 1R17A 4L8DB 4YC2B 1WITA 1BLNB 5L2KD 2NMSA 2E8YA 2HFFA 3MA9H 1ZVHA 5GGVH 3TJHC 4DP9X 1FO0H 1N70A 4EN2A 5I8CB 1E5ZA 4HG4K 4EAEA 4HJSA 4E5XB 3DO4A 1QLEB 5TQ0L 2I60L 2VNCA 3IMRA 3OKLB 4NCC2 4BDVB 3VM5A 1NDMA 4UWQB 4JFDD 1DVTA 1ZE3C 3SDXB 3QNYA 4F7KA 1HSAB 1J12A 1A7RH 1JHKH 1EZVY 4F2EA 4G1MA 4HJGB 1DLHA 4X6BA 4PW4A 5C0IA 4GI9A 3VGBA 4UM9D 4XX1E 1EEQA 4Y19A 4MAYB 5E6ID 5E24E 2MQ0A 4Z9KB 4LAQL 3L3IA 2CO1A 2CMRH 4HIIB 3OF6A 1J0ZA 4F2FA 4KK9D 4FLRA 3WLWC 4PLOB 2F53D 2DQGH 3ZKMC 2E59A 4DETA 5C0NC 3JWOC 5MEPA 4C4BA 1D9KD 1CFQA 2CBOA 3ZMRA 2ZX7A 5LNGA 1E7VA 1IBBA 1TCRB 2BFGA 1CUOA 5MI0B 3U0PB 4QHLB 2PCFB 5E99H 2BY3A 2H6PA 4B9ZA 5IJKC 2JVUA 3BGMB 2G4EA 2GITA 4BRJA 3QJHA 4YLBA 5CJOL 4C8XA 1MW1A 1OB1A 3UBXG 4Y2DD 5DRWB 2AEPL 3T65B 3E2HC 3T2OA 5T3XD 3TWYA 1N0XL 5F7HA 2Y69B 1JZ7A 5D7KE 2XN0A 3F7KA 1CFVL 4PJ9A 3UMTA 5EO9B 5KTEH 5IB5A 3NIFF 3NAAH 1F0LA 3QUKB 5INCB 5F7EH 3FO2A 1DN2A 3P0YH 4HUXA 4N90D 3UH8A 5HGBA 3IETB 2B5IC 1LQBC 1JD9A 2A9NL 3MLSL 4HPYH 1NH6A 3AXHA 4OIAA 2KYIA 4ADGA 1BQ5A 4LLYB 1CDYA 4KK5C 4DIXA 4JDEB 1MELA 3ZKNC 1K5NA 5D96B 3QBTB 3QIWC 3GSWA 4UIKL 3HRZA 5L4IA 4P2QD 5EZIL 4GW1B 5FO9A 1A9VA 2BLFA 2IIJA 3QDMA 2X7LA 4RIRA 5CEYA 5K59F 5A7EA 1VZHA 4AKQA 3S4SA 1C5BH 1KIQB 1LO4H 1YUKB 3AREB 3CVDA 4F7TA 4LSRL 4YHPB 4HWZA 5C0BB 4PJDB 1JVLA 5F44A 5DUMH 1DBAH 1HXYB 3HVNA 4H7VA 5DQJB 3N41F 1GSMA 4NKOA 5MP6L 4FQ2L 2NQCA 3QJQB 3IWVA 5GS0C 5I1LA 1KTLA 4LPYA 2N01B 3B2UC 4MQ7A 3R18A 4QDGA 1NGWA 4K94H 5PCYA 5BZZA 1NGZB 1HYSC 3CSGA 3KE0A 4GBXA 1NA8A 2NY3B 3HG0A 3MVSA 5J3HC 3V7AG 5J11C 2QQNH 3I02A 3PPEA 1IM9B 1OE2A 5AVSB 2KERA 3QWNA 1PKQB 3PQYA 4DVBB 3ZQ9A 2ZYIA 1MDTA 3ZE0F 1C5DB 4ERSH 3ZTCC 1KFGA 2BSRB 4OGYH 5JZ7D 4E0RA 3HLAB 5J6HA 4G8FA 3LNFA 2RCSH 4IRSD 3A4AA 3X3GL 3UEQA 3ZXAC 2XVLA 3B9KC 4R26H 3DX6B 4FNRA 4QXGH 4EI0A 3MLPA 1WO2A 1WFMA 2V3EA 4YXKH 2EYTB 2XG4A 1AD0B 4XE5B 2FLMA 3K8LA 4OKVB 3RGVD 5EU6B 3L1OH 2OAAA 3BQVA 3TZVA 3IPBA 1AQ8A 2G5BA 5HI3C 4DVRL 2E47A 1NSNL 1WP6A 4JO1L 2I5YL 2EH7L 4A7SA 5HGHB 3ABMB 4ODSL 3FT3A 4DN4L 4TVSa 2XVGA 1AZZC 2RR3A 3G6JE 3VXSA 2GSGB 1JZFA 1MWAL 2CLRB 4YBLB 2YFOA 1D5ZB 4APXA 5I28A 3DGCR 3OWRA 5HYQA 2X2UA 5CSZA 3WGVB 1L5GA 1B2WL 1HYRC 1VEMA 1X7TA 1YYLL 3MNWA 1FFNA 4F58L 1GRWA 3ESVF 2CE6A 4KBPA 4FCHA 4WWKC 5T5FL 2CR6A 2C34A 2ICWI 5ITBL 4FYTA 3ZE2B 5C0JB 4QOKA 4OTXH 4NBYB 3DBXA 1NC2D 1IKFL 2DYPA 2EKJA 4WF7A 4POZC 4M1CD 2IAMA 3GT6A 1R1CA 5LXGH 4TQ8A 4JG5A 2FQFA 1E8YA 3CVIH 3OAZK 3PGFH 5AW1B 1IC7L 4OT1L 4M48H 5BO0D 1DJGA 3RVVD 4WO4B 1E9QB 1MRFH 2P8MA 3VFTB 2W60B 4G8GD 3PREA 3M7OA 1D7BA 4JFSA 2W07A 3KJ4C 1I75A 3VYPA 3GBEA 1MCOH 5FYJH 4KX9A 3SBQA 3JVGC 3BD4A 1EVUA 3WFDL 4AQ1C 2ZICA 2GJZA 5DTFB 2VJ8A 4HFUL 3RG1C 4JM2A 3V4VA 5JXEA 3TBTB 3TBBA 1KN4L 4QTHB 5TGBB 3EYQD 4L3FA 3GXNA 4H20L 4X0KB 2DLHA 3LVEA 1XGZA 3FZUD 5LQBL 3FQUA 2VR6A 3QULB 5EHFA 3QUYC 3L7EB 2W9EL 2F54E 3H9ZA 5AVQB 4BRVA 1GAFL 4M43L 3ARTA 1L7TL 3WFBH 2KZBA 2NCMA 4LVEA 3ATFA 5ICUA 1OSEA 2V7HB 5KS9E 3NSXA 2BVOA 1AXTH 3UDWA 4NN6B 4IBSA 4U1HA 2P47B 4I5BB 5FECA 4ONFH 5F8QC 2VH5L 4AITA 1IAOB 5F7WC 5E8DL 3IGLA 2FEJA 5CEXB 1A0QH 1F1GA 3HC3L 2CBPA 4J3UA 4XP6H 3T8VA 4K7FB 3DPBA 2VT0A 1CL7I 3D2TA 4KAQH 4TQPA 2VE6A 1RZKH 3MBEA 4P9HH 3T04D 1J5CA 3WU1A 3HN5A 4L4VD 1PSKH 5AVVB 1T04B 3PL6B 4Z7UF 1XIWB 2BY0A 4WGKA 2IADA 3IDMB 4NQDE 4MS8D 1UM5L 5T1JA 2C1OB 1TJHL 3SCMB 1L0YA 1VA9A 4D0CA 3VD2A 4XWOC 4D9RE 4JVUA 3ARBD 1U41A 1UHVA 5B7EA 5FOBB 2OI9B 3VFOA 2KKQA 1U8JB 3ZOAA 3SDDC 2QZQA 3MODL 5ABZA 3RTQA 3EOBB 3TO4C 3DMMC 3WD5L 2HJKB 3FFCD 4TLTA 4MDIB 5FYJU 2VDPH 3CCHB 2XTJC 3WNOA 4FP8L 2PP9A 3QEGL 4GMSL 1I1FA 4EUPH 1CXLA 5BZWA 4JMNA 3MA7A 4TUKL 3UP6A 3NCWA 5FYLD 1B6UA 3O11B 3KH3A 3N50A 2FO1A 4K8RD 2F7PA 1MLBB 1A66A 4PJ6A 1DZBA 4O4YL 2WYIA 4X4YB 1F2XK 2AK1H 4YVNA 3F84A 1WFTA 3HHMA 3NGBB 4UANA 4ZUTA 1ED3B 5BQ7B 2DD8L 1M4KA 2DQUL 2PETA 2WBJD 1LO3H 4GAJH 3PJSB 4RH4A 1IBGH 4XH2A 3HUJA 1CG9A 2Z64C 4L37B 4U1LB 5CJBA 1PZCA 2TAAA 3NEOA 4PBXA 1IEHA 4QXVA 1R3JB 1G43A 1JPFB 4LXFA 2QQKH 2P48B 1EQWA 3EJCA 5CP3H 1ZRUA 4RZCA 1S5IL 4OZ4A 3F6JA 2QZ5A 3FQNB 5DD0L 1TNMA 4HJJL 1U93B 1FNSH 3LB6C 5J1AA 4XN4A 2DW5A 4U1MA 3V7AE 2BJML 3FT4A 3LCYA 5ESQA 1CZ8H 1E5UI 4PJHE 4GG8B 3GJFB 3D12B 3Q9PA 2KUTA 1L9QA 2VLRD 2H0EA 2N59A 2XUWA 2DPKA 4E9SA 5LDSA 2DDQL 3CLFH 2VO5A 4LSDA 5EPMA 2DOCA 2AJSH 5HGGS 1G6RH 1NMCC 3RWDA 4TNGA 3N1QC 4PHZA 3S2AA 2NY0D 3LTVA 2YQGA 3LH9A 3RZWA 4AT6A 2R4SH 4Y2OA 3K71B 4EUPG 5BCAA 2ZPKL 4U1JA 4LE8A 1BX2A 3VH8B 4NZRL 1IGML 5K1NA 1VFAA 5CHNB 3ZZLA 3JTTA 4WKZB 2WQVA 2P5WE 1DQIA 5JNYA 2P3YA 2BSCA 1UOVA 1ZA3B 2D9QB 1XCTB 2CK2A 3A22A 3OC8A 3H9YA 1E8WA 2WO2B 3VI3F 3RA7L 5A7BA 1OAKH 2H6UA 2HJFB 4IU3A 4LLMA 3LS4H 4M5ZH 5CF3A 4WTZG 1ZTXL 5IF0B 3KG5A 1HWGB 3JYCA 4Q6IA 1R5WB 1T83C 5HDRA 3QQDB 3S35X 4F80A 4E41D 4P23B 2W88A 3S36X 4N1EA 2YAMA 4B5EA 3QXDA 2PR4L 1AH1A 2RAMA 2DKSA 2R1YB 1DLFL 3FN0L 1S7UA 4QJ4B 1JGVL 4Z7VF 2AV1B 4QUOA 1N3NB 4J27A 3KNBA 3P69A 3ULVL 2YC1A 3RTLA 2X4QB 4NQTA 4RDQF 4ZX5A 3D39E 3CQPA 1JGDB 4MMXB 4NGHH 3ES6A 3KXFD 5HDQL 3GI9H 4FXKA 3L4CA 5ESVA 4XP5H 1A3RH 4WKXA 3HLKA 4CDHA 5DJCB 2YBRA 5EBLB 4L5FL 3A0OA 3O45B 1MI5E 2BOCA 4JFYA 1HXKA 2VDKH 1AKPA 2K78A 1YY9D 4UB0L 4V1DB 3UXFA 2OCFD 4FG4A 3VFSA 4CMHC 1UATA 2CXGA 1COBA 1A6AB 5T1KB 3F3HA 4AQZA 3OAUH 1GMIA 1IGTA 5ALCL 2P7TB 2RD0A 2QR0A 5IW3A 2YPVA 4A39A 1I7TA 3LEXB 1V10A 2M2DA 4E2OA 5A1AA 5CD5C 4JB9L 6PAZA 2LLGA 4GT0A 5CO1A 1NFKA 4F7PB 1WBZA 4MNQB 4HC1H 4WEEA 4W9KC 1G87A 2BVEA 5DVLA 4FQCL 2NY4D 4GSDL 2H3NB 1UZ8A 4AWJC 4A55A 1U2CA 1I9RL 3O8XC 1ZLUK 1WAAF 2XOTA 1KJ2A 1SVCP 1HHJA 3K80A 3KHOA 5I1EL 4HUVB 1KJMB 3B9DA 3RVTC 4MA1B 4QRQA 2V2WA 1BFTA 3I75A 4ZTPH 4UDTA 3U83A 1KCBA 2H9GB 2AJXH 2VR4A 1ILUA 2EQDA 4HJ0C 4NC0B 1DQLL 2C3VA 1JGEB 2OTPA 2R0ZH 2XG5A 4ZS6D 1UD6A 3MV8E 5F6IC 1A1NB 2E9BA 4KI1A 2A1WH 2PNDA 3EHBC 3WXVH 2ITCB 3R19A 3AS2A 1QFPA 3ECWA 5D7JD 1MVUB 4AYBA 1AQDB 3EJZC 2K8QA 1TJIL 4OI9A 2DWEA 4PSRA 4B9FA 1UM4L 3C5JB 1IJ9A 1JZHA 2F5AL 4Y2LA 3WXWL 3B34A 4JE4B 3QIBB 4CC1A 3ASWA 3T2NH 5LCVA 3LN4A 2DQEL 3D09A 5AENA 1YJDH 3LKQB 5C08D 1U92B 3BAEH 1DVFA 2M1KA 4ZMVA 3OHXC 4HXBH 3QC5X 1FFTB 4I0PC 1RURL 4N0UE 4PRHD 4X5WA 5ILTH 3KHQA 2R1WA 3QA3B 4JHAH 1KB5B 4M3JA 1TR7A 1NMBL 5JMRA 4KRPC 3G6AA 1L9SA 4W9EC 3MJ9L 2Z4QB 3PP3K 3C6SB 3HG1D 2YXVA 4YDJA 4PB0H 5HGAA 4PWKA 3P4LA 1AO7D 3RX7A 4LQFH 3IDXH 4POYA 1GKEA 2DH2A 5D7LA 3S5ZA 5HHMB 2CHNA 3SBPA 1TZHA 2FSEA 2W80C 4XMKH 3S35L 1WT5C 2CHZA 3KLAA 3S36L 3OQ3B 5ICYA 4ZXBA 3MRMB 3U46B 3CX2A 3MYJB 3OKKB 2J43A 3UYOD 5D5MF 1XWVA 3CD4A 2X6MA 2R69H 4S1RH 1JFQH 1OSZB 4JY4B 3D30A 2VR7A 3ZKQD 5D70L 5IUSA 4S1DD 4Z7QF 3DETC 3VXNB 5CIPB 1E9PB 3MR9B 3PGCA 3BZFA 4NP4L 3LQAC 5IB4A 2I25N 1NCGA 5HGDB 1EFXD 4AYDC 5JPNA 1A3QA 1B90A 2Y22A 2VXVL 3KR3H 4PGCB 2RA1A 2OK0H 3LRSA 4JN2A 1WWBX 3A4FA 5D7LE 3CDYA 4OY9A 1GR7A 4PJ8C 4YDKL 1S9WA 4U2YA 2MCAA 1UA3A 4JFED 4ZAKB 2LT9A 5DFWH 1ID5I 1ZVNA 5ALBH 2J72A 3WDIA 2EE6A 4ACPA 3AAZB 3T0EE 4YO0B 4N2KA 1BQKA 2YN3A 2B4CH 4HETA 4Q52A 3TT1L 3VI4A 4TSAL 3BVVA 4K8RL 3QQ3B 4E5XG 3HVDA 2BIHA 2D73A 3BUIA 2XWTA 3L1GA 5FA3A 2OTUB 1W2KT 1IZKA 2O5YH 2R7EB 2X4NB 3GSXA 1PPIA 4XBGB 2AHIA 1JF6A 3HJEA 2BSTA 3U4EB 4U6XA 4N0FB 1AE6H 4OM0L 4MFHA 3DBSA 1IQWL 2GAZA 3MV9E 4R9HA 3IE4A 3LRKA 2OS7A 2YQBA 2BOBA 3L3GB 4IGBC 1MFCL 2HVBA 3TTYA 1MFEH 3GINA 1UQSA 4LSPL 1C12B 5IJBC 4L8SB 4AIZA 1X44A 3PWVA 2IH1B 4PRPE 1SXBA 2AQNA 3DWTA 1MHEA 2B1HH 2W0FA 1XF5A 4NUJB 5IMMA 4FJYA 5D55A 1OCRB 2HT3C 2EE3A 3IDGB 1BXVA 1ZIBA 3RWIB 1GZQB 1CU4H 2N4IA 3BVUA 1KENH 1E3ZA 2CXKA 1CLYL 3P2DA 3QE5A 3FUKA 1KYAA 3V4PL 1DQMH 1ZT4B 4I89A 3AG2B 3VG9C 5GS3A 2UWEF 3QIUB 3U1QA 2XPGB 3MV7D 4ETQB 3S88L 1MWAB 3AG1B 4PJXA 4OV6F 2OMTB 4FDWA 5AKSA 3NCJH 4K73A 5AB9A 3JTBA 4RMVA 4M6NH 5DS8B 1DDTA 1PY4A 3O6FB 1DBJL 4OAWA 4Y1SA 3LZQA 3CFCH 4PP1C 3BWAA 4C56A 4A2MA 2ZSVA 2NX5E 3SE6A 3P9MA 4OD1H 4HXAH 4LEOB 4Z77A 3AM8C 4IEFA 1RUAL 2B7DT 5J9PB 5HDBE 3QORC 4PW9A 1RFDH 2OP4H 3G5XB 1TQCB 3RZCC 5TJWK 1OTUC 4A1RA 4S1QL 5DJXA 4NM4H 4P4KB 1QSEA 3RDTB 1BZEA 1UENA 4Y16A 4RFOL 4Q7DA 5LB1A 4G9FB 4A7UA 2YEZB 4HS3A 2OXHA 1MHHB 2EDDA 4HT1L 4JHWH 4R96A 4BXSV 1K72A 2BFVH 5BNXD 1XF3B 3AXIA 4HWNA 4PJXE 5SX4H 5F71A 2YRPA 4X8XA 4P3CH 2HVKB 4POUB 1YNTF 4JBSA 4OCWL 2Q76A 5JPMC 4UQAA 3CSBA 1R33A 3E38A 4DGYL 4KK8C 5LLIC 2OJZH 4PR5B 1DUZB 1UWEH 4H8HA 3ZDZE 2CA3A 4NQEB 2LR4A 4JPKL 4OUUA 4PGEA 1DQTA 4TNFA 5LGHH 1OGAD 4O02H 3I84A 1EHXA 4EBQL 2RB8A 1P69B 2VZ1A 2H0JA 1F18A 2Y07H 5HDWA 3RGHA 3BPCB 3D07A 3SKJL 4JANB 3U7AA 1PY9A 2ZCKH 5DJ2B 4N24A 2BVPB 3IDIB 1YLBB 2UV3A 3NT0A 3I3DA 4HJIA 1FE8L 2YGVA 4X5RA 2A3TA 2RBLA 1HHKA 5ECJE 1WWCA 4TRPH 3FCUB 1J5HA 1DO5A 3ILPB 3CVHH 2ATKB 2EE9A 2KL6A 5EEUA 4IJTA 3UBGA 1SPDA 3RUGF 1FN4A 2NNAA 2AJ3A 1KIRB 1U3HC 1ZANL 2GC4C 2EDOA 3IDJA 3O3BB 2AK4A 4G2AA 1HE8A 3FFDA 4JDZA 2B59B 2MQCA 2VM9A 3EH3B 1G1OA 2VITA 5L2KB 4CADB 3RWGB 3L1EA 3EBGA 4J28A 1RMFH 2WLJA 2Y7QA 1YEDA 2H0FA 2HG0A 4NJ9H 4LOVA 2WNGA 1UG9A 4DWHA 1B4RA 3CZSA 4JRYD 1I8IB 2A4CA 2O6CA 3H7BB 4AYID 4ALAL 4MYPA 1JPTL 1OGTA 3HS0B 2VDRH 1JF1B 4GNKB 1F4AA 1DE4A 2ZXGA 4IOSD 1WWWX 3CSPA 1QRNE 1H3VA 1JWMB 4Q4IA 2YAHA 5DC9B 4JFDB 4HBCH 1KLGA 4RMWA 1YAIA 4PIBA 1FQ9C 1YYCA 4AVHA 3LEVH 1HI6B 1QVOB 3IXAA 3LXCA 3Q0HA 3HE7A 1HHHB 4XVSH 2VTFA 4UM9B 4Y5VB 2XXGA 4AI7A 4H25B 3VD0A 1NL0L 1NUFA 5E4AA 1ZJAA 5M7QA 1JYVA 1PZ2A 4K9JA 4L8DA 3TO2B 1BLNA 1BQLL 3A23A 2DQJL 1D9KB 5A2IH 1WBXB 2M8XA 1AS7A 2OYKA 3SBWC 2GBAA 2OZ4A 5JR1L 3S48A 2GY7B 5I8CA 4M5YH 4OLZL 4PYGA 4E5XA 1HTYA 2CLVB 4ODVH 1KCKA 1KXQA 4Y2DB 4JY6B 3KWWB 4YE0A 5L4JA 4HCRA 3ATEA 3DLQR 3CX5K 3SDXA 1QA9B 5FB8A 2YUVA 1RIUH 4FFZA 1SYVB 2BMKB 3RWEA 1YEJL 2ZX9A 2VUYA 3GXPA 2L4OA 4MYWB 4OLUL 1BFVH 2W0PA 3CLEL 4MAYA 1SMOA 3RVUD 1ETZA 4PJ9C 4R2GD 3AGWA 2ARWA 1HL8A 2JKJA 4HIIA 3STZB 3CDZB 4GKOA 4WW1B 1S78C 3MCLH 3WTSA 1MJ7H 4KVCL 1I7ZB 1CXIA 1KN2H 1L4IA 1LWRA 1KTDB 3JV0A 4R90H 2F74B 3D08A 4PJGE 3U0PA 2DEWX 2PCFA 5EORH 4IBVA 5IB3B 3EF4A 4CJ1A 5JUEL 3BGMA 4P2QB 4OF3A 3CN4A 5C07D 3NIFB 4XCYB 3HRZC 4PRNB 1AS8A 2PLTA 4FS0A 3A4DA 3P9WB 5E4OA 1ODUA 5BZXA 3P0VL 4X5QA 3FCSA 4ZZKA 3IFNL 3MRKB 1XH3B 1SXAA 2H45A 2WVVB 2IH8A 1OP9A 3QAZB 2C8NA 2NYKA 4Q4EA 5IV2A 5DJYB 1CCZA 4B3EA 3V0WH 2R51A 1N7MH 1K2DB 3GLAA 4FI8A 5IFJA 5F9WB 5TFSH 1SXSA 4H5SA 1DDHA 1NKGA 4UTBA 4NHCH 1W91A 4LLYA 1JNLL 5LBSA 4WUKH 2EC9U 3V95A 3MJWA 4IHOB 1JK8B 1CD8A 2IJ0C 5IQ9B 3ZL2A 1G7LA 2IQ9H 1KCRL 5HI5C 1IC4L 3B37A 3II3A 2Q7NA 3HJ0A 5I0ZA 3VFWA 3N41B 2O5XL 4UQCA 3OKMA 3FQ2A 1SFHA 3NH7H 2CPUA 2X10A 3BZ4A 4ZPVA 2D03H 4FXGC 4IRSB 4GS7C 2X0WA 1U42A 2DQDL 3W2DL 4OSUL 3VDCA 5HI4C 2V5SA 4NZDA 4NC1E 1T5WB 1TF4A 5GSRB 3AW5A 3GRWA 4AVJA 1OW0A 3HNSL 3RGVB 2AQ2A 1FYTA 1H15B 4QT5A 3DJSA 2Q7YB 1ZDSA 3L9BA 1PX4A 1OAYL 4KO5A 2W91A 2BVQA 3MBWB 4I18B 1II4E 5LG6A 4K71C 2ZX8A 5CINL 5IW6B 4OCXL 5KN5B 3TZVC 4OFIA 5E2TH 3ZE0B 1IM9A 4RAHA 1M71B 2NYZA 3PFQA 1XF2B 4DVBA 4DH2A 4CSPA 2E6JA 4XNUL 1CXKA 3B2UD 3KPOB 1YQ2A 1C7TA 1QZ1A 1GVIA 1AHWB 3VRLF 2ZCHL 4PJDE 4Y4HC 2BSRA 5C0BE 2XV6B 4DKTA 3Q43A 3VXOA 3HLAA 3MBXL 2DQ6A 4NC2B 5E8NB 2P44B 3LPGA 5SWQA 1RPUA 5C70A 1J9RA 4X2UA 3AS1A 5J8OA 4M7ZC 3SKNB 3D3VE 2BNQD 5FV1L 1Q9WB 2V7NA 1NC2B 3D34A 4OKVA 4DP4X 4JY5H 1F02I 2CGRH 4KHTH 1EMTL 1L9RA 4J3SA 5I6OA 1AS6A 4OF5A 4IJ3C 4ODXA 5IEHA 5CFAA 1PKQE 4XB3A 1M53A 1JPST 2WVTA 4TOYH 3DIFB 2IAMC 1KPRB 1G9ML 1IKOP 1I31A 3I50L 3MRGB 3HCVA 4G8GB 3LEYH 3SQRA 5LXGL 1D5ZA 2HMIC 3TM6A 4ICWA 4Z5RA 4KJQC 4N0CD 5DLMH 1FHGA 4QEGA 1IKNA 2WW8A 1LEKA 2APVA 5JHAA 4GKNB 1ADQH 1DANT 5GJSL 2GTZB 4ZMYA 2JLLA 4YZWA 2W95A 3OXSA 4H0GA 5CN1A 4G80B 4TF4A 3VH8G 5D7IA 2IH3B 5EU6E 2BNRD 5A40E 3WNKA 1MLCB 1I8AA 4UMSA 2DLEA 5IM7B 4N8CL 4LLUB 3EH4B 3QXAA 4O5LL 4F2MA 2XTSA 5TQ0H 1NOAA 2I60H 3GIVA 4M7LT 4ONHB 5JHLA 1QI3A 2I07B 1ZT1B 3D2UA 3VFTA 2W60A 1AQHA 1EAPA 2AVGA 2HT4D 3IMSA 4YQXL 3PYCA 2H1XA 3UDWC 2J25A 2YD7A 5GGRB 1R3KA 3H9HA 1KJVB 2NXZD 3QFGA 5DR5L 4FABL 2WANA 3ARGC 4XGZB 4HWBH 1JSYA 2O61A 3QEUA 1HT6A 1KBPA 4LAQH 4PV8B 5C09A 2PXYA 5DTFA 4L4VB 3FW6A 1KJ3L 3KYNB 4HKBA 3SOTA 4G7QB 5TGBA 2ZOWA 4M4PA 2ZAGA 1G7IB 5C0CB 3ARPA 2OSLA 4NZTL 1AR1D 1FYHB 1X5XA 2BIOA 3L3OC 5IVZB 4N1HB 4N3TA 3L7EA 2DH3A 4O9HL 4G3YL 4HCGA 3GMRA 5EU3B 5I5RA 2RJMA 3ARBB 2YEQA 1IQDA 2GTWB 5CJOH 1QSZA 1KXTB 1A7QL 1P4BL 1F3RB 2AEPH 3QEHB 1KZQA 2V7HA 4N0YL 1TENA 4XMXA 4YPGA 1H6UA 1N0XH 2BP0B 4I5BA 3PHQA 5D1XE 3LIUA 1CFVH 1G7HB 4LMQE 4M7KL 3FFCB 4N20A 1WD9A 5L4MA 4JG9A 4Z7UB 1QFOA 3RTQC 2D31B 1MCIA 4Y0GA 1WDAA 4XCFL 3UTPE 4AH2A 3OLIA 4K7FA 5EUOF 2VQTA 4PN6A 1WICA 3UERA 2A9NH 2A74A 3GNML 3MLSH 3PL6A 2A9BA 2DIJA 1XIWA 4IYKA 4NBZB 4PH8A 4UBDC 4YHOL 3IDMA 4Z78B 5DMGC 4M93B 4GSRA 4HDIB 2IPUG 3SCMA 3SKUD 2G5UA 4UIKH 2YPLD 1NC4D 4JAMB 2WBJB 5FOBA 2PYEE 2JQMA 1JPEA 3L9RB 3SGKA 1U8JA 4R4ND 3NEEA 1W6LA 3QDGA 4LSRH 2G9HB 3EOBA 3C75A 1FL5A 4NQXB 4DK5A 3CXHJ 2WQUA 4GLRI 2CDGA 4XWOD 1L3NA 1A9BB 1M05B 1K85A 4I1PA 5MP6H 4TL5A 4FQ2H 1YY8A 3L6FA 3T3PF 3V4PB 1N2RB 2R29A 2CCWA 3MLTB 2FO4B 2WB7A 4MXVE 1VHPA 2F8IA 2P1YA 1SDDA 5JHBA 4XZ4A 5EDXA 4B7IA 4I2XB 3S3PA 1Q90A 1S7SA 2CU9A 2YO3A 2IWFA 2PP8A 3TVMC 3AQXA 2VLRB 4ODWB 5I0DA 2D7TL 4MA3B 3QFJA 4Q74A 3N06B 2LTQB 2LFEA 3NCYS 1QI4A 2LAGB 4YSOA 5BQ7A 5F3BA 1KYOJ 2NY0B 1U58A 2WSPA 3PJSA 2A4EA 2LLNA 3BZEA 2WJ7A 1CTNA 4L37A 1JZ2A 4HW6A 4YZFE 1RUKL 4F8NA 1XD0A 2Q3AA 2R4RL 4XNZC 1JPFA 1FLRL 3WYRA 4U3SB 2QVIA 4K07A 3ZGHA 4I1NB 3X3GH 4UV7L 4V2CB 3U1SL 4TVPD 1ZDQA 2DL2A 3FQNA 2QBWA 1U93A 3EH2A 4UT9A 3MRDA 4C4UA 4YH6A 1MDAA 5KAQG 4YDNA 4P2RD 4GG8A 3GJFA 3NIGF 4DVRH 3WIHL 1NSNH 2YLKA 5FHBL 4JO1H 4OI7A 2I5YH 2NY1C 2EH7H 1OP3H 1PG7X 2KLSA 4F1ZA 5L88L 4PS8A 3MOQA 4ODSH 3S3SA 2K7QA 4U1NB 4DN4H 4E41B 4YMPA 5F1NB 1MWAH 3LB6D 1KMGA 5DK0B 1I3RB 3U36B 2EDHA 1WEJL 4IOFD 1SEBA 3GXUB 3NABL 1NAMB 1ONQB 2OXGB 4GI8A 4BQBA 2W8CA 3FQTB 4G7YL 4BFNA 4R7NB 1B2WH 5ISZD 1GL4B 5HVHC 1UWYA 3ZTDC 3US0A 3TEUA 1YYLH 4F58H 3I6SA 3KXFB 2WCSA 3VI3B 5CHNA 4ELME 4F7EB 4WKZA 5T5FH 2CUHA 1YYML 4E9RA 3WY3A 1OP4A 2AXWA 1ZS8B 3C5SA 5GGUA 3AZUA 1XCTA 1LWHA 2GHWB 1IEBB 1ZLWH 4UOW0 5I1KL 1I9JL 1IKFH 2ZYRA 2HJFA 4Y9FA 1LL1A 3ATDA 3ISWA 4MRCA 3QQ4B 3DTXB 3K46A 3HZVB 4JO4L 5JW4M 5KBPA 5E5MB 3KDMB 4GKSB 3K3QA 3ZHFA 4Z7VB 5C9KA 1IC7H 4F7CB 2Z31B 4LGPB 4OT1H 4RETB 4NB7A 4P23A 3V6FB 3GXTA 7TAAA 3MRCB 1AFVL 1VCAA 1Z2KA 5EIIA 4U05A 1A7BA 3IFPA 2AV1A 3Q6GL 5C0DB 1EDQA 2G9KA 1UXWA 2X4QA 3WFDH 1Z7JA 2NY4B 2ZD0A 4ZUWB 4HFUH 4MMXA 3MRHA 1V3MA 1IAII 3FUHA 1GS8A 1KN4H 4J3TA 4H20H 4FQHB 2YGNA 2AC0A 2MCMA 3I6LE 3O45A 4EI5C 5LQBH 3PE9A 1MWOA 2W9EH 1L0PA 1OHQA 4Z7IA 4ILDA 2EIMB 1A6AA 2AEIT 5T1KA 2VM4A 1LD9A 3TIEB 2I9TA 1GAFH 4KGLA 4M43H 4K7PX 1L7TH 1DVSA 2IDFA 2P7TA 3HHSB 3GXIA 4PG2A 4WSJA 2ERJC 4JN1L 4L3AA 5EMYA 3SGDH 3U30B 1WUZA 2GYSA 2WY3B 2A77L 2G3ZA 5D7JB 3VB9A 5CJXA 5KZCD 5E4EB 4LPWA 4XVJL 4DTGL 2VH5H 2M83A 4X5XA 3E9UA 4X42A 5E8DH 1CDCA 1ZLSL 4WI7A 1NFIB 1A6UL 4MNQA 2B0SL 3HC3H 4PD4J 5IBLC 1BFOA 4N3UA 2N3JA 4ORGB 4R3SB 2OL3L 1CC3A 3OB0H 4GO9A 2ZAIA 4PW3A 2CM5A 4QMEA 2IFGA 3D0LB 1A6VL 5C08B 3LH2L 4NLHA 4Z6AT 2DQHL 4WFHD 4V1DE 4HUVA 1T66D 4N28A 3DVNA 4Y4FD 3MACL 4XO9A 2ITDB 4AQ8C 5JW4R 1TJHH 2ED8A 4DKFL 1WFNA 5LGKA 2H9GA 2RACA 3VYOA 5B8CB 2Z1PA 4KRNA 3HR5B 5F97E 3N44F 4NNPL 4EN3D 4ZUUA 4GP8B 3CSYB 3HG1B 5DC2A 4OF7A 1N18A 3MODH 4HH8A 2IWKA 4BINA 4I48B 3T3MF 4YHYC 1MVUA 1AO7B 4HPHA 3WD5H 1CF1A 1J8RA 1QX1A 5KYWA 1PG7L 2ZUYA 4H8QA 4HJ0D 4FP8H 3QEGH 4GMSH 3C5JA 4HZLB 5AG9A 3FO9B 3F12B 2BZ7A 1DBKL 2B08A 4TUKH 4OCRL 3QIBA 4HD5A 1QPPA 1IBFA 2NSQA 4XHQA 5TDPB 5TK2A 1QR1A 3EGSA 3NPSB 2WLHA 2QLVB 4ZFOA 4ZXBC 4XC3L 5D1ZI 2EO9A 3T0EC 4JUSA 4BCYA 1Z66A 2Q2LA 5K1VA 3WHXA 4O4YH 5BPPA 5CJ5A 3DO7B 3QYCA 2F68X 2OQJB 2E8ZA 3FYIB 1EFXB 4AXWB 1UD2A 5DJDB 4QRUB 1KB5A 4LIQE 2DD8H 2DQUH 3BWUC 35C8L 4GUOA 3CZNA 2Z4QA 3RNKB 1DTUA 5AG8A 3C6SA 1SZNA 1MW3A 5HHVL 5C6WH 3UP1A 5JPNC 2CHWA 4AENB 3DURB 4JFEB 4I0PD 1JWUB 5D5MB 1S5IH 3SY0B 1NEZB 4R8WL 2JCCF 4GAAA 5DD0H 3L5WB 4HJJH 3DK2A 5FUOL 3U46A 1EERB 1KTKE 3RY6A 4Z7QB 3MYJA 2BJMH 1PG7W 2GHZA 4HJUA 2VDQB 3FAXA 2O93L 1A6TB 2BCKB 2YJLA 4U31A 5KSAC 1BP3B 1OSZA 4JY4A 5E8OA 3VG0L 1U0QA 4U7SA 5D1QA 2C26A 3BP7A 4GIAA 1QFWL 2BWDA 1BZ7B 4FA8A 1M6OB 1SJXA 2DDQH 5HGDA 5C1MB 1G4RA 1ZSHA 2AMUA 1HEHC 3J07A 4PGCA 4YHIA 1NGXB 4UT6A 3GS0A 4KH9A 4QAWA 4RDBA 1YN6B 5HD8C 5JIMA 4U33A 3PY9A 2ZPKH 4H8WH 3ZX1A 5HHME 4PJIF 4NZRH 4FLSA 1IGMH 4FQPA 5DD1L 3CFKB 4PTTA 1EPFA 3ESNA 4ZAKA 3D7PA 4UZGA 3UIZA 1LILA 3AG4B 3M6DA 3AAZA 4MCNA 4L3ED 3APMA 3MV7B 1P4LA 4J3OC 2ZXBA 4TM9A 4ZMAT 3NZSA 4KJWD 3WUZA 4R97C 2ALAA 2YUXA 3BFOA 5FGCE 3RA7H 3OGCB 1TETL 1AVAA 3DOSA 1EJFA 4QHPA 4WU7A 1XH0A 2QPDB 3X12B 1AMYA 1ZTXH 2JJTA 2X4NA 3UO1L 1CXEA 4XBGA 3V9EA 3FRPB 2VR9A 4N0FA 5FDYA 5B3JF 1I85A 5IJDC 4P5SA 4X4ME 4B3VA 2PR4H 2X3CA 3U0TB 4H8UA 5F21B 1O9VA 3HPJB 3HE6D 1DLFH 1J11A 3FN0H 4NRYB 1JGVH 5LNEA 1F6LL 3UIYA 1F6AA 3DECA 3EYOA 3QISA 4H26B 3ULVH 1LE5B 1SLXA 3QRFM 2UWEB 2HKFL 4NUJA 4QRPD 5KOMC 2UZIL 1F13A 5HY9A 3IMBA 4TVPL 4YXLL 1T0PB 3RWIA 4RQQB 4K7PY 3FTXA 1QNZL 5MHSD 1B0RA 4OZHE 3DX8A 5GZOD 3QNXB 4L5FH 3QIUA 1U8NA 2XPGA 4ETQA 3MAWA 1RK0B 5FFOA 4UB0H 3U6XS 3GSQA 4UOZA 4FLQA 4NN5B 4NYLB 5DS8A 1JS4A 2FB4L 2FWLB 3HA0A 1NINA 3SD2A 2J8OA 4XNXL 4NFDA 3T0WA 1NPNA 5ALCH 4EDXA 3BGFC 3G08A 4ENED 3GDCA 4JPWL 3ZL4H 3CDFA 4I8DA 3DVFA 4KK6D 1OGAB 1NBCA 1BG9A 5AYTA 5K9JL 2N0KA 4OI8A 3KL3A 5I75C 4WK2B 4JB9H 4M5SA 4MQXD 2XFXA 3G5XA 3R0MA 4DESA 2GI7A 2P45B 3GK8L 3D69B 5DQDL 3VXRE 4P4KA 1O0VA 3RDTA 4DW2L 4M56A 5DCCA 1YNTB 1F5WA 3GHPA 1OCCB 4FQCH 1ERNA 4GSDH 1KNOB 2XXCB 3CH8A 1RL1A 2YEZA 4OB5L 4ZTEA 3QJFB 1I9RH 5K1JA 5I76B 1THCA 1TPXB 1WQVT 3NK3A 3QORD 1E90A 1T22B 5I1EH 3FOLA 2HVKA 5KBLA 3RZCD 3PDGA 1CFTB 5T1LB 4F8OA 5I9QB 1S7QB 3EYFA 1U91B 4F9LA 5BQDA 3WS6C 4RX4D 2YSSA 2HFEB 1DQLH 4PR5A 3OXRA 5HXMA 3VXME 4NQEA 1I1RA 2AKRA 4XP1H 3W81A 3LPOA 5JIPA 5BUPA 5D2NB 4P5TD 3SBRA 3SQBB 3E1ZA 3FB8A 3X14B 2W81C 4WNQB 3P3TA 4JRYB 2JMRA 1IL1B 2PTTA 5EFIB 1YG9A 1B3JA 3WFZA 1TJIH 2CK0L 3I3BA 3BPCA 4NPJA 4G9FE 1UM4H 3I6KB 2H8PB 5AW9B 5DJ2A 3MJ7B 3IDIA 2F5AH 4YDIL 1XCXA 1Z6JT 3SO5A 4AC2A 3RUGB 3WXWH 3Q44A 3O9WA 3ZYZA 3Q8CA 2A73B 5I0WA 4N22A 3B3IB 3ILPA 1YA5A 3LKNB 1NGPL 1GOHA 2WXRA 1G9EA 3GKZA 3A3YB 1KIRA 2C4FT 1A1OB 1RURH 5DK2B 5DGRA 1BQSA 4HLJA 3GUFA 3FQ1A 4QHUB 5ICZB 1SN5A 4APQC 5BRZD 3QR1A 1NMBH 4KVPA 5FDWB 3MRFB 1YHPA 4YOKA 3MJ9H 4ZK8A 3BJ91 5D1ZA 4YGVB 1KWKA 1NKRA 2AXJA 1JYWA 4NKMB 3QG6A 2G2RB 4JPVL 1ET8A 1AJ7L 3RP1A 4XCCL 4YC2C 1U3HD 1I8IA 4QHKI 5KYNA 1YJDC 1KBBA 4WTQA 3S35H 4B95C 5FM4A 3S36H 3W9DB 1OQXA 5EF1A 3D4YA 2CUAA 3RJDA 1JWMA 3CE1A 2F19L 3FRUB 5DRNA 5I8OL 2QKIB 5C97A 2WINB 1PU0A 2XV2A 4Q9QL 6FABL 1EJOL 1QVOA 1RVFL 2UY7A 2YZ1A 2OV0A 3ESOA 5D70H 4WK4B 5GPRA 4UM9A 2X70A 3P30L 5JLZB 5C0AD 4NP4H 4FLOA 4JLRA 4ZMZA 5L2KE 4R2GB 4UI2A 1ODAA 2VXVH 1EAQA 1BZ9B 4MAYC 5FS5A 3GMMB 5IBUB 1D9KA 1TVDA 1WBXA 2CRMA 1A21A 4YDKH 5DEZA 4NWUH 5E56A 5IMLB 3MKKA 5E9DB 2AZAA 5CEZD 4C83B 1CFBA 3BPOB 3OR6B 5T1DL 3CN3A 2VL4A 4FTDA 4U1IB 3GTVA 4JFDE 5IG7B 1SOXA 1X7QA 2FYVA 4ZUVA 2AQRA 4KKLD 3NRFA 3TT1H 4ANUA 2CIIB 5DJAB 1GW6A 5ACLA 5C07B 3DSFL 2EDBA 3ECQA 2PWFA 4TSAH 3CLWA 4EZJA 5MI0C 3SJVB 3ARXA 4ZNEA 5IROC 3TYGL 1E5YA 5C0GA 4AJVA 2QPSA 4ZMNA 5JQIB 1SYVA 2BMKA 5DC0A 1IILE 4AMXA 4L9LB 3A67L 3TH4T 2X6UA 4BM7A 4N1CA 3BIBX 4OM0H 1IQWH 4M7JL 2GTQA 2F53E 2G4GA 4N2HA 2ZWKA 5BRPA 5CZVL 4X4XB 3STZA 1MFCH 1ASOA 4WW1A 2GJPA 4LSPH 4XN8A 4MRBA 4IBWA 4FX5A 4Y5XA 4NAJA 4S10A 3OKEB 4NC1C 2B4CC 1KTDA 3DPDA 4YIQB 2GJ6D 2ZUQB 1Z3RA 2VCOA 2YMXL 4I3SL 4K3EL 2VO8A 1I8MB 2IOMA 1CLYH 1P2CB 4PJ9D 1WPCA 3V4PH 5IB3A 3L3DA 4P2QA 1KTCA 3HAEH 4D8PA 3S88H 5D96C 4KZEL 3DI2B 4WHCA 1DBJH 3ABLB 4MJ6A 1RPQA 4QRRE 1Z3GL 4N90E 4IIZA 3AREC 4HK0A 4LCUA 1RUAH 1XH3A 3D4GA 3P3SA 1JZGA 1E67A 2WVVA 3PIQB 4PSPA 3E3QC 5DJYA 4F33A 4GAYA 4PGZA 1F8TL 2J6WA 3RBSA 2PW2B 4S1QH 4HYTB 1OW0C 3QDMD 2HWZL 4RFOH 3LQAL 1GY2A 1SDAB 4U3HA 1W72B 5T5NF 4JE0A 4LSQL 1H8NA 2QJDA 4HT1H 1VPOL 3Q6FA 4IHOA 1JK8A 3OVUB 1JXGA 2X4SA 3SYOA 2EUVA 2NY3C 3NIFE 4FHKA 3BFWA 4OCWH 3CH1B 4MJ5B 1QTSA 4BZYA 1SBSL 4N9GB 4JO3L 4YDLB 4IK6A 1NWOA 4DGYH 5BUAA 2GK0B 3GMQB 3IXTB 3F7LA 3FU0A 4WK0B 4GXUM 1MW0A 3OX8B 1K8DB 4GBXD 4JPKH 1T5WA 4UINL 5GSRA 2WIIB 4O2EB 2BNQB 3BKYL 3BW9A 2H26A 3PQYD 1KEML 3F5WB 4EBQH 1UKSA 4CU8A 3SKJH 1G0YR 1ZTXE 4KKNA 4XWGL 2YLHA 2AXFB 4I18A 1BW8A 1URLA 2TSAA 2ICCA 3SYQA 1FE8H 2ICWJ 5IW6A 5KN5A 4LPXA 3FT2B 1S7VA 5DFTA 3VNZA 1XF2A 2QDWA 5IHLB 1ZAGA 1KG0B 1C8PA 2VC2B 3NSFA 3KPOA 2X88A 1ZANH 5EEWA 4Z0XB 4Y5YB 4YBLC 2ZZUT 4XPGL 2IPKB 2IGLA 3AXLB 1XVSA 3LSOA 5J89A 1O7VA 2L8AA 1E50A 4NT6B 4Q9RL 1IKNC 3QSKB 4DCQA 1KEGL 1JWSB 4AV4A 3P73B 3PJNA 2AMGA 3RWHB 3C8KB 1P1VA 3QQXA 3B7UX 2IDSA 4ZX6A 1NPJA 8CGTA 1IAIM 4L1LA 2BNRB 1FZKB 3SKNA 5I66A 1PIFA 4ALAH 4KKAD 1JPTH 4KZCA 3V52H 3VDBA 5F1IA 1M7XA 4H2AA 3FU6A 1ASQA 3ZE0E 2CHXA 4LB8A 1EX0A 1QLRA 2AQ1A 4HUMB 3BVTA 1T0MA 1FC1A 4AZ8B 1YZZA 3DIFA 3MRJA 1JPGA 2KZKA 2Y5QA 3MRGA 2QFRA 3SZKC 1GA2A 1IC5L 2F2HA 2YWYA 3ZSTA 2YGPA 5T3ZD 4RMSA 1WFIA 2NXZB 4WO4C 1KIPA 3D0VB 4GKNA 4QOKD 4JM2F 3VA6A 1NL0H 4YL4A 1JK9B 1EXGA 2DYPD 1S4IA 4U1KB 3OQRA 2R23A 4G80A 4HOMA 1BQLH 2DQJH 3JBG7 2B1OA 2PXYC 2HAZA 3V9CA 2IH3A 1S9VB 4OD3L 4RLDA 2P28B 1TOXA 1AR1B 3AQYA 3BKML 1FNGA 4GQ9L 4Y8AA 5JR1H 2BS9A 3ML9A 4IBYA 3OKYA 2R9HC 4OLZH 4UNIA 1MOEA 2A0LC 3BX7C 2X41A 4WWPA 3L3KB 1NUDA 4OFDA 3BAIA 4ONHA 3NJHA 3LS5L 4G8GE 1FDLL 3GO1L 2I07A 5JXED 4JM2D 4WI0B 4DK3A 4OU3A 1E4WL 2F1BA 1YEJH 3MDJA 2DYRB 4XMLL 4RDQG 2QMKA 4Z7NF 1KJVA 4GFTB 3CLEH 1K3ZA 3ME0A 4ANXA 1Y1UA 2E7BA 3SYAA 3PGDA 2NYYC 5HVFB 1KSRA 4L4VA 1NFAA 1AG0A 5G55A 2Z35A 5IREA 3AMLA 3DHUA 4BFKA 1G7IA 3VSUA 4KVCH 1KV7A 1DJZA 2V5TA 3LQZA 1KCLA 4ADIA 5C0CA 5J5EA 3FMGL 5IVZA 1QUPA 2VAAA 3PL6C 1UJ3B 3F2LA 1BPVA 5D6DA 1XIWC 1XZWA 4W93A 2BH0A 2YPLB 1NC4B 4NNYA 5JUEH 3ARBA 1OSYA 4F7MB 4MB1A 1KXTA 3SCMC 3QPQC 1SUJA 1DCLA 1WZ1L 2O5ZL 3G5VB 3SKMA 1T0OA 2FNBA 3VGEA 5DS1A 3FQRB 3MBED 4YSPA 2OI9C 5EUOB 3RPIA 5H2BB 3SGKC 5ITFB 4CGTA 5IT2L 2DJUA 2V9TA 3P0VH 5EO1B 3CGTA 4HAGA 3EJYC 1NCCL 1YPZF 3Q5YA 1AMXA 4O2CB 5EZLA 3OLEA 1U2YA 1J0YA 5DEFB 4X6DA 1AXSB 5HHOD 5KJ4A 1MHCB 3IAQA 4JFZL 4ZFGL 1UD4A 1CIDA 5KSUB 5KYYB 4R83A 2CZNA 4K3JL 1JNLH 4Z78A 3FCBA 4DP1X 5BS0A 2B9BA 5EBWA 4TSCL 4N2AA 1Q9LB 3ZQWA 3NFNB 3FSVA 3QI9A 3MRQB 4ZTOL 3W39B 1V3JA 2VN5A 3R1GL 4JAMA 4JM4L 3UTZB 5C86A 1KCRH 4XZUA 3PFUA 1JYXA 3L9RA 1IC4H 4S0TD 3QUZD 5TPWL 4TUJB 2WOYA 2J4WL 2RQEA 3NGBC 2O5XH 3FFCE 3T3PB 3IVKB 2A38A 4Z7UE 1BMZA 2DQDH 4OSUH 3OV6A 3WKML 4EIZC 3PS6A 5AWNL 1CGXA 2VABB 5TQ2L 3HNSH 1N2RA 5I19L 3KPRA 3MLTA 4P2RB 2FO4A 1OAYH 4RMRA 5CINH 4ODWA 2VLRA 4OCXH 2EIBA 5CSGA 4GG6E 3DRQB 3AY4A 4L29B 4D0DB 5HTSA 3B3BA 3HI6L 2D3VA 1DVZA 4OLEA 1EXUB 2J3SA 3HMXA 4N2IA 4XNUH 2EVJA 1YDPA 1X6LA 1J8HA 4JQXA 5GQBA 2F5BL 2V2XB 2A6DB 5ISZB 1XXDC 3ZKXB 1QW8A 2ZCHH 3EYVB 5JQHC 3OMIB 3MBXH 1J0KA 4Z7WA 3S8FB 4EOWL 4OJYA 4U3SA 1MFDL 3TNMB 4N9OB 4JVWA 4UQ2B 4X6CA 3IU3A 3WI9A 3ZHLA 4AL8C 3NIGB 2ZF9A 1IRAY 1FAIL 3PWPD 1JV2B 3BYTA 1NEZG 4I2XE 4OGAD 5A3IC 3NCMA 4AYGA 4NUMA 1EMTH 2VLRE 5GZNC 4X7EC 3OGOE 2ZUTA 4XI5D 3ZN6A 4ESKA 5IQLA 3TYFA 5SX4I 4I9WD 4M62L 4U1NA 1A8ZA 1INEL 1BZ8A 1G9MH 1IGFL 3I50H 2HYMA 3CZGA 3U36A 3ATBA 3IJ7A 3MRLA 1H8SA 1UEYA 1WRFA 1LYQA 2AJZA 4OJFL 3UBHA 3DXAA 4LKCB 3W5MA 2OXGA 4P23C 3FQTA 3ZPDA 5GJSH 2XFGB 2D4DA 3DYMA 3BO8B 3FT9A 1J5OL 2ADIA 2FBRA 1U30A 3ERXA 4IKKA 2ZJSL 4R5XA 3RFZB 1UADC 3LXAA 4PCKA 3WLBB 3FN9A 4MMXC 3VMOA 1XL6A 1IEBA 4MXQC 4N2CA 5CCJA 4N8CH 1QRKA 3QQ4A 3CUPB 4O5LH 5I73B 1SDYA 2YD0A 3HZVA 4E41E 3ASOB 3VM7A 1NPUA 3W9EB 2OR8A 3X1GA 2PPDA 4N6QA 4Z7VA 2AP2A 4AGQA 3P4NB 5EZJA 5SWZA 4F7CA 2Z31A 3FRPG 4LO9A 5F70A 5KZCB 3AITA 1S7WB 4KKBC 1KXVC 2VLKD 4PG2C 4LCYB 4P3DB 4YQXH 4PEEA 4TNVK 5ANMA 5IBTL 5AYQA 2AQQA 2BIMA 3RNQB 5DR5H 3KXFE 4FABH 5SX5H 4DGVL 3VI3E 1O6VA 3UMNA 1HJCA 2WTRB 4WAFA 3U2SA 3VFGL 4ZUWA 3F7YB 1IAKB 1ZXQA 1MCFA 2FH8A 4OJEH 1A6PA 4ZMTA 4NXKA 4FQHA 2Z8RA 3KVDD 3H54A 4H88L 4NZTH 4Y4FB 3EBIA 1SJEB 4BQ8A 4LDLB 4MNHA 4UNVA 2R2BB 1R9FA 5BVJB 4O9HH 3AT9A 4G3YH 5E1IA 3CFBB 3TIEA 4XR8C 5C92A 5JQ6L 2WBXA 5E51A 1BVLB 2HP4A 4MA1C 4EN3B 1A7QH 1P4BH 5CZKA 3HHSA 1SHSA 3CZKA 2WBKA 4N0YH 4HHAB 2VB5A 5H35A 2ZKWA 1P4IL 2VQ1B 3BDYL 5D7JA 2NY5L 5IEKB 3BOVA 1JVOA 3HBZA 2CQVA 4LP4A 4OFYA 5AAMA 2WQ8A 1J9SA 4M7KH 4J7RA 1YEGH 2P5PA 3WJJA 1TQVA 3OL2A 5DVMA 1WAAA 4WUUB 1NFIA 2D2CC 3CN2A 4R3SA 5G5DA 4D7PA 3MLZL 1VERA 4KY1L 3GNMH 3AU1A 2R0KL 2YJQA 4PQXA 2H6OA 3QIBC 3N44B 4YHOH 4NQQA 5CNHA 1WHPA 2ITDA 1E27B 1H19A 2V9UA 2YPKB 3M17B 5IBLD 2XY1A 4N2OA 4YE4L 4XVUC 5B8CA 3K6SA 3T3MB 3HR5A 1NCNA 4CL7A 1OALA 1KGIA 2D2OA 2K6WA 3BLPX 5FXCH 3HS9A 1P7HL 3V4VL 5GS1A 2ICEB 1ZGLB 1RHHB 4Y9BA 1PD0A 2XQ0A 4QWWC 1S7XB 3Q2VA 4I0PB 4PREB 3GYRA 1DVFD 2NR6A 4KKCC 4D9QD 4HZLA 5D2LF 1ZE3H 4JGMA 3O2WL 3F12A 5I71B 3MYZA 5C08E 5ACZB 2OMWB 3BYYA 3S96A 1KGWA 3ZT7A 1KBWA 4FTVA 4KZ0A 5I1GL 2FR4A 3PP3H 1YMHB 2P8LB 3C6EA 3CPUA 3ABGA 4MZIA 3MU3A 4PJBA 3D51A 4PRHE 4FE9A 5HYFA 1CLCA 2C9RA 3JYBA 1WK0A 1QSVA 2EDQA 1CD0A 2DKUA 2D7TH 4G43B 5GGTA 1TTAA