2FE0A

Nmr structure of smp-1 (small myristoylated protein) from leishmania major
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
131
structure length
131
Chain Sequence
MGCGASSENSSVTYVNGRPTFVGEEVTKGFEKDNGLLFRIVNKKKKQWAYYNDTTQYEMHVLVTFNEDCDIKALGKTKLEQQENGEWVASVVVYPCETEMFIEGRVNGFKSKMDALPLSEEYRQHQAEKDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords small myristoylated protein 1
publication title Function, membrane targetting and structure of SMP-1
rcsb
source organism Leishmania major
molecule tags Protein transport, membrane protein
total genus 15
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09149 DUF1935 Domain of unknown function (DUF1935)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2fe0A01
1EHAA 3BSHA 2PWFA 2Y24A 4UNIA 3HG4A 4J7RA 4J3VA 1SZNA 4JFVA 3IGUA 3KE0A 2Y4SA 4WSKA 3WELA 1V3KA 2CXGA 1KWKA 2G3MA 1VJSA 1QI4A 1HVXA 3D4YA 4PCSA 2Y5EA 5HXMA 2GVYA 2QMKA 1JI2A 1TQTA 4QAWA 1CXKA 1CGWA 2EABA 3BAYA 2Z1KA 1BSIA 3DDFA 3A21A 3ZSSA 3LRLA 1KBKA 2ZWYA 1JDAA 1XSKA 2PWEA 2YA2A 4CGTA 3VGBA 1JI1A 1WPCA 3ZOAA 1HXKA 3BUIA 4CKQA 3FW6A 4GO8A 3WY1A 3OLIA 4JCMA 3II1A 3EJRA 3EDDA 3WNKA 3ZT6A 1J0JA 3KL0A 1EH9A 2XN2A 3VU2A 3L4WA 4ATWA 3ZQ9A 1XSIA 2DIJA 4NXKA 1HTYA 3BLKA 1T0OA 2QPUA 3VM5A 1UA7A 2DH2A 2FE0A 4FLOA 1CGXA 5E1QA 3D4ZA 3CZSA 3IJ8A 2WCGA 4AMWA 4NZFA 3BMVA 1CGUA 4H2CA 4FNTA 1KTCA 4X9YA 2VRKA 5I23A 2EQDA 1R75A 3EJPA 3K8MA 1U33A 4JL2A 3WEMA 3CV5A 3WFZA 2BY3A 2OYMA 1CXIA 2EO7A 3DX0A 3QGVA 3EDKA 3GXIA 4GI9A 1XV8A 1XH1A 3ZR5A 1KGWA 1CYGA 4UOZA 4OIFA 3GBEA 4CN1A 4CN4A 2WKGA 2ZX6A 5CLTA 4BA0A 2WKLA 3BAJA 2E9BA 1WZLA 1CLVA 3WNOA 2XN1A 1JDDA 1S46A 2XVGA 1B0IA 1CGVA 2F2HA 2WPGA 5BRQA 1IZJA 3BVWA 4B9YA 4DO6A 2E8ZA 2NT0A 1QWUA 2J25A 1AMYA 2XIIA 2YOCA 3WDJA 3VSUA 3ZR6A 3ZO9A 1HX0A 3IJ9A 1A47A 1UD8A 4GIAA 2PWGA 1CPUA 2XVKA 3A4AA 1DTUA 1PJ9A 2ZXDA 3UEQA 3VMPA 1MW2A 1ZJAA 1JAEA 2EJ1A 2QMJA 3FAWA 3LXBA 3DC0A 1SMDA 2XWEA 4MAZA 3DX3A 2ZX7A 3HG5A 3CZLA 4WSJA 4AYSA 1OT2A 1BLIA 3ZT7A 4HP5A 3CPUA 4UQBA 2C7FA 1R34A 1WO2A 2WCSA 3BVTA 4NI3A 4OJYA 1J0IA 4J3UA 2OSXA 4DO5A 3TV8A 4UCFA 1E40A 2D0GA 1IZKA 5I24A 3WENA 3EJTA 1UA3A 2D3LA 3BVUA 4AIEA 4H7VA 3DDGA 1XD0A 4H8HA 3UG3A 1KXHA 2IGTA 4FLSA 2YKKA 3LXCA 1R46A 2FH8A 4UOQA 4PSRA 3EDFA 3GXNA 5I0DA 2D0FA 2OW6A 2ZUVA 5A6MA 5E6YA 1KGXA 3L2MA 4E2OA 4JFWA 4LQ1A 2V3EA 3A22A 4AIOA 1KB3A 3UERA 4BZYA 3IJ7A 3D50A 3AMLA 4J27A 3BUQA 2WVVA 5A2AA 2BY1A 3H54A 3W37A 3MI6A 1MFVA 4U2YA 1L0PA 3TTSA 2D3NA 5CLWA 2WC7A 3D52A 3VM7A 4J3XA 1BPLB 3M07A 1UASA 3A24A 6CGTA 4CN6A 4FLQA 2ZX8A 1P6WA 2ZUWA 4GI6A 2ALWA 2EAEA 3TTYA 1WE5A 1JF5A 5CGMA 1XH2A 1UOKA 1JD7A 1GJUA 2VNCA 4U2ZA 4GINA 1QX1A 1BVZA 3CZNA 3EJUA 1QI3A 1E3ZA 1MWOA 2XVLA 2ZX9A 4NZJA 3OLEA 1KWGA 1XGZA 1CXFA 1WP6A 5E6ZA 2NT1A 3FAXA 3BC9A 3CZGA 3BUBA 1V3JA 3VMOA 2YJQA 4PSPA 4KMQA 3VGDA 1BAGA 1OGSA 1OSEA 1CGYA 3BAWA 3GXMA 1HL9A 2PWHA 4WF7A 3VMNA 1DEDA 2BXZA 3L4XA 1WZMA 3LXAA 1JL8A 5HPOA 2F7RA 4GKLA 5E9AA 1KXVA 1NOFA 1OB0A 2F1AA 3L4ZA 3DHUA 3VGEA 1G9HA 4DO4A 5CXPA 5DFAA 4FMVA 3KLKA 1KXQA 4PEEA 1G5AA 2FHFA 1UKQA 1TQVA 1HL8A 4JFSA 4AYGA 2CHNA 1VFMA 4J3WA 1PZ2A 3WDHA 5A2BA 1KCKA 2G3NA 1NM9A 1WZAA 3AXIA 3K1DA 3VX1A 1G1YA 2WVTA 3WDIA 1BVNP 3HG3A 2GUYA 2OYKA 3VNZA 4HPHA 1PIFA 1UKTA 3S2CA 1JGIA 2OSYA 3BMWA 2ZXBA 1UD4A 2FH6A 4PCTA 1JXKA 3ZT5A 2AMGA 4OGZA 1QHPA 2WANA 3LPOA 3ZSTA 3IK2A 1RP8A 4J3SA 2AAAA 3KEHA 3WY4A 4GQQA 1ZJBA 3CC1A 5CGTA 4CVWA 1UH2A 4JFTA 5DO8A 1VFUA 3VX0A 3WNMA 2PWDA 3GXTA 4OKDA 3WY2A 1Z32X 4B9ZA 9CGTA 2ZXAA 1CDGA 4U31A 3LRMA 4GI8A 1CXLA 4J3TA 2OYLA 1OT1A 1PEZA 2X2JA 4NXSA 3S5ZA 8CGTA 3BAKA 4HOZA 1M53A 1GVIA 3A47A 2GJRA 1LWJA 4UQDA 1JXJA 3WNPA 2QLYA 1U2YA 2ZWZA 3BLBA 1JD9A 3DX2A 5A6LA 1KBBA 3GTNA 3AXHA 4FNPA 3A5VA 2WVUA 3AMKA 3VSVA 1QW9A 1W9XA 1D7FA 1TQWA 2F7PA 3WEOA 2CPUA 4MB1A 5E0FA 1CXEA 3ECQA 1AQMA 1XD1A 3UG4A 4UQAA 2BHUA 1QI5A 3VSTA 2X2IA 2TAAA 2E0PA 3DX4A 3VNYA 3K8KA 1XH0A 4LXFA 3WNNA 3D51A 1TQSA 1V3LA 3DHPA 3OLDA 1PZ3A 1DHKA 2FHBA 1MFUA 3CLWA 1KCLA 1XSJA 4JL1A 1SMAA 1UH4A 3KL3A 4KWUA 1BF2A 1HWWA 3LX9A 4XB3A 3GXPA 2QPSA 4UQEA 3BSGA 5E70A 3L4VA 4UQ9A 1HT6A 2WSPA 5I5RA 1UD2A 3CZEA 4UZUA 2D73A 1WZKA 1M7XA 3L4TA 5F7UA 1ZS2A 3BCFA 2ZICA 3OLGA 3L4UA 1JFHA 2VR5A 2VUYA 4AEFA 2XIBA 3VGGA 2XWDA 4U3CA 3TONA 2Y2WA 1KXTA 2YIHA 1QWNA 3GBDA 1JDCA 1EO7A 1J0KA 1UD3A 3BAIA 1R33A 1VAHA 2D0HA 1V3MA 1UD5A 2YFOA 1UH3A 3VO0A 4LPCA 2BHYA 2DH3A 2WVSA 3L4YA 3KL5A 1MW0A 2BY0A 2FGZA 4UZSA 4AW7A 2ZX5A 1XCWA 2V3DA 2ZUUA 3RIKA 2D2OA 2FYVA 3GXDA 3EJSA 4GQRA 2EACA 3EDJA 1LWHA 3HZ3A 3WY3A 1E3XA 2F7OA 2ZUSA 1EO5A 1CGTA 3S5YA 1VIWA 1GJWA 2F61A 1MXGA 3BVVA 4WLCA 1C8QA 3BH4A 1AVAA 2VRQA 2WNWA 4FNRA 3LPPA 1J0HA 1XCXA 3EDEA 3TOPA 1ODUA 1RP9A 2C8NA 3A6OA 2NSXA 3KLLA 1G94A 3GXFA 1EA9C 3WN6A 1E43A 3VGHA 1RPKA 2E4TA 2VT0A 3W38A 2YFNA 1UD6A 2GJPA 1PAMA 1MXDA 2ZIDA 6TAAA 5HDRA 4UQCA 4HA1A 1AQHA 2ZUTA 1VB9A 4JCLA 4JFUA 3LRKA 4X0NA 2ZE0A 1Q4NX 2BHZA 2XN0A 3AJ7A 4HOXA 1MVYA 1O7DC 5TD4A 4AEEA 1PS3A 1Y7VA 1QPKA 2F1BA 1QW8A 1HNYA 1QHOA 3VGFA 3RILA 3KWXA 3H55A 3WMSA 1D3CA 2BY2A 5KEZA 4H8VA 4AMXA 4U33A 3UCQA 2F18A 3BAXA 1TQUA 4H8UA 4J28A 4M8UA 4M56A 2V3FA 4W93A 4FLRA 4HOWA 1CXHA 3H53A 2EEXA 1I75A 1PIGA 2F7QA 3BCDA 4FNQA 4NX0A 3A23A 3DX1A 1TCMA 5BRPA 3BLPX 2WVVB 2OSWA 3CZKA 1MW1A 1JF6A 2BXYA 3K8LA 3HJEA 5A2CA 2DIEA 2OW7A 1JIBA 2ZXQA 3HG2A 1H3GA 1KTBA 1KGUA 1VFOA 3WNLA 1PPIA 1IV8A 4FNUA 1U30A 2FHCA 3UG5A 3BUPA 1UKSA 2X2HA 3CGTA 7TAAA 1TMQA 1BG9A 3EJQA 1MW3A 2E8YA 2WSKA 5EMYA 3CTTA 3L2LA 7CGTA 3BVXA 1B2YA 4GO9A 1JG9A 4TVUA 2EADA 1GCYA 3BUDA 1CIUA 4FNSA 2YA0A 2QV4A 2YA1A 1R47A
chains in the Genus database with same CATH superfamily
3V6FA 4GMSH 5AQ0A 3V4PA 3U1SH 1SY6H 3EBHA 5L4JA 2R0LL 3QEGL 1GTFA 1SZNA 4C8XA 2QVIA 5CWSB 1XF3A 2UY7A 3IGUA 3L3IB 2MOVA 3L3JB 3FU9A 4PRHA 3DRQB 5GGSY 1GPOH 2D31A 4GRWH 1RJYB 1AJ7H 4GW5A 1BIHA 1Y1UA 2W38A 3G5ZB 4ICWA 5HXMA 2GVYA 3QO1B 3GKWL 4LMQE 4RIRA 2HWZL 1EFQA 1W72L 5IFAL 2GEEA 2NR6D 5GS2D 1UQSA 1P5VB 3DIVA 4LKCB 4DN4H 1JHTB 1ZTXL 5HYQA 1UGKA 5CEZD 3OAYH 5CZKA 3UTTD 2Y1AA 1OKEA 2DKSA 3L9BA 3Q9QA 2X6MA 2RFXB 5D9SA 1SVZA 2E76C 1QP1A 2Y25A 4Y4HB 1WFJA 1TTGA 1H6UA 3VDCA 4QNPE 5IOPA 3WNKA 1J0JA 1ZHNA 3NCFB 3PIQA 1KMGA 4BUGA 1NCAH 5DGRA 3QUYA 3UTQB 3FB6B 4X4YA 2MTPA 4CW1A 3R1GH 3BLKA 3QXAA 1UA7A 3EKCA 5K93A 1TZAA 5DHYB 4P2RB 1HZHH 3BP5A 3CZSA 1T0MB 3TJEH 2EVIA 2OV0A 2PO6D 4U1LA 5MHSE 2WQAA 5J1TC 1KGCE 3SYPA 4TRPL 3RZCA 4TOYH 2O5YL 2NXYC 4YX2L 2Z7UA 4AEHL 1ADQH 1T83A 3TIEB 1SEBA 2QTVA 2K9UA 4O5LL 1Q0XH 4BSVA 2CSPA 1EJOH 2ZUYA 4F58L 2ZX6A 4G8EB 5BQ7B 4D9LL 2EVJA 3S37X 1WZLA 2HZHA 3AXLB 1I8UA 3J07A 2VDQB 1GC1H 3MV9D 4LMQI 5J9PB 3HE6D 4G42A 1F4YH 1DJIA 4DN3L 3MZGB 4Y4HD 3UBXI 4NUGH 4L0PB 1MEXH 4IS6B 4ISVA 5AAPA 2GBVA 4NUQA 1F3JA 2OPCA 5CZRA 1TR7A 1CDYA 1RUML 2YAEA 1JAEA 4WEUD 4P2RD 2Q10A 1DDTA 5JHLA 4AZ8A 2NNRA 4JO8A 4OGAD 4ZS7L 3DX3A 3RG1C 3HG5A 3TN0A 3U9PH 4AYSA 4DEPC 1P84J 1Y0LA 4DKFL 1R3IL 1P7KA 3CPUA 1NBYA 2ERJB 1LO0L 4JVWA 1BVOA 1CUOA 3ARDB 4KJPC 4PRHE 5HJGA 4X6FB 3LV3A 3V5HA 1D9KB 5J8OA 3KYMB 4AQ8C 1IEAB 4P5KB 5T5FH 1HK6A 3GF8A 3AW5A 5E08L 2VDPH 4HZLA 5I1GH 2BVQB 4LDLB 1N5AA 2W8CA 4GXVH 4PJEA 5IF0A 2R0WH 4NT6B 4DETA 5ERWA 4XPAH 4QJ4B 1FAIL 1XD0A 4NLAA 4MXQD 2GTWB 2AKRB 4PB0H 2ZSWA 4FMFA 5A43C 1B4RA 1LD9A 4R90L 2A73A 2PYFB 2XU9A 3GD1C 4EZJA 2OW6A 1ORQB 2H9GA 5CJBA 1PY9A 2H1PH 3QFJD 5DJAA 3VQ1C 3O0RL 3L2NA 4XAWL 4AIOA 5E9DA 3VI3F 5I71B 2CRIA 4PRPD 3ARPA 3B7TA 5IM7A 2ZNXA 3PV7A 2H2SC 2XFXA 3H54A 5FS5A 4M6OL 5E51A 2P44B 2YPVA 5CN2A 5EFIB 4ZSOA 5IHLB 3MUHL 5KS9A 5DFTA 4LGPB 2FIRT 4YBQC 2K1MA 1MNUH 4F24A 5JYLA 3KNBB 4GB9A 4U1IA 1KCWA 3ARDD 5DEFB 3A24A 2AJXL 4DP2X 1G84A 4Z7IA 3SKNA 5LXGL 1D9KD 3CDYA 3HVNA 5ALCH 4ABVA 4K94L 4FABH 2E7CA 3LKRB 5ADPH 2EAEA 1XF2B 4OFPA 2CIKA 3AY2A 2QZ5A 4MCZB 4YHIB 3LNDA 2G3XA 4RFOL 2ALAA 3WMPA 4ALAL 3KLHC 4LVNB 2EXWD 3FYIB 4I18B 5CJ8A 4YR6B 4KROC 4R7DA 5CEYA 3UBXB 3UTPE 1MCNA 3C5ZA 5FUCE 3MFFB 3QCTH 2APTA 1HAWA 5JQ6H 4MZIA 3O4OB 5I75B 3QPKA 3K7UA 2G5UA 3MJ7B 4N4YB 1GIGH 3GHBL 1QASA 2ZPKL 3P0VL 2AZUA 1ACXA 3OJDB 3SDYH 5KN5B 1TZIA 2VSMB 4LVHB 2BP3A 1AAJA 2PWHA 3IMRA 2OMZA 3LN5B 2BSBA 3A67L 2F7RA 2IIJA 4G6JL 3MXWL 3D9AL 1CLCA 1NGXB 4JW3A 1U8KA 2QPFA 1DQMH 3MO1B 5J1AA 2CLVA 3VG9C 4FFWD 4LSRL 3L3DA 3VXOB 5C2BL 2QGDA 1NMCC 3W82A 3B3IA 3KVDD 4FMVA 2N1TE 3CFEA 2JB5L 4UIMB 3Q3GA 3D06A 3N1MC 2J56A 5EEWA 2KBGA 4AKQA 3WNJA 1PW3A 3QHTC 4G6AC 2VMJA 2X6CA 4D0DB 4L3ED 1EXHA 1IC7L 3NJHA 1SEQH 4ZOEA 4JFEA 3VX1A 2AP2A 4PJEE 3KYNA 2WY3B 4NQTA 4XTRD 5E8PA 3NA9L 5IBLC 3UFIA 3ABMB 2H3XC 5HI5D 2PP8A 3N44B 1F6AB 5C8JB 1LK2A 5LG6A 2ZCLL 4HJ0D 4JG1H 3P2DA 5IROA 5IW1B 4OLUL 3ZHFA 4XNZC 4IBWA 2FEDD 4KTEH 1L5GA 4RAUA 3UYRH 4EVNB 1RUQL 3KPSD 4XN5A 4RRPG 4I0PC 4TUKL 2F6AA 4HUCA 4M5ZH 5LUMA 4JFTA 4ZFOA 4WO0A 5E9DE 1L3NA 3EJYD 3WNMA 1NC2A 5BV7H 5JTWA 3A6BL 3WY2A 1OAKH 2LAGB 3RVWD 2CKBA 2MH4A 5TDOB 1A25A 1CXLA 4G8GA 1E2VA 4Q6IC 4HG4K 1GAFH 2L7UA 2OLDA 4ZSOE 5AZEH 3L3KB 2H32B 5J6HA 3MRMB 2J1KA 3MRRA 4NO5B 8PAZA 3V6FB 5CNHA 3QW9A 3V4PB 2ZAIA 3U0PA 2HG5A 1NEZA 2MKLC 3SGEH 1XF3B 2UY7B 3EFDH 2L0DA 4JBSA 4KO9A 5L88L 4J39A 2YWYA 4HS6A 4UDTA 4PRHB 2D31B 3DJZA 3D0LA 3G08A 3WEXA 3RU8L 1TETL 4PS3A 1W9XA 2MNUA 4GW5B 4GXUM 4XBMA 2CUAA 2VDKL 4WAFA 1V7MH 3UAJA 4RIRB 3CK0H 3L5HA 4N86A 5F97E 4KXZH 4K8RC 3QWRD 1J7VR 1UQSB 3MV01 3S5LG 4K71B 4XMVA 5HYQB 3VU1A 1U95A 4NKIH 5KBMA 1DANU 5D9SB 3GUTA 2DOCA 5LBSH 1OXYA 4YDNA 4UQ3A 2EIMB 2KDGA 5IOPB 4XNXL 3ARRA 3EF4A 3PIQB 1ZHNB 3UJJH 2B8OT 1YEFL 2WQWA 3QUYB 3WJLA 4ODWA 1BYNA 3O6MH 3JWDH 4KTDL 3IDNA 5D70L 5DVOA 2WYTA 4CW1B 4X4YB 3QXAB 1K8IA 5L6YL 2IQ9L 4APXA 2NNXA 3BP5B 1I4FA 2D73A 3DO3A 2FL5A 5E5LA 3OXSA 5F8RC 1DFBH 2AXWA 4U1LB 3RHWK 3Q8EA 4LK4A 4MXWL 4X9HA 1TMCB 1HHGA 3T0WA 3RA7H 3DK0A 1DBBL 1WTLA 3Q6GH 3LJ3A 1S3KH 4Y4KC 4IYKA 4HKBA 4OZGF 4YL9A 1JDCA 4JFEE 2YQGA 1SEBB 1RIUH 1WVZA 3LS5L 4MJID 1R33A 4CC0A 3NESA 1HKFA 1QFUL 1XH3A 3P2TA 3QIUD 4KVNL 2R56L 3MYZA 3NZSA 3K6NA 3DUHA 1U3HA 3GPEA 3MZTA 5IEKA 1MWAH 4X80H 1OAUL 3F7VA 2G60H 4PN6A 1K4CA 1YAIA 3BWSA 4Y9CA 5I1CL 1PYWA 2XPYA 1CQKA 3TEUA 4R7XA 4NYLA 3HS0C 2NDFA 1CFTA 3DYPA 3KM1A 4JVUA 4J3OG 5DC0A 4ISVB 3AY4C 1F3JB 1TFPA 3RE0A 4ZI8A 4FNRA 1WAPA 4G8GE 3V95A 4AZ8B 3A6OA 3GXFA 4IOIA 3REVA 1GOHA 4YHKL 3BRFA 1RZ7L 2AEWA 1OW0A 6PCYA 1S7WA 2OULB 1Y0LB 3N9GH 4LP4A 1P7KB 4ODVH 4RSVA 4N0RA 1NBYB 3EH2A 1COBA 3RZCD 4L9LA 2B16A 2ZUTA 3RJQB 4UT9A 3LV3B 5EDSA 3V5HB 2CO7A 4RA3A 2C26A 4RZCA 2HFEA 1TJHL 2NY4D 3IMTA 3T0XA 2B3RA 4HZLB 2ZE0A 1OSPL 4JQIL 4LSDA 5DMKA 1N5AB 2BHZA 3ARSA 5J6SA 4PJEB 3TVMA 4LVEA 5IF0B 5ERWB 4BK8A 3MLVH 2VLJA 4LASH 3HN8A 3MRIA 3MSPA 3EO1A 4KZEL 1CN4A 12E8L 1HNYA 4OFYA 2ZSWB 3RRQA 4UNVA 1LD9B 1SOQA 4PLJC 4AQ1A 2A73B 1P84K 2EIKB 3RIAK 3PF2A 3LEYH 2H9GB 4ZUWA 4PB9L 3FN0L 5I6NA 4LCIL 5DJAB 4PJ7F 2A0LC 3PPEA 2ZXWB 4ZODA 5E9DB 5SV3A 5KAQF 2V5YA 1MCHA 3IDJA 4Y1AA 1OO2A 1GXEA 5IM7B 1GGIH 1IGIH 3WFHA 5JPMA 4FZ8H 2XFXB 3QS2A 1GSMA 2WB1A 3V6BR 5L4IA 3MLYH 4XNBA 4ZSOB 5B3NA 1DBKH 3MNZA 4WCYL 2HFGH 3TN0D 2DIEA 5KS9B 5TE4L 5M7QA 4I9WD 1Q1JL 4K3HA 4NBXB 3NGBB 4U1IB 4PRIA 2H1XA 4APQA 1HNGA 4AIZB 3GLEA 3SKNB 3IVKA 3BUPA 1T89C 4PP2A 4JCWA 5DJXB 2OAAA 1TMQA 2KC0A 1TQBB 4BD4A 1M3JA 2CIKB 4M29A 4XP5L 5GS2H 5EF1A 9PCYA 4I0CC 5JIPA 5D96C 2ETWA 2BH0A 1EZVX 2J1ZA 2VC2H 4FNSA 4R7DB 4XXDA 5CEYB 1KXTB 2DQ6A 1RIVL 2EUWA 2PWFA 2KI6A 3C5ZB 1RU9L 1KCRL 2R1YA 4J3VA 4GP5B 3B5GA 3QPQC 3BGAA 4X9GA 4WUUD 1BMWA 2QDWA 3PXJA 1J1XH 3AB0B 1TZIB 2CXKA 2EO9A 1EMTH 2Q6WA 4ZFGH 3D4YA 2OMZB 4PJIF 3W9EA 5CFAA 2CK2A 2BRRH 4Y4FD 3GLAA 5J57B 4JY4A 3FBQA 3VFUA 1JCKA 3SQBB 1U8KB 5DZAA 3DDFA 5J1AB 2CLVB 4ZTPH 4YS4A 4P3CL 5FCUL 3L3DB 2W65A 1Q38A 3B3IB 4HPYH 3CFEB 3OJMB 3Q3GB 5AOKA 4AL8H 2Y7SA 1M42A 3EHBC 2KT6A 4PGDB 2ZONA 3LOWA 4OCYH 1J5CA 4JFEB 3EFFA 4KVPA 2D2CC 2Z6FA 3ULUF 3KYNB 4JJOA 5E8PB 1CICA 1T6BX 2B0SH 2VLJE 2BP5M 4NZUH 4ZO8A 5E23A 4AWJC 2J44A 2XWJA 2DTMH 5I18H 1CE6A 1KTCA 1LK2B 3WUWG 1JGLH 1UJTA 2IDUA 3MPCA 1MAKA 2AJYH 2C4FU 2LLNA 4RAUB 1L5GB 3UH8A 2EO7A 2FQDA 2DJSA 1SFHA 3FYEB 5CEXA 1QR1A 4GIOA 1B3IA 1HYRC 4K7PX 4ZFOB 2JLPA 1MFAH 1XB8A 1NC2B 4Y1AE 5ITFA 2XACC 7PCYA 3FFCA 2CKBB 4JFZH 1MY5A 3MXVH 2E9BA 3PAYA 4GRLC 5JIIA 2B9AA 3SPHA 3WOVA 4G8GB 2RCSL 1JDDA 1S46A 4PTTA 5J6HB 4G6KH 3RZWA 3MRRB 1AXTL 1F58H 1BZQK 4HZ1A 1KELL 3N04A 4DO6A 2V2WA 5CLYA 3U0PB 2HG5B 4WEMB 1NEZB 2MWCA 4PRIE 3SPCA 1JNNH 4MD4A 4O9HL 2P43B 3UMNA 4ZX6A 1KZQA 3DGCR 4HS6B 4UDTB 1U91A 4GIAA 3D0LB 1MFBL 2PWGA 3G08B 3EO9H 3QZPA 4IIQC 4OCXL 3RGVC 3WEXB 1TNMA 4PBVC 4KKPA 4B9PA 3O6FC 3ELAT 4FX5A 2EJ1A 4DP8X 2VIRA 1D5IL 3T3ME 2CHDA 4V33A 1QRND 3CZLA 1U95B 4ZO7A 3BWUF 3WS6A 1LXMA 2FJSA 3SE8H 3GUTB 2VDOB 2NTFA 1EGJA 3MACL 3G9AB 3E9UA 4QHKI 2DRUA 5DHDA 4UQ3B 3H2QA 4K8RL 1T5WA 1YNTF 2QVKA 3CFIC 4AGNA 4KNSA 5JW4M 1IZKA 3BZDA 1YA5A 1NC2D 3LZFL 2J1WA 4ODWB 5DUPH 1H8OA 1MFCH 2D3LA 3IDNB 2N7SA 4WI3A 5E0QA 5DR5L 1K8IB 3K0YA 5E6SB 3SGKA 3VQLA 2XN9D 2ORBL 3LNHA 4APXB 2DBLH 2ZKMX 1I4FB 3GSOA 5I1HH 2FL5B 3OXSB 3LY6A 3BVNA 1MJ8H 2CNZA 5EEYA 2HCZX 5DVKA 3KGUA 2HFFA 3BN9C 1CF8L 3JWNC 1HHGB 3JUZA 4W6XB 3WKNA 3MOQA 1IMHC 1GGBH 2ZCZA 1OM3H 1S7VA 3ZK0A 2X89A 1YUKB 4HKBB 4JG9A 1H3TA 4F7PA 3EFOA 3H6JA 2CZNA 2BK8A 2NYKA 2W95A 3AMLA 1XH3B 2B1HL 5DHMC 5I15H 2WVVA 2AITA 5IVXF 1MCOL 3LIUA 3U2JA 2F53A 1U3HB 5IEKB 5DWUH 3QUMH 4M6AA 4MBOA 5ES4B 3F7VB 4WO4D 4OAWA 1K4CB 1KYOJ 1PYWB 5DURB 2EVFA 4NYLB 2L7QA 5E5RB 1CFTB 3ULSA 5E2JA 2ALWA 5J1SC 3DX8A 4JKWA 5F6IB 2XZCH 4JE0A 4YFLF 3FFCE 3MA9H 1NCWH 3N40F 2Q8AH 4ONOA 1OP9A 4DP6X 5D1ZA 3JV5A 4KHXL 5FYKE 1BVZA 3CZNA 4IOIB 2GTQA 2TRYA 4N90D 5E6UB 3REVB 1S7WB 5DD3L 3UJIL 4LCYA 2ZX9A 1P1ZA 4UNUA 5AL0A 4AQAA 1A2YA 3BSZH 4L9LB 4KQ0A 1ILSA 3DHMA 4YDIH 4EO5A 3L9EA 4GW1A 2CO7B 4TPRH 3V4UH 1O7SA 2EH8H 2HFEB 2XQBL 4ZMVA 4C4UA 4WU7A 5DMKB 1F86A 1UM6L 1Z9SA 4LSVH 3TVMB 4AQOA 3HHRB 5C0BA 1PGRB 1OD9A 2VLJB 2WQRA 4DGVH 3MRIB 5DA0B 3EO1B 1U3HD 1U9KA 5EZIL 1L9PA 2PP7A 3WYRA 3BWUC 4AQ1B 3R8QA 4UM9D 5DURD 1ONQA 4ZUWB 4YZWA 3CHPA 1LWRA 4JDZA 1BZ9A 1W8EA 1I8MA 3ATAA 3FTVA 2COQA 3IDJB 4Y1AB 5D7SH 4QTHA 3I3DA 1U8MA 4HCRH 4OGXH 4K5MA 1USQA 3X12A 3WFHB 5JPMB 1PIFA 3BDYH 3RX9A 1JGIA 2FGWH 4QXTA 1MPAL 2FT7A 5I9QB 3MNZB 2VN5A 3HKFA 3QNYA 5LGJA 3WJJC 4HXBL 3QUZD 2V37A 3WXWL 3T0DA 4GQ9H 2BHFA 5AVYB 3WIHH 4PRIB 1C5BL 4APQB 1SRDA 2FWUA 3CC1A 4JM4H 1TJXA 3I84A 1G6RL 3IVKB 3L13A 3DBXA 4PP2B 5DJDA 4YSAA 5FO8A 4HT1L 2CJSA 4YHML 2EIZA 2QQNL 1Z3GL 3LH2L 4YIQA 3ZTDC 3V4VH 4AXWA 1MREH 2NW3A 2ICEC 2VLJD 5GRZA 5CILL 3HS8A 2BP0A 2F53E 3T3MB 4XXDB 5IFHH 3BPNB 1CT8A 1M53A 1UEYA 3KGTA 4HOZA 1OE1A 2R1YB 3NTCH 5ITBH 2IFFH 2PMZA 3WNPA 5JZ7C 2RQ8A 5IBUG 4XMKL 2P5ED 2Y7QA 5I0VA 2KZWA 3NJMA 3GS4A 5J12B 1NKRA 5AL8A 3CBJB 1RV6X 1BOGA 2Q6WB 4JY5L 4AX3A 4L3AA 3L16A 3ULVC 4ZT1A 5HBBA 4OZFG 5E0FA 3W9EB 4AMKL 1UATA 5CCKH 3MA7A 3BKML 4KKCC 1MAMH 3ZQXA 5CN1A 1PSKL 4DF9A 1S9KC 3VFUB 4TM9A 2VITA 4X99A 3ZYZA 2TAAA 3T1FA 5CJXC 3ZTJG 2W65B 1V3LA 5E2TH 1RUAH 3D1MC 4FG6C 3BQUC 4DGYL 4ERSH 3OHXC 4A7GA 1XCQA 4PRID 4APQD 4L4JA 3BW9A 3RBSA 5EH1A 3QHZL 1WICA 3DUUA 3EFFB 4JANA 5E2UL 3TEXA 1CMOA 4OCLC 1RZFL 5C0BE 3WNIA 1CICB 2YBRA 3GNMH 5LAPA 1JHKL 4ZUTA 4FYQA 4UIKL 1M7XA 5GSVA 2XWJB 3COOA 3G5VA 3HPJB 5IP4A 1CE6B 4XX1E 3OLGA 4L8BB 2IDCA 3NIDE 2VUYA 1MHPL 4ODTH 3TV3H 3VFTB 4U6VL 4K3JL 3ASNB 1A6TA 4NZ8A 2Y2WA 3C8DA 1P9MC 4YDVA 4KK8D 5CEXB 1QR1B 2V8MA 2A77L 1HNFA 5LNEA 1J1OL 3VA6A 5ITFB 3GIZL 4XHJD 4C4BA 3T6WA 4A2MA 5JHBA 3FFCB 3GI9H 1UXWA 3RDJA 1UXMA 4PTTB 3SPGA 3V0VA 2D3JA 4CMHC 2MTAA 4UTBA 4YHLL 3VXRD 3RIKA 2I60L 2V2WB 4KPHH 3HC3L 3LDBB 4XNMA 4QRBA 5EEXA 1KLUA 4Y2DC 2VLKA 4MD4B 4RISL 5D1ZI 2JTYA 1U91B 4YXHL 1CGTA 3LEVL 3IGAA 3MBWA 2E56A 3L5WA 1IT9H 3BH4A 3OF6A 4N2FA 3U2IA 3LPPA 2VDNL 4G59C 3NYKA 4UTAL 1T7XA 4QMEA 2VIRB 4X6DF 4BH7A 3BD3A 1OB1A 4QOKD 3FMGH 1VCAA 3UIYA 4AVIA 3MNMA 1JTTA 4MSWA 1ZLVK 4KO6A 1AOZA 3W38A 5EU7C 3ZDXE 5I1IH 1UUNA 2WZPD 1OANA 2NTFB 4Q6IA 4HIHA 2QSQA 4OQTL 4OIIH 2PCPA 3CFCL 1T5WB 1FLTX 3QEQA 3RY4A 2FTAA 2ZOWA 2AJVL 2L7EA 4N5ED 3QFGA 5TD4A 1BW8A 5F89A 1NBQA 3R18A 4M4RA 4YLCA 3DGGA 3N2JA 2YD9A 3GSOB 4DP4X 3BVNB 3GO1H 4NNPL 1JZFA 4HFUL 2HFFB 2F54A 2PXYC 4XXWC 1CF1A 2A9NL 3D8MA 3NSJA 4NP9A 3ARFC 4UT7H 4P9HH 2D7TH 1S7VB 3OGCA 2AJSL 1NSNH 1LO2L 1TPXC 2M1KA 4M48H 2X6UA 4KKRA 4FNQA 4F7PB 3EFOB 4JG0H 1TCMA 4YUEH 5TK4A 3T6VA 1YYMH 1GTNA 5LDUA 3W2DL 2WVVB 1RZJH 5GGTH 3IJYA 2IDQA 2EIDA 4GT7A 1JZ8A 3O2DL 2F53B 3QRLA 4MMYA 1T5KA 5A2CA 1QNZL 5AKRA 5F96H 1NPNA 1QBLL 3D0AA 1Z3RA 4OAWB 3QR0A 4JB9H 4ODSL 1X44A 2NQDA 2PYEA 4UT6H 3E8UH 1SQ2N 3ULSB 1RK0A 1ZK9A 3DX8B 3GM0A 1J0ZA 2MHAA 1A8JH 1ZOXA 3FH5A 3DETC 1D2PA 3IPEA 1I31A 3EYQC 1UHVA 2EADA 2R4RH 4Y4KA 1MDAA 2A9ML 4LU5L 5D1ZB 5G5DA 2DWEA 5MEPA 3INUH 3TWYA 1N8OE 4LCYB 3TBBA 2WLYA 1P1ZB 1V55B 2VLKE 1SXCA 2HG0A 4AQAB 1A2YB 1VSCA 3T0EA 2WXHA 5GJTH 4OLVH 1KYOK 2NY1C 4GW1B 1MCPL 1UWEH 2YK1H 4Z7NE 1CBVH 4Y88A 2R8SL 4WU7B 1CWVA 1G9NH 4R26L 4N1EA 1Z9SB 1Z2KA 2LW3A 5C0BB 2EABA 4XO8A 2XX1A 4TXVB 4E9XA 1UM5L 4BGLA 5T3ZE 3L3OC 4CJ1A 3Q06A 1W6WA 4J6RL 4WDIA 2C1OA 3K2KA 4G2AA 3AY4A 4JGNA 4F2MA 3NIDB 5KW9L 1JS4A 1E6OL 4ANWA 3KBHE 2ARJQ 1ONQB 1ZVHA 4N8PA 4CSSA 4JDZB 2QPDB 1BZ9B 3QEQE 1I8MB 2LT9A 4DEPB 1QTSA 2GIYA 3VM5A 4PVLA 4QTHB 1ECZA 1CGXA 1BLNA 1U8MB 4KQ4H 3X12B 1IGFL 3MDJA 4I0KA 4S1QL 3F62A 2NXYD 4OCSL 3KWUA 1PAZA 4RMWA 2ED7A 5IB1A 2OMVA 4QXTB 3RURA 1MY7A 5HI4C 4ZAKC 2Z65C 1G4MA 3KYKH 4LHQB 1INQA 5I1JL 3QNYB 4LT7A 2F54E 5LGJB 4NB7A 4L9DA 2YPLA 2DLFH 4K7FA 4UBDC 3IFNL 2HMIC 3DBXB 5C2UB 4H26A 1CYGA 1WH0A 1XR9A 2V7HA 5DJDB 5FO8B 4OIFA 1EERB 2EIZB 5GGVH 5DFWH 4W9HC 3LQAL 4YIQB 5C0BD 4AXWB 1NJ9A 4V1DA 2NW3B 4BCXA 3QJSB 4BA0A 4OFIA 1KTLA 5F1OB 2O6PA 1I9IL 1A6WL 2BP0B 3NRQA 3VA2C 2DS4A 3FCSA 1O5PA 1CT8B 2F58L 4AKPA 2QHRL 3WD5H 5D6CA 4XP1L 4XPFL 3ZDXB 1XGQA 3WDJA 2WZ5A 2PYEE 4AVKA 4F7CA 2Y7QB 3ZGHA 4UINL 4OM0L 1A47A 3FH7A 3B4NA 2XVKA 1KB5H 3ZYJA 3O3DA 2G4EA 1BOGB 3QFDA 4LPUA 1JNJA 4C58B 2WW8A 3MA7B 2WQ8A 2BOCA 4KJPD 4K73A 3K6IA 2F5BL 4WW2F 4D3CH 2VITB 1BFSA 1ND0A 4X99B 1U2HA 4Y2LA 3T1FB 3WU1A 1HI6A 4BFOA 3DO4A 2XTLA 4CVXA 3VB9A 1WO2A 3T0EE 3AT9A 1U3JA 1XCQB 4OJYA 1GZQA 3O9WC 4Q0XH 1X5IA 4GIPD 3VW3H 2NZIA 3BW9B 4KROB 5FHAL 2PKDA 4L2LA 3H8NA 4FQ2H 5INDA 1KEGL 1NAMH 4HWBL 3DUUB 4JANB 4YQXH 5FYJE 2YBRB 2R0LH 3QEGH 3NIFF 4ZX5A 4Z78A 2TRHA 4ZUTB 5GSVB 1X4YA 3G5VB 3U2SA 2YKKA 3ZZ1A 1RMFL 1TTFA 4F2ME 5DLLA 3WIFA 3GQFA 3GKWH 1A6TB 4QLRA 1W72H 3PWPA 2H2SD 15C8L 2WLMA 4YDVB 3VG9B 5AB0A 1QLEB 5GGUB 1OAJA 1ZTXH 1A0QL 4HIXL 2V7NA 1XZ0A 3RQ3A 4YBQD 3IJ7A 3D50A 3UGXA 4J27A 5A2AA 4EUPG 2ZP8A 1VDGA 2ZKXA 1RPUA 1UXWB 4BRJA 3SDDC 3V0VB 4DAGH 1XZWA 1URZA 1DBML 1QACA 2EE0A 4FKHA 4XNMB 1KLUB 2VLKB 3FQWB 2YPLE 2XPGA 1AR1C 1Y6NR 4KROD 3W56A 2C3HA 4PIBA 3U4AA 3IGAB 3MBWB 4Z7NB 3L5WB 4LCCC 5L4FA 4V1DE 2P1YA 3ISYA 2J88H 4TRPH 4BH7B 1OB1B 4U2ZA 4U1MA 4KDTC 2O5YH 2X3BA 4L23A 4TSAL 4YX2H 4AEHH 1BQ5A 2G2RA 4MSWB 1KGYE 1N67A 4O5LH 2Y0SA 3H0TA 4F58H 4GRLA 1EDHA 2D7PA 4GNKB 1OAXL 4HIHB 4Q6IB 4MJHA 4KMQA 2EDXA 4YSOA 3QG7L 2PCPB 4D9LH 3A3YB 3KVPA 3OAWA 2B7DT 2WK2A 3QEQB 4KC3B 2IMMA 3LXAA 4M4PA 5F89B 2MRYA 3L7FA 4M4RB 3DGGB 3N40P 1DL7L 3ARBD 4DN3H 4G6AD 4IIQA 3RGVA 3U6XS 1G7MA 3CBRA 1SOKA 5DSCA 4DTGL 1UOLA 4M02A 3O6FA 1I3UA 1UCBH 4LLWA 1G5AA 4PV9A 4Z5RA 3C9NA 2F54B 4OD1L 5GRUL 4BV1A 5JXEC 2VLKD 2WGNB 1DFXA 3PU7A 5HD8C 1RUMH 3P3TA 1XL6A 3OGCB 2HPTA 4J3WA 4WUKL 1KCKA 5EA0L 3ARVA 3AXIA 1BAFL 4ZS7H 1G1YA 4U3HA 3OF6D 1VLXA 1IAIL 4JM2C 2ARJA 2GUYA 3HN3A 4R5TA 3ZYOA 1R3IH 5CS7A 4DKFH 4EDWH 4I0PD 3ROLA 2C9AA 3Q2WA 1LO0H 1GGCL 3IJYB 1HCFX 4AKOA 1PLAA 3CLEL 4XCEA 4MMYB 2VH5L 3ZT5A 2WANA 5E08H 2KH2B 2A2QT 3PWPE 1GYCA 1SJVA 3CVHL 4XZ4A 2PYEB 1MRCL 1FAIH 4W9CC 3ECVA 4Y5XA 4QJ3B 5JOPE 1RK0B 4Z7VF 2F15A 3QEQD 2MHAB 1WJ3A 3FF8A 3VXMA 2ZXAA 4NNYA 4U31A 2I07A 1QFHA 2J8HA 1X5YA 4U05A 1J88A 4Y4KB 5G5DB 2DWEB 4OJCA 5MEPB 5FPIA 1CS6A 3O0RH 1RZ8A 3GWJA 4K8RD 2Z34A 5IW3A 3IAGC 4E0RA 4LLVA 1KV7A 3T0EB 4D7BA 3IGFA 3BJ91 4RESB 3GTVA 4M6OH 3C8KA 1HWHB 2UXGA 3HUJA 3CVDA 2CPUA 2I5YL 2HRLA 5GISL 3JV0A 3CSFA 1DVXA 4BIKA 2QADB 3MUY1 2AJXH 4K5LA 1DJWA 3DX4A 2FQFA 5LXGH 4L5FE 2VL4A 4K94H 4WDIB 2E7BA 2C1OB 1MF2H 3B5TA 3H9HA 5GJSL 3RWGB 4F2MB 1LHZA 2O1AA 5GRVK 5FF6A 2YMOA 1F5WA 1K2DA 3FJTA 4N2BA 2PYED 4G70B 4RFOH 2R69A 4KWUA 1P4IL 3LZPA 3NDYE 3TNMA 4ALAH 5F7WC 3RWHA 1NC4A 2CLRB 3FONA 2ITFA 5C1MB 1HH6A 1A4BA 1E8ZA 2QPSA 2ZSVA 3H2PA 1BLNB 5HGGS 3BVDB 2P46B 4R3SA 1A14L 4UZUA 4ZD3L 1YEEL 3D3VA 4Y4KD 3GHBH 2OMVB 5IB1B 2ZPKH 3P0VH 3FSAA 4L8DA 1IVLA 2AC0A 1INQB 3MODL 3SDXF 5IW6A 2ZKWA 3S98A 4P57A 5E8OA 1GCFA 4KI5F 4HULB 1ZDQA 1OCOB 2YPLB 3MXWH 4K7FB 3OXRA 4XN9A 3D9AH 5DC2A 2AVGA 4B9IA 5D4QA 3I74A 4H26B 1XR9B 3BAIA 2V7HB 2OR8A 3I50L 3QNZA 4ZUSA 1CTNA 2BNUA 2JKTM 3IN2A 4LSRH 1TO4A 2DB8A 3LS4L 3HBGA 4ZXBC 2P26A 3SO5A 4DUVA 5C2BH 4LPCA 5LHDA 1NJ9B 5I6MA 4V1DB 5FYJD 1S7RA 2JB5H 1S2EA 1KTLB 3SKUD 1FVEA 2ID5A 4LPYA 2ZYIA 3UC0L 4B9FA 1KBGL 1JFQL 3LCYA 4OJAA 3EYVA 3SPVA 1N6QL 1YNTA 3FCSB 4TULL 1IC7H 2V2XA 4TUOA 2XZQL 3S35L 5D6CB 4ETQA 1XGQB 1WQVT 3NA9H 4F7CB 3VI4A 4W9FC 4PR5A 3L1OL 1NCTA 1EO5A 2IJ0C 3O3DB 3QFDB 1B0GA 5T1MA 1N0XH 1IAOA 2NX5A 3JWNE 2ZCLH 3D4CA 1RJLA 4RFEA 1I85A 4J8RA 3VXME 3WJJA 4OLUH 3AUVA 2BOCB 1AMXA 1SUHA 5K9QI 3T2OA 1FSKC 1RUQH 2W9LA 3F7LA 1ND0B 2JWYA 2VAAA 4TUKH 4YXLL 2BM3A 3FUEA 4WKXA 4GSRA 3H9SD 4TS6A 5J7CC 1DVQA 1HI6B 2XPZA 3SE6A 4JG5A 2YGPA 4CVXB 2FQEA 1A6VL 3BWZA 2ICEA 3GRWL 3IMWA 3A6BH 4M7LL 2X2YA 3I6GA 4OD2A 5D96B 5KSBF 4K9EC 3B2VL 2R29L 1GHFL 1GZQB 4LLQA 5I1AA 5FYJU 2VW6A 3APMA 3NOIA 1OGAA 3HUJE 5INDB 4U7MA 2MQCA 1A3LL 3AJ7A 3FTYA 4HOXA 3PGDA 3WFDL 3M46A 1PS3A 4V1DD 2Q76A 4Z78B 3O3BA 2JKNA 1KN2L 5L88H 4NS0A 2A0LD 3DNKA 3U2SB 1I82A 4JFOA 1TETH 3RU8H 5ALBL 4UILL 2VDKH 5CZXD 3WIFB 1NWPA 1KT2A 1J5DA 1AFVL 3PWPB 4PJFA 1CYXA 3OD3A 1NCGA 4HWBA 4N0FB 2V3FA 4W93A 1T0NA 3WTXA 3ZE2F 2V7NB 1XZ0B 3BQUA 4I77L 4ENEC 3OHXA 4BSWA 4PREA 4W9KC 3PJLA 3D3VE 4PPTA 3T0BA 2YUXA 3MVSA 4KMTL 4I3SL 2DM7A 5BVPL 3EHBB 5AYUL 3LMJL 4XNXH 4OLWH 2ZT9C 1DQQA 1YEFH 3BZ5A 4KTDH 5D70H 4Q9QL 4LIQE 4KQ3L 1LK3L 1M1XA 2Q5BA 2XPGB 1OQXA 5L6YH 2IQ9H 1HHKA 2CRMA 2WBJC 2WO3B 4FF9A 3V0JA 4M43L 2Y22A 1PDKA 1KEML 4F80A 4H5SA 3UBXG 3AQDA 3BVXA 2QL1A 4MXWH 1P9MA 2BSCA 2X44D 5TJWK 3BXNA 1DBBH 2VR6A 4NZTL 4U1MB 3CMGA 5I6KA 1T6WA 4AV5A 5GS0L 1YECH 2G2RB 4DFHA 3HZMA 3LS5H 1PU0A 1SLUA 4DERA 4JRLA 3H0TB 3VI4E 4M7ZC 1QFUH 2IXQA 3PWPD 4GRLB 4WWID 2E5EA 4KVNH 2R56H 1N19A 4ILDA 1VJSA 3KPNA 4HSQA 2NX5E 3IU3A 5JOPD 1LMKA 1OAUH 1A1OA 1FA4A 3L7FB 4FJYA 4R7NA 2LTQC 2QEJA 4NKDA 1DQLL 4U49A 5I1CH 1TJIL 4IIQB 3RGVB 3AG3B 3EHBD 1G7MB 4GKNA 4KVCL 5DSCB 3ZOAA 3O6FB 5IHUL 4LLWB 4FG0A 4PV9B 4Z5RB 3C9NB 1JYVA 2WV3A 4AIXA 5I73B 1JXFA 1PNDA 3ZDYF 4HLZH 4Q52A 3KL0A 1OGAE 3CJJA 2E9IA 5AYTA 4YHKH 2A6JA 2DIJA 1RZ7H 2FJFA 2DH2A 2HKHL 3FZUD 2ARJB 4JN1L 1AZZC 1GOGA 5TFSL 3ROLB 3IJ8A 2WCGA 3ULVE 4XCEB 5F7BA 4H88L 2VRKA 1TJHH 2EQDA 5ETUA 4PW4A 1GKEA 4JL2A 2ICWA 3SYQA 3CV5A 4JQIH 3WFZA 4HUNB 5LN4A 3DX0A 4PJFE 1Q9WA 2YUWA 4GRLD 4BFNA 2J8UA 4Q74A 4Y2NA 3LAFA 4Y5XB 1EPFA 2YAMA 1ADWA 3QQ9D 4YHOL 4KZEH 12E8H 1QFPA 4JMXA 5LG1A 3CDCA 2PXYA 2ZYSA 4XXWA 1EHNA 3VXMB 4NNYB 3ARFA 2I07B 2HT3C 4CU8A 2QPEB 3BO8A 4PGEA 3H7BA 3T6QC 3FN9A 3DI2B 4PB9H 3FN0H 4TQEL 4LCIH 3GZPA 1RZ8B 1QSEA 3O6FD 4B9YA 2DWTA 2E8ZA 4TTGA 1OCZB 1IGCL 1KIPA 1KXVC 2DKUA 4N85A 3BEVA 4LE8A 5F7DA 4E0RB 4LLVB 4NWUL 2CWRA 2YARA 1XVSA 1OTSC 2C34A 5GHWL 6FABL 3C8KB 5FO7A 3HUJB 4PJ8C 4IBVA 3MN8A 3PP3K 4I7ZC 3B7UX 4IK6A 4WCYH 4P3WA 3NN8A 5TE4H 1OVZA 4K0OA 1Q1JH 4N2LA 5D1XA 1RUKL 2FEEL 5C6PB 2A74C 4YSRA 1FAKT 3BT2L 1NDGA 1TCRA 4QXVA 3U36B 5ACLA 3FB5A 3H9HB 3Q1EA 5FF6B 1K2DB 1OSYA 3NCYS 4ANKA 4W68A 1ZV9A 3FF7A 4J3UA 1XX9C 3HRPA 3TNMB 3QIWC 3QR2A 4PCKA 5I24A 1NC4B 4YH6A 3FONB 5AKSA 1HH6B 4AYBA 1JZ6A 3J27A 3BN9D 2WLLA 3S9DB 2ZSVB 3O3AA 3VXMD 1RU9H 1E50A 1KCRH 3ETBJ 4XBEL 5D4JA 3IXAA 4DCQA 4R3SB 4OQ1A 3WTUA 3D3VB 4TVPH 3UG3A 3AFLA 5C7XL 3ATDA 2FBJL 4LRNL 4L8DB 3GYRA 1OV8A 1AZRA 2OK0L 4IW4C 5IW6B 1NGZA 3EDFA 4P57B 5E8OB 2VUKA 4N2DA 3BZEA 4B96A 1KGXA 2JI1A 3L3OA 3OXRB 1OT4A 3BDXA 4ZUSB 2C4XA 1KB3A 3QNZB 5EU7E 2XOTA 4P3CH 5FCUH 3OZ9L 1QLRA 3B2PA 4OI9A 3NABL 3C09B 1S7RB 1BQUA 4X4MA 7FABL 1FVEB 1FFPB 5EZOL 5K9JH 3B9KC 3SPVB 3UPCA 3EYVB 3NACL 4GG6E 1YNTB 1ITBB 3PWJA 2V2XB 4TUOB 2Y2TA 4WEBL 1U4FA 4U1JA 4ETQB 4ZOBA 2J8UE 3VI4B 2GFBA 1AS8A 4PR5B 4ZAKA 1OP5K 1VF5C 1B0GB 2A99A 5T1MB 1IAOB 2NX5B 3TCTA 4RFEB 1RJLB 4J8RB 2P5WD 3OAUL 4FULA 2FB4L 1JXDA 4UMGA 3MOBL 2C9RA 4FQHA 3U46A 2X09A 3BPLC 2NZ9C 3VXSD 5KBDA 5I26A 1QSEE 1WZ1L 4IGBC 1AS6A 2BFVH 2XBDA 2ICEB 4OD2B 1NDMA 3I6GB 1CD9B 4NUJA 4Z3TA 1JVLA 2W9EL 1PG7L 3CQFA 4ADJA 5I1AB 2PPAA 1BOYA 1OGAB 1AO7A 1R6VA 2RCSH 1W16A 3NSDA 3CVIL 3PGFL 1AXTH 2W91A 4JRYE 3PGDB 3UXFA 1KELH 4X7SL 5JNYA 4RQQA 2XQYA 4FFYA 5D1XE 3JVGA 2Q76B 3B6SB 1SM3L 3O3BB 2VM3A 4O9HH 1OK0A 2Y7OA 3I6SA 3IFPA 2Z1PA 2WWKO 4K9EL 4OCXH 3HLKA 1MFBH 1RZPA 1I1RA 2EICA 4JFOB 4R2GC 5JDSA 2ISDA 5E4AA 1KXQA 4PEEA 3WLBA 5DHVH 1OAZL 4I1PA 5I0ZA 1KT2B 2X4SA 4PJFB 2N1KA 5AEAA 1D5IH 2J6EA 3G6JF 1T0NB 2D9QB 1WZAA 4HAKA 1TITA 5LLIC 1IAIM 2ICWI 2IBZX 3JBG7 1MJJA 2E9WA 1OAYL 3BQUB 3OHXB 4BSWB 2XTJC 4PREB 1RZQA 3O9WA 4MA3A 4BQ9A 1SF5A 1IAII 4Y1TA 2R15A 4YC2C 2J71A 2E9GA 1JZGA 4K8RH 3VAEA 4YN3A 1DQQB 1MZZA 5B1CA 2YUVA 1JNLL 5ISZD 4Y19A 3LZFH 3ZE1F 2COVD 5I8KL 4UQIM 3FO0L 5IHBA 1T1YA 5DR5H 1M1XB 4X6DE 3BQVA 4Q2ZA 2ORBH 1HHKB 3MLSL 1BBJA 4DESA 1PDKB 2Q7YA 3VDAA 1A21A 1M2OA 1E8XA 1PLBA 4GRWF 4H5SB 3JV6A 1SOXA 5A2LH 4A6YL 1ZLUH 3FQ2A 1CF8H 4X4ME 5KVDE 1MI5D 2NNAA 3BXNB 1T1WA 1EAPA 4NJAL 1VFBA 3S5ZA 1MRFL 3TZVA 5DMGC 5EOCH 3ULVD 3BAKA 5DHEA 3HZMB 4F91B 4ZPVA 3PXLA 4KKCD 3FOMA 1UGNA 5EDXA 2IXQB 3A5VA 2B1HH 4EXKA 2WVUA 2Z93A 4CMHB 3KPNB 1MCOH 5AVZB 3ZBMA 3V6OC 3IU3B 1L9NA 3GTTA 3GS0A 4FG6D 3BQUD 3UADA 3RB7A 1A1OB 4BHUA 2XQYK 2AHIA 4URTB 4R7NB 1HEJC 4NKDB 1CLZL 2CJUL 3P4NA 3FUHA 5FGBC 4GKNB 3WNNA 4WGWB 5CUSL 1GH7A 4LAQL 5GGRY 2VERN 1ZLWK 5DGQA 4BFKA 2WP3O 3THML 4KDTA 1IC4L 1L0QA 1TZGL 1AO7E 4KHXH 1MCWW 3DXAD 1N8ZA 4H20L 2A6JB 5IUSA 2FJFB 5DD3H 3UJIH 1OAQL 4PUBH 4OLEA 5F71A 4CU7A 1WZKA 4FRWA 5D5MF 4AE1A 4AYMC 4OZHA 5E95B 1YQVL 2AI0L 4UOJA 1AG0A 1KXQE 3CCHA 4PLKC 2XQBH 4A39A 2H7WA 3P1VA 2ICWB 2XWDA 4WW1A 3U83A 1UM6H 2D3VA 1Q9WB 5D7EA 4KBPA 1GS6X 5I5IA 4FG2A 4IJ3C 4WW2A 2J8UB 4S1RL 3WKPA 4CSTA 4BSJA 2HJFA 1YVLA 2MIZA 1AE6L 2QELA 3NZUA 1WF5A 3OR7A 5EZIH 1ZVNA 2CUHA 4FNLL 2PXYB 3Q8AA 3Q1SL 4Y2DD 3ARFB 5DZ9A 2J4WL 2IAMC 3BO8B 4PGEB 1NUDA 3H7BB 4WWKC 1NEZG 1R5IA 2FGZA 3HFML 5J11C 3MGTA 1XCWA 4XAKD 4Y19E 1QSEB 1YQ2A 3NCCB 4JM2A 1MIEL 5EO9A 3PNRB 2AV7A 5I16A 1YCSA 4MMZC 1KIPB 1HJCA 5F7DB 2R39A 5BW7C 2X6AA 1G1CA 1NTDA 5FYLL 3GSXA 2A4CA 2F61A 3W39A 5FO7B 1MPAH 1C8QA 1HDMA 3FUMA 2OCJA 4KK9C 3NN8B 1XCXA 4JY6A 1ZIBA 1G1KA 4JRYB 4HXBH 3WXWH 1RXLA 3IJSA 4HSCX 5D1XB 5FDYA 1QYGH 1RP9A 4MJ6A 3ARGA 5ABZA 1MHEA 4NCC2 1G6RH 1NDGB 1TCRB 3V0WL 5I6XC 5E4IA 3FB5B 1U8CA 4HT1H 4B41A 4YHMH 1J5OL 5KVFL 2JKWA 2QQNH 1Z3GH 3LH2H 5HDRA 2EH7L 4IOSA 4JCLA 4DW2L 4PP1C 5CILH 1FVDA 2X87A 2ZG2A 4YBHA 3V9FA 2VR8A 2B08A 2WLLB 2PXYD 3O3AB 4PHXA 2V9TA 3ARFD 3IXAB 5I66A 3T8XB 4DCQB 3F01A 4XMKH 1TTAA 3DK2A 1QPKA 2NY1B 1QW8A 2C9PA 1KSRA 3KLQA 5F8QC 5A7EA 1TZOA 1KNOA 1NFKA 5DZLA 3SCMC 4JY5H 3NEXA 2FJUB 1NGZB 4LOUC 4U33A 1CURA 2AK1L 1I1YA 2VWEC 4AMKH 3BKMH 3BZEB 1PSKH 1F42A 4X6DB 3L3OB 5KSVA 4QRSA 1V7NL 2H5UA 3HHMA 4WHYH 4OBSA 1CE1L 1CGSL 2W80C 4GG8A 5T1JA 2RA1A 3GMQA 4WFFE 1DLHB 2WLHA 1QLRB 3SO3B 4HPOL 2HX7A 2YN3A 1B4LA 4JO1L 5GS1C 4DGYH 2CCWA 3Q2VA 4OZHE 2XY1A 1SHMA 5MEND 3NBNA 3F5WA 4P9ML 3NJGA 1LP9A 1OCWL 3DETD 3PWJB 5CAYB 3QHZH 5IV2A 1JHLL 1KOAA 5E2UH 4NQXA 4U1JB 3CU1A 1AC0A 1RZFH 2WXGA 1BFOA 2JCCF 4AGMA 2GFBB 4TTDC 1JHKH 4UIKH 4WRLA 3WLWD 4ZAKB 1CFVL 4J4PA 3E7JA 4AV4A 5ECJE 4AITA 3MV8D 4R8WL 1KYDA 1PY4A 4XODA 1MHPH 3HN5A 4U6VH 4K3JH 1T4WA 1KY7A 4FQHB 3U46B 5T1KA 1JTOA 2NY1D 2QV4A 3C2SA 5C08D 4S2SA 4ZK8A 4XHQA 5C9KA 1XCTA 1H5BC 4QT5A 1BWWA 2A77H 1U3NA 3HE7A 3L9RA 1J1OH 3ESUF 3ME0A 3EBAA 4R7LA 5AW6B 2Y4SA 3UPAA 4BHUI 4EOWL 3GIZH 4NHCL 1NDMB 2XXCB 1F0LA 3QK0A 3HA0A 3ARTA 1R3HA 1V54B 4QD2E 1E4XL 1QI4A 3IMBA 1GZHC 1AO7B 1AHWA 2DY2A 1MRDL 1T3FA 4YHLH 2WTRA 3OSVA 1CGWA 2I60H 5JNYB 4RQQB 4F57L 3HC3H 4CBPA 3ZMRA 3E9TA 4RISH 3ZSSA 3IFPB 5E8DL 2FSEA 3ZRSA 3QZLA 4YXHH 5JDSB 4OU3A 3LEVH 3WLBB 2Y07L 1NANH 3NUKA 2Y6SC 4UV4L 4EQ2A 2FWOA 2X4SB 2VDNH 4G6FB 5AWNL 3EDDA 3GHEH 4TQIA 4UTAH 3ZTCC 5KBNC 4LGSB 5HI4D 3EH4B 2BOLA 2O6FA 2BCKA 4ZAKD 5EN3A 3UACA 4XNDA 4YK4C 4KK5C 5CU9A 1MJJB 1IBBA 5A6LA 1IE4A 2E27L 3O9WB 4MA3B 4FERA 4NZFA 1U58A 4FNTA 2BOBA 1PX8A 4OQTH 4CA4A 3LHAA 3CFCH 1A7QL 3WEMA 2CGRL 3EJPA 1HZLA 4OZIA 1L0XA 4Y19B 5CU5A 3FU6A 2AJVH 2WLZA 1H6FA 1T1YB 4GUPA 3SBQA 1DP0A 1O7VA 3P4OA 4LDCA 4Q2ZB 3F58L 5KANI 1BBJB 3GBEA 2Q7YB 4R97C 3RVTC 1IGML 5E8EA 4CN4A 3JV6B 4HHAA 1GJIA 5IHHA 2DICA 2APVA 2K4WA 4HFUH 4XNQA 4Q9CA 2A9NH 5KUKA 2NNAB 1T1WB 1EAPB 1CLOL 1VFBB 4U6TA 3FFDA 3TZVB 3SGDI 1J9QA 1I7RA 1LP9E 1IQWL 1LO2H 2AJSH 3LVEA 5KBKA 5AW3B 1KB9J 4UB0L 2FECL 1FZMA 5IQ9A 1U8IA 4ZPVB 3FOMB 2CBTA 4R5VA 3S6CA 2JVUA 4G6FD 3W2DH 4M3KB 3RWJA 2Z93B 4ONGL 2EKJA 2CA3A 3A4AA 1HINL 3O2DH 3A6CH 3VMPA 1GW0A 1QNZH 2Y72A 3SDXA 4FHKA 1QBLH 3K74B 4BZ2L 1AR1B 3O9WD 4ODSH 3P4NB 2UVFA 3ARZA 4FS0A 2M26A 4AK1A 1J8SA 1HEHC 3LZOA 2DLEA 1U21A 2WJ7A 2VJ0A 3D08A 4PGBA 3WGUB 3QJUB 5L0QC 1A3QA 4BDVA 2WJ5A 3BIAX 3MRLA 5DUML 2CHWA 3RB5A 1AQDA 3ARYA 5I1LA 3W11C 3TJPA 1E40A 2A9MH 4LU5H 2DQTL 4Z7AA 4AUUA 1N8ZB 1AYOA 4H0GA 2VXUL 4R4ND 4AT6A 5HPMA 3HZYA 1ES0A 1A9EA 1NGWA 4OZHB 1MCPH 4UI2A 3CCHB 4PSRA 5IFJA 1DVFD 3II2A 2R8SH 1JTPA 4WW1B 3O45A 4R26H 1QSVA 1CI5A 1N18A 5TQ0L 4N6QA 4WW2B 1UJ3C 1UM5H 3U9UA 1KYUA 3SDDD 3RIFF 2HJFB 4NERA 2G2NA 5ANHA 3CMOL 3OR7B 1DVSA 4J6RH 5D7IF 1CL7L 3BUQA 1BREA 1DQIA 2CCVA 3GSQA 5KW9H 1AR1D 1WITA 5BV7C 1E6OH 2XWTB 3WTYA 2H0EA 1RZIA 2WC7A 1R5IB 4NM8L 1Z0NA 4PWJA 3MGTB 4OZIE 3KPOA 4ORGA 4JM2B 4Q9RL 5EO9B 1BPLB 5EPMA 2AV7B 3LPFA 5I16B 5HDWA 3DARA 3FQNA 1IGFH 2Z8SA 2ZX8A 4S1QH 4OCSH 2BIIA 3GSXB 4PYGA 3KPMA 2D7NA 1QHQA 5E5MA 3W39B 4HETA 5E1HB 1HDMB 4N5UA 4ZNEA 3K2MC 4PJHF 3MUUA 5I1JH 1VEPA 4JY6B 4WFFD 4UQ2A 1GJUA 3IJSB 2FX8H 1KFGA 1T7WA 4GINA 3ARGB 1FYHB 4MJ6B 1MHEB 3ZKSD 3QWOA 1E5AA 2CIIA 3IFNH 1SY6L 3EZJB 3JT2A 5IESL 4Z77A 2HN7A 2E7DA 1U8CB 1F4XL 2CMRL 5AUMA 1XBRA 1FO0L 2OTPA 2GCYB 3BUBA 3LQAH 1GPOL 3II3A 4PSPA 3TBWA 3S97C 1FVDB 1I9IH 1A6WH 2QKSA 4XN4A 4WF7A 4F37F 2CPCA 1KBPA 4NN7C 3SDXE 4GKLA 2F58H 2RALA 4M5TA 2QHRH 1KXVA 3AU1A 5JXED 3LNIA 4Q4IA 2J8OA 1FN4A 3L4ZA 4KI5E 4XP1H 1FGVL 4XPFH 5HD8D 4WKZA 5I66B 3H9YA 1SXSA 3JWDC 4E9LA 3SKJL 4UINH 4OM0H 1G9HA 4HH9A 1IC5L 4AJWA 2UY6A 1JMXA 5GS3A 1MCJA 4PJ8A 2P80A 1KNOB 3HRZC 3MRGA 4JM2D 2YSTA 4F1SA 1X9UA 3DJ9A 3V6ZA 1HL8A 3KYOA 1I1YB 3MTXA 4AYGA 5F7YC 2A74A 5KSVB 4QRSB 3WAJA 3K1DA 1U93A 4JQXA 1ILUA 3SN6N 4GG8B 1EXUB 3AS3A 4NFCA 2CBMA 1ZGLA 3GMQB 3G7TA 4HPHA 3VE0A 1MDTA 4NHUA 3VD5A 4ZQTA 3QIWA 4PCTA 1JXKA 5FHAH 3QJXA 2VDLB 3F5WB 4MAYC 1KEGH 1LP9B 5IV2B 1M05A 4F15C 4NQXB 3SBWC 1UM4L 4F9PA 4GQQA 4CVWA 1BFOB 3CFNA 4JM0A 4WHDA 4IOSD 3KWVA 2FUQA 1E2WA 2J1XA 3EF7A 3M8OL 4KKAC 2GT9A 3IN0A 2KPNA 1Z32X 5DZNA 1RMFH 4DPRA 1CDGA 2VQUA 4G3YL 4YPGA 1B4TA 3EO0A 1AR2A 4J3TA 4NXSA 3A0OA 5T1KB 3QQ4A 15C8H 3CH1A 3BFOA 3C6LA 4OIBA 4S2SB 4UTCA 4XMXA 1XCTB 2VQTA 4QT5B 4WJKB 3ULUL 4K3EL 3HE7B 3L9RB 3ME0B 1A0QH 2PR4L 4HIXH 3TCLA 5LJYH 4JFFA 3AXHA 4IOFC 2Y6TE 4OF8A 4NUGL 1CYWA 1MCDA 4WU5A 1R3HB 3B9KA 4WZ9A 4MQSB 3OKMA 5GRWA 4BUQA 1AHWB 4ZNEE 1T3FB 1DBMH 4G8FA 2WTRB 1BJ1J 1MKFA 1RZKL 2NPLX 3MR9A 1ZT7A 3CN0A 5B3JF 4XX1G 2AJUL 2DQJL 2L4OA 3SBPA 3GSUA 2WAQA 3V8CA 1DO5A 3S3CB 4C83A 2FSEB 1QVOA 2X2UA 3ZE2E 3OLDA 4HEPA 3HR6A 4LLAA 5D55A 5HYJD 2FWOB 4X7EC 1HWWA 2VDPL 3S3SA 2BCKB 4XB3A 4IGBA 4TSAH 4JNXA 4F7KA 4HU2A 3B7RL 5FFLA 2X1WL 2FWLB 1UD2A 4H4NA 4ZJ9A 3VFPA 1U58B 4K5NA 5T1KD 1NGPL 1OAXH 1UZ6E 4XVJL 3LZLA 1FG2A 3QG7H 3ZXAC 2I69A 4LCVA 4OZIB 4ZXBD 3SOBL 5B7FA 4LHUA 4QIRA 5H4ZA 5L4MA 3FCBA 3IBOA 4GUPB 1PVHA 1FNHA 4PGCA 3P4OB 3QG6A 4JKNA 1UD3A 3HPLA 3S48A 1FRGL 1DL7H 3EBIA 1J8HD 3FSZA 3IDMA 4IEFA 5FWRA 2AK4A 3MNVA 5E8EB 3X1GA 4D2NA 4DTGH 1U8JA 4U0RC 3CD4A 4HHAB 3TEWA 4HX1A 4OD1H 4XNQB 1S9YA 1QBBA 3ILPA 1X7QA 3W1ZA 3WO3B 2O30A 5K9OA 3FFDB 3AGWA 4IKJA 3HB3C 4WUKH 5EA0H 3RVVC 1BAFH 1WTGT 4QHNA 3EJSA 4L37A 1FZMB 5IQ9B 1U8IB 4FKEA 2PPFA 1JYXA 4Z7OF 3QCUL 2JJWA 3WY3A 1CFQA 3RWJB 3V7MA 1GGCH 5CP3H 3CLEH 3RYMA 2VH5H 4EI6A 3SDXB 2EKSA 4WNSA 2Q9OA 5CLZA 3CVHH 5J89A 2ZJSL 3WN6A 1MRCH 1WCBA 1EUUA 5FK9A 1UT9A 2HUEA 3OPZL 3NFSL 5K33A 4PGBB 4YEEA 5BOJA 1J1PL 4JFFE 4BDVB 3EJCA 1KB9K 3MRLB 4XMUA 1AQHA 2E7LC 3QEHA 1AQDB 1XAKA 4EZKA 3DX9A 5I1LB 4P04A 5DRNA 5HJ3A 2UZYA 1VEMA 4X0NA 5LBVA 4HWEL 5HP5A 1IGYA 4AL8C 5FECA 1E9QA 1ZGLM 4AT6B 5HPMB 4XC1L 4M7ZB 4JFDE 1MCIA 1EEQA 2IWKA 3HZYB 1ES0B 1A9EB 3QC5X 4C55A 1NGWB 1HKLL 1QPXA 4K5PA 3KPPA 5F93C 3SPJA 1N7ML 4E9RA 5IFJB 1MJUL 5B22A 2I5YH 3O45B 4HC1L 1RIHH 2LTQB 4KV5F 4M8UA 5GISH 4PVBA 3U9UB 3AT0A 1VFAA 5FGBA 3H53A 4ETYA 5BOZG 2JKJA 3NDZE 2YO3A 4BCZA 5EC2B 3OB0K 4B7IA 4YJZL 5GJSH 4QR7A 3GSQB 1T2QL 4P23C 2WBJD 4QRTA 4QO1A 5EN2A 4JG1L 1AGDA 1Q1PA 1P4IH 1RZIB 4UU9A 3O2WL 4IBYA 1KPUA 3KPOB 3HI6L 1YMMD 5EPMB 4FNUA 2KKQA 3GKZA 1WYJA 3BFWA 1R5VA 1FC1A 5K1NA 2OKMA 3FQNB 1KF9B 2AERT 4MLSA 1A14H 1RURL 3CGTA 3DKHA 1YEEH 4MYPA 4DUWA 4ZD3H 3TPUA 2NQ3A 3KPMB 5E5MB 2AK4E 5B1KA 4MJ2A 4NP4L 3IS1X 5EMYA 4H44C 5CP7A 3MODH 2IH1B 2H26A 1EJ6A 1JG9A 4UQ2B 5C86A 1QSFA 1KIUA 2YA0A 4B3EA 3QWOB 3NJIA 2CIIB 2EDRA 2JTDA 3G6JA 1CB4A 1UUSA 3HG4A 3I50H 4JO4L 3ZE2B 4Z77B 1SN5A 2HN7B 3KE0A 4PJ5D 4OV5A 5AUMB 1O6VA 3LS4H 3O11A 2IAMA 1R3JA 4WWKA 2MCMA 3TBWB 1IM9D 2DYSB 4LPWA 2QMKA 1KBGH 1JFQH 1N6QH 1TQTA 4JFQA 4TULH 4MMZA 4UOW0 3JUYA 3AU1B 5F7EL 2XZQH 1FN4B 3GSVB 1FH5L 2JXMA 2OZ4L 4XWOC 5BW7A 2BRQA 1SY6A 4HZAA 4TN9A 4WKZB 1NMAL 3VACA 4NKIL 4HH9B 5CJQL 5AAWC 2BVUA 2UY6B 5C0AA 4PJ8B 3AADB 3L1OH 1F4WL 1LE9A 3KR3L 5KVEL 3KMDA 2G75A 3MRGB 2XBTA 5KVGE 4WFHD 3HBQA 3V6ZB 3KYOB 4NO0A 4JCMA 4FFTA 4GPVA 3II1A 1AZCA 4AY0A 3ZHLA 3WTVA 1KCSL 2J21A 2A74B 2VDRL 4QRPA 5FOBA 3VU2A 1DBAL 2KS0A 3L4WA 4F8TA 3JWDL 4YXLH 1T0OA 2QPUA 1MCSA 1ZGLB 1Z9MA 5DK3A 3GM8A 4AQZA 1QD0A 4KRPB 3VE0B 1A6VH 3GRWH 4NHUB 4M7LH 3ATBA 3B2VH 2R29H 1GHFH 2FD6L 3F6LA 1JP5A 3Q13A 3QIWB 4RMQA 4XNUL 3ESOA 1M05B 2BY3A 3RNKA 1OHQA 1A3LH 3ISRA 2JLLA 4OKVA 4LSQL 1L7TH 3MV7A 4FEMA 2EECA 1B2WL 1KN2H 1PL3A 1ZEAH 3SCMA 3PGCA 2GT9B 4PW3A 4EZLA 5CLTA 5ALBH 4UILH 1AH1A 4YPGB 3EO0B 2WXRA 1DBJL 1PD0A 5SX4H 4G1EA 1OTSD 2EDBA 1AFVH 3QQ4B 3CH1B 3LPGA 3C6LB 5E2VL 2G0LA 4X80L 1CGVA 2F2HA 4P48A 4KGLA 2P80D 2G60L 4R0LC 5E8NA 1ADQA 3UPRA 3TCLB 4I77H 2XYBA 4BFFA 4JFFB 1O9ZA 3RJDA 5D5MA 3B9KB 4KMTH 1DTUA 2WWKT 3OKMB 4I3SH 5BVPH 1P4UA 4L8SC 5AYUH 3LMJH 3CN4A 4G8FB 4KZDL 4YZFE 1TT6A 3MR9B 1MJ7L 1QSFE 1JZHA 1ZT7B 4JFDB 4B97A 3GSUB 4KQ3H 4E9VA 2XNAA 3G6JE 3RP1A 3QIWD 4C83B 1QVOB 5J3HC 1BLIA 1F56A 4M43H 2YRLA 2FIKA 1R34A 3GBNL 5F7LB 1Q72L 1XB6A 2EE6A 1FGNL 5E4EC 1I8KA 3BPLB 1J18A 3OKLA 5LQBL 5IY5B 4FI8A 4NZTH 2YD6A 3GK8L 4C54A 4P2OC 4IGBB 3BVUA 2DEXX 4F2EA 2IOMA 3OJ2C 5GS0H 3ARXA 5DXWA 3T6ZA 1JJUA 3ZE1E 3L7EA 5D7LA 2EUZA 3VFPB 4WFEE 3D69A 2IGTA 1GZHA 5C0AE 1FG2B 5CBAA 1MFNA 4GRWE 2CBPA 1F41A 2VM4A 3F12A 4LHUB 5T5FA 3P40A 4F8LA 4JFFD 3KXFD 3MMEA 1JGUL 4QRPE 1DVZA 5E6YA 2W94A 1JMZA 4PGCB 3QG6B 1DQLH 3HPLB 4L4TD 2HJKA 4BFIA 4O58L 4WI9A 3IDMB 1TJIH 4IEFB 3UERA 4R2GB 2KYIA 3TH2T 5FM4A 2AK4B 2BSTA 3MNVB 4JHWL 4KVCH 1U8JB 1AXIB 1XGTA 5IHUH 1HIML 4HX1B 4RAVA 1BVKA 5DQDL 4HDIA 1S9YB 3ILPB 2JKRM 1X7QB 4XOCA 4FQPA 4F3FA 3ZN6A 4KX7A 3ARQA 2ZOTA 1VERA 3P77A 3VM7A 5AENA 4QHNB 1YDPA 2N3JA 4L37B 1SN0A 3A4EA 2GBUA 2GITA 2HKHH 3H3PL 3APCA 3MV7E 3QYCA 4JN1H 3VWJC 4CN6A 2X12A 4YC2B 3N50A 2NZ9D 1CFQB 4LNRA 5TFSH 3QAZC 4OLYL 3UTSD 5KSUA 4FHJA 1Q9KA 4IGBD 2N4IA 2LQRA 4MNQA 4H88H 4EI6B 1UOKA 1JD7A 2EKSB 4G43A 1SDYA 1K72A 4ZMTA 2B14A 4P4RA 2XVLA 1WCBB 1WCQA 3HIZA 4GAGL 2FT8A 3FTZA 5DD1L 5FK9B 3KLDA 1KWGA 2ENPA 3TT1L 3VCLA 3QEHB 4IDLA 5D5ME 3VGDA 1IM3D 2MEJB 5BMFH 3DX9B 5DRNB 5HJ3B 3V8OA 1F11A 2UZYB 4CJ0A 2CUMA 4R2GD 2AJ3A 2YOAA 1IGYB 2NQCA 4GUOA 5FECB 4PJEF 2AK4D 2IGFL 4TQEH 1E9QB 2GI7A 3SPIA 5GSRA 4EN3C 1IGCH 5C3LD 4KKNA 2JCCA 1RL1A 3GI8L 2HT2D 5GHWH 1UCTA 3KPPB 6FABH 3FHEA 1F3DJ 3WKQA 4WHCA 5EU5A 2XTJD 4Q97A 1NZRA 1NEPA 2IH8A 5IQ7L 4F20A 1RUKH 2IBGA 3QNFA 4WI2A 1W91A 3BT2H 1LEKA 3VXNA 3S8WA 5HHOD 5K1VA 1KTRL 5D7LE 3T0VA 1ZY9A 4X6CF 4XVTL 4QRTB 4QO1B 2WHVA 4UAHA 5EN2B 1AGDB 2CD0A 2AMGA 4UU9B 5KS9F 3LB6C 1KPUB 4JVPA 5GQBA 3MGOA 3IK2A 3CFBA 5EUOF 2XI9A 1I1FA 1H8LA 1R5VB 4XBEH 3X14A 4Z3IA 4PS4L 5E7BA 3SB3A 1EAQA 3TPUB 3B83A 5C7XH 1ZRUA 4OKDA 2FBJH 4IRSC 1R24A 5HVHB 3IJHA 3Q8CA 5CP7B 2OK0H 1A4JA 2H26B 4GI8A 4ODXA 3FS9A 4IJ3B 4LL9A 4KTGA 1QSFB 1UJ3A 1KIUB 3DV4A 1KN4L 1M6OA 3G6JB 4XN7A 2OZNA 3A47A 2GJRA 1LWJA 1PCXA 5K9QG 4MVBD 4YVNA 4OV5B 4EF3A 4RDQG 2Y2YA 3OZ9H 3APDA 4FNPA 3UJTL 3Q05A 2IAMB 3NABH 4M1GL 1E8YA 4Q89A 4M03A 4WWKB 2ED8A 5M94B 1D7FA 7FABH 1NICA 5EZOH 5J11B 4G7QB 2B59A 3NACH 5GGQL 1TEGA 4MNQE 4ZOCA 4JFQB 5C6TL 3ECQA 4TMPA 4MMZB 4WEBH 3S34L 3ZE1B 1WHOA 1JERA 4MRBA 4NUPA 3EYSL 4NLHA 4YSDA 5C0DA 3P11L 5C0AB 1TQSA 1GSKA 3OPUA 2KZ1B 3OG6B 4LVOC 1LE9B 1TZHA 3IXTA 3VFTA 2G75B 4GRWB 1DHKA 2PTTA 2NRDA 4G8IA 1MFUA 3OAUH 4NO0B 5KZCD 2ZKYA 2FB4H 1XSJA 4MLIA 1DQVA 1UH4A 5FOBB 4QRPB 5INCA 3MOBH 3FKUS 1RLBA 2Q3AA 4J3OC 5I6XB 3TS8A 4JLRA 4P9HC 2NMSA 1WZ1H 5L7XL 3QYNA 1TOXA 3T2PA 2SEBA 3B5HA 5IOKA 3VD2A 4LEXL 5D7JC 3C12A 3O3UN 1ACYL 1QSFD 2JCCE 2YEVB 1MELA 2W9EH 1PG7H 2M83A 3GMPA 5FX3A 4TLSA 3ESVF 5LBSA 2HT4C 1QWHA 1RZJC 1OOWA 1N5YL 1D2OA 1XHHA 3TNNA 2WINA 3RNKB 3CVIH 3PGFH 4NI6A 1H3XA 4OKVB 3OB8A 4G8AC 4U7KA 2Y3AA 3NT0A 3KWWA 4X7SH 4BWUA 1VPOL 3MV7B 4WY7H 3JWNG 4WWKD 1GS7A 1SM3H 5BXFA 4Y7MA 2YFOA 3HRZA 3PGCB 4K9EH 4Q6KA 3SCMB 3WTWA 2G5RA 3WIAA 1Q9LA 2PETA 2X5PA 4M7KL 1OAZH 4G1EB 4BWTA 1K8DA 1MW0A 1AHKA 4WFED 3TEZA 5HYSA 1Q0EA 1B9KA 3MROA 4HKJA 4UZSA 5C0AD 2ZCKH 2D2OA 3KM2A 3QBTB 3BIBX 4GQRA 4KK9D 5E8NB 1AANA 1TO5A 3UPRB 1OAYH 3DX7A 2AFNA 3U25A 1XAUA 1BDYA 5D5MB 4QRPD 1G7QA 4ZMPA 3LD8B 4HIQA 3EGSA 7PAZA 4FYRA 1J5IA 1T7YA 3SBWA 1ET7A 1L6PA 3UAAA 5CKAA 3LH9A 1JNLH 1MWAA 3QO0B 3SE4C 1PX3A 5I8KH 3FO0H 1EA9C 1G9NC 2XNAB 1TJGL 3GJFK 3CXHK 4N2MA 1HEZA 2E4TA 2PF6A 1ZK5A 1A7BA 4GAYA 4W9EC 1ZA6A 3V9CA 3MLSH 4A7QA 2P9RA 2FIKB 5D7IA 5JIDA 4PWHA 3J7HA 4A6YH 1I8KB 2W59A 4NWTL 5SWZA 3MV7D 4JFUA 3OKLB 2EH8L 4YSPA 4NJAH 1M7IA 2BW5A 2LU7A 4FCHA 1MRFH 2XN0A 3D5OF 1O7DC 1NUGA 1ET8A 4LOUD 4GFTB 3L7EB 5D7LB 1L7IL 2IAND 4JO2L 3D69B 3FT3A 3GXUB 2O6DA 1AP2A 3NCEB 4A04A 3CX5K 5CBAB 3KPRE 4OM1L 3TXAA 2F18A 3IT8D 3F12B 4PJHA 4Y5VA 2C7UA 2P8MA 2VDPB 1KPRA 3MMEB 1CLZH 4BFIB 2HJKB 4ESKA 1PIGA 4B53A 1EZLA 2BSTB 3AS0A 2FK9A 3F7PC 4LAQH 5CUSH 2DEYX 1XGTB 2DI8A 3OAZH 5ESAA 4MA8L 4RAVB 4TQPA 4HDIB 4TTDD 3BP6A 2ITCA 2NLJA 4F3FB 1B4JH 2Z7YA 3THMH 1IC4H 3BPOC 1TZGH 3PHAA 3TA3A 5IJDC 4YK4B 4AGQA 2AEQL 1YDPB 2EUXA 4H20H 4G82A 1S78D 5C0RL 2GITB 1OAQH 1UKSA 5TPWL 2HLEB 4LNRB 2J73A 1MH5A 1TVDA 3L5XH 3TBTA 3ABGA 5KSUB 1Q9KB 2JQMA 4HUMB 1YQVH 2AI0H 3MNWA 4MNQB 5E2WL 3PFUA 2KL6A 4A2LA 2WOYA 3B34A 4G43B 5EUKA 1AGBA 1KJMA 3MJ9L 1L9TA 2OYPA 1P7QD 3BUDA 3JTBA 3QORC 4P4RB 5IFHL 3F64A 2Z91A 3WCYA 3RIFK 4KZCA 2EEFA 5AVSB 1UWXK 2WLNA 5HHNB 4JFVA 4FXKA 1V05A 3NG5A 2CXGA 4FNLH 3VCLB 4XMPL 5MI0C 3Q1SH 2HRPL 3SGEI 3PFQA 2J4WH 1DE4A 3FU3A 5FB8B 1F11B 2K8QA 3UTTA 1BAWA 2AJ3B 5CCKL 3HFMH 4GFXA 1CXKA 4IK7A 3PP4L 3NFPA 1MIEH 3DJSA 5GSRB 2G30A 2AQRA 4KXZI 2JCCB 2ZWYA 3I6LE 2CGYA 3WKYA 2LLGA 4CL7A 5FYLH 3GMMA 3GSNL 2Y23A 4KK5D 3FW6A 4OJEH 4HK3N 5D7IE 5KOVC 4WI5A 5EU5B 4WO4C 3K6DA 5D72L 2HRHA 1ITCA 1CFMA 3K6FA 5LDSA 4ZMLA 2IDTA 1EH9A 3IPFA 1EEUA 2YRBA 3WHE0 3KS0H 1Q9OA 4RFNB 1LEKB 1TIUA 1KTKE 2BSSA 3V0WH 3VXNB 4MNQD 1I7ZA 5L0QB 4XP9L 1J5OH 4IKNA 4D9QE 3CQQA 5KVFH 1CFBA 2EH7H 4K23L 3HMWH 4NRZA 4U6YA 4DW2H 1UT1A 4B27A 2VO8A 4FD0A 3RVTD 4CSZA 4F37K 3MGOB 4NKOA 3CFBB 4GMTH 4PJHE 3MX0A 3EDKA 1FC2D 1I1FB 4GI9A 1XH1A 3ZUCA 4JKLA 3X14B 1NMBL 1CTMA 2XXMB 3T3PE 3MV9A 1JUFA 3UO8B 4XT1C 5BS0D 1R24B 1OY3B 3IJHB 3HE6A 1A4JB 2XV0A 4ODXB 3WNOA 43CAA 2AK1H 4NFDA 1UJ3B 3DV4B 3SDCD 4PBDA 2K3TA 1M6OB 4JPVL 4CC4C 5BRQA 2K7QA 1V7NH 1CE1H 1CGSH 2VM9A 5HGAA 3V0IA 4KGJA 4JHZA 1MHHA 3PUUA 3VFMA 2EXTA 3D25A 5TE7L 4XCYA 4HPOH 2E6QA 4ZMWA 5BV7B 1CPUA 1J9RA 1CLYL 2OMYA 2VN6A 1KJ2L 5T1LA 2B59B 4MAUL 2NY5L 4P9MH 3IDXL 2GG1A 1OCWH 1VZIA 1A6PA 2FLMA 1JHLH 3QPXL 3QB7C 1JE6A 1XEDA 3BPCA 4X98A 3ZVVA 2C9QA 1VA9A 3Q44A 4HXAL 3W11D 4U6XA 4AGPA 4D94A 5C0DB 3I75A 3X13A 2AQPA 1CFVH 3KPRB 1TZHB 3IXTB 5F1IA 2PTTB 5LCVL 4DJMA 4G8IB 2VE6A 3BD4A 4R8WH 1ML0A 3LN9A 3KLSA 4OCWL 1D6VL 3BZFA 1OP4A 5INCB 3DVFA 3QULA 3UTTE 1SF3A 3IM1A 4JLRB 4RA0C 3S4SA 2NNCA 2WNGA 2SEBB 4E41D 2QZQA 1KLFA 3DDGA 4EOWH 1YJDC 3CSTA 1MAJA 4D8PA 1OGTA 4Y9GA 4NHCH 3EOYG 2EUVA 2OMBA 3QFJA 3FT0A 4XP4L 3GMPB 3GO1L 5E4OA 1E4XH 3LXCA 1MCRA 1RHHA 2R0KL 4NN7B 3MLZL 4DK6A 3TNNB 4PRPA 5EB9A 5A6MA 2ZUVA 4P9HL 4Q56A 1W2KT 1E5ZA 2GY7B 2D7TL 4UMSA 5ABDE 2LE9A 3MFGB 4F57H 3L2MA 4E2OA 3P9WB 5AAWA 4NEHB