3QUYC

Structure of the mouse cd1d-bnnh-gsl-1'-inkt tcr complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
203
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 202
sequence length 203
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyC02
3VXPA 3PXHA 3ZKNC 3RL1B 2YPLA 5C0DB 2OL3L 3FO0H 3VDCA 1Z2KA 5C8JA 3ARQA 4WU7B 5MI0B 2FYYB 3INUL 1TJIH 4WWKC 4Z7NE 1INQA 2W59A 3DTXA 3MOAH 1H3WM 1UM5H 2APVA 3LIZH 1J1XL 2CPCA 2V2WA 3O6KH 2JF1A 3LKQA 4WI9A 4JFHE 1IGFH 4GH7B 4RMUA 4XVTH 4MDJB 4CMHC 3VGDA 2OM5A 4R0LB 1IEAA 5KSUA 3MREA 1AGEA 4TNVK 1EGJL 2DRUA 4E0RB 4OB5H 4P23B 2HAZA 3QZWB 4LAQH 1CVSC 4ELMF 3TN0C 1FFOA 3OR6B 1I9JL 1PG7X 4ZFZA 1LVEA 1MRDH 5BRZD 3S88H 5DK0B 4XNXL 3KLAB 4B0MM 3CH8A 1MLBA 2GK2A 1IL1B 4XH2A 5E2JA 3MRNB 3RJDA 1LHZA 1WAAE 5T1LD 3OJMB 3AB0C 1T66D 4M1GH 1U3HD 3VE0B 3O9WB 1J0YA 2IBGA 4IMLA 3RZCB 5MENA 1BLNA 5ANMB 4J4PD 4ELKA 1S9VA 1MFBL 4NN5B 1XAUA 4J3VA 4U6XA 5C0JA 2X4QB 1S5HB 3QB7C 2LFGA 1FNFA 3MGOB 4RMSA 4X6CF 5GS3A 1D6EA 2PF6A 3QI9C 1X5IA 2VR4A 3RKPA 5JW4N 3QAZC 4ZOEA 5L2JB 1CCZA 1HHIA 2AV1A 2G75A 3W0WA 4POUB 5CLWA 5M7QA 3R06A 5ANME 1JZ3A 5DEFA 2W60B 3CPLB 3KYAA 5T3XL 2VDKH 4HW6A 4ALAL 5A2LH 3BPLB 5E08L 4WEUD 1G7LB 4TULH 2IFGA 3H8NA 5A43C 2HJKA 3VG9B 4TVPD 2R2HB 4U31A 5IFJA 3VMOA 5IB1B 1YEEH 2GJ6D 5KSBB 3IRZA 5FB8A 4KK8C 3MSPA 4JRWA 2Y1VA 4U0RB 3VH8B 5C0NC 4LCCC 4LGPB 3LPGA 1T22B 1I4FA 2VLRB 4K7PH 1B3JA 4FQQA 1IGYB 3VFTA 4YWGH 3WSQH 1D5XA 4G6KL 2ZNWA 4CKVX 4YDLC 3LKOA 1UC6A 3DMMA 3P30H 4M62L 4WW2C 5KSBE 4HZLA 3UAJC 3LRSB 4TSCL 4XBEL 3GGWB 4XZUA 3H42H 4WDIA 3FFCB 1KN2L 4XPFL 2VLRE 2E8ZA 1EHAA 1AY1L 2AJVH 4NFBA 1NGQL 4DOHB 2NY1C 3H0TB 1Y6NR 2XIDA 1FFRA 3SDAC 3O8XC 4L5FH 4G7VL 2HT3D 3C2SA 4DTGH 4HXAL 2ADJB 1KC5H 1H15B 1HZHH 3PP3H 2HMIC 1AGCA 1BIIB 1U8QB 1IM9A 5I30L 1MPAH 3VGEA 5ABDE 1FE8H 3FFCE 4JM2F 3CDCA 1TFHA 3RJQB 4Z7OE 3NIFE 2ZSWB 4DOHE 1AR1C 2F53D 2D7OA 1MHHB 5E03A 1DBBL 1JWSA 2HLFC 1KIRA 3L3DA 1A6UL 3QXWA 1QSFA 3BYTA 1ZWIB 5E2WL 3SDCA 3LS4H 5CIPA 5ITBL 4LARL 1KTRL 1C12B 4XPAL 2Q86A 1BM3L 1XGYH 1Y0LB 5HHQB 1OGAA 2EC8A 3MUJA 2AS5M 2OSLB 4J3OC 3KS0H 3ZE0E 4NFDA 4HKBB 4HG4J 5E8EA 4LF3A 2EC9T 5JW4R 3ZLQC 3BRGC 1UWXK 2IGFL 1KGCE 2D4DA 3QUZA 1OPGL 5D7LA 3Q5TA 5BW7A 4DGYL 1PKQB 3MZTA 4F33A 3G6AB 3X14A 3TCLB 5A2KH 3S9DB 5DJ6A 5EH1A 3FO9A 2EYRB 1MCLA 1S7WB 1IVLA 4KVCH 3TIDA 3TNNB 4ZFFA 5KG9B 1MCKA 1L0XA 4ZOCA 5DMGD 3Q1SL 5LXGL 1L7TL 4APQD 1NLDL 1CBVL 1PKQE 2YHGA 5J57B 4G8IB 3HHRB 4NN7B 4QLRA 2OQJA 4MA7L 3FTGA 4OGYH 2VXQH 3H9SB 3OMZA 5KVEH 4GBXB 1KELH 3VA2C 1MFAH 3SY0A 4PV9B 1RPQA 3LDBB 4YZFE 4PRDA 2DYPA 3HMWL 1NCBH 4BQBA 4UNUA 4WWKB 1MHPL 4DAGL 1QD0A 1NC4A 5FA3B 3D3VB 1T83A 3T0XA 5F96H 4CU8A 5DRZA 3RGHA 3H9SE 4M7ZC 3RGVD 4F7MA 4R8WH 3HE6B 5EOCH 5D2NB 3EHBC 2XY2A 4CW1B 3IDGA 4UB0L 5EZJA 4MWFA 1V3MA 2HFFB 5DJ0A 3V4PL 4Q6IC 3VU2A 1FYTA 3NACL 4PJ8C 5E2UL 3I3DA 4C57C 3NMEA 5DGRA 3T3ME 4ZODA 1B0WA 1A1NA 2YUVA 2V2TB 3GSRB 2XTJD 3D3VE 4LEOB 3VJ6B 1CR9L 3LVEA 5F1SA 3VXOA 4OUOA 4K9EH 1BBJA 2BRRH 4HUUB 2YN5A 5D2NE 3RWEA 2R2CA 3SO3B 5E8OA 1F58H 3JWDH 3FB7A 2EDKA 4PJDF 2WINB 1AQKH 4I3SH 4LASH 2JJSC 1H8NA 3ZYOA 4NSKB 3ESUF 3O41A 3CJJA 3UTSD 2R2BA 4XNQA 3EOAB 4Y4FB 2ICWJ 2QQLH 1NJ9A 4KJQC 3RI5K 2NY4B 5F7DB 5HY9A 4URTB 1M05A 1GC1H 1S78C 4DZBB 4XMPH 1RUPH 3MRGA 2VC2H 3PP4H 3ARBA 2DBLL 4OFIA 2CIKB 5JQHC 3WIIH 5BV7B 4XAKE 4HD9A 3O4LA 4K3DH 4U1JB 1DQTA 1T3FA 3LCYA 3S37L 4ONGL 1HNFA 3ORJA 4WI6A 3RWCA 5I16A 4M1CC 1AD0B 2AEWA 3A67L 4J8RA 4XGZB 3B3IA 5F7EL 3W11D 5JOFA 1NBYA 3HPLA 4OFKA 2ZCKL 4Z7VF 1FVCA 2GK0B 1I9RH 1HQ4B 5AZ2H 2AJZB 2YRZA 4FQXB 1P7KA 3HLAB 1FBIH 4KWUA 4OCRH 3V0AC 1G6RB 1X5JA 1S3KL 2QADD 5KVGL 4Q9QH 4C83B 1NCAH 3RIFK 1OF2B 4PREA 4QTHB 2QQNH 5KVFL 4ZFGH 1OSZA 1QFWI 2ZZUT 3RUGF 4ONHB 2AXGA 5DI8B 4GXUM 3MYJB 1M7XA 4HQQH 2HVKA 5C09A 4YHIB 5CEZL 3BZEB 5AYQA 3QDGA 2FIKB 5E5MB 1GVIA 5JZ7D 1FV1B 5JOPD 1YECL 5I1HL 2ICWI 5DUBA 5FHBH 5E1AB 5T1MB 5I1AB 5AZEL 5IMKB 3QBTB 1CK0L 4LCWB 3WN5B 2GTZA 3IJSB 3ZHKA 3H9ZA 4QXTA 2P5WD 4OKDA 4HS3A 3D87B 4QRPB 4WUUD 2BVQB 2E7CA 4JVWA 5GGTA 4ZS7H 4KK6C 3ULVL 5ENWA 3UYOD 1RMFH 3S7GA 3IFPA 4OGZA 1SBSL 2DLFH 2K9UA 3HB3C 3KLSA 3GKZA 3SPVA 1E4XI 1IGTA 3O4OB 3C6LC 4LCWE 3KPRD 3FN0H 2C3WA 3Q3GA 4M1DL 2VNCA 4HHAA 5B4MC 4QRQA 1JRHL 1RUAH 3CUPA 3BD5A 4QRPE 5EWIH 3EOTL 4DK3A 1A22B 4QRUA 3BP6B 3RPIA 5E2TL 5A16A 2A74A 1FP5A 2MHAA 1M7IB 3DX7A 2I25N 3ZYIA 2YPVH 1AFVH 4JO4L 3B2UD 3O6ML 3O3EB 4N5EC 3QJFA 2RFXB 3O3AA 1OTSD 2XY1A 4BFIA 4KKNA 3FB5A 5TQ0H 1PYWB 3BXNB 5EFIB 3WFBL 3SBWA 1Q9OA 3C5ZB 4GKZA 4HWUA 5T33H 4JRYA 5JIHA 2CKBH 5D72H 1KYOK 2EYTA 1VFMA 4LL9A 1WJ3A 2OYPA 2WW8A 1N59A 1FFNB 1XFPA 3GMOA 1S7SA 4P2OD 4QGYA 1K8DA 4QOKA 3AMLA 3MGTB 4NKIL 1IGIH 1MUJA 1ORSB 2D03L 5E9DD 1WC7A 5E6YA 1X4YA 5MERB 3BD4A 4P5KB 4P57A 1ZS8A 1T7VA 4S1SL 1KIQA 1IC5L 3DYMA 3S6CA 1RZ8B 4FABH 5IBLC 1JFQL 4XCFH 4YXKL 3T1FA 1WTGT 2X7LB 1DANT 4NZRL 3FQXA 2CJUH 2GT9A 3WS6A 2VKXA 1H3VA 4JM4L 5ALCH 1XCTB 1N0XL 2NW2A 3CVHH 2ADFL 1RUQH 3RWJB 4U1HA 2VWEE 1Q38A 3MZGB 2Y36L 1MRFL 5TF1H 4D3CL 4GBXD 4WJ5A 4TTDC 5FEBA 3ZKND 4PJHB 4KRNA 3MR9B 3OKNA 1CFVH 3QUXA 5MEOB 1OQOA 1VEPA 3BQUA 2E5EA 5D7IA 3WKML 4OZGB 1BX2B 2VITB 4K3HA 3GDBA 1GOFA 1FFQA 4WWKD 4YEFA 5T1KB 3BUYA 4X98A 3IAQA 2GY7B 1FC2D 3D3VD 1OL0A 2K3TA 3WO3B 1UH4A 1XF2A 4P5MA 4PJHE 1PDKA 4U6HB 3V9FA 5D6CB 1VADB 3NGBB 5KJRH 2BVTA 2GTWB 3BIKA 4OZGE 3V6FA 3DURB 4S2SB 4WCYL 3WKNA 2XXMB 3FZUC 1QFHA 3VA6A 1E4KA 1XIWA 1I1RA 2Y9RT 4GAYB 3B6SA 3RHWF 4HF5L 1FAIH 1S7TB 4KHXH 2LE9A 1Z3GH 3GSNL 1FH5L 4LSTH 2R0ZL 3EW3B 3LKRA 3TN0D 3VFVB 3HE7B 4Y5VB 1XGTA 2PW2B 4WI7A 1QYGH 1YEIL 2OR9H 2XKUA 4LAJH 1UB5B 4Y4HB 3D2UA 4P9HH 5IQ9A 3AREB 4WW1A 2N7AA 1YEDA 3ZL4L 4BSWB 3IKKA 4P2RA 5MP6L 5BJTB 3PL6B 1J1OH 5CP3H 2GUOA 1FC1A 1CU4H 3BRFA 1WK0A 3EYSH 1QA9A 4QTIH 4PJCB 1IAOA 4YHML 5IB2B 2DQGL 5F9AC 2UUDK 5F7UA 1KACB 1IBGH 3U83A 4XAKD 4I3RL 3ET9F 1D5IL 2R0LL 3QI9D 2GW5A 4HUMB 1CZ8H 1MI5B 2J6EL 3DARA 4UINH 2CO7B 1R3LB 1FZJB 2PYEB 5CUSH 4HIJB 3T8XB 3EZJB 1CWVA 5C6TH 1ZHLB 4RA3A 3K4DA 4M9PA 1H3PL 2I9LB 2AXFB 3OAYH 4WO4A 3QDHA 4CNIA 5C0FA 1T0PB 5MEPA 1P2CB 4PJCE 1LE5A 2YA2A 2FX8L 2DQEH 3MRIB 1QPPA 2B5IB 2R1WB 3SKJH 4U1KA 1YMMB 1MI5E 2X9XA 2PYEE 3R1GL 2MQCA 4F8TA 4KK8D 1NC2D 5C0ND 1FNSH 1J1PH 3HUJA 5IHZA 3SE3C 4BUHA 1I7ZA 1ZT7B 1XGQA 4NJAL 4D0CB 4U1LB 5GISH 3C8KB 1CLZH 4ZSOA 1EX0A 3DECA 3OPZL 4IBLT 3IDXH 4X6BB 1UVQA 1EFQA 1TVDA 3DVFA 4YDJB 1YMME 2D7TH 4M00A 4JKLA 1EJOH 2IPUG 3QIUB 5BO1L 3CDGA 5HHMB 5EO9B 4O00A 3UAJD 4JO3L 3JV5A 1K3IA 5DTFB 4GOSA 2G5BA 1LK3L 2JB5H 7CGTA 1O7SA 2V7HB 2R2EB 1TQBB 2NY1D 1I1AB 2ESVB 1T1WB 5FGBA 3SDAD 4ETQA 4N1CA 3O8XD 5L9DL 2AEQL 1T5WB 5DHVH 3QH3A 2B1AL 5HHME 3VCLB 3PQYD 3VGHA 2HMID 1JGDB 1MCQA 1ROWA 4GXVL 3NCYP 3X13B 4BZYA 4JQIH 4R97C 5C2UB 4RZCB 1ZGLM 3CU1A 1AR1D 1TJGL 5GRYA 1FIEA 1BFOA 2ESVE 2A73A 4H1LG 1LO4H 2HLFD 3GIZL 4CUCA 4BK5A 1KIPA 1MHCB 3P4MA 1JUFB 3WD5L 1YEHH 3MXWH 1B0GA 3BZFB 4WY7L 1NGZA 5LGKA 4CN6A 4K94L 1FJ1A 5TFSH 1FNLA 4OLZL 4P3DA 3L1OH 4PJIA 4BH8A 4XP1H 2DOCA 1TNNA 3KPOB 3GM0A 4M5YH 4DGVH 1H5BA 3WE6A 4XBGA 4XVSL 4OCSL 1QNZH 1OM3L 3D18B 4RWYH 4X5XA 2PXYB 1IGJA 2IFFH 3EAKA 5FECA 5FYLE 2DJUA 1KCKA 3MBXL 3TLRA 1U92A 3I75B 5DQJB 3UJIH 4OZHA 1EEYB 2R4SL 4H5SB 5IMMB 1KOAA 2P8MA 4JO2H 3DV6A 1HDMB 3GMLB 1OW0A 4TUJA 5C0BB 2K7PA 4DCQB 4OCXH 5SWSB 3VI4E 3QYCA 4D9LH 4UNVA 3MC0A 3QG7H 4LSQL 1IZKA 2BSSA 2AI0L 4MMXC 3VDBA 2DQJH 3IFLL 4TRPL 5BRZA 5I15L 2DF3A 4LLWA 4KTEL 2WIIA 3UTZA 4NKOB 3W81A 5I1DB 3BX7C 3OXRA 3C5JB 4HUXB 4XRCA 5IBUB 5C0BE 2K1MA 2VZUA 5T1LA 3MMEB 5SWSE 1CGTA 4MD4A 3CMGA 4EVNB 1U3HA 1S9XB 1DQML 4OF3A 4KPHL 4HV8B 4J4PA 1RJLA 3RWGA 3T2NH 2J8UA 1TZGL 3VFOB 1J0IA 1OAXL 4L9LA 1J10A 5EUOF 3PWJB 4NZUL 2FECI 4R7DA 5EA0L 2W07A 5ACZB 3CX5J 1A6PA 3PABA 3MRKA 2HN7A 3EHBD 1ZA3A 1MCIA 2NY6C 2BNQD 3MLTA 3L3HB 4PRHD 2VE6B 3QXAB 2DLGA 4PJ8D 1TQCB 1KFAL 4LOUC 2BY3A 3PF2A 5A2FA 5F1KC 4LP5A 5BZWA 4X4ZA 2E6PA 1U8LB 4E42A 4F2MB 1NKRA 3QIBC 1EZVX 4Z77A 2B1HL 4Y16B 3EBAA 5HJ3B 2GJ6A 1NGWA 4BZ1H 4HH9B 3QNZA 3DWTA 1D6VH 5I18L 4FFWC 3U4BL 3T2QA 3S5LA 2HRPL 3WS3B 4GAJL 4HS8L 3TO2A 3G6JF 4U49A 2JB6B 1MJJA 5F9JA 3CFDB 3IETB 3HC3L 2VLJB 3U30B 4AH2A 5EUKA 1EMTH 2HH0H 4Q9CA 5J12B 4HDIA 4KJQD 2MQ0A 1CF8L 1J87A 2VZTA 3SE4A 3MNZA 1S78D 1BGXL 1P84K 2X4RA 1DBMH 1YDPB 4X7SL 4PV8A 5EO1B 2CLZA 3IKCA 1P6AB 2VLJE 1WCBA 1PZ5A 4JANA 3Q5YA 3OKEA 2IPTH 3EYFA 1JNNL 1J05B 3BAEL 1LP9B 1I85A 5CZVL 2F53A 4H1LH 2OTUA 2UWEA 4PJ7A 2VO5A 4MLSA 4M1CD 4HFWB 4MXWL 1FVEA 5ITFA 2FJGA 4JPKH 1U8MB 5EPMB 1NMBL 1PX3A 2WANA 1DVFC 2WZPD 3V5DA 4PRNA 1ZLVH 5F3HB 5C08B 1LP9E 1UXWA 3IDMA 4NQSA 3IGAB 4JZJA 1KPRB 1WEJL 2AKRB 4J3WA 4AT6A 3I3EA 4P5TB 5F71A 3EFFB 4QHNB 3WYRA 1I1YB 3BP7A 2AVGA 4GG6A 4J6RH 1EVUA 3QPXH 1JHKH 3EOYG 5C08E 4POYA 4D0DA 4YHOH 4LSRL 4ODHL 5E8NA 5SX4H 4PJXA 1DUYA 4H0IA 3SQOL 4MHHG 2LU3A 4JHWL 1K5NB 5E7BA 4JY6B 4K8RH 4YDIH 3C60C 4NKQB 4G3YH 1A6TA 3VXMB 4BFGA 3DXAB 1QFWM 5LQBH 3RL2B 3STLA 1LEGB 4FMFA 4APQA 1KT2B 1NFIB 1IC7L 1AO7D 3ARTA 4HKZA 3MLVH 5TPWL 4HFUL 3T65A 3D6GA 2QKIA 1RZFL 1CDBA 1NCWL 3D39D 3LV3B 1S9YB 3FT4A 4P46B 4KK6D 4GAGH 4FQ1H 3SGJC 2OBGA 5GJSH 3CCHA 4JQXC 2FLRT 5IFHL 3GHEH 4HGWA 3VXME 2HKHH 3DXAE 4Y5YC 5BQ7A 1BZ9A 1BOGB 3HB3D 1WBZB 2P8LB 3HNVL 3N1GC 4GW4A 1A6VH 1OB1B 3C6LD 3HNTL 4M7JL 4F3FB 2IH3A 3U2SA 1X3DA 3MCLH 5LAXA 5FM8A 4ZNCD 3RGVA 3C8HA 1UJ3B 5B4MD 3D85B 5I66B 3WFHA 1IC4L 3KXFB 2O61B 5DMKB 5GS0C 1ADQL 3UZVB 2AJUH 3MQIA 5D7SH 5I8KL 5BOPA 2AJYL 3F6LA 4XNUH 4ZUVA 4P2YA 3F12B 1I3RA 1G6VK 4GUPB 4U6YB 2PYFB 2ZSVA 4EXPX 1HILA 1E28A 1IAII 2DQCL 3LQZA 2UZIH 4N5ED 4LLDA 4R4FL 3V6OE 2XN9B 4QWWC 5FOJA 1OTUC 3TZVC 5LG1A 4ZO6A 2Y6SC 3ILPA 4Z95L 3KXFE 4LKCB 5DJCA 2CMRH 4RMVA 4PBXA 2W91A 3P9WB 4ZNEA 1TPXB 4PB0H 1OCWL 5IW1B 1G0DA 2P49B 1KCUL 1KNOB 2ZNXA 2DD8L 1GH7A 4WIQA 2J88H 1EEUA 4WI4A 2A9MH 1S7VB 2DBJA 2F58L 2XN9E 2Z31B 3UTSA 3G5XB 2EO1A 3U7WL 1AHWB 3MXVH 4Q2ZB 1GRWA 5IK3A 3LHPH 2F19L 3TWCL 1RK1B 3L3OB 1WAAA 5JNYB 4M4RA 5IBLD 5D2LA 5TH2A 5EU5A 2BHYA 3ROOA 5KVDL 1N5AA 4N9OB 2HLAB 3GSVA 5F70A 2XA8L 3AXLB 5KBNC 3R8BB 1QFWH 3QHFH 2DQHL 4O5LL 5EOTB 2IMMA 1DQLH 3N1FC 5EOQH 1MWAL 3EYUH 3IFNL 1T2XA 2ERJB 4OD1L 3CDYA 4TTDD 4YHPB 3SKNA 2I07A 3BRDA 2XZCH 5DZOA 1FGNH 1DLHB 5GSRB 3GKWL 5ADPH 4KQ3H 4M8VA 2Q3AA 1Z0MA 1MCPH 1OLLA 4HX1B 5D96C 2DL9A 1BPVA 4XMKL 4RX4D 3ARXA 4RRPA 3MNWA 4FQCL 4LSPL 3I6KB 3GRWL 43CAB 4U2ZA 3BPOC 1Q0XH 3VI3F 2XWJB 2X42A 3DGCR 4AMKH 3QQ9C 3GI9H 3FZUD 2WK2A 4LK4A 1JGVL 3SGDI 2YN3A 4DEPC 4HJ0C 4NUGH 3CD4A 4K3EL 1CFSB 3BIBX 2BY2A 2LV4A 3HZVB 4GKNB 3BO8A 5J1SC 1JYWA 4HWZB 4PJAA 1K85A 2VZ1A 4MJIB 1OARH 5GGQH 4M43H 1IGYA 3C5SA 3UTQB 1JZ6A 4TVPL 4V2BA 5JW4M 2P5WA 2OLDA 5HHOD 1FSKB 4WUUA 2HT2C 2VLJD 2FL5B 3FB8B 3LRSA 5LWYH 2GFBA 3V4VH 3GGWA 4FNLL 1LMKA 4OIIH 4YUEL 4MJIE 1DL7L 1FLRL 3ZYJA 2D3VA 3PWVB 4YC2B 5K59F 2G2RB 3BH9A 1F6AB 1KJ2L 3KPRA 3FB6B 2V5YA 4MLIA 1JGEB 1NH6A 2F74B 5EC2B 5J1TC 1CD8A 2AJXL 4FQ2L 1U8QA 3OKMB 3DBXB 3VWKB 4Q58C 3QDMB 4HS6B 4IRSB 1Q94A 4HIXL 1V05A 3DGGA 3I02B 3QIWB 1VHPA 2FEEI 2DQIL 1BBDH 4WVRA 1N2RA 1P4LB 2ENYA 5IKCB 4K7FB 3PXJA 7FABH 1UKQA 2I24N 4KMLB 5DD3H 1WFUA 3E0GA 3ULSB 3OJ2C 2EE3A 4HGKC 4YDKL 5I73C 4CVWA 4BQ8A 3QDME 5IR1B 3HKFA 4UV4L 1V7MH 2OSLA 5SV4A 2MCG1 3PWLA 1MRCH 5CZXC 1G0XA 3P9MA 4MAYC 3ULVF 5MHSD 1N26A 4P2OA 5F6HJ 5DMJB 4FA8A 4RMRA 5GGSY 5E9DA 3WLWC 1CGXA 4F9LC 3KWWB 2FZ3A 2MCPH 4WU5B 3MLPA 4ZXBB 2Z8RA 3CFEA 3KJ6H 3WFCL 4ZG1A 4NWTH 4DZ8B 1KLFA 1OAUH 4I77H 2HT4C 5EG6C 1GXEA 1JPFA 2C9AA 5FKPB 2D2OA 2CKBB 1Q9WB 4H0HB 4M7LL 4UT9L 2IG2L 4MCYB 1CG9B 4OCLC 4GBXA 2ENSA 1NFDB 3P3YA 4LSUL 4JO1L 1S7XA 5FOBB 4A6YB 4Q97A 1J12A 4L1HA 1A2YA 1CICB 1R3HB 1BP3B 3O3DB 4WWKA 1I3GL 4G42B 4LPXA 1JBJA 4DVRH 3D3VA 5D6DC 2B2XL 1B0RB 1ZLUH 3BDYH 4DN4L 3UPRA 3D85D 3G9VA 1NFDE 1NMCB 4ZQKA 1HKLL 2X9YA 3EO1B 5IIEA 4LLVA 4NBZB 2VDOH 2B4CC 5KZCD 3MJ7A 1VFAA 4UMGA 5B39A 5I1JL 1RVFL 1VDGA 1SMAA 1TVBB 2QHRH 2W9EL 5GS2H 3ULUL 4UOW0 3TN0A 5E94B 1A21A 5B8CC 4LDOB 3BHBB 5F7LB 3FRUA 1FZMB 3EOBA 5CEYB 5EBLA 2ILLA 1MCDA 5F7HA 4LLQA 2X5PA 4IDJL 4UTAH 1VFBB 4LHUD 3O2DL 2HP4A 4DUVA 4H25B 5DQ9A 5IV2A 1CGUA 4LLYB 3QO1A 4HBQA 4DQOH 4HZAA 1R5WB 2CDFA 5CEXB 1TZIB 5F7NC 1FNEA 5M95B 3BH8A 2NY3B 5J13C 1ZANH 5DHVA 5I76B 1CT8A 5K9QG 5IF0A 1DQQA 3QQ4A 3QI9A 4P3WA 5AAWA 5F72S 4YR6A 3K4AA 1J8KA 4DZBA 2NY6D 3FQTB 2MOVA 4KJYA 3HNSH 4OZIF 1LO5B 1YQVL 1FL6B 4LOUD 3LKSB 3NAAH 4QHKJ 1EEZB 5DMIL 5E6IB 3QUYC 3RIAK 4DEPB 1YN7B 3MJ8B 3H7BB 3CXDH 3QIBD 1DQDH 5K9KA 1QSVA 1WVZA 4G6FB 4JDTL 1N6QH 5HHVL 4HJGB 1LNUA 3HG1B 1NC2A 2R69L 4U3XA 4LCCA 4FFWD 3CVIL 1P53A 1NAMA 2LU7A 4NQXB 3WUWA 1A1OA 2EDYA 3SKUD 1T04B 3LB6C 4NGHH 1U58B 3AAZB 1I8MB 3EFDH 3KYNB 2OP4L 2QSTA 2OI9C 3K7UA 4WW2A 4JR9L 3HG1E 3ZKXC 1CIDA 1GZPA 2ITDB 1A4KB 5DD0L 4JPWH 1PG7L 5FA4A 5IJKC 3FO1A 4Y4KB 5FUZL 1CGVA 4M93C 4HIIA 2EYSA 4FTVB 5ISZD 5ID1A 4OTXL 2R1YB 1OF2A 5AUMB 4RBPH 5F7KC 1XGPB 2OTPA 5CJQL 3SDAA 3O8XA 1FG2A 4M3KB 3WO4C 4HWEH 3PQYA 4YHIA 1CGWA 3BZEA 1RZ7H 1HXYA 1IEBB 3LZFL 4GRWF 1UYWH 2FIRT 3CLFH 4O51B 5D93C 4O02L 5IB3B 4H26B 4LSSH 1BJ1H 4F37F 5DVMA 4FTVE 5I1AA 3DX8B 3DX9A 4TUKL 3TBWA 1BFTA 2P47B 1W72B 3IJSA 1MF2L 1QG3A 1CD1B 1NANI 2BVQA 1CLOL 1DVFD 4K2UH 2VXTL 5FUCC 2EIZB 1HEZB 4F15B 4R2GC 4RGOH 4UDTB 4OGXL 4ONOA 2NLJB 2LVCA 1KPVA 4MAYB 1XF1A 4GQ9L 3V0VB 3QJHB 3WV0A 4PRBA 3NIDF 4JGJA 2VDLL 4OLXH 4GMSL 1AJ7H 2V7NA 3S96A 3LRGA 3OKLB 2YD6A 3CK0L 1CL7H 2R0KH 5LCVL 3PP3K 2D0FA 1ZEAH 1JNHB 1DQJB 1JPTH 4JFXB 3G5VB 4G8FB 2YXFA 5T1DL 5EZIL 3ESVF 5C9JB 5H35A 1BZQK 2D7PA 1WWCA 1S7QA 2XZQL 4CMMA 3C60D 4EN3C 1T1ZA 4ZPTB 2FGWL 1HWHB 1A02N 1N4XL 1U93A 1YC7A 4NO3A 5TE7H 1IQWH 4WHTA 3OAZH 4JDVA 1S7RB 3VFMA 4HUVB 1UA6H 1WIPA 4QHUA 3T3PE 5DZNA 3IB4A 3U48A 5JDSB 4D9QD 5LVEA 3RTQC 1NCCH 3DO7A 4HAFA 4OM0L 4U1GB 4PY7B 5A2JH 1O0VA 3MROB 1QUNA 1WZ1L 4QRSB 5D1ZB 5EIQA 2MSPA 5AD0B 5CSZA 4MDIA 1EHLH 1F3DH 1T7ZA 1SVCP 3CDFA 5DVNA 3KJ4C 1FZOB 5GS0D 2BNQA 3UPCA 4KRPC 4PRHA 4Q6IA 3SKMB 5DFVC 3IDJB 4NP4L 4O58H 1RIVL 2H26A 4PJ8A 3DVGA 3VW3L 1FORL 3GI8H 4JJ5A 5SV3A 3V0WL 2NCMA 2CLVB 1ND0A 4JZOA 2BOBB 3DHJA 5D7JC 4TTGA 2NYYC 4AEIL 2IADB 4QWWD 2CDGA 1KEMH 5B8CB 1OTUD 3TZVD 2Y6SD 3ARGC 5L0QC 1U9KA 2P5EB 3QXVA 4LMQI 4OCNC 5DHYB 4Z9KB 2IANB 1IAIM 3RAJH 1P5VA 3U1SL 5SWQB 2Y7QA 1F4HA 2JJSA 2KL6A 1IGCH 1GGTA 1TLKA 3GJEA 5J1AA 4TSBH 3UMTA 1X5YA 1BMGA 2WAHA 3WDIA 5LGJA 4L3EB 1T7YA 2XNAB 2P5EE 2OTWB 3G5YB 2BNUA 3D48R 2IANE 3QISA 1ZGLB 1JWUB 5GS1C 2X1PA 1CDIA 1KJVB 4JVPA 3OR7B 3KPNB 4S2SA 5A40E 4HK0B 2DQTL 3DUHA 1A5FL 3MLRH 5F9DC 2IAMB 1BAFL 2OZ4L 5FHAH 3V7MA 2P7TA 2JELH 2PR4H 3TCXA 4PP1C 3ZT5A 2EEDA 2DJ4A 4L3EE 4PJ9B 4ODBD 35C8H 3WNLA 3RA7H 3TBVB 4AQ1B 3DIFB 2CK0L 1XR9B 1A7RH 3O3BB 4IIQB 3T0VA 1KG0A 1BEYH 5HSFA 1NEZA 2XICA 1LO3L 4LGRB 4KKLC 5L8LB 2YD2A 15C8L 3TESA 1B2WL 3N1QC 3QNYB 4PIRF 1C8PA 3MCKB 3PG2A 2F15A 1CGYA 5ETUB 5TGBB 5K9JH 3V5HA 5IB2A 5GGVH 5F1IA 3WNKA 1T1YA 2WWMC 3LQAL 2ZOLB 4OI8A 4HIJA 3GK8H 4N9GA 5DJ8A 4RMTA 1FVDB 5KSAC 3VGBA 3CSGA 1LDPH 4XWGL 2EH7L 3QQ9D 3KNBB 3K0WA 4XP9L 4XP4L 1DFBL 1P2CA 1GGUA 2CKNA 4H1LB 2C7UB 2C1PB 4HJ0D 4DGIH 4YLQT 2AABL 1GIGL 2HFEB 2Y25A 1N7ML 4UQ2B 1ZK9A 4XPHL 3HI5L 1YMHA 3CFKA 4UV7L 4Z78A 3LKNA 3HG1D 5J6GB 2VISB 5D5MB 1IAIH 4JN2B 1DDHA 4TQEH 5FAAA 3K1KC 5DD1H 2ZCHH 3PIQA 4MA8H 3DRTA 5JUEL 1AO7A 4I13B 4JRXB 2QLVB 5H2BA 5ICYB 2KBGA 4LEXH 3FFDB 3TJEL 3MLSH 5DT1L 5E99H 3NVQA 3D39A 4S1RL 3ALXA 5IG7A 2HT2D 4WHYG 3K46A 4BZ2H 1WV7T 5FKAA 3LEXB 3TGXA 5D5ME 3U4EB 2Z4QA 4C55A 3REVA 5CINL 4UTBL 5DR5L 1U3YA 4YQXH 3A0OA 1D5ZB 12E8H 4YXLH 3HAEG 5CGMA 1CQKA 4JRXE 3C6LA 4U7SA 4W6YB 1C1EL 3LY6A 1JRHI 4QRRB 2MPAL 2J8HA 3MODL 2ZUXA 1L6ZA 4Y5XC 3FRPA 1H3UA 3D69A 2JE8A 4N8VG 4WHCA 4RAUB 2VH5L 3LAFA 2A0LC 1VGEL 1I8KA 5CGTA 1G6RL 4LIQH 2ICWA 3DSFL 5L8JB 4PJGB 1YNTA 2Y07H 4QGTA 5F1NB 3V4UL 1I9EA 3MRDB 4NQED 4QRRE 5D70H 3UJTL 1UWEH 3TH2T 3ULVC 4ZAKB 1RFDH 4GRMB 1RIHH 2DM7A 4MJ5B 3N1PC 1HCVA 2ATKA 2YR3A 4PJGE 4IRZL 1ZT1B 1ZE3C 3HUJF 1YNKL 5CZXD 4JKKA 4MAYD 4MNGB 2WLYA 2FX9L 3RTQB 3QFJB 5E7FA 3I6GA 5GGRB 4TSAL 4X6DB 4YE4H 5L2KB 3WLWD 4NQVA 3S36L 1DLFH 3QWRD 1MCCA 3GMLA 3TEUA 2FR4A 4EI6A 1OP5H 4U1IB 2WIMA 2ICEB 3KJ4B 1BJ8A 3HRPA 4MNGE 5HPMA 2VDML 4JG1L 5EU7E 3QFJE 3U0TB 4LVNB 2ATPA 2W0KA 2A1WH 2HT4D 2IH1A 4X6DE 5L2KE 4TPRL 2ZCLH 4O4YL 4AG4L 1CXFA 1YYLL 3WL9A 2FD6L 1W0VA 1U8KB 1GAFH 3C5JA 2VXSL 4OAWB 3DRQA 1BQHA 2DMCA 5GJTH 5CKGA 1WBYA 4CJ1A 2H41A 3S4SG 1YYML 1LO2L 4JY5H 2Q8BH 4IHOA 5LGHH 5IEHA 2IQAA 1EFXB 4ODWA 3TO4B 1UENA 3X3FH 4RX4A 1KCSL 4PJIF 1MAMH 4KZDH 4O9HH 1T7XA 3VRJB 3WIHL 2JJWA 4YHNB 3CAFA 4XVJL 2K7QA 2VAAB 1O5DT 3IDNB 2VE6A 5BMFL 1SJVA 2B39A 1DBAH 4OFYD 1IJ9A 2PUQT 4HWBL 1U8LA 3D0VA 2Q7NA 3I85A 3NFSH 2Z92B 4OZHF 5T5FH 4M48L 3TYGL 5HHNA 4NQDB 2ARJQ 2WUCH 3HC4L 2KKQA 5M94B 1JGLL 3C08L 4I48A 4OCWL 4MX7A 1LO0L 1DP0A 3WXWH 5B38G 4ACPA 3BGMB 3CFCL 4UIKL 3WNOA 4BH7A 2AV7B 4NJ9L 1ERNA 1QRND 4G80B 5JR1H 1URLA 5F7WC 5CJOH 3QUKA 4LVOC 4NQDE 5HHOA 3S37X 2VLJA 2B0SH 4WHYH 4NQCD 5EN2A 5JA8B 1KEGL 3FJTA 2OK0L 5GZNC 1G7MA 5DQDL 1S7UB 4HK3N 1KLGA 1G7PB 3Q6FB 4BFEA 1A6WH 4PS4H 1J5OH 2VDNL 4L8SB 5EU4A 4KUZL 5I1GH 2J8UF 1OAQH 1E4WL 1U36A 5ADOL 2Z0BA 1SJEB 3IU4L 4JFFD 5EO1A 4EDWL 1CS6A 4FQHB 4P99A 1OD9A 3D1MC 1KCVH 4BKLA 3L3GA 3QUYD 1LILA 3P4OA 4NKDA 1QFPA 1GGCH 3HZMA 5IQ7H 1K2DA 3NCBB 4UOW1 2B4CH 4W68A 1HI6A 4PRPD 1XGUA 5DXWA 4PRIB 1NDMA 3E6FA 5GIRB 1FGVH 4TYUA 3W9DB 3SE3A 1FN4B 3KYMB 4G8GD 4G8EA 4ZTOL 3E3QE 4PGEB 3LB6D 5F3HA 1RK0B 4BSVB 4O2EA 2OL3H 2AJSH 5TQ2L 5IMOB 2P24B 1AGBB 4QRTB 2G5RA 1QRKA 2YRLA 4PRIE 1BIHA 2AKRA 3DUUA 5AWNL 3KDMA 5T3XD 1JWMA 1J1XH 1YY9C 3KVQA 3OAYK 3EFFA 5FUOL 1DBJL 1JNLL 1ZKAA 2D0GA 3X11A 5ILTH 4OLWH 4FOMA 3PV6A 3WJJC 1IGML 1EGJH 3F58L 2JCCA 4JFZL 1N8ZB 5FF6A 2J3SA 5KOMC 4JY6A 1PLGH 1SM3H 2DLEA 5HVHB 3MLWL 4LPYA 4OLUL 5B3JF 3SE8H 3OKKA 4JHZA 1Q9LB 5C70A 4QXGL 4KDVA 3P9LB 1YJDC 4JFYB 2OR7A 2VLKB 5BS0B 1GZQA 4X6CB 2BVPB 2GYSA 4M02A 3LV3A 4GO6B 4NDMB 1EXUA 3DROA 3LSOA 1MJUH 1A7PH 3MACH 4X5WB 3OG4B 4XPGH 4PJ7F 1OP9A 1T21B 4R2GD 2QSCL 5I1KL 2P8LA 1MFBH 3EO0A 3STZB 4F3FA 3JWOH 1EAPA 1AQDB 2VLKE 3OGOE 5BS0E 3D85A 4X6CE 4YK4C 4DFIA 2O93L 5CD3B 5T5NF 2X05A 4YDVB 3QDJB 1SJHB 3QEUB 2VDRL 4NRXA 5DJXB 4KKCC 1INDH 3FQRB 3F12A 4GUPA 1U8NB 4HC1H 5T3XH 1JYVA 4XC1H 4ALAH 3FT3A 5DRWB 3GBNL 5GHWH 5E08H 5KSVB 4GG6F 2MNUA 25C8H 3P40A 4EN3D 4K94C 1H0DB 3VFSB 4IJ3B 5E00A 1QOKA 3QDJE 1ODAA 4KTDH 3DSNA 3F5WA 1NPUA 5J11B 2HFGL 3F7VB 3SGEH 2LAAA 4LHUA 4NWUH 4XBPB 2YK1H 1ZGLP 1JTTA 5I8CA 1X5XA 1UB6B 3ELAT 1EHXA 3VRIA 5FYLL 5EIIA 5JW5A 1KUMA 1NCTA 2APWA 4OV6F 2UVFA 1RZKH 2PETA 2X4NB 3RTQD 2NTFA 4LKXA 5JHDD 3FMGL 2VN7A 1C5BL 3VXUB 3MLUH 4XC3H 2W0LA 4L8BA 3UC0L 3EYVB 3L3OA 1IT9H 4XPFH 3WHE0 1AY1H 4JM2B 3DUSA 2Z91A 5EORL 4KRPD 5DFVD 2A6KA 1FPTH 2BOCA 2D31B 5DJ2A 4HXAH 4KMQA 3VXUE 3MOBL 1YUHB 3U6RA 5D7JD 3QIBA 1HSAA 1NCDL 2NYYD 2RCSL 2OJEA 3A6BL 2V2XA 5J4MA 2ITCB 1X6LA 3ARGD 1R3KA 4EBQH 4Z76A 4QYOB 1KTKE 3VXTA 4UQ3B 1LE9A 1DBBH 4PR5A 1X7QB 1MCNA 1ED3A 1TJIL 5GSRA 3EDDA 2ZUVA 1A6UH 2A6DB 1LEIB 3KPTA 1UM5L 5B22A 4OSUH 1V7NL 2SEBB 2FO4A 4ZFOB 4HCRA 2UYLB 5ITBH 1DUZB 2YS4A 3NCMA 4LARH 1UFUA 4XPAH 1IGFL 3SKOB 4HLZG 1XT5A 5HYQA 4NZDA 3RWDA 3PJSB 3E6HB 4OB5L 2NR6C 3QFDA 5FK9A 2IGFH 3IDYC 1M6OA 5ISZA 2R1XB 4QF1B 5JW3H 1A9EB 2RIKA 1HKFA 4PP1D 4GAFB 4RGNC 5CCKL 1PY4A 1OY3B 1AIFB 4XPBL 1HHHA 1WAAF 3CU7A 3IF1B 3WFDL 3LEVH 1DANU 4X80H 5FO7A 5C0AB 4M1GL 3RRQA 5LXGH 4KKLD 1EPFA 4PJBB 4P2QB 1NLDH 1CBVH 5IM7B 4R3SA 4YHZL 3MA7B 4XPTH 5FDWA 5K9OB 3ZE2F 1QQDB 4MA7H 5DYOB 3W2DH 5FXCH 5KAQF 2IPUK 1PG7W 1DVFA 3N85L 4OZFH 5E4IA 1A0QL 1IM3B 4WWID 4Y1AD 3NOIA 2YOCA 1BECA 2WWMD 4X4YB 3HMWH 5C0AE 2B8OT 4PJBE 4P2QE 3CLEL 1MHPH 4M5ZH 4X9FA 4DAGH 5KSAD 3T77A 1WZMA 1U8OA 3HI1B 3N06B 4G7YH 2KZ1B 3FCTA 2MFNA 3RVVC 5IB4A 4TULL 3DVNB 5GRJH 4EIZC 4UB0H 4IRJB 2J5LB 5DUPH 4OBSA 1T6VN 4OZ4B 3HS0A 1YEEL 2FBJH 1T4KB 1TMCB 4RFNC 3LS5L 4UDUB 3HMXL 3MO1A 1R3IL 1RUMH 4PJDB 5IKCA 1CR9H 4K7PL 5EB9A 3C60A 5HYJD 5IWLC 3THML 4YWGL 1QHOA 2L7UA 4K55A 1HE7A 1ZLVK 3N50A 2JLLA 1SVZA 4PJAF 3G04B 5D1QC 4XNYH 4NOBA 4DKFH 1OP3H 4PJDE 4M7KL 4KROB 2FJHA 3SGJA 4M6NL 4JQXA 4TOYH 2AJVL 4PBVC 4Y5YA 1XCQA 2BVOA 2G9HB 5CWSA 4M6OL 4LQFL 1VPOH 4PGDA 1RJYA 4L5FL 4J12A 4DTGL 5JO5A 3K80A 4RAVB 1PZUB 1HZHL 4YK4B 3BVNB 4P0DA 4Z18A 1MPAL 1FE8L 3NIFF 2VLLA 3CZFA 4NO0B 5I0DA 2A0LD 3U9UB 3ZDYF 5DSCB 3VWJC 2DBLH 4OKVA 1GYAA 4FXKB 1JPGB 3CFJA 4XXCC 3NFNB 3TZVA 1BJMA 4KZEL 4LQ1A 5I9QB 5FOBA 4Z7VB 3ZE0F 5DJZB 4A6YA 4UAOC 1YEGH 5I75C 3IXAA 4EOWH 4AL8L 3PGCB 4PJ5D 1J88A 5FGCB 3GUTB 4IS6B 4XCCL 5F7EH 3F7RA 3BWAB 2EECA 2BSRB 3GJFB 4W4NA 2XKNB 2ZCKH 3VFPA 5IROC 2W9DH 5BOZG 3MBEC 2CLRA 4Z7VE 3SCMB 5CSGA 3DETC 3TVMB 1I7TA 5FGCE 3RU8L 3VFNB 4CDGC 4BJLA 2ADIA 1S3KH 3QQ3A 2EDEA 1J8HB 4L4JA 5DUML 5C0CB 2NW3A 3U7YH 1MCFA 1G7QB 2EDRA 4EZMA 2BC4A 3V95A 2YC1B 2WQRA 2PO6C 4OGYL 5CEZH 2WUBL 1FO0A 3QR2A 5KVEL 4PLJC 5HGHB 2X4OB 3RWHA 4YZFF 32C2B 5DRXA 3GSOB 2BNRD 9CGTA 4U3CA 1J8HE 3GB7B 4P3CL 5DA0B 5AZEH 2EEAA 1UACL 2GJJA 1CK0H 4FXGB 5C0CE 5BVJB 4HMDA 5IEKA 1UXSB 1A7OL 3QEQB 2Z9TA 4QO1A 3WDHA 1W0WB 2YKLH 4LCYA 4EI5C 4ZUWB 1BQUA 3LN5B 1CYGA 5F96L 3VXUD 1C5CH 5L88H 4R8WL 4EXKA 3ULVH 2YA0A 1YN6A 2G60H 4YBHA 3C6SA 1J0HA 3CX2A 1S9WB 1EK3A 1IQDB 2BSTA 2XFXA 1KLUB 3BKMH 3QEQE 4RQQA 5I17B 1FL6A 3T0WA 5E2VL 3EOTH 3U0WL 1P1ZB 4Y19D 5ESVA 1MCBA 1VEMA 5C07B 2HJLA 3GMPA 3ILQD 4FG6C 1CE6B 2J7LA 2YPKA 3BIAX 4J3SA 3GNML 3O6MH 3HG1A 4X5LA 4HIEB 1KIUA 3W39A 1YY8B 2ICCA 1VERA 4QKXB 5CBAA 3W9EB 1QTYT 3AS0A 5C07E 3SDDC 1ZVYA 4OUUB 4MMZC 2QQLL 2GAZB 4X99B 3U0PA 5FYJE 2JKXA 1BWWA 4LSVL 1U8JA 1BFSA 5GZND 4NCC1 2JK5A 4DFHA 1NBZB 1U95B 5EU6D 5CIPH 3BPCB 1KPUA 4NKIH 4Z7UA 2ED9A 2D03H 3QUMA 4G5ZL 2VC2L 1HOCB 1MSPA 1XGPA 1RSFA 2VYRE 3RNQA 3TFKC 3PGDA 1KYOJ 1IC5H 1CIUA 1R5VB 1CXLA 2XWBA 3OXSB 2A6IB 3WIIL 4K3DL 2C4XA 4YXKH 5F6IB 2BCKB 3S3SA 3FOMA 2WWKO 3VXQB 4JFDD 2X4TB 1YEKL 1HIMH 4YFDB 1KJMA 3B83A 4ISVB 3BKJL 3M1BA 3SDXA 5I6XB 4JM4H 3GMQB 1N0XH 1Z9LA 2IMNA 2DTML 4NQEA 4L4TB 3C09C 3RBGA 1A4JA 1MRFH 3NTCL 5TF0A 1ZHKB 2EIZA 3WKMH 5GRVL 3DX6A 1I9RL 1G9MC 3GSQA 1F3RB 2V6HA 4I18C 2PCPB 4NC0B 2NLJA 1FL5A 3OJVC 4MAYA 3WMSA 1VACB 1R3JA 4JFQA 1MHEA 4L4TE 4NOFA 1YY9D 2W0PA 1QFUL 1X4ZA 4R9HA 4KGLA 4EDXA 3QWRA 4F9LA 4F7EA 1JNHA 1DQJA 1G7IB 4HQQL 43C9B 5IFAL 1K4CA 4N0FB 3BEWA 1WZKA 5HVWA 3GSNH 1KB5A 1FH5H 1Z9OA 2R0ZH 4FZEL 3UPAA 5E24E 1K4DB 1KJ3H 3S98A 5JPNA 4H8WL 4LIQE 1OLZA 4KY1L 4M03A 4OD2B 4L1DA 3JXAA 4X0KB 5FGSA 1J86A 1T89C 5ESAB 5EBMA 3ZL4H 2EDNA 3LPFA 1F97A 1RMFL 4Z0BL 3WLBB 3KPQA 5MP6H 1JK8B 1OWWA 1SYSA 4NPYB 5IVZA 5D7KE 2P48B 4S0TD 3UTTB 2CIIB 4KQ4H 4LCIL 3S3PA 4QRSA 2VAJA 4P4KB 5D6DA 3ZSSA 3GMRB 1DBKL 5I1CL 2EH8H 4P4RB 2DQGH 5EWIL 5J56B 4B53A 1MNUH 1QBML 4O2CB 4XCEB 4AM0A 5DJAA 3T4AA 2J6EH 1E6OH 3RWIB 5I8EB 1XF4B 2PNDA 1RURL 3IDJA 2I60H 4KKCD 4GRLB 4GKSB 1F4XL 1KTLB 3UTTE 4OFYA 4MD0B 4GW1A 1IAKB 2X70A 1HH9B 1HQRB 4GRWH 4HMEA 5B8CA 4ODXB 4OI9A 5FCSH 2HTKC 1OOAA 3AS2A 4GT7A 2RJMA 1MLCA 1INEL 2PO6B 3P73A 3IJHA 2EE9A 3NCEB 3TPKA 2BVUA 2CKBL 5D72L 2H8PB 3T0DA 1QRNA 4Q9RL 4QY8B 4NJAH 3RDTC 2MTPA 4LFHD 3BP5B 2IJ0C 3GMMA 1WFTA 3VFUA 2DDQH 4A6YL 3AGVA 1ZLUK 4ORGB 1QSED 2Z93B 4NQCA 5C0EB 1U8IA 1JMZA 5F7FA 5BO1H 3OB0H 3L3KB 4HKJA 3OZ9L 1KJVA 1EGJA 4NO5B 4ENEC 3MRPA 4FABL 4E5XA 2Z8VC 2FGZA 3ULUC 4MA3B 4HUKB 3OHXB 5F9OL 4Z0XA 1XR8B 3H2WA 1MCOH 3JV4A 1J8HD 5T3ZE 5KS9B 2CJUL 4JFFA 3B5HA 5DK2A 4G9FD 4KMTL 4MNQB 5L9DH 3DV4B 2AEQH 1F8TH 4NCDA 3QUYA 2B1AH 3NCJL 1RUQL 3QWOA 4LPTA 1CGSL 3NFPA 2EKJA 5IHBA 5C0IB 2GCYA 4GXVH 1CFVL 1A6AB 4U1NA 1D9KC 1RZGB 4PRPA 4HJJL 3MRJA 1FRGL 2C5DC 4S0SD 5KS9E 5ICXB 3P4NA 3GIZH 4CVXA 3QEQD 4MNQE 5GPRA 3U46B 5F3BB 4G8GA 3M17A 5MI0C 3DYPA 3HAEB 3S34L 2PW1B 4K94H 4OLZH 4PJHF 3GMNA 3Q6GH 4R96A 1AD9A 3QRGL 3OKOB 4K3JH 5DFWH 4B41A 3SHSA 2ZOLA 1U8PB 2GEEA 3K8KA 1UZ8A 3B8YA 1AKJD 1T2QH 4N8VB 1C7SA 2AK4D 4R6UA 4XVSH 2V5TA 4ODSH 4F7TB 4OCSH 4U1SB 1OM3H 1TZHB 2BDNL 4V1DD 4NRYA 3O11A 5H94B 4R0LC 3GBLA 4J1UA 1I9IH 1FAIL 2NR6D 2EDOA 4KHXL 4OQTL 3MBXH 5GGTH 5IJKA 4LSTL 5FM5M 3VXSD 2V9TA 4P23C 1ZHNB 5E8PA 2OR9L 4HIHB 4NUJA 4RGND 5FYJD 3IU3A 1JCKA 5DVLA 2XT1B 4NCC2 3PHQB 1MCWW 4LSQH 2AI0H 3PDDA 2R56L 4GG8B 3RVTC 3IFLH 5I15H 1HHKA 3PDOB 1J1OL 1EH9A 2H9GB 4KTEH 4PRAA 4J23A 3FFDA 2VXVH 3FT2B 3O9WC 3EYSL 3D9AH 1E4JA 3RZCC 3K74B 5EUOB 4NN5C 1IBGL 4DJMA 1HHJA 4UINL 5D9SB 4ZPVB 4Z5RA 4YIQB 3TBTA 3O3UN 1TZGH 4WV1C 1BVLB 3VD5A 1ZSDA 4JLRA 1UADC 4PJCF 4RBPK 3QG6A 4AYFA 1NSNL 3BJ91 4BQ9A 5EUOE 1SYVB 3RVVD 4RDQF 4KXZI 3GSUA 3BPLC 3CH1B 2CRYA 5CMAB 3WNMA 1KFAH 2A9NL 3VG9C 4F7CA 3T0AA 4QHMB 1FNSL 4WFGE 3NCCB 4U0RC 4EN3A 3S4SB 1KBGH 3G6JB 3U36A 2B1HH 2X4SB 2ZJSH 1CLZL 3ABZA 5I74B 5BZDB 5I18H 2E9JA 3TA3B 1JF1A 1C16A 4K23H 1JHTB 5J9PB 1W72L 2HRPH 5D1QD 2FJFB 4FFYL 4NYLB 4HS8H 5KTEH 2WBJB 3TYFA 3X12B 2JB5L 5FGRA 4M6AA 5DURB 3RTQA 4C4KO 4NM8L 3G6JE 2NNAB 5KN5A 4PPTA 5JHDA 2VZOA 2YBRB 1R24A 2HG5B 3H9HA 1MVFA 4PB9L 3DI2B 1WLHA 2DLHA 5TDPA 3T4YB 4KKAC 3FONB 5KANI 1HYSC 3SO5A 4XP5H 5FYKE 2VLME 3ISWA 1F11B 2DMBA 3MRQA 3STBA 2DQFB 4X7SH 5B38B 3TBYB 3VWJD 3GSXB 5D7KD 4BELD 1T0NB 1QVOA 1Q72H 2FLBT 4N0YH 3MXWL 5D7JA 3MX0A 4X7TB 3OGCB 3O6FB 1NDGB 4OZFA 3BAEH 1KB5L 1P84J 3ARGA 1A14H 4RFEB 3WFEL 1MH5B 1ZA6A 3FQWB 2VR9A 2YEZB 4R26H 3TBSA 3GIVA 4OV5A 1QNZL 4Q6YA 2AP2A 4RWYL 4QHLB 5HBBA 2IFFL 1GHFL 3AY4C 4ODTH 3QCVH 3BISA 3L3JA 1JHLL 2O5ZL 4GSDL 4X6EA 3MBED 1RZIB 2EE2A 5DDHA 4JO2L 5GS1A 4L8DB 3VI4F 5HVFB 1HK6A 2AJ3A 1A6ZB 3GJFK 3DETD 3VXRB 1F4WL 4D9LL 1A47A 1XGRB 4I2XB 4Y2DB 4ZUTA 3ARFB 2DQJL 5SX5H 4FS0A 1VGKA 4P2CG 4LSRH 4ODHH 1AXSB 5LKNA 1SEQH 4MQ7A 2QSQA 3SQOH 4I5BB 1JL8A 2PO6D 4M7LT 4I9WE 4PLJD 4G9DB 2HJFA 3VXRE 1CFQA 3BGMA 4UUJB 4I2XE 2H3NB 2R15A 4GBXC 4Q74A 4X8JB 2O5XL 5JIIA 1IC7H 3LDBC 4QT5B 1Q1JH 5TPWH 3P0GB 2ZG3A 3NN8B 1U6AL 4HFUH 5T3ZD 1ZHBB 3B9EA 4EI5D 3TP4A 3L95B 1NCWH 3KPLA 3EGSB 4WHDA 4W81A 1ORQA 5F88B 2C4FU 4Y1AA 3TT1L 3MV8B 3VFRB 2XG4A 3Q6FA 3S5LG 4OM1L 5IFHH 2R8SL 1D5BB 4MYWB 3MV7B 1RHHA 4L8SA 3ARDB 3HE6C 3RNKA 1S5IH 3BZ4A 5D2NC 5KSAA 3HNVH 5FO9B 1BD2D 3HNTH 3QO0B 1IFHH 4JFPA 4FQHA 5FO8A 3MUGB 2GJZA 4TUOB 2Q6WA 3BMVA 3MV8E 4LLMA 4AENA 3L6FB 5I8KH 2AJYH 3KPSB 1YPZA 4NO2A 3MV7E 4FG6D 4BZ1L 4L29B 4X4MA 1UM4H 3GSWB 1EO5A 1D6VL 2R9HC 1CFBA 5E8DL 1BFVL 4FQLL 4NHCH 2DQCH 3ECBA 3NZ8A 3OAUL 3SO3C 4R4FH 4EJ1C 3BW9A 5DRNA 5HYJA 1TCMA 1ZVSB 3WXVL 4UOJA 4Z95H 5D71L 3LQAC 4Q7DA 2L0DA 3L7EB 3SDDD 3KPSE 1UM6H 1KCUH 4AIZA 3REWA 3MLZL 1EMTL 1EUUA 4LBEA 4MQSB 4Y4FC 1CD0A 3CFBB 1G7HB 1T20A 2F58H 3SOBH 3KGRA 1E0OB 1BZ7B 4MNHB 2NY4C 1G9NH 3KPMA 1QHPA 4NZJA 1DBML 2I9TB 1LD9B 4WV1B 4LCUB 4ZMAT 1II4E 3G08A 5T5NG 3TFKD 3NA4A 1HXMB 4ONFL 5IMLA 1NKOA 5JXAL 3MLXH 1ZT4B 3TWCH 4I8DA 4PP2A 1BQLL 3P0YL 1N8ZA 4Y5XA 3VD7A 1SEBB 5KVDH 4S1DC 5DWUH 3FO2B 2ZUYA 3ROLB 3D25B 5BV7C 1CDHA 1FG9C 4P9MH 1M1SA 1TTFA 1ZLSL 4NT6B 3R8QA 3PNWA 4B7LA 4GS7B 1OT2A 4O5LH 3MV9B 3VXPB 3ZKSD 2DTSA 1HWGB 2YPLB 3IFNH 3MV01 3ZHLA 1CDUA 4NDMA 2PTTA 2ED8A 5C8JB 3PGFH 4PJ5A 1INQB 4JREB 3GKWH 3DTXB 3O45A 1MAJA 2V2WB 3AMKA 4PG9B 3MV9E 3LKQB 1PEZA 3WNPA 4FQXC 2MMXA 4G6AC 2ADGA 2HWZL 2YPLE 4YBLC 3KPPA 1MVUA 3O2WH 3QPXL 4FQCH 2HKFL 4LSPH 3MUHL 3HI6L 3EDKA 4YHOL 4MQXD 1IEAB 4YO0A 5KSUB 5DJXA 3RHWK 3MREB 1AGEB 3GFUA 3R0NA 4FHBD 5HXMA 1MOEA 4K8RL 4YDIL 1FFOB 1PQZA 3WIFB 4ZFZB 2DL2A 3FQUA 4JPVL 2X6MA 3A6CH 4K3EH 5CD5C 3Q48A 3MLVL 1MLBB 4NC2B 4XH2B 2JCCF 3AVEA 3WN5C 4Y8DC 3JVGC 4NNXA 3IJYB 2XI9A 4JFED 1FFPA 5ALBL 2BNRA 4WTXA 5FYKD 2OXHA 1A9BA 3GHEL 2GQHA 4TVPH 3AU1A 3KLDA 2XXCB 4IMLB 5F7YC 5MENB 1BLNB 4ELKB 1S9VB 4U6XB 5C0JB 3ZDXF 4NC1E 2KUTA 3VXUA 3MCLL 1A7QL 3O4OC 1KN4L 1WT5C 4FNLH 3UTPE 4YUEH 2JIXD 4PUBL 3EYVA 1DL7H 2B7DT 1FLRH 1G1CA 1OP5K 2AJUL 5GGUA 2QR0A 5D7SL 2FWOA 4XNUL 1HHIB 2G75B 2H32A 3DLQR 4P59L 2E3VA 5K59E 3SE9H 3DNKA 3R06B 2XQYG 5DEFB 3O6LL 2GITA 3I6LD 2FB4H 1AR2A 2JJUA 2UZIL 4XCNA 4Y19A 4ZOBA 2N7BA 2AJXH 2KPNA 2DIJA 4FQ2H 3CIQA 4PLNC 2MJWA 2ITCA 3UBXA 5IFJB 4HIXH 2HTKD 4PB0L 4QYOA 4BYHA 5HGAA 2HVJA 3V6ZA 4N90D 3C5ZC 3HZYA 4WI8A 3MJ9L 6FABL 4FQQB 4U7MA 2A9ML 1MFEL 2QSVA 4OJFH 3VFTB 3TJHC 4UU9A 1D5XB 3RDTD 2XYCA 5KAQG 5GGRY 4YDKH 3LKOB 3QPQC 3DMMB 2A83A 3JZ7A 3I3BA 3MXVL 4GKOA 4HZLB 3W5NA 4F7PB 1MFDH 4XZUB 1Q8MA 5CGYC 4WDIB 2VZVA 4LU5L 4Z7WA 5GRWA 4OZIA 4ENED 5EU6A 4DUWA 4N68A 5F7MC 3GSNA 3PWPD 2VWEC 5I19L 3OJDA 3ULUD 3ZE1F 1ZAGA 3GBMH 1OHQA 2VABA 4OF0A 5MEQA 1KENL 4RRPG 1WISA 1MIEL 3S3JA 1NGXA 4IOFC 5EBWA 2X2YA 3EDEA 5HGBA 5EOQL 3LD8C 1JIBA 4JFDA 4ZUUB 4Y7MA 4YGVA 1D9KD 4JFHD 1JWSB 5EC1A 1FGNL 1F42A 1KIRB 1NUFA 4UT9H 3RX7A 3L3DB 5ADPL 4KQ3L 2C1OB 2IG2H 1FAKT 1QSFB 3SDCB 2AK1H 3RWFA 4LSUH 3C87A 4JO1H 1OGAB 3JV6A 1QLFB 2J2ZA 4XNMA 1H8SA 4RMQA 2J6EA 2M2DA 4IMKC 2IPKB 3MV7D 3ARUA 5ESQA 1Q0XL 3EO9L 4HEME 2ARWA 1I3GH 2NXYB 3VFWA 5E8EB 4LF3B 4AMKL 3GI9L 2BFVH 3NGBC 1SBBA 3MOQA 3QUZB 4WEBH 4I4WA 1WUNT 4UZGA 3HPJB 3F65A 1A3LL 1HKLH 1OGAE 3BP4A 3DVNA 1TDQA 4NUGL 4P23D 2CRIA 4NKMA 2CD0A 3MRFA 1V5JA 1LEKA 2CSPA 2GI7A 1RULH 3HE7C 3WJJA 3FO9B 4Y5VC 3TIDB 5I1JH 3MTRA 5ERWA 2N56A 3CSPA 2W9EH 2Y5TA 3L3IA 3ULUH 1Y6MR 5FIEA 4Y4HC 3AREC 2X1QA 2Q76A 3RVTD 4FMKA 3V2AR 4G43A 4L8CB 1CE1L 4HXBL 2OQJB 3NIGF 3PL6C 1VESA 3QHTC 3FTGB 2VB5A 5EU3A 4IDJH 3M8OH 3O9WD 3SY0B 3G04A 5LWYL 3RZCD 4XXDA 1UQSA 4OIIL 1Y18B 2F54B 2DYPB 2W1NA 4S1QL 1WIOA 1NC4B 2Q7YA 4ZD3L 2F8OA 4X4XA 1I7UA 1FIGL 2EDXA 4F7MB 1F6LL 4J7RA 4YBLB 3AFLA 3UDWC 1BVKA 1HYRC 5EZJB 4MWFB 4HKXA 2F54E 3F6IA 5DJ0B 3U9UA 5B3NA 1FYTB 5JMRA 3OB8A 2B5IC 1BBDL 4WFHE 1A1NB 3PWNA 5F89A 1YZZA 3S36X 3ZSTA 3VXOB 7FABL 3JTTB 3MV9D 1BBJB 3RVXC 1QPXA 3DJ9A 1ONQB 2IALA 1F02I 5GSVB 3RWEB 1JV5A 4JDTH 2VLRD 5HHVH 5E8OB 5BXFA 1FYTE 2NXZB 2R69H 3FB7B 3PGCA 1FQ9C 1MRCL 3CVIH 3M07A 1NMAL 4FRWA 4R4NC 3TT3H 3QHZL 3QIUC 4CGTA 1F00I 3O41B 5IJVA 2R2BB 4UILL 4XNQB 4AEEA 2V17H 2OP4H 1QSEA 3FFCD 1NGYA 2UUDH 2W65A 3O2VL 4JR9H 1TQBC 1NJ9B 1I1AC 2AQ3A 3CXHJ 4KKAD 4CVZA 5HY9B 4Q0XL 4GRWB 5DD0H 1M05B 1T1XA 1HYSD 5IW6B 1JYNA 3KJ6L 1PG7H 4QNPF 5FUZH 1C5DA 3MRGB 4NWTL 1J8HA 4I0PC 3I2CH 4I77L 4LNRA 3ARBB 3ARYA 4G9FA 4WTWA 2X4PA 4MXVE 1Z9SA 3P0VL 3KAAA 5HGHA 5B39G 3QCUH 4CDHA 1T3FB 3J7HA 3UTPD 4GRWE 5IGXH 3GSOA 3RWCB 2VIRA 5I16B 4RSVA 1KGCD 1JF5A 4TUKH 3BESR 1VKXA 3QEQA 3QXDA 4J8RB 5IVXA 1IILE 2FATL 4R4BA 3B3IB 4DVRL 5JOFB 1M71A 1CLOH 1NBYB 3HPLB 2V5SA 4G6JH 5ACMA 3FAWA 4U33A 3BDYL 1UJTA 2PXYC 1T6WA 4RIRA 1AKJA 2VDOL 4AEFA 4YHYC 1JN6A 2AK4A 4M4PA 4OGXH 1P7KB 4GQ9H 4V1DA 2RAMA 1SHMA 4GMSH 3ALPA 3VXSA 2VUOA 3QEHA 4PREB 5LCVH 2NQCA 1OSZB 1NCUA 4UNTA 4M9OA 3AS1A 2AXGB 3BT2L 2HVKB 1WWAX 4FN0A 5EZIH 5C09B 5T1DH 1S9KC 1N64H 4WGVB 1T0MA 2X1WL 5GRUH 3QDGB 2DWEA 4UTAL 5I8OL 5IUSA 4DKEH 3LD8B 4RNRA 5DEZA 4V2CB 1L0YA 1Z5LB 4FFZH 4XHQA 3H9SD 2FGWH 3W9EA 1N4XH 4HK3J 5ID0A 2GTZB 2NY2B 4QXTB 5IBTH 1F2QA 4HS3B 3HR5A 5C09E 1EHNA 1ZANL 5HVGB 3BEVB 4BSJA 5IB5A 3QDGE 5ENWB 1IAMA 1MJ8H 4M8QA 3IFPB 3WUWG 3VD3A 4ZFOL 1XEDA 4YX2H 3SPVB 1IGTB 1FNHA 3HE6D 4EUPA 5ELIA 1WZ1H 3Q3GB 3KS0J 2ARJA 4HHAB 2P8PA 4QRQB 3CUPB 4LHJB 5INCA 4QRUB 3RPIB 4KAQL 1TQCC 5A16B 2OCFD 3QXTA 3HCVA 2A74B 3CXDL 1RJZA 2MHAB 3DX7B 1W2KT 3EIFA 1N6QL 2XZAH 3VW3H 1FORH 4Y16C 1AC0A 3QJFB 1IKFL 2R9HD 1PJ9A 3O3AB 3UROR 1VEOA 1YC8A 1M7DA 4BFIB 1NAKL 4N0RA 5IWLA 3FB5B 1E27A 4NGHL 2FO1A 1IRAY 1Q9OB 5C7XH 4MA1B 4GKZB 1ACZA 3CGTA 1JPSL 4C56B 5D1QA 2EYTB 1JGUL 3U30C 4Y4FD 1N59B 1VACA 2R29L 3GMOB 4LLUA 5J12C 2WWKT 1K8DB 3C8DA 1FZKA 4QOKB 1MUJB 1VFUA 4H0GA 1KULA 1EVTC 4LPVA 1S8DA 1WC7B 2NY4D 1AGFA 3ZYZA 3IVKA 1IKNC 4A2LA 4P57B 1ZS8B 4XB8A 1KIQB 3QCTL 3TNMA 4ZYKA 3P4LA 1TJHL 2DQTH 4C56E 1CI5A 1A5FH 1RZ7L 2A2QT 3CLFL 3BUTA 1BAFH 1Y6KR 4FXLA 3F7PC 4Z7UF 4S1DD 5I2IA 3PDGA 4QOKE 5AYUL 2WP3O 3FQXB 1CXIA 3V5KB 5EOCJ 2GT9B 4L4VB 2JJTC 4HBCL 3VWJA 2NW2B 3L9RA 4QXUL 2CK0H 2VDPH 4U1HB 3V6BR 3G6DL 2PTVA 4XXCA 5E1HB 5ESAA 4WJ5B 1HHGA 1XF3A 1MCSA 3OKNB 4K2UL 5HYSA 4RWHA 3BQUB 5D7IB 3FOLA 2F54D 4AK1A 3HZKA 1UCBL 1OP3K 3SDXF 2IBBA 1KTDB 4L4VE 1B2WH 1Q9KA 1QO3A 5DA4A 1AXIB 4YPGB 1JZ5A 3BUYB 4X98B 4HUWA 4HAGA 1Q0YH 4O2FA 1YJDL 1OT1A 1AJ7L 2FSEA 3GMRA 1T03H 4XAWL 3EJJX 4FQXD 4G6AD 1XF2B 5IROA 4ODVH 4P5MB 3LQAH 1TTUA 1CL7L 2R0KL 1ADQA 4P5TC 3MBEA 4FQPA 1W8NA 1ZEAL 1RU9H 5D7IE 1JPTL 3BIKB 4OLYH 1XIWB 3MUY1 4XWGH 3B6SB 5IVOA 1FL3B 4XP9H 4XP4H 4MCZA 3E8UL 4XTRC 4MD0A 3LKRB 4I0PB 1HQRA 1XGTB 1ZLWK 1MJ7L 4N0UA 2AABH 5CD5D 1IQWL 2PO6A 1A7NH 4UV7H 3MRMA 4WW1B 3T3PF 1UA6L 1ETZB 1MAKA 4LCWD 1I3UA 2H8PA 3S8WA 1UKTA 4ZUSA 4P2RB 4XP6L 2E27L 4QY8A 2BVYA 4QRPD 2NY0B 5GZOC 1LK2A 1NCCL 3KLHC 4P46C 1PSKH 2GUOB 5I1EH 3ETBF 4JAMA 1AP2A 5J6HA 2QEJA 3GO1L 4EI5A 4S1RH 5C0EA 2H6PA 2OR8A 1IAOB 4YNYA 4DW2H 2IQ9L 3FHAA 2GSGA 1NAMH 3O0RL 4NO5A 4W6XB 3V6OC 4UTBH 2GHWB 2NY7L 1TETL 4OT1H 4P2RE 5DR5H 4JDZB 2GSIA 1UJ3C 1U2HA 2VL4A 4YHYB 1CD9B 1N5YL 1BD2A 2L7JA 5DC0A 4WO4B 2M1KA 3OX8A 4CNIB 1C1EH 5C0FB 5MEPB 2MPAH 2ED7A 1LE5B 1PGRB 3MODH 1HCFX 1MWAA 2VH5H 4U1KB 1VGEH 2BY0A 4Z7QF 2YSSA 3U9PL 1A6AA 2YD1A 2VUYA 1UH3A 4IOIA 1RZGA 1RI8A 3EDJA 1J0ZA 3HUJB 1G7JA 1TPXC 1QEWA 5IHZB 2DWDA 3C5ZD 1I7ZB 1XGQB 3B2VH 4TSBL 3E2HB 3UJTH 5DZLA 2OJZH 4ZSOB 3P77A 3TJHD 4WGWB 5JORA 4UT7H 4M61A 1UVQB 3SDDA 2Z31C 3QPQD 3GRWA 4HPYL 3K4ZA 1NEZG 3CDGB 1GPOH 3BPNB 1HINH 1AHWC 3HUJE 5CGYD 2P42B 4RFOH 3UO1L 2FX9H 2G5BB 1I1FB 2J4WL 3MLRL 4PJFA 2JELL 4K9EC 4C54A 1ZOXA 5TDNA 4ZSOE 3VRLF 2XPGA 2CUIA 1ZHNA 3S36H 4ETQB 4RDQG 3QH3B 4NN6B 1V3KA 4PJEB 2YMXL 4FZ8L 2DM3A 1A7RL 1OSPL 4IOFD 1A3QA 4DVBA 2VDMH 4NZTL 1BEYL 3PHOA 4JG1H 5CBEA 5DC9B 3V52L 2JJVA 2ERJC 1BFOB 1NUGA 2A73B 4TPRH 5ICZA 3PWUA 4O4YH 4AG4H 1KIPB 5I1LA 1YYLH 3P4MB 5HYIA 3TC9A 5FYJL 1WBXB 1NGZB 2VXSH 4PJEE 4BH8B 1FJ1B 3ARRA 4P3DB 5GGVL 4PJIB 5DEGB 1C08A 5T1KD 3WHXA 2COQA 1K6QL 3BGAA 4K7PX 1H5BB 2W0FA 1KJ2A 3WE6B 4XBGB 4I18A 2DLTA 1YYMH 5I71B 1OD7A 4YIQA 4L3CA 1LDPL 1IGJB 1MCWM 2V5MA 5FECB 3FN3A 2UV3A 4ESKA 3IXTA 2X4UA 3BMWA 4OZHB 1WIUA 1SYVA 3BFOA 4PJIE 2P8MB 1HH6A 3DV6B 5GGSA 4TUJB 3CH1A 3I50L 2YD4A 3UP1A 3HE7D 1N6UA 5GGVY 4HWBH 2BSSB 4YHKH 2EDBA 4LPUA 4Y4HD 5BRZB 2ZCHL 3ZTJH 1N6VA 3TYGH 2E9BA 3ARED 3FRPG 4OZHE 2WIIB 5CHNA 3HC4H 1E6JH 3UTZB 4GW5A 4KK9C 5I0ZA 3C08H 5DLML 3OXRB 4XRCB 3PL6D 1T89A 4OCWH 5T1LB 1HN1A 1LO0H 3M45A 4N0CC 4JFEA 1JHTA 4C56D 3CFCH 4MD4B 1FSKC 4NJ9H 1U3HB 1K8IA 4PG2C 2E9IA 1P4BL 5H37G 4MZ3A 5JHLL 12E8L 5BRZE 8CGTA 4YXLL 1RJLB 3RWGB 3GM8A 2J8UB 3TPUB 4NHUA 5HDBE 4JKPL 1MI5D 3QWQB 1KEGH 2PYED 4L9LB 4YC2C 4CADA 4R7DB 3FONA 2JIXA 1XZ0A 1OAKL 3PABB 5A2IH 2NZ9C 5JPMB 3BGFB 2HN7B 5J06A 1ZA3B 2F5AL 2Y06L 3K81A 2CK2A 4H8WC 4KUZH 4LIQL 1E4WH 4U1MA 3MFFA 2DQFA 3VWKC 2J8UE 3IU4H 4L4VD 4EDWH 4JVUA 4IEFB 4IRSC 4D0BA 1YMMD 3QIWC 4MJ6A 4E42B 4PGCB 5DS8A 1KXQE 1DN0A 2XWTA 4KHTL 5DJDB 4Z77B 1EUTA 3RVXD 4C4KT 3MRLA 1RFDL 4TNWF 3WFZA 2GJ6B 1NGWB 1QR1A 1QFOA 4HULB 4GMTL 3QNZB 2APTA 4HT1L 4PJGF 3VFGL 5KVMC 1XF5B 4FQIL 2ZKHH 3S5LB 3V7AE 4PTTB 5J89A 4FQJH 4R4ND 1A1MA 3TO2B 3T04D 2N4IA 3SDYL 3RDTA 3QIUD 4XCYA 5HHMD 1MQKL 4OQ1A 1MJJB 5TQ2H 5F9JB 4YE4L 4AH2B 2EKSA 5EUKB 1BQHG 1DLFL 1N3NA 1UH2A 1CFNA 4X6FA 2CH8A 1I1AD 3IDIA 1A6ZA 2ESVD 5AWNH 4MJ4A 2BMKA 3PWPA 4ODUA 1F3JA 4ZXBC 5JLZA 3OKDA 4Y89A 3MNZB 5FUOH 2R0WL 2X4RB 2Z35A 3MRHA 3LEYL 4I0PD 4PV8B 2CLZB 1QLRA 4D8PA 3HC0A 1D5MB 2ZCLL 1WCBB 1IGMH 1PZ5B 5HPOA 4JANB 3F58H 3OKEB 4JY4B 4I5BA 4JFZH 1GAFL 3EYFB 1MIML 3O2DA 4YHLL 4F37K 4G9DA 3RPKA 5DFTA 3MLWH 5E5RB 3QEGL 4OLUH 2F53B 1D9KA 3QNXB 5FYLD 4WUKH 1LWRA 2OTUB 2UWEB 5B3JE 4X8JA 5E4EB 3RL1A 4KDTC 5C0DA 1SY6L 1CICC 4QXGH 1FVEB 3NZHH 5ITFB 2FJGB 2Q8BL 4WU7A 4PRNB 2FYYA 5F88A 1TITA 1MAML 4KZDL 3QSKB 3OB0K 1UXWB 3IDMB 2PXYD 4MQTB 4NQSB 3B5TA 3MV7A 2F53E 3ES6B 3ARWA 2MKLC 2QSCH 5I1KH 2UWEE 5T3ZL 4JZJB 1NMCC 3ZKMC 3LQMA 5EO0B 5DGQA 4MDJA 1IMHC 4R0LA 3UEZA 1UG9A 3CSYB 3BP7B 5C0BD 4GG6B 1MCRA 1U3JA 1YQ2A 4E0RA 2DIAA 4P23A 5SWSD 5T5FL 2QHLA 4HSQA 4D0DB 3L6FA 3QZWA 3OR6A 5E8NB 3CZJA 4L29A 4PJXB 1DUYB 1F90H 3BZDA 1R6VA 5DK0A 1T7WA 3KLAA 4JCMA 3WBDA 4J2XA 4R90H 3GBNH 1IL1A 5JR1L 4Y88A 3STLB 5HYFA 4APQB 3MRNA 1A3RL 4GG6E 4HKZB 3WJLC 4RGMC 3T65B 3L7EA 3ME0A 2QKIB 3VE0A 3O9WA 4PJXE 5D4QA 4NNPL 3RZCA 4WI5A 5ANMA 5H37H 2NY3C 3CCHB 2X4QA 3ZZ1A 4HGWB 1J5OL 1EBPA 1S5HA 5BQ7B 3MGOA 1BZ9B 2FCBA 1BZ7A 3RBSA 3FMGH 1OAQL 4GW4B 2EE6A 2IH3B 4WV1A 3SQBA 3U2SB 3SEPA 1E4XH 5LAXB 5L2JA 3RGVB 1KCVL 4P9HC 3WFHB 3UC0H 5D1XC 2W60A 3CPLA 5CJ8A 2DLIA 5E6IC 3NBNA 4ZUVB 1G7LA 3VGAB 2EO9A 1I3RB 4Y0GA 2CGRL 2ZSVB 2XOTA 2XTJB 4Y16D 2R2HA 3AROA 1HILB 1E28B 3V79C 4LLDB 5IB1A 5KSBA 3MV9A 2C3GA 3VH8A 5HHXL 3ILPB 1NCDH 2RCSH 3A6BH 3MRBB 5DJCB 1T22A 3MA9H 2VLRA 1YPZF 5F9WB 2AJSL 3LMJL 1CLCA 1VSCA 2P4AB 3HN3A 2XTJE 4LRNH 1QLEH 1V7NH 1YEFL 4PG9A 3UTSB 1KF9B 4KFZC 4CN4A 3FFCA 5ILTL 4ZNEE 4OLWL 4Y4KC 5IK3B 1G9ML 3H0TA 1DEEB 3KG5A 1QBLH 5D2LB 5TH2B 1JP5A 5EU5B 3ROOB 3K3QA 1N5AB 2ADJA 1PLGL 1SM3L 1H15A 4KH2A 3GSVB 3WIFA 3UTSE 5L7XL 3SE8L 3OKYA 1BIIA 1EA9C 1DSFH 2GY5A 4KVNH 5CCKH 2ZSWA 4GJTB 4XPBH 1MHHA 3WFDH 5D2LE 3IJYA 3SKNB 1I8IB 5IOPB 1ZWIA 2I07B 1MJUL 1A7PL 3MACL 4XPGL 1C12A 4N8CH 4YHZH 1Y0LA 5HHQA 5FYJU 4GLRI 3TM6A 5C08D 4F15C 3ZE2E 3JWOL 2E7HA 3AY4A 3N85H 4HKBA 1A0QH 3VGGA 3LH2H 4LHUG 2EDFA 5FYKL 1FHGA 3MNWB 4P5TD 1F2XK 3KYKH 3CLEH 1INDL 1PKQA 3QP3A 3G6AA 4HC1L 3TCLA 2QADB 4XC1L 3C2AH 5GHWL 2EYRA 1K9TA 1S7WA 4XTRD 25C8L 3TNNA 5KG9A 2ZP0T 4PGBB 1RZJL 4KTDL 4XI5C 3VXMD 1H3GA 3DXAD 3MJ6A 3BO8B 4N8PA 4AEHH 4DUXA 2A6JB 2XKSA 3ARVA 4NWUL 3FQNB 3LS5H 2YK1L 3HMXH 1R3IH 4PJAB 4G8IA 1NUDA 3H9SA 3C5SB 3THMH 3L5WB 1RZKL 2D0HA 5GZOD 4PV9A 2P5WB 2C4FT 3KLHD 4P46D 1CLYL 1OAZH 3UYRL 1KV3A 5IP4A 4WUUB 2BSED 2H1PL 3IYLW 1YNLL 4F7PA 4U1GC 2GFBB 3MLUL 3NH7L 4XC3L 3VDAA 1L4IA 4PJAE 5FA3A 4M7KH 5D1ZC 5JOPE 1WITA 1IT9L 1CXEA 4M6NH 2OZ4A 3BH9B 3HE6A 3KPRB 4M6OH 4LQFH 5D2NA 3KXFD 2P5WE 3MYZA 4CW1A 5CS7A 3EYQC 1FPTL 2HFFA 2RHEA 4WUUE 3CVHB 5SX5K 1B9ZA 2VR5A 4QCIB 5C71A 4ERSL 1RIUL 2V2TA 3GSRA 2VDQH 4LEOA 3VJ6A 5JQ6L 4HPOH 2R4RH 4ZUUA 1Q94B 3DGGB 1YEJL 4EBQL 4M6ML 2XN9D 4KJWC 3ZDYE 3KPRE 4HUUA 1N2RB 1MY5A 3MUZ1 5DO2C 3CC5B 3IS1X 4F57L 4DN3L 2C1OA 5F6HI 1PAMA 2QL1A 4OSUL 1CN4A 3VG0H 4KZEH 4EQ2A 4X9IA 2WINA 4K71B 4RGMB 5CILL 3SN6N 1QLFA 4XNZB 3X17A 1OWRM 1PBYA 2EIBA 1SQ2N 3F62A 4AL8H 3B8SA 4NSKA 2Z31D 4NFCA 2IPKA 4YFLI 3PWLB 5GRXG 1MEXL 5L6YH 3P9MB 4BQCA 3EOAA 4Y4FA 4XCCH 4P2OB 1EDQA 1EEQA 2LVEA 1KXTB 3AC0A 2N1KA 5E9DB 3HPJA 4E41B 5JW3L 5F7DA 1RY7B 1RD6A 4OD3L 2IAMC 2NY5L 1EERB 4KV5F 2FZ3B 3BKCH 1NFKA 1JZ7A 4Z7WF 1AXTH 3CFEB 2LTQB 4PJ9C 5D1XB 2VTFA 4H20L 3RU8H 4OLVH 2A77H 2Q8AH 1NBQA 2CIKA 3LEVL 3SGKC 4PLKC 4X80L 5DUMH 4IIQC 5E9DE 1JPFB 4U1JA 4E41E 2FEDC 4XPTL 3ZHDA 4L8CA 3DYOA 3W2DL 2WUBH 4X8XA 1WICA 3KR3L 1AD0A 4HH8A 1S7XB 4XGZA 4JJHA 1A2YB 1Y18A 2F54A 4GQPH 3CXHK 2D7QA 4P3CH 1R0AH 4PJBF 3ZT6A 1UACH 1A7OH 4M5ZL 4H88H 2GK0A 3I9GL 1NBVL 1HQ4A 4G7YL 5J3HC 2AJZA 3G5ZB 4FQXA 3UPRB 5SWZB 4JN1L 4RA0C 4ZQKB 5AEAA 3HLAA 5IIEB 5GRJL 3NCYS 3ARZA 4LLVB 4CMHB 1G6RA 2UZYB 2VL5B 5DUPL 2BJML 4C83A 3MJ7B 1VFAB 5B39B 2Y4SA 5SX4I 2FBJL 2IEPA 3CMOH 4QTHA 3RY4A 4ONHA 1RUML 5E2VH 5DI8A 3U0WH 3MYJA 4U7KA 3TN0B 2AERT 3JTTA 5SWZE 4EIGB 1QBBA 2FIKA 3FRUB 5E5MA 1ONQA 5GSVA 1FV1A 1PY9A 3EOBB 4MJID 5EBLB 3TV3H 5JW4Q 5E1AA 4LLQB 4KK9D 3GNMH 5T1MA 5IMKA 2ID5A 3BWUC 4YEEA 4LCWA 3WN5A 4XNYL 3JVGA 4DKFL 5DQ9B 4N0CD 1XMWA 5IV2B 5DF0A 3AB0B 5F93C 4QRPA 3QO1B 1GGBL 2RR3A 4X83A 1U42A 4TOYL 2CDFB 2I5YL 3I84A 1FNEB 1VPOL 3BH8B 4QHKI 2WNGA 5DHVB 4LSVH 1CT8B 5IF0B 1DQQB 3QQ4B 1WT5A 3QI9B 1UKSA 4K8RC 5IW6A 2NZ9D 5L8KB 4HCRH 4YR6B 5CLTA 2KQNA 3QAZB 3BP6A 4G5ZH 3NA9L 4KJYB 5A3IC 4XMLH 2XACC 1M7IA 3VWKD 1ZTXL 3QDMD 4U6VL 1SJXA 1NUNB 5CZKA 4IRSD 3QIWD 2XRAL 2NTSP 1F45A 3O3EA 4G6ML 3BN9D 1FNGB 2RFXA 2R39A 4JHBA 5K9KB 1YEKH 1YEGL 1LNUB 4EOWL 3BKJH 1F4YL 1NC2B 1PYWA 4LCCB 4ZAKC 3BXNA 5EFIA 2VN4A 1NAMB 2DTMH 5CAYB 3WUWB 3C5ZA 1MY7A 1A1OB 3A6OA 2FX7L 5C0RH 5EZOH 2P45B 3NTCH 2W9DL 4YDLB 1ACYL 3WIHA 1FFNA 5EU7C 4WW2B 2ORBH 1MFCL 4CBPA 3MGTA 1ORSA 4X9GA 5J8OA 3PV7A 1GZPB 2CXGA 2V5RA 5LBSH 2VXUL 5MERA 5FA4B 4HWBA 4P5KA 3FO1B 4HIIB 2NY1B 2EYSB 4ZXBD 1RZ8A 1QFUH 5ID1B 3JV0A 2X1XR 3AM8C 3U7YL 3SDAB 3O8XB 1FG2B 3H3KA 2X7LA 3UCRA 4LVNC 5IFAH 3PQYB 4MD5B 1HXYB 4WFFE 1XCTA 4P49A 3LKPB 4FZEH 1Z5LA 3RWJA 4H8WH 2NX5B 3BSZL 2AEPH 4KY1H 3DX9B 4KGJA 3TBWB 1ZXQA 4PJHA 3MR9A 5MEOA 2YKLL 1FDLL 5KW9H 1CICD 4KI5C 5HGGS 1V3JA 4OZGA 4UBDC 2FH8A 1BX2A 2VITA 3PQYE 3BEVA 1C5CL 5L88L 5T1KA 4Z0BH 2G60L 3TO4C 4IMKA 3DVIA 2NX5E 3FKUS 5IVXF 1KPVB 3BKML 4U6HA 4LCIH 4PRBB 3ZKMD 5D6CA 1VADA 1DBKH 2V7NB 3S96B 5FYKU 2GTWA 4JHAL 3DURA 2X89D 5JOEA 1QBMH 4N5UA 4GAYA 5FCUL 4B50A 1S7TA 4TNVF