3QUYC

Structure of the mouse cd1d-bnnh-gsl-1'-inkt tcr complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
203
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 202
sequence length 203
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyC02
5DMJB 3OXRA 1JK8B 2EKJA 2UY6A 1VADB 1WBZB 3GJFB 4FTVA 5E2VL 1IBGH 4PTTB 3TO4B 5I0ZA 3H7BB 3DROB 2AK4A 1K5NA 3MGTB 4UIKL 5JUEH 1CTNA 2XXCB 5F8RC 5CAYB 1IM9D 3FONB 4JPKH 3MROA 4YHLL 1U3HC 3UP1A 3C60B 1QFWL 3VW3L 5F97E 3CK0L 2YA1A 4QCIA 3CC5B 1H15A 4HT1L 4Z0BL 5AZEL 4EBQL 3OG4B 1KCUH 1DN2A 2JK5B 3B9AA 1U8HB 4KRPD 2HRLA 3C5SA 1T3FB 3PNWA 3CVIL 1SY6A 3FN3A 3QUYC 1VGEH 1H3PL 3STBA 4Y4HD 5FGSA 3WXWL 2YSSB 2YRLA 1J0IA 4XH2B 4LLVB 1A7NL 1TZHB 2R9HD 4URTB 3BPCA 3ZHDA 1Q9KA 1S78C 3QHFL 3KPNA 3QYCA 3O4LE 5D2NB 3DBXB 1BZ9B 2O61A 3EOYG 3RIFK 2V5MA 4YIQB 4PJ9C 5KANI 1I9RH 2PCPA 1YN7B 2C3VB 2R2HB 4XPBL 3PG2A 4ZAKC 2JIXD 3NIFF 4JO4H 2VXSH 1CK0L 4LP5A 3EYOA 3KS0J 3UXFA 2ZCLL 5MEQA 4BQCA 1A6VL 3DVFA 3QWRA 2RAMA 4HFWA 1GGCH 1IGFH 4NPYB 5ALBH 1FVEB 3SCMD 3WFDH 1KB5H 3SKOA 2JCCA 4MCYA 5C2UB 3V5HB 4PJFA 4YFDB 5JOFB 2YPKA 4HW6A 5I1GH 3L3KB 1QRKA 3QO0A 2F53D 3U0TA 3VXUB 2LE9A 2QR0B 1VPOH 1F4WH 1CL7L 3Q6GL 2OMBA 2F58H 5HGHB 3P9WB 1ZLUH 5IW6A 2PN5A 3GSWB 4RGOH 4RISH 4H20H 1FYTD 4HZAA 3VFUB 1FZKB 2X4QA 1HHJA 3NAAH 4CL7A 3LQZA 4P5TD 3BKYH 1EJOL 1JGEB 4NN7C 2C5DC 1J11A 4X98B 1JV5A 3E6FB 4LNVA 2OR9L 4GQPH 1UJ3B 1BVKB 3CSPA 5EZOL 3ARBD 3O4OB 4NNPH 5DK2B 4Z5RB 3MNZB 5JXAL 3DYOA 2AS5M 4Z7VE 4D0DB 5ADPH 5F9JA 4HBCH 2D31A 1NUGA 1J1PL 3PWLA 5I6XB 5HGAB 3LSOB 4TNWF 1ZT4A 4AEHL 2D4DA 2AGJL 1NMCB 3H3KA 2BFVL 2CRMA 3GSXB 4G5ZH 3E6HB 4M5ZH 43CAB 1G7PA 3QI9B 5CEXB 4HUUA 2I9TB 3L3GB 3WDIA 3SKNB 4XCYB 4E5XB 3QRGH 1LGVA 1IAIH 3D0LB 5ESAA 1QYGH 4G80B 3LQAH 3EFFA 4KKCC 5JNYB 3D69B 1J1OL 1L0YA 4R7NA 1HIML 5KSBB 1I7TA 5FYJH 3BH8A 3UTPE 3DURB 3PL6D 3MLTB 4M1DL 4UOW1 1MF2L 4XHJD 4KZDH 1A3RL 3BZDA 5CEZE 3VXTB 5J6GA 1AQKH 2GIYA 1Q9WA 3RHWK 3U83A 4YHPB 4MLIA 1CVSC 2WM0A 3VFTA 1HNFA 3KJ4B 3HC0A 4LSRH 1CDUA 4WFED 3ULVF 2ZCKL 1ORSB 2IADB 4ZMAT 1HEZA 4TUKH 3SGJC 3WUZA 1DE4A 4P4KB 4N5ED 4PFEA 4YR6B 2DM3A 2DJ4A 3L3HA 1XGRB 4DKEL 4RRPG 2AEQH 4NQCE 2DWDA 4YHKH 4YHIA 5KSVB 5D6CB 4UNTA 3QJHA 3GMQA 3B6SB 2E9IA 3KHQA 3VXMB 4LLYA 3CX2A 3LEVL 2X4NB 1Q9OB 1AE6H 2IH1B 4XAWH 1IL1A 4N0YL 1M6OA 5JIHA 2BHUA 2BSTB 3HMWL 4D8PA 4NFBA 4R96A 2OL3L 1F90L 3SE8L 4Q9RH 1AXSA 2L0DA 2VXQL 2R1YB 3EYVB 2WUCL 4OD2B 3R4DA 4WUUE 3UZEA 4XVUD 4G8GD 3HG1E 2GK0B 1JGLL 3CLFH 5E7BA 3TN0D 3Q48A 4FFVC 5BZWA 1OT2A 3DGCR 4MJIB 4ONGL 4WGWB 4OZ4A 4XVTL 5LJYH 4Z0XA 1OTTC 4WNQB 4TSCH 1Q94B 1JN6A 5FO9B 2VLJA 3KPOA 4U33A 4JFQB 2JCCF 4KKBC 1U8MB 4PJFF 3IVKB 2X4PB 1YNTA 4ENEC 3QFJB 5C0CA 2W65B 5IMKA 1UZ8A 3CXDL 1RZ8B 3D48R 4LSVL 1QLRA 5AWNH 1W0YT 1FNLA 3R1GH 5H94B 4XMPL 4YNYB 5TPWL 3DUHA 5FO7B 5I1LB 5E24E 1A9EB 1LEIA 3EZJB 5C0FB 1G9NL 3L5WB 4OGZA 2JTDA 4W6XB 4WTXA 2W60A 5MHSE 5E2TL 2KPNA 2NY3D 1JGUL 3PDOA 4LCUA 3O2WL 3LOWA 2XQBL 4HQQL 5F3HB 2FRGP 4LFHD 2BDNL 3IDGB 4CMMA 3GSOB 2O5XL 2Z31A 3FOMA 3KXFD 5CILH 4O4YL 3TPKA 1AI1H 1AO7B 1QACA 4RIRA 2DI9A 2Y72A 1YMME 3WL9A 2VDOL 5E1AA 4BZ2L 2E7HA 3GSQB 4H0IA 1CE6B 3FCTB 3KPRD 3T0DA 1KTDB 3GO1L 5IROC 4Y16B 4IIQA 1CIUA 2D7QA 3UBXB 2FX9H 3GB7B 2BY2A 1AY1L 4LVNB 4YEEA 3TBYA 2F54E 3SGDH 1BQHB 3OR6B 4F3FA 4PRHB 2J6EA 4GAYB 1JRHL 5HI3D 4HHAA 3E3QC 4Z6AT 1A6ZA 4KV5E 2BXZA 1I7ZB 3GBLA 3PE9A 4PBWD 1FZMA 3EO9H 3WN5B 4XP5H 5IB5A 5E9DD 3ZE2F 3KWWB 2NY1B 3GIZL 4M4RA 1OLZA 4NJ9L 5KVEL 5FM4A 2X4SA 4LCWB 4NQEB 5HDQL 3L3OB 1IM9A 3ZYZA 4PJHB 3QEUB 1PSKH 5BVPL 4CVWA 3HI6H 3MXVH 1U41A 1I8LA 3EDDA 3VFVA 3BHBB 3DIFA 4R0LC 3DWTA 4S2SA 4Y2OA 5ICXB 1OAQL 5IVZA 2Q7NA 1N6QL 3C2SA 4X8XA 4LLQA 4PJAE 4OZHE 5CP7B 2EDYA 2EE3A 1KJMA 3NN8B 2M26A 4UQ2A 1TMCB 1FZOB 2COQA 3BSZL 4QXGH 2XACC 4HIHB 2JB5H 2X6MA 1WCBA 4Y4HA 1U2HA 1G7HA 2EZ0C 3C8DA 5IBLD 1PEZA 1J87A 2FO1A 3RL1A 3SY0B 2RFXA 3BXNA 2CPCA 4CN6A 1MUJA 4Y19D 4MDIA 2GJJA 2HWZH 1U8JB 4U0RC 5ITFB 4Y5YB 4PY7A 5ILTL 5ELIA 3OV6A 4RDQF 2H41A 4HV8A 5F7YC 1VEPA 5B8CC 15C8L 4R7DB 2BVTA 3RZWA 4WFGD 1J0KA 4GXVL 5D7SL 1UT9A 3EOBA 2F5AH 3QIUC 3I02B 4U6TA 4QRRB 3ULUL 4MCZB 4ELMB 1Q0YH 2EDRA 1RFDL 2P5WB 2JIXA 1CD1A 1E4JA 3C5ZB 3OBAA 1J8HB 4PJBB 3IDXL 4JPWH 5GRJL 5GRUL 4MAUH 3IAPA 4JB9L 1TQCB 5E6ID 3L5JA 3Q0HA 2OK0L 4WHTB 3QPQC 1CS6A 4QKXB 2FX8H 1UM4H 1IE5A 5FKAA 4P48A 1FO0B 5CINL 3SCMA 1YEJL 1IFHL 2H1PL 5FV1L 2H3NA 1F8TL 4OFVA 2VXTL 3MOAL 4DN3L 3NBNA 2F53A 3HNSH 3LMJH 4XB7A 1EEZA 4M8VA 2OTWB 2VDKH 3WFBL 5TF0A 1JZ7A 2ESVB 5LGJA 4R9HA 5M94B 1FYTA 2APVA 5DJ0B 3RWIB 3LD8C 1C1EL 1FZJB 4P5TA 3ZTJG 5MEOA 5JORA 2HT2D 5DJZA 4Q97A 3FFDA 4PGCA 1OSZA 4NKDB 4U7KA 2VN4A 2DYPB 1AKJB 1CGTA 2K9UA 3H9SE 1YJDC 4I0PC 1FC2D 4O9HL 3S96B 5HY9B 1AGDA 5LVEA 4XNZB 1EHAA 3KR3L 4HGWB 4XCEA 3GHEH 3O2VH 4WI3A 4NP4H 2H2SD 4OFIA 5B4MC 3DTXB 3RGVC 2AJZB 4FQQB 2VITB 3WFCL 4OZFB 3BUYB 1MNUH 2MSPA 3OKDB 4JY4B 1I85C 2HAZA 2NTFA 4HCRL 1J5OL 3SGKC 1F42A 4GOSA 3N06B 5FUOH 4F37K 5DMIL 3JUYA 4LSPH 2GY5A 3P0YL 2FWOB 3JV0A 3KLSA 4UU9A 5L2KB 4ZQKB 3S5LB 5F7LB 4CGTA 3IAGC 5FB8A 4B41A 1AD9A 3MJ9A 4S1RL 5HPMA 1QNZH 1HQRA 2AJUL 4KQ3H 3DGGB 2C1OA 1UZ6E 1IC5L 4XBPA 2P24A 4P9HH 2FJGB 2C26A 1WVZA 4JPIB 3PL6A 1WF5A 1MRFL 4ZXBB 3IDIB 1KLGB 4QHUB 2CLVA 3HNTH 4OCRL 1OARH 4GMSL 4OCWH 5DJ2A 1N5YL 1LEGA 3DMMC 4M43H 5A1AA 4O51B 3NCBB 3KLHC 1G9NC 1MAKA 2D7OA 4TOYH 4XX1G 1IC4L 1OGAD 3M17A 4WWKD 5GGSB 4LQFH 1PBYA 1DBML 3C6LC 4NM8H 2GTZB 4BUGA 2DQUH 3FFCB 4LSSL 3FZUD 4K3GA 1OQXA 1BAFH 3CFDB 2XWJA 2J7LA 5FOBB 1OD9A 1DQLL 4R97C 3IRZA 4YUEH 5GSRA 1D9KC 3TBSA 2DICA 4RBPH 3LKNA 1ZANH 4NNXA 2BVOB 1JPST 4XWGH 4I13B 1RUQL 1A6VH 2ILLA 1RK0B 2VXUL 5HHME 3TEUA 2CRIA 2Y9RT 1GGTA 1KPUB 1WTLA 4AG4H 1E28B 1L7IH 5KJRH 1A1NB 1P2CA 3RNKA 2VO5A 4XPTL 3X3FL 3S88L 2BNQD 3IJYA 2HTLC 3BRFA 2HJFA 4LVHB 3JSSA 4G8GA 1NLDL 4OSUH 3FRUB 1TZIB 2DTSA 5HHOD 1KYOK 3P4NA 5IJVA 3TN0A 5H35B 4RFOL 1KCKA 3QQ3A 1GAFL 4D94A 3TJEH 4NFDA 3T0EC 3RIAK 5L8JB 1IQWL 5TDNB 5IMLA 4UB0H 4XNYL 1CR9H 1XGUB 5GS0D 1KB5B 2Q8AL 1BQHG 3UTTE 3IF1A 5AD0B 1DLHB 5I19H 4ZUVB 4IMKA 4F7EB 4AH2B 4GRLC 3ZDXE 1MFCH 3MOBH 4Y1AB 4YDJA 2A77H 3U9UB 1MFBL 3DX6A 3MV11 4S1QL 5ACLA 1ZLSL 2XICA 5C0IB 5KVFH 3QUMH 3LKSA 5DLML 3BD5A 1G7IB 3IDYB 1WWWX 3I9GH 2C4FU 4C56D 5DMKB 4JAMB 1S7WA 3T2OA 5IIEA 1HHIA 3O45A 4UDUB 2DDQL 5I74C 3UTQB 2I60H 1YEGL 2FHBA 4FFZL 4U1SB 3ARXA 4D9QE 4IRJB 3KXFA 1HNGA 3PHOB 4L8SC 5IMOA 2ZWLT 3OHXA 2B4CL 3MRIB 4KWUA 1D5XB 2CKBH 3BD3A 2DQHH 1XEDA 2AQ2A 3WS3B 2NZ9C 2ZUWA 4HAFA 4M1DH 3KPRA 3ULUC 4PGBB 2NY7L 3WS6C 3CVHA 4H8WC 1DQTA 5TDOB 2VDRL 3G5VB 4GFTB 3KPLA 1QSFE 1SQ2N 4P23D 2CLRB 1NCWL 2C7UB 3U0PB 3O41A 1W0WA 2XZAL 4JPVL 3K46A 1WK0A 5D7IB 2CJUL 4YHYB 2R15A 1BBJA 2YUZA 2ZUYA 4TVPD 2ZNXA 1J10A 2WMPA 1U6AH 25C8L 2A38A 2I5YL 3PHQB 1KTRL 5E9DA 4HFUL 1FG9C 4PRIA 2IAMD 1WGOA 1S7TA 2H32H 4HKJB 2PO6D 2ZKHL 1BGXL 5IHZB 3WIHH 4NO2B 3BX7C 3LPGA 2Y6SC 3TO4D 5B39B 3KDMB 2VLKE 2YEZB 3VI4E 3VWJD 5DS8A 2FB4L 4GW1A 1L7TL 3RWEA 1LO0L 2C1PA 1YJDH 3N50A 4KJQD 1MHEB 2VDPH 3HN3A 3UAJC 1TQBB 1SVCP 3MLSH 3GJEB 3UX9B 1JGDB 3I6LE 3C60D 2GSIB 3ZYJA 5CS7A 4BK5A 2ADFL 3GMNB 3CGTA 4FXKA 5DK3A 5ESVB 5K59E 3DX9A 1EEYA 2K7QA 3BZFA 1DUYA 2WBJB 1EBPA 2PXYB 3E2HC 5DHVA 4IBLT 1C8PA 2ATKA 4U49A 5KS9A 1DCLA 4JZNA 1XH3A 1C08A 2DL9A 4X6FA 1D5ZA 3RZCC 4AMKH 1BEYH 1I3GH 1FGNL 3ARDB 1EGJL 2D7TH 4LOUC 1MCIA 1J7VR 4H25A 1U8QA 2FJHB 3T4YA 3SBWA 4ZUUA 5HHNB 4OQ1A 3I84A 5EBLA 3MV8E 3HNVL 3ZE0E 2KL6A 3MV9D 4OF3A 4RFNC 2GITB 5E6IA 1RI8A 5DO2D 3K80A 1U3HB 2YHGA 4YXHL 3S36H 1LE9A 4C83B 4HG4K 5J89A 4LPTA 4UT6L 3EYUL 1C12A 3SE9H 3NVQA 3QNYA 5HYSB 4U1LB 4CN4A 3MRGA 4EVNB 4DGVH 2GTWA 1U9KA 1OP9A 3SDXA 1IGIH 1YEEH 3WO3B 3BZEB 3FHQA 3QQ4B 1RU9H 4AIXA 3S7GA 5CLTA 4MJ2A 3QUYB 3VXRD 1QLEL 5IGXL 4JEGB 5F70A 3VXUD 5L9DH 2VZ1A 3BAEH 3T3PF 1I4FA 4DVRH 2VJXA 5I15L 3QEGH 2LU3A 5L8KB 2ICCA 5J8OA 4ETQA 5EUOA 5FGRA 3CX5J 4Z8FL 2DJSA 1FSKC 4PJ9B 3BIKB 2OYPA 1CGYA 5FA4B 4EIGB 5A2LH 4ZAKB 3UPRA 1TVHB 5FYLE 3N9GH 3GIZH 4KKLC 3OX8A 3RBSA 3UYRH 1WBXB 4POUB 2QSCL 2W07A 1T7XA 1OCWH 3BKCH 2EC8A 2YN3A 3GSNL 5HVHC 2EICA 2IQ9H 3S37H 3P9MA 4NRXA 3PWUA 1JJUA 3D85B 2PYEB 2R0ZL 1JPFB 3EJJX 4U2YA 3IB4A 3QI9D 1GIGH 3DSNA 4FXGB 1G7MB 1FYHB 4K7PH 4HJJH 1Q38A 3RWHA 3T0WA 4N0CC 4CVZA 1IKNC 1NGZA 1T20A 4XZUB 3SDAD 4F8QA 1DQMH 3KLAB 1UWGH 3KYOB 3NIDE 4QTHB 5FGBC 1E4WL 3BPNC 5C0AB 3RVTC 3VRJB 3EJZC 3BP7A 3L7EA 3HS0A 2GYSA 4Y5VC 1IEHA 5I2IA 1TDQA 4NN7B 5DI8B 3ZDZF 1VFUA 3QP3A 6FABL 1E6JH 1BLNB 1FQ9C 3DV4A 3HI1B 1NLBH 4KUZH 3TCXA 1KTLA 1F97A 1OGAA 4WWKA 4MJ4A 1A21A 4KKAC 1WJ3A 3PIQA 4IOSD 2V9QA 2PF6A 3OJMB 2OTPA 2VQTA 1CG9A 3NCJL 1UXSA 1S9XB 1BX2A 1EAJA 4H8WH 3C2AL 4BH7B 4WFFE 5KS9F 1CDGA 4XP9L 3X13B 5GRJH 3W9EA 4PS4H 1N6VA 1A14L 3WE6B 2GCYA 3MRBA 4UQ3A 4JFYB 3LN5B 1DQDH 1MWAH 5HHVH 2CXGA 5E2WL 4CU6A 2EDWA 3VXMD 4GKOA 5JPMB 2AXGB 3WNKA 3CLEH 4HEME 4LHQB 3CDFA 3HR5B 1F8TH 2BNQA 2HJLB 4G8FA 1MCWW 3MRCA 1JFQL 3D39E 4KPHH 1ONQB 1CLYH 3ROOA 3U79A 5FIEA 3VXQA 3HUJE 3QUXC 3FT2A 5HHOA 4GSDL 5CZVH 1T5WB 1P1ZA 2GKIA 4P2RE 1ZSDB 4OGAC 4HKZB 3CH8A 1VDGA 3KPSB 4GMTH 4G9DB 1T83C 3QQNA 4XP1H 3DUSA 4MJID 4RGND 3UJJL 5EOTB 2D7PA 3SDXF 3KPQB 4PJDB 3VFRB 3QIBC 4BSWB 4LSUH 4POZD 3MRNB 2WWMC 5DRNA 4O9HH 2V17H 2WW8A 3HPJA 4CU7A 1B2WH 4FTVE 1ZGLA 4PJXE 5JA9A 4RRPA 4Y8DC 1CZ8L 4OV5B 3K1DA 4NYLB 3QFJD 1T21A 3FQXB 4HGMA 4JFDB 2EKSB 2OP4L 2P7TA 1LMKA 3GMOB 2WIMA 3QDJB 4NBYB 3PV6A 1J5OH 2XOTA 3AS3A 5EUKA 3V7AE 1UKTA 1NBYB 4C56A 1YY8B 1T22A 3H0TA 3ULVE 5B39G 4L3EB 2J12B 1AQDB 1NKOA 1ZHNB 4U31A 3S8WA 1FVDA 4X7SH 1A1MA 3ES6A 2VL5B 5GGVL 4WCYL 1T2JA 2QJDA 4L9LA 1MVUA 3FMGH 1AO7D 2Z35B 3F58H 1K8DB 2NCMA 3KNBA 3LB6C 1DQQA 4Z9KB 2XN9B 4DKFH 4H26B 3MRJA 5IM7B 3VFSB 5DGQA 4U1JB 3QT2A 3DSFH 1IGCH 4P23A 4OCYL 5HJ3B 1AXIB 1UJTA 5LAXB 2A74A 4OI8A 1IC4H 2BVEA 4OLWH 2DIBA 2HKFL 1CICC 3MLXH 4HIJA 1RZIA 1F2QA 2GT9B 1LO5B 3WNNA 2J8UB 1RUAH 3L3DA 5JHDD 3MODL 3N1QC 2G2RA 2IAMA 5FKPA 3VA2C 3ZZ1A 4KDVA 1DQLH 3VGFA 1VHPA 3U4BL 2PO6A 2NY1D 1JK8A 4F9LA 2X4OB 1VADA 1WBZA 5LCVH 4BSVB 4DZ8B 1BBDH 2NR6C 3TO4A 3H7BA 3DROA 3A0OA 3V0AC 3D2UB 4KJYB 4NQED 5EPMB 4KTDH 1QRNE 2R0WL 1S5IH 4MHHI 3FONA 3QPXL 3CFCH 5F1IB 4FFWD 2GEEA 3C60A 5BJTB 5HYSG 2YD4A 2HRPH 2FYYB 3CC5A 2YXFA 1R3LB 1EHNA 1RQ5A 2LU7A 1UWEH 5JXEC 3DYMA 4M7KH 1KF9B 2JK5A 1U8HA 5KTEH 1LNUA 2A6JB 3MUHL 1T3FA 4XPAL 2YK1L 4OIAA 5EO9B 3WKML 5C08D 3AREC 4LARH 3F7QA 4YQXL 4F15C 3V95A 1K8IA 2ZUQC 3ROLB 4OM1L 2YSSA 3OZ9H 4E42B 5J3HD 1N4XH 4XH2A 4LLVA 1TZHA 3QIWC 5DUML 1GCFA 3LVEA 2X70B 1MCLA 5C86A 5CEZL 3DBXA 1BZ9A 1ETZB 4JFOB 4JHAL 5HD8D 1C7SA 4YX2L 1YN7A 4JR9H 1A0QH 4QRRD 4YBLC 2C3VA 2R2HA 4Z95H 2FECL 1P69B 4M6AA 3MV9A 4CW1A 2W9DL 1Z5LA 4ESKA 2P5WD 3PP3K 5E4EC 1SYVB 4TUOB 3RDTD 2VDML 3RX8A 4EDXB 4R0LB 5GGUB 1CXIA 1UKQA 2WANA 3VFNA 4XGZB 3ZE1F 4B5EA 4QRPD 1YNLL 2R2CA 4NPYA 1FVEA 2DLHA 4XI5D 3LY6A 5JOFA 1MRDH 4TVSa 2OZ4L 4NO0D 1JRHI 5FYKD 1S7XB 3VXUA 1HINH 4J3TA 2QR0A 3EYSH 1UCBH 1P6AB 5I1IL 2FJFA 1BFVL 4U0RB 5ISZB 1DBAL 3GSWA 1IGJB 1H3WM 2G5RA 1HKFA 2W9EL 1QFPA 1X4XA 3GBNH 2E7BA 4CBPA 4JPVH 5B8CB 1L4IA 4LEXL 3SDCC 2CJUH 1JGEA 4AENB 4XAKE 3JXAA 4X98A 3QIUB 2VLRB 3JUZA 3NCMA 4PJCA 2DYPD 1UJ3A 2PNDA 4JQIL 1BVKA 5FDWB 2K3TA 4Z5RA 2EDFA 5DK2A 5A2FA 1RY7B 3WEXB 4G6KH 3ARRA 5DQDL 4D0DA 2R56H 1YYLH 5HGAA 3LSOA 1E27A 2EDQA 4PV9B 3GMLB 4CJ1A 5F1SA 3GSXA 1CU4H 3E6HA 2BY0A 43CAA 3W82A 4CJ0A 3QI9A 1MCDA 4Q0XL 4I18A 4J7RA 1AH1A 1CGSH 2I9TA 3QHZH 3L3GA 1HXYB 3LEXA 3CMOH 1N5AB 3SKNA 4QNPE 4XCYA 4E5XA 3SDAA 5EWIH 2CK0H 4OGYH 4UTBL 5L2KD 4JRXB 1FNEB 4G80A 4BYHA 3V4PL 2EO9A 2V7HB 2VDNL 5GZOD 4ZS6D 5JNYA 2H32B 5BS0B 1CBVH 3D69A 5DHYB 1J1XH 3W2DH 4YJZL 3LD8B 1N0XH 3JV4B 4KJPD 5KSBA 4Y89A 4PRDB 4K3EL 3DURA 4K8RH 5IMMB 3NTCL 3MLTA 4Z7WA 3VJ6B 4QXTB 4ZXBD 3X3GL 5FDYA 4TSAL 2VR9A 4IOFD 3VD4A 5GGRB 4I0PB 2YD2A 4YHPA 2AEIT 1J18A 3A67L 4YPJA 2OL3B 4WI5A 1A02N 1ORSA 3RGVB 2IADA 4YEFA 4OLYL 2ZJSH 1DEEB 4O2EB 1FNSH 5SWZD 3H42L 3FFCD 4P4KA 4YR6A 1BVZA 3GRWL 5F1NA 2IPTL 2PW1B 3MXWH 1XGRA 1UYWH 2FNBA 4EUPH 3JWOH 3S4SB 5KSVA 5D6CA 3HHRB 3B6SA 5FHBH 4BFBD 1P4LB 2WZPD 3VXMA 2EC9T 4ZPVB 1HSAB 5HBBA 3BN9C 2X4NA 4QHNB 1Q9OA 1FC1A 4ZUSB 3HTLX 1FL3B 1LEKB 2XRAH 5ID1B 5I18L 4OIIH 5CZXD 5DC4B 5J9PB 4G7YH 2B39A 3DMMB 2VNCA 1MAMH 3VDCA 2R1YA 4OD2A 3HMXL 1CF8H 2GK0A 2VDLH 3BEVB 3HKFA 3MA9L 5JMOC 2L7JA 1TJIH 4F7MB 5CBEB 4MS8C 3C6LB 3NCYP 1P6FA 4MJIA 2D9CA 1PAMA 2EYRB 1WC7B 2NTSP 4WNQA 1CLCA 1Q94A 5HGBB 4UTAH 3ILQD 5FO9A 5T3XE 4GJTB 4JFQA 3Q6FA 1DLFL 3FO1B 3BH9B 1B4JL 4G6AD 2AQ1A 4R97B 4G43A 5HDOA 2X4PA 2DI7A 4F33B 1D9KB 2FDBP 3IFPB 3FQUA 5HI4D 2A6IA 3GGWB 3QFJA 4XXCC 1P5UA 4ZNCD 3LV3A 4JO3L 5BRZB 1RZ8A 4Y1AD 4G6FB 2W0FB 2W9LA 2YRPA 3IRPX 4YNYA 1AXTH 1EZVX 3L3IB 5FO7A 5I1LA 1HWGB 1A9EA 3MYJA 1EUTA 3EDFA 5C0FA 5TFSL 3L5WA 3VGEA 1F4XL 3DRTB 1E6OH 4GKNB 1BQSA 1M7IB 3D6GA 5F3HA 3IDGA 3U36B 3GSOA 4IRJD 3UDWA 5EIIB 5KAQG 1YYML 1AO7A 4U6YB 2VIRB 3QXAB 4QHLB 3U46B 5I71C 1U92B 4H1LB 2OJZL 1A4KB 3GSQA 3T0EB 5DZNA 3CD4A 3HC4H 4PY8J 3GB7A 3MNVB 3SKJH 2BVYA 5HYJB 2R29L 4J4PD 1BQHA 1PLGL 3O3EB 4NKQB 2FEDD 5TH2B 4GRLB 3V6FB 3MV7B 4LIQH 5T33L 2R2EB 5DT1H 4ZD3H 5FHAL 1ACZA 2PR4L 1I7ZA 5F7HA 2BNRB 2F74A 3WN5A 5KSBF 3HRPA 3KWWA 4X80H 4GQ9H 4OBRA 2Y1VA 2NW3B 1WTGT 4OF0A 4Z7WF 3R0NA 2HTKD 1A14H 2APTA 1U8PB 4YHZL 3DHJA 5FCUH 4A2MA 4IMLB 5I74B 3TC9A 2YA0A 4NQEA 1FNHA 1W72L 1A6UH 3KJ6H 4Y88A 5AEAA 5J6HB 3L3OA 1RIHL 2B8OT 3QEUA 3LH2H 5CWSB 2VQ1B 4L8SB 2CO7B 4LKXB 2R4SH 3AROA 4YFEA 2F53E 1A7OH 2OS7A 2EDEA 5T1MB 5ICXA 4X9IA 4YGVA 3GBML 4NSKB 1MJ7L 4GG6E 3PP3H 5CP7A 1MCPL 4FQLL 3NN8A 1OAZH 4F37F 3FQRB 3VDBA 2YPLE 5CD5C 1FYTE 3D1MC 5I0DA 2IH3A 1FZOA 3O6ML 4BQ8A 2DBLH 4ZSOB 4YWGH 2WBJD 2PXYD 1FBIH 5T5NG 4A6YL 3T04D 3V5KB 1QVOB 3W0WB 2E8ZA 4M62L 4TULL 4QXUL 2I07B 3CVHL 1JHKH 3SY0A 5DVKA 1FHGA 3G9VA 4OLXH 2PTTB 2AEWA 5ITFA 4HZLB 1BF8A 1N59B 1E4KA 1SVZA 2RHEA 1TCRB 5GGQH 4M7JL 4F80A 4PP2A 3DX7A 4R7DA 2J8HA 1I3RB 1HOCA 1NMBL 2XKSA 3I02A 4QRRA 4MCZA 4ELMA 5DJCB 2P5WA 4QYOB 3C5ZA 5IVNA 4JGMA 1J8HA 4PJBA 1KJ2L 3QCUH 5F7NC 4U1HB 4M1GH 3SEPA 4NQUA 4WHTA 4MX7B 3P30H 4TSBH 4QRPA 3BZ4A 5GGVH 5GJSL 5FM5M 1FO0A 1RHFA 5B3JE 3C8KB 4CN1A 3E2HB 1HYSC 4LRNL 4IS6B 3WFEL 4WO4C 4JZJC 4HWUA 3RZCB 1PZUB 2IQAA 3QUYD 2DMCA 1H3TA 1A9BB 4Z7UB 2MPAL 4W6WB 4F7TB 1GJIA 4YDIH 3FRPG 3NACH 3PGFH 5DJ0A 3RWIA 1FZJA 1S78D 4CKVX 2IANB 2AXJA 4NKDA 4P4RB 5F9AC 5GGTH 1XF4A 3STZB 4PJ9D 1RURL 2DYPA 1WEJL 1X5LA 3ZKMD 3WHE1 1IMHC 2JKXA 4PB0H 1IKFH 2HH0H 4N8VG 4XRCB 1GSMA 2DQEH 2HVJB 4ZAKD 3S96A 5KG9B 5HVGB 5HY9A 4RFNB 5I1CH 4M5YL 3RIAF 4HGWA 1T7YA 3TT3H 1F6FB 3DTXA 2QHLA 2AJZA 5IWLC 4FQQA 3HE7C 1NGQH 4HWBH 4OZFA 1WZLA 5JW4Q 1U2CA 3OKDA 1H8SA 5JW4N 3RAJH 1RVFH 3D85D 4KK8C 2PYED 3T1FA 4DGIL 1NFDB 3S4SG 3V0VB 4LU5L 1NL0L 2A6KA 1YEFH 3TGXA 4DUXA 3QA3B 5L2KA 1LE5B 3K81A 4ZQKA 5EO1B 1XAUA 3NGBC 3HPLB 5EOCJ 3DGGA 3M8OH 4OM0L 5BQ7B 5CGTA 1J9CT 2EYTB 5EBGA 3QAZC 1MIEH 3QDHA 5D1ZC 2AABH 2FJGA 2R39A 4JKWA 5EBWA 3TM6A 2C3XA 4ZXBA 4FS0A 4JFZH 1FSKB 5F7EL 1KLGA 4QHUA 3IKCA 4X83A 2HA1A 3X14B 1T1WB 1N0LA 4O51A 3RWDA 3EIFA 3MJ6A 5KVGH 5MENB 3EOAB 3WHE0 5GGSA 5CEZH 5FYJE 5SWZA 2BP3A 5JW3L 2A9NL 3FFCA 5I8EB 5HVHB 1FFPA 5I1HH 3DI2B 2HJKA 3T2QA 5ESQB 2X1QA 1OAXH 1QSEB 3T3PE 3MCLH 3CFDA 5C0RL 2CGRH 1FLTX 5FOBA 5KW9L 5J13C 4ZG1A 4MNHB 1ITBB 2BVOA 5IB3B 3Q5YA 4ZFZB 2W1NA 5IW3A 2WK2A 1RK0A 3KXFE 4TTDC 3D3VE 5C07B 3BPNB 4KKCD 1VGKB 1TJHH 1A1NA 5FA3B 4PP1D 1EO7A 3KPRE 4N1HB 1Q1JL 1ZA3B 2I27N 3B2VH 3CDYA 4R8WH 3WJLC 4ELMF 4JJ5B 1F00I 2Q76B 1PVHA 4JREC 4PJBF 3FRUA 1TZIA 5IK3B 4LHUB 4MNQE 4H1LG 5DRZB 3VD7A 8CGTA 4CDGC 5JOPD 1TETH 3GNML 1NC4B 1JPGB 3KPSD 3MZGB 3U2SB 3GSUB 4PB9H 2DQJL 1MOEA 2JELL 1FDLL 1AJ7L 1XGUA 4HUXA 5E9DE 5JR1L 3PJSB 3RQ3A 3OKEB 5I75C 3W5MA 5AD0A 1DLHA 1EZVY 4ZUVA 5CUSL 2YPVL 2OX5A 5ENWA 1ACYH 3GM0A 4F7EA 1MREH 4WV1C 4O02L 2BY1A 4DJMA 4Y1AA 1P7QD 1T66C 3ZSTA 4ZYKB 4JFDD 4JFFB 1WAAE 2XTJE 2F8VA 2A1WL 3BEWB 3MFGB 3ARZA 4WTZG 5C0IA 1OLLA 3QDJD 4X7TB 1G7IA 5LWYL 1D5BB 1MHPH 1K3ZA 3GK8L 2H2PC 4L3ED 4UTBH 4UDUA 1NAKH 1FE8H 4U1GC 2VDNH 2V5RA 3QUXB 4TRPH 5A40E 1EX0A 4IRJA 3ZKND 1ZTXL 5TQ2H 3PHOA 2FEEI 3TBWB 5KS9E 3MRIA 3G5ZA 5CMAA 1JWUB 4FFVD 3O2DA 5I9QC 1XF2B 3WS3A 4PGBA 5A3ID 1ZGLP 5C0JB 4XCCL 4PD4K 1SJHB 4Y19E 5ICYB 3QDGB 1OTTD 2XN9D 1PG7X 4HMCA 5TDOA 4CVXB 3QIBB 4NNYA 3G5VA 4JY5L 4C4KT 5FK9B 2CLRA 2G60L 4J4PA 1FH5L 3U0PA 4WFGE 1F4AA 4IHOA 5DRWB 3F7RA 4XPFH 4L5FL 5D7IA 2O5YL 3UJTH 3NFPB 3OAUH 2D03H 4RMWA 5CIPH 1JPSL 4JQXC 4M7LL 4APQB 4E41B 1PW3A 2ICWI 4J3WA 2VWEE 3NZ8A 5TE6H 5JW4M 2JJVA 3B83A 3O6LH 4QRUA 4NO2A 4MA3B 5FYLL 4B50A 5HYQB 3P3YA 5B39A 3KDMA 1KEMH 5ITBH 2YEZA 2VAAB 4NQVB 4XBGB 4PLKC 4IRZL 3SDXE 3MX0A 3ZLQC 3RI5K 5ADOL 1NCBH 1WICA 5DQ9B 3UC0H 2KZ1B 1XGPB 3GJEA 3MBXH 1JGDA 2GSIA 2OI9C 2KH2B 3GMNA 4NC1E 4PV8A 5CFHA 1ZMYA 5DJYB 5ESVA 4Y4KB 4UV7H 1X9QA 4EUPB 1DBBH 4HKXB 2WBJA 1CFBA 2PXYA 4OBSA 1RZJC 1CICB 2AK1L 4Q7DA 5EUOE 4MJ5A 4KGJA 2C3GA 4R4FH 1T1YA 4ZS7H 3NFSH 3P11H 2KBGA 2O26U 2Q1EA 5TE4H 1X5FA 1EHLL 1MFAL 2VR4A 4OTXL 3ARDA 5M7QA 3ZKSD 2NMSA 5I16B 1JYXA 5E8PB 3SQOL 3MLUH 3MCKB 1TCMA 1FIGH 2XZQL 1VKXB 1DJSA 4L4TB 4XTRC 1LK2B 1LO2H 4R4NC 4K94L 2FJHA 5HHNA 1NSNH 3EDEA 1NCCH 1WBYB 1VA9A 3I6KA 4QT5B 3ESVF 3V4UL 1T6WA 3V8OA 2MCPH 2YS4A 1U3HA 1YQ2A 5TFSH 4D0CB 4X7CC 4MVBC 1MJ8H 2ZCHH 3PWJB 2EH7L 5HYSA 4U1LA 1MFNA 4EVNA 5MERB 3BZEA 4LGPB 3QQ4A 5HDBF 3BRGC 3GSNB 2OJZH 3AREB 3WLWD 1FNFA 3QUYA 4F15B 1G84A 2ZUQB 3MACH 4MA1C 4MB4A 4KZEL 3TA3C 3N1FC 3AM8C 3QIWB 1DFBH 1KYOJ 4KROC 1XIWD 3EHBC 4U3CA 1NEUA 1JNLL 1NDMB 2R0KH 2VZVA 3C08H 4NZUL 5D96C 3TZVC 2YZ8A 4LSTL 5ALCL 4PJ9A 4J3SA 1NJ9B 4D9LL 3BIKA 4EDWH 3RWJB 1RJYB 1UC6A 2AJYL 2VLRD 3IJHB 3QIUD 4YBLB 4ZAKA 5SWQB 1GVIA 3B3IB 1WITA 1I3UA 1NANI 1WBXA 1WIOA 4FN0A 1ITCA 2R1XB 3R06A 1WT5A 3QPQD 3PQYB 2QQKH 5C0EB 3OMZA 3D85A 2PYEA 1JPFA 3LZFL 4NHUA 3BD4A 4FXGA 5DJ8B 1G7MA 5D7IF 3BKJL 1MPAL 3TV3H 2DQTH 4R6UA 1D7FA 4Y5XC 5D8JL 1HH9B 3RVWD 4XZUA 2VQUA 2CMRH 4JRXD 3KLAA 4LLUA 3KYOA 1S7QA 2DQIL 5BS0D 1N2RB 4BFIB 4N5UA 3VRJA 1OAYL 3CMGA 3DECA 1OSPL 3SDCB 1IEAA 4ZFFA 5DI8A 4K55A 1ZVSB 2W38A 3QO1B 3ZE1E 4K23H 1F11B 2X89D 3HI1A 2FATH 3GUTB 1FPTH 1W0VB 3RA7L 1T7VA 4MSWB 1OP3K 4PREB 5B4MD 3RGVD 4QOKE 4X4ME 4GUPA 1HKLH 1C5CH 5F7FA 1P4BL 4P5KB 3KS0H 1PQZB 2J4WL 4BH7A 4C56E 2CKNA 3X13A 3CCHB 1RZKL 2MKLC 1LWRA 2NXYC 1F3RB 3WE6A 3ARYA 1OPGL 4HS8L 1WV7T 1F3DJ 1MCRA 2ORBH 1XGTA 4CU8A 4JFYA 1OTSD 3LN5A 4M6NL 3GI8L 4U1MB 4JO2H 1F3JB 5JPMA 5DD3H 5E99H 1G7QB 4PTUB 3HR5A 1T7WA 4U1IA 4MQ7B 2HJLA 5C6TH 2AXFA 2QSVA 4XVJL 3AC0A 1ONQA 2VZ3A 5EU5B 2P5ED 5D1QC 3LEYH 4JN1H 4LCIL 1A4JB 5T3ZL 3RWCB 2V2TB 4HXBH 3ZYIA 2DTMH 2EXWC 4ODSL 3RU8L 1RJLB 1T5WA 1EXUB 3KLHD 4I0KA 3WYRA 4F8TA 3NABH 1ZSDA 4KMLB 4FOMA 4HKZA 3KPSA 4TVPE 5EZLB 4EQ3A 4G9DA 3C6LD 2V2WB 1RURH 4YK4C 1KCRL 3SGJA 5EOTA 2ZUSA 1ADQH 1U91B 4JG1L 3KPQA 4PJDA 2HMID 3VFRA 4BSWA 1QFUH 4JFEE 4MWFB 4AL8L 1D9KD 1RZJH 4KJWC 1P7QA 3EW3B 2XG5A 4OV5A 1HDMB 4JFDA 1Z2KA 2EKSA 1RUMH 1EAPB 4X9HA 1MLCA 3CPLA 3GMOA 1AR2A 2K7PA 1IGMH 3EFDL 4G6FD 3QDJA 3WO4C 3S36X 1A5FH 1NBYA 4HG4J 3CJJA 3QEHB 1YY8A 5B38B 3Q1SH 2LFGA 4L3EA 5HYIA 3GHBL 2YZ1A 3W5NA 1ZHNA 2HTLD 4TNWK 1P84K 4KKNA 5F1KC 4LSQL 4HC1L 2DQDL 2VL5A 3PWVB 4L4VB 4HLZH 2AEPL 1KGCE 2VDQH 3DARA 1FCCA 5INCB 2UZYB 1JZ5A 4X6DA 3LIZH 2DLFH 5I1JL 4K94C 2Z35A 2O5ZL 1K8DA 3T0VA 1BFTA 3PP4L 4Z7VB 2E6PA 1P9MC 2XN9A 3T0ED 4H26A 1GGIH 3VFSA 5IM7A 3A6BL 3ARPA 4U1JA 3TCLB 1H5BC 5IFAL 5HJ3A 4OLZL 5LAXA 2GY7B 2NY2C 2Z8WC 1UG9A 4P3CH 3IXTA 4GRLD 4OQTL 3ESUF 5F6HI 1MIMH 3MV7D 2GT9A 1HH6B 1FGVL 1LO5A 3OF6A 2J8UA 4J8RB 1O0VA 1T04A 3MV9E 4NKMB 3O6KH 1QG3A 1V7ML 3WFHB 3VFGH 4JM2C 2BNRD 2QQNH 1GC1H 1PFCA 2X4OA 4BSVA 4DZ8A 2YOCA 3L95A 2DBJA 5AAMA 4M48H 1RUKH 4OCNC 4D9RE 2P44B 4KJYA 2DF3A 5EPMA 4DTGL 4FA8A 1K3IA 3RPKA 5EOQH 4WGVB 4Y4FD 4NBZB 3TIEB 5C7XH 3VG0H 5F1IA 3VXRE 5I71B 3BT2H 3LDBC 5DVMA 1FP5A 1T4KB 4XBEL 5BJTA 1S9YB 4OD1L 5AAWA 3IGAB 2FYYA 3ULUD 2OXHA 1FVCA 1R3LA 1X6LA 1OF2B 5IF0B 5IR1A 5DD5L 2R8SH 4C4KO 1ZV5A 1L6ZA 3G9AB 1DL7L 1SEBB 3QCVH 3CDGB 3O11B 4TQEL 5EO9A 4OZIE 2ZOKB 3W0WD 2EEBA 4NQCB 4PJCE 5IQ7L 4Y8AA 2JELH 4P9MH 3ROLA 4XPHL 4KH2A 3IFLL 2R0LH 35C8L 1PG7W 1QHOA 5H37G 1KCLA 2P1YA 2X70A 4HPYH 3NH7H 4P2OC 1VACB 3T8XB 3BE1H 4UUJA 2VC2L 4C55A 1ETZA 3BFOA 3BVNB 4P3WA 3PUCA 4HK3N 2E27L 4PBVC 4NUGL 3S34H 2IEPA 3S35L 2SEBB 3OAYK 2EH8H 4LKCA 1NCNA 4U7MA 1CT8A 1SYVA 4WUUB 4BZ1H 4TUOA 3HG1B 4DGYL 4EDXA 1X5ZA 3RKPA 3AFLA 4R0LA 5GGUA 2XPGB 4OF7A 3UEZA 1KC5H 3U4EA 1B4RA 3DUUB 4PJDF 1IT9L 4XGZA 3RTQC 4RAUA 1AD0B 3CZJA 4F7CB 4W4OC 4I3GA 4AEIH 4EQ2A 2HFGH 2IGFL 4MQSB 4NBXB 1KEGH 1GGBH 2QKIB 4Z7WE 3WD5H 5ID0A 1S7XA 4XNXL 3RZCD 5EC1A 4Q2ZA 3G6AB 1ZWIB 4FNLL 4OCSL 3U7AA 3CSBA 3T0XA 2DS4A 1RZKC 4WU5B 3TPUB 3LPWA 5ISZA 1MH5B 1IGJA 2EC9U 4OI9A 3AGVA 5EU4B 5LXGH 5D7JC 4XC1L 5GRWA 5B8CA 2D0FA 4AENA 4L5FH 4O58H 4OT1L 4LOUD 5JQ6H 2IAND 1I1AC 3QIUA 2QL1A 2VLRA 4NM4H 1Q72L 1JPSH 1TTGA 2Z0BA 5GRYA 1LHZA 4FP8H 2X10A 4X5XB 3SO5A 2B1AH 4XT1C 4X6DF 3HAEH 1IM3B 4MD4B 4WHYG 2ADJB 5T3XL 1G1CA 1OAUH 4PV9A 3GMLA 7FABL 1YMMB 2BVUA 3VXME 5KBNC 5I1EL 2D7NA 1P4IL 4RWYL 5DQJB 4P2CG 5ADOH 3W11C 4AQ1B 1HXYA 4OF8A 4WO4B 4JZJB 4G8EB 4JCMA 2EEAA 1N5AA 2F54B 4JE4B 2J8UF 4JRXA 1YC7A 1FNEA 5HTSA 2V7HA 3IDMB 1M05B 3D18B 4NQTA 5BS0A 5DHYA 3H9ZA 4DAGH 4I9WD 2P43B 2F5BH 3JV4A 3HC3H 4XX1E 4KVNH 4AT6A 1CXEA 3FRPA 4RGNE 4PRDA 1ZT1B 4JFHD 2JJUA 5IMMA 3VJ6A 4QXTA 3UTSB 3D0VA 4YXKL 3WNLA 1ORQB 3QXVA 5ETUA 1NAML 5E2UH 1JZ6A 3ARWA 2X89A 2HT4C 2CXKA 1FG2B 3DVGB 5GGRA 4S0TD 1V5JA 1FFOB 1CE1H 1RUPH 4N8VA 5FYJU 2VN7A 2ED7A 4KKLD 5MEND 4FG6C 5D5ME 3F5WB 2OL3A 3RVVC 3RGVA 4ORGB 3HE7B 4I77H 1DEEA 4O2EA 4LMQE 2NY4D 4PRPB 4YHOH 4ERSL 5DJDB 1I85A 1SM3H 4PJAB 3MLYH 4X5WB 4OZHB 3TVMC 1QSED 2PW1A 3NCCB 5A43C 1UH4A 4OCMC 3S4SA 1RULH 3IDNB 1YPZB 3H3BC 4N0CD 1KLFA 5CSBA 2EH7H 3NGBB 3QG7L 4ZPVA 4I3RL 1HSAA 5C07D 4QHNA 3QAZB 4WEUD 1QFHA 5CP3A 5D1ZB 4ZUSA 5B38G 1KG0B 4WY7H 3RVTD 1FL5B 3EJZD 1FL3A 2CDGB 2W91A 1LEKA 5ID1A 2FBJH 4K3JH 2P5EA 5J9PA 5HGGS 2J88L 3I75B 1KXTB 3INUL 1UM5H 2AJXL 4X7FC 1LP9E 5DDHB 3TYGH 2D0HA 3S3JA 1IBGL 2UV3A 4KKAD 5CBEA 4F7MA 3C6LA 3MUGB 5DYOB 5JUEL 2EYRA 5JHDE 3GMMB 1NC4D 3QH3B 1JMXA 5JPNB 1XGQB 4JPKL 2P4AB 2Z8SA 2NXZC 3BH9A 4RMUA 2ADGB 1EUUA 5T5NF 1BREA 1D9KA 3IFPA 1G0DA 5IHBA 5J13B 2P49B 3GGWA 4NFCA 2D7MA 1A2YA 1KCUL 1GL4B 4JFFD 3LZFH 3L3IA 2MWCA 1K4DB 5DJAB 4WU7B 3D5OF 2XY2A 4U1KB 3BRDA 3G6JE 1VGEL 1BD2E 2JLLA 1NCUA 4LBEB 1IAIM 3DRTA 4GKNA 1M7IA 3C6SB 4LVNC 4JREB 1A6WH 3MUJA 4FQIH 4NCC1 3R8QA 3QUXD 2LAGB 3ULVH 3H9SB 5EIIA 5C08E 1YEHH 4UDTA 4U6YA 2VIRA 3QXAA 1OSPH 4QHLA 3U46A 4FXLA 4ZTPH 1U92A 4OLUH 4H1LA 3FB6B 4OGAD 1I9RL 4PGDB 3JTTB 1A4KA 3T0EA 2V5TA 3KLDA 4NZTH 3T0AA 3QDGD 1SY6H 3JZ7A 4JO4L 5I75B 2VXSL 2WWMD 5T1DH 1K2DB 2OCFD 2XT1B 4WV1B 4GRLA 1INEH 2B2XH 3V6FA 3MV7A 2EXYC 4QRRE 3HZMB 4ELME 2R2EA 3CXHK 4ZUTA 4UAOC 1GGCL 1IGFL 2FZ3A 2P5WE 2ZSVB 5ALBL 3WFDL 2E9JA 1KB5L 1NGWB 1YUHA 4A6YB 4PJBE 2BNRA 1GZQB 5I1GL 4WTZA 4K7PY 5J0BA 2NW3A 1F13A 2FR4B 4GXUN 1U8PA 1VPOL 1F4WL 5F7MC 4IMLA 4QRPE 2F58L 1S5HB 4PYGA 4PY8I 4UINH 4U1GB 4RGOL 4RISL 3K4ZA 4H20L 2VQ1A 4IIQC 4LKXA 3BKYL 2OSLB 4M1CC 5IFHH 5I9QB 5D7KD 2XA3A 5T1MA 4K2UH 3T4AB 3LS5H 3MLVH 3WS6A 3LB6D 4NSKA 4N9GB 2HLFC 4NNPL 3L7FB 1KJ2B 2DRUA 3FQRA 4M93C 1L9NA 5HYFA 4BQ9A 1T6VN 4HBCL 1FORH 4ZSOA 5LKNA 3MJ8B 3OGOE 1AC0A 1CICD 3QCTH 3V5KA 1QVOA 3W0WA 4G5ZL 4KDWA 2Q7YB 4M5ZL 2I07A 3H8NA 3IU3B 2NNAB 2PTUA 4J3OC 4YDVB 4R3SB 4HZLA 4M9OA 1N59A 1OM3L 1YY9C 1H3GA 1TCRA 3QRGL 5E8OB 1LD9B 5C6WH 1EVUA 3QJFB 4OUUB 1IAIL 5DWUL 4OFYD 1UEMA 1QYGL 5FUCE 5LQBH 2NR6D 1I3RA 3LQAL 4L4TD 1RIVH 4TN9A 1BFSA 5IHLB 1U8KB 3ZHLA 4QYOA 4EI5C 5FYJL 1KUMA 3MPCA 4U1HA 4QRQB 4KZDL 2OI9B 1U95B 3CU1A 5IFJB 3ILPA 2DQCH 4G7VH 3IJSB 4JDVA 5LBSH 3G6DH 1AQKL 3MFFB 5B22A 5JXED 1X5YA 1BWWA 5CHNB 3C8KA 4LSRL 1LK3H 1JBJA 4FFYH 2IPKB 3G08B 4IS6A 5I1JH 1IAKB 1J88A 5SX5K 1SJEB 4TUKL 2VR5A 3RZCA 3ARED 2N56A 1CLOH 4Z7UA 4HCRA 4F7TA 4HH9B 4YHNB 1GPOH 5IFAH 3E8UL 4OLZH 2AEQL 1ES0B 1RJZB 2ZP0T 3QIWD 2DIAA 1D5IH 4YHKL 1NH6A 4YZFF 1LO3H 5SWZE 2IANA 3ABZA 4P4RA 2X05A 1FIEA 3REVA 3STZA 5DD0H 2CD0A 3V4VH 1AE6L 4XRCA 4DCQB 4XAWL 2ZG1A 2HVJA 3OJVC 5KOVC 1ZLVK 4A2LA 3MRDA 5I76B 5KG9A 1R3HB 4R90H 3ECBB 3SKMB 4HULB 3IETB 5I8CA 4Q9RL 2HLAB 1KOAA 1QLFB 3FTGA 3WXVH 4X6EB 5L6YH 3VXPB 1UXWB 3PQYD 1U58A 3F12A 3H9YA 3C9NB 5KN5B 1RK1B 3CLFL 2FX7H 4PJ8D 1HXMB 3DX8B 1NFDA 2C4XA 3V0VA 3EO0B 1QSFB 4PR5B 5JDSA 3FKUS 3QA3A 4XBEH 4TSCL 4JZOB 1LE5A 4MA1B 5EO1A 1MCEA 4JFXB 2F19H 3TA3B 4KROB 3ARBC 5BQ7A 1BZQK 2EYTA 5D96B 5DD1H 4G42B 1SEQH 3IU4H 5DHXB 1OY3B 3S6CA 3SDCD 5DFVD 5AWNL 2AXHA 5EU7E 3R1GL 3X14A 4PJ5E 3FHAA 5E0QA 2NX5D 1G9MC 4ZTOH 1T1WA 1FN4B 4XXDA 2VLKB 3RY5A 1EHXA 1ED3B 5D9SA 5MENA 3EOAA 3V2AR 5HDBE 1I7UB 3ULUF 3JV6B 3ZMRA 3RRQA 3S3SA 3L6FB 5I8EA 1KIUA 2EDJA 3WJJA 5E8DH 3WUWG 5BO1H 2OQJB 2V9TA 8FABB 5CBAA 5ESQA 5CILL 1MCSA 3ARUA 1AI1L 3CH1A 1QSEA 4GXUM 1QOKA 1K9TA 3TFKC 2FGZA 3RFZC 1C5BH 2YD6A 3T09A 4Y5XB 4MNHA 5JW5B 2G9HB 5IB3A 3AB0C 3MLZH 4ZFZA 2FX9L 4R4BB 5CJQH 5C07A 5FGBA 4RAHA 4G6MH 4Y5VA 1AGBB 5FA3A 1RJCA 3G5XA 1U3ZA 5IBUB 1S7UB 3OKYA 2AW2A 2AV1A 4CADB 1ZA3A 2P46B 1HK6A 1QEWB 4JJ5A 3RI5F 2KQNA 4Q74A 2Q76A 3EO9L 5K9QG 4XP5L 1AP2A 1GH7A 2UWEB 5IK3A 4LHUA 3MV8B 2VUYA 2ZNWA 4F58H 3CAFA 2A6DB 2MHAB 1NC4A 1JPGA 1MJJB 1F4YH 3U2SA 3GSUA 4WJ5B 3T08A 2BY3A 3HI6L 3MXVL 2J6EH 4X99B 3PJSA 2MNUA 1UADC 5L7XH 3OKEA 4XPGH 5F44A 1I3VA 5KSAC 2AVGA 3HZYB 1JPTH 2NXYB 2BRQA 3C5JB 5T3XH 1N8ZB 4Z7UF 1ZS8B 3A6OA 3T65B 2JJSC 4ZYKA 1HZHH 3L5XH 4JFFA 1DBKH 5CCKH 2OTUB 1S3KH 3BEWA 4QXGL 4XVUC 4PYHA 4XC3H 2M8XA 3BN9D 4QGYA 2YA2A 1ZHLB 5CSGA 4K7FB 1CYGA 5D1QB 2X40A 5BV7H 1EO8H 5CJXC 1R0AH 3HAEB 5C3TA 1KBGH 2HWZL 3QUXA 1YEKH 4L4VD 4XNUL 3TBWA 4NOBA 5LGKA 3LQAC 1JWUA 5C0CD 5F7WC 2F5AL 1T83A 3RVUC 4MS8D 5C71A 2C3WA 4Q6IC 5C0JA 2LTQB 3MRFB 4YK4B 1SJHA 1Q0YL 3OKKB 4Z7NE 2PUQT 3QDGA 4CVXA 3QIBA 1NFDF 4JPWL 4MAUL 5FK9A 5GISH 1JWSB 3U48A 4L8BB 4Z78B 5DRWA 3D25B 2FX8L 1UM4L 4XNQB 3P4OB 5DVLA 5T1KB 1OP5H 5I1KH 3BIBX 1JWMB 2WBWB 3HNSL 3WKNA 3NOIA 3LMJL 3SN6N 4KHXH 1RMFH 3UO1H 1A3LH 4MA3A 5HYQA 2VDKL 1H9VA 4NQVA 4LIQE 4XBGA 3MOQA 3UTPD 1UENA 1EGJA 1JF6A 3MC0A 4LLAA 4NO5B 5SWSD 5DQ9A 4NWUH 5E5RB 2ZOLB 1XGPA 4P2QE 3V0WL 1TVBA 5IW1B 3VI3E 5HI3C 3FB7A 1YA5A 1H5BB 2VZOA 2V6HA 4PLNC 3GHEL 3O2VL 4F57H 2Y06H 2NY2B 4NP4L 1CICA 1MNUL 3OG6B 1S7VA 5HGDB 4NQCD 4ZUWA 3U9PH 2HVKB 3QSKB 4MDJB 2CO6B 5FUOL 4LSPL 1LQSR 4JM2B 2XTJC 5E8PA 4Z7OE 3MCKA 4OFYA 4PUBH 3E1F1 1VKXA 4L4TA 1LK2A 1QNZL 3RWGA 1NBVH 3REWB 4KQ3L 4HMDA 1PZ5B 3D39B 2CH8A 4BELD 5IB1B 5DUPH 1WBYA 2DOCA 4P9HL 3ZKQD 1BWMA 1G9MH 4QT5A 4PPTA 1IZJA 3HUJB 1PDKA 4UIMB 1P7KB 1MQKH 4QRSB 3HNTL 3LDBB 4WUUD 4LLWB 4D0CA 1OARL 3HG1D 4OCWL 3EGSB 3PWJA 2UYLB 4M43L 4J3VA 4I4WA 5JXEA 2ATPB 3U1SH 1KV3A 4TOYL 1RHHB 4LQFL 5CD5D 2WSKA 3MJ9H 1KNOB 3ZHKA 3FO0L 4NM8L 5E5MA 3GSNA 5F3BB 2DQUL 2MQ3A 3AREA 3OXRB 4FTVB 4PJXB 9CGTA 1BAFL 4JHWH 4Q9QH 1TZGH 3QIWA 2FHFA 4YUEL 4G6JH 1UVQB 4K9EH 1XMWA 1X5HA 4P2OB 1ZANL 2C9AA 1NDMA 3VG9C 4GAJH 4XWGL 2AI0H 4PJIA 4XNMB 1JZ4A 5GRXG 5TJWK 2VWEC 4KDTC 4XCNB 3RWJA 1H15B 2GW5A 1RJYA 3LAFA 4G3YH 4LMQI 3IJHA 4AG4L 2ZG2A 2E5EA 1L7IL 1T7ZA 1WZ1H 2H9GB 5KJRL 2ZSWB 5MHSD 5SWQA 2R2BB 4DVBA 3VGDA 2AKRA 4IDJH 3C5SB 3FN9A 4WUKH 5KVDH 3PQYA 4OSUL 5M95B 3RTQB 3EYQC 4LASH 4PJ8A 3VFMB 5C0EA 3ARTA 3TNMA 2JJTC 1HYSD 3FT4B 4HDIB 3TJEL 4J1UB 2OR7A 2HT2C 2BHZA 4UB0L 1CR9L 5GRVK 1HH9A 4NQDE 2FGWH 5FAAA 1UA6H 5T5FH 4XCFH 5I19L 4LLDA 3P77B 5JOPE 1N2RA 3QEQE 4BFIA 5D7JB 1MFCL 3MOBL 3PWPD 2A77L 3SDCA 2FH6A 3OKOA 4PD4J 3PGCB 1I1AB 2NX5A 3ET9F 3JWDH 4PJEE 4KI5D 3UTSD 3QO1A 5I8OL 5KVFL 3QUML 3X12B 1F11A 2ICWA 3GUTA 3I9GL 1W0VA 3P0VH 1QRNB 3T77A 1OM3H 3T3ME 4MSWA 2GI7A 5DWUH 2I60L 1R5VA 2YPKB 3OL2A 4OUOA 1BOGA 1R3IH 4RQQB 3HE7D 3HA0A 1XF5B 4JG0H 2XZZA 4PRPD 2M1KA 4CDHA 3B4NA 2CKBL 4KK8D 3OKMA 5IW6B 2DQHL 1T80A 3CCHA 2X4QB 1CLZL 3QNZB 5MP6H 2J1KA 4LDEB 4U1MA 1F3JA 5MEPB 4X6DE 1G7QA 4HPOH 5L8LB 4PTUA 5D1ZD 3QUKB 4MQ7A 3O0RH 3TJHC 2WLYA 5D2LB 5F9JB 3PF2A 1U6AL 1ZT4B 5F9OH 3ME0A 1U8OB 1A4JA 2YD1A 2V2TA 3FZUC 3E8UH 3N85L 4OGXH 5EDXA 1EXUA 4ODTH 3FAXA 5IG7B 3WIHL 3B2UD 5F89B 3MQIA 5EZLA 1HHGB 5D1XC 1JNNL 2ADIB 3FQNB 2V2WA 2J8UE 5E94B 3TF7C 3BIAX 1YJDL 2VZTA 1I9IH 4ONFH 2VDPL 3TVMB 4MAYC 1UKSA 3KGRA 4LGRB 3MLSL 1U8IA 3CFKB 1XGYH 4MWFA 4TUJB 1XR8B 4IM8A 5GZND 1I7TB 5IEHB 4MXVE 1EAPA 4HXAH 4PJ7E 5GGVY 2H26A 4UOW0 4RMTA 1VSCA 4PJIF 3JVGC 1BVLA 3MBEC 3QEHA 4AMKL 5DEZA 5B38A 1BEYL 2VZUA 3AXLA 1I3GL 5IEKA 3DVIA 2HKHH 4U7SA 4ZOEA 4HIEB 3OWEA 5EG6C 3PWVA 1I1FB 4L4VA 1HCVA 5I1AA 2D7TL 2F8XC 4JN2B 5INCA 5I17A 1G7LB 3BQUC 1Y0LB 2BSED 5DHVH 4Z7VA 4P9HC 4X4XB 3TCLA 1EH9A 1A7RH 2ITDA 2NXZB 4QF1A 3S36L 2HN7B 4KK5C 4R2GC 5IBTH 3GJFK 2X44D 4XXCA 1IL1B 4RSVA 3MZTA 3SE9L 5EZIH 5F9WC 2GAZA 4DGVL 1HH6A 1IGIL 1YEEL 4J8RA 4NKMA 5IVXE 4GRWB 1RU9L 5JLZB 5EU6D 4N90E 2W0KA 4NRZB 3F7PC 2Y36H 5BZWB 5L9DL 3BAEL 1MJUH 5DGRA 2NQCA 4DVRL 3QEGL 1SBBA 5B21A 1HYRC 3I50H 3KPOB 4B53A 5SWSA 4P23C 3QZWB 2NYYD 4FMFA 4ZFGH 4NUJB 2Y07H 4RFEA 5EIQA 2VISB 1QKZH 1A1OB 4C57C 1S9YA 1TIUA 3IGAA 4JCLA 1D3CA 1VESA 1KJVB 4OB5H 2P45B 4NT6A 4XMLH 5JW4R 5IF0A 3N9GL 4FQXD 3GSRB 1JZ8A 4UILH 3UYRL 4PRID 2IAMC 1SEBA 1OCWL 4NQXB 3BKCL 2PO6C 2IQ9L 3S37L 3V7MA 2VLRE 2ZOKA 2CUIA 5E6YA 4NQCA 4KQ4H 4UAOB 1UACH 1GIGL 3VWJC 4MLSA 4FZEH 2OZ4A 4I3SH 4K7PL 1OTUC 4HJJL 3MV01 4KJQC 3V7AG 1B6UA 1VACA 3T8XA 3BVNA 1UGNA 1DQML 1CQKA 1UWGL 3B8SA 4GBXD 5D7LB 3GMPB 2SEBA 3BKML 1GRWA 1QPXA 4IIQB 1UM6H 2RBLA 5DMGC 4MA7H 2YMXH 4WUUA 5IJKC 3HG1A 1E6JL 2XKNB 2XPGA 4G8IB 3DUUA 3QXWA 2XQYG 1NLBL 4KUZL 4KAQH 4M93B 1AD0A 4MNGE 5BW7C 1A6ZB 4DWHA 4F7CA 3STLB 4XNUH 5C1MB 2XQYK 5C09B 5IB5B 3GI9H 4BQBA 3M07A 2QKIA 5I73C 3MRLA 2CLZB 5CJ8A 4U2ZA 3G6AA 1ZWIA 4H8WL 2XFXA 1R5WB 3MSPA 1Y6NR 1IM9B 1QA9B 5EZJB 3KYMB 4PS4L 4WU5A 1MH5A 5EU4A 1J05A 3TBVB 1LO4H 2EEDA 5HHXH 1M7XA 5BV7B 1DQDL 1MWAL 5HHVL 4R4ND 1KLUB 2O93L 3CLEL 2DKMA 4X5XA 3VGHA 4WI7A 5CSZA 4EI5B 1NMAL 3RPIB 2VKWA 1QQDB 4X9FA 1IM3A 4KPHL 3QDMB 4Z7VF 1CLYL 2ADJA 1NAMB 2BXYA 3J8F7 4MVBD 1YMMA 2IBBA 1PG7H 4YBHA 5CZVL 2W59A 4WTWA 5DQJA 2CUHA 3OR7B 4GMTL 4PY7B 1K85A 4JZJA 2P5EE 4G8EA 2B0SH 4XP1L 4ZDHB 2CK2A 3O3DA 3V0WH 2VABA 1CN4A 1P84J 1A6TB 12E8H 1IAOA 1MHHB 3MYZA 4LSUL 4NHCH 3GRWA 1I1YB 2V17L 4DFHA 3IDMA 1M05A 5GHWH 3TA3D 4DK6A 3D18A 2MJWA 2YKLH 1B2WL 4KROD 3GEWB 5DVOA 3BJLA 4FZ8H 3PWPA 1IAII 1MFDH 3EHBD 3W39B 3OAZK 1N7MH 1ZT1A 2AQ3A 4H88H 3TZVD 4LAJH 4WI2A 3UTSA 4DOHE 1ORQA 4WRLA 2GJ6B 1FG2A 4NZJA 3N1MC 2P8MB 4AEEA 2WINB 1FFOA 3SCMB 5GS0H 1MHCA 1V3MA 1XCQB 4I18C 1KFAH 3F5WA 3VDAA 4X7SL 5D6DC 4ORGA 3S9DB 4NRYA 3HE7A 1RAMA 1RZ7H 2WP3T 4PRPA 3HMXA 4S1SH 3SDAC 4AYFA 1EEZB 3ZKXC 3I6LD 5DJDA 4GG6B 4X5WA 4OZHA 3FMGL 3F58L 4POYA 2YPLB 2DD8H 4YZFE 2BC4A 3IDNA 1NGPH 4P5TB 4LPYA 4DKFL 1YPZA 5DJZB 4YHMH 4QRTB 1EEUA 4JKPH 1A8JH 3DSFL 1IGCL 4HUVB 3Q3GA 3DXAE 3LRSB 3ARBB 3VH8B 4PG2C 4OLWL 3MLXL 5IB4B 2K1MA 5D1ZA 4NQSA 1KG0A 5L0QC 4BM7A 1FL5A 2A9MH 3FO0H 2CDGA 2HFEA 3T0EE 4UT7H 2XA8H 2IALB 4MJ6B 2ICES 1RUAL 1B0WA 4YE4L 1INQB 2J8OA 4AJ0A 3I75A 4EZMA 1DANT 5DDHA 1E4XI 4XVSL 5LCVL 1BBDL 1QTYT 3MV8D 1WFTA 4CNIB 2LVCA 1CFTA 2I26N 3MUGA 4DEPC 5DYOA 2PTVA 3GMMA 4KTDL 3QH3A 1MCOH 1S5IL 4NKOB 5JPNA 1X44A 1XGQA 1VFBB 3CFCL 3WUWA 5HPMB 1HQRB 4TVPH 4F9PC 3SJVE 4U6VH 5DEFB 2ADGA 3V6OE 4XBPB 2P24B 2HRPL 1Z9MA 4HWEH 1UWEL 3WIIH 1ZEAH 3AB0B 2X4RB 4M7KL 2CLVB 1RZFH 5KTEL 5IV2B 1LEGB 5JHLH 1K4DA 4WU7A 3CFBA 4LARL 4U1KA 5EOCH 3UBXG 1DQJA 1KENH 4LNRB 4LBEA 4HUKB 3BP6B 3OZ9L 4L29B 3T2NH 4XWOD 3WJLA 1N4XL 4RGNC 1SHMA 2X09A 5CKAA 3MLWH 3C6SA 3QWOA 3QZWG 3LS4L 2EXWD 3ARFC 4NZRH 1B90A 1YEDA 3WMSA 4FQCH 1W72A 2CRYA 2WLZA 3FB6A 5FYLD 4PGDA 3IXAB 1Z9LA 4JR9L 4NNXB 1A0QL 2BERA 4Z95L 5I8OH 4WDIB 1BM3H 3DV6B 4EOWH 3K3QA 5C9JA 3THML 5KSAB 3NMEA 1K2DA 2XY1A 5SX4I 5F6IC 3RNKB 1KB9K 4WV1A 3HE6C 4D0BB 4KJWD 5ANMA 4I0CC 3I85A 3HZMA 2W92A 1UH3A 4RCAA 3U0WH 1IC7H 3SGDI 1UB6B 2ZSVA 3U7WH 2BVQA 4KV5F 1NGWA 1X5KA 5EU6A 4A6YA 1WWCA 2ICWJ 1MRDL 1YQVH 5E95B 4HUWB 4KI5F 1HINL 2FR4A 1CDHA 1CLZH 3EYSL 2VXVL 1UCBL 2HFFB 2EE2A 1S5HA 4AIZB 1YEIH 1T89C 1Y6KR 3GBNL 3ALXA 1HCFX 1AGEB 5JIKA 1D5MB 1SJXA 1X3DA 2OSLA 3ZDYE 4M6OL 4EXKA 1KCSH 1K4CB 3T4AA 1CXKA 1A7BA 2VLME 4Q6IB 4KHTH 4Z7UE 1G6RL 5F88B 3V79C 5D72H 4N9GA 4FQXA 3L7FA 4OZHF 1PKQA 1KJ2A 4G6KL 1FNGB 4PGJA 3N85H 4M6OH 2QQLH 1INDH 2EO1A 1MFEH 2R56L 5IT2H 4NJAH 1YYLL 2Q8BH 2ID5A 1DSFH 1YPZF 2IANE 2NY2D 3MJ8A 4ODBD 5HXMA 1PY4A 3RY6C 1JNNH 1CU4L 2Q7YA 2EYSB 2AJSH 1I9JH 4J2XA 3IU3A 3O45B 5IIEB 2NNAA 2XI9A 1CGSL 1Y18B 4YDVA 5L88H 3QHZL 4F7PB 3KXFB 4R3SA 3D3VB 2QHRH 3CMOL 1ZE3C 1HN1A 4ODWB 4JM2D 4HLJA 2XZCH 1LD9A 2CK0L 3QJFA 4OGYL 4OUUA 5E8OA 5EWIL 1BJ1J 2AJ3B 1MCQA 4GBXA 4EN3C 1CBVL 1UQSB 5ICZB 3K74B 1Q0XH 3O3BB 1U8KA 3P4MB 4JO1L 1J1XL 3W2DL 3D39D 3W9DA 1N0XL 1R3JB 4HIXH 1CCZA 2PYFA 1TJGH 2R1WB 4K8RL 3TO2B 4MNQB 1U95A 3H6JA 4JDTH 4BFGA 1VERA 5IFJA 3TT1H 4JKMA 4PJGB 1CGWA 3MFFA 3D9AH 4I9WE 5E03A 3U6RB 4OCLC 1PX4A 2Q3ZA 4ALAH 5E8NB 4JFHE 3G08A 1IAKA 3JV5A 5T1LB 1SJEA 2ZJSL 2WIIB 5C3LD 1FNSL 3K4AA 5I1DA 4KXZH 2VMFA 5HD8C 1HHHA 2QADC 4HH9A 2DL2A 4YHNA 3MXWL 3ZTJH 1UYWL 2FO4B 5DS8B 1RJZA 4S1DC 4Z77B 2XTJB 3JWOL 4GW1B 4OZFG 2C1PB 3WIFB 3RDTC 3ULSB 2WV3A 3PXHA 5FHBL 3MRMB 3U82B 3TP4A 2DWEB 1R3KB 1NFIB 3OAZH 1QSEE 4RX4D 3HRZB 4DCQA 1ZXQA 2XRAL 2R23B 1QPPA 3S5LG 4O2FA 4OIIL 4XI5C 5BOZG 5DHVB 4O5LH 1R3HA 4G7YL 2G75B 3ECBA 1ZVHA 5KS9B 3SKMA 3IETA 5DVNA 2HLAA 1MAML 4QTIH 4X6EA 3VXPA 1GXEA 1UXWA 3RL2A 1CF8L 2VDLL 3C9NA 3RTQD 5KN5A 1RK1A 1HXMA 4Y19B 2YWZA 1TJIL 3OKLB 3FB8B 1D6VH 4I2XE 4YDKH 1R24A 4RMVA 5F7UA 4JZOA 4UTAL 2JF1A 4G9FE 4Q58C 4N0UA 4E9LA 4H25B 3TA3A 4HS6B 3AM8A 3GIVB 1QFWI 5EBLB 3TBTB 1OD7A 1UZ6F 2CR3A 5D7JD 4MXWH 1KPRB 2E9BA 3TZVA 3VG9B 4UV4L 4G42A 1V7NH 3WSQH 1QBMH 2WWKO 1IZKA 5FUCC 1DBJH 1AXTL 3VFOB 1C12B 1J8KA 3QNYB 4ZNEE 1FN4A 3AVEA 3MRGB 5F9DC 2VLKA 3ORJA 1ED3A 3SDXB 1I7UA 1T0NB 5L2JB 1QRND 3SQBA 3JV6A 1E6OL 1PYWB 2APBA 4YXLH 3L6FA 1OWWA 3CXHJ 5T3ZD 3EYFB 3BYYA 3R0MA 3BKMH 4P46C 8FABA 3LKOB 3AMKA 3NIFE 1F58H 3MMEB 5FOJA 4MB3A 5JW5A 3VXSE 2G9HA 5EUOB 2HFTA 4LF3B 3HC4L 2GQHA 4PGEB 4R4BA 3SKJL 2UUDK 3L1OH 4IOFC 4LAQH 5E56A 1YNKH 1VFOA 1CGUA 3NIGF 3P9LB 2WUBH 4LIQL 4QO1A 5IKCB 1Z6JT 4CADA 5DT1L 4ZD3L 3KPMB 1NBQA 1QEWA 3KPTA 4P4KD 3P9MB 4NRXB 4X80L 4YLQT 2HT4D 3MLPA 4GQ9L 2UWEA 1X6NA 4OIBA 5IHUH 3MV8A 1CFSA 4U0QB 3RUGA 4S0SD 4KTEH 4P59H 5FCUL 5A16B 1CFVH 4FG6D 1CL7I 3IDJB 1A6UL 2A6DA 2BCKB 2MHAA 3KJ6L 2WP3O 3RVVD 1MJJA 4CVZB 3DO7B 3LH2L 4WJ5A 2EDTA 2R4SL 4X99A 1NC2B 1A7OL 1NMAH 3TVMD 3HZYA 5JMRA 3L7EB 1NPUA 3CZFB 4OAWB 2DM7A 3O81A 2IPUG 3ZDXF 1OAZL 1TNNA 3T65A 1LDPH 2DBLL 4YWGL 1FBIL 1NCAH 5FO8A 4PGZA 1DDHB 5D7KE 3O9WC 3L9RB 3MLRH 5DA0B 2N7AA 1ZHLA 2RB8A 1JHKL 4HK0A 4OLXL 3MGAA 5E4IA 4HEPG 3HAEA 1UXSB 5EU7C 5AUMB 5FXCH 5GGQL 4XP6H 4G6AC 1T1XB 1PD6A 2AK4E 4XP4H 1G6VK 4R26H 5HI4C 4BKLA 3F7YB 4LCYA 5D1XB 3MNWA 5TF1H 1HSBB 4P5MB 2VH5H 3OKKA 1FJ1B 2MOVA 3MCG1 1IARB 3C09C 4APQC 2VZSA 2YC1B 4K8RC 3K2UL 4MAYB 1DVFC 3QCUL 2NXZD 1JWSA 4KK9C 4M1GL 1IEBB 1ZA6B 1KXVC 3P30L 4TSBL 1KN2L 5F6HJ 4XNQA 1GZPB 2V5YA 2QLVB 1ODAA 5T1KA 3VMOA 1F3DH 3FT2B 5J1AA 1JWMA 3MBEB 4S10A 3IYLW 3R8BB 3JBG7 5K9JH 4MXQC 4NWTH 4Y4KC 4Y16D 1OWRM 4BFEA 1W8NA 3JWOC 1XF3B 1A64A 4YDIL 3VI4F 2AJVH 3NACL 3PGFL 3T0BA 3HCVB 3NFNB 4OLEA 1F6LL 4NO5A 1YDPB 1JTOA 1T1ZA 1G0XA 3BQUB 4PRHD 1MLBB 4OJFH 5GGTL 2ZOLA 5KSUA 1FO0H 3WDJA 5IW1A 4PB0L 1IKFL 1S8DB 1P9MA 2HH0L 4NGHH 1D6EB 4YE4H 1T21B 2Z4QB 1QO3B 2DQEL 1H5BA 2P7TB 5FYKH 4QOKB 5I1CL 2DLTA 4XVSH 2J3SA 4N1EA 3GJFA 4DQOL 1BJ8A 1CDBA 3TT3L 4PJIE 4PTTA 4R2GB 2P48B 1NGQL 4HWBL 5CEYB 3MGTA 3MRQB 1KIPB 4LCWD 5F9WB 5C0BB 3O3AB 2EXYD 1JGVH 5HGDA 3RAJL 3EDKA 1FVDB 1RVFL 2JCCE 4PJFE 1A3QA 3SPVB 5EB9A 4UT9H 1JTPA 3PDDA 3ZL4H 7CGTA 4JM2A 1YEFL 4NKIH 1WIPA 4LRIC 5LGHH 1HQ4B 1YC8A 3GZKA 4PG9B 1OVZA 4LCCC 5TDPB 3REWA 3M8OL 3D39A 4RZCB 2UWEF 1KELH 3MRJB 5D7LD 5IB1A 1MIEL 2AABL 5AZ2H 2YN5A 4P23B 3RUGF 1A7PH 3ZE0F 3HUJA 1P7KA 4JFZL 2A74B 4QRSA 1S7RB 2JB6B 4M1CD 3MO1B 4HIJB 4M8QB 3EGSA 1FNAA 2UYLA 5EU3B 3NCFB 1VEMA 1KN4H 2MTPA 3QUZC 2HLFD 3OSKA 2ATPA 5DA4A 5KVGL 1P7HL 2IFFH 1RHHA 3LS4H 4AQOA 5D2NA 3MA7B 5D71L 2IAMB 1KNOA 5CJOH 3WLBB 4HUMB 4YIQA 2KKQA 5C09D 4JFEB 2DN7A 2PO6B 3RGHA 5BMFH 2NX5E 5I1HL 1ULVA 2NY5H 3VRIB 4PJXA 1OAXL 3MCLL 5JOEA 2CGRL 3VWJB 3C5ZD 1J8HD 3THMH 1UVQA 5F7DB 3BPOC 5INDB 2V2XB 1SMOA 2V5SA 4P2OA 1T2QH 1YY9D 1QP1A 4YGAB 4XNMA 4U4BA 5D93C 3PDGA 1G1YA 4XCNA 3B5GA 4RX4A 3I3BA 4WFHD 2H9GA 1TJHL 2ZSWA 4GKSB 4J6RH 2W0PA 3ZE2E 4W81A 3V5HA 2R2BA 4EI5D 3L3KA 3SDYH 5FUZH 1LNUB 3B2VL 4R8WL 3AU1B 2XKUA 2HP4A 3QDMD 4UI2A 2QBWA 3QUMB 2VXVH 3Q5OA 5HGHA 2GUOB 3RTQA 1K8IB 2ZG3A 3D87B 3SE3C 3VFMA 2ESVD 3K8LA 5FEBA 4W4OA 3VFUA 1FZKA 4U6HB 5F1OB 5C9KA 1HE7A 3FT4A 4HDIA 1TETL 3LKPB 4J1UA 4BSJA 5ECJE 4FABL 3E6FA 3MR9B 4PB9L 1TTFA 5I73B 1G6RH 4X6CB 1AKJD 3AY4C 3OQ3B 3MRPB 3MNZA 3ZKMC 2CKBB 1M4KA 3VCLB 3E0GA 2FLRT 4OZGB 3K7UA 3NIDF 3P77A 1ACYL 1VFAB 4X6BB 1MREL 2QV2A 3MV9B 5HI5D 4CW1B 5D7JA 1CD0A 1U42A 4N8CH 1Z5LB 2Y5TB 1U8NB 2UUDH 1T5XB 5GS2D 4RAVB 3GKZA 4LEOB 3PGCA 1I1AA 5CEXA 1WT5C 3DETC 1I7RB 5DK0B 3VFNB 3X12A 3A6CH 2GJ6D 5CGYC 1A7QH 1MHPL 4KK6C 1QRNA 3D0LA 1TITA 3U30C 1NAKL 3VXRB 1FE8L 3X11B 4TRPL 3MJ7B 4RQQA 5HDLA 1XF5A 4JO1H 5TQ2L 5I8KH 1J12A 5ERWB 4JJHA 5DMYA 2FJFB 2Y23A 1EV2E 2YPLD 4JQVC 1OAKH 3VXTA 1QBLH 2VLJE 1KIRB 3QNZA 4L4VE 4OZIB 3UPAA 1CIDA 4EEEA 3RX7A 2B1HH 4J3UA 4PJCB 4JM2F 5MEPA 4KMTH 4QY8B 3SO3C 5I30H 5GQBA 4PLJC 5C0CE 3BJ91 3ZTNH 3QUKA 4XPFL 1FFNB 1KT2B 3UJTL 3OAUL 2D03L 1IRAY 1W8OA 5D2LA 3BWAB 3SOBH 5DURB 1E27B 1R6VA 4IDLA 1U8OA 3O6FC 1T03H 3O2DH 3HUJF 2BMKB 3LKQB 5TE6L 4I18B 1EEQA 5IG7A 5F89A 3O6LL 4QWWD 2ARJB 3TWCH 4HC1A 3LEXB 1KEML 1HHGA 1TPXC 5ITBL 3VGAC 2ADIA 3FQNA 2NY0C 5E94A 3SDAB 3ZKXB 4KMQA 2IH1A 1NCBL 3TVMA 4BK4A 3UC0L 3CIQA 3BYTA 3VWKC 1RZGB 4ODHH 2BSTA 5J12C 3MBXL 3TFKD 3CFKA 3MRHB 4PP1C 3U7YH 5FF6B 2R4RH 4TUJA 1XR8A 4KUCD 4DZBB 4PJXF 2YBRB 5IEHA 3HFMH 3EYVA 4UV7L 4XHQA 4Z7WB 3F6LA 1AGCB 1DBBL 2AERT 3FL7A 3H3PH 3TH4T 5AYUH 5SWSE 5IOPB 3I2CH 1GOHA 5L0QB 4R4FL 5E8EB 4ZS7L 4JGUA 4OQTA 3NFSL 3P11L 4EI6B 4WEBH 5DTFB 5TE4L 2ZPKH 1NGXB 2DM4A 1L9MA 3FN0H 4HIEA 1U8MA 3F7VB 1I1FA 3IVKA 3MLUL 4JN2A 5CKGA 1FIGL 5F1NB 1Z3GH 2W65A 1G7LA 1LO2L 4UV4H 1Y0LA 3OB8A 3KVQA 4DEPB 2DB8A 1NSNL 3TYFB 1JHLH 3I6GB 1NCCL 5H94A 2GFBB 3IT8D 3TH2T 1DUZB 4X4XA 2UZIH 4D3CH 4OCXH 2MCPL 1BIIB 4FQJH 2HN7A 4PRNB 4P99A 5KSAD 4DW2H 3EO1B 1MJ8L 1S9VB 2ZCHL 4MMZC 3BDYH 2QTEA 1E4XH 1NCDH 5IESH 1DZBA 4X0KB 3ZKNC 4DKAA 3EKCA 5JLZA 4JVPA 3S97C 4JRYB 1CE6A 3FCTA 3MACL 1NUDA 1KTDA 4NRZA 2VKXA 2FIRT 4Y16A 5DZLA 3UBXA 5A3IC 4RGNB 2DI8A 1DFBL 2X5PA 3LHPH 4X4ZA 1KTKE 1QHPA 2BNUB 3OR6A 2R0KL 4RBPK 3ARFB 3C08L 3QZWA 1Q9LB 3Q6FB 4V2CB 4PRHA 4NUJA 4FQ1H 5EORH 4GAYA 1CDJA 4EDWL 2VISA 4G43B 1XR9B 4UBDC 1A1OA 3FQUB 1KJ3H 4ELKB 2A6IB 3RVUD 1J0JA 4TPRL 1N3NB 5D5MB 1KJVA 3LV3B 1IGTB 1DR9A 3GSRA 1FV1B 5FYJD 4RNRB 4NQXA 5F6IB 1YN6B 3HE6B 3VFPB 3BDXA 3MYJB 4LCWA 5IUSA 5GJTH 2QQKL 4PJHA 4GKZB 2FBOJ 4ODVH 3H9HB 1BZ7B 3TESA 3BHBA 5C2BH 4ORZC 2DQTL 3TV3L 5D2LF 3D3VD 3BP4B 1I1CA 4TTGA 2EIBA 3P73B 3IFOB 4MA8H 2CMRL 3MREB 4JM4H 4M61B 5SX4H 5D7LA 1FAIH 3GMPA 3GKWH 1WWAX 2CIKB 2QQQA 2ZUXA 2QEJA 4K71C 4HIHA 2NY6C 1MWAB 3ARGC 3VXOB 1LP9B 3JTSB 5F96H 2XKNA 2FH8A 2VL4A 4G8IA 4MNQD 2VRAA 5DZOA 4K23L 3ARDD 1KCVH 2FATL 2FD6H 5FGCE 1U8JA 3EUUA 4Y5YA 1FPTL 5JHDB 1FRGL 3PWPE 3STLA 3OPZH 5C09A 1MCHA 2F74B 3QG6B 1MEXH 4H0HB 4LPXA 5TE7H 4KI5E 5T1LD 1HKLL 3UTSE 1C5CL 1V8HA 2CLZA 1R5WA 5EZJA 1QA9A 3K2UH 1ZAGA 3KYMA 5F93C 1N64H 4PRBB 1U3HD 2IBZX 1MCWM 2XTJD 3OJDB 3QULB 1JI2A 3TBVA 2ORBL 1KN2H 4PRPE 2AAVA 3G6JB 2HG5B 4EN3B 1BD2B 4JO2L 1FLRH 1KLUA 4YGVB 5DD3L 5E99L 2CQVA 3UZQA 4CRPA 5C6TL 4EI5A 1BQUA 4N0RA 2BJMH 2UZXB 3RPIA 2IH3B 1QQDA 1DANU 3DOSA 1YPZE 3QDMA 4OLVH 3LEYL 4JN1L 1NAMA 5C08B 3WLWC 2OTWA 1MQ8A 3MRRB 4HXBL 2DTML 2ESVA 4MQXC 4WFEE 3PXJA 3NABL 4JY6B 1I8IB 1XIWC 3OR7A 4ZDHA 2GSGB 4QNPF 1AKJA 1ADQL 1MRCH 3DX7B 4PP2B 1A6TA 1MHHA 1QFUL 2QADB 4FQHB 1I1YA 1HOCB 4GRWF 1EFXB 4H0GA 4P49A 3NZHH 3NA9H 4FQ2H 1JL8A 2IG2H 4DQOH 1RZJL 3W39A 3RDTB 2VITA 1EMTH 3BUYA 1RUML 1MY7A 2DJUA 4P3DB 3EOTH 4OD3H 4JY4A 1IGML 2GJ6A 4QRPB 2P8MA 1A5FL 3BZ4B 4HWNA 5EFIB 2WINA 4ISVB 2R69H 1CFQB 3Q1SL 1XCQA 3ZSSA 2FWOA 4LLMB 3S5LA 1A6PA 4G8GE 2XWBB 4NO0B 1K6QH 3RVWC 2IQAB 2VDQL 43C9B 3LN9A 4K3DH 4M3JA 5C0AD 4UMGA 3EYQD 4U1NB 4GG6A 4JPIA