3QUYC

Structure of the mouse cd1d-bnnh-gsl-1'-inkt tcr complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
203
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Galactose-modified iNKT cell agonists stabilized by an induced fit of CD1d prevent tumour metastasis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 202
sequence length 203
ec nomenclature
pdb deposition date 2011-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3quyC02
4JPWH 5GGTH 4I3SL 4YHYB 1EHLH 5K33A 5FO7A 5CHNB 4GQPH 1OSZA 3NPSB 3OXRA 4WO4D 3MX0A 3SDXA 3BESR 3HUJF 5EZIH 1BZ9A 3OB0K 4HMCA 3EGSB 2AJ3A 1PKQA 2FX9H 5EU6E 2DKMA 4M6MH 4WGWB 4JDVA 1LK3H 3BP7A 3N06B 1T83A 4X99A 4C54A 1H3UA 2H1PL 4YQXL 4U7KA 4L5FH 5DLMH 3RVWC 3MV7E 4OZ4B 4X9BA 4WIQA 4GW1B 2A0LC 4U0RC 4M62L 4Z76B 1AQKH 2EZ0C 1R3LA 2GT9B 5F6HI 3NTCH 3CFBA 3MBEA 3N85H 5KSVB 4Q9RL 4RQQB 1JF6A 1JUFA 3B2UD 4KJPC 2OZ4H 4R26H 1TPXC 5LWYH 1M05A 1CR9L 2VN7A 3QHZL 4FMFA 4PJ8B 4HXBH 1VSCA 4RGMB 5D7IF 3W82A 1IGTB 4J3UA 1E6JH 2D31B 2GFBA 3RHWF 2XA3A 4XNMA 5DFVD 2Q87A 1P9MA 3UTPE 3DV4B 3P40A 1P4BL 5HVHC 5IFJA 2IFFH 3MXVH 5D1ZA 4M3JA 1RU9H 5B8CC 1S7QA 3QDGE 5K9OB 3MR9B 3LKPA 2J8HA 4BQBA 5DEGB 1QLEH 5DK2B 4MNHA 2FEDD 4QTHA 2AJSH 2VIRA 3BVNA 2HVJA 2HJKA 4LRIC 2XN9B 4U1HB 1FJ1B 3MOQA 3VG9C 4BQCA 3RWCB 4JPKL 5I6XB 4QKXB 3BEVB 2QKIA 1FZMA 4F2MA 4ZYKA 4CVXA 5E8EA 4K7PH 1DL7H 4NO0A 4M4RA 2BXZA 5BV7H 1AKJD 1PSKH 3IAPA 1UXSB 4ONHA 5J6HB 5TGBB 5D2LE 3MRHA 3JUYA 3IFOA 3V6OA 3OB8A 3UTTB 1N5AB 1ZA6A 1LO5B 2V2XB 5TQ2H 5JDSB 3D69A 4ALAL 1D6VH 4LIQL 1INDL 1MOEA 3IDNB 2NY5L 4JFEE 1G9NL 5C92A 1NC2D 3DGGB 4CJ0A 4FQIH 1HCFX 3U0PA 4L4VB 4XRCA 5EO1B 2VXVH 1BIHA 5EZOL 1D5BA 1XGPA 4NM4L 4NUGL 4PLKD 5BXFB 1G7IA 5F9OL 4RAVB 3T3MF 3NFSL 5I1HL 4E41B 3BXNA 2R69H 3VH8G 2NY1B 2C7UB 2FX8H 1OPGH 1FNEA 1MAKA 4MNGB 5IM7A 1JFQH 3QJFA 5DYOB 4PREA 1NDMA 2XWTA 2NY2D 4PJ8C 4RGMC 1CXLA 1I1YB 1RQ5A 1REIA 4D8PA 1VESA 3BN3B 3I02A 2DB8A 4NN7C 3RPIA 4GUPB 4TULL 4KHTL 4OFKA 1KTDB 4ZNEE 1ZHLB 3QNZB 5HHQB 4QWWD 3VD7A 1NBVL 2L7JA 2YPLA 1W72H 4OCSL 2JTDA 4LLDA 5AAMA 2R0LL 2R39A 3SDDA 5E5RB 3IETB 2L4OA 5T1KB 1YPZF 2B1HH 3VD4A 1BOGB 1OAUH 4IMKC 5TDOA 4KK5C 5I6XC 4KKLC 1ZGLB 2VTFA 1QR1A 4FQXD 3TBYB 5KANI 2X70B 4MNQA 4XPBL 1MJJA 3QPXL 4WUUE 4K3GA 5IVZA 3LDBB 4RX4A 2GJZB 5I1GL 3DVFA 5E5MB 3LQAH 3GMNA 4WI7A 3QUXB 3STZB 4WTZA 3TNNB 1FNAA 3I9GH 5EOCJ 5IMKA 1S8DB 3CXDL 1MI5E 3BRGC 3VFOB 1QLRA 4XCNB 3VXQA 1MCOH 1RUKL 2AK1H 4GMTL 4OB5L 3QT2A 2ID5A 1TVBB 3AXLA 4NN6B 4ERSL 1I3RA 3KLAA 2D3VA 3L5WA 3T1FB 3KYMA 4YDKH 1UZ8A 4U4BA 3HZVA 4ODTH 5DD6A 4KJQC 2NY1C 1AXTL 1Q1JH 2F53B 1MIEL 5L2JB 5EOQL 4M43H 3HNVL 4U6XB 1S7RB 5C86A 1RVFL 2YBRB 4NZRH 4QRRA 3FOLB 1FNGB 1WBXA 3VRLE 1MF2H 4KTDL 4HZLB 4Z8FL 4UQ3B 4FZEH 3SQOH 1G7MB 4H0HB 4HV8B 4YEFA 4URTB 3QWQB 4LPYA 4LEOB 1JNNH 1F4HA 4X0KB 5KN5B 1NCTA 5AAWA 5D96B 3SKJL 3T8XA 3SO5A 1JZ6A 3TYGL 4M61B 4R0LA 2NXZB 1CFSB 3L95B 3LQZA 3ZKQD 2KQNA 1DANT 1U3HB 4O2FA 5ESVA 3IKCA 5IKCA 5B4MC 1G7QB 2C1OB 4FXGB 4OF5A 1NUDA 4DN4H 1J1OH 1RJLA 5CP7A 1UM6H 2D4DA 1S9WA 1UB6B 2BHUA 2BVOA 2XWJB 32C2B 2ICEB 3LKNA 4G9FA 3V4VL 4I3RL 4ODUB 1D5MB 4M7ZB 3SY0A 2BFVL 1V3KA 3EDDA 2VE6A 3LDBC 2G75B 3A0OA 1MY5A 4PBXA 1NLBL 3WKNA 3QIWA 3P30H 4X8JA 6FABL 4G7VH 4AIOA 5FUZL 2Z0BA 1DVFA 4LCCC 1F6AA 4L1DA 4NN6C 3QWOA 4UTAL 4FXLA 3WUWG 4AG4H 4XVSH 5E2JA 4Y16D 3HR6A 1A3LL 1RJZA 3TYFB 3ARVA 3KXFA 1JI1A 2G60H 4M9PA 1QHPA 1DEEA 1TMCB 4XMPH 2X4NB 5B39A 5HHVL 3NCYP 4LOUC 1EEYB 5FUCC 2MCG1 3WJLC 3AGVA 3C5ZA 5KANG 5SV3A 3BJLA 5F3BB 2XZCL 1YQ2A 3ULUL 3K2UH 1IILE 4UT7H 3UTTE 5D96C 1HHKA 4DUWA 4HIIB 2GUOA 4U49A 3SE9L 2D03L 4P5KA 5EBMA 5EO9A 5LBSH 3D9AH 2D9QB 3D39D 3PP4H 1CVSC 2NXZC 3BEWA 4XCEA 5GS3A 4L4VE 3T0BA 5ISZB 5HDLA 1U3HC 1S9XB 4H88H 2OXGA 2R4RL 4M5ZL 4ETQA 2GJ6B 1T2JA 5F7YC 4OJFH 4E41E 1V7NL 3VWJD 4HHAB 1V3LA 3FL7A 4MNGE 2XICA 1MLCA 3ZT6A 3IFLH 4ZDHB 5F7NC 4CW1A 1FL3B 4M7ZC 3C9NA 3V0VB 1KLUA 3IB4A 5H35A 4JJ5B 5K59E 2UZYB 3DRQA 3F6LA 2YD9A 1S7XB 2E9WA 1MCWM 2F19H 3OZ9H 4FQQA 4XC3H 4D9QD 5IB3B 1TXKA 5HGAA 2YMXL 3ARDB 4P2QA 2W07A 1AO7B 2X4QA 1U58B 4KVCH 1I85C 4WDIA 1FVDA 1CE1H 2AJZB 1I7ZB 1LO0L 5CLWA 2CJUH 4NHCH 3DTXB 1L9MA 43CAB 3MNZB 1IGMH 2FBOJ 4XHJC 4MYWB 5K9QI 1NFDA 1O0VA 3D0LB 1R3KA 1ZWIA 3RDTA 3MV8B 1CXFA 4JANB 1V3JA 1NCAH 2HJFA 5FYLE 5JXEA 2OP4L 5BQ7B 4RIRB 2WANA 4LVNB 3UO1H 1N0XL 5J12B 5SWZD 5T3ZL 5DGQA 5FO8B 5IB5B 2DM7A 3MRCA 5DQ9A 4X4YB 5GRJL 1RUQH 1U8PB 5F6IB 3WLBA 3SO3B 4GAJL 3WS3A 2DJSA 2IANA 5J11B 3SGJA 1G7PB 3U9PH 4GQ9H 1WZ1H 1FG2A 4YDVA 3WSQL 4NNPH 4FFYH 4ZOEA 1DE4A 5EIVA 8FABB 3CZFA 2NTSP 3N1FC 4OLZL 3ZYOA 2F53E 3KYAA 2WK2A 4JFYB 4RA0C 2RIKA 1D5IL 1A1OB 4L8CA 4PG9A 4RFOH 3GMRA 5D7JB 2QTEA 3U7YL 5ID1A 5I66B 5TDPA 1PZ5B 4OD2B 5ANMA 3TNMB 3PUCA 5FUCE 3VA2C 4HMEA 3JTSB 1HHJA 3EJZC 3CPLA 1KT2B 4RMWA 4GSDL 4WEMB 4K8RC 1H3PL 1QBML 1NLDL 1MQKL 2AEQH 2NMSA 2VLLB 3U6RB 3ARDC 4P46A 1EEZB 2JCCA 2X7LA 1XGTA 4UT9L 5DWUL 1YEFH 4RSVA 1ZEAL 1MWAL 3KPLA 4PV9A 4BH8A 4P2CG 5DQDL 1PFCA 2VH5L 4UDUA 1PG7H 2XN9D 2BSRA 2H32H 4KK5D 4KKLD 3G5VB 1HQRB 2CKBH 4ZPTA 5HHPA 1KPUB 3J8F7 2Z92A 2EDRA 3OKDB 1B2WL 1EK3A 2HG5B 5DJYA 2XY1A 4KUCD 4CMMA 3BAEL 3PL6D 4CN6A 2C3XA 3PV6A 2I26N 4P9MH 1NEZA 3TIEB 5K9KB 3P4NA 4Z7WF 4H8WL 4LVNC 5J12C 3ZDYE 1KJ2A 3QEQA 4YBLB 1A6ZA 1RPQA 4K9EC 5HD8D 3ARBA 4RGOL 5F6IC 4HIJB 4M5YL 4OF8A 3KPPB 3ZO0A 5E24E 2W59A 2EDOA 4WHYH 5GS0D 1UYWH 4M6NL 4PJIA 1QFOA 1R24B 3UTSB 3LN4B 3QDMA 2WBJA 4NJ9H 3STLA 2WLZA 3OJDB 3NIDE 3LRHA 3ARFA 4X6BB 1XAUA 4S1DC 1RIHH 1XGRB 2G2RB 5F7UA 4JKPH 4JQIL 3D87B 5DHVA 2EDWA 2HFTA 5HHXH 1E4WH 1LO2L 4FQCH 4Y1AD 5K9QG 4G6AD 5HGDB 3FOMB 4PB9L 4GFTB 1ZT4A 4PRNA 5ACMA 5E99L 4OLEA 2EIDA 1AIFB 5F1NA 4UQ2A 4EDWL 4DK3A 1JPFA 3UDWC 1FL5A 4GG8B 5D7JC 5TF0A 1M1SA 1Z5LB 3U46B 1J05B 2ZZUT 3V8CA 3CFKA 1OD7A 2LVCA 3CU7A 2IJ0C 1YYML 4RCAA 4NC2B 5FAAA 4XMLL 2B1AL 2DQJL 1HXYA 3QUZD 1JZ5A 2H1PH 4L3CB 4PY8J 5FO7B 3T65A 4YQXH 4CDGC 3QA3A 4O00A 3RWJA 1EMTL 5T1KD 3SDXB 2HAZA 1ZE3C 5B4MD 1IGYB 3PGFL 3T0EE 5ISZE 4M62H 2AJ3B 1PKQB 3FRUB 1DBAL 2GJ6E 1FCCA 5GGSB 4JDVB 3U4BL 3U0TB 3IVKA 4X99B 4Q9RH 4JFDD 2FEEI 3DRTB 4QXTA 1KCKA 1CR9H 2PXYA 3QHZH 4F3FA 4XPGL 1RV6X 1GC1L 5EOTB 4NOFA 3S7GA 4YBLC 2HFGL 3QCTL 4FP8L 1RSFA 2FYYA 2FX7L 3CNKA 1BBJA 3CFBB 3MBEB 1P4BH 5HGBA 3DVGA 1JUFB 4ORGA 5I19L 4JCMA 5CEYB 5J06A 1P4LA 1AO7E 5MENE 2CRYA 3CJJA 3ROLA 2QR0A 3MUHL 1T03L 1QZ1A 1U8JA 2GFBB 3GMLB 4HUXA 4X9IA 3TBWA 4CVUA 5EULV 3RI5F 1MPAL 3NFNA 3ZKSD 3MV8E 5IFJB 4JPKH 4LOUD 2PR4L 5D1ZB 4NNXA 4FQJL 1S7QB 4GXVL 2BJML 3KS0H 4LP4A 2IAMA 1J1XL 4MAYB 4GBXB 3LKPB 4Y4FC 4MD4A 4HAGA 4EI5A 2OL3A 2R2EA 4JGJA 1RHHB 4G8EA 5DFTA 1AGCA 1K8DB 4MNHB 3OX8A 4QTHB 4PLNC 3EAKA 1I7RB 2VIRB 3BVNB 3TO2A 1KEGL 2HVJB 2HJKB 4NBZB 2V2TA 3ECBA 4ALAH 2X9XA 4LIQH 2QKIB 4NQDA 1FZMB 3LIZL 1INDH 4ZYKB 4F2MB 3T1WA 4GG6E 2NY5H 4RAUA 1G9NH 3OG6B 4NQSA 5E8EB 4CVXB 5JOEA 4NO0B 4Z78B 1U3HD 1JHKL 4C57C 4OQTA 3L3HB 4XTRC 3MRHB 5EZOH 4NUGH 3IFOB 3L3JA 5F9OH 2WV3A 4OIBA 1ZA6B 3NFSH 4X6CF 5I1HH 2F8VA 3D69B 2BNRA 5KS9B 3ZYZA 1JPSL 1XCTA 5JMRA 2FATL 3JBG7 2PW1A 4MB4A 2HA1A 4QRPA 3GEWB 1KGCD 3EKCA 2W9EL 3U0PB 3MNWA 4XRCB 3TM6A 1C5DA 5DA4A 1D5BB 1XGPB 1HXMA 4F7TB 4KKCC 4ODXB 3B9KA 4ZD3L 4OZGA 1FNEB 5IM7B 3QJFB 4TULH 3VDAA 4KHTH 4PREB 3FFCE 4YK4B 3O3EB 5BRZA 2XWTB 1NBVH 4OCSH 2PYEA 3S3SA 2AERT 2ZG2A 1MLBB 4XHJD 1BIIA 4LLMA 1JZ7A 2BVEA 3SDYL 2R0LH 4LPXA 3I02B 3MRMA 5JTWA 3ZE0F 4DZBA 2ORBL 3RPIB 3QUML 3ZTJG 1MELA 4S1RL 5D1ZC 4OT1L 2P44B 1EFXD 4J2XA 2YPLB 4XPBH 3VFGL 1Q9OB 2GSIA 4MAYC 4GBXC 2APTA 1E28A 4GKNB 4I0KA 3WFEL 5DURD 5GGVY 1M4KA 2HFFB 2PN5A 4HFWB 1S7SA 4LLDB 3SDDB 1LEGA 5I1GH 1EX0A 2CQVA 2HT4C 4N8VB 3CDGA 5BCAA 2X4RB 4HFUL 1N26A 3BHBB 3T4YA 3CXDH 3PDOA 1QR1B 1MCRA 3FT3A 3EOYG 2AEWA 1RUKH 4MNQB 3UTSE 4Y5XA 3BGMA 1CIDA 1MJJB 4FFWD 3BDXA 1JMXA 4GMTH 2R0WL 4OB5H 2GJ6D 4ERSH 4F7EA 2P24A 1GYAA 2Z35A 3V6OC 3VD9A 2OR7A 1BLNA 3AVEA 3GMNB 1UB5A 1AXTH 1QD0A 1N64L 1JWUA 1MIEH 2P8LA 3N1QC 2P46B 5DJCA 1OAYL 5IMKB 5F9AC 1RVFH 2JB5L 1QLRB 2MKLC 5J1SC 4PGEA 1FNLA 3MFGB 3AXLB 4KTDH 5CSZB 4OFVA 1I3RB 4Z8FH 5IBLC 2A74A 3KYMB 4K8RD 1UZ8B 3CZJA 4ETYA 5IBUG 5DD6B 3O3AA 4Z6AT 3INUL 1AO7D 1NAKL 3SKJH 3IJYB 3QZWG 2NY7L 5KOMC 1N6UA 2D7OA 4QRRB 1WBXB 3TYGH 1T1XB 1FYTA 1U8NA 2AXHA 2XKSA 4YXLL 1QSEA 3SDXE 4UB0L 2HTKC 3MV8D 4OCRL 3MTRA 1VGKA 1U8KA 2DQGL 5JPMA 1PKQE 4G8GD 3T8XB 4DOHB 5KSUA 1U2HA 1RULL 5FCUL 2AJVL 4XPFL 3V52L 4RMRA 4LAQL 3V4VH 4Z0BL 4MXWL 4I3RH 3HHRB 4OTXL 4R0LB 2BFVH 1DLHB 3RGVA 2WM0A 3SDDC 1NLBH 4O2FB 5ESVB 1YEIL 3GSRA 3NCFB 1SQ2N 3IKCB 1I1FA 4Q97A 5IKCB 4LSUL 3CFJA 4O2EA 4ONOA 3IXTA 1RJLB 5CP7B 4Q9CA 3D48R 6FABH 2BVOB 2P8PA 5D8JL 5DMYA 4W6YB 1BVKA 2QSVA 3S4SG 1FNFA 3LKNB 4G9FB 4KQ3L 5FUZH 3SY0B 4UTAH 2VE6B 3VI3F 1U8MA 4A6YL 2FNBA 1EO5A 3V5HA 3QIWB 4MAUL 3TVMB 4XNXL 3I3BA 4JM4L 4BFBD 1CGSL 5HYQA 5CP3A 4YXHL 5D7JD 1TQBB 1HKLL 3CH1A 5HHVH 1DVFB 1I7UA 1F6AB 2DIAA 3QWOB 4JREB 1MFCL 4B0MM 2VWEE 1MEXL 2XZCH 1RJZB 5J13B 3ULUH 4R3SA 3RVVD 5DVMA 4NKOA 5DUBB 5EU5A 2NZ9D 2VMFA 2CO6B 5EC1A 1CN4A 1JCKA 5J3HD 1ZHKA 1DEEB 5I16A 5B39B 3SE9H 2D03H 1KNOB 3L5HA 4KHXL 5T5NF 3DNKA 5IG7B 2R4SL 2E6QA 1IMHC 1F3DJ 3V6OE 4M5ZH 2R4RH 2CLRB 3Q6GL 4J3XA 2CR3A 4NYLA 2VERN 1HHKB 1VFAA 1P69B 2J1KA 2AEPL 5E94B 2G9HA 4XP9L 1XR8A 1V7NH 2GUOB 1A9EA 3SKNB 3QXTA 5EBMB 5EO9B 4LSQL 4IOIA 4WI3A 4ACPA 3I6KB 3NBNA 4YFDB 3P73A 3BEWB 4XCEB 1WICA 1UCBL 1ZANL 4APQA 3RIFF 3UYPA 4KUZH 3RWHA 1B6UA 1FQ9C 1X9QA 5EA0L 4ELMA 3K46A 3QUYD 2F5BH 4JE4B 3MMEA 1KIQA 2AQ1A 2NY4B 4QO1A 2YMXH 4Y8AA 3ARGA 1MLCB 4XXCC 3FQWB 3C9NB 4RNRB 3EOBA 1KLUB 3VXTA 2GIYA 5FECB 1LGVA 1LO0H 3UZVB 3GBLA 3DRQB 3HPJA 4LU5L 5E2VL 1GZPA 1AC0A 3QIWC 3TVMC 3BZEA 2CGRL 5FM5O 5EZLB 5HGAB 1TQBC 4YBHA 4Y4FD 4RRPA 1C7SA 1JRHI 1DVFC 1FVDB 5ACZA 4Y2DA 1GPOL 2YPLE 1SYSB 2Z8RA 1N0XH 3WNKA 3DMMD 5T3ZH 4YEEA 1K3IA 5J13C 4I0PC 1NQBA 1R5IA 3W9DA 4EBQL 1SBSL 5GRJH 1ZWIB 2VXSH 4GAJH 4M7LL 2HJFB 3LKRA 3MLWL 2UY6A 4NDMA 4OKVA 2YRZA 4WI2A 4HWZA 2ADIA 2P48B 3REVA 1WAAA 1CFTA 3RWEB 3MRFB 4MNQE 3WSQH 4WHDA 3KPRD 3MRLA 3M8OL 2NXYB 3MRCB 5DQ9B 3F7YB 1U3JA 3AREA 3L5IA 1XGQB 4OLZH 5E70A 3S34L 3WS3B 4PP2B 2IANB 3QRGL 1D5IH 4N68A 4O2CA 1CFVL 3QWRD 5KVFL 1FG2B 1BQLL 3U7YH 4JFFA 4QNPF 4I5BA 5DEZA 1DE4B 1DSFL 4GSDH 3CZFB 4QTIL 3LKSA 1H3PH 1QBMH 2WWKO 1NLDH 2AQ2A 1MQKH 3SEPA 1XMWA 2NY4C 3BT2L 4JG0L 4L8CB 1F45A 4K2UL 4UT9H 3MV11 4PG9B 5DWUH 4QRRE 3GMRB 5ID1B 5TDPB 1ZEAH 5ANMB 4JFOA 5DQDH 2VH5H 1FAKT 5IB2B 2FEEL 3CUPA 3TO4B 1NUNB 3CPLB 1AD9A 2QBWA 5EUOB 3CMOL 4I77L 5E8PA 4DOHE 1B2WH 4MAYD 4GBXD 1XGTB 2V2WB 1AGFA 4HEME 3KPLB 4PV9B 4H8WH 5J0BA 1TCMA 2PW2B 3KPQA 3UJTL 2WQRA 2VO5A 2BSRB 3HCVA 4JO1H 5MI0C 1KYOK 3FB5A 4RGOH 4HS6A 35C8H 4M5YH 2BVQA 1CGXA 2Z92B 1KN4L 1UA6L 4OAWA 2X10A 2JJWA 3C8KA 1ERNA 4CMMB 4Q58C 3X3FH 1N6QL 4M6NH 5E6IB 2JELL 1NEZB 2GYSA 3BX7C 4G9FE 5KZCD 3P4NB 3UEZA 1KJ2B 1QUNA 4FN0A 4Y5VA 3QEQB 1O7VA 1A6ZB 2NXYC 2B4CL 3A6BL 3GMPA 4OFDA 1KXVC 4JQIH 1FBIL 4OCXL 3MNVB 1SHMA 4AK1A 1LO2H 5KSBF 2KZ1B 3RIAK 4HC1A 1LNUA 4HKXA 3SGJC 2MHAA 1JI2A 4PB9H 2DMKA 4PJIB 5E99H 5IBLD 4EDWH 3QDMB 2WBJB 3STLB 2EC9U 5ABDE 4H1LG 4EUPG 4XB7A 3GKWL 1CT8A 3E6FB 3ARFB 4KRLB 5DHVB 3EYSL 3QUKB 1YYMH 4XMLH 3KXFE 4Z5RA 2B1AH 4YDIL 2DQJH 4PRNB 4IM8A 1IZKA 5IW6A 5F1NB 3E0GA 4UQ2B 1JPFB 1QNZL 1EMTH 1NAMA 1WFNA 1K5NA 5C07A 5IF0B 4I2XA 4R2GB 4MSWB 1U91B 5FF6A 3TO4C 3PGFH 4JN1L 3U36A 2YC1A 4WJ5A 1EXUA 1GGTA 4N8CL 1DBAH 1ZVHA 1VB9A 2AV1A 3U4BH 2YPLD 4L3EB 3GSVA 5GGSY 3U48A 5GS2D 4NRXA 2ARJQ 3QA3B 2BY2A 3RWJB 2R23A 4XPGH 1GC1H 3IXAB 4WW2A 2UWEB 2HFGH 3LD8B 3QCTH 4FP8H 5KG9A 4LGPB 2FX7H 1U92A 3RL2A 2VQ1A 2EKJA 5HYJA 1PY9A 3IVKB 4GRLA 4AH2B 4LKCA 5EC2A 3FCTA 5E6IC 4JRYD 5I19H 1XZ0A 4QXTB 2RCSL 3RTQB 1UZ6F 4Q9QL 1F5WA 2PXYB 4G6ML 4N5UA 4XNQA 1GGIL 5DJXB 2IQAA 2OJEB 2FYYB 4MMZC 3EJYC 1CDYA 1MPAH 2IH1B 4LLUB 5HGBB 4P48A 3DVGB 2PR4H 1E27A 4KGLA 3TCXA 4P2QE 1ULVA 1P4LB 3HKFA 4FQJH 2WBJC 4GXVH 2BJMH 1MNUL 1J1XH 3TC9A 1QHOA 4OSUL 4LRNL 4RMSA 3RHWK 1U8JB 4HUXB 3TBWB 1ZT7B 2YA1A 2XOTA 1JWSB 2OXHA 3SGEI 1KEGH 5C0BA 1NFDE 1UH4A 4N90E 1BJ8A 3ZHKA 3NFNB 1HSBA 5IB4A 3MLSL 4NNXB 3LIZH 3QIUA 4CN4A 3FAWA 2IAMB 5ERWB 2J6EA 1JHKH 2YN3A 1TNMA 4R2GC 5FHAL 4MD4B 2FR4A 5FYJL 2OL3B 2R2EB 4GW4A 4G8EB 1AGCB 4S1QL 4WRLA 3OX8B 4HIEA 3T0AA 3TO2B 3VD3A 3CAFA 7FABL 2V2TB 2BHZA 3ECBB 3W11C 4JGMA 3ELAT 2KZWA 1T22A 4RZCA 5TQ0L 1JPSH 2VLKA 2FATH 1VACA 2IANE 4NQDB 2WNGA 4RAUB 4JM2F 3MXWH 2RFXA 1LP9F 2W9EH 1X5LA 4NCC2 3LD8C 3WIFA 4IRJA 3CX5K 1A9BA 1Y0LA 4OI8A 4K7FA 5GS0L 4NBYB 1OGTB 2BNRB 4F7CB 1XCTB 4Y4HB 1XFPA 5CZXC 4MA3A 1VFBA 1QG3A 3RTQC 4QRPB 4FQ1L 3J7HA 4M7JL 3MNWB 1WWAX 3ESVF 2NY6C 3TVMD 3UTZA 5ANME 1HXMB 2ZUXA 1PEWA 5ENWA 3SDYH 3B9KB 3E3QC 5LVEA 2WW8A 2ORBH 4AZ8A 2FB4L 3QUMH 4OZGB 5DD5L 4S1RH 4RMUA 4OT1H 1R0AL 2APFA 5BRZB 1XF4A 1IKNA 4FHBD 3VFGH 2PYEB 2CK0L 4I0PD 4ZTOL 3SCMA 4EOWL 1BIIB 3WFEH 3OAUL 4O02L 4GAFB 3MRQB 1HQ4B 3MRMB 3OB0H 4D0DA 4GO6B 4HFUH 4YPJA 5DZOA 4E42A 4M3KB 4LLVA 4L4JA 4JPIB 2XPGA 4PPTA 3RZCD 1U6AL 3LH2L 5HHMD 2IAMC 2GSIB 3LPGA 1E28B 4FTVD 3P77A 3OF6A 2R0WH 2VYRE 3VDBA 4QHLB 1S7SB 3HN3A 3FB7B 1LEGB 3FHAA 3QEQE 4YIQA 4I3GA 2ATPA 3CXHK 4HWUA 2VR5A 5GGVL 4PJFF 3CDGB 5EB9A 3T4YB 5DMIL 2BRRL 1OAYH 3EIFA 4LDEB 3PDOB 1IC7L 4TUKH 3RGHA 3ZDXF 2JB5H 3FT3B 4PJIE 1KLGA 3VGEA 3G5XA 1OSPL 4R97B 3QDME 2H2SC 3DPBA 4OLVL 2Z35B 1BLNB 1KSRA 2I9LA 4KROD 1UB5B 2NY4D 4KV5E 3D85A 4HX1A 1KEML 5HPOA 3JV6B 3INUH 2P8LB 1JWUB 1NAKH 1P1ZB 4MA1B 4Y4HC 5DJCB 1IM9A 1G1YA 2NY7H 3IU4L 3VI4E 5F44A 1K85A 2Z4QA 1AJ7L 5FOBB 4PGEB 1MFDL 2QSTA 4P23A 2VDML 5J1AA 3T4AA 4YXLH 4HKBA 4UB0H 4OCRH 3ARZA 3O3AB 1PY4A 4MD5A 2DQGH 3B9KC 4PJXF 4P4KD 5FYJE 3GSNL 3WS6C 1P6FA 5I15H 1RULH 5FCUH 1RUPL 2AJVH 4XPFH 5K93A 1D6EB 3V52H 2FRGP 4LAQH 3VFNB 4Z0BH 3EFDL 4MXWH 4OTXH 1FZOA 4QOKB 1ZS8A 1U8NB 4N90D 5F9JB 1GZQB 4MCYA 3HC0A 1VGKB 1YEIH 1U8KB 3VXMA 2QQKL 5JPMB 4LSUH 4UIKL 3NZ8A 2DLIA 5KSUB 2GSGB 2AJYL 1YPZA 5D8JH 2XV6B 4KQ3H 4OF3A 3GMQA 1TJIL 4CADA 3CLEL 3RGVB 3OR6B 3QQ9D 1PX3A 1CF8L 3GSRB 1I1FB 4QGTA 4FMKA 1V3MA 4WI6A 2DJUA 3BZ4A 4A6YH 2GITA 3HZKA 1XH3A 2DM4A 4O2EB 4XNXH 3IXTB 1CGSH 2DKSA 4PGJA 1JNJA 1BVKB 3DLQR 1HKLH 4H20L 3IDMA 1L6XA 3S97C 2XT1B 5ESQA 1B6DA 1MFCH 2NR6C 3WNOA 2RAMA 4P5TB 4HCRA 1M6OA 1MEXH 1U8MB 2K7QA 3TZVA 3V5HB 4MA1C 4B41A 4KQ4L 2C9AA 2BDNL 1KCSL 2FJHA 3CH1B 5D6DC 3WIIL 1T89A 4KHXH 3TO4D 1I7UB 1FG9C 4HG4J 4M6OL 1FN4A 1KC5L 2HJLA 2EE6A 2R4SH 4OCYL 4UT6L 4X6DB 5E56A 4ZXBA 3T2NL 4R3SB 3Q6GH 5HYSB 3BFOA 5EU5B 4DUXA 2AEPH 5EC1B 3ZLQC 4XP9H 1ZHKB 3FO9B 3ULVF 5I16B 1P7QA 4UU9A 1KB9K 4NQDE 3C2SA 4LSQH 1ED3A 4CNIA 4BUGA 3QR2A 1CYGA 2RHEA 4OQ1A 3E6HA 1AI1L 1UCBH 4Z7UB 1ZANH 4U3HA 3NFPB 4NYLB 2DF3A 1ETZA 3VFPA 5EA0H 1VFAB 4HS3A 5E6ID 2G9HB 4BH7A 1XR8B 2BNRE 4HJ0C 5TJWK 1A1NA 5DRWA 1A9EB 4JRXA 2BY0A 3VD5A 4IOIB 3LSOB 2Y4SA 4QRPE 3TPUA 2APVA 3P73B 2FGWL 4MQ7A 3RGVC 3P3YA 4X5WA 4HKZA 4APQB 2NY0B 3DSFL 4LU5H 4UIMA 3GJEA 5E2VH 5HI3D 2OZ4A 3RWHB 4ELMB 4PGDB 1CICA 3HAEH 2CGRH 3MMEB 1ZHNA 1BF8A 1KIQB 4FQ2L 5C0GA 2WBJD 4OZGE 1AE6L 3K81A 1MHPL 1YEGL 3D6GA 4OZHF 1MCHA 4L9LB 3DX9A 5BRZE 3BI9X 3EOBB 1GPOH 2PYEE 4P5TC 5GRZA 5FHBL 3HPJB 1T7WA 3VRIA 3VGHA 5DMJB 3RKDD 1GZPB 3VXSD 4JFHE 3BZEB 2QQQA 4EBQH 1SBSH 5CS7A 5BS0A 3EO1A 3K0WA 1F11A 4M7LH 4G9DA 3MLWH 1YYLL 1J9CT 2F54B 5IMOA 3PXHA 5D7LA 5I8OL 4XXDA 4AY0A 1WK0A 5FGCE 5ACZB 4Y2DB 1E4XI 2PO6A 2WP3O 3WJJA 3KPSD 5IP4A 2BVTA 3OGCB 3MREB 4J4PA 3JSSA 1IAKA 3M8OH 1AH1A 3ETBF 1R5IB 4L3ED 3W9DB 4J6RL 3S34H 1ITCA 1MH5A 3LKRB 3QRGH 3WE6A 4NDMB 3CU1A 1I8IB 1MRCL 3ZE1E 4HWZB 2ADIB 4U6VL 1CFVH 1OTTC 5KVFH 3REVB 3G6JF 1BQLH 1CFTB 2EDHA 3JV5A 4LPCA 2BP3A 4PJCA 5DVLA 1KFAL 3MRLB 3T77B 2EDDA 5CMAA 4LPTA 1DSFH 4PTUB 4YJZL 4QTIH 5CZXD 4GMSL 4GKSA 3DUUB 5F21B 4PJAF 3RTQD 1GOGA 5L9DL 4N8VG 3BT2H 3NACH 4JG0H 4O2CB 2CDFB 1ZVYA 3KDMA 4K2UH 2NY6D 1QFUL 4YZFE 3G6DL 1T66D 2X1OA 4JFFB 4QHUA 2MPAL 4JY4A 1X4YA 5F97E 4APQC 4TRPL 2NY0C 2MFNA 1I75A 3RFZC 3LKSB 5CZKA 2MJWA 3X11B 2ED7A 3ORJA 3O8XC 1CDHA 3CMOH 4I77H 4KFZC 5L7XL 1YNTA 4L9LC 3MRNB 1JTOA 3WKML 4XVUC 3RVXD 2R1WA 3WNPA 4GW5B 3UJTH 1FYTE 1QSEE 3CUPB 4PRAA 1CGVA 1TQCB 3CDCA 5M94B 3SKMA 3RUGB 1W72A 2VDKL 3SOBL 1KN4H 1UA6H 4WFGE 5E8PB 3O6LL 4XAWL 3FN9A 4HIXL 4UMGA 1LO3L 2V5YA 2H9GA 2NZIA 5T3XE 1N6QH 5DK3A 1AGFB 4Y2DC 1HH6A 3F6IA 2JELH 1AR1C 3KPQB 3SKUD 4I9WE 5C0NC 2B4CH 3A6BH 3X12A 3VRJB 3FB5B 4HS6B 5F70A 1FBIH 4OCXH 2BVQB 3KPOA 2M2DA 3C8KB 5DR5L 4MX7A 2QADC 2AW2A 3G9AB 3WHE1 3U4EA 1KLFA 3CIQA 2WSKA 4UILL 4Y5VB 1NKRA 3GKWH 1NUFA 1WFTA 3MSPA 4IRZL 4L8SB 3AY4A 3GMPB 1XF5A 2IWGA 1GCFA 4Y4HD 3EYSH 1K4CA 1ZGLM 4KAQH 4HKXB 2MHAB 4YDIH 4YC2B 3D3VA 5E5UB 4PFEA 5FUOH 5E9DB 1QNZH 4N0YL 2VKWA 1QP1A 1DBML 4AQ1B 3F12A 4ZUWB 4KWUA 3RVUC 3BE1L 4JN1H 1N3NA 4JN2A 2GI7A 4N8CH 4PRBA 1HK6A 2L7UA 1QBBA 5I1KL 2HFEA 4Z5RB 2P45B 1KACB 3HG1D 3HZMA 4IOFC 2Q7YA 1YJDL 4XMKL 1WCBA 4YUEL 4G6JL 1NCCL 2KUTA 4M6AA 1NAMB 3O3UN 1K5NB 5DS8A 5C07B 2ZKHL 1F2XK 2VUYA 3PWPA 4S1SL 2VOTA 3B9EA 2YC1B 1TQCC 3HE6D 2BNQA 4WJ5B 3U36B 5ITFA 4PS4L 1EXUB 5E8OA 1UH3A 2N7BA 4GRWB 4PG2C 5DF0A 4LHQB 1EBPA 2AV1B 3O6ML 3QDJA 4X7DC 5KVDL 1T21A 2RCSH 3P0VL 4Q9QH 2YPKA 3AROA 2FLBT 1N8ZA 1NMCB 1XCQB 4G6MH 5CD5C 4MS8C 1RUAH 1FO0B 2IQ9H 4MA8L 1GGIH 5MEOB 3B3IA 3I3EA 1JV5A 1BQUA 2ZCHL 1U92B 3RL2B 2VQ1B 4ELME 2JJTC 4GRLB 4L29B 1FE8L 4LKCB 2VZTA 5EG6C 1HWHB 5INCB 5JOPE 3VFMA 1O7SA 2NR6D 4KMQA 4E5XB 3LB6C 1DUYA 3BMWA 1MNUH 3B2VL 2YOCA 4Y5VC 5I2IA 4XNQB 4TOYH 4OSUH 4L8SC 4LRNH 1DQLL 2DICA 2IQAB 5IEKA 3JXAA 3QSKB 1G7JA 2MTPA 4MWFA 4YC2C 2LE9A 1P4IL 4PRIA 5HDBE 4DKEL 1E27B 3BYYA 3MLSH 4I4WA 2GK0A 4PRPA 5ALCL 3U2SA 4M93B 5LCVL 3W5NA 4WNQA 1LDSA 3KPNA 2AXGB 3H0TA 1UQSA 3F7VA 5FHAH 3SE8L 5FYJH 3VMPA 1WBYA 5EPMA 4NO3A 1TFHA 4PRDA 4S1QH 3HRZA 2FHBA 2C1PA 3RI5K 4MJID 7FABH 5M95B 2DL2A 3ARTA 1HSBB 2G5BB 1LMKA 2OMBA 5TQ0H 4QOKD 5IB4B 3KJ6L 2ED9A 3QIUB 2AJUL 3H3BC 4U6HA 3M1BA 3BW9A 2XTJB 1WAAE 2FR4B 4GW4B 1FNSL 5T33L 3SJVA 4QXGH 5GS0H 1GXEA 1G9ML 3H9YA 5AZ2L 4RZCB 2VLKB 1BX2A 1FGNL 2X4TA 4I9WD 3RGVD 3RWGA 3ABZA 1C16A 3W9EB 4FQ1H 1NMCC 4M7JH 2EE2A 3HNTL 1JGVL 1F3JB 2IMMA 5LQBL 1I1AA 4JFFE 5T1DL 4D9LL 3M45A 3WIFB 4IRJB 1A9BB 1T7VA 1Y0LB 3MUGA 5D2NA 2B2XL 3I6GB 3WO4B 1S7UA 1GH7A 3RJQB 2FB4H 2J12B 4GRLC 5DD5H 4FA8A 2ZCLL 4MA3B 1VFBB 4U3XA 1R0AH 1EHXA 5KVGL 4N1HB 4P5TD 3BUYA 5GGRA 1T3FB 3NCYS 4PLOB 2CK0H 4ZTOH 4EOWH 3UTZB 3GIVB 3OAUH 1OY3B 4O02H 3VMOA 5ENWB 5CGYC 1UC6A 2OLDA 4HLZH 5C9KA 1PEZA 1T04A 1RJYA 1J8KA 4G7YL 3RUGE 8CGTA 1OQXA 5T1LA 1EIBA 2X4PB 2SEBA 2WUCL 4M93C 1XF4B 1U6AH 3LH2H 4M1CC 4K07A 1BREA 2JJSC 3KYOA 3SCMB 2QLVB 4LQFL 3QEUA 2GY7B 5GJSL 2O26U 4P3DA 4EN3A 4KZEL 4Q2ZA 4XGZA 5GGVH 4D0DB 5C0JA 5BOZG 4U1NA 2HTLC 5INDB 3RKPA 4D9RE 1Z6JT 4LLVB 2BRRH 5DMIH 1IC7H 2XPGB 3QIUC 2DDQL 4YFLI 3EYQD 5HXMA 2YRLA 4EDXA 5CFHA 3S5LA 5C0EA 2XTJC 3K1DA 1Z0MA 1OSPH 4QHMA 3U0WL 1BD2B 4NZUL 4OLVH 5JHDD 3MFFA 4P2RD 1P7KB 3JWOC 4ZFZA 2ATPB 3IDXH 1ZT1A 2WQ8A 1YNKL 1FFRA 3IU4H 3W5MA 3FB6B 1AJ7H 1KLGB 2P42B 5GRWA 1N0LA 1MFDH 3G5XB 1B0RB 3U7AA 1M7IA 2CRIA 4OFYA 3QO0A 5DJ2B 5HY9A 1NEZG 4IRJC 5E8NA 3LS5L 3O8XD 2I9LB 1T6VN 3D85B 3WO4C 1P53A 1WBZA 4HX1B 1VEMA 4P49A 3VRLF 3VFSA 3U1SH 3GSNH 2FECI 1RUPH 2Z4QB 2H41A 2X40A 1KXTB 3GMOA 1IC4L 2AQ3A 3EFDH 4JZNB 3ILPA 4P23B 4K23L 1OAZL 3Q5TA 4YLQT 3T4AB 5J1AB 5JOFA 5C07E 4HKBB 3KGRA 4I2XE 4OGYL 5F72S 4N8PA 2DTML 2NCMA 2OX5A 4MD5B 3QAZB 2F54D 2QQKH 1IAIL 1E6OL 3HC4L 4LP5A 3IYLW 2X2YA 1CDBA 5MERA 3BDBA 4Y2DD 1MAML 2AJYH 3CDYA 1AR1D 2FJGA 4JY5L 1XGUA 1IKNC 1OL0A 2H32A 5AG9A 1FZOB 5C0ND 3SCMC 1MRFL 1CTNA 4OZFG 2CKBA 2FIKA 4BK4A 3RWIB 3CLEH 1BECA 4MCYB 1H3VA 1CF8H 3HC0B 4H1LH 4N0CC 4EUPH 1SJEA 4Q74A 1MY7A 3VXMB 3TBTA 3CMGA 3NZ8B 2J8UA 1PYWA 1UWXK 2V5MA 2QADD 4FFZL 5HYJE 1YPZB 4FZ8L 1YY8A 5ESAA 1AFVL 4H20H 1EAJA 3GMQB 1X5KA 1SJHB 4CADB 1YN7A 2A6JA 5JA9A 3SE3C 1KCUL 2VLRD 4XAKE 3QH3A 2XACC 2F8XC 3BZ4B 2Z31A 3IDUA 3QI9A 3HZKB 1E4XL 1XH3B 3CVHL 5C0AA 4Y19B 5DC0A 5GSVA 4CU6A 4KQ4H 1W0VA 2BDNH 1KCSH 4NRYA 3DX6A 4XNZB 4F9LA 3WIIH 4AEFA 3MYJA 3RVUD 3IDMB 4MJ2A 5ESQB 4Z9KB 2H8PA 4M6OH 1KC5H 4OCYH 3WMSA 4UT6H 1HDMA 4OUUA 3T2NH 1EJ6A 4IOFD 3TZVB 5HJ3A 4N9OB 3SPVA 1MCNA 5C0BE 1R5WA 3Q1SL 3BD4A 5GGQL 5D9SB 4N0FA 4KUCF 1BQSA 2FJHB 3WFZA 5IMMA 4P23C 3S37X 2A38A 5L0QB 2D9CA 3IDIB 3V4PL 1B0GA 3NIFE 4AYFA 4POZC 1AI1H 1FN4B 2HJLB 4J3VA 4PV8B 4ZXBB 1RZIA 3QAZC 2GQHA 2HKFL 4M8QA 1YEEL 3EYVA 4U7MA 3S36L 5DJ0A 1SVCP 2AAVA 1RZ8A 1F02I 2YD4A 3O3DA 4XVJL 5D71L 3GNML 3V6ZA 3S9DB 3O2DH 4TTGA 3NABL 2VLKE 1P7QB 4UU9B 2MKWA 2R1YA 4ZMAT 1L4IA 4MS8D 2VISA 1ED3B 3AS0A 5C6WH 2W0LA 3RJDA 3E6HB 4X4XA 1KV3A 3DSFH 3SBWC 3WFCL 1VEOA 1U93B 1ETZB 3VFPB 5IQ9B 4HS3B 4BH7B 3GI8L 4FQ2H 4KDTA 3LB6D 3OHXA 4HIHA 4R7NA 5DRWB 1AE6H 5K59F 4JRXB 3TLRA 1MHPH 1YEGH 3A6CL 1A2YA 1U41A 3C60B 1CFBA 2ICWA 3TPUB 5IHLB 1MQ8A 2CIKA 2VLMD 4MQ7B 2V7NA 4X5WB 4MDIA 5FHBH 3BN9C 1PAMA 3RIFK 2OR9H 4UIMB 3GJEB 1ORSA 5E9DD 3NOIA 5I8EA 1T5XA 5C0GB 3DUSA 4DEPB 1YYLH 2QL1A 1P7HL 4XNZC 5C08A 4BQ6A 3EOTL 5I8OH 1Z9LA 3S35X 5FO9A 1KB5L 3FN0L 3DX9B 4QCIB 4HBCL 3HE7A 1BVLA 1CQKA 4IEFB 5JIKA 3VRIB 2VLJA 4LL9A 3TZVC 3DO7A 3NCMA 4GLRI 4J6RH 5EN2A 4F7PB 3EO1B 5DQJA 4AM0B 3SDCA 1F11B 1C5BL 4YHLL 1IAOA 4CAGA 5C07D 3T2PA 5IMOB 5D7LB 1MRCH 2NLJA 4U6VH 1MAJA 4B50A 3I75B 5L0QC 4AT6B 4JDZA 5FM8A 5AYQA 3OKKA 4FRWA 4ZXBC 2C3HA 1HILA 1Z3GL 1IAKB 5E03A 4X4ZA 1R3IL 3NZHL 4H25B 2R8SL 1SEBB 4GMSH 5DK0A 4YHIA 4ODWA 1KJVA 5BV7B 1MH5B 3TCLA 5L9DH 1U9KA 3VCLA 3IDGA 2C4XA 4DVRL 3BKML 2X1QA 1QFUH 5DVKA 3H42L 3G6DH 2B39A 4PJCB 2MPAH 2WZPD 3MJ6A 5JIHA 1HYSC 2VDRH 4TRPH 1TTUA 5CMAB 5C7XL 4U0QB 4KK6D 5C0CD 4L4TA 3MLPA 4KJYA 2UY7A 4LHUA 1AQKL 1D5ZA 3UTQA 4HUUB 4GKZA 3T3ME 5BMFL 1INEL 4XAKD 1C08A 2DLHA 3C60C 3EO0B 3WKMH 3NGBB 3MACL 5CGYD 3VMNA 5CCKL 2CUIA 3DARA 3T3PE 4QF1A 4N1CA 5SWSB 4YBQC 2CLZB 1FH5L 3CFEA 4KI5C 5F7MC 3KG5A 4G6KL 2VDKH 4HZAA 2ZUTA 3SOBH 1JK8A 4LPUA 4M1CD 3O6LH 4XAWH 5C8JA 4HIXH 1LO3H 1G6RL 3G6AA 3FHQA 1YNTB 4NC0B 4F9PA 2R1WB 4Y89A 1SYVA 5I8CA 2C26A 4Z7VA 1J0JA 4PRAB 2HTLD 3C6SB 4D2NA 2ZOKA 15C8L 3VXME 1JL8A 3SKMB 4ODVL 1W72B 2FO4A 3T0VA 2D7MA 1BJMA 3ZDYF 2XTJD 3QXDA 5DR5H 2H9GB 5ALBL 1PQZB 1YPZE 4P9HC 3SGEH 3FTGA 3MRKB 3WJJC 3HI5L 4UILH 1IGFL 1I9IL 5CD3A 1G9EA 4IRZH 4RGNB 4ZFOB 3PG2A 3X12B 1N6VA 5DJDA 3KPOB 3GSUB 5BV7C 4P59L 2A6IA 4C55A 3WV0A 2XG5A 3LS4L 4MX7B 4NHUA 4OLXL 1TNNA 4U1LA 3HI1B 3U4EB 4PJ9A 4N0YH 1DBMH 2CXGA 3BE1H 1XF5B 2EXYD 4RMTA 1OLLA 2H26A 1GOHA 1K4CB 4GS7B 5I1KH 3UC0L 3D3VB 5B3JE 1YJDH 4XMKH 3K7UA 4YUEH 4G6JH 2EXWD 4HWBL 4HXAL 4Z7QE 1NC4A 3VGBA 1NCCH 3NGBC 1LEIA 2GK2A 1X6LA 3S8WA 3OTTA 3F12B 2ZKHH 1OGAA 4I13B 3P4MB 2PCPA 4LMQI 1IBGH 4NRZA 4S1SH 1MHHA 1I3GL 4PS4H 4PRBB 5HHOA 1A6PA 3HB3D 5GIRA 4PJ7A 3O6MH 3P4OA 2HFEB 3HZMB 2H6PA 2Q7YB 1LD9B 1NANH 1WCBB 2X89D 4K3JL 5KVDH 5IMLA 4N0CD 5DS8B 4YDJA 5FOJA 3NIGF 4MA8H 2A2QT 3PWPB 2UZIL 4JKMA 2BNQB 4NWUL 3W39B 1YUHB 2ZCHH 3CSPA 5FDWA 1I8MA 4BUHA 2MQCA 3QDJB 3CFCL 5HYSG 2Z9TA 1FE8H 1BD2D 1T21B 4JRXE 1HI6A 3VXNB 2YPKB 3W0WA 2EH8L 3D2UA 2X4UA 1N8ZB 3B2VH 1CGWA 5CKAA 2HMIC 1UM4L 4C83A 3D25A 4KGJA 3TESA 4RGNC 3H9SA 1DQLH 1JV5B 2Q3ZA 3C08L 1ZV5A 3HR5A 3KYKL 3O6KL 4I8DA 4J23A 1OWRM 1RZJL 3NMEA 3ZZ1A 1P4IH 3VFMB 1HH9B 4EIZC 5ALCH 4OF7A 3LQAC 1DUYB 1NSNL 4UAOB 5I2IB 3SE8H 2PTVA 3AY4C 2YUWA 1FFOA 1EJOL 4L9DA 3VXOA 3MV9A 1G7JB 4GS7C 4MWFB 1JP5A 4KK8C 3CK0L 5BS0E 5C71A 3UROR 2E9BA 4HD9A 3KJ6H 1Q1JL 4I4WB 4PP1C 4MLSA 2GK0B 5D7LE 3D18A 4WNQB 3KPNB 3ZE2E 1HCVA 3F7VB 3MJ9L 1A7NL 1AHWA 1WBYB 2C4FU 5EPMB 4PRDB 1FNSH 1WWBX 3HRZB 5T33H 2C1PB 3MGAA 4U1MA 1GHFL 3MLYH 1G6VK 1G9MH 1TCRA 5AZ2H 3PHSA 4F8TA 4NQEA 3OWEA 1JNHA 1FGNH 3MC0A 5F9DC 1IRAY 3FQTA 3BW9B 3M1BB 4Y0GA 3HNTH 2IPKA 1JGVH 2ITCA 4UV4H 3RP1A 5LQBH 5T1DH 4PJCE 4D9LH 5MHSD 3PWNA 2XKUA 1K9TA 4RAHA 2P5EA 4ZO9A 2DIBA 4WU5A 3SJVB 5IW1A 5C2BH 3QCUL 2B2XH 3KPMA 1FZKA 3R4DA 4JO2L 3M07A 4UUJA 5HSFA 2KBGA 1BX2B 4DVBA 5JIIA 2ZCLH 2X4TB 2C3VB 5KVGH 3RWGB 1C16B 1IKFL 3VFUA 5L2KA 1OOAA 2JLLA 4Y19D 1FIEA 5SWSE 5D2NB 4LSRL 3LN9A 1MFNA 4NKDA 4G7YH 1NFIB 4C56A 2UUDK 4HUMB 2WUCH 2ZCKL 3BUYB 5GGRB 2P7TA 3NCJL 5F3HB 3TZVD 2ZUQB 5J4MA 5E2WH 4LQFH 4DUVA 1OD9A 5GJSH 2P5WA 2V7HA 4P4RA 4KZEH 1GL4B 1F4YL 1Q94A 1T20A 1T04B 5D70L 3FO0L 2YA0A 4AMKL 4PGBA 4PRHA 4S2SA 5JMOC 3PQYD 2SEBB 2DDQH 2EYTA 3C6LA 1BFSA 1I9EA 4CMHB 5HI5C 3AU1A 2APBA 3DVNB 4XMPL 1PW3A 3U0WH 4NZUH 3QEUB 4OCLC 1BJ1H 4WENB 4IBLT 3G5ZA 3VH8A 4EN3B 4WI4A 4Q2ZB 4RGNE 4XGZB 1JF1A 5C0JB 4U1NB 4UBDC 3V5DA 1PKOA 3FONA 5EU6B 1YNKH 4H0IA 2Y72A 5C9JA 1JYWA 3S5LB 5C0EB 1HYSD 4V1DA 3O6FD 1F58L 4QHMB 5IVXF 3MFFB 2YS4A 1D9KC 4JM2A 3WFHA 1TZHA 3OJMB 4ZFZB 1CI5A 4OLUL 2NQCA 2CIIA 2F5AL 3IU3A 3C60D 4OJFL 4R90L 3D3VE 3T0XA 1IC4H 4HULB 1IEBB 5IJVA 1M7IB 3AAZA 4K23H 2Z91B 2NPLX 2BSTA 2YR3A 3QO0B 4KI5D 2FHCA 4FFVC 5HY9B 4OGYH 5HPMA 4TUJA 5E2TH 2DTMH 5D2NC 3BDYL 4WHCA 4POUB 4YO0A 1FSKC 5LKNA 3H3PL 2O5ZL 1IAIH 1E6OH 3HC4H 4PJGF 3REWB 2QJDA 3VFSB 1MAMH 1UKTA 5FDYA 4F37F 1I8LA 2XZAL 2FZ3A 3SDXF 5D1QA 4JY5H 3GMOB 1UCTA 3HI6L 3ILPB 2W9DL 1MRFH 2ZUQC 4JQVC 5JOFB 3L7FB 1HSAA 4PY7A 1CLYL 3AMKA 4MJ5A 5H37H 3PWPE 2AABL 1J7VR 2BNQE 4WW1A 3OMZA 1IGML 5EFIA 3QDJE 4FZ8H 2FJGB 1XGUB 4CMHC 2H32B 2CDGA 1AFVH 3TA3B 4JHZA 4BJLA 3QEHA 5EZJA 2CKBB 2FIKB 1X5XA 5ICXA 1KCUH 1SJEB 1QSFA 3TBTB 1ZLUH 2J8UB 1E4XH 1PYWB 1EEUA 1QLFB 3CVHH 1QRND 1Q0YH 4JPVL 5I1AA 3WHE0 1YY8B 5ESAB 4EQ3A 4NQCD 4KRNA 3G04A 2QSCL 1EZVX 4MJ4A 2A6JB 5SWQA 1ZLVK 2I25N 3F7RA 3QH3B 2XQYG 4FFYL 3QI9B 3AS1A 3R06B 2EDFA 3Q1SH 5GZNC 4YGVA 5GSVB 5GGQH 1T2QH 1W0VB 3QFDB 2FDBP 2IPUG 4PRIE 3JWNC 4QRUA 4ORZC 3UMTA 4PRPE 5DHYA 3MYJB 5SWSD 4S0TD 1KYOJ 1ORQB 2H8PB 3V4PH 4RFOL 1HOCA 4QHNA 4LCWA 1HDMB 4OUUB 1KCVL 1QFHA 2YSSA 1YEEH 5HJ3B 4NZTL 3S36H 5D7SL 4YR6A 5CGTA 1R5WB 4ZFGL 4JFZL 1WZKA 4XVJH 5D71H 3EYOA 4N0FB 3GNMH 4PJXA 3NABH 5I1EL 5A40E 5IMMB 2NTFA 5DZNA 4X98A 1QFWI 1RZIB 5KS9F 1GGUA 3WFCH 4M8QB 5LGKA 3EYVB 3SJVE 4QRSB 3VFVB 3F62A 2JB6A 2OQJA 5DJ0B 4NO2A 1RZ8B 3O3DB 3GI8H 4MA7L 3MRPA 4BSVA 2EH7L 3QNXA 2V5SA 2IPTH 2R1YB 1KPRA 2VISB 3QPQC 3A6CH 5D5MA 3TA3C 3WUWA 1Z9SA 3BH8A 2BOCB 3ULVD 1DZBA 2GCYA 3MGTB 4X4XB 3TN0A 3EHBC 1LO4L 5FYKD 5D2NE 3S88L 5F7EL 4ELKA 1OLZA 4R7NB 3L7EA 1UM5L 1X3DA 3EOAA 3EOTH 2Q20A 1KB5H 1A2YB 2ICWB 4YHNA 4HBCH 5LG1A 2DYPA 2V7NB 4M48L 4P2OD 3WIHH 1G7LA 2R1XA 4W4OC 3V2AR 3EDFA 4KK8D 2AV7A 3QI9C 4HPYL 2ERJB 5CEZD 1ORSB 5I30L 3OXSA 1T5XB 1RIHL 3ZKNC 1RD6A 4U05A 5KAQG 1C5BH 5D6CA 1RZGA 5C08B 4F9LC 3BIAX 1BJ1J 3SDAA 5FO9B 3HE7B 1B4JL 1BVLB 1TVDA 4O51B 3SGKA 4DGYL 1ZKAA 1Z3GH 2X6MA 2VLJB 2NW3A 4B5EA 5D1XA 1R3IH 3NZHH 2R8SH 3PNWA 5EN2B 3HMWL 5DQJB 3GSQA 4KTEL 2NLJB 4DVRH 1T4KA 3BKMH 4XPHL 2X05A 3H42H 3I6LD 4BZ1L 1A7RL 5I75C 4JDZB 1BAFL 4ZS7L 1HILB 1NDGA 5C7XH 1AXSA 1I1RA 1YMHA 2HLFD 3LMJL 1IM3A 4YHIB 1QEWA 4ODWB 5DRNA 1KJVB 3TCLB 1CD0A 2MWCA 3QQ4B 1TLKA 4F7MA 4DQOL 5BMFH 1INEH 2EDEA 4K71B 1WT5A 1XIWA 2P8MB 3MACH 2JIXD 1NUGA 4XT1C 5CCKH 3QJHA 1JGEA 1GJIA 2BSED 1A6AA 3F7PC 1FH5H 5LGJA 4W81A 2E7BA 4G6KH 4L4TB 5BW7A 4OF0A 2O61B 2OMNA 2VAAA 4GKZB 3DI2B 3H3KA 1G6RH 2D0GA 5ELIA 1C08B 4YPGB 5EUKA 2R9HC 2LVEA 1EVUA 4QF1B 3QUMA 1UADC 4OZHA 4HMDA 1OP3K 1BFVL 3GUTA 3PWUA 3FRPG 2ERJC 4WO4A 15C8H 2BY1A 4ODVH 2ICCA 3FQRA 5HI5D 3TFKC 5C8JB 4ZUVA 3G6AB 5ALBH 3ZE0E 4YHYC 1VENA 3CX5J 1SYVB 5I8CB 3HI5H 4KRPD 4Z7VB 1IGFH 4U1GB 5C09D 1I9IH 5I71B 5FGRA 3BSZL 3NPSC 4Z0XB 4HK0B 4OCNC 4TSBL 2ZOKB 3KNBA 2J8UE 2FO4B 2Y9RT 4P59H 3QXDB 3B9DA 3LS4H 4PLJC 4OLXH 3X3GL 3FQNB 3FTGB 2O5YL 4G5ZL 1D9KD 3PABA 4OIIL 2LU7A 5CD3B 4ZSOA 1R5VA 4P99A 4NCDA 4BM7A 5KVEL 2NY5C 4NKQB 5DVOA 5JQ6L 1RJCA 1G9NC 3GB7A 1E4JA 1JNLL 2KKQA 2Q76B 1RURL 3O41A 4WFHD 4C59B 5C0AE 2A6IB 4PJHF 3UC0H 4PJAA 4HWBH 4HXAH 4FFVD 4U1LB 1A7PL 4K71C 4PJ9B 3UP1A 2HT3C 2XY2A 4IRSA 3ARQA 2X4OA 1NMAL 4OZFH 5IFHL 1DQQA 1I3GH 4CVZA 1PX4A 5DJ6A 5E6YA 3DX8A 2CR6A 1FYHB 3AM8C 5IOPB 4JQXA 4K3JH 1IEHA 1NC4B 3DXAD 1KJMA 1LEIB 4U1IB 1VPOL 3CXHJ 4B53A 4LVOB 4TVPD 5DRXB 1OGAB 2PCPB 1VCAA 2UZIH 1MHHB 4NWUH 1L7TL 2DBLL 3UBXB 5K9JL 1AKJA 1S5IL 3OKOA 4U7SA 5GIRB 4PJ7B 3P4OB 4HS8L 2FWOA 2H6PB 3CFCH 3WHXA 2W91A 1ZHBA 2BVPA 2MQ0A 5IQ7L 4F9PC 2EH8H 2WWMC 5IMLB 4XWOC 4YDJB 2ZSVA 1UM4H 4U1GC 5I71C 5JW4N 4FOMA 1NC2A 3RBSA 5EU6D 3C08H 2IALB 5FDWB 1I8MB 3KYKH 3O6KH 1RZJH 3QULA 4QEGA 5IGXL 5GHWL 1FAIL 4DGVL 1HI6B 3UJJL 1I3UA 3MV7D 3D2UB 2X4UB 1X5JA 1NSNH 4A6YA 4BK5A 4C83B 2KPNA 3GIZL 4KC3B 2ICES 3H9SB 1EJOH 3HR5B 2E3VA 2ITDA 4HGMA 2O5XL 5KSAA 3CK0H 1JZ3A 4Z7NE 3TGXA 5C08E 4PJ9C 4JKLA 3PWVA 2VDQL 2X5PA 4WI5A 3MJ9H 1A7NH 2VZOA 1FFOB 2BVYA 3UTPD 5I1JH 2VLJE 1QA9A 4RWHA 3VXOB 1IGIL 2Q1EA 3BGAA 4JFXB 1GHFH 1GSMA 4F15B 1DUZA 5J1TC 3QDGD 3FQUB 3D18B 4EVNA 3I85A 2A77L 4FQLL 2YKLL 3VXUA 4JLRA 4LVOC 4ZQKA 4FQXA 2VUOA 1CDCA 5C0IA 2CO7B 5DJ8A 5MEPA 2J88L 3QCUH 4LIQE 4U1MB 3WYRA 1TCRB 4PJ5A 3BPCA 4JO2H 3TA3D 1S7WA 1JNHB 2RR3A 3FQTB 3GHBL 5GSRA 2Q6WA 4L8BA 3EHBD 4LEXL 1M71A 1EHAA 4DAGL 2IPKB 1IKFH 2ITCB 4WFFE 3PWNB 2R0ZL 2P5EB 4WU5B 4LSRH 4U6TA 3KLHC 1FZKB 4HKJA 4L4TE 4UUJB 4LNVA 4JFED 3QUXC 3WBDA 3EYUL 2OI9B 3KJ4B 4LLQA 2ZCKH 3QDHA 3VFUB 5EO0B 3NCJH 3HAEA 5L2KB 2EKSA 5EUOF 2KH2B 1S7VA 1HHGA 4DKDC 3BKCL 3D0VA 3ZKND 2GHWB 4ZO7A 1BMGA 1F4YH 4AMKH 5D70H 1KB9J 3FO0H 3C5SA 4XBPA 2OYPA 4C56B 4QT5A 2DMCA 4DGIL 4R4NC 5GPRA 2P7TB 3BPOB 3KWWA 1Q8MA 4Z7VE 3R1GL 3RA7L 1MSPA 4KPHL 4P4RB 5T1MB 1I8KA 4HAFA 4QRQA 1Q94B 1T20B 4F15C 4PGBB 4PRHB 4S2SB 4Q9BA 5F89A 3HZYA 3OG4B 5H94B 4LLWB 4ZUUA 1X7QA 5J7CC 1QR4A 3QQ3A 1NGWA 3IKKA 1XF2A 2EYTB 2VZ1A 3ULUC 2YZ1A 2FCBA 2ARJA 2DM2A 4PGCA 3AU1B 3PIQB 3RVWD 1F58H 1DBBL 3B5HA 4NSKA 1T1WA 4YWGL 2A0LD 2B20A 5IIEA 3G5ZB 3VH8B 3P9MA 2FSEA 3T0EB 4OLUH 4OZIA 4BFEA 2EZ0D 3V5DB 2XNAB 4LGRB 2F5AH 3FONB 1ODAA 1XF1A 4R90H 5KJRL 4KJPD 3V7AE 3STBA 3L5JA 4WUUD 1RZKL 4V1DB 4YDLB 3WL9B 1IL1A 5EU3A 1QSVA 3OKMA 4JEGB 4LARL 3WFHB 3VI4F 1KG0B 1TZHB 4CL7A 1T5WA 3BDYH 1NJ9A 3H3PH 2O5ZH 4XX1E 4I0CC 2VDOL 1T7XA 2CIIB 4Y16A 3ET9F 1MI5D 4KUZL 3IU3B 2XZAH 2F5BL 4R7DA 2R9HD 3U9UA 2OI9C 3KJ4C 3HI6H 1OQOA 5IJVB 1Q72L 3K2MC 4EKXA 2W9DH 4HLJA 5A2IH 2BSTB 1FV1A 1ZA3A 5MENB 1EDQA 5HPMB 1CLYH 4TUJB 1OGAE 2DWDA 4YO0B 2AABH 2DQEH 1ES0A 3SE4A 5HHOE 2X09A 2BX5A 1FFNA 4UNUA 4PJ7E 3OKEA 1MWAB 1YZZA 5F93C 1DTUA 1KULA 2FZ3B 4PY8I 1MCBA 5ITBL 1X4XA 3KYNA 1N59A 3DO3A 4K94L 2UWEF 1CWVA 3BPOC 3FQXA 5JZ7C 3V79C 3EW3B 1HSAB 4PY7B 3EZ8A 3IRPX 5HDOA 3D39A 4J7RA 2NW2A 5E1AA 4AEEA 4UV7L 4WW1B 3O9WB 5EFIB 4JPVH 4Q6IA 4LK4A 2VXSL 3B8YA 3QNYA 2CDGB 1RK1B 2D7TL 1EH9A 4A2MA 4GLRH 4GG6B 5EZJB 3VWJA 5F88A 3W0WE 2QSCH 1NMBL 4P3WA 4U6YA 1URLA 5C0DA 1NBZB 1QSFB 3T0EC 4I1NB 1NL0L 3H9SE 2A9NL 3QZWA 1EBAA 4UDTA 5GRYA 4YFLF 2EIBA 3BOVA 4GRMA 1S7TA 3O3BA 5I1AB 4JFPA 1DN0A 1SMAA 1MCEA 3RWFA 4ZOBA 2VL4A 4PJ8D 4YDLC 5B8CA 3G04B 4NQVB 3VE0A 2IF7A 4YH6A 3P0YL 2ENYA 5CSGA 5E00B 4NGHL 1E4KA 1FLRL 1T0MA 2APWA 2QHLA 3VWKA 1KCVH 5DDHA 5AD0A 1R3JB 4NZTH 5D7SH 3MV9E 2Y7QA 4ZFGH 4YGVB 1AGEB 4JFZH 4WEBL 4PJDB 4Q7DA 2M8XA 2EDLA 1K8IB 4QRUB 5I1EH 1CGYA 5DHYB 5TF1L 3FFCB 3RY5A 2VABB 3ULUE 1G7HB 3UZQA 2I24N 1HOCB 1QVOA 1VERA 2BOBB 4LCWB 4XNYL 3RWDA 4EEEA 1LILA 3ZHLA 1X44A 4R4BA 4TNWF 3EGSA 3ARRA 5DI8A 4J3OC 1SY6L 1UH2A 5SWZA 3TV3L 5DMGC 4NQTA 3EYOB 3S4SA 1AC6A 1I8LC 3CC5A 4MA7H 1OCWL 2WWMD 1QFPA 4PJXB 2EH7H 4NQEE 4XWOD 4OKDA 2X4SA 1T1ZA 3MCLL 3MCG1 1A3RL 4LNRA 2C3GA 4KKAC 2HRPL 3PE9A 4WWID 4OZ4A 4X98B 1OM3L 4C4KT 3UTTD 1LO4H 3BH9B 3MQIA 2P5EE 3S88H 5ETUB 3O9WC 5F7EH 4JO1L 2JB6B 2OQJB 4G8FB 3WFDL 4NO2B 4H8WC 1OT2A 3X13A 3MRPB 4BSVB 35C8L 4RMQA 3SO3C 1UM5H 5I8KL 5FKPA 4F33B 4NZDA 5D5MB 3CSYB 3WUWB 1U8LA 5J11C 1N2RA 3BH8B 5A3IC 4L4VD 3X3FL 2GCYB 4M48H 2D7PA 5L2KE 2N4IA 1AR2A 4OZGF 1CGTA 3NAAL 2QEJA 1UZ6E 2R0KL 3V7MA 4E41D 1BP3B 4HPYH 1MJUL 4KJQD 2NY1D 5I30H 2VQTA 1IGJB 4YFEA 4ELKB 4PJ9D 1HKFA 1A21A 3DROA 4C56E 2I27N 3WFBL 5BVJA 1IEAB 5A2KH 4YHNB 1QKZL 1YDPA 1B4JH 2NY3B 2R1XB 4UTBL 4DGYH 5DEGA 2P5WE 2AV7B 2B8OT 2Q86A 4MVBC 5F7HA 2XN9A 3HMWH 4U1HA 1A4KB 4OCWL 4PRHE 5D6CB 4IMKA 4Y4KA 5F8QC 1RZGB 4KTEH 4ONGL 5D7KE 5T3ZE 2AXFA 3SDAB 4XPHH 2XKNA 4YAQA 3P2TA 5JR1L 2RBLA 4BZ1H 1A7RH 1Z2KA 5DD1L 1BAFH 4Z95L 2BY3A 1UXSA 2VQUA 5J6HA 5TGBA 3PL6A 4ZS7H 1OSZB 3OXRB 2ADFL 1Y18A 4P9HL 2EICA 5D1XB 5TE7L 1UT9A 2KQMA 3PNWB 3JV0A 3F58L 1GIGL 3LMJH 5FYLD 5JDSA 3GSQB 1BZ9B 5DXWA 1UWXH 2MOVA 3GSWA 1FNHA 1T4KB 3UCRA 4F57L 2E27L 1XR9A 4DQOH 1C5CL 3BP7B 2AKRA 3DGGA 2X1XR 4V1DE 2P49B 5FGBA 3KLHD 2EDNA 1NDGB 1A6UL 1FCGA 2H3NA 3QUXD 1YMHB 3GDBA 4NN5B 1QEWB 4BFIA 2C7UA 1GC1C 3MLTA 4Y8DC 1R3LB 1ROWA 4F7MB 2OJZL 4YHPA 1KJ3L 1YY9C 4Y1AA 1XIWB 4G80A 1UGNA 2VZUA 1JN6A 2HRLA 1HN1A 1M05B 3QJHB 2F8OA 2R2BA 4X4MA 1JGEB 1I1YA 4HUVA 1JE6A 1A6AB 1BFVH 1LWRA 3VGAB 5LGJB 5ECJE 3QFJA 2F53D 1A6TA 4XNMB 4GUPA 4R4ND 3O81A 2VAAB 5L8JB 3BPLB 4HBQA 4PJEA 3PWLA 3QNZA 2XXCB 1GRWA 1IAMA 5SX5K 5EUKB 2NY3C 3QUZA 3QUMB 4NNYA 3BSZH 1A7OL 3PWUB 5CJ8A 4TSBH 4WO4B 4NOBA 1BHGA 5T1KA 5C0FA 3FQRB 3LEYL 4AENA 5B38G 3SDAC 3LN5A 2JJVA 3X3GH 4P5MA 2HKHL 2Z93A 2O5YH 4G5ZH 4D0CA 3LKOA 5DMKA 2NXZD 4JFDA 3WNMA 3SGKC 1C12A 4OIIH 2QQNL 4ONHB 5D1XC 1P6AB 5KVEH 1QSFE 5JQ6H 1JNLH 1RURH 1JZ4A 2I5YL 5I74B 2WUBL 4ZFFA 3ULVL 3MOBL 3WDHA 1T83C 1A7PH 3PABB 1BQHG 3RZWA 3T2QA 2NYYC 4LCCA 1EVTC 5FYKL 1TVBA 4MCZA 3MXWL 1ADQA 1NMAH 3T1FA 1R5VB 5ACLA 5IFHH 4PUBL 3ALXA 3RU8L 3GB7B 4NN5C 1G7IB 1F4XL 1PLGL 3C09B 5A2FA 3O41B 5SX4I 4XC1L 4JO4L 3BXNB 4YHKL 1VEPA 1S7RA 4PJDE 3MBEC 4TNVF 3UAJC 4PJAB 1AP2A 4JVWA 1WT5C 1XIWC 1ZSDA 4U3CA 4LLYA 3FOLA 4X6DF 4BYHA 4DKAA 1VPOH 5FA3A 4IRSB 1NDMB 4HZLA 1F00I 2X4OB 4R6UA 5CEZL 1JZ8A 4MDJA 3GSNA 3K8MA 4WHTA 1B9ZA 4LCWE 1DQQB 3VGAC 1L7TH 2BK8A 2DBLH 4LCUA 5K9JH 4LEOA 1S5IH 1MRDL 4FQPA 4CVZB 1SM3H 5DJ6B 4WHYG 5KN5A 4D8PB 4HS8H 1P9MC 1H3GA 3U7WL 3VW3L 2Q8AL 3FZUC 5JZ7D 4PJXE 4BZ2L 1J1PL 1KJMB 4Z7UF 3SGDH 4GRWH 2CUHA 5IQ7H 3HRPA 4M61A 1QFWM 3A6OA 3L95A 3QBTB 4PRHD 1U3HA 4WO4C 2VWEC 3OKOB 1YMMA 5DUPL 1G7QA 3IDJA 2AS5M 4X9GA 1FO0H 2VDLL 5JO5A 3L6FA 3VGGA 1ZHBB 2BVPB 1HE7A 3MODL 5IESL 5TDOB 4M4PA 5GHWH 1FAIH 2Q8BL 4H1LA 4DGVH 4EUPA 5IGXH 3UJJH 3UZEA 5D5ME 1D5MA 3T0ED 2HH0L 4WTWA 5ISZD 3GIZH 1NC2B 5CGMA 1DP0A 3L3GA 5IVZB 3CD4A 2EEDA 4BSJA 5I74C 5CSBA 2O5XH 3QULB 4CU8A 2GAZA 4OM0L 4TUKL 2Q3AA 2VDQH 2XA8L 2XRAL 4A6YB 1UWEL 4P3CL 2P4AB 3VXQB 1KUMA 5JW5A 4JHWH 1EAPA 2NY2B 3EJZD 5HDBF 4YX2L 3KLAB 3E2HB 3TYFA 1Z0NA 3L5WB 3C09C 1RIUL 1IGIH 1ND0A 2ITDB 1PBYA 3HZVB 2F15A 3JTTA 5KSAB 5EBLA 3ARDD 1P5VA 1V5JA 4NJAL 5MEND 1KTRL 1QACA 2A77H 3QG7L 4FQLH 2YKLH 3PJSA 3PWVB 1CXKA 4IRSC 4KY1L 4YK4C 3SKOA 1EFXA 5F3BA 1WSST 2QQLL 5DMGD 2J88H 1ACYL 1DUZB 2W0PA 1WAAF 2M1KA 3LRSA 4HIIA 5CINL 4EVNB 2LAGB 5I15L 3GHBH 4PIRF 4LEXH 4DAGH 4UNTA 3VXUB 4ZQKB 3VDCA 5C0IB 3O9WD 2ICWJ 4IJ3B 3IJHA 2R0ZH 1S9XA 3O2DA 2HYMA 5DJ8B 5MEPB 3LQZB 3LOWA 4EQ2A 4Y2OA 5FK9A 43C9A 1TZGL 3CFDA 4PJ5B 1NCWL 3LQMA 1FC1A 1S7WB 2N7AA 4HHAA 5A3ID 2VDNL 2G5RA 3EYUH 2BERA 5GSRB 2Q6WB 1V8HA 3U30B 4L8BB 5JNYA 5M7QA 1S9WB 1M71B 2R29L 2ARWA 1EGJL 1VGEL 3BKCH 4LCIL 4S1DD 3UBXI 3BRFA 4PLKC 2VZVA 5IB3A 3VGFA 2FHFA 1I9JL 4WWKA 3QDAA 3KS0J 4JFQA 3BMVA 4DGIH 3QEGL 4X8JB 2AJZA 3HAEB 4MVBD 3VFTA 3RUGF 1HHGB 4H26A 2NY2C 43CAA 4OZHE 3R1GH 3MUZ1 3RA7H 3R0NA 4KPHH 5J57B 1NCUA 3C5SB 4XBPB 5KSAC 3Q5OA 4F80A 1TVHA 3W2DL 3WO3B 3FFCD 4QT5B 2APXA 3KXFB 4R9HA 4NQXA 3RY4A 3UTOA 4TVPL 4G8GA 4LCWD 3BZFA 4ODSL 1AXIB 1A4JA 3KWWB 1DBBH 1NGQL 2COQA 4QWWC 4YWGH 2E9JA 2AJXL 3C5ZB 5HTSA 5ILTL 4QRTA 2JK5A 5F89B 3HZYB 1X5HA 1OF2A 1B0WA 1X7QB 2MSPA 3QQ3B 4GH7B 1NGWB 5JXAH 1XF2B 5KJRH 3FB8A 4WFEE 1Q0XL 1G7PA 1QBAA 4PGCB 2LU4A 4HPOL 1RZKH 1U42A 1DJSA 2K9UA 4MHHI 4P5KB 1T1WB 4IJ3C 3MPCA 2VRAA 4PBWD 4LARH 4J8RA 4R0LC 1CU4L 5IIEB 5KW9L 4ZSOE 3P9MB 2FSEB 4OZIB 5J9PA 1JPGA 3QG6A 4WUKH 5EIIA 3NCCB 4DN3L 2VDOH 2XTLA 4ETQB 2EEBA 3V6FA 1KF9B 3UTSD 3U30C 5DVNA 1FORL 4PJAE 1S78C 3UDWA 1IL1B 1Q72H 5D7JA 1PZ5A 5EU3B 4CW1B 3OKMB 2EC9T 5H35B 3JTSA 1NJ9B 2GTZA 1EHNA 1KT2A 5GRVL 4PBVC 4Y16B 1WV7T 2UV3A 3U6RA 3MUY1 4FQQB 4R7DB 5ITBH 2NY3D 4HUWA 5GXBB 4NQUA 4K94H 3V7AG 4P2QB 3BUTA 1CK0L 2X4QB 1FV1B 2UVEA 1ZA3B 2CPCA 4GRWF 3TBSA 4WDIB 3NA4A 4BFGA 4JREC 1ES0B 4UV7H 3G5VA 2AXJA 3BP6A 2DQDL 4XX1G 1FFNB 4F37K 3OKEB 1NFDB 4PJBF 3OKDA 1R3KB 2HG5A 3RDTB 1B4RA 1N59B 2D7TH 2XWBA 5K9KA 3FQXB 1JPST 5F1SA 1NMBH 4XTRD 1TZIA 2LFGA 1VHPA 3X14A 3C5ZC 1GGBL 3WXVL 3D39B 1NL0H 1V05A 2A9NH 3UPAA 3JWDL 3UBXG 4Q6IB 3WLBB 4QHKJ 2NYYD 3QNYB 3QUYA 2DLEA 2BMKA 3VWJB 5F88B 2IADA 3P0YH 2J2ZA 4U6YB 3N0PB 4YDVB 4Y7MA 3OJDA 4NGHH 1FLRH 1V7ML 4KKCD 3H7LA 5IVXA 3QZWB 5GS1A 4UDTB 7CGTA 3MBED 2R2HA 4FNLL 3LPFA 4GRMB 4DTGL 1S7TB 4WEBH 4GOSA 4D3CL 4JFPB 1H0DA 1CBVL 2UUDH 3RWFB 3ZYJA 3A67L 3NACL 5TF1H 3VE0B 2VKXA 4ZOCA 4Y4FA 3MO1A 4XNYH 1T0MB 3VWKB 5DDHB 2D0HA 5AD0B 1UEMA 2GKIA 1D5XA 3DMMA 1SY6H 4Y16C 3TV3H 1HHJB 3FZUD 4HW6A 1N5YL 5BVPL 2ZG1A 3VG9B 5D1ZD 1OCWH 3NIFF 4L3CA 2MCPL 4PJGA 3K1KC 4P46B 1KCRL 1J12A 3MCLH 2JCCB 2X7LB 1A3RH 5I1CL 1QPXA 2WMPA 3VXUE 2HRPH 1QVOB 1OW0A 3RWDB 5CWSA 1OM3H 2X42A 1DBJH 1IGYA 3TT1L 1TIUA 2K7PA 4RBPH 4BH8B 2V9TA 4MHHG 1NKOA 4R4BB 1PG7W 4GAYA 3SE4C 2HT4D 4UDUB 5I1DA 4K7PX 3FRUA 5DI8B 5SWZB 1F6LL 3KPRA 4ZAKA 5GGSA 3WFDH 3S4SB 2YPVL 3CC5B 3U0TA 4PJ5E 3RDTC 4ZPTB 5HHPB 2ZUUA 3MLRL 2X4SB 5I8KH 3DRTA 1T1ZB 4NO0D 1B90A 5DJYB 1DBKL 4LNRB 5JXEC 4LASL 5EOTA 5KAQF 3PV6B 2XZQL 3QWRA 3L9RA 3PHQA 1CXHA 1OB1A 3NAAH 3KLSA 2R0KH 5IROA 4LSTL 4OCMC 4WFED 1MJUH 3U79A 3DECA 3ARBB 3X13B 4Q6IC 1XT5A 1I1CA 5FKPB 3WFBH 3UX9B 2B4CC 5CEYA 1MFEL 1U8LB 3L3IA 1N2RB 3VWJC 2X1WL 1QKZH 4XI5C 2LTQB 3FJTA 4UTBH 1MCCA 3GMLA 4L3AA 4NN7B 4OCWH 3LVEA 3DROB 4WI9A 3O0RL 4ONGH 4IRSD 5BVJB 4KAQL 1KENL 5JR1H 1ZT4B 3NA9L 5FUOL 1YDPB 4MAYA 4JRWA 4GBXA 3AC0A 5DD1H 4Z95H 1E4KC 1FL5B 2B0SL 2HTKD 4WEUD 1RHHA 3VWKC 5L8LB 1K8DA 1L0XA 2ADFH 2D0FA 4P9HH 3QO1A 2Q86B 5TE7H 1DCLA 5TE4H 1I7RA 3CFKB 3JVGA 3F58H 1GIGH 3LHPL 2ZUVA 4Y4KB 4EI6A 4F57H 2AXFB 2E27H 4P46C 1C5CH 2XKNB 3KPTA 4YAQB 1HXYB 4Z78A 3T65B 2VSDA 1MCWW 3L3HA 5FYKU 3PL6B 3SDDD 2HLAA 1Y18B 1A6UH 4IDJL 4M1DL 4OZIE 1OARL 3PWJA 5KS9A 4QGYA 3TIDA 3GSWB 2C3WA 1XR9B 2OJZH 4XB8A 3TEUA 1KJ3H 4MNQD 2AKRB 3MOAL 1A47A 1NCBL 5CIPH 2YD5A 4RX4D 4XBGA 4F3FB 1T2XA 1ZLVH 2A9ML 2H3NB 4F7TA 1GVIA 1RUAL 2IQ9L 1ZTXL 4ODXA 4BA8A 3IJSA 4BFIB 5BO1L 3ARBC 3MLTB 3T3PF 1BBJB 4YHPB 3O3EA 4Y1AB 4G80B 4ORGB 1S9KC 1JN6B 1KBGL 3T0DA 2LTQC 1MLBA 2R2BB 4HUVB 4HJJL 5KSAD 3UYRL 1A7OH 3ROLB 1JZ2A 2QR0B 4TOYL 1NGPL 3QFJB 3OSKA 3ARFC 1A6TB 3H2WA 3MLZL 1X4ZA 3LEYH 3T09A 3Q48A 2BRQA 4PJEB 4QRRD 3PWLB 4KKNA 5D72L 2HKHH 3ULSA 4HGKC 1Q9OA 4AIZA 1AY1L 3QUZB 4GKNA 3MLUL 1J0ZA 4NNYB 2HFFA 2RQ8A 4HFWA 2QQNH 5EORL 4EI5B 5E1HB 2Y36L 3D39E 4N8VA 2X4RA 1ACZA 5C0FB 4N9GA 2I5YH 4TUOA 4Y4KC 2DTSA 2HP4A 1CXEA 3BHBA 2WUBH 3VXUD 4AENB 3LN5B 3ULVH 4P5MB 3MOBH 2Z93B 3HUJA 3F8UB 2LABA 4Y5YA 1AGDA 2K3TA 2QV2A 2CLVA 1RIVL 3RNKA 3P9WB 1F4AA 4D0CB 3LKOB 5FYKH 4JFDB 5DMKB 1C12B 4JRYA 4NQSB 2EEAA 3PL6C 2DLGA 1A6VL 4PJ5D 4PUBH 5ICZA 3OR7A 3RU8H 3PP3K 1PLGH 1F4XH 3L3JB 1FP5A 4E9LA 1ZLUK 2OCFD 4XC1H 5HD8C 4QXGL 4ZFFB 1A64A 4JO4H 4YHKH 1S78D 1HHHA 4G9FD 5F6HJ 3N1GC 5F1IA 4D9QE 2PW1B 3N9GL 5GS0C 1L6ZA 4LCCB 5FGBC 4MCZB 1ZVSA 5CSZA 4ODHL 3CFIC 5CEZH 2PXYC 5DD0H 1CDGA 5B3JF 1C5DB 4DK6A 4XZUA 5FKAA 3QIWD 4Z7QF 1RAMA 1MRDH 3DJ9A 5DC9B 3IJYA 3AS2A 4ODBD 1KCLA 5D7IA 3U7WH 3VW3H 4WU7A 2Q8AH 1AP2B 1J1PH 4BZ2H 1DVFD 1ZSDB 4G6AC 1MHCA 2PTTA 4LLYB 4M7LT 5FA3B 2JCCE 1JMZA 4IDLA 1T1XA 5IB1A 1TJHL 4MDJB 3GSNB 4WHTB 4LLMB 4LCUB 3H9ZA 3KXFD 3IF1A 3OGOE 5DUPH 5EWIH 4OF6A 5SWZE 5BZDA 2VDLH 4HWEL 4DZBB 2R15A 3MODH 5IESH 2Q8BH 3MYZA 4HH9A 1IZJA 2HVKA 3C5ZD 3QUZC 5FGCB 2BXYA 2HH0H 3OV6A 1DLHA 5FYLL 1I9RL 4EI5C 1CG9A 4WVRA 3WUZA 3OKNA 3DBXA 1YMMB 4X7EC 3IDJB 4N5EC 1WIPA 5DUML 5I1IL 1FGVL 1K2DA 5JO5B 3L6FB 4OM0H 1DEDA 1WJ3A 4BQ9A 4H1LB 4EUPB 1CCZA 5HVGB 3B9VA 5ICYA 4XXCA 1J11A 2XA8H 2XRAH 1A3QA 3CVHA 1UWEH 2GTWA 4KI5F 4P3CH 3B6SA 4Y5XB 3BGMB 3L3GB 4U1KA 4YX2H 4G42A 4F7EB 2P24B 5L6YL 4UOW1 1RIUH 4W70A 3TVMA 2Y23A 3IDXL 4CU7A 2GAZB 1ADQL 4NJAH 5DTFA 3QG7H 4PJHA 4KY1H 1W2KT 2E9IA 1LQSR 5CJ5A 5JW5B 1EAPB 2QQLH 1OP3H 5IT2L 3CLFL 4I0PA 2A74B 1ND0B 3ZE2F 4O4YH 5DUBA 4PD4J 3JTTB 1ACYH 4KRMB 5EBLB 2XN9E 2FBJH 4P2QD 2EYSA 4JKKA 5CINH 3U1SL 1KNOA 3PJSB 1WLHA 3SKOB 1UXWA 5IG7A 1EFXB 5C0RL 3RZCA 3GI9L 1FL6A 4FS0A 1FYTB 3BGFB 1QSEB 3PF2A 4FTVA 1ONQA 2CLRA 3RDTD 2YEZA 3ZMRA 5DURB 3GO1H 6CGTA 5C70A 1U0QA 1TZGH 2EDTA 4U1JA 2W9LA 5E94A 1NCWH 3LRSB 4LGSB 2VDNH 5JXED 4PJCF 5TPWL 1WTLA 1MJ7L 3SKNA 4NP4L 5HHNA 2ZPKH 4LBEA 3I6KA 2R29H 1X6NA 4TSAL 1MCQA 1EGJH 1VGEH 2NXYD 3IJHB 1AQDA 1SBBA 4LCIH 4TYUA 5TFSL 4G6FB 43C9B 1QPPA 5FK9B 3CFDB 4MB5A 4U1SA 2IAND 1JRHL 2XZZA 4JGUA 1I9JH 2CD0A 3CFJB 1R6VA 3DURA 3AMLA 4XI5D 5JNYB 4J3SA 3QEGH 3MLXL 3LEXA 3FQWA 2P8PB 5DHXB 4Y1AE 4RNRA 5FECA 2EO9A 4Y5XC 4R97C 5GQBA 5DT1L 4X4ME 5HVFB