1B6UA

Crystal structure of the human killer cell inhibitory receptor (kir2dl3) specific for hla-cw3 related alleles
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
199
structure length
199
Chain Sequence
HRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P58 KILLER CELL INHIBITORY RECEPTOR
publication title Crystal structure of the human p58 killer cell inhibitory receptor (KIR2DL3) specific for HLA-Cw3-related MHC class I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Killer cell inhibitory receptor
total genus 32
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 1999-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b6uA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b6uA01
3DX9B 4K7FA 4KRPB 4WO4C 5IMOA 5J6HA 1JZ3A 4AEFA 3I02B 5AD0A 3PGDA 2C3VB 1CE1H 4JQVC 5JXAL 5KAQF 1XIWC 4LSUL 5D9SA 5ESQA 1VACB 5IM7A 1YPZB 2QADC 1EGJH 2ZG3A 2W60A 3FFCE 3AMLA 1FNFA 1B4JL 4IOSD 1FL6B 5L2KE 2YUWA 5TQ2H 1CGXA 5DDHA 3NIFE 2YZ1A 4MDJB 1FG9C 5JDSA 2R8SH 4F8QA 4JM4H 5DSCB 3TPUA 3NFPB 3KYAA 3ELAT 3T1WA 2A77L 1D6EB 1AH1A 5CJ5A 1J8HB 4WENB 5LGJA 3ARVA 4MQ7B 4E41D 3WNNA 4Q2ZB 3VFUA 1BZ9B 2AJVL 3E1F1 5E2UH 5CCKL 3TBVA 1NEZA 2ZUQC 2UZXB 4P4KD 5DMIH 1QLEL 5EOCH 3D85B 2GSGB 5HHQB 1KXQE 4KTYA 4Y2DA 4QGTA 1NFDB 4U3CA 2FEEL 3BIKA 2GJ6D 4OCYH 5SWQA 4HAGA 3CFKB 5CJQH 4HLJA 2ITCB 3BP5A 1QR1B 1GGBL 4Z76A 3O2WH 3MRNA 5DD3H 4XNQA 5ESAB 1A6TB 2ZSVB 4ZSOB 1Q9LB 3NH7H 1G7HB 2AERT 4PJ9A 2H8PB 3ARBD 4XI5C 1S3KL 5FYJU 5C0AB 5T1DH 4DCQA 1QSFA 3BQUD 1QZ1A 3FT2B 1SJEA 4JPIA 4NUJB 2Q8BH 3ECBA 3QIUA 3WUWA 2BK8A 2Q3AA 4EI5C 4V1DB 4GRLB 1YEIH 2XY2A 3QCTL 1EUTA 3ZDXF 5E08H 1BBJA 2MHAB 1DLHB 1S9XA 4WEUD 5FCUL 3NABH 3QIBB 1JHKH 2ERJC 1Z9SA 5FO7B 4GJTB 1WITA 4N8CL 3OKYA 4XTRC 4F7CA 1T21A 4KUZH 3VFPA 6FABH 2CK2A 1J0KA 4JDVB 5HDQL 1WC7B 2CDGB 4APQA 5E2VL 3JTTB 1HEZA 4GAFB 3OKLA 4U7SA 2QHRL 2Y1VA 3N9GH 4WHCA 4JY4B 3NGBC 2H2PC 3EOBA 3MRHA 5C08D 3LKSA 5HGBA 1KJMB 1I3VA 5BW7C 4NKOB 1JF1A 4PGDB 3HNVH 5C0ND 1EMTL 1CD0A 1U36A 5D8JL 3O9WC 1ACZA 2E27L 4KHXH 3WLBA 3MLUL 1EX0A 4AENA 2AABH 2E6PA 1EZVY 4NC0B 3LB6C 3OG6B 4EVNA 4F3FA 2XTJE 2DTMH 3S7GA 3F58H 3SDXF 5FOBA 4DWHA 4NT6A 1LNUB 3H9YA 2ED7A 3ESUF 5CD3B 3MRKA 2CDFB 4MA1B 4HG4J 1DQMH 1EO7A 3QUMH 1D3CA 3ARGB 2R4RH 3PGFH 1T04A 5IBLC 3FQRB 5IB1B 4MWFB 3CXDL 1XZ0B 4J4PC 4QWWC 5EIIB 1OSPH 3FQWB 1XF3A 2VXUL 4WHTB 3MV9D 4ONGH 1UC6A 5BMFH 3GRWH 3UPRB 1A4KA 3P9WB 1XGQA 1FORH 1AD0A 1E6JH 2MPAL 2V5MA 2P8PB 1BLNB 2VR4A 3DXAA 5FYJE 4OZGB 1WUNT 5L9DH 4WI9A 3CDGB 3QWQB 4JFFB 4RAHA 1ND0B 4TVPH 2R0LL 3MCKB 1OSZB 4NM8H 1OAZH 2RB8A 2AI0L 4H1LH 3L3OB 1A2YB 3SDAA 1S7SB 3UBXA 2ORBL 4LRNL 12E8L 3BYTA 4OUOA 3VRLE 4M43L 4JFEB 3FO9A 2DQEH 4Y5YC 2J8UF 1JGEB 3KYNB 3ES6B 5DEGB 5AWNL 3TFKC 5EOTA 3O6FC 5GS1A 1E4XI 3VFVA 2Q3ZA 3O2DH 2LAAA 5J13B 4ODSH 1CICB 1S5HA 3GMQB 5MHSE 1U3ZA 4JRYD 5ELIA 3Q5YA 2P7TA 4PJGE 1XR8B 2Y7QB 1I75A 4X6CF 2HLFC 5E4EB 4N0FA 5C0EA 4GW1A 4KQ3H 5TFSH 1FYTE 5BJTA 3PP3H 5EU3B 2AEIT 2G5BA 1CBVL 5KTEH 1AGFB 3KPRB 3ARYA 3OAUH 3U7YH 2AVGA 5EBWA 3IDYB 3SHSA 4DJMA 4TOYH 2B1HL 2EIBA 5GRJL 2Q20A 2YD2A 1IBGL 1MCWW 2D4DA 3D3VD 1H15A 4PY8J 3WS6C 4DKAA 2AXGB 1GGYA 3GHEL 1DBML 3MRFA 1TTGA 2XACC 1FG2B 4DZBB 4GMTH 3MACL 3SDDC 1MRFH 3WO3B 1J0YA 4F37F 1OGAA 2J2ZA 2PETA 4XGZB 2OQJB 1SJVA 4DN3L 4YDLC 4X0KB 4ZS6D 5F7UA 4X6DE 4TUJB 4GH7B 3TO4D 4XX1E 2XWJB 5TQ2L 2V2WA 4MAYA 4D0BB 4LLWA 4JM4L 4XP5H 3VXSA 1NC2A 3DX8B 2BY1A 1RUAL 2VLKE 3ARDB 1VSCA 2DLEA 3P77B 1NAKH 5E00A 4XP4H 2BOCA 5F8QC 1WZKA 1UEMA 2X4PA 5DD6B 3K8KA 3C5ZA 5CJQL 5I1GH 4YWGL 4N8VA 2BY2A 1D9KD 4HV8A 4R8WH 3NH7L 5B4MD 4K3DH 1S7TA 3VRJB 4DGYH 5GZND 1G9EA 4U1JA 1MLBA 4LIQL 5HDOA 4TULH 4TN9A 3L3JA 1AC0A 2R23B 5T3ZE 2Q8BL 2HJFA 3GIZH 2YC1B 4RAUA 1A7RH 1MWAH 3RVUC 3OJDB 4FQQB 2EDRA 1Y0LA 5FHAH 3CSGA 1XCTB 2R0WH 4P9HH 1Q8MA 5LVEA 4MA7H 4WW1A 3NABL 1PVHA 4CN1A 1JHKL 1VB9A 5GGRA 3RZWA 3QDGD 5I71B 3GMPB 4JVPA 5T1LD 1XT5A 2IWGA 5F7DB 3QDMA 1AJ7L 3PP4L 4I18B 4OD1H 2XZAL 1JHTA 3SQOH 1NSNH 5CINH 2WP3O 3QUXD 2G9HB 4S0SD 5IHZB 2BSSB 5ANMB 1MAMH 1CE6A 1CG9A 4HFWA 2FJGB 5HVHC 2FYYA 2IGFH 4P2QB 3SDCA 4OLUH 2Q7YA 1A7QH 3MA9H 2V2TA 2Q7NA 3T3PE 4JJHA 1CLYL 3MRQB 1J05B 1X5HA 3E2HB 1F13A 5FYLL 3CD4A 3HNVL 3QJFA 2WAHA 4KK9D 1AR2A 2B1AH 3HR6A 4KHXL 1YA5A 3SO3C 3EGSA 3O8XD 5J7CC 3MRDA 3C5JB 1F02I 1MQKH 3H3PL 3LQMA 3FZUC 1IM9B 3SCMD 4FA8A 1HNGA 2DTML 5FUCE 2IPTL 2I9LB 4MNQD 5D70H 5F9WC 1DSFH 3UCRA 1P1ZB 1TCRB 3TZVB 4NO0A 4DEPC 3L95B 1KTLA 3QO1B 1WZ1L 3UZQA 5MENA 3QNXB 1FIEA 2VDMH 3L5WA 3MPCA 3QNZB 5CMAB 4YNYB 5B38B 5JNYB 3QUML 2DQUH 2EIEA 2VITB 4FZ8H 1N0XL 2CO7B 2Q76B 1IQWH 1TENA 3G9AB 4PJ7E 4WJ5B 4PJEF 4E9LA 1OSPL 4Z0BL 2BVPA 4JFQA 2XWTA 3BKCH 4HWUA 3VWKB 4Z77A 3GJFB 1MJJA 4HBQA 4PRIB 3G6JA 5EZIH 2HT2D 3PWVA 5BMFL 2CKNA 4EIGB 5JOFA 1FORL 3MFFA 4Z7VB 3WN5B 4R4ND 5C1MB 3ZDZE 1C7TA 3ZYZA 1FE8H 1Q9WB 3V6FA 4UILH 3AREB 2NXZC 3HZYB 1GYAA 1S78D 3K81A 3O6KH 5I1EH 1DQLH 3SGKC 3TIEA 3UZVB 1KPUB 1JNHB 4TVPL 4U1HA 5HGDA 1H9VA 4P5TC 2BXZA 4PJ8A 3SOBH 4NRYB 5CSZB 3W5NA 3EDFA 1W0VB 1WBYB 4QHNB 1FL3B 1OW0C 4OV6F 1JNLH 4XXCC 5KJRH 2DQEL 5ICYA 5SWZB 4DZ8A 2C4XA 4XWOD 4NYLA 3QFJE 1CFTB 1HE7A 1C5CH 5ISZE 4Y16C 1IEHA 4JG1H 3O2DL 3A0OA 4HPOH 4ZYKA 4ZNEA 3HC0B 4NHCH 3C6LC 3I6KA 1F45A 2VLJD 4NKDA 3BQUC 3HI1A 3U0TB 5ENWA 3OV6A 3VWJA 3S88H 5D5ME 5F1SA 2O5YH 1HHHA 4NHUB 1R3LB 5C0FA 2ZCKL 1KJ2H 5TFSL 5C09A 4JAMB 3D6GA 2AQ3A 3IDUA 5DFVD 3KXFE 4I0CC 4JFYA 2YEZB 2VKXA 4JFDE 4LSPH 5E6YA 2CLZA 4O58H 3TF7C 3RY6C 3JWOH 1C8PA 4Y5VB 2FATH 3HNTL 4S1QH 1A9EB 3PWLA 3DUSB 2XN9B 3EOYG 2P5WD 3G5VA 2DLIA 1UZ8B 4O9HL 3CC5B 2ZOKA 4X4XA 5AYUL 1F6AB 5JOPE 4IOFC 3O81A 3SJVB 5J11C 1R5IA 2X09A 5GS2D 4YHKH 4ODHH 4KJYB 1MRFL 4N90E 2FX8H 3VXUB 3BGFC 4D9RD 4LK4A 5IMLB 4OD2A 3ARFD 1H3PL 4TSAL 5C0NC 5DQ9B 1FNHA 1A9BA 4X99B 3AC0A 4JZJC 2QR0B 4LEXL 2NXYD 2EE6A 4KV5F 4PJXF 4ZAKD 3OX8B 2YPLD 4XP5L 2J8OA 1V8HA 3D1MC 2O93L 4AMKH 5I66A 1CDCA 3TJHD 1ED3B 2H2SC 5GJTH 4BH8B 4WI4A 1KCLA 3B8YA 3VXRD 3NIGF 1HHJB 1QP1A 1AGBB 2V2XA 1Y18A 1UJ3C 5I74B 1GHFH 3T2PA 4LBEA 4NKIL 1MFAH 3ZKXC 2EIDA 2IMMA 4YIQA 3UTQB 3DRQA 3MR9B 1FSKC 3EO0B 5DLMH 4NN7B 1NMCB 3I6LE 4OGXL 4R8WL 5D7KD 5JO5A 5DC4B 2YPKB 3O45A 4DGYL 3VXTA 3SKJH 4NSKA 1I4FA 5JORB 5F89A 3HAEB 1BOGB 3C6SB 4GLRH 4M5YL 1FO0A 3RNKB 3QSKB 5I8KH 1OCWH 1L6XA 5E9DB 4P4RA 4D0DA 1T83A 2W65A 4ISVB 1A7RL 1IEBB 2WMPA 3V5HB 4HF5L 2NLJB 1C5BH 4EI6A 1JFQH 3HMXA 4M62H 4UQ3A 5FHAL 4ELMA 3CCHB 3JV4B 4MA7L 3RUGE 2DD8H 4K55A 3EYVA 5C0CE 1KLGB 4HXBH 4XVSH 3UJTH 3WDIA 1UG9A 1Z9MA 1HQ4B 3FMGH 5I1KL 4JZNB 3X12A 5J8OA 2CPCA 4OF8A 4OD1L 3SQOL 1NSNL 5CINL 4LKCB 5C9JB 4R0LB 2ADJA 2BCKA 1IMHC 4YZFE 1IAOA 1ZHBA 4QY8A 2J1KA 4HUMB 2XPGA 1NEUA 4NQCB 3O4LA 3SKMA 5J56B 3MA9L 4F15B 4MD5A 4OSUH 4AQOA 2W59A 4IJ3C 4RNRB 1CGSL 1TXKA 4ZQKB 5FM5O 1M7XA 3NVQA 5DJAB 5B38G 4GG8A 4XT1C 3BSZL 1DZBA 3LEYL 4TNVF 1XGRA 5IG7B 4Q9RH 1PG7X 2HJKA 4I0PC 2IG2H 1R3HA 2B1AL 4XCNB 4FTVE 1PG7H 1AR1D 2UYLA 1EH9A 3QPQC 1G84A 2BNRD 3QUYA 5C0IA 3AXLB 1AXTH 5JW4M 1KELH 1NGXA 1MPAL 4OQTL 1DSFL 4GRMA 1JYVA 1ORQA 4POZD 3QQ4A 1NDGA 3DECA 4G6AD 5D2LE 5DJXB 3JWOC 5F3BB 3DIFB 1WFOA 1J1XL 3VFSA 2J8UB 5DJ2B 1YMMB 1MFDL 1LO3L 3FFCD 3ULSB 3ULUE 5L2KD 1M05B 4BELD 4Z0XA 1JGLH 1JPTH 3LQAH 4XNXH 3RPKA 4PG2A 2QLVB 4NN5B 2H6PA 3GEWB 3UTPE 2DWEA 3RHWF 3QEUB 5F3HB 4BZ1H 1YUHB 3DVGA 3EYUH 4EXKA 2GFBA 3RRQA 4X6CB 4ZS6C 2X9WA 3TO4C 3OKNB 4BFBD 4UILL 1FNLA 3UTTE 2GT9B 4HIEA 1IFHH 4XPGH 1WBXB 1U8NB 3O6KL 3U9PL 4Z6AT 5I1EL 1DQLL 5CSGA 3THML 5JPNB 5DJ0B 2IH3B 4WO4A 4Z7OE 3HUJE 5I1JH 2BVYA 1JUFA 1QBAA 3CFEA 4NQEB 5E7BA 1RHFA 3H9SB 5F9JA 4OLVH 1CL7I 1J0ZA 4MQSB 5J1SC 3CMOH 1CVRA 4NWUL 5KJRL 1S8DA 3VGHA 1C5CL 3F12B 2VZUA 4LMQI 1T2XA 4YBQD 4JG0L 4IRJD 5HJ3A 1KC5H 4JG1L 4YBLB 4K7PY 2XNAA 3B9KB 3MRRB 3F5WA 1CT8A 4NIKB 4NHCL 1PYWB 1JNJA 1OAUH 5EU4A 3RWJA 1FLRL 4YQXH 1CK0H 4Y19A 4Z7QF 3T0BA 2XXCB 1IAIH 5IV2A 3MGTA 3L3GA 3PNWA 4KZDL 4M6MH 1KJ2L 3MJ7B 1UWXH 2VQ1A 1R5VB 1OP5H 4PGZA 2VDLL 4YE4L 4LSPL 3UDWC 1F3JB 4JO4L 1N6VA 1GOHA 3OAZK 3JWOL 4GQ9H 3FB5B 3PF2A 2IBZX 2FATL 1JPFA 4P46D 4WNQB 2H32A 3X3FL 4S1QL 5GJSH 2HT4C 2VDKL 4G8GA 4RGMC 1JPGB 1QA9B 3EYFB 3MRPA 5H8DA 1YN7B 1UKTA 2R1YA 4J1UB 2VABA 2X4QA 1TNNA 3FQNA 3QG6B 1BAFL 4Y8AA 1QQDA 2DQCL 4EI5A 2HFGL 4HJGB 3LHPL 1N7MH 2XTJD 5K9JL 4F7PB 4LCIH 3QULB 1KACB 5TDPB 1AO7B 2G2RA 3LKRB 2VH5L 4HZLA 4XP9H 1CXIA 4PJAB 4AMKL 1RMFL 3HAEG 1VFOA 1EFXD 1OAKL 5JA8B 4F7TB 4UT7L 4ODUA 1U8MB 5GJTL 2FR4B 1E28B 1J8HE 3IDXH 2E7MA 2HFEB 3HFML 3TT1H 4U6TA 1GHFL 4M7KL 3CH8A 3NCCB 4ZUWA 4UTAH 5F88B 2H45A 3E3QC 4NQUA 3S5LB 3VD5A 5BW7A 3RGVB 1MVUA 2AJZB 3BH9A 5C0DA 2WUBH 4MAUH 3WSQL 7CGTA 1PX4A 3UTSB 5FYJD 5F72S 3O9WA 4WI3A 4LDOB 4NWTL 4HUUA 4JB9L 1A21A 3SE8H 2ZUTA 3MCG1 4PJDA 4KWUA 4PJBF 3QEQB 3GK8H 2HT2C 3D69B 5EZLB 5ILTH 1CLOH 5J12C 5C0AE 1RIUH 3TN0B 2H1PL 4R4NC 3X14A 4XPAL 4OGAC 1DVFA 4D3CL 1MFCL 3KLHD 1PZ5A 5JW4Q 1AIFB 3BT2L 4V1DE 5EC1A 2PCPA 3QJHA 5IF0B 4XH2B 1P2CA 4HXBL 3BEVB 2M1KA 2BDNH 4ZOEA 3FMGL 2WIMA 4J4PA 5FOJA 2PR4H 3GI9H 4P2RE 4JY5H 2FRGP 5MHSD 3OJ2C 1CVSC 4PJEB 3T1FB 4FG6D 2DMBA 2CUHA 1P4LA 2P5EA 1P4IL 1EGJA 4BKLB 3RX7A 1VESA 4FQXC 1EO8L 1FYTD 3MOBH 3H7BB 4PRBA 4LRIC 1MFBH 3HS0B 1YN6A 2BRRH 3K4ZA 4MQXC 3TA3D 4XBEH 2AJ3B 3G5YB 1LP9A 5A43C 4IS6A 2HFFA 3MFGB 4XAWH 4X98B 2VDOL 4BUHA 2Z31D 5JQ6H 3FTGA 1GRWA 3U30C 3UYRH 1VGKA 2PW2A 2Y5TB 5D2NC 1A6AB 2X89D 3KJ4C 1JRHH 2QJDA 1D6VL 5GGTL 4KTEH 3HG1A 5EUOF 3G6AA 2CLVA 1A1MA 1UM6H 3IGAB 1IGMH 1ORSB 2M26A 3PWPA 3GMRA 1C7SA 4PJIA 3DVIA 2A6KB 5ITBL 4OI7A 2W9DL 1QYGH 3O6FA 1AKJA 2FSEA 4Z7UB 4HWNA 5HYQB 1KJVA 3JV5A 2XRAH 1HSBA 2OZ4L 3VGBA 5EO1B 1TZHB 5DXWA 1JGLL 3IFLH 1JPTL 2BNUB 4C56B 3RA7H 2WZPD 3FOLB 4YH6A 1QFWH 4H25A 3I85A 1U8QA 4IM8A 3WCYA 1QBLH 3S97C 4BZ1L 1QHOA 1IGCH 1SY6L 5DVOA 1Z6JT 3BP6B 5T1KA 3C87A 3MLWH 5L2JB 1AGEB 1MCQA 2P24B 1R3KA 1G7JB 2VZ1A 5FM5M 5EDXA 3VMPA 2KUTA 4FFYH 5CEYB 4OZGE 3ET9F 3WS6A 1IFHL 2N7AA 3VFWB 3KPQB 3IXAA 3BJLA 1DN0A 4LEOB 3BE1L 4MJ4A 1CR9H 1A6VL 1LE9A 4OLVL 3SDDA 1KG0A 5C0RL 3H9ZA 1MCOH 3HB3D 4CBPA 4D2NA 3K3QA 1F8TH 4LHJB 5T3ZD 1RVFH 3AM8A 1I9JH 2WWKT 3EFFA 4JO1H 1UB5A 1AP2B 1KC5L 1O0VA 1R24A 4UB0L 4XRCA 4ORGA 4WW2C 1YYLH 1SBSL 4HUXB 4UQ2A 3O6MH 5KSBB 1JWSA 1FFOB 3QAZC 1HXYB 5FUOH 1FGNH 3FO2A 4PJXB 2MNUA 3RWEB 5KSAD 1CK0L 1OTSD 1IAIL 5IR1B 4Y1AA 4I5BA 2ED8A 4HUWA 3PJSA 4M6ML 1E4WH 3SGJA 5KVGL 4LMQE 2VXSH 3V6ZB 3T2QA 1ZA3B 4OLYH 3UYOD 2EH8H 5K59E 5TDNA 3KPRE 3IF1A 4YUEL 2APXA 3EJJX 3QUMA 5GJSL 4OZ4A 1XEDA 5DTFB 3QIWB 3H42L 1MCFA 4IIQB 3C9NB 4O00A 4URTB 1R3JB 2CUMA 3WIHH 2X4TA 2Q87A 1IM3A 1QRKA 3GRWA 2YUZA 3MLYH 5E1HB 1JNNH 3GBMH 2PYEB 4NPYA 1K4DB 1CIDA 4XNYH 3ZSSA 3S5LG 3CLFL 3A67L 1L0XA 4O5LH 4AIOA 4P23D 5FB8B 2DL2A 1NBZA 1A0QL 5ID0A 3OMZA 4P59H 5BS0B 1MI5A 2ARJA 1FL5B 2FZ3B 5EBMB 4ZPVA 4U6VL 1QKZH 4JANB 1EO5A 1NBQA 4BQ9A 1S9WA 4H1LA 1NKOA 2Y07L 5KN5B 1CLZL 2GUOB 2VL5A 3RZCA 4XCCH 5SWSA 1V3KA 2NY4B 1AQKH 2N56A 4G6AC 4QOKB 2AKRB 3RKPA 4C4KO 2WUBL 5ESVA 3R4DA 3O2DA 1PKQA 4UBDD 4PGEB 5E70A 4NBZB 1KCUH 1H3VA 4MD0B 5FXCH 5IB5B 1A7OH 1U8LB 2NW2A 3RVXC 3WFDH 4GAYB 3AGVA 1XF4B 3MLVH 5TJWK 3NAAH 3GK8L 4QRQA 4AM0B 4CN6A 4R2GC 2A74B 4RMUA 1CLOL 1N5AA 4ZPTB 1RIUL 5F1KC 1V7NH 2DM7A 3ULVE 4DUVA 1YNKL 4LLQB 1XGPA 1ONQA 2X4SA 4Y4HA 3FO1B 2CRIA 3QFJD 2QSTA 2KQNA 3EAKA 3CFJA 3ILPA 1R5WA 4LNVA 3UP1A 4DKEL 5ICXA 3HZMB 4O2CA 4YO0B 5E8OB 3TJEL 3VDCA 1NANI 1OTTC 3U82B 1BQLH 4JY5L 3EYOA 3GM0A 1U2CA 3MYZA 2OLDA 5IK3A 2HRLA 5ANME 3MLTA 2DI7A 4PTTA 4P2QE 4EDXA 2BZDA 4PRDB 3INUH 5F21B 3KXFD 5GRVK 4JFDD 4ZFGH 3WFHB 4ZXBC 3SGKA 2JF1A 2P48B 1ACYH 4KMTH 4XAWL 3D2UA 3KPTA 4P5TA 5DJ6B 1CXHA 1IGYB 1WISA 4MYWB 4RQQA 3UYRL 1HXMB 2EIZB 1INEH 1TFHA 4YDJB 2COQA 5KVFL 4PLOB 1BZ7B 4QCIA 3JVGC 3PABB 1JRHL 5E8PA 4KTEL 3MODH 2WBJD 1OW0A 4XXCA 1UM6L 1A6WL 3BDYH 1YNLH 4U1IA 4KHTH 2XFXA 1OAXL 4G7YH 4WY7L 4N90D 1DE4A 1MHCA 1KNOA 3TYFB 5BVJA 2OTWB 2V7HB 4U1LB 4Y16A 3HI6H 3CU7A 1QLFB 3HZKB 4QRSA 4RA3A 1CDGA 3D25B 4QLRA 3ARSA 2J5LC 1JK8A 4PREA 1JV5B 3C6LA 2XRAL 3KPPB 4DK3A 3BQUA 2GIYA 4NO5A 3LEXB 3IFLL 4I2XA 3T3MF 3RA7L 1YNTA 1CQKA 4QRTA 5E94A 1GJIA 3K8LA 3LPWA 2LQRA 1JYWA 4KJQD 3PHSA 1MWAA 3ZKNC 1U2HA 1KPVB 3OR7A 3CFCL 4LVNC 1S5IH 3RY6A 4X8JB 4QHMB 4HDIB 3RWFB 4ETQB 1CU4H 1MIEL 5EA0L 2ZNWA 4WV1B 2WUCL 1YEFH 3U4EB 3BZDA 3PDOB 4HK3J 2F5BH 5A2KH 4JFXB 3I6LD 1VFBB 4WDIB 3RI5K 3MV8A 1CR9L 4UUJA 1BVKA 3CVHH 2FO1A 1MCOL 4I3RL 4PUBL 1TVBA 4X6BB 4WFFE 4J6RH 4F9PC 1MY7A 1F8TL 5DK0B 1RVFL 4FFWD 1SYVA 5A2LH 4Y88A 5SWZE 2MTPA 3QUZB 4Z7NF 3T4YB 4PS4H 2ZUSA 4K8RD 1D5ZB 5C0CD 3REWB 4Q74A 2QHLA 5ID1A 3S35X 1RJYB 1CD9B 2F19H 3ARXA 5F7HA 3MNWA 5LQBL 5MEPA 3I50H 2A6DA 1UJ3A 5J1AA 3S35H 1ZA6B 4MDIB 5EU7C 5DI8B 4YX2L 1EERB 1FH5H 4XCFH 1MRCH 1ZLUH 1A6UH 1UGNA 4XBGB 2ESVB 2KH2B 2E5EA 3O3EB 2EH8L 4JHAL 3U83A 1FZKA 1I1AD 4LNRA 4NRXA 1R0AH 5F9OL 1B88A 4C58B 5H37H 1UM5L 3NOIA 3MC0A 5K9KA 2YUVA 1JN6B 1QFUH 1JI1A 4FTVD 4MHHG 3FRUA 3VI3F 5CUSL 2D7TL 3MLYL 3QCUH 5FK9A 1JNNL 2EDFA 3GFUA 4OCXL 2OMBA 3RWGA 4XNYL 2LE9A 4EN3D 2O5ZH 1RUKL 4RWHA 3VXUE 5HPOA 2E7LC 4PY7B 4ZFOA 5GGVH 4LPWA 2HLAA 3HC3H 1DQQA 2Z31C 5E8EB 1T7YA 1NLDH 1ETZA 4PB0H 2QL1A 5T1MA 5F9DC 3S3JA 2FEDD 3UC0L 1P4BH 2NY2B 4H0HB 4HCRL 3ULUD 3ZDXE 4PTUA 3ZE2F 5E8DL 3G08A 3T08A 4GG6A 1VKXB 1J5OH 3RTQD 3FQXB 5FV1L 4M7JH 3JBG7 2XXMB 1BM3H 3QA3A 1AQKL 1ZTXH 3LN5B 4LLDB 1E4KC 3UTPD 2DQTH 1HIMH 1TQBB 1HKLL 1B9ZA 3NPSC 5FYJL 3T0AA 4OZIA 4PG9A 1FIGH 4KI5F 4U1GB 5I1IL 4N5ED 4U6HB 4H88L 1HH6B 3MREB 1CTOA 1LDSA 4I0PA 4X7EC 3OQ3B 5EPMA 1FLTX 4FXKA 4OZHB 3UTTD 1KCUL 3DUUB 4TQEL 4BSWA 1G0DA 4FQHB 4HX1A 4NNPL 3EYQD 2QTEA 5IOPB 4LLMB 4NQVA 3PHQA 4FXGA 4L3EA 5HGGS 4QRRE 1OLLA 1KJ2A 4Z78B 4QYOB 3KR3H 3IU4H 3NFNB 5IMOB 5CHNA 1AXIB 5AD0B 3PGDB 5IVXF 5I76A 3V9FA 1NMAL 3WHXA 2EYRA 5D1QA 4TRPH 3K2UH 5ESQB 2OSLB 3ZKMD 5IM7B 3CFIC 1MHPL 3E6FA 3MLSH 3W0WA 5BXFA 3HB3C 5AUMA 2EXYD 4N0CD 2K9UA 5DDHB 5JDSB 4X8XA 5HDLA 2X41A 3Q48A 2FL5A 4G8EA 5EBGA 1BPVA 3WLWD 1IC4H 3MJGX 4NQCE 3INUL 4HS8H 4ZFFA 5LGJB 3RDTC 3B6SB 3VFUB 4X4ME 2GEEA 3TBVB 1NEZB 4KMTL 1TJHH 4YLQT 3KPSA 4OFYA 5GIRB 4HIHA 5DD5H 3QI9A 4PRAA 2BNQB 1N4XH 2RIKA 4Y2DB 3BIKB 3C09B 1VERA 3BP5B 3WNKA 3VGAB 5L6YH 4M1DL 5D1ZC 4FFZH 2X6MA 1U8PA 4JPKH 4DQOH 4KRPD 3BW9A 5JXED 4JR9L 3HPLA 4PJ9B 4S2SA 3B4NA 4E5XA 3N1PC 2OJEB 1OPGH 3WNOA 4NZUH 4M61A 4DCQB 5J6GA 3HI6L 1H8OA 4JPIB 3ECBB 3QIUB 3WUWB 1YECL 1C5DA 2J8UE 1YMME 3MJ9L 4LDLB 5C2BH 1NMBL 1BBJB 3SO5A 1IZKA 1MFEL 1S9XB 3RWIA 5M94B 3V7AG 1YPZA 4KKBD 5DD0H 4F7CB 1T21B 3VFPB 3OXRA 5BZDA 3UDWA 4Z8FH 2VO5A 1J8HD 4APQB 1HCFX 3ME0A 1KCVL 1P84K 4XC3H 1HEZB 3OKLB 1T0NA 1CU4L 5H35A 3LD8B 3D85D 1A1NA 4HMEA 3HE6C 3MNZB 4KKNA 3EOBB 2EC9T 3LKSB 3OB0K 4LSVH 5HGBB 4V2BA 1BZ9A 1JZ7A 5F1NA 2GSGA 5HHQA 2V5RA 3H9SE 3S37L 5T3ZL 1NFDA 3WLBB 1E6OH 4AENB 2EO9A 4GRWB 2NPLX 5TE6H 3IU3A 3ZL4H 1GIGL 5ESAA 4ZSOA 1T6WA 1Q9LA 3RVWC 3OZ9L 4F3FB 2H8PA 3WFZA 1JYNA 1GCFA 1N3NA 1KB5B 4LLUA 4L9DA 2E3VA 4JM2F 5FOBB 4NT6B 1LK2A 3FT2A 4FQIH 3GSNB 3QIBD 2Q6WA 3MRKB 3BZEA 2BMKB 4P2RD 1LO4L 1T04B 3QISA 3W2DH 3CIQA 1S7XA 1I7ZB 1NGYB 1DLHA 4HWEL 1FH5L 3DSFH 4A2LA 2DBJA 4LF3A 1MIML 3IAQA 5GRYA 1ZK9A 3T0XA 4JZOB 2CRMA 1A4KB 2EDJA 4UAOC 1XGQB 1R0AL 1AD0B 1UWGL 3JTTA 4M5ZL 2XY1A 4K94C 3GM8A 1AY1L 5DVLA 2CGRH 1Z3GH 2HYMA 4G8IB 4OT1H 4TPRL 2UWEF 2UZIH 3QCUL 5TF1H 4UINL 1G9NH 4PGDA 5D93C 3LV3A 4MHHI 1YEGH 5GRWA 3P4LA 3UBXB 4NP4L 1NLDL 3PL6C 3FO9B 1AO7E 3FN0H 1TETH 3UX9B 1U8JA 4JY6A 3EO1A 3ARGD 4PJAE 2BC4B 1QRNA 3P4MA 2YXFA 5EOTB 5GS1B 1OAQH 1KCRL 3VFVB 3B3IA 1J12A 1ZGLP 1BM3L 5CD3A 1S5HB 5JZ7C 4FQXA 4X9IA 1HIML 4ZS7L 5L88L 1MFNA 2WM0A 2YRZA 2P7TB 4LRIA 4NC1C 3FQRA 5IB1A 1MCDA 2W07A 1GZPA 1V7MH 4GW1B 4N0FB 1P53A 4W81A 2EDOA 5GGRY 5KG9A 4OTXH 3FQWA 3UTSE 5BJTB 2BY0A 1CLCA 4KUCD 5HBBA 2P44B 2G5BB 4QXWA 3BD5A 4ODXA 5I19L 1HHGA 2ICCA 1I7UA 5D2NA 2XQBL 5DR5H 5EBWB 1LDPH 3AB0B 3MJ6A 4KJQC 1BLNA 1MVFA 5F7MC 1JBJA 4FQLH 4AK1A 1H15B 3KR3L 2EDHA 3MRFB 3CDGA 5JW3H 4JFFA 3K74B 4KRLB 4O51A 1PSKL 1ZGLM 3Q5TA 3WFBL 1I8IB 4NBYB 1NEZG 4PPTA 3GBLA 2X05A 1W2KT 3K2UL 2BVOA 3QNYA 1OGAB 4K94L 4EQ3A 5DJYA 1CXFA 1A2YA 1RURH 4M6AA 3IJSA 4JFEA 4Q6IB 4WI7A 4YFLI 2G60H 1CICD 2V2WB 5HY9B 4MAYB 3MRBB 4LLWB 1T7ZA 3IAPA 4PJEE 3DO7B 3RFZC 3OPZH 4HS6A 3R1GL 4KRNA 1FAIH 2YMXL 4KMQA 4RMSA 1E4XL 3E8UL 1NC2B 3VXSB 5JPMB 4HGKC 5E03A 5B22A 3GMOA 4JO3L 2AQ1A 5EWIL 3GMQA 4K8RC 3AFLA 2R9HD 3EIFA 2JCCF 3WUWG 1TJHL 5E00B 2V6HA 2BOCB 3X3GH 2X4PB 3RI5F 3WIFA 3C5ZB 1X5JA 4NNYA 1A7NH 4LLYB 4N8VB 3LS5H 1RULH 5ECJE 2XZQH 4HV8B 1LILA 1XGUA 4D8PA 3SGDI 2CJUH 1S7TB 3KPMA 5DZOA 4ODWA 5GS3A 5LGHH 4KMLB 4ZG1A 2EEBA 1BBDH 4U1JB 4MSWA 1IC5L 1MLBB 2HTKD 4HUVA 5EO0B 4RGOL 1Q9OA 3BUTA 1MY5A 4RAUB 1KIPA 4JQXA 4Z7UE 4CU7A 1MQ8A 1RIVL 4HWBH 4OFKA 3MMEA 3CSPA 4WHDA 2EKJA 3QXDA 3UJJH 4WW1B 3T0DA 4H26A 4C56E 5GGRB 2XV6B 2OQJA 3SE9H 4YHZL 3Q6GH 2DWDA 4KC3B 1T3FA 3QDHA 4TUJA 1G9NC 2R29H 3QDMB 1NGPL 2CO6B 3L3DA 3KS0J 1LQSR 3TVMB 3K8MA 1O7SA 5E2TH 4XC3L 1NCWL 3DRTA 3BPLC 2DKUA 1CE6B 4OF5A 1CG9B 3A6CH 4HFWB 4Y0GA 2FYYB 1MLCA 2VXTH 3SDCB 3DX8A 4M7LH 3ULUC 2Q7YB 5IFHL 2V2TB 3O4OC 3ARDA 1A64A 1Z5LB 4LSVL 3P77A 3FT4A 3X11A 3VG0H 4KGJA 3QJFB 4IDJH 4PJDF 1N6QL 3MV7E 3EGSB 1E6OL 4U49A 3MRDB 4LLVA 2RR3A 3ULVD 1K5NA 4L8SB 1R6VA 2BERA 2PTVA 4K8RL 5IJKC 3P0VL 2WQ8A 3N1FC 1KXTB 2BNRA 5KBNC 5A40E 1KTLB 3F7VB 2OL3H 2X4RB 5EFIB 2R23A 2MFNA 5KSBE 5DO2D 3L5WB 3CUPB 3U79A 2VLLA 4G6KL 4PJXE 1XCTA 1RZGA 2CIIB 5FYKU 4NQDA 2GK0B 2VTFA 3DSFL 5HDBF 2I5YH 2XWTB 4Z77B 5I9QC 4P2QD 4X80H 4AEEA 1MJJB 2A9NH 3G6JB 3SE4A 3QT2A 1K8IA 4OFIA 5D96B 2QQNH 3UBXG 3I6GA 3KJ6H 4LSDA 5JOFB 2HTLD 3MFFB 2QV2A 2AS5M 1SYSA 5BV7H 4PRNA 5EORH 4G43A 4PD4K 2JB5H 2LU3A 1G9MH 3V6FB 1I8LC 1EV2E 2QQQA 2UZIL 5TF1L 4XXDA 3MRQA 3H0TA 3F8UB 3TIEB 4ZOBA 2XTLA 4U1HB 5KS9F 3IDGA 5I1LA 5HGDB 2PYEE 1IM9D 5F7EL 5EU5A 1J87A 1MAJA 2O61A 4XMLH 1RFDH 1I3UA 2ED9A 1YEGL 2JIXB 1CD1A 3TZVD 1X4YA 1WEJL 4KK5D 3H6JA 3ULUL 5ICYB 5BS0E 1T89C 4DZ8B 1I9IH 5GS0D 5EZOH 1F3DJ 4XVJH 5TE7H 3U7WH 1OAQL 4OLEA 5JXEC 5D7JB 2DM3A 3QO1A 5E6IC 3QRGL 4ZYKB 4QTHA 2B0SL 3VWKD 4NKDB 2ZKHH 3WNLA 3HI1B 2VITA 5ENWB 3WNMA 2Y06H 4QOKE 3IKKA 3VWJB 4ZXBA 2OTUB 1HHHB 4YK4C 5C0FB 3PWUA 4OLZL 2ICWB 4X6FA 4BQ8A 4OJFH 2AK4A 1NGZA 4JFYB 4PRIA 1FNSL 3ARED 2CLZB 1MCBA 3TP4A 2GW5A 3LKQA 5EO9B 1LDPL 4MLIA 4Z7VA 1LMKA 3MBEC 2C1OA 1Q9WA 3G5VB 3K1DA 4R97C 2DJUA 3ZDYE 3DYPA 5JW3L 4X4XB 1ZVHA 1ZS8B 3SKUD 4ACPA 4WFFD 1RZIA 1IAMA 4LGRB 1B2WL 1R5IB 1JNHA 4YPJA 2BHYA 4WU7B 1RZJC 4GXUM 5FYKE 2XA8L 4J12A 4OD2B 4Q97A 2DMKA 1W0VA 1IGIH 4YC2B 4QHNA 1CL7H 3WIHA 3MGAA 4N8VG 3S36X 1I1CA 1A9BB 2KBGA 1UB6A 4OV5A 2LTQC 4LCUA 3S36H 1TJGH 1AHWC 1CFTA 4HFUL 4OFVA 4JFPB 5I66B 2FGZA 4NZRH 3R8BB 3WD5L 3VG9B 2VC2H 3HC0A 5F7LB 3V4PL 3F7RA 4WWKD 1FPTH 3U0TA 2V2XB 1Y18B 4JVUA 4LBEB 1DN2A 4NHUA 1TIUA 2IAMD 3X3GL 5HVFB 1XGYH 3DRQB 4Z5RA 4R26L 3LS5L 2XZQL 1Q0XH 3ZYOA 2C4FT 4U0RC 3ZO0A 5JO5B 3KS0H 3O45B 1I4FB 5F89B 5E99H 3DUSA 4RGNE 1BBDL 2XN9A 5CD5D 3VXUD 4XNUH 1FO0B 3DX6A 1UH2A 4FABL 4P4RB 2VL4A 2VKWA 2W65B 4MJIA 4XMKH 3SJVA 1H3UA 2HWZH 3ISWA 4EI6B 5BV7C 1Q0YL 4ELMB 3EDJA 4IEFB 1DR9A 5ACMA 4EZMA 3EYVB 1RUQL 4AIXA 4QHUB 5I17A 5INDA 1BECA 1BREA 1UXWA 3IT8D 2V17H 3X12B 1BVZA 4AL8L 4K23L 1XF2A 2DI9A 4A6YL 5IFAH 2ADJB 3QXWA 4BFEA 5L8LB 1WCBA 1RZJL 1ZHBB 4QY8B 1RZ7H 4M93B 4MNHA 1RJCA 2XPGB 4G6JL 3SKMB 1K3IA 2DAVA 5HHMB 5IW6A 2FX7H 3V4VL 3GUTA 4U6XA 5HI4D 3SE3C 4G9FA 4S1RH 3IRZA 4IDJL 1XGRB 3JV0A 1X6NA 5KSVB 2NR6D 4XB8A 1J1PH 5F7FA 1R3HB 5C0JA 3QWRD 3V7AE 3UTQA 3HI5L 4QRRD 3MR9A 2E7LA 3BISA 2UYLB 4MVBC 2UWEB 3EO0A 1AGCA 32C2A 3QUYB 3EFDL 5C0IB 1GPOH 4Q9CA 4X7DC 2PTTA 5AG9A 1F58L 1NGXB 4ZTPH 1Q72H 1EUUA 2C7UB 3WO4C 1BOGA 1A14L 3DBXA 5MI0B 1RIHH 1ORQB 3QQ4B 2QSQA 5HD8D 1NDGB 1HINL 4WTXA 1I9EA 5E9DA 5AZ2L 1OHQA 5D7IA 1W0YT 1KEGL 4ISVA 3I3BA 3VFSB 1X5AA 2CK0H 3EDKA 1KF9B 1E4KA 3LSOA 1JZ8A 4DGVH 3CCHA 4PLJD 5E8NA 3TBYA 4ETYA 3SDXA 4Z0XB 3RIFK 1QPPA 5DJCA 2I5YL 3G5XA 4LSSL 1X4ZA 4OCRH 4KK6C 1DBBH 2A9NL 4JZNA 2ESVE 4NQCD 2FLRT 1WAAA 2H6PB 2Z8SA 2R2HA 3KJ6L 3QXAA 4WCYL 3RVVC 4LKCA 4R0LA 3HPJA 3L7EA 4Y5XC 3DVGB 2HA1A 2LU4A 5BV7L 5IHBA 1SHMA 1F3DH 1LGVA 5BRZB 3UBXI 1V5JA 5IT2H 4J7RA 1P5UA 4LCWB 4M4PA 2D03L 5J3HD 3QCVH 4WO4B 4Z95H 1CDUA 1JUFB 5IG7A 3CFEB 4HJJH 1KB5H 2R9HC 1XIWB 2GJZA 1KYOK 1UT9A 3GSNH 2QADB 4BJLA 1BOYA 3VDBA 4QXGH 2YA2A 4YJZL 3JWDL 1YMMD 3CVHA 3VGGA 5AZEL 3C8KA 5EB9A 3F5WB 1CT8B 4JQIH 3V5DA 2ZKHL 2EDLA 5EU4B 5FGBC 1YY9C 3MGOA 4MQTB 3RDTA 4HT1H 4Y19B 5IGXH 3MGTB 3L3GB 3PNWB 2FBOJ 3WUZA 2ZUQB 3T0EC 1QEWA 1MUJA 1ZLVK 3V52H 2VQ1B 2IFFL 2YPVH 3B9EA 1K4CA 2B4CH 4OZHE 5MEOB 1WT5C 1T03H 3QEUA 5F3HA 5D1ZA 1ZANL 1JPFB 2H32B 4X6CA 4POUB 2J12B 4G8GB 4GAJH 3V79C 4GS7C 3P11L 3MRPB 3H9SD 4C57C 1WBZA 4OI9A 1SM3H 4Y4KC 1Q94B 1WBXA 2R1YB 1IZJA 5DJ0A 5IVZA 4XAKE 2VABB 2X4QB 3FQNB 4JPWH 4XP6H 4KK8C 1RI8A 4EI5B 4D0CA 4NQEA 4KY1L 3HTLX 5LBSH 1CL7L 2E9JA 4YXHH 15C8H 1GAFL 3FB8A 2ERJB 4HPYH 4FQPA 1QVOA 2G2RB 1OF2A 4HZLB 3F12A 3ULVC 3PIQA 3MROA 4V2CB 4YHOH 4FOMA 2AJYL 4BA8A 2FIKA 2VC2L 2A0LD 2E9BA 3B9KA 3NCYS 3U2SB 1B0WA 1PYWA 3HE6A 1BF2A 3NGBB 1FPTL 3O3UN 1OD9A 4XVTL 5K93A 5E0QA 2MCPL 1FZMA 3JSSA 3FN3A 1X5XA 2Z4QA 1UVQA 3S4SG 3BH9B 1XGYL 5C0DB 3O9WB 3NCJH 1IC7H 4PP1D 1ZXQA 3ZE1E 4HUUB 4LHUB 3S3SA 4AQ1B 3FB5A 4UNTA 1X9QA 1AE6H 2VIRA 3TYGH 3W39A 5CZXD 4PJDB 4ODTL 5DZNA 5E99L 2BP3A 2NY6C 2UY7A 5FHBH 1IGJA 4GKNB 2HTLC 1UQSA 1YN7A 1QSFE 1WIOA 3OGCA 1KEMH 4U1NA 4XMKL 4G6FB 1PZ5B 4NUGH 1AO7D 4KJPD 5EC1B 2PCPB 2ZNXA 2IBGA 3EBAA 1P2CB 2OX5A 3GSRB 5DD1H 1XH3A 4JDZB 2F58H 1SEQL 2KL6A 1RPQA 1W8OA 3QP3A 3CAFA 3QFDA 3OF6D 3OAZH 4OZIF 4KKLC 2UZYB 5DA0B 3T2OA 4X7FC 5FM4A 1P4LB 2P5EB 2VZ3A 1TQCC 1T7WA 4NJ9L 4HWZA 4HGMA 1DBAL 3UTSD 4BQCA 4TSCL 2FR4A 3MZGB 2HFEA 1YN6B 4K2UH 2DICA 5SV3A 2DIBA 1LP9B 4HKBB 4CVUA 1X5IA 2HFFB 1O5DT 2C4FU 2AJZA 4WFGE 5GRZA 3FTGB 3ULVL 4CU6A 4TUKL 5KVEH 1EJ6A 1VGKB 3DMMD 2PW2B 1L4IA 4P2CG 3WJLC 2VLME 4GRWE 3TN0D 5ABDE 1VGEL 2QQKH 1TVDA 3MYJB 2P8MB 1UM4H 2CLVB 1A1MB 3D87B 3PL6A 4RFOH 4Y5YB 3GMLA 3QEQA 3PWPB 5CILH 3HMWH 3BYYA 3GI8L 2B4CC 3O6FB 2FDBP 4ODVH 1AKJB 3P73A 2DOCA 2FSEB 4HH8A 2YN3A 4AEIH 2ZUWA 4PLNC 1KJVB 4G5ZH 3DURB 1LEIA 5FKPB 1HSBB 5AYQA 4NDMA 4PRPD 4YEEA 4YAQA 3IFNL 4P3DA 4LFHG 1GSMA 1KIRA 2OP4H 1KSRA 1AQDA 3NZ8B 4NNXA 4H25B 1U8QB 3ZT6A 5D7LA 4DFIA 3ARPA 1NCCL 2HRPH 5T1KB 3JUZA 1IL1A 3B9DA 4OLXH 4X5WA 3PV6A 4B7IA 4HKZA 3V6OA 1R3KB 3DXAE 2XG5A 1C1EH 5KZCB 1B0GA 5C6WH 1YEJH 3DX7A 4Z7WF 4IOIA 3IXAB 3H7BA 4D94A 3QCVL 4BFGA 4P3CH 1DN0B 4Z95L 1WTLA 3U4BH 3BAEH 4UDTA 5TGBB 1LE9B 3BI9X 4X98A 4M03A 3SDDB 1KG0B 4WWKC 1NL0H 4CNIB 2CSPA 3U46A 2J88H 3WS3A 4QXTB 4KDWA 1OARH 1A6AA 1QSZA 2FECI 2IAMC 5GS0L 1G6RH 4YDLB 3EFFB 4CMMA 1DL7L 1UZ6F 1UB5B 4I77H 4M1CC 4BSVA 1EJOL 1R24B 2PXYD 3P3YA 4XRCB 4ORGB 3VD3A 4C56D 1MJ7H 4JQIL 4UQ2B 3VXMA 1OY3B 4MZ2A 3FO2B 5IGXL 3RJQB 4Y1AB 4I5BB 1TZHA 4HUWB 3PJSB 4M3JA 4PV9B 5T3XE 4JKPL 1DBKL 3STZA 5IQ7L 1LO0L 2JJUA 5TDNB 3IF1B 1IARB 2C3GA 3QUMB 5LAXA 4OZ4B 3BP6A 3N85L 5C92A 1T1YA 3MOQA 4GAJL 1AGEA 2OK0L 2MQCA 4PJCA 2XQYG 4GXVH 4LKXA 4XMPL 5CEYA 3B2VH 3MV7D 4KQ4H 2X4TB 3E6HA 3KPQA 1ZMYA 1IM3B 3TC9A 1CFSA 4ONFH 4FRWA 4J3TA 4KVNH 4CJ0A 2CMRH 4NPYB 4PLKD 3BPCB 2AJSL 2VZVA 1OGAE 1T1WA 3BRGC 2XICA 5DC0A 4P2OC 4LHUG 1F2XK 3U36A 4ZPVB 3HRZB 3OKMA 3VXSE 5HVHB 4U3HA 4C83A 1KENH 5SWSB 5HD8C 3NTCL 2JK5A 2C9AA 1UEYA 3GSWB 5IR1A 4XPHH 4KROC 4WHYG 4LVOC 1KOAA 5ESVB 3QIWD 2J4WH 4UMGA 3NCJL 3V6ZA 4PGBA 1PKQB 1IC7L 1NFKA 3VD7A 1YC8A 1KPRA 3RQ3A 3SO3B 5KVDH 3RWHA 1OD7A 3NBNA 3HKFA 2FWOB 1HN1A 1AE6L 2NW2B 4WEBL 1UADC 2ENYA 2Q8AL 3LZFH 5IJKA 1FZJA 1ZT1A 1XFPA 5FHBL 2PYED 1N5YH 1KTRL 3G6DL 5F9WB 2R2EA 1N5AB 1BEYL 4DEPB 4PGCA 2DQGH 35C8H 4HK0A 1KEML 4DW2L 4FQCL 4ERSH 3C60C 4OCSL 3NACH 4NUGL 3MRGA 5BS0D 4JE4B 3EUUA 1ONQB 1CXLA 2X4SB 2WK2A 1K4DA 5FFLA 4N68A 1MCNA 1ZVYA 2L0DA 2BSED 1DQJA 2DKSA 1R5WB 3GDBA 3ILPB 4PJHA 3ESVF 2F58L 1O7VA 4GKSA 2BFVH 1RZKH 3LH2H 4O2CB 3RIFF 3RVTC 1PD6A 4W6YB 4ZO9A 1D7FA 2FGWH 3EYOB 3QDME 5LXGH 1OB1A 1IKFL 5EBMA 3B2UC 5IK3B 4QOKD 2Z92A 3MLTB 4EDXB 4OM1H 1I8LA 2NXZB 1EEZA 3ROLA 2OM5A 3N50A 1FDLL 3D2UB 4JN1L 1M6OA 3F6IA 4P5TB 3F65A 5DQJA 5KVEL 3RAJH 2BJMH 5ITFA 3Q6FA 2OXHA 2IBBA 4PGEA 1FNEB 4AZ8A 5I30L 4QCIB 2WW8A 5E8PB 2OMNA 2L7UA 4RFOL 3N1GC 4WFEE 3T65B 4XCYA 3TCLA 2XFXB 2CDEB 4PB9H 5CILL 3HMWL 1DE4B 5FYKD 1MHCB 5DGQA 5BVJB 4DVBA 2IANA 4OCWL 4Y16B 3TPKA 4PJFA 3BKMH 5MENE 4QRSB 1TTUA 5E6IA 4R7NA 2ARJQ 1JK8B 2IQAA 3C6LB 2VAJA 4OCNC 3BQUB 4L3CA 4NO5B 5JXAH 3ZE2E 1TVHA 4I2XB 5ADPL 2P43B 1YNTB 1A02N 3D9AL 2N1KA 4LSUH 4QRTB 5E94B 3HZMA 4N0YL 2D31A 3G6JE 1CDIA 4HWBA 1ZLSL 1B4JH 3OR7B 4QRUA 3RKDD 4OLXL 4KI5E 2B2XH 4M8VA 3KYOA 3MBEA 4WUUA 2A77H 3GMMA 4EBQL 2YZ8A 2EYSA 1H3XA 4BM7A 5CCKH 5J11B 1WIPA 4UUJB 1ZLWK 1BVKB 1QLEH 1SVZA 4JGMA 4RGND 3BGFB 3SKOA 1HI6A 1HXMA 1TVBB 2EIZA 1QOKA 2APVA 3QYCA 5L8KB 1JMZA 1GGBH 2VXQH 3PABA 4WW2F 2AEQL 3CVIL 5I16A 1SYVB 2YSSA 4PP1C 5EU6A 4JZJB 4N0RA 3STBA 3BMWA 1Q9KA 1AHWA 4RCAA 1F3RB 1S3KH 3TYFA 3L5JA 1MJ7L 2OTWA 4R4FH 1QLFA 3BPOC 2Y36L 1WSST 4ZNEE 5A3IC 2XZCL 4PR5A 1RD6A 2ZUUA 3EJZD 5I8OL 5ID1B 3N1QC 2JE8A 4YXKL 3MNWB 5MEPB 2A6DB 1UJ3B 5J1AB 3ZKXB 1NBYA 3DSNA 4JGUA 5FCUH 2OL3A 2UVFA 5C09E 2XZZA 3RX5A 2YBRA 4N8CH 5HDQH 1FSKB 1S9VA 5FKAB 4KDVA 5E5MA 5C07A 4LNRB 2Y72A 1S7UA 1EPFA 4NRXB 5E2VH 1U9KA 2ZSWA 4KKAC 3BESR 4L8CA 4F7MA 2DIJA 4GXVL 2QHRH 3BMVA 5K9KB 3B2VL 3VE0A 3FRUB 3TNMA 3PDOA 1P6AB 2JJTC 4UTBL 5J57B 5FK9B 4KVNL 4WFHE 4JLRA 1SEBA 3PG2A 5A2IH 1DANU 3HNSL 4HS3B 5DVMA 1J0IA 4NOBA 2Y25A 5IESH 2Y6SD 5GPRA 1EMTH 3RP1A 5D8JH 4ZNCD 1ZT7A 2E27H 2NY3C 2HLAB 4GAGH 4X6BA 2F54A 3GB7A 4ZOCA 2R56L 1B90A 2VSDA 3O3BA 3ETBF 1ETZB 5CEZE 1FGVL 3DMMC 5DUBB 2GYSA 3QUZA 4PTUB 3G08B 4GG6B 4HK3N 2FJHA 4RISH 3REWA 43C9A 1J18A 3QA3B 4Y4FC 1YQVH 2DF3A 3WKMH 4TYUA 3NIFF 3VJ6A 4IJ3B 4JM2C 4OZIB 1OP9A 5A2JH 5DJ8A 2FJFB 4MDIA 3CXDH 3VI4E 2J4WL 2OS7A 4I0PB 3ROOA 1T1ZA 3L5XL 4FXKB 3CK0L 4NQSA 3LDBC 4HX1B 2N7BA 2PW1A 4NQVB 1S7RB 3PHQB 4FXGB 2MPAH 4L3EB 1N5YL 4O02L 1UCBH 1KJ2B 3BRDA 1P84J 2YWYA 4PYGA 2DQGL 4NQTA 1A22B 4EXPX 1YY8A 5CHNB 4GBXC 2QEJA 4J3OC 3D3VB 2F5AH 3IS1X 4PJBA 2R0LH 3WHXB 5K33A 4ELME 2EYRB 3NPZB 3QO0B 2NY2D 3Q2CA 2AI0H 3E6FB 1G1CA 3W0WB 12E8H 5BXFB 4M43H 4P57B 5LXGL 1E27B 5AUMB 1KTDA 3J7HA 1UCTA 2I60L 1VKXA 5AWNH 4CKVX 3TO4B 4KTDL 5ICZA 4XPFL 3O4LE 5EN2A 1M7DA 5HHME 3OXSA 2PXYC 4LLDA 4QHLA 3H3BC 4LCCC 2AJXL 1F6FB 3B8SA 3ALPA 3EW3B 3PHOA 4LPVA 1FFRA 2X5PA 3KPSB 1LO5A 4HIHB 1VFMA 1X5YA 2MOVA 2DLHA 4K7PL 5C7XH 1IGFH 1XMWA 3KPOA 3RAJL 4Z7WB 4OKVA 4BK4A 2IH1A 3DUUA 3P2TA 1CBVH 5JHLH 1U8PB 4NCC1 5HI3D 4O4YL 3BW9B 3EJYD 5IOPA 4L4VA 3HPLB 4OCLC 2OXGA 4PB9L 4S2SB 4WHYH 4E5XB 1G7IB 2B1HH 5GRJH 2PNDA 4L4TA 2DRUA 1IBGH 4YGVA 4M61B 4QYOA 5J6GB 3GHEH 4H5SA 3QQ9D 1DBMH 3NFNA 2K7PA 5EUOA 1C5DB 3CX5K 5FGBA 3D18A 5IB4B 3MACH 1T80A 5IB5A 2OSLA 3RWIB 4WI5A 3T0EA 1KBGL 2GAZA 1MCPH 1Y6MR 4PLKC 4DN3H 3OXRB 5BZDB 4NGHH 2HN7A 2J7LA 2B2XL 1X5FA 1LWRA 1T0NB 5H35B 1WTGT 3MTRA 1HHKA 3HZVA 3L3IB 4RGMB 1A1NB 4M9PA 4Y2DD 1BGXL 1RUAH 2DDQL 4UNUA 3P30L 2YD9A 3OAYK 4Y4KA 3B6SA 4LP4A 5LGKA 4HKXA 2ATKA 5F1NB 5GIRA 3BKJH 1T0MA 3P9LB 4WUKL 2BNQA 3VH8A 4YWGH 2VXQL 1QSFD 3IU3B 5FM8A 2X1OA 3QIUD 4ONHA 4IMKC 4UV7L 3GBNL 4CGTA 5I1DB 3EHBC 5F93C 2IQ9L 1N3NB 4LLUB 2OJEA 1NCTA 4P3WA 1J8KA 2Z8WC 4OZFB 3KLSA 1MCRA 4LVHC 5IVOA 1EK3A 4LIQH 1LK2B 4R4FL 4ELKA 2Q6WB 3H3KA 3BZEB 4X6EA 5E2WH 3FB7B 4B41A 2EDBA 2IBZY 1UKQA 4Y19E 5GRVL 4APQD 1S7XB 4XVUC 1I1YA 2EZ0C 5FUZL 4LF3B 1FVEA 1AJ7H 3PP4H 4UT9H 3S98A 2XZAH 5I75C 3I3DA 5DS8A 4G8GE 1FFNB 1HOCB 5J12B 3MNZA 1UJTA 1CCZA 4EKXA 1CLYH 2NX5A 2VLMD 3SGEI 2R69H 5JA9A 5FA3A 5FYLH 1ADQH 5IESL 5IVNA 3LV3B 3OG4B 2ATPA 3PQYA 1W0WA 2AXFB 2LAGB 2X10A 3GJEB 4S1SL 4GAGL 4IRSC 4Q58C 3UTZA 3MSPA 5D7IF 3H3PH 1A7PL 4HEPG 1U8JB 2AV1A 4JY6B 3EO1B 2IPTH 4H0GA 4OM0L 1KB5A 3ARQA 1QRNB 3P4MB 4L3AA 4XC1L 3B3IB 4RISL 1PGRB 5HI5C 1WZ1H 3GSNA 4X6DF 4HIJA 3VGEA 1T4KA 1YQVL 4FQXB 3WKML 1WAAF 1MCCA 4X4ZA 2BMKA 4OB5L 1N0XH 4F7EA 1CFNB 1I7ZA 1NGYA 1GZPB 1EXUB 3CLEL 3ZT5A 5KG9B 4P49A 3DXAD 4Z0BH 2KKQA 5CJXC 3U30B 1BD2A 5D1XC 4ODXB 1HHGB 4H0IA 1I7UB 4JZOA 5D2NB 3WJLA 1YDPA 3KJ4B 1L7TL 4PJDE 2VRAA 2CR3A 1RK1A 1UCBL 2NY1C 4HJ0D 4KXZH 1AD9A 3RKDC 4G8IA 3FB6B 4O51B 3EO9L 3SDAD 5JHDA 2WQRA 2F5AL 2G75B 1KT2A 1DQDH 3BP4B 3QNYB 2BVOB 3BP7B 2R0KL 3LKOA 4OF3A 5DJYB 2DLGA 1IE5A 3R06A 4RGNC 1Q1JL 3IJSB 4RIRA 2PO6C 3VCLA 1ZHKB 4UOJA 1W72H 1ITCA 4K71C 5DMGD 3BZ4A 4HS6B 4JDTL 1FNGA 2BC4A 5HVGB 1H5BC 5T3XD 2F9BT 2P5EE 3GMOB 2ZUYA 2YD7A 2YPLB 2QQLL 1LO2L 1XR9A 1JF5A 1I7RB 3QDJA 4YHIB 3RU8H 3MLPA 1LP9E 1BMGA 1WJ3A 4CW1A 5C7XL 1IGFL 3WIFB 1FAKT 2ZCKH 4NNYB 3TCXA 1BIHA 5JHLL 1KN2H 5D6DC 2WWKO 4D8PB 1XGUB 3IDJA 5HYJA 3KPMB 3S34H 3HG1E 5HVWA 4ODWB 3HNTH 1YEHH 2C5DC 1MCHA 3PWPE 4MSWB 2H9GA 4PJIE 4HUVB 1Q9OB 4O9HH 2ADIA 1OGAD 5AYUH 4WW2B 4QRPA 4PD4J 1KIPB 2WV3A 4LPTA 3QAZB 3MMEB 1I8IA 1EA9C 1JGDB 3QXDB 4MAYD 1H3PH 1VFUA 4H26B 43CAA 4N1HB 4WTZA 4TSAH 2DWDB 3VXSD 1MCPL 1NC2D 4MS8D 4FNLL 2Y6SC 1T3FB 5AAMA 3RL1A 1QSEA 4NGHL 2AJUH 4Q6IA 4JHBA 3L3DB 3ALWA 4LEXH 4HBCL 4PJ7F 1TITA 5HY9A 2EEDA 3DRTB 3DWTA 3MRBA 3PXJA 3DO7A 2VQTA 4ZO6A 4UT6L 1MLCB 4L5FL 5JPMA 5CBEA 4OZFG 5M7QA 2A38A 1SBBA 2I07A 3C5ZD 1JIBA 4NO2A 3U9UA 4ZFZA 4NZTL 3FT4B 3X11B 2Y5EA 3DETC 8FABB 3B5HA 3ZE0E 3ZDZF 3BKJL 4NKIH 1QFOA 4BUGA 1FFPB 2VE6A 3KHQA 2X70A 4LLYA 4LLVB 5BZWB 1NH6A 3LKNA 3WKNA 1K5NB 4MD4A 4OGXH 5HYSA 4DKFH 1CFVH 1YMHA 2MSPA 4K3HA 4P2OA 3P0YH 3TT3L 1KCKA 5C9KA 4RWYL 2BNRB 4RX4A 3MNVB 4M5YH 4NJAH 5KOVC 5EO0A 5DRXA 2WNGA 5ALBL 2L4OA 4HF5H 5E2WL 1PAMA 3DV4B 2E7BA 2VLLB 3NIDE 3QDMD 1RZGB 5CJOL 4NQDB 1RHHB 4Y1AE 1DDHB 1PEWA 1U93A 2FLBT 3O6LH 2J3SA 2OI9C 3SDCD 4F80A 5L2KB 4X7SL 5I1KH 2AXJA 1K8IB 3I6GB 4UT9L 3TVMA 1KFAL 2W91A 3BKYL 5D5MF 1FRGL 4U1MA 5D7SH 2XKSA 1SYSB 1P7QA 4PRNB 4G43B 3RNQA 3TESA 2VDQL 4R2GB 1AXSA 4XXDB 1Z5LA 3H0TB 4LSRL 1WGOA 3C60A 1CGSH 5T33L 2R69L 3IDGB 4OI8A 3X17A 5I1LB 1ADQL 1PY9A 1UENA 3BSZH 5I2IA 5EU5B 3LEYH 2O61B 3HE7C 2SEBB 4U1KA 1FQ9C 1CD1B 5GQBA 3TWCH 4NO0D 3CX2A 5DVKA 1BFSA 5JQHC 4L8SA 5MEND 1MI5E 3NMEA 1MELA 5MP6H 4TVPE 1MPAH 4OQTH 4PY8I 2YUXA 1R3IL 4RRPA 2AQ2A 1U3HC 3EJYC 3F7VA 4U31A 2X4RA 1T66C 3CSYA 5EFIA 4X9HA 5GZOD 2D0FA 4QTHB 1G6RA 1J1XH 3CUPA 5SWSE 1LEGA 1J1OL 4IRJB 5HSFA 1MFDH 1LO3H 4WWID 5BQ7A 2CIIA 1PX3A 4ZXBB 2GK0A 3ZTJG 4KI5D 4JKWA 3GO1H 3PWUB 4X6FB 4M6NH 2AK4B 1NGZB 1Z9LA 1PKQE 5IFJA 2HP4A 5F8RC 3GNML 1ZWIA 4UIMB 3LKQB 1PZUB 1A3RH 2EDWA 1VCAA 1B6DA 3OKEB 1IT9L 2AEPL 2C1OB 2IEPA 4PJ8D 1X5ZA 1RK0A 5AEAA 4X9GA 5HPMB 5IEKB 3U9PH 1RZIB 3THMH 5IROA 3AS3A 3BRFA 2J5LB 1DQDL 2EYTA 3JV6A 5TF0A 2GSIA 1JTTA 3AS0A 1FN4A 1U58A 2JIXA 3C08H 1JWMB 3BN9D 2DI8A 4P4KC 1WWAX 4NFDA 3ZLQC 3IAGC 4NWUH 5IVXA 1UB6B 4OV5B 1W72L 2GCYA 4LCUB 1J10A 3CDCA 4QHKJ 5DHYA 4OD3H 4LVNB 1NCBL 1WZMA 4TSBL 3VWJD 4JG0H 3V0WL 5D7JA 1U92A 2AGJL 4NQXA 3ARBC 1BQUA 3IFOB 5C09D 5LWYH 5I18L 1EIBA 1EFXB 1INDL 4YZFF 1FLRH 3VXQB 4DGIL 3RU8L 3EOTH 4TUOB 2DYPA 2OTUA 3BFOA 4CDHA 1EEYA 1NCAL 3L6FA 4KZDH 3U4AA 4BFIA 4PJCF 2ICWA 1CYGA 4Z5RB 1L9NA 4FQJL 1BX2A 5C86A 2VDLH 2PF6A 4YE4H 1KN2L 3L7FA 4JO4H 1M71A 4WFHD 5EO9A 3S34L 3QEHA 3X3FH 1YEHL 3HN3A 3N06B 4GLRI 2RFXA 5TE4H 2VDKH 4ODBD 2V5SA 5C2UB 5TH2A 3DX6B 2JJSC 3P4NA 1ZS8A 4MJIB 4U2ZA 3OB8A 4LCYA 1T2QL 3DROB 4WU7A 4FZEL 3I2CH 4MJ5A 2ZZUT 5CEZD 1BAFH 2DQCH 2HFGH 2JKXA 4GMSH 3LHPH 2IPUG 1RUPL 3T77B 5K9JH 4I2XE 5D2LF 3NA4A 5I17B 2YR3A 1VEOA 5INDB 1UXWB 2X4NA 1U8IA 1MRDL 4N0UA 2AV7B 2AJUL 1JP5A 1MREL 3ULUF 1XF2B 1KYOJ 1U42A 2VH5H 1ITBB 1WCBB 4JFPA 2WINA 3DUHA 4WGVB 1RMFH 4MNHB 2VWEC 1OAKH 5CBAB 5B39B 4LU5H 4UT7H 3BH8A 5IW6B 3AROA 3CZFB 1D5BA 4FFVD 3GUTB 2JJTA 5K9OB 4U6XB 3HFMH 1A7BA 4G9FB 4M7KH 3MV8E 3QB7C 2HT3D 3IDNA 5C0JB 1FYTB 2DLFL 1JI2A 3WSQH 1DEDA 3BXNB 1AGCB 32C2B 4NWTH 2CQVA 4Z7OF 3HUJF 4JB9H 4DKFL 1CFVL 1MHEA 2PTTB 2Z31B 3OHXB 3P0YL 2GJJA 3QPXH 4MXQD 1HH9A 3DMMA 3DBXB 1MJUL 3L1OH 4NJAL 2A6JA 3NCBB 4PJHF 4JEGB 5J89A 4AT6A 3V5KA 2H1PH 4EDWL 4XPAH 5D7IB 4HJ0C 4XWGL 1D5IL 1MFCH 2BVQA 4D3CH 1JGUL 4Y4FA 4JN2A 3BT2H 3LSOB 3S4SA 4JHZA 4ZOAA 5E8NB 3TBYB 5CZVH 4JM2A 3NPSB 4J3UA 3SDXB 3SDAC 3QUKB 5DJCB 4J3SA 4QHUA 3G5XB 3O6LL 4OKDA 3K1KC 4PRPA 1WF5A 3O4LD 4KRMB 3QXAB 2R2HB 5HHMD 1SMOA 3HPJB 3L7EB 5D7SL 2LFGA 3GJFK 4G6ML 3LRGA 5GGVY 4CUCA 1NBVL 2YRPA 1P4IH 4AJ0A 2DS4A 2MKLC 1EO8H 5HHXL 5IHUH 3QUYD 1A6PA 3BVNA 3AUVA 2H26A 4GBXA 3T2NL 5KSVA 2R1XA 4YDKL 4DTGH 4LOUD 2R0ZL 2VDOH 2HH0L 4L29B 4OZFH 1UA6L 3TWCL 2GJZB 5FECA 5L0QC 2UWEA 3A6BL 3MLRH 3C5SB 4PJFF 1OOAA 4MXVE 1P5VA 1JZ2A 1D6VH 5GGTH 3MOAH 5MP6L 3QWOA 3WJJA 3B5TA 2NY0D 5IMKA 2C7UA 3CVHB 4PGJA 4GG6E 1F97A 4HH9A 5ITBH 2W9DH 3C8KB 1U95B 3MA7A 3IVKA 4M48H 1UKSA 3V5DB 1KB9K 1SMAA 3MUHL 3MGOB 3RDTB 4HLZH 5TPWL 4YHYC 1T20B 2DMCA 2OZ4H 4LCCA 4OZIE 3NZHH 3OJMB 4MLSA 3GO1L 1U3YA 1QEWB 1MUJB 3I3EA 4M6NL 2EXWD 3PWNA 3SY0A 3DVNB 1K4CB 3AS1A 3LEVL 3CDYA 2B7DT 1X7QB 5D1ZB 1A3RL 1SY6H 2FX9L 3C2AH 4WO4D 4J3VA 2BVUA 4L3EE 5KAQG 4DAGL 4J23A 5BRZA 4LGPB 1WBZB 4LFHD 1VFAB 3ZTNL 4F58L 2EH7L 2NMSA 4LCWA 2E7CA 3QR2A 4RMWA 3EZ8A 5IVZB 2QADD 5HYEA 3TBTA 3BE1H 4D0CB 3CH1A 4JQVA 1A6VH 3C08L 4GW5A 5C0RH 5DYOA 1XIWA 2CIKA 3FB8B 1HWGB 1OTUD 3W0WE 4G3YH 1QVOB 2DJSA 5F1IA 1OF2B 5T3XL 4OD3L 1D9KC 3PIQB 3MROB 3Q1SH 4Y19D 2FHCA 2JTDA 5B4MC 3KPLA 4Z9KB 5GZNC 4UB0H 2FIKB 1SBSH 5EH1A 5LWYL 3HE6B 4E0RA 5J1TC 1ZVSB 4PJ7B 1EBAA 4FQ1L 3EOTL 5HHNA 1FZMB 3U1SH 2Z4QB 3KPSE 1UVQB 4JFHE 3DVFA 4G8GD 1F4WL 1XGTB 5KVGH 4F33A 1PY4A 2FD6L 3ABZA 5MEOA 4JGJA 4XI5D 1TNMA 2JCCA 4Q9QL 4YUEH 5KANG 4HIIA 5DRZA 4QXUL 2EDKA 2VIRB 2HMID 3W39B 5TE4L 3ZTJH 7FABL 1PKOA 1IGJB 2DM4A 1HYRC 4EI5D 5FDYA 3H42H 4N9OB 3QUXC 4HEME 3GSXA 3GHBH 5GGSB 4JJ5A 1UQSB 3MCLH 5B39G 5GS2H 4J3WA 3OGCB 4U1NB 1Q94A 2VAAB 3F7PC 3U6RA 2MJWA 4ORZC 3I2CL 2EICA 1UZ6E 4GMSL 3V95A 4XNMB 3IDMA 2E8YA 1H8NA 3CLFH 3A67H 1ODAA 1XH3B 2DQFB 5FV2A 1YPZE 1CDYA 1JHLL 3GKWL 1B6UA 4ALAL 4KK9C 1A0QH 2E9WA 1ZLVH 3MUJA 3FRPG 3BX7C 2OR8A 3O8XC 3I75A 2FO4A 3QFDB 4U6VH 4UAOB 3GIVA 4KVCL 1OLZA 3IFPB 3SCMC 4LAQH 1P6FA 4LU5L 3KNBA 4HWZB 2KZ1B 2Y07H 1I9RH 1CLZH 3WL9A 3U2SA 3W5MA 3O9WD 1UACL 5D5MB 3CZJA 4K3EL 3BD4A 5SX5K 2XWBB 5GZOC 1WWWX 1JWUA 2YK1L 4KUCF 3LB6D 5LCVL 5CP3H 5D93B 4OZGF 4L9LC 3EZJB 4HHAA 1NFDE 2P45B 4JFDB 5C8JA 4JO2L 5F6HJ 4MCZA 2CKBH 4IRSA 4LHUA 4XX1G 3OSKA 3SN6N 1DVFD 4G6FD 4ZSOE 3QPXL 3PL6B 3GMLB 1J11A 5C0GA 3L1OL 2XKNB 4GKNA 4UOW0 5DRNA 1I1FA 5ERWB 1T5WA 3P73B 4FS0A 3T8XA 3VXNA 4BYHA 1F90H 4J4PD 4QWWD 1WLHA 4P99A 3ZHKA 1YNKH 1LEIB 4NDMB 5CZVL 5JR1L 1S78C 3MV11 1Y6KR 3GSRA 3M17A 4YAQB 1TPXC 3E3QE 4P5MA 2VLRA 4P3DB 2DBLH 1RZFL 4JDZA 1QFWI 5CIPB 1KIRB 4WU5A 4DKEH 2P5ED 1AQDB 3DARA 4NNXB 3TJEH 1F4XH 5CJXA 5D7LB 1P7HL 5D1XA 1IL1B 1GC1C 1L7IL 4JKKA 3PV6B 4X5WB 4HKZB 1BIIB 4XWOC 1B0GB 2GTZA 3DX7B 5K59F 5IHUL 3DYMA 4IOIB 4WTWA 5CP7A 4M8QB 1FCGA 4UDTB 4HKBA 4DTGL 3HG1D 2PTUA 3LQZA 5EOQL 3PWPD 3U46B 3WS3B 3MLRL 4J8RA 4P5KA 4MCYA 5KVFH 1A6ZA 3BO8B 3IDIA 3O6FD 5KS9A 1AKJD 4PJ5A 3MOAL 3MYJA 2P8MA 3TO2A 4PRHA 5DFVC 5C3TA 4CMMB 1A6WH 2PO6A 4Y5YA 3S8WA 1OAXH 4GO6B 4WY7H 4BSVB 3RY5A 1QRNE 1C08A 1H5BA 2HLFD 4M48L 4P2YA 1L6ZA 3FQUB 2NY7H 3GSQA 5KW9H 4F37K 3VXMB 5FO8A 4IBLT 3DURA 5FKPA 5EOCJ 5IWLC 4JCLA 1PBYA 1GOGA 3NZHL 3OKDB 5FGCB 5C0CB 1HHIB 2HG5A 2OYPA 4DKDC 5T1KD 5H37G 3BUYB 5D6CA 4IRZL 3STZB 3KPNA 1U91A 3ARFC 3NZ8A 2VLKD 3D39A 5LG1A 5JW5A 5D2NE 4CMHC 5LAXB 2XG4A 3C2AL 3CFCH 2OR9L 4HUNB 1T1YB 3B5GA 2ZUXA 2A83A 4PJCB 2VNCA 1MIEH 5EA0H 2NXYC 4ZAKC 4LKXB 5DRWA 3SDDD 2WUCH 2F53A 3TJHC 3E6HB 1CFSB 4JFFE 5BVPH 2RJMA 1D5MA 5DEFA 5I8EB 4XPTL 2W9LA 1F4YH 5TGBA 4DVRL 3NA9L 3MO1A 4TTDD 1GC1L 2A1WL 4CNIA 4I3RH 4NCC2 4PUBH 1T1WB 3AVEA 3ULVF 4QXTA 2HT3C 2FECL 1NC4A 5SX4H 4G3YL 1KIQB 4GW4A 2D4FA 4RZCB 8CGTA 4JFEE 1ADQA 3U36B 5HGHA 3MUGA 3Q1SL 4CN4A 1EAPA 3BPLB 3OKMB 4UZGA 3TM6A 1T83C 2FH6A 4M3KB 2O5XL 3WNPA 4JRXA 4MXQC 2H3NB 4C83B 1G1YA 1CGTA 3O4OB 4AY0A 2JK5B 3U1SL 4KPHL 4OIBA 4LSTL 5LQBH 1G7MA 4PV9A 4MB5A 4YX2H 4MZ3A 4PGBB 1KPRB 3RWHB 2AW2A 4JHAH 2ZCLH 4D9LL 1OWWA 5C0BA 1I8KB 5F9OH 1EAJA 1FZJB 1ZT1B 3WEXB 3UTTB 2R2EB 1UM5H 2NZIA 3GHBL 2KDGA 3MCLL 1X3DA 4R3SB 4PGCB 4HK0B 5KANI 3HUJB 5CUSH 2EEAA 2D7TH 3SQBA 1NDMA 3MRGB 1NGQH 4OCXH 1MI5D 5HHOA 4TVPD 1RUKH 2WSKA 1DQJB 3BPCA 4PJHB 2DN7A 4I3SH 1A3QA 1CS6A 1IKNC 4GKSB 3BN3B 4GFTB 5I9QB 1AR1C 3RZCD 1FCCA 1SJHA 5SWSD 1OB1B 3TIDB 2EE2A 1BJ1J 3UC0H 3HRZA 1MCSA 5A16B 4HCRH 2Z92B 5E8DH 4LAQL 1C12A 1REIA 3KYKH 5B8CC 2NY0C 1IGTB 1I9RL 4S11A 1E0OB 4POZC 2GKIA 4RMVA 4ZUUA 4GUPB 1EEZB 3GSWA 3ROLB 1W72A 2UUDH 1HKLH 5FYJH 1H3TA 1I3GL 1M6OB 3FZUD 5I1IH 4H88H 3LRHA 3S9DB 5DQJB 3HE7A 5ITFB 3Q6FB 3WXVL 3NCMA 1WQVT 2CKBL 3HMXL 3FOMB 2R4SH 4TQEH 2FWOA 1CZ8L 4NNPH 4XCYB 3TCLB 1A5FL 4Y4HD 2BNRE 3RPIB 1JPSH 4MJ2A 3SPVA 5DQDL 4DVBB 2IANB 1U3HA 4PJFB 1F90L 5E6IB 2JLLA 1HDMA 4R7NB 2UV3A 1KGCE 2IQAB 5B3NA 1NMAH 1ZT4A 4L3CB 1MH5B 1TVHB 5KVMC 4NQDE 3I84A 4YK4B 2DBLL 1OT1A 5IIEA 5ISZD 1INQA 1N59A 2J6EH 1MHPH 3IRPX 1F4XL 4HKJA 2YD1A 1LK3L 2D31B 1CF8L 1K6QL 1GVIA 2NXZD 4QRUB 1OTUC 3KVQA 1JL8A 3KYOB 4F57H 3D2UD 3MBEB 5LKNA 4P5TD 3BWUC 4WUUB 1P7KA 2DQJL 3GMMB 4R97B 4YBQC 1N64L 4IRJC 2EYSB 4A6YB 3CMGA 1U8OA 1TZGH 5I15L 3SDYH 1I7TA 2Z91A 2FIRT 4HGWA 4YXLH 5IB2A 3SKOB 1HI6B 4E41A 2RCSL 4GSDL 1FNEA 1ZE3C 4P4KA 4M1DH 4Y16D 4O2EB 1CI5A 4M00A 5JOPD 1VADA 5I16B 4K9EC 3T65A 2LTQB 1GGUA 2GJ6A 2YSSB 5EU6B 4JR9H 2CDEA 5JLZA 3C6LD 3OL2A 2W38A 3D48R 2ICEA 1Q9KB 1AHWB 4P46C 3UMTA 2HMIC 1NAMH 1QHPA 2NY7L 5KW9L 1Z2KA 1J9CT 3ARBA 1MEXH 4PR5B 5DT1L 1U41A 5AG8A 3GMNB 1L0QA 1YECH 5IKCA 3TBSA 3MJ9H 5D71L 3I9GH 3LN9A 1NMBH 3MBXL 1MFEH 1NBYB 2JB6B 2CH8A 1JGVL 2OL3B 3WHE0 2XTJC 4P2RB 2AK4E 4LARL 2YBRB 4PRIE 1S9VB 4C59B 1PQZB 5E5MB 5C07B 5JDJA 4U0RB 1S7UB 4H20H 5GGUB 1KCVH 4Z7VE 4IOFD 2ZSWB 3MV8D 2IPKA 4L8CB 4F7MB 2VXVL 5TQ0L 5F96L 1UH3A 3VE0B 3TNMB 4QTIL 3ORJA 5I73C 4JLRB 2JJSA 5BVPL 1SEBB 3V2AR 5JTWA 3K80A 1F4YL 5BV7B 2ZG2A 3S37X 2D3VA 1D5XB 3UJIL 5IJVA 2Y4SA 3HC4L 5C08A 1FYHB 3S37H 5T3ZH 1ZT7B 2P42B 2Z0BA 2J8HA 2F54B 3TV3L 3GB7B 3MXVL 4YEFA 2H2SD 3O3BB 1GIGH 5FA4A 2K3TA 1K8DA 2BVEA 3FFDB 3OZ9H 4JZJA 4CU8A 5GXBB 1CGWA 1DVFC 2FJHB 4LSQL 2B8OT 43C9B 4JPVH 4U6YA 2L7JA 3VJ6B 4OQTA 1LO4H 2HJLA 2YD6A 5DJ8B 4K9EL 4G80B 3KLHC 4CVZA 4HWEH 3CX5J 1ZLWH 5EZJB 3ROOB 1LE5A 1T1ZB 2I24N 2W9EL 2R1WA 4NQSB 5CSBA 2ZCLL 1M7IA 4XPBL 5FKAA 3MLXH 1MIMH 3AU1B 3VFMA 2C3HA 1RZ8A 1MF2L 2PW1B 3QG7L 2RAMA 3P9MA 1BJ1H 1UWGH 2AK1L 4OCMC 5H2BB 4M5ZH 1Z9OA 2XN9E 3MV9A 3WO4B 4M6OL 4Y8DC 2F8OA 1AY1H 4TNVK 4FG6C 1RU9H 5EULV 4TPRH 1YY8B 4MJIE 3SJVE 5FDWA 1NGQL 3SGEH 3U7AA 4HS3A 4UINH 1V05A 3L5IA 4HZAA 4PJBB 5ETUA 4W70A 2EKSB 2IALA 2QKIA 4I3SL 3TA3C 1KULA 4Q6YA 5EU7E 1NLBL 3WE6A 5HHPA 3MLZL 2X4UA 1NKRA 4NP4H 3UEZA 1L0YA 1PJ9A 4CDGC 1KTDB 5ADOH 5DUBA 1ZHLA 4Y5XB 4LGSB 3KYKL 5DFTA 3QH3A 4YHNA 1KCRH 4P0DA 5ICZB 4DN4L 5EN2B 4I0PD 1M7DB 3OXSB 1PG7W 5GISH 5CGTA 4YPGA 4QHLB 1CDBA 3MRJB 2KQMA 3QPQD 4ZS7H 5L88H 3PHOB 4G9FE 4FP8H 2B39A 1LO5B 4FXLA 3RHWK 2FJFA 3BPNC 4L3ED 3KPOB 5C71A 5DUPH 2ZPKL 4JRYA 3L3KA 3N0PB 4G7VL 4OIIL 2D7NA 4OKVB 5T5NF 2IH1B 2R4SL 4F8TA 5I19H 1NUFA 1N8ZA 2XQBH 5EIVA 3ALXA 3VFRB 1ES0B 4L4VB 1S7RA 4NCDA 5GRUH 1RSFA 2Z35A 4X5XA 4L4TB 1JPSL 4YGVB 1S7QB 5EUKA 5D1QD 4OFPA 5F6IC 4H5SB 3QDAA 2V7NA 4M02A 4L8BA 5E9DE 3W9DA 1CE1L 5D7IE 4MMZC 4IDLA 1PSKH 5EUOB 2VSCA 4MX7A 3W0WD 1HK6A 3D3VA 3QZWA 3FAWA 1A1OB 3D18B 3WFBH 4EUPH 5IW1A 3QO0A 1EGJL 3SDXE 1BF8A 1G7LA 3T0EB 3T4AA 3AM8C 2D0GA 2J6EL 4K94H 1B0RA 1HILA 2GAZB 3NCEB 4TTDC 3FO0H 1WAAE 4P57A 2HN7B 1E27A 2R8SL 3CSBA 3UO1H 3WYRA 1NGWA 3R1GH 4F57L 3IJHB 2YMXH 3KPSD 4OFYD 3RBSA 1HHKB 3HZVB 1E4XH 3E8UH 4JFHD 3QI9D 3STLA 4GS7B 3TO4A 3HLAA 4R7DB 1IILE 5E2UL 4JO3H 4YHMH 4Y4KB 5EWIH 3SGJC 5DMIL 5EOCL 4HKXB 2ATKB 1DP0A 1TZGL 3SDYL 4OCYL 1T0MB 4YXLL 1NJ9A 3ZHLA 5KSAC 3VH8B 3O2WL 1OTSC 2D0HA 3HR5B 5DD3L 4Z7WA 1XAUA 4WGWB 5HGAA 2KZWA 2OJZH 4ONHB 4LDEB 1G7IA 5T1DL 2EE3A 1D9KA 1QLRA 1IC5H 3KDMA 5DHVH 3R8QA 1NAML 5DC9B 1NUNB 5CIPH 4ELKB 4RGOH 1ZGLA 1N26A 2PYFA 1MEXL 5DJZB 1QTYT 1YEIL 5CWSB 4ZDHB 1RIVH 4X6EB 5E08L 4MJ6A 4PJAF 3C2SA 5IB4A 3I9GL 4CRPA 1G0XA 5MERB 4HAFA 1JMXA 4LASH 5DWUH 5DMJB 1I1YB 4KUZL 6FABL 2HT4D 5FUCC 4YHZH 4HSQA 1CFBA 1FVEB 1NGPH 4H20L 4P23C 4F9LC 1GGIH 3QDGA 5DS8B 1BQHA 1NCWH 4X6CE 3N9GL 4ZUTB 1NUDA 4RAVA 5T1LA 3DI3B 4I48A 2NY6B 3BIBX 4NN6C 4W4NA 3RZCC 3L3IA 1OQXA 4XHJD 5M95B 3QUXA 1GH7A 5IFHH 3DHMA 3V7MA 1I3RA 2NX5B 2YS4A 4Q9BA 3OKOA 1H0DA 5FA3B 1EHAA 2X9YA 3FQTA 4NQEE 2ATPB 3P9LA 2W0PA 3PQYB 1KLUA 1W0WB 1N6QH 2AABL 5C0AD 5JUEH 3UXFA 3UTZB 1RJLA 4K8RH 4UBDC 3F58L 3P0VH 2AV1B 2APFA 3RWCB 5E1AA 5I1DA 3O8XA 4M7LT 4V1DD 2VMFA 4GRLD 4OZFA 4OUUA 1LEKA 2LV4A 3SCMA 3H7LA 1ERNA 4LPYA 4HIJB 1TQCB 4JPVL 1FFQA 1T4KB 1DQML 4MNQA 4Y4HC 5E5RB 3PGFL 2R4RL 5GGTA 4I9WE 4HULB 3FB7A 4G6KH 4F7EB 3OAYH 3Q5OA 3L3HB 3CU1A 1GGCH 1BWMA 1UFUA 3CPLA 4L9LA 4ONGL 3GRWL 2MWCA 1BD2B 3MLXL 2ADGA 4YHPA 1E6JL 3O41A 1TZIA 1YDPB 2D9CA 2X4OB 2OZ4A 4OGAD 1VENA 1A4JA 1RK1B 5L9DL