1B6UA

Crystal structure of the human killer cell inhibitory receptor (kir2dl3) specific for hla-cw3 related alleles
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
199
structure length
199
Chain Sequence
HRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Killer cell inhibitory receptor
molecule keywords P58 KILLER CELL INHIBITORY RECEPTOR
publication title Crystal structure of the human p58 killer cell inhibitory receptor (KIR2DL3) specific for HLA-Cw3-related MHC class I.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 1999-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b6uA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1b6uA01
4Y1AB 4P3CL 1YEJH 4YK4C 5GZOD 1Z0NA 3PHQA 4MZ2A 3I3BA 4PB0H 4NN6B 3V4PL 1WIOA 1OQOA 5JUEH 4V1DE 5DVLA 3VXSB 3G6AA 4NFDA 1ZHKA 3KPPA 3QQNA 1R5VB 5EU5B 1WBXB 1NKOA 3ARDB 1BFSA 1FZJA 1QKZL 4MHHI 2K9UA 4G42B 4PJDE 1OAXL 4DKAA 4YHLL 3VRJB 2C4FU 4FQIH 3U9UB 1E27A 3LPFA 2M1KA 4FMKA 1BZQK 1GHFL 2VWEC 5CP7B 4NGHH 1T2QL 4Z77A 3WXVH 4PJAE 3U2SB 2Q86A 4MNQB 5DDHA 1WEJH 1OAUL 3FFCD 1GOGA 4LLMB 5GJTH 1A7OL 2VL4A 5EO9A 1JP5A 3L9RA 3W11D 5C9JB 2IBGA 4M6OL 3V6FB 5L2KE 1KN2H 5C1MB 2BSSA 5KOVC 4NCC1 2ICEB 3VXOB 1EBPA 5INDB 2V2XA 4WTZG 1QSEE 3QYCA 2O5ZL 2ZZUT 1CXEA 4MJIE 4NQUA 3S36H 4HS8H 2AJYH 2GI7A 4JDVB 4RMWA 4JQXC 4YFLF 1WZKA 3DO7B 4NOBA 5LQBL 1A1NB 4NQVA 3RIAF 5E2TH 4HHAA 5EN2B 5FM4A 4X7SH 2F53B 3UPAA 4R7DA 5JXEC 1CFSA 4UV4L 4TRPL 3LCYA 4I1NB 5D1XA 1TVDA 1FYTB 1RK1A 5FEBA 4XVSL 4YAQA 3AROA 4Q9QL 1YNLH 2Q8AH 4Z7UE 2WBJA 3RVTD 3LKSA 5FO7A 1GGBL 4ZD3H 4NHUB 4M3KB 5IHZA 4QF1A 2XZQH 2Z8WC 4OGYL 4WUUD 2DMBA 4JFPB 3QXVA 4D9RD 1RJLB 1S5HB 3DARA 1T66D 3GBNL 3GHBH 4OGZA 1WCQA 4PGBA 4Y2DB 5EPMA 4DN3H 2RGSA 4MGXA 3PNWA 2V7NB 2R69L 1NJ9B 4PPTA 1XGRA 4E5XB 3EYSL 4FRWA 4XX1G 3I50H 3O6FC 4XP5H 2BNQE 5KS9B 1T83A 4Y4HB 4JFEA 3N1MC 5ALBH 1CXFA 1OGAB 4L8SA 4Z76B 2FB4L 3T09A 4M9OA 3T0AA 2P8LA 2UV3A 4X4YA 5ID1A 4FQQB 3WIHL 2MTPA 2HH0L 3K8LA 3T77B 4I48A 4MHHG 3QJFA 1BAFL 3QR2A 2JCCB 3RNQA 1IQDA 4DEPC 3CLFL 2X4QA 3NOIA 2WUCL 3H9HB 4C56E 1KLFA 1TETL 4ONGH 1I1FA 2ZPKL 1GGIL 5K93A 1T1YA 1U8LA 4S1QH 4ZPTA 5D7LE 1R3KA 5DMJB 1NAML 4NC2B 4MLSA 3LKNA 1F8TL 1MCKA 4EN3D 3LMJL 3TPUB 2ICWB 5LGKA 2OP4H 5E08L 3WDHA 4P59H 1KGCD 2BVUA 4O5LL 4ZFGL 4ODTH 4ZSOB 3LV3B 3ZDYF 1NUFA 1QFOA 4DN4H 3RWDA 1AIFA 5JQHC 5HYEA 1M7IA 1BOYA 4MA8H 4JANA 3H9ZA 4AG4H 1JYWA 1XIWA 5J13C 1U58B 3EUUA 3TA3D 1XR9A 4XNMB 5MEPA 4NZTH 4L9LC 2XQYK 3SE8L 4PBXA 1NGWA 4XMPH 4YBQC 5C0CD 3SDCD 1TTUA 4EDWL 4NN5B 1T1ZA 1KLUB 1P4BH 1LEGA 1F5WA 4UDTB 3DVGB 1B6DA 5HTSA 2HVJB 4Y5YC 2J8HA 3INUL 3LKRB 2Y9RT 4X7EC 4Z0BH 1RZJC 3PG2A 2HVKA 1KG0B 4UTAL 4N9OB 1MFCH 5TE6H 5C0IB 3SDAC 1G7QB 3BPOC 3PHOB 2GUOA 2GSGB 5L8JB 3ESUF 3MR9A 3ZTJG 1H3VA 2PXYC 2DQEL 3QCTL 4RISL 5CBAA 3BMVA 5D8JH 3L5IA 5DMKB 5IQ9A 5IFAH 3LKQA 2R9HD 3KPRA 3QSKB 4UZGA 2AJXH 2NZ9D 1YEIH 5AG9A 3IFNH 3FFCE 3ES6A 4HWBA 3CLEH 3ARPA 1J8KA 1FORL 3NFNB 1J0JA 2VC2L 3VI3E 3QQ3B 5FYLL 4ZPVA 4HK3J 2O5XH 3QRFM 5BRZB 4K94H 2R1YB 1MCEA 5BVPH 3LEVL 4WCYL 5DHYA 4PJXF 2B4CH 5MP6H 3UYPA 2E5EA 3WXWH 4XPBH 1QACA 3BUYB 1RSFA 1CGUA 3QEUB 1J0HA 4H1LA 4EOWH 1BLNA 2P1YA 5CJBA 1BJMA 1S3KH 2YUZA 4OKDA 1TNMA 1J8HD 4ZAKA 3V5HA 5IG7A 1IGCL 2VAAA 1HCFX 4PJAA 1F97A 1T5XA 3RWJB 2JK5A 1IM3A 4F7TB 1LP9B 3GIZL 2XWTB 4PREA 4OKVA 2WWKO 3MYJA 1G7LB 5FYJU 5L2KA 4M1GH 4RFEA 2X7LA 3JWDC 2BC4B 3ULUD 3QFJD 5I30H 2H2SD 1BFOA 3T4YA 4LLDA 1QSEA 1NC4B 4AIOA 1OSZA 1LEKB 2EIBA 5DQJA 4M8VA 3RX7A 4WUUE 3ZKXB 3QWOA 3H3KA 1EEUA 2VLMD 3MV9B 4D9RE 4RGMB 3IJSB 3DSFL 1KBGH 5ITBH 2GFBB 2Z92A 3M07A 3G5XB 5I75C 4PGJA 3TBSB 4HULB 2J6EH 2K7PA 5KSVB 1UH4A 4TUJA 1OTUC 1RZFL 2FBOJ 4Z7UA 3TM6A 5GZNC 2X4OA 2XFXA 1MFEH 3EGSA 4KV5F 4IOFC 4M1DH 1XH3A 2ADFL 1U8PB 3VFVA 4NDMA 5JXAH 1JV5B 1M4KA 4LVOB 1A4JB 5C0RH 5IVXF 5A2LH 2GSIB 4JQVA 5FOBB 3RWHB 5C0GB 3H3BC 3EO9L 1Y6KR 4HBCL 5FGBA 1K9TA 3L3OA 3BIKA 4F58H 3AY4A 3MFFB 1C5BH 2VB5A 4U1LB 2BHUA 2OL3H 4N1EA 4Y5XA 3CSYA 1MVUA 5GIRA 3BKJH 2CIKA 4OCNC 4DZ8B 2Q76A 1FO0B 1KC5L 2V9QA 2NY6B 4D0DB 1W0VA 1LO5B 4FFWC 5IESL 1BQHG 4OZIF 1W8NA 2VQUA 1B2WL 4PJ7B 4L5FL 1HXYB 5EOQH 3VDCA 3EYUL 1DLHA 4IOSD 5DTFB 3MJ7B 1G0DA 5FUCE 5MERA 2DWDA 5C0DA 2OTWA 5I9QC 1I1AD 1KGCE 3MRJA 1X44A 5ESAB 1QBAA 2JJTC 3O4LD 3VD3A 1F6FB 4HDIA 4ODUB 3TCLB 1HZHH 5CZVH 1G7JA 2DQIH 2OZ4A 1KELH 5D7LA 3KS0J 1I4FB 1KCKA 1FGVH 4HIJB 1MQKH 3P11H 4NBYB 3S35X 2HFGL 4PRHA 1LK3L 3H7LA 2IBZY 2IBZX 1PDKA 2XRAH 3V52L 4TUOB 3GJFA 5C0CE 4B0MM 3CFBA 1YEDA 5INCA 1F2XK 4YHOH 3CIQA 4YO0A 1FVEB 5BMFH 1IFHH 2EDKA 5I1CL 3S35L 2BSTB 5I1KH 5KOMC 1MHHA 1PY4A 5DD0L 5EC2A 1XGQB 2NX5D 4NQED 1MIEH 3BW9A 4BSWB 3NACH 3IXAB 1NBYB 4GW5B 4PJBE 3PGFH 3GK8H 4WY7L 3FZUC 4YHPA 4DAGH 3VGBA 4D2NA 4CW1B 1AD0B 3KR3H 3MRMA 3GSOB 2XY1A 4ZUWB 3H6JA 1ZA6A 4WI7A 2ATPB 5C0JB 3N1PC 1XZ0A 2Z35B 5EUKA 1IGFL 1LNUB 3TV3L 1ADQL 4UIKH 3S3PA 1RZJL 5BCAA 3X14B 1YQVL 1KLGA 5H8DA 5HDBE 2F8XC 2IANB 4LFHG 4EVNA 1DBKH 4KXZI 1Z9MA 3ZTNH 2DI8A 3TYGH 4Y19B 4OFYA 1U9KA 1BVKB 3ZSTA 1OB1B 4J7RA 3SKJL 4YR6B 1NFDF 1UM6H 1J8HE 3DMMD 4UNTA 1ROWA 3W5MA 1VKXB 1B0GB 1I7TB 1BWMA 3NPSC 3FFCA 4JZJC 2DQCH 4RA3A 1IM9A 4Z95H 4XC1H 1D3CA 3JV6B 4CRPA 4LASH 4XP6H 4Q9CA 1TZHB 1SHMA 3IDYC 3RWIA 4QWWD 3K0WA 5KZCB 1NAKH 2DWEA 4LVHC 1XGTB 2MMXA 2Z93B 4UT7H 1OW0A 5HHXL 3MBED 2IFFL 3ULUE 3IDXH 3QFJE 2O61A 4MVBC 2IWGA 5IMKB 4GG6F 2EIDA 3PDGA 2YEZB 1NLBH 1BWWA 3UTSE 5I8CB 1R5IA 2EZ0C 2VLME 2CUHA 1U6AL 4LEXH 1NBVL 4TPRL 5GRJH 4TVPL 3MROB 3ZE2E 2D7PA 1EO8L 2H45A 5IW3A 3N9GH 2IG2L 1G7HB 4R2GC 4OUUA 3JWDL 4M1CD 5SV4A 3P0VH 2CK0H 4JGMA 2A1WH 1KACB 1JNNL 3QDMB 2NXZD 3LQMA 5CEYA 4OGAC 5CKAA 3GFUA 1IC5L 3CFCL 2BY3A 4APQB 5GGQH 5HDQL 2VL5B 4PJHE 1NMBH 4OBRA 1IGJB 3WIIH 5EZLB 1GZPB 4K7PH 1JPTL 3HKFA 3C08L 1WLHA 3VDAA 5L2JB 2HT4C 3SGDI 4OI9A 3DRTB 3CPLA 5E2VL 1NMAH 1LD9A 2WW8A 2VDMH 1HHHB 3KPSB 2Y23A 4U1HB 2EC9U 3FN0L 2J5LC 1S9YA 4ZFFA 4FFZH 2ZOKA 3BZEB 1F45A 3TYFA 5GPRA 5TDPB 2YPKB 5I71B 2E7MA 4CADA 4GUPB 3IFPA 4RRPA 3U48A 3BKML 3BI9X 2EE9A 4LF3A 5F7MC 1VDGA 2W92A 4NIKB 3TIEA 3WNLA 4LLYA 4F7EB 4XPGL 3LS5L 3MO1A 1HH9B 4PJGB 4YBLC 1CFTA 5I15L 1IGYA 4KKNA 4O9HH 5CILL 5DJDA 1T4KB 3O4LE 3QNYB 3I84A 4MB5A 4MX7A 2ZCKL 3BT2L 5BQ7B 2NY4C 2Y7QB 5EOCL 4CMMB 3FT2B 3MUGB 1WBYA 4JPVL 4D9QD 1X5ZA 3SY0A 4KVCH 2HKFH 1C16A 1VEMA 1MHPH 5D5MF 1D9KB 1S9XB 2BVQA 2D03L 1GL4B 2EH7L 3RGVA 4X6FA 1KCUH 2PUQT 1KIQA 1YZZA 2V2WB 4PJ8C 2B1AH 4Q6IA 1Q9WA 2FECI 3HPLB 1QEWB 1N6UA 3K4AA 2I25N 3ARBC 5E8DL 4JFFD 2QQNL 1S7VA 1UJTA 2NX5E 4MNGA 5BZDA 1WIPA 4NQEE 4QTIH 2P5EA 1BD2A 4PGEB 5CD5D 1T1XA 3TA3A 1CT8A 4OF8A 1YPZB 5HI4D 2B1HL 3O2WL 1FE8L 4J3OC 4HSQA 4OZGE 5C0CA 2YK1L 3BJ91 5I1JH 5ESQA 4KRPC 5C09A 2YPVH 4JFOA 3ZE1E 2AK4D 2N7AA 1ZLUK 3C5JA 3KJ6H 3GMPB 2G2RA 3OR6A 4JPIB 5H35A 2V5YA 4I18B 3S34H 3QAZB 4DTGL 2GCYB 3S37X 1LE9A 2I27N 2CD0A 4KJPC 4JAMA 1FNSH 4PJBA 3JV5A 1CCZA 1SBSH 3RL1A 1XF2A 3E1F1 3VG0L 3D18B 4I0PD 4N0RA 1ZVSB 1UYWH 1NCCL 4P23B 5JA9A 4I13B 5AUMB 2E8YA 2P5WB 5E8OB 1MPAL 4PJ9B 3PGCB 3RU8L 4OTXH 4TUKL 1RZ8A 4UT6H 5DZNA 3HG1B 3GRWL 3HNSL 5L88H 3H9YA 4ODHL 3JWNC 4KMQA 5IJKA 1JTPA 1J7VR 3MLTA 4X6BB 1A5FH 1JGLL 5E2UH 5SWSD 1KFAL 3GJFK 1F4WH 1IEAB 5I66A 4F57H 4XP9H 5J6GA 4N0UE 4PJCF 2X1PA 4GJTB 4M7ZC 1I7UA 3P77B 1RZIA 2W59A 4LQ1A 2EDNA 2NYYD 1QZ1A 1G7IA 2EKSA 5I76A 3ARQA 1YDPA 3L3GB 5I2IA 1UEMA 1UM5L 3WLWC 2DBLH 2PTTA 4LLWB 3EOYG 3L5JA 2HMID 3P4MA 3HCVB 4K3DH 3C5ZB 5DK2B 4HKXA 3VFMA 3EO1B 1VACA 1FHGA 1NFKA 5JR1H 4I8DA 5FYJL 2FECL 3E8UH 3QFJA 1G7PA 4NBXB 4QXTB 1P7KB 2CRIA 1U8HA 1V05A 2X42A 3H42L 4U1SB 4LIQH 4N5EC 3UTSA 5HGBA 3KLAA 1WWAX 2VR4A 4FFYH 2ZCLL 2V2TB 2H32B 3RVWD 1TCMA 3U0TB 4GOSA 3UTQB 1T04A 1MRCH 4IS6A 4YBHA 3VD5A 2DI7A 2OTPA 1IT9L 3EOAB 3NIFE 3SO3C 3MJ9L 2PCPB 4FQ2L 1MCOL 1RFDH 2EEAA 3O3AA 5IVZA 5JHLL 4DKEH 3SKOB 3S9DB 2I5YL 4JM2A 1M7DA 4LRIC 1YUHA 4PJHA 2C1OA 3WKMH 4S1SL 1DBJL 5AYUH 3FQUB 4EI5D 3X3GL 1RIVL 2CR3A 4W68A 3V79C 5T3ZL 4F9PA 2YR3A 3G6JF 3CK0L 5EU4B 4MQSB 4LAQH 1C1EL 5ICXB 1YNKL 3RVVD 4UT9L 5EU7C 3L1OL 1N8ZB 3EZJB 4XP4L 3UTZA 1AXSA 2VLJD 3C5SB 4Y4KB 5GS1B 4XCYA 3UJTL 5DRWA 3LN5A 1TTFA 2AQ3A 1AFVL 4P2RB 1MREH 3SGJC 5HHNA 1TQBB 5BVJB 2AEQL 5HGHA 1HEZB 3OAYK 3MRCB 4PUBL 5IMLB 1PKQE 3UPCA 4RGND 4OV5A 1N0XH 2X5PA 4IDJL 2E27L 4OIBA 1X6LA 4MA1B 1I1AB 4N0YH 5DQ9B 2L0DA 3WHXA 5DLML 1X5JA 2P8PB 5LBSH 4PJ5E 2DTMH 5K9OB 4BQ8A 4JFFE 5GSRA 1NGQL 4U6YA 1MCDA 4OM0L 4LLUB 4HWEL 2IAMB 1TQCC 1VA9A 4NJAH 5D6CA 5F96H 3EFFB 4JDZA 5EC1B 4UBDC 3PWVA 5CCKL 2WBKA 4P4KA 3CVHB 4K2UH 4POYA 3NCEB 5JHDD 1OSPH 4FQXB 4WTWA 4DKDC 1OAKH 4Y16C 4ZXBB 3S4SG 4ZO6A 4EEEA 1CICD 2FATL 1CQKA 1UWEH 1CS6A 2I60H 2ARJQ 1HIML 1KULA 4GQ9H 3WHE0 1JZ3A 4NO3A 3AAZB 2AK4E 3D3VB 1XF4B 4Z5RA 4LCIL 4AL8H 1BZ9A 3OPZH 3VXTB 4WJ5B 4TYUA 3K2UH 4NN7C 1H5BA 3P0YH 2VQ1B 3UXFA 5FUZH 1KF9B 3DLQR 1RIHH 3TN0B 3KPNA 2ICWJ 4I2XB 5FXCH 2HFEB 1AKJB 1FO0H 2ARJA 4GRLB 3QUXB 1KB9J 3GSXA 4CJ1A 1UCBH 4R0LC 1PGRB 2E9JA 1QBMH 3MBXL 1DL7L 3DX7A 1SMAA 1ZEAH 4FQCH 1U8MA 5EU3B 4N8PA 2PYFA 5I17B 2PO6B 1W72L 3DX9B 5D7KD 3KYKL 1KEGH 3SQBA 2J6EA 5BOZG 5SWSE 5D2LE 5IQ7H 4JY5H 1GGTA 4JFDB 3WFHB 4HUMB 4N9GA 43CAB 4GAFB 1RZGA 4Z9KB 3T0BA 2YA1A 3MV7B 3DMMB 5E00A 4BELD 4ZG1A 1WCBA 5IT2L 1KPRB 4LSRL 3ULVF 1JGVL 1F6AA 1S7XB 1UA6H 3FQXB 1F90L 1Q9OA 4JRYD 2VDKL 4OGXH 3BGMB 4IJ3C 3JXAA 4NNXB 3U9PH 2AEIT 3MFGB 2HKHH 1CL7H 2OL3A 3VRIA 3MBEA 3BE1H 5DHVB 4FG6D 3LHPH 3IU4L 3IXTA 2OS7A 3P4OA 4EI6A 4N0UA 4RDQG 1A6WL 2AVGA 2EKJA 2XWBB 4HUUA 2EDXA 5CSZB 4BQ6A 4XNZB 5KW9L 4XPHL 4HEPG 4X80L 4K9EH 1FZKB 1PX3A 1P53A 3P30H 1JGUL 5EUOA 2UUDH 2BY1A 3P9LB 2FIKA 2NLJA 1K5NA 5HDOA 3CCHB 1KXTB 3VWJB 4GW1A 2WV3A 3D85D 1BEYH 4POUB 4RAVA 4XBGB 3TZVC 4MD4B 1G9NH 5DS8A 4P5TD 5ESVB 3STZA 5HYJD 3PF2A 1TCRA 2WINA 3DIFA 1N59B 2PW1B 3L95B 5KG9A 3MRKA 4GKNA 1EGJH 1KNOA 1CTOA 5TH2B 4Z7VF 5J3HC 3UJJH 1SEQH 3CDYA 4NJ9H 1AJ7L 4ALAH 5IW6A 2W0FA 3QXAA 4WV1B 4IRSD 3LN9A 3DX8B 5I1GH 1AR1C 4G8IB 3TO4D 2HTLC 5BV7B 1JIBA 1M05B 5BW7C 4EDXA 1X5XA 3OKMB 1XF3A 4IM8A 4L8DB 4M48L 4HIHB 3VXUD 3QUYB 4NZJA 2R2BA 2MCPL 5C6TL 4HUVB 2D31B 4HK0B 1DUZA 2HT3D 3ULVC 1U93B 1Q94A 3M17B 5E6IB 3X3FH 1G6RL 4XC3H 4RGNE 4DQOH 5FYKU 4X4ZA 1MFBH 4WDIB 2EDFA 4LCUA 4MA7L 3QRGH 5C2BL 1ZTXH 5C0AB 5BS0E 5I6XC 2QADB 4G9FB 5CJQL 1NFIA 1R6VA 2LVEA 1F58H 3BWAA 1CK0L 4ONOA 4XZUA 4YLQT 5GSVA 5ENWA 5KN5B 4U6HA 1A0QH 3L3JB 4P9HH 2AV1B 5F6HI 1M6OA 4GAYA 4WI5A 2IGFL 2FJFB 4I5BB 4X6DF 1CLZH 3RNKA 4J6RL 3BDBA 1SY6H 3TJEH 2AJVL 2GTWB 4JE4B 1MCPL 1V5JA 5E9DD 3IDMB 3GI9H 3MPCA 3RVUD 5JHDE 1NCBH 3GJEB 1CGWA 4L4TA 3JSSA 2X09A 5FHBL 4R4FH 3SDDB 1G84A 5T1MA 1AHWC 5CGMA 4PJ5A 2WNGA 1T21A 5D7SH 4TSCH 5TJWK 3T2QA 2VLKA 4P4RB 1QBLL 3FOMA 5IW1B 4JFFA 2IH1B 2Z31A 1CD8A 4QLRA 1QQDA 4RMTA 3RUGB 3MMEA 4FZ8L 4M61B 1MHEB 3C60D 3B9VA 1PBYA 1T1WB 4C58B 2VSCA 1WJ3A 4FTVD 2I07A 2VISA 3U1SH 5MI0C 4OI8A 4XNXL 3UTTB 4HIXH 1A7BA 4DCQA 4LIQE 4OCRL 1A1MB 2O93L 4HUWB 2X4PA 1WQVT 2R4RH 2DQGL 1WWBX 2AK4A 4OLYL 2CKNA 4QNPF 1CFNA 4M8QB 5C0FA 5F7LB 4BH8B 3HC4L 5D7KE 3EO0A 1T22A 1QFWH 1FC1A 3MLYH 1NCDL 1UJ3A 4HJGB 3MV8B 2VDLH 4HH8A 3D69A 1UXWA 2Q1EA 3MODL 1J0ZA 3U30B 3QPXH 2XG5A 3V7MA 4I0PA 2A73B 2CK2A 4PJIB 1MNUH 3CX5K 4Y4FD 3DYPA 3O4OC 2EICA 3WDJA 1SQ2N 1RUPH 2X41A 1U2CA 3CFEB 4PY8J 4W6WB 1R5VA 3JVGC 2LABA 5EU5A 2A38A 1I8KA 5ILTH 1WBXA 4YHNB 3ARDA 2H3NB 4LSQL 4JRYE 4JFQA 4JHZA 1FVCB 1FH5H 1Q9KA 3KPQA 5SWSA 4RGOL 5D2LA 4DUXA 1CGSL 1R3JA 3A67H 2BVOA 3QJHB 4QO1A 5CP7A 4BSJA 4L3AA 4YDJA 3KYOB 4Y5VA 3MRHB 5L9DL 1DQQB 2ZUXA 4I4WB 2WANA 4LLMA 2NTFA 4XTRD 4LGPB 5C9JA 1CGYA 4OI7A 1K4CA 2ICEA 1LK2B 1TJHL 3VXOA 5INDA 5JW5B 3RWGA 4GRWF 1VEPA 1JRHI 2RFXB 3QXDA 4NQDD 5JMRA 1CIUA 3IJHA 3G5YB 2W65B 4XPAH 1INDH 1FL3A 4NP4H 4L4VB 3LEXB 4HWUA 4PP1D 5ETUB 3WJLA 3DO7A 3DX6B 4JHAH 1A1NA 3MRGA 3MCLL 5EN2A 1Y0LB 4RZCB 1DDHB 3GMNA 3I6KB 1QYGH 2VQTA 4HPYL 3RY4A 5J57B 1OY3B 3CFKA 4UOJA 2UYLA 2DBJA 1FYTA 1I1YB 4JM4L 1A6VL 3IF1B 5D7IE 5KSAA 1D6EB 5KS9F 3HI6L 4UV7L 1TLKA 3VWKB 3MLXL 4NHUA 4HJ0D 4MCYB 4RX4D 4URTB 4ZQKA 3VXUE 2E9BA 4JFPA 5T5FH 1HWHB 1RJLA 1VADB 3G6DH 5DRZB 4RIRA 4DK6A 1HOCB 1NJ9A 2VE6B 4QRPB 5BXFB 4E5XA 5DVMA 2XA3A 4KROD 3S88L 2ZWLT 4N90D 3FONB 1NLDH 1BGXL 1JWSB 4GH7B 3SQOH 3VD9A 5DVKA 3S7GA 2JCCF 4PGDB 4MD5A 2UWEE 1I9IH 2AJSL 3MRPB 3MJ8B 4NO5B 3N50A 3SBWA 3ULVL 2OMNA 5E94A 4YNYB 1VFMA 4LSUL 4Z76A 1FSKC 3VFRB 3BN9D 3VA6A 3VCLB 5E9DE 4OLXH 4JFHD 1OM3H 3MOBL 4J4PA 2BX5A 1XFPA 1CGXA 4BA8A 4UI2A 2WBJC 1QHOA 3T77A 3BEVB 2ZUVA 5BS0A 2Y06L 4OM1L 4PJEB 3VE0A 5J1AB 1E4WL 2RR3A 3P0GB 5SV3A 3OV6A 1YMMD 5HHPB 3HE7C 1M7XA 3QH3A 5FUOH 4N0FB 4R96B 1JPSH 2VO5A 2XYCA 2HFFB 2AEWA 4J3TA 2H32H 2V5TA 1HINL 3ZKMD 1U3JA 1EXUB 3QEGH 2ICWA 5ISZD 4Q6YA 1GIGL 3VFTB 1T83C 2YD3A 5JHDA 1MWAL 4LRNL 3GSNH 2VLRD 3LV3A 2JJWA 4ZSOA 1L4IA 1FNEB 4GS7C 2J8OA 4L8SC 1JN6A 3FRUB 4XCNB 4MZ3A 3CMGA 1RMFH 5ICYB 4GBXB 5EOTB 3NMEA 3GMQB 2AGJH 3DV6B 3TBWB 1KJ2H 1U58A 5F9AC 2EXWD 4E0RB 4XNMA 5ERWB 4OCWL 3GI8H 1YQ2A 5IMMA 2AABH 3LDBC 5I1HL 3O6FD 1KLUA 3ARGC 4UDTA 2F54B 3DVGA 3D0VB 2HJLA 4LU5L 1YEHH 3BFOA 3LKRA 1A9EA 1IILE 5T1KD 5D1QD 1NCTA 4YIQB 2VZSA 1J0YA 1KG0A 4K7FA 4OJFH 1Q1JL 3BP6B 5CSGA 1I7RB 5C0IA 1G7QA 5F9OH 2R2HA 2NY1C 3PHOA 3BDXA 4PJDF 4XPTL 4NQCB 2HJKB 3QDGB 4MCZB 2D9QB 2JE8A 4LP4A 5IV2B 1RJZB 4NKIH 4D8PB 3IJYB 4G3YH 4YDIH 1SMOA 3UDWA 5F44A 1TITA 4Q2ZB 4H20L 2YN5A 4WENB 2BSRB 1KB5B 2IPUK 1XIWC 2C3HA 2VR5A 3GMLB 4AEIH 5EZJB 5IB4B 3QZWG 4EIZC 3NFNA 5F6IC 3QQ3A 1IL1B 4WEUD 3TLRA 1GVIA 2BK8A 2R1YA 3IGAB 4JRYA 1X5AA 2VDNH 2VJXA 4NQDE 1A9BB 1JWUA 4UIMB 1CF8L 3MXWH 3OZ9H 3RHWK 5J12C 2CDFB 3QULB 4OZFB 1NEZB 4U1KB 2XA8H 4UQ3A 4KU1A 3DBXB 3RWJA 5IGXH 3CC5B 3WMSA 1ZSDA 2BNRD 3EIFA 1FCCA 4JCMA 1QP1A 3WKNA 3RDTD 4BZYA 1LP9A 2Z8VC 2H8PB 2XWTA 3JWOC 4ENED 1LO0L 3OX8B 1G7LA 2A9MH 5DYOA 4C59B 5C0BB 4JB9H 1JHTB 2FL5A 4KJYB 2BC4A 4QXUL 1S8DA 4Z7UF 1NCWL 1LDPL 3BQUB 1NC4A 1L9NA 1BMGA 1B4JL 1X5LA 3VMOA 1EHLL 5HYJB 2KPNA 2LVCA 4BUGA 3THMH 4DUWA 1OCWL 1XF1A 4LPXA 3IJSA 1LO3L 4OFVA 5CZXC 1HSBA 3O6KH 1QRKA 4XP1H 4N90E 3SDAD 1MJ7H 4JQIH 1ONQA 3BVNA 5D7IA 5KSVA 3HZYA 4HUKB 5SWZD 4IRSA 1RD6A 4WVRA 1TJGL 3TO4A 5CHNA 5JW4Q 3Q6GH 1VGEL 3L7FA 1K85A 2VWEE 2XTLA 3VXUA 1A4JA 3HS0B 3PP4H 5DJXB 2GSIA 4UDUB 1FBIH 2X2YA 4LEOA 1DE4A 3SN6N 1IAKB 4JFHE 5JOPD 3CZFA 3V5DA 1N4XH 5FYKL 2X89D 3ZYZA 4U1LA 2L4OA 5DK0B 5AAMA 5FGCE 5DHVH 1QO3A 1QR1B 4DZ8A 4WO4D 5DEGB 2VABA 3W81A 1II4E 1FO0A 2AXFB 1YMME 4KMLB 4XBPA 1PQZA 1DEEA 1LO5A 4RWYH 4YDLB 1ZGLB 5LWYH 4PJ7A 2FRGP 1MHCA 1FDLH 5HGAB 1AQDB 1QPXA 1H3TA 1S9VB 4QRUB 3T0WA 2EDBA 3MJ7A 4TVPD 5E9DA 4O2EB 2FSEB 2C3VA 5A2IH 4WW1B 2W9DL 4H88H 1ZE3C 3HI1A 2ATKB 2VLRE 4IEFB 1D5MA 1NANH 4HXBL 4B7LA 1MCWM 4IIQC 3NAAH 5DRXB 4ODUA 1IKFH 5J89A 5IJVA 1QLEL 4AK1A 4CN1A 4LMQI 1H15B 4JQVC 5F7WC 5T3XH 4JN1H 2R4SL 1KJVB 2ITCB 5FGBC 4Y0GA 1KTDA 3VFWA 1RULH 3AY4C 3PV6B 4FTVB 3A6BH 4Y5XC 1FIGH 4L8BB 4WI3A 5SWQB 2ESVD 1BFVH 4WGVB 4K71B 1YY9C 2LFGA 2YD2A 1FVEA 1NSNL 3RP1A 2W0LA 5BV7H 5GZND 1HHIB 2HN7B 1CLOH 1A22B 4FQJL 4DKFL 1EFXB 3VXPA 3JTSB 1JHLH 4DK3A 3EFDH 1XGQA 4XNQA 5IKCB 3PIQB 3B2UC 3HMXH 4M03A 2F5BL 4EQ2A 4DFHA 3EYVB 1H3XA 1CDUA 1S7UA 4Q9RL 4CW1A 1AD0A 5B8CB 3CUPA 3GSOA 3O9WD 3QHFL 1WTLA 2RBLA 4LARH 2DQDH 2Z35A 1LNUA 3FTGA 2I9TB 3BHBB 4Y4FA 2Q87A 2P7TB 3X14A 4KZDH 2V5MA 1EGJA 1LO2L 3MLVH 3A6OA 1JTTA 3RTQD 3VI3F 2IQAA 4KQ4H 1LDSA 3VW3L 3IETB 3MLWH 4Y19A 3ZE0E 4LL9A 1I75A 4XGZA 1T03H 1N5YL 3LSOA 2YD4A 1BQLL 4NNPH 1OB1A 2DLFL 4HXAH 1HHJB 1MF2L 1VERA 4WFHD 1DLFL 3N85L 2VRAA 4TTDC 4YZFE 1A3RL 1KB9K 3C8HA 3UZQA 5B3NA 3U7YH 5CJOH 2ADJA 3G08B 1YN7A 4HJJL 3O0RH 2FX9L 2XACC 2OR8A 5C0NC 2BNRE 4KKCD 1NDMB 1I7TA 4G5ZH 3FO9B 3U36B 2Q20A 2VXQL 5CUSH 2PW2A 3PWUA 1TZHA 3PWLB 5DI8A 1JPGA 4F7CB 4NO2B 5EORH 4JZOB 1K6QL 1NUDA 1SYVA 2Y36H 4M3JA 3REVB 5GZOC 5EOCJ 4O2CB 4R97C 5F7EL 3P4LA 5HVHC 3IYLW 5IMKA 2YEZA 2XN9B 1CZ8L 3K1DA 2WBWB 3B9KD 4KUCD 4WHDA 2BJML 1SY6A 3MROA 3R06B 4K8RH 4MQTB 2H1PL 5CS7A 2N56A 1G7HA 3KDMA 3HUJF 1GCFA 1BOGB 1XGPA 1DUYA 4Z7WF 5SWZE 3BXNB 4YHZH 5EU6B 5IFHH 2ADGB 2GT9A 3RAJL 4G6JH 4F7MB 2VL5A 3GKWH 4YK4B 2EDDA 4HWBL 4XH2A 4RX4A 5T3XD 2G9HA 1GZPA 1NH6A 5F7DA 3EDKA 3W11C 4OF5A 1BECA 4G7YH 5L2JA 3UPRB 4P2CG 4HKJB 1HILB 1OW0C 2FZ3B 2XZAH 2Y4SA 1AGFB 3PGDB 4U1HA 2OQJB 4MSWA 1ND0A 1URLA 4LSVL 2OYPA 3BZEA 1QA9B 4KJWC 3F7RA 3FHQA 5BZWA 3KLSA 1A7PH 1RUKL 3GMRB 4GUPA 4XWOC 1VFBA 1L9MA 2GW5A 3TJHD 5F3HA 2RCSH 3LH2L 4J3UA 4NPYB 1TDQA 4OAWB 4AT6A 4TVPE 5DC9B 2EDYA 4QY8B 4F7EA 3DTXA 4TOYH 1HH9A 3RVTC 2CLVA 4IMLA 4K07A 3UBXG 1T4KA 2AV7A 4Y2OA 1D5IH 3QNYA 3R1GH 5TGBB 2Y7QA 4CMMA 1FNGB 5DUML 4DOHB 5FYJD 5C8JA 1YMMA 1JGDB 4LCWD 3QIWB 1VSCA 4Q74A 1T66C 4X6CE 5IHUH 4HGWA 3SEPA 4Z8FH 2R0KH 3MNVA 3CVIL 3IDIB 5SX5H 4P2OD 1MLCA 1KCSH 4JG1H 2X4SB 3EYQD 1D9KA 2BCKB 2OI9B 4HC1H 3CDGB 4MLIA 4R2GD 4RCAA 1Z3GL 4JR9H 3VJ6A 2VLRA 1RUAL 4DZBB 1QEWA 4HAGA 1ZLSH 4CJ0A 1M71A 3DUUA 3DV4B 2D2OA 4YXKL 2P43B 5C0EB 2GTZB 2HT2C 4PGEA 1J1XH 4WFGD 4XXCA 1A1OA 1YPZA 4ISVB 5DMIH 2CPCA 3QNXB 3CH1B 3TBVB 4NNYB 4FN0A 1P2CA 1VCAA 2JELL 3CFIC 5D70L 1OAYH 1IGIH 4PJFF 1JFQH 4MS8C 1PZ5B 5I18L 1ZWIA 1BQHA 3HR5B 3FFDB 3V5KB 4EUPH 5HDBF 5T1KA 5D1QA 1J1OL 1HI6B 3WE6B 4JRXD 1EZVY 4M7LH 4EN3C 2GCYA 1R3LB 1EZVX 1UZ8B 3ZMRA 5FUCC 3RGVC 3DPBA 3HC3L 5AD0B 4O4YL 4WFHE 4N8VB 4Q6IC 4WUKL 1J9CT 3B43A 1HKLH 5CP3H 5A2JH 2OZ4L 4XNUH 5AUMA 4WI6A 4DEPB 4PJ9A 1CD0A 2HRPH 1IC4H 1P5UA 5GRUH 4POZD 4NWTL 1JNLH 4XMKL 2CKBH 3TA3C 3WL9A 4KHXH 5TPWL 3GM8A 3REWB 4YXLH 4OCSH 5I1AA 1FV1A 5I19L 1XGUB 3WNMA 3ULUF 1IEAA 3GSQA 1YYLL 5E1AB 4RSVA 1C5CL 2DLEA 4S11A 3VXMB 2QHRL 2HG5A 3QUZD 3KLDA 2ZSWB 3P77A 5E2WL 1ES0B 5DD5L 3QT2A 5T1LD 5DA4A 3ZE2F 2BNRA 2CLRB 3J8F7 2VDQH 3RDTA 4RAUA 4OD1H 3K4ZA 1F4AA 4Z7NE 2R0WH 3SKMB 1XGYL 3C5ZA 1SVZA 5KJRH 1P4LB 3W2DH 4L9LB 4OIIL 4QXTA 3WEXA 4HMDA 4P3WA 3FB8B 2BOCA 3R0MA 4UINL 3NZ8A 5FF6B 4YHYC 1U3HD 2R9HC 1PX4A 4U1SA 5T3XE 2VZVA 1K8DB 3NA9H 5IJKC 4Y5YB 2V2TA 2P8MA 2H32A 3WFBL 3U0TA 4OLVH 5F7YC 1MY7A 4U1MA 2B20A 4PP2B 3SDAB 3EOAA 3BPOB 4RNRA 5D71L 2E7BA 3GSNA 1OVZA 2N1KA 4GG8A 1R5WA 5CD3B 3SOBL 2GJ6B 3WN5A 5SWZA 1Q0YL 2PXYB 2JIXB 3DRQB 3HI5L 3QIBD 5EIIA 4LVEA 2AJUL 3ZO0A 5FM5M 1MIML 4CN4A 3P4NA 4J23A 2OM5A 2NY0D 4V2CB 4YFDB 1KB5H 3FQUA 1KJ2A 2BRQA 3QBTB 1WZLA 5DT1H 2NW3A 1CU4L 1CLYH 3L3HB 1MJ8L 3H3PH 5EU4A 3MREB 4MXVE 5DJ0B 3FO0L 3ORJA 2YKLH 3ULUC 2C7UB 1KPUA 1YEFL 2H2SC 5FHAL 5KSBE 2X89A 3E3QE 3DURB 4Y4KA 5ADPL 4UOW1 4YJZL 4GAGH 5AEAA 4YQXH 5EWIH 2R1WB 2PNDA 4ORZC 4P2RA 1FFQA 1F4HA 1UXSB 4LCWE 5FYJE 2FBJH 5C71A 1A2YB 3KXFD 4P5MB 5IB5B 1HEZA 4YHKL 1GC1H 3MRCA 4LVNB 5IMLA 2FHFA 3RKDC 3BP7B 1UKQA 5EZOL 2B39A 5GS2H 5HHVL 3BKYH 2N7BA 4E41B 5DQ9A 2GK2A 5DZOA 1TMCB 2IADA 3O41B 3B3IB 5EFIB 4ESKA 5FOJA 5K9OA 1IVLA 3HFML 4M5YL 2YRPA 2E9WA 3FN3A 3RY6A 1QRND 2AERT 3DUSB 3T0ED 1RURL 4LLUA 3SHSA 1QPPA 3EDEA 2DDQL 4X6CA 3MA9L 4F9PC 4FFVD 2FX7H 4AJ0A 4MMZC 3U4BL 3QHZH 3AXLB 4WFGE 5EA0L 4LAJH 4FQXA 1ZANL 1IJ9A 2VITB 2W60B 3DNKA 3VH8A 4OZGF 4JVPA 1EAJA 5CINL 4YHLH 3ISWA 1OP5H 5CFHA 3ZE1F 1DBMH 2ARWA 1JBJA 4ZDHB 2XTJB 3D3VA 4KAQL 1XF4A 3F7YB 3OB0H 4CVUA 1ORQB 2NY2B 3OF6D 3VXTA 1YEJL 4RRPG 3DYOA 3AC0A 1F3DH 4PRNB 1OP9A 3BPLC 4WJ5A 2XKUA 4PB0L 4LKCB 4R4NC 1JF1A 2MKLC 5JUEL 5JIIA 3O9WA 1C08A 1HDMB 2DIBA 4MJ5B 3T65B 3T8XA 2ERJC 5DSCA 4EKXA 3T1FB 2HFEA 3LRGA 2HLFD 1FZOA 1PVHA 5KVEH 3VGDA 4K94C 1KXVC 3L6FB 1ZT1B 4U1IB 3OXRB 1VFAB 4FQIL 4WIQA 2PO6A 2B4CC 5C07B 5I8KH 5D1ZD 4HUXB 5TE7H 3C09C 3W0WB 4YH6A 4NGHL 3WXVL 4F15C 4JFDA 5IR1A 1HQRB 3WFHA 3PWNB 2CLZB 4LSTH 43CAA 1WEJL 1I3UA 3BH9B 5I9QB 5GJTL 3OJ2C 3BP5B 1KN2L 4IRJB 4YHML 5D6DA 5CEZH 1A6AA 4P57B 5DJYA 4HZAA 1TVHB 3L3IA 5E8PB 1S7XA 3FQXA 1MCHA 1H5BC 4NCC2 3QCUL 3BGMA 2VXTH 4HS8L 5D72H 1BJ1J 2AJYL 4NNXA 4X7CC 5CJXC 1KCVH 3P40A 2F9BT 5DHVA 4LK4A 5CEXB 2HRLA 5E2TL 3QISA 1ULVA 2JJSA 1CXKA 3KPOA 2A74B 4X7SL 3ZT7A 2DQTL 4PRAA 5EBMA 5GGRY 2XWBA 5CSZA 1KJMB 1EEYB 4WHTB 1IMHC 2SEBA 1X5KA 4BZ2H 3B9KA 1FZKA 5GS2D 1X4ZA 1YNLL 3P9LA 2Q8AL 5IVXB 3AS2A 2CXGA 3IFOA 4JPKH 4ZD3L 2DQUH 2DM3A 3L3KB 2Z91B 3NIFF 3MRQB 4OLWL 2XZQL 3KYMA 2BNUA 3HMWH 5IF0A 1Q0XL 2QSCH 5GQBA 3ZKND 2A6DA 1H3UA 1G1CA 3GHBL 5EO1B 4DN3L 1EERB 4XB7A 1B88A 3X11B 4GW4A 4RBPH 5JPNB 2DQFA 5TF0A 2PW1A 3L95A 1S7TB 1D5XB 3I50L 1DVFD 4XP5L 4OZIB 1TETH 2VKWA 4QWWC 4M4PA 1WGOA 2QBWA 4J3VA 1QFHA 5GGUB 3MBEC 3FT4B 4WV1A 1E4XI 1E6JH 3SPVB 3DX8A 5ALBL 5BO1H 3MRLA 2EE2A 4G8GD 3I02A 3OKMA 1JCKA 3MOAH 4L8DA 4OLZH 2CXKA 1P9MA 3D39B 3NABH 4HUVA 4QOKD 4PTTB 4ZNCD 3KXFE 3HMXA 2B7DT 1P7HL 5E6IA 3AM8A 4HF5H 1FFNB 3ARED 3MLPA 3QCVH 4WDIA 5IBLD 3BWUC 3OKNB 4M1CC 4G9FA 5ACMA 4ONGL 2NXZC 1TNNA 2OBGA 4FQPA 4S1QL 5C08D 5KSBA 5DURD 5MEQA 1S7RB 1PG7X 3ILPB 3VGEA 1UKSA 1GZQB 3IDUA 4CBPA 4O58H 1WTGT 4DVRH 3FO1B 4I5BA 1QRNE 2IMNA 3T0EE 4ZFZB 1ZT4A 2R23A 2OP4L 2E7LA 4P59L 3V4UH 2JTDA 3X13A 3R0NA 1RI8A 4P2OA 2F8VA 1SJHB 3IDMA 4ODTL 1JYVA 4JY4B 4DN4L 2NNAB 3GSVB 5KVDL 3RHWF 3PP3K 1F3DJ 2R29H 4NO0D 4HG4J 1F2QA 4OFKA 2H2PD 4MA8L 5CEZD 1Z9SA 2C4FT 4AG4L 3TZVD 1I3GH 2AQ1A 3OXSA 1SJEA 1U95A 5E0QA 4NZTL 2IH1A 3NFPA 4P2QD 4D9LH 4X7DC 3RUGA 1VEOA 4XMPL 1WSST 4M61A 1ZLWH 4N68A 1P4BL 5J3HD 3D2UB 4JPWL 4WW2A 3UTTA 3E2HC 5LGJB 5FO8A 1BBJA 4Z0BL 2OTUA 4PJIF 4XT1C 1BM3H 3LEVH 1NFDB 5CWSA 1MFCL 5DD3H 2CGRH 5TE6L 5AZEH 2J5LB 5E7FA 4NZRH 5FDWB 1F13A 4JRXB 4OFPA 4RWHA 3SDYH 5ABDE 3G04A 3BOVA 3QG6A 4ODSH 4XCFH 5D8JL 2BZDA 1E4XL 5DR5H 4G8EB 3BYTA 5IFAL 5MENE 3RZWA 3D48R 4HQQH 2AJXL 5F9WC 3WS6A 3VXRD 2OK0H 1YEIL 4YBLB 3IFNL 5JW3H 3CLEL 1H0DA 2Z8RA 3OJVC 3LQZA 4GG6B 2O5XL 1PW3A 3CFEA 4J3SA 3HE6D 4K94L 2FJHB 3MQIA 2CR6A 2NY4B 2YUVA 2YS4A 5BVPL 1BBDH 5IROA 1FLTX 2B4CL 3DXAD 5MP6L 4YHNA 4GAJH 3WXWL 4XPBL 3B9AA 1FVCA 4PRID 5HI4C 3NCJH 5ITFB 3STBA 1U42A 1CE1H 3MLSH 4EOWL 5IUSA 1S3KL 3BO8B 1OF2A 2YZ1A 4XMLH 2XKNB 3ARFD 3U46A 5EG6C 3ARVA 3QJHA 4MDIA 2XOTA 4QRRD 4PJ8B 3QUZA 1Z9LA 1X3DA 5EB9A 1DQQA 4I4WA 1W0WB 3O3BB 3ARBB 1ZXQA 2V7HA 2EXYC 5I30L 1UJ3C 2ZOLB 3TBYB 3RZCD 1X7QB 2NMSA 1LK2A 5DK3A 4KY1H 4DUVA 5JW5A 3Q6FB 1QLFA 4I0PC 2FYYB 3G5YA 2W65A 3LKPB 4HV8A 3CU1A 4XRCB 3LEXA 5GHWH 2X4NA 4PGCB 1KBGL 5ITBL 4X98B 4JLRA 4KRPB 1U3HA 2VXSH 3TNNB 2CH8A 5LAXB 2Q3AA 5I8OH 1Y0LA 2AKRB 3UX9B 3AB0C 3ARDC 5DUBB 3PQYB 2J6EL 1KC5H 1I1YA 3F62A 5JIKA 1CI5A 3FCTA 3IF1A 5HGGS 1P6FA 4U7MA 4EQ3A 4HC1A 1MFEL 1D6EA 3EYUH 4G6MH 1BF2A 3MZTA 2OCFD 4M1DL 4DGIH 5JXAL 1UM4H 2RAMA 5AWNH 3VWKA 5ACZB 3BD5A 3VFNB 5C0RL 4G8GE 3QDJD 4Y5VC 3ECBB 5C2UB 3W5NA 1UWGH 2APTA 4QGYA 2D7MA 3FMGH 4QOKE 1FJ1B 3WNOA 3H7BB 2EE6A 2DYPD 1OGTA 4FS0A 1KPVB 3R8QA 5IMOB 1HOCA 2YC1A 1YEEH 1C5BL 4U1JB 3RL2B 5BXFA 2OL3L 4F37K 3T3PE 3BKJL 3FONA 5CAYB 5F9DC 1J0IA 1D5BB 1JWSA 4MDJA 1VFUA 5D5MB 2EE3A 2VH5H 4PJEF 5C08E 5HXMA 1ZS8A 5A40E 4HEME 1A47A 3ZHLA 3EW3B 5EOQL 3RWEA 3P9MB 1I8IB 1IAOB 3MJ8A 4NO5A 4EUPA 2J4WL 3Q48A 5JA8B 2F5AH 3VXQA 5HVGB 1MCWW 4EZMA 2RHEA 2HJFB 1MUJA 3PABB 2FCBA 1DQJB 1UQSA 5KSAC 2QLVB 4X0KB 5E95B 3BEVA 3MRBB 3B8SA 1HZHL 5J1AA 5D93B 5CP3A 5CZVL 3ALPA 2DQIL 4KRLB 1KELL 4UMGA 3PWJB 5CEZE 4OZHB 3E6HB 1FGVL 3QNZA 1SVCP 4LLVA 2ZSVB 3WSQH 1GPOH 2R0ZH 4R96A 2ITDB 3U4EB 1KTLB 1U8QB 1QOKA 2CKBA 2DJUA 2P24A 4P2QE 4EI5C 3T0EA 3NBNA 2XRAL 2XI9A 1EXUA 1VGKA 1P7QB 4YHOL 4L1DA 1MCFA 1DP0A 2D7NA 3VFTA 1IFHL 1MLBB 5BMFL 2NXYD 3HN3A 4N0CC 4NQXB 3OKKA 5GGSA 5I1EH 5I1KL 3SO3B 3AS3A 3FQRA 3SBWC 3SKJH 1MIEL 4ELME 3BGAA 3NACL 4XCNA 2EH8H 5FKAB 4XAWH 3PGFL 3GK8L 4FXKB 4WEMB 1EDQA 5DGQA 3GDBA 1R0AH 5K9KA 4JO2H 4RGNC 3DV6A 4J4PC 3KR3L 3FQTB 3TVMB 3MGOB 2GY7B 4E0RA 1A7RH 5I1DB 4AEFA 4ONHB 1G6RB 4J1UA 1HQ4B 2J2ZA 3VXRE 1NC2D 1UEYA 3D0VA 4KJQD 4PJCB 4JJHA 3ZTNL 1A6ZB 4BKLA 3TYGL 1KJ3L 3QXUA 4PG9A 3H0TA 1V8HA 1UG9A 1UB6B 3DXAE 2YD7A 4MA3A 4MD0B 1Z9OA 5M7QA 5IB2B 5D1XD 1WUNT 1NBVH 1ED3A 5D1ZA 3W9DA 3TO2A 1UM6L 2XZCH 1ORSB 1OD9A 2HJKA 4ZTPH 5MENA 4MCZA 1IARB 5IV2A 1RJZA 3I9GH 3MUZ1 2DQCL 4M4RA 4Z95L 4LASL 4XP6L 4KK5C 2APBA 1KB5A 3ME0A 1NAKL 1ZHBB 4UT7L 1IL1A 2A83B 1T0MA 3IDXL 3K8MA 3IGAA 1TQCB 4I3RH 5F88B 1NLBL 1A9BA 1AO7B 2CUIA 3O3EA 3QULA 1MEXH 4LEXL 1N2RA 5GRJL 3SE9H 4U1KA 2BY0A 4F7PA 1CDBA 4NC1E 4Y16B 3I75A 5TQ2H 3ULSB 1DZBA 3N9GL 5DEZA 2W0PA 1U3ZA 4TNWK 3P0VL 2CK0L 2A1WL 3GSUB 3OX8A 1F3RB 2RIKA 4PRDB 4QXGH 5D7IF 5HYIA 5GGQL 1FL5B 5HHQA 3G6JB 4KJYA 4YGVB 1NMBL 2QKIB 1MVFA 3WIIL 2J8UE 4NN7B 3BQUA 4GKSB 2UY7A 4K7PL 4G6KH 1BHGA 3QDJE 4RFOH 5C92A 3AVEA 5ICZB 1Q9LA 4O2FA 2V17H 4C55A 1U8OB 4PGZA 3ZSSA 4YDVB 3QUMB 3BP4B 4OFDA 2X4RB 1NMAL 1WISA 2VDML 1DVFA 4R0LB 3GZKA 2WP3O 4U1GC 5I16B 3WUWB 3QEQB 4NYLB 2Y1VA 1MCIA 4TSBH 5J1SC 4FFZL 3QWRA 2UWEF 4XCEB 1NGYB 4G8GA 3MA7B 1A14H 4S10A 2F58H 3JV4A 4UDUA 1REIA 4JN2A 3UJIH 1N3NB 4H25B 4JHBA 4O9HL 1IAKA 2ICWI 2QQNH 2K3TA 5B39B 2DIJA 3MRFB 4IJ3B 4YPGB 4HIIA 5JW4M 4CVWA 3HPJA 4CUCA 4ODXB 5C08A 1EA9C 3MGTB 4P5TC 4XNYH 4KVCL 2HKFL 1FNLA 2OLDA 4NT6A 1MHPL 2AJ3B 1ZGLA 3QA3B 3DGCR 4YHIA 5HGAA 5E4IA 3DOSA 4GRMB 1KCUL 4QRUA 5HJ3B 1MAMH 4PR5A 3F58H 2C3WA 4IRSC 4X8JA 2ED9A 4Z78A 2ATKA 3TO4C 2VDPH 1MCSA 4NO0A 2FNBA 4GFTB 5TDNB 3ZDXF 1NBZA 4QTIL 4EBQH 2H26B 4OB5H 3BRGC 3KPRD 3VFUB 1AGDB 1H15A 2HT3C 3S37H 5K9JH 4U49A 2XT1B 5T5NG 4LQFH 1KJVA 1MPAH 2OSLB 5FB8B 5I1JL 3GIVB 3PV6A 3GRWH 3BESR 1J5OH 2YPVL 1AQKH 5D9SA 1F4XH 4TNVK 5SWQA 4BFIB 2PF6A 3C8KB 4PB9H 5F89B 3SCMB 3OKOA 4BFGA 3KJ6L 2DLIA 3HNVH 5ECJE 3S34L 1LHZA 4LGRB 4ZAKD 3QG7H 4WI4A 3JZ7A 4ELMA 1UZ6E 3AU1B 1FNSL 5FKPB 1R3HA 3OAUH 4DGYH 4HWZA 1FVDB 1UYWL 3T3MF 3OAZH 4JREC 4KMTH 4NSKB 3RVUC 5F8QC 3EYVA 4ZO7A 2FEDD 2PYED 1DN2A 4OTXL 4JGJA 4UT6L 3KPTA 3VXRA 3V0WH 2I9TA 5L88L 3H9SB 3O45B 2P7TA 3CMOH 2BRRH 1A5FL 3HE6A 4KH2A 5E2UL 1GJIA 1AGCA 1K8IB 1JUFB 1F4WL 3IETA 4D0CA 4F57L 3DXAA 4H0HB 3C60C 4XP9L 4WHYG 1DFBH 2BP3A 3GMMA 1XR8B 1MAKA 4HUNB 3QO1A 3U83A 4U1NA 4Z6AT 1MWAB 2XV6B 1FNAA 3G08A 1JNHB 1QNZH 2VNCA 4K9EC 1QSFB 4QRRB 5C86A 2DBLL 1AHWB 5GJSH 2EC9T 3FO9A 4K3DL 2DJ4A 2JB5H 1INQA 3LRSB 5F8RC 5JR1L 3PWLA 1WZMA 3RIFK 1BX2B 4F7CA 3E8UL 2ENSA 1PG7W 4LLQA 3RZCA 3V6OE 2VLLB 5FO9A 1LO4H 1MFDH 4LIQL 3REVA 3BPNC 2BOBB 4O2CA 4AIZB 5MI0B 4X5WA 4Y4FC 5TDOB 4FFYL 1QLRB 2Q7NA 4M7JH 8FABA 1MRCL 3IVKA 1YY9D 1U8NA 2A77L 2P48B 4LBEB 3QI9D 3MRIB 3R06A 4M43H 5JLZA 2B0SH 4O02H 1RFDL 4QHLB 4YC2B 2HP4A 3LEYH 4DKEL 3OJMB 3UZEA 1BOGA 1Q72H 3ARXA 3WO4C 1H9VA 4NHCH 3MCKB 2VN4A 2GHWB 1VESA 4JJ5B 3S96B 1DQMH 5I74B 3WKML 3QP3A 4U7KA 5AYUL 3BZ4B 1MI5B 3EBAA 1WFOA 3GSRB 1B90A 4G8FA 2G75A 3O4OB 4XTRC 5FV1L 2RB8A 2DYPA 5D7LD 4X6DB 4LAQL 3QEHB 5A2FA 3MNWA 2A6IB 1HILA 2EC8A 2X70B 2FZ3A 4PRHD 2MPAH 4P9HC 5D96B 1L7IH 4PRPB 5HYQB 5BJTA 1A8JH 4JFYB 4JZNB 1QA9A 1QFWM 3V0AC 1N0XL 3NFSH 4L29A 3SJVB 1VPOH 4KGLA 5EBLB 3OGOE 4N0YL 4XCCH 3TWCH 3MJ6A 2XQBH 3F5WB 4IOIB 2GK0B 4NPYA 4DJMA 4E41E 2UVFA 5JO5B 5LBSL 4HH9A 1CL7I 3O6LH 4QY8A 2F74A 1H8NA 3RWFB 2NY3B 1R3IH 4XXDA 5T33H 2DTML 4FHBD 4HJ0C 4PY8I 3JBG7 2CUMA 2QQKH 4ZYKA 3NCFB 4KUZH 4NJAL 4RFNB 2X05A 2E6JA 3KPRE 1JGDA 3G6AB 1E4KC 3QIWA 4K2UL 2R8SH 2CDEB 1OSPL 1OAKL 3IDIA 1L7TH 4NRXA 4PY7B 4KROC 4MNHB 4FP8H 5JXEA 3CFJA 1FZJB 2IH3A 1UWEL 2BCKA 2I60L 4JRWA 4OFYD 5DMYA 3CDGA 2ZCHH 4GQ9L 4Z7OF 1E27B 5HVFB 2XY2A 2PKDA 5I71C 4NM4H 1DANT 4AL8L 3OPZL 4G6FB 3T0XA 1O7SA 3DV4A 4TQEH 4AYFA 3K2UL 4WWKD 5C0EA 1OPGH 5EO9B 4M6NH 3BN9C 5FUZL 1XCQB 1RIHL 3HRZA 1IM9D 4HG4K 2BSSB 3K1KC 4ISVA 4R90H 3JV0A 3QNXA 4PJXE 2V2XB 2PYEE 4Q97A 2IPTH 3MACH 3TBVA 1FO0L 3EJZD 4Q9BA 4U0RC 3OKLB 1UCBL 4FXLA 2WK2A 1NC2A 1QBML 3GBLA 4FQCL 1ZEAL 1PZ5A 3HR5A 3FFDA 3IU4H 5IEKA 1KEGL 4GXVL 2FHBA 4KJWD 4TSAH 4XHQA 3WE6A 3PWPD 4X5XB 4R7DB 4XWGH 1CFSB 5IQ7L 1SEBA 5C07E 3ZKMC 4JY5L 3CSBA 4XWOD 1D9KC 1FSKB 1UZ8A 4GMTH 1RK1B 4X5LA 4X80H 5AD0A 2I26N 2EDHA 3WNKA 4L3EE 4N8VA 2EO9A 2R1XA 2WBJB 4GRWB 1T20B 2QSVA 5IHZB 4LPCA 3EHBD 1UA6L 4G9DA 3OJDB 4OGXL 5E5MA 3PXHA 4N1HB 3HE7B 3WCYA 3U9PL 4CNIA 2IEPA 1FRGH 3MRNB 4HLZG 2HKHL 1CL7L 4PGBB 4OCYH 4XXCC 5EPMB 5CIPB 2EXWC 3C6LB 3BE1L 3LHPL 4DGVH 2WLYA 5DFVD 5B38B 4P46D 1XGUA 3KWWB 1QFUH 3K4DA 3K7UA 4K9EL 4ORGB 1PSKH 4JFEB 2ZSWA 3P30L 1RZKH 1ES0A 4I77H 2WMPA 5D1QC 3FN9A 4L8SB 2CLRA 4X6EA 1BEYL 3KYNA 2HT2D 5ANME 2GJJA 1G9NL 2XWJB 3V6OA 1P4LA 3QJFB 5A16A 4H8WH 1IQDB 2BMKA 3QDHA 5GRVL 2X4QB 1EGJL 3LDBB 1IEBA 3ARGB 4NJ9L 1T1YB 1U8LB 1RK0A 5C70A 4OQTH 1K8DA 4ALAL 4G80A 2HTKD 3PL6D 1U92B 4KKLD 4MS8D 3LKNB 4YFEA 1QFWI 1N5AB 3UYRH 2FJGB 5H37H 5I1GL 3GHEH 4PP2A 4X7FC 4PRHE 1V7ML 2NY1B 4Y8DC 4WI2A 4GSDH 3RGVD 2GJ6A 3VMNA 5F1KC 5HYSA 3DRQA 2JIXA 3P73B 3O8XD 3QIUD 3X3FL 4XC3L 3RWDB 4DQOL 5E7BA 1T7WA 2G5RA 1MFBL 2KBGA 3RDTC 2VIRA 3QRGL 1M7IB 1ZTXL 4ENEC 4JANB 2P5ED 1XIWB 1BD2D 3GB7A 3L3HA 1F58L 4QTHA 1U8JA 2N4IA 3MREA 1A0QL 4P9HL 4X4XB 3I85A 3WFDH 1JWMA 1NGWB 2C7UA 3KNBA 3X17A 5L6YH 3O2VL 1CLZL 3DURA 1LEGB 2XPGA 2GJZA 4JVWA 5J12B 5C09D 1SY6L 4EXPX 3TJEL 2R1WA 1MCQA 3VU2A 5IIEB 5C7XH 3GI9L 5IB5A 5DVNA 3BKCH 3EYFA 1NCBL 2HVKB 3GM0A 3BP7A 1E28B 4JY6A 2OXGA 3CJJA 4R4FL 4E41A 2GUOB 1O0VA 2WQ8A 3MR9B 3WN5C 5D7SL 3LRHA 4AIXA 4W6XB 1CBVH 1A7QH 3TCXA 4TSCL 5CBAB 1B0RB 2ZG1A 3IDJA 3B3IA 4LKXA 5EFIA 2RJMA 3BMWA 4LPYA 3VFOA 3IDGB 5MEOB 1P1ZA 3DUSA 5FV2A 3QQ4A 4V1DB 3QUMH 4NUGH 3ET9F 4ZO8A 4W4NA 3U1SL 3DETD 1NGZA 4ZPVB 3AXLA 4HIXL 2X9WA 5H94B 1DBBH 1AXIB 5DHYB 4PJDB 2W60A 4Y4KC 2KQMA 3U7WH 3GNMH 1HCVA 2R4RL 2EYTB 2CIIA 2YSSA 4H1LB 4WO4C 1BLNB 4E9LA 4FQHA 2X1QA 1TQBC 3V5HB 5IG7B 4P48A 2VAAB 4PJAB 4ZDHA 3CD4A 2F19H 1QFWL 3MLYL 1DQLH 2MSPA 2JK5B 3PWPE 3GSWA 1JYXA 3QPXL 1NUNB 2X1OA 4WNQA 3TESA 1HSAA 5L2KB 1MNUL 2E7CA 4RFEB 1BREA 4OLUH 2X7LB 4U05A 3UBXA 4LHUB 1RUPL 4PJXA 3M1BB 1WAAF 2PYEA 1BFOB 1QSEB 4MJ5A 4MJIB 1TJHH 4GG6E 3RY6C 2AAVA 5ILTL 3S5LA 4AMKH 1NDGA 4FABH 3QWOB 3UTSD 1FH5L 1UVQA 2VXUH 2DLHA 5HHOD 1ZT1A 5F71A 4U1IA 4F37F 4NQSA 2Z92B 5C07A 2DMKA 4HUXA 3RKDD 3A67L 4KDWA 3W0WA 5F7NC 1MJJA 4D0BB 3NTCH 5K59E 4L3EA 4TUJB 4JM4H 4Z7UB 2WZPD 1IEHA 2X4OB 2XFXB 2YRLA 1RIUH 3EGSB 3WDIA 4JM2D 4KUCF 1XH3B 4IRJA 4IIQB 4P57A 4JO3L 1TVHA 4J2XA 5E8PA 15C8H 2DJSA 4NWUH 2X44D 5HVWA 4Z7NF 5IB3B 4XPAL 4JKKA 1INDL 1N26A 4NP4L 4FZEH 3I6GB 1UB5A 2Y5TA 3BIKB 3O9WC 4RMQA 4JHAL 2IALA 2BNQB 2GEEA 3PDDA 5CEXA 4Y5XB 1MVUB 1OAQH 4D94A 3STLB 4WHTA 3RTQC 2PO6C 3QI9A 5LJYH 3R8BB 4YXHH 5IM7A 3L3KA 1LE5A 2DWDB 3LIZH 5ANMA 2EDWA 3SKUD 4WHCA 1CYGA 4XVJH 5T5FL 3UC0H 4R4ND 5DJZA 3CU7A 3G6DL 5EO1A 4HDIB 3SKNA 3EOBB 2OR7A 3X11A 4C56B 5JPNA 4KKCC 4MXWH 4L1HA 1S7TA 4N8CH 1FIEA 1NMCC 5D7LB 3RIAK 1NLDL 2EYRB 2YPLB 4OZIA 4MNGE 3WFZA 3SQOL 2P5EE 1BD2E 3K2MC 2H9GB 2YA0A 1FG2A 4MXVF 4P4KD 3PJSB 1I9IL 3FT4A 5FIEA 5KSBF 3GJFB 3SPVA 2JJVA 3CFBB 2QSTA 1JRHH 1XCTB 5IBTH 1IGTA 5C09E 3BUTA 3B9KC 3D39A 5HHMB 3I3DA 4PTTA 4OLXL 3O2DH 1OM3L 1MHHB 5EC2B 4LCYB 5KAQG 1T7ZA 4R7NB 1PLGH 2J3SA 3OKNA 3BEWA 3Q1SH 1ETZA 1TXKA 3HRPA 1ZA3A 3HAEB 5FUOL 3OR7A 2IJ0C 1JPSL 1EIBA 1ZA6B 4IBLT 1S7RA 2DRUA 2VDRH 3ILPA 5GS3A 4S0TD 1TZGH 4R97B 5EUKB 3PV7A 5HVHB 1A4KA 32C2A 3QEGL 3P9WB 3V2AR 1KLGB 3MLUH 4X99A 4EVNB 3MSPA 4NZUL 1SJHA 3GSNL 5KVGL 4WV1C 2BERA 1D6VH 2NNAA 1MSPA 4MAUH 2BDNL 1RMFL 1P9MC 1IQWH 2AGJL 1KJ2L 1BVLA 1AC6A 5JTWA 4TNWF 3AM8C 4MQ7A 3TJHC 3FFCB 4ZUTB 4M62H 4WWKA 3GI8L 2AABL 3V6ZA 1VB9A 5L7XL 1OTTD 1SYSA 3ESVF 4LOUC 1MFAH 1RHHA 3MV01 1B6UA 4XBEH 1YEHL 4BQCA 3ZDZF 3E3QC 2X9YA 3IAQA 2O61B 3KLHD 4OJFL 1O7VA 5F9OL 4HPOH 1R5IB 4FNLH 3BPCA 2R39A 1QVOA 2E7LC 2W0KA 3L3DB 2QR0A 5HHOE 1HNFA 4P2OC 3FQNA 3PWPA 5E99H 1IKNC 3EYQC 3IDNB 4NKIL 3ARTA 3D5OF 4OUUB 4QHKJ 4G3YL 4YDIL 3UTPE 1MCCA 4U33A 2X4TB 1G0XA 1NL0H 1C8PA 4KHTH 5IK3A 4AEIL 3WJJA 2B5IC 5TE4L 4GG6A 2FJHA 5DQDH 4WUUB 4LSDA 3B4NA 2VDNL 2VZOA 4PLOB 1EHLH 3MXWL 3OZ9L 3D0LB 1OCWH 5DJAA 3CPLB 3LPGA 1OL0A 4WW2C 1MY5A 1LD9B 2FGWH 2XA8L 3HUJB 4P46A 5A3ID 1NKRA 4BQ9A 5IGXL 4Z7WB 2AJZB 3VH8G 4K3EH 4ZFFB 1T3FB 2ZOKB 3I2CH 3TYFB 4HAFA 2A9ML 2AP2A 3O3BA 4DW2H 2DL2A 2FEEI 2AEPH 1SM3H 4LF3B 2ZOLA 3TBYA 3TIEB 4IRZH 1X7QA 5JIHA 3Q6FA 3SDXF 3WS6C 3MO1B 4CGTA 3W9EB 1C5DA 1CFTB 2FYYA 5IVOA 3THML 5TQ0H 4KZEH 5DJDB 1L6XA 2ADIA 1JZ7A 4XRCA 4PFEA 2Y07H 4PGCA 4IHOB 4X98A 3ROLA 1FZMA 3O6KL 4G7VH 3TNNA 1RQ5A 2YXFA 1YC7A 1WBYB 4POZC 4XP1L 1MJ7L 4JQIL 1JE6A 5FK9A 1PEWA 3PL6A 3SY0B 1CG9A 5TF1H 1AXTH 1C16B 4EN3B 4TNVF 2YN3A 3WHE1 2BVQB 4WGWB 3Q6GL 4L4TD 4AZ8A 3BZFA 4RDQF 1H3GA 2WWKT 4GRWH 3QUZC 3EJYC 3PP4L 4Q6IB 1Q9WB 1EX0A 4PJ5D 1AGBB 1FBIL 3O8XA 2EEDA 3QIUA 4YE4H 4J3XA 1CWVA 5D7JA 4Q0XH 1RVFH 2VLKD 5F3BB 5IMOA 1KPVA 5JOFA 5BZDB 3VI4F 3MJGX 1MOEA 1N4XL 2O5YH 4U1JA 4AY0A 2Z31D 5CIPH 3KPLB 5EIQA 3TA3B 2QEJA 1Y18A 4LP5A 3GBMH 4RWYL 1KSRA 5C0CB 3BIBX 3SDCB 5KSUB 5AZ2H 3FB5B 1U3HC 5LWYL 4OZHF 4PRBA 1FDLL 1EAPB 4F9LC 5DO2C 4HX1A 4M5ZH 3FQWA 3C5JB 3DYMA 1ACYL 2OXHA 1V7NH 1D5ZA 3HR6A 4H88L 1LE9B 1Q38A 2OJEA 2DMCA 2A6JB 3MUHL 4PJBB 2EXYD 3NAAL 3RL1B 5FA3A 1XF2B 1TZIA 4Y1AD 1P84J 5GGRB 3QIBC 5C6WH 3E6HA 5T3XL 4JN1L 4YHYB 2EIZB 1INEH 2FEEL 4PJFB 2NY0C 2ITDA 1RULL 1KTLA 1U8QA 3RWCA 3A6BL 3RIFF 5HY9A 1VFOA 1FIGL 2JB6B 3FRPA 3MLTB 1BFVL 3ARDD 5E4EC 5I1LB 2VTFA 1MLBA 3TT1L 5BV7L 3UEZA 3QQ9D 4NQXA 2D7QA 3VW3H 4Q58C 1CLOL 2WM0A 5I66B 5J6GB 1JHLL 3EFDL 1BF8A 3I6LD 1GGUA 3HMXL 1HE7A 4AH2A 1I7UB 1RZIB 3RFZC 5FKAA 1J8HB 1T89A 4FXKA 4MNQD 1G7IB 3Q3GB 4XB8A 5F21B 2EKSB 5HI3C 4HS3B 1LVEA 1HHGA 1YDPB 1LWRA 5I73C 5I2IB 5EUOE 3OAZK 3FQTA 2PTTB 4QGTA 3TVMA 5E8EB 4NKQB 2R0LH 3P4MB 4LARL 1UCTA 2DQDL 4HKXB 1HQ4A 4JO1H 1VACB 1CE6A 5F1IA 1CGTA 4JFXA 4KZDL 2P44B 3QFJB 1G7PB 3MLVL 1U8HB 3MRDA 3NIDE 1PZUB 2Z4QA 4KQ4L 4PJCA 5FM5O 4R3SB 3RBGA 1A6ZA 3MLWL 1OP3H 5CGTA 3T0EC 1T03L 3KLAB 4G43B 1B4RA 3VFGH 4NNPL 4HXAL 3AUVA 4FFVC 2F53D 1UB6A 3O6MH 2IQ9H 5HHOA 1T04B 4IS6B 2YWYA 4PTUB 4JKMA 1FYTD 2Q7YA 3U7YL 3JWOH 4GKZB 5CJOL 4QRSA 5KSAD 3O0RL 2BVYA 3BYYA 1NCAH 3O3AB 35C8H 4QEGA 1QSFE 1YECH 4G5ZL 1M7DB 5E24E 2CDGB 3BGFC 5CUSL 1EHXA 5EORL 4MWFA 1A6PA 2C1OB 1A64A 3WD5H 4KK6C 4HIEB 5F1NA 4Y89A 1AD9B 1IBGH 2EDQA 4Y2DD 4Z7VE 3LB6C 1YMHB 3GUTA 1JPFB 2OMBA 1JK8B 5JZ7C 4NUJB 1KENH 2VSDA 5F88A 1MCRA 3I3EA 1IAIH 4L8CA 4N0CD 5ELIA 3UTZB 1K4DA 4H1LH 1LILA 1X6NA 4Y4HD 4E42B 5DRWB 2AK1L 3LN5B 2HLFC 5B3JF 3VXNB 1TFHA 1AP2A 4W70A 4LGSB 1OGAD 4HBQA 1A7NL 4ODBD 4M6MH 4AENA 5D1ZC 1KN4H 4YHZL 1EMTH 3DROA 2UZXB 1KIRA 5GS0H 5IFHL 4G6JL 4J4PD 3HA0A 3D25A 4KKAD 3GKWL 1TJIH 3FB7A 5L0QC 3G6JA 2QKIA 3BPLB 2IFGA 4GKSA 4L4TE 5CMAB 3WHXB 5BS0D 1YEGH 2WAHA 1QBBA 4TULH 3K8KA 2ZG3A 2D0HA 4G7YL 1G1YA 3O4LB 5D2NE 2ERJB 3TFKD 3V0VA 4HZLA 3QUMA 4EIGB 2VLKE 1F4YH 3L5XH 3E6FA 4U6YB 2XZAL 3S3SA 3IKKA 1RJYB 5D6CB 5I16A 4JDZB 3T3PF 3PWVB 5FCUH 1RY7B 2DLGA 4ZUSA 1WBZB 2BVTA 5AG8A 3MNZA 1A7PL 5C6PB 3RVXC 4F15B 1S7QA 1GC1C 2RCSL 4NO3B 5IOPA 1Z3GH 4N5UA 4JHWH 4TOYL 4HKBA 2BVPA 1FGNH 4Z5RB 4KK5D 1KEMH 3WLBA 2NX5B 2P42B 2R2EB 4H25A 1BZ9B 4NQEB 3LKOA 1HH6A 5F9JA 1D5IL 1I9JH 3R1GL 4ODWB 1H5BB 5B39A 3MRFA 4YPGA 2COQA 3ZKNC 4Y1AE 4RMRA 3F12A 1ZGLM 3TPKA 1YYMH 3OKEB 4Z8FL 5IHUL 4OZGB 2R0KL 4YUEH 4WU7B 2DD8H 1CFVH 1KCSL 4KTDH 2ARJB 3VXSE 4OIAA 4JG1L 2YXMA 4BZ1H 1DVFC 3NIGE 1U41A 4U6XB 2FX8H 1ZLUH 3DX7B 4HC1L 1RZ7H 3MLRH 4QNPE 4GRMA 5HJ3A 3AMLA 4HMCA 4CVZA 3L5WA 2D0GA 4JR9L 3WNNA 1PAMA 1PJ9A 1ZLSL 4ZS6D 2D9CA 1RZGB 4HFWB 5TDNA 3I6LE 4ELMF 2H26A 2Q8BH 5E00B 1PYWB 4FQLH 4JKPH 3HC0A 3VFUA 4MNQE 1AGDA 3WYRA 2CO6B 5J56B 3AREC 5DMIL 3FT3A 4X9IA 5IBLC 2OSLA 3HZKA 2DKSA 3GIVA 5BRZD 2HAZA 1OAYL 1YN6B 1IGIL 1NGPH 2NY7L 2ZKHH 2OL3B 4BFIA 3SCMA 2M8XA 2PTVA 3VRIB 3MBEB 3DVIA 2O26U 3IXTB 4EI6B 4N0UB 1OT1A 5I19H 4M7LL 4HUUB 5BW7A 4P3DA 1S5IH 4PS4H 2QHRH 4EUPG 2F53E 5HYFA 5GS0D 5T1DH 3CNKA 2FIKB 2NLJB 1T6WA 7FABH 4NSKA 2AI0H 1FYTE 1HKLL 4XNUL 3QO0B 1BZ7B 3VG9C 4UAOC 2HRPL 2H2PC 4KTEH 2NXZB 1PKOA 3HAEH 1NC4D 3AS0A 1UWXH 5GGSY 1JNLL 5DS8B 2CKBL 4YWGH 3H9SA 5F70A 3MRRB 4KHXL 3STZB 4RMVA 1IE5A 1TCRB 3DIFB 2D7TH 3MV9D 4PLJD 4YXLL 1HYSD 4OCSL 3MRKB 2ED7A 3CFDA 4GKNB 2APVA 5DC4B 3K3QA 1NPUA 4S1RH 5DJ2B 5SX4H 3T4AB 5IW6B 4OF6A 4HK3N 2PTUA 4OZ4B 2NY5C 3QXAB 2CJUH 3X12A 1I8MB 5FAAA 5KS9E 1PD6A 4F2MB 4YX2L 1AI1H 4S2SA 1JNHA 5D71H 1QSFA 1XF3B 5BOPA 3O2DA 3BSZH 1AHWA 1FCGA 4OD1L 2R2BB 1V3KA 4RA0C 2DS4A 4I3SH 2R0WL 1OGAE 1Q94B 5KJRL 1ZLVH 5DHXB 3W2DL 3C9NB 1BX2A 2G60H 4Z7VA 3C2AH 1MRDH 3TNMB 1G9MH 4LCUB 2VLLA 1CU4H 2J8UF 1F6LL 2JCCE 4XZUB 2BY2A 4AIZA 5GSVB 3NA9L 5TDOA 5ENWB 1QLRA 3E2HB 4OLVL 4W81A 3N1GC 1CFBA 4QCIB 4MAYA 3MLZH 3HE6C 4NKMA 2NY6D 4XVTH 4LBEA 5M94B 3RNKB 5LXGH 3G5VA 3IKCA 3NGBC 3OL2A 5H2BB 1PKQB 3ROOB 4UB0H 1AC0A 1C7SA 3ARFC 2W91A 1TIUA 3MCKA 3QUKA 3TIDA 2HWZH 2MQ3A 1FC2D 5F1OB 3S96A 4ZSOE 1QG3A 2FDBP 5F9WB 1KB5L 3BZ4A 5DT1L 1T21B 5B4MD 3GSRA 1CLYL 5D2NA 3H3PL 1QSVA 3T2NL 3FOMB 4JFFB 4J8RA 4X6DA 2YKLL 2RQ8A 2UVEA 1QQDB 2A6IA 4UUJB 3MMEB 1IAMA 3RZCC 2ICCA 2X70A 3A6CH 2DQJH 2DDQH 3B6SB 3GMOB 4BFBD 4GAGL 5EWIL 4YQXL 1BQUA 1GYAA 2FBJL 4AM0B 4DCQB 5HYQA 5FA4A 4NC1C 1CD9B 1GC1L 3QXWA 3V8CA 4X9FA 1U91B 3NCYP 3BD3A 3SJVA 3VGGA 3BKYL 4MJ6A 5EZIH 2AK4B 5CINH 4A6YB 1G6VK 3W39A 1CFNB 5C0FB 2R56H 2DLTA 5JO5A 3IFLH 1T22B 4CL7A 1UJ3B 5F97E 1UACH 2ZUWA 5LGHH 3CH8A 1SJXA 3EYOA 4XVUD 2X10A 4KRNA 4I0PB 4Y1AA 3EOTH 1A6UH 2FX7L 3B2VH 1FPTH 3QHZL 3LQAH 5KVMC 2CDEA 3VXSA 2DOCA 1J12A 2IAND 1I8KB 4PY7A 2KUTA 3NN8B 3AB0B 4MNHA 43C9B 4JFQB 4Y19D 5BRZE 1Q9KB 1CDGA 3KPQB 4BH7B 1HK6A 3MUY1 4UU9B 2YZ8A 4G42A 5SWSB 5D2LB 1DBML 1KIPB 4NCDA 3VRJA 5LCVH 1H3PH 1I1RA 3U9UA 1R3JB 4K3JH 2JF1A 2BVOB 4BSVB 1QFPA 1UZ6F 4YDJB 5DZLA 4C83B 4Y5VB 2CMRH 5CGYD 3U2SA 4HGMA 4MNQA 4AEHL 3ARYA 2NTFB 2ENYA 1LP9E 1XCQA 1FN4B 4YHMH 1K4CB 3V6FA 4I0KA 4EJ1C 3D9AH 5KZCD 2NTSP 3RWGB 4MB4A 3QXDB 3IJHB 1WV7T 3MXVH 3OKLA 3QCUH 4K23H 5E8NB 5KVEL 1FL3B 2ZNWA 3FKUS 2KL6A 3QIWC 4JDVA 1W8OA 5I8KL 3MRGB 5E5UB 3KJ4C 4GMSH 1HNGA 3MV9E 5TE7L 4X5XA 2DQTH 3GMNB 1G9EA 2F53A 4D3CH 2MJWA 3VMPA 2GY5A 3CFKB 2OI9C 3DI2B 2UYLB 4LSTL 1YY8B 2NXYC 5JDSB 5KBNC 1X4YA 5KSAB 2Y25A 5J4MA 3QDMD 2BHYA 5ALCH 2VOTA 4I0CC 5CEZL 1KT2B 1T20A 3S8WA 1DEDA 4OLWH 4APQD 4ZQKB 3ZT5A 3TP4A 1Q0XH 3OJDA 4LDLB 3ZLQC 2VXTL 5D72L 5FFLA 3HE7A 4ZTOH 4G6AD 3MRNA 1KCVL 4RIRB 3D1MC 5CIPA 1S5HA 3C6LA 2XICA 4EI5B 4Y2DA 4OD2B 2NY5L 2V7NA 3BJLA 5B38A 4ZFOB 3KWWA 1I9RH 1G7MB 3KPSD 5L8KB 2MNUA 4BZ2L 5KS9A 4MD5B 4ORGA 4ERSH 3N1QC 4KJQC 2VLJB 1WK0A 4Y4HA 1FP5A 4JPKL 2DQUL 5DJCB 5E94B 2VDOH 1ZHLB 4U0QB 4PJ7E 1OGAA 5JIPA 3HMWL 2Y5EA 5HD8D 5D1XC 2QSCL 4RGNB 4FQQA 2XWJA 4PIRF 5BS0B 1U0QA 5CKGA 4X7TB 3VE0B 1LGVA 1AGEB 4UQ2B 2FGZA 2JCCA 3ULUH 3ARGA 4GLRH 3H9HA 3QH3B 2YPLE 1KCRH 1U92A 1E6JL 1N5AA 2BFVH 5JNYB 2FJGA 2WIIB 5BO1L 2DQHH 2NW2B 3DUHA 3ALWA 4RQQB 4MXQC 1D9KD 3TPUA 3MOAL 4OLZL 1YEKH 5JHDB 1PG7H 3NH7H 3NABL 2NZIA 1I9EA 3P73A 5HHME 5KVDH 1CICB 4HF5L 1EJOH 1JN6B 3QCVL 4GXUM 1IGMH 3RA7H 1S7SB 3KYAA 4HD9A 1OT2A 5LG1A 2GIYA 3V6OC 2Z0BA 4OT1H 4X4XA 1WC7B 2IC2A 4O58L 5IMMB 3FOLB 4DVRL 3BZDA 4OCXH 2MWCA 2OR9H 5ADOH 1A3LH 3IRZA 4F33B 1MH5B 4JPWH 4KKBD 2HJLB 3KS0H 3GKZA 4A2MA 3V4UL 2KDGA 5DJ6B 5IIEA 2HVJA 1A9EB 3TT3H 1U3YA 3VFPB 1WICA 1FLRH 4K7FB 2IANE 1E28A 5DMGD 2R29L 3PUCA 3L7EB 3BAEH 1LEIB 4Y19E 2R2HB 3MX0A 4LSSH 3HLAB 2GSGA 4P9MH 1I3GL 1B0RA 3SE4A 1E4XH 2H41A 1JZ4A 1OARH 4P23D 3SGEI 2GYSA 4D9LL 1UENA 4OF7A 4XHJC 5DMKA 3IDGA 5IBUG 1T2JA 3WFCH 2P5WD 5MEOA 1J05B 2FLBT 2VUOA 2ZJSH 4PJ9D 3KHQA 4PJAF 2DM4A 1J18A 4V1DA 2ZP0T 4KI5D 3HG1D 4H26B 1EVUA 4NKOB 2FR4B 5I8EB 4CDGC 4MQXD 1P84K 5H94A 4U1GB 4JRYB 1BM3L 5BRZA 5DD3L 4PJDA 2CGRL 5AZEL 1JWUB 3CVHH 2EYTA 4NZRL 4OD3H 4HT1H 3BUYA 3QEUA 2YMXH 3SDYL 3F7VB 2CRMA 4NKDB 4UQ3B 4ODSL 4YFLI 4XCFL 4LVNC 1AY1H 2WSKA 5DR5L 3CXHJ 5C3TA 1ZSDB 5F93C 1A6TB 1W2KT 4HQQL 4F7TA 2OK0L 4XPFH 1N7MH 4UILH 1XEDA 2A9NL 5JW3L 4Y88A 5DYOB 5GGTH 4WFFD 3C5ZD 2FL5B 1S8DB 25C8H 3QDME 4LHUA 3BDYH 3M1BA 2LV4A 3D85B 4MJIA 1BBDL 3RI5K 3P3YA 4PD4J 1X9QA 3C6SB 4GAJL 5DGRA 1LEKA 4P5TB 2EYSB 1WFUA 1MRFH 3IS1X 1CR9H 4XAKD 3NCJL 1CE1L 3MLSL 1CD1B 3MV9A 3TGXA 1HSBB 4XMLL 2APWA 2VN7A 1OAZH 2GFBA 3HUJE 1ONQB 3G5XA 4D0BA 3TBSA 3BVNB 4Z7WE 2FWOB 5D7IB 3KPSE 3HZYB 4BK5A 4IRSB 3TO4B 5CHNB 4LCCB 4ZAKC 2XTJC 1SJVA 2FH8A 2G5BB 4IIQA 3L7FB 2OJZH 2DM7A 1U8PA 3VXUB 1JV5A 2NY2C 4KY1L 3FL7A 4NQTA 1RUMH 4LEOB 1DE4B 2XXMB 1MELA 5FOBA 5IB3A 2X4UB 3LZFH 3RWHA 5GHWL 5C0GA 3CZFB 2FEDC 1ZT7B 3EJJX 3I6GA 4R8WH 4PJGE 2VXSL 5GRYA 3V5DB 2AXHA 2BNQA 3MFFA 5I8OL 12E8H 1QO3B 4Y4KD 3STLA 2VABB 2UWEB 4XBPB 1PQZB 4P2RD 1DEEB 4D0DA 1MHCB 4G6ML 4DGIL 1HXYA 1UM4L 5AWNL 2YBRB 4ONFH 2J4WH 4ZUVB 3WUZA 2LU3A 4U3CA 5E9DB 1FAKT 3WO3B 2C3VB 1PFCA 5DTFA 4JREB 3VGHA 1UWGL 3HI1B 1CQYA 4KVNH 1N64L 3FMGL 3LAFA 1D5MB 4N8VG 3AFLA 5ESAA 4IRJC 3EOBA 4JFZH 1YEEL 4C56A 1UKTA 3RJDA 5IJVB 3TCLA 5IB1B 3HZVB 3B5TA 2YPLA 2EYRA 2P46B 1AE6H 2IAMD 1L0QA 4RMSA 1GGCH 1I4FA 2KZ1B 2H9GA 2W9EH 2VH5L 4JCLA 3VA2C 4HIJA 4KPHH 1KTDB 5TFSH 3VFWB 3PJSA 3C60B 1YPZE 4FQXD 1T2XA 2FD6H 5J11C 4TUOA 1P4IH 2F5AL 3OWEA 1XCTA 3M45A 4ZXBD 4NRYB 3C2SA 5F1SA 2NCMA 3WV0A 2AXJA 3QI9C 3IU3B 3VXPB 2BSTA 4JG0H 3CX5J 3D3VD 4XNQB 4ODVH 3CDFA 1EBAA 4LCYA 4QT5B 4ZS7H 4R7NA 4BSWA 3IXAA 1NBYA 4GW5A 1S7UB 4M6AA 3HAEA 1S7WB 1GPOL 3CUPB 3WSQL 1N6QH 2R0ZL 5DF0A 4M02A 5DWUH 3TN0D 1MJUH 1CDYA 4ZUWA 3BPNB 3FTGB 2ATPA 4PJFE 5C0JA 2P5WE 4IMKA 4Y4FB 3IB4<