4R26H

Crystal structure of human fab pgt124, a broadly neutralizing and potent hiv-1 neutralizing antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
231
structure length
226
Chain Sequence
VQLQESGPGLVRPSETLSVTCIVSGGSISNYYWTWIRQSPGKGLEWIGYISDRETTTYNPSLNSRAVISRDTSKNQLSLQLRSVTTADTAIYFCATARRGQRIYGVVSFGEFFYYYYMDVWGKGTAVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PGR124-Light Chain
publication title Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
pubmed doi rcsb
source organism Nomascus leucogenys
molecule tags Immune system
total genus 40
structure length 226
sequence length 231
ec nomenclature
pdb deposition date 2014-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r26H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r26H01
3C5ZB 3NVQA 3TO4C 5ILTH 3LQAC 1HH6A 5CZVL 2IAMA 2NXZB 2EO9A 4RMUA 1QEWB 3C08H 4J6RH 4XVUD 1UM6H 3PWNB 1S9VA 1E28A 4MJ5A 4OLZH 3QHTC 3G6JA 3AGVA 5GGQH 3B83A 4IRSC 2F54A 4E41A 4RMWA 3WSQH 3H3PH 5SV4A 3WCYA 5AZEH 4OLVL 3VFNA 1A1NB 1QFHA 4K3HA 1QBAA 5MEQA 4TNVF 2F8OA 5D4QA 1MCIA 2ESVD 2HFTA 3G6DL 2AJYH 5D6CB 2CLRB 4P3DA 1R3JB 3OB0H 4OCWH 2XA8L 1MLCB 2VDNH 4NWUH 1CL7I 5SWSA 5I17B 1C5BL 1S7VB 4LIQL 4XMLH 2VDQL 5KW9H 1EEZB 4OD2B 5L7XL 1T5WA 2EE6A 3HC3H 1KCKA 4YEFA 1T1WB 5TE6H 4YQXL 1FJ1A 1CG9B 1EVTC 3NH7H 3CLEH 1JGDB 4PJHB 3MR9A 3WS3B 4FZEH 1OSZA 2NY4D 4NKDB 1NC4B 2YBRB 4FS0A 4F7PA 3TO2A 1LNUB 2PKDA 1N5AA 3PWVA 4I5BB 4KVNL 3U0TB 3ARDB 3GSOB 1JGVH 3QUKA 1MIMH 5E9DA 4OFYD 1L0XA 2DICA 2NLJA 1XAUA 3AREA 3HNVH 25C8H 4OQTH 1I1AC 3MNZA 1FZOA 3MRQB 2ENSA 5IQ9A 3IF1B 1U8QB 2BVOA 4PJ8C 4LEXH 4R3SB 3KAAA 4Q9RL 1NGZB 1EXUB 5T5NG 1I85C 2D4FA 1S9XA 3I3BA 1CLYH 4YZFF 4HCRL 4ODUA 4JZOA 4GG8A 2IQ9H 1EGJA 3MREB 1JN6A 5E4EC 5F6HJ 5EZIL 5MENE 4YAQA 2FR4B 4ZFOB 4RGNC 2YK1L 3C6LB 4FTVD 2J2ZA 4JHZA 3EYUL 4BKLA 3MLSH 3DUUB 4G8GA 4PRDA 3O2VL 2EYRA 3IETA 4HV8B 1QPPA 4WTZG 2VLKB 2ZOKB 5FV1L 4NO2B 4MQXC 1QLRA 3J7HA 5F9AC 4Y5XB 2Q8AH 2EDQA 1V7NL 4RAVB 3F7YB 4KK5D 3GSUB 1ZKAA 3VXRB 3QYCA 1NCWH 3DV4A 2VIRB 1CDUA 5BV7H 1B4JH 3DECA 1KTKE 2NY5H 3ZL4L 4EDWL 4PD4K 3V6ZA 2MKLC 1KOAA 4WTWA 3PWPD 4Q6IB 4ZUVB 5A2FA 3RNQA 1OAQL 1F02I 2R0KH 4NQED 1S9KC 1XH3A 4JQXC 4PJFE 4JM2B 1MRFH 2DM7A 4OIAA 2GY7B 4U1JB 5I2IA 4PG9A 4N8CH 5BS0B 1MEXH 1ZVYA 5L88L 1EEUA 3L95A 2VLRB 5ADPH 4E5XA 4KAQH 1YJDL 5BW7A 1FN4A 4JHAL 4OSUL 3E8UH 4P5MB 1C08A 1OSPL 1XF5A 5FHBL 4ZTOL 1UH2A 4NO3B 4G80B 1GZQB 2BDNH 1XMWA 2YPVH 1P4LA 2CLZB 3SDXB 5IF0B 4N1HB 1M1SA 2HLAB 3H8NA 4XVTL 2VXUL 4OUUB 3NOIA 3DX8A 4Y7MA 5JNYA 3LN4A 4U33A 1G7PA 1K8DA 3TV3L 4QNPE 4FQXC 1N4XL 2KQNA 4OI9A 2E6JA 1G0DA 4NC1C 2GYSA 4YHOH 4HCRA 1NDMA 4N0YL 4C56E 3VI3E 2AP2A 4Y2DA 4UB0L 4XPGH 3CSYA 3QIWD 2EDJA 4CMHB 3SO5A 3DHJA 5I1AB 3HMWH 1S5IH 5FCUL 4PRPE 1HKLH 2E9JA 2E7HA 5GGRA 4LVNC 2WUBH 35C8H 4ONFH 2BNRD 5F88A 5TF0A 3HPLA 4HWBL 1XCQA 3BEWA 2F74A 4O9HL 5DHXB 3RI5K 1IGTA 3TVMB 5JHDD 2W65B 5FYKL 1OTTD 3UTQB 1YQVH 4DQOH 5F1KC 1JZ2A 4G3YL 3AUVA 4JG0L 5SWZE 4XCYB 2DLEA 1UKTA 2FH6A 3SE9L 1NGQH 3RIAF 3ECBB 5F89A 3VRIB 1OAZL 3RBGA 3HKFA 3FQWA 4OFKA 5GRJL 1FBIH 3U9PL 3QJFB 4AG4L 4HX1A 4TNWK 4XP4L 1NLBL 4J4PA 3MV9A 4MJ6B 1MIEH 3RUGF 1QHOA 4BFIA 2PCPB 2CDEB 1FAIL 3N1MC 3UMTA 4EN3D 1BF2A 3EAKA 5FYJU 1WZ1H 2W9DH 1DUZA 4GS7C 1K6QL 1GSMA 4DGYH 5D7SH 4PD4J 3MLWL 3PWJA 3MXWH 1U58B 4Z7WA 3O4LD 4Z0XA 4JG1L 3HS0B 3BJ91 2WANA 1T83A 5EWIL 4OM1H 2YD4A 4HQQH 2MQ0A 4DZ8A 3R0MA 3GRWL 1MCDA 4BZ2L 3VGBA 4YDJB 1LO2H 1NUGA 1I1RA 2QEJA 3HFMH 5EC1B 5EUKA 4EQ2A 3AXLB 2FECL 1A6PA 2B2XH 5EOCJ 1F3DH 1MF2H 4F15B 1T7XA 4GKZA 4P5KB 5CZKA 3MRBB 3UX9B 5T3ZL 4KMLB 1KPUA 1OTUC 3TN0B 4WEBL 3RA7H 3O9WB 1CICC 3ZKXC 4K3DH 1I1CA 3SEPA 2EDHA 4KDVA 3CFKA 2GQHA 3RVUD 3G6JF 5IJVA 4NFDA 4HWBA 5DD1L 3U2SA 3U30B 1JYWA 3K0WA 3OR6B 1EFXA 4G6FB 3OAZK 3G08A 4M3KB 1FYTE 4HPYL 2DTMH 3KG5A 2RCSL 1OTTC 3RWFA 1U8MA 4HT1L 4AEEA 4IMLB 1U8OB 5FO7B 1TQCC 3RWGA 1D5ZB 3QCTL 2YD1A 2YD3A 4TUKH 3Q3GA 1XGRA 3G5VA 1JYXA 4HZAA 3E6HA 3NGBC 3MRJB 3SCMD 2GFBB 1IKFL 4M7JL 3L7FB 2YD5A 4X4XB 4BUGA 1UM5L 1QBLL 1RJLA 1CLCA 5E1AB 1Q9KB 4I4WA 5EDXA 5DRNA 1FZJB 3T77A 1YEIH 1B9ZA 1QRNE 2HFEA 4H1LA 2UVFA 3H9YA 1U8PB 4EN3C 4JCLA 2BFVL 1KXQE 4JANB 5DVLA 4U6YA 4P2OD 3CC5B 2CPCA 4PG2C 1KFAL 1MFAL 3PP3H 5IK3A 4L4TE 3G6AB 1RI8A 5IEHA 5GPRA 3FQTA 3MV8B 3ULUE 3ARGD 1T6WA 1KXVC 4LMQI 4F9PA 1EHLH 2HJLA 5MEND 2QSQA 4ZUUA 4EZMA 3VE0A 2Z91A 2QV2A 4XCCL 2RR3A 4NN6C 3OV6A 3GRWA 4GO6B 5DZNA 2EDOA 4I0CC 5I1GH 3QEQE 1LK2B 4RRPG 1ZT7B 2ZCLL 1RZ8B 2B4CH 4DUXA 5CP7A 4R2GB 3R8BB 2BNQE 2W9EH 1BLNB 1TVBA 1VENA 3G5ZB 2V17H 1KTLB 1QLEL 3L5XL 3NCEB 1ZXQA 1TVHB 3JUZA 1FGNH 2X41A 1DR9A 5L8KB 4XNYL 4PJDF 1UXWB 4KPHL 3PGFH 2D9QB 1FYHB 5KOVC 4NHCL 4PJXE 3EOTL 1Y0LB 1R5IB 1PYWA 4RMRA 3SJVD 4G8EA 3B9VA 1XF4A 1H5BC 2D7TL 5F1SA 4X7TA 3KWWB 3MA9H 4X6EA 1KNOB 3WO4B 4MD0B 2E5EA 1LWRA 1BVLB 1HQ4B 4L8SB 5BVJA 4M4PA 5LWYL 3GEWB 4GAGH 5HI4D 1G1YA 4Z7QF 4AYFA 5L8JB 1T2JA 1U8JA 1TJGH 4YPGB 4HIHB 2CIIA 4V1DD 2J5LC 1G7IA 3UC0H 1I7RA 2XFXA 3D48R 2R69H 3HE7D 1OTSC 4TRPH 1H3PL 1AO7D 3MRLB 1JNNH 5ALBH 5ACLA 3OAUH 3H9SD 3DRTA 3LRHA 2DTSA 3F65A 5BVPH 2GEEA 5ICZA 2W0KA 3ARGC 1X5YA 2MWCA 4PUBL 4HC1H 5EO0B 1ZT4A 3RWJB 3UAJC 1HHKA 1IAOA 4YXKH 4KY1H 4M48L 2QADC 1DQMH 3T3MF 1KCUL 5I1CL 4BQ8A 3DLQR 1NKOA 4Q2ZA 5E8EA 5HHNA 1D9KD 4L4JA 5DYOA 1AXSA 4X4YA 5CJBA 3GM0A 3QWOB 2XTJE 4WI3A 2XZCH 2HVKB 1NGXA 2Q7YA 1JBJA 3B9AA 2XWJA 1DLFH 2Z4QB 1J10A 1JNLL 1ZWIB 2FWOB 1TZHA 1IGIH 1DQJA 4U1KB 1OY3B 1NAML 1BREA 3TP4A 5FFLA 2BNUA 2P8LA 1E6OH 2W92A 3KYAA 5BRZB 3QJHA 4HK3J 3FCTB 3BPCB 1LD9B 3BAEH 4XAKE 1SY6H 5K9JL 1MRCL 4OGAD 5IROC 2BY3A 5D7IE 3D0VA 1G7LA 4L29A 1OCWH 3HG1B 2DBLL 3S37L 4XBGA 4L5FH 1HHJA 5C71A 2BVPA 2LU4A 1JPTL 3C6SA 2YPLE 3PL6A 1P7QD 1IGML 4PP1D 4NQDA 2IANB 4YK4B 4M02A 4BFBD 4U0RC 1U0QA 5CAYB 4F7MB 5IM7A 4Q9QH 3JV5A 1CR9H 5DJ2A 1NANI 5DRZA 1A4JB 5FK9A 5JORA 2VB5A 4WNQB 3QIWA 2W0LA 2ERJC 1WSST 1R0AL 1S7RA 3QAZC 4BH7B 3VD9A 3BT2L 3OR7B 2GKIA 2CKBL 2VERN 1T03H 2EZ0D 5TQ2H 3WJLA 3D1MC 3QPQD 1N6VA 4F9LC 1EJOL 3OJMB 3L3OB 5C09D 3T0ED 2A83B 5FGSA 5IVOA 3WFCL 3OX8A 3MOBH 4JPKL 1AH1A 5TDNB 3FT3A 5HY9A 1RUQH 1IC4L 2ZNWA 4ISVB 4Y1AB 3BKCH 5C0BE 1AI1L 1R3HB 5JHDA 4KZEL 5L2JA 2OJZH 2ITCB 2W38A 1D9KC 4QOKE 3W0WA 4NBXB 5HHXL 1MY7A 3MC0A 3RZCD 1DQDH 4RMQA 2CLVA 3OJDB 4WUUB 3C60D 3JV0A 4RFOL 5IB4A 4K94H 2JLLA 4JY5L 4X8JB 2AEWA 5FAAA 4XBEL 4ZPVA 3QXUA 5JPNB 5CEXA 1GGBL 3GMOB 3IJSB 1NAMA 3HCVB 3CUPA 3GMLA 4OGAC 5CKGA 3PDDA 4PREB 3HZYA 5D2NB 3MRNB 4RZCA 1WBYA 2NY6D 3NIDE 1MPAH 3EFFB 2FGWH 1KLFA 4HG4K 4UTAL 4MNGE 5BXFB 4NZTL 4NCC2 4QCIA 1RZKL 4M7LH 32C2B 1F90L 4EJ1C 4G9FB 3JTSA 5FO9A 5DJZB 2VMFA 2ZOLB 1A7QH 2GJ6E 2PYEE 1CZ8L 4YHLH 3G04A 1IGJA 2J88L 4FNLL 5EA0L 3D85D 2AEQL 3S36L 5SWQA 3UTSE 3CVHH 3UJTL 1WFTA 3SDAD 1S9VB 4L4TD 4MQTB 5IB3A 1E28B 3IDXH 3G6JB 5EBLB 5FEBA 1BIIA 5FYJD 5HHVL 5I15H 4E41B 3MRGA 3KLHD 3CH1A 4F7TA 1CGVA 5FO8A 3QPQC 4UV7H 3VFNB 3SO3B 2VH5L 2B5IC 4GUPB 1IM3A 4NZDA 2CKBA 1GOGA 1XGYL 2A0LD 3T0EC 2F58H 2A6DB 1YYLL 5C6TH 1DLHA 3IDIA 4P3DB 2ORBL 3TIEB 5HHME 2ZCKH 3RQ3A 3L5IA 5D1ZD 5FB8B 5F6HI 1TTFA 1MVUB 3REWA 2NY0C 5CJXA 4FP8L 1JZ8A 1NPUA 4OCMC 1I75A 3GSWA 5J13B 4U0QB 2APVA 4I48A 1WFUA 2CIKA 2VAAA 3CVHB 2FX9L 4Y4HB 1BOGA 1T5WB 1KLGB 1EGJH 2RQ8A 4MJIE 5GHWH 1FJ1B 2QQLL 2HFGL 1XGPA 2BC4A 2VABA 4I3SH 5A2JH 4XCFL 4P4KA 3MR9B 1G6RL 3WDJA 3QUYD 5D7JD 4HS8L 1OSZB 2ZG2A 2E8ZA 3PWVB 1IAKA 3GHEL 3VG9C 3QUKB 1JZ4A 2NLJB 1AR1C 2EYSA 1RHFA 3OKKA 3MNZB 1FZOB 3DTXB 3TA3C 4JGJA 3V0AC 1LMKA 3VDBA 4N9GA 2WUCH 4P2OA 1ZHBA 4JDZA 3OGCA 4LSTH 1EO8L 5HYJD 4XP5L 5T5FL 3QRGL 4OLVH 4LPVA 1KN4L 5DEFA 4D9QD 1JE6A 4YHZH 5IQ7L 1NLDH 4N8PA 1J1PH 3G6DH 2P47B 2EDFA 5MENA 1GVIA 2HLFC 3SDDC 3B43A 4BKLB 2EYRB 2P5WD 1C5BH 2AI0H 2NZ9D 4LIQH 5IEKB 4ZTPH 4LPXA 4PJDB 2FSEB 2P24A 1B90A 1BOYA 1FFNA 4D0CA 5MERA 1NSNH 3UTPE 1A6WL 3C2SA 4YQXH 1FVEA 1NCAL 3I6KA 1ZLUH 4CVUA 3DV4B 3V4VL 2A0LC 3T0WA 3HMXL 4HG4J 1RJCA 4GXUN 3KNBA 4JPWL 4YBHA 5D1ZC 1MREH 2PF6A 3X12B 3RNQB 3OF6D 4AQ1B 4M3JA 3VRJA 1XH3B 3QXAB 5AG8A 4PJFA 5IR1A 2FO4B 5I74C 4G6KH 5I2IB 5EU3A 4PG9B 4Q9RH 4J8RB 3NA4A 3SJVA 3GSNL 2J8HA 1F45A 3ARTA 5HDOA 3V5KA 4E5XB 4X6DF 2HTKD 4HCRH 5CJ8A 4U6VH 1FN4B 3QUYC 5D7JC 2A38A 1XF5B 5EZIH 5KSUB 4XAKD 1LHZA 3EDJA 1G6RA 5DS8B 1PEWA 1HKFA 3BKJL 4GLRH 5T1MA 3EYUH 3P0YL 1UT9A 5JW3H 1C5CH 1P4LB 4O2FA 4YPJA 2D03L 1P5VA 3MRKB 4RGNE 3DX8B 5LKNA 3EYSL 3LN4B 5CMAA 5GS1B 2IBBA 2IQAA 2R29H 1G7PB 1K8DB 3M45A 2Q86A 1V7NH 3IXTA 1TVDA 1RQ5A 2WWMD 4G6MH 3QCUH 2OXHA 3CCHB 1JI2A 1T0MB 3AY4A 4EDWH 4HUXB 4Y2DB 3NTCL 4C56A 4HEME 1IBGL 3C09C 2NZ9C 3Q48A 4PRPA 4FXGB 4K8RH 1Z2KA 3P4OA 1AY1L 2C3VA 2A6IA 5LGJB 1NFKA 3UPAA 3C2AL 2DQCH 1A6ZB 3N50A 1XCQB 3AU1B 3MODH 3H0TA 2OQJB 1YJDH 4JHAH 1IGTB 4OSUH 1YUHA 3SE3C 3MLPA 5C0BD 3VFTA 1J0JA 3VWKC 2R0WL 2GAZA 3HMXA 4UQ2B 1YC8A 2RBLA 1IVLA 1Z5LA 4XVTH 5D6DA 5SWZA 1YPZE 1AC0A 4ELMB 2IH3B 2Z92A 1BPVA 3DETC 4LLDA 3TV3H 1JHTA 4YHKH 3FQWB 1N4XH 2DQHL 1J0HA 1K4DA 2HTKC 2N4IA 3HA0A 4HX1B 3GSNA 4JY4B 5EG6C 4MYWB 1OARH 2PO6D 2ZUQC 1AQDA 4N0YH 3TIDB 2FIRT 3RTQD 3WXWL 4LPYA 3CXDL 4UB0H 5EUOF 1KPRA 5HI5D 3OKLA 4M7KH 1S7WA 1KPVA 3F6IA 4LRIC 5FCUH 4WI7A 4Z6AT 1V8HA 4UNTA 3PWJB 4QRPE 2ZSWA 5FYJL 1CDIA 5C07E 3QH3B 1GPOH 4Z0XB 3QG7L 1J0KA 1QVOA 4HWBH 4DZ8B 3UXFA 5DJCA 4O9HH 4NT6A 5EUKB 5F71A 5ELIA 2KZ1B 5DQ9A 5ESVB 1F58L 3JV4A 2HT3C 4XI5D 4RMTA 4PJCE 4H88L 5D1QA 1YZZA 1G0XA 4JG0H 1KPUB 4JFQA 2LVCA 5CJOL 5IFAL 4LDOB 2NY1C 4MS8C 2R56H 1OAZH 4K2UH 1ADQL 5C3TA 2YUXA 5A3IC 4PJAE 1V7MH 4H1LH 4TNVK 5IJVB 4XP4H 1NLBH 3U2SB 2ATPB 3QHFL 4DKAA 1EFXB 5CJ5A 4W6YB 1UJ3C 4HUWB 4DOHE 4Z77B 1FYTA 1FAIH 1BWWA 3RWFB 1U8MB 2AXFA 2FEEI 2ICES 3EYVB 4C58B 3CX5J 1K6QH 1U92A 1XGRB 1FG9C 5E00A 3EKCA 2X6MA 4AIZA 4MJID 4JG1H 1FNGB 2HT2D 3PWLA 2DKUA 1BZ9B 2OR8A 4GXUM 4H8WL 2BOCB 4H0HB 4FQ2L 1RJLB 4HWNA 3GRWH 3OPZL 3GIVB 3FN3A 3QI9D 4PJIE 1C1EL 3CZFA 5DRNB 5B22A 1WTLA 5JW5A 3T77B 2PO6C 5F70A 4QXUL 1UQSA 4K9EC 2HFEB 3CDYA 4H1LB 2BXZA 1QRNA 2W07A 5F7UA 1XT5A 1M7IB 1CGSH 3EBAA 3D85A 1VGEH 2IH1A 5T3ZH 1YEHL 2VDRH 3DSNA 4AMKL 5IEHB 3P4NA 4L4TA 3ES6A 5IB1B 4I9WD 1UC6A 2HWZL 3FQTB 3S3PA 3VA6A 5TGBB 3IJHA 3P2TA 1W2KT 3WFEL 3NBNA 1G7MB 2R0LH 4Y2OA 4QRQA 2HJLB 5ID1A 5DRXA 4ZFGL 2YSSA 3D0LB 1VB9A 4EOWL 3P4LA 3VE0B 5DD1H 4WU5A 4Q6YA 2XT1B 2ZPKL 1A2YA 3B5HA 4UU9B 4XI5C 2RCSH 4HT1H 5C0NC 3FFCE 4MJ2A 3QEQA 3PDOB 1M7DA 2I60L 2BNQA 2M2DA 3PJSA 5D72H 1IKFH 4M7JH 1NBQA 4IIQC 1UM5H 1P7KA 1QBLH 3IRZA 3FQXA 1ADQA 1SM3H 4HFWA 4NRYB 3WUWA 4DKDC 2R4SL 1MCPH 5GS2H 3S3SA 4W6XB 1F3DJ 4PJXA 3VGAB 5IVZA 1PYWB 2ZUSA 1KFAH 1MFAH 5E7BA 3IFNL 2IWGA 2P7TA 3UJIL 4K7PL 4JREC 4JFYA 3BDBA 3CU7A 2F5BH 3L3HB 4QRSB 4X7TB 4X6EB 4YHMH 5HPMA 1NGWB 4PJFF 4ODVL 5CINL 1F11A 1AHWC 4NN7C 3NCYS 5KSAD 1U8JB 1P6AB 3LS4L 3MROA 5C9JA 1G7IB 5IVXB 1I7RB 2XFXB 2X2YA 1U3HB 4OI7A 4JJ5B 1LEKA 1FH5H 2NY3C 2ZCLH 4L3EE 4ZQKB 5B8CC 1NQBA 1Y6KR 4LQ1A 1XIWD 1IEAA 3DYMA 4K3GA 3DRTB 3K8MA 3QUXD 4D0DA 4UAOB 1A6UL 1DQTA 5ICZB 2DJUA 3QULA 1QLEH 5A40E 1RIUH 5CBAB 1ZT4B 1H0DB 3F7QA 1HHKB 1IAOB 1MRDH 4WFHE 2IPTH 4OF0A 5IBUB 1ZA3B 4KPHH 4KDTA 3QT2A 1BQLL 3SDCB 2I9LB 5E8EB 3EOTH 2FIKA 1P4IH 4X6DB 3OF6A 4TTDC 2QSTA 4MAYD 4PJ5D 3TNMB 4UIKH 1PJ9A 4Y19D 5F1IB 1EUTA 2D7TH 3WIIL 1BF8A 1ZAGA 1TZHB 2LFGA 2IF7A 3STZA 3T3PF 4NZUH 1DUYB 4OFVA 5LWYH 2BNUB 4P2RE 2P8LB 2WWKT 3QJHB 1LE9A 1IC5H 4HGWB 4OM0L 4TPRH 1NGPL 1INDH 1TCRA 5D7IA 1KIQB 3WKML 2A9NH 2VZTA 3WL9B 3RJQB 1KACB 3W9DA 2NXYB 1HHJB 2BVPB 1OP5H 2QHRH 4JHWL 4NC0B 1QP1A 3PL6B 4XXDA 3KXFD 3X13A 2YPLA 4S2SA 1OHQA 5F9DC 4NQDB 2IMMA 5TH2A 4UT6L 4M48H 3FRUA 1KC5L 1IM9A 2APTA 3UO1L 5DUMH 2Z8VC 1KCUH 4WWKD 5DJ2B 1JFQL 5A2IH 5FK9B 4FFWD 5GGSA 1HXMA 5GGSY 5C07D 4HXAL 4KK8D 1S7RB 5D70L 4R4FL 1NBZB 2O5YH 3FRPA 4NKOA 1JNLH 4ZYKB 3VFPA 4P23D 3TFKC 4DW2L 5J6GB 1NAMH 1F4YL 3P40A 1DFBL 3FT3B 5HY9B 1FNLA 4HUUB 4P9HL 2P45B 5K9JH 5C0BA 5CBEB 5HGHA 5L2JB 1JWMA 4LSSH 3W0WB 1QSVA 2G2RA 2DBLH 4CUCA 3S37H 3L6FA 4LOUC 1JPTH 3SGEI 5EUOB 1IGMH 5IB4B 1E4KC 4JJHA 4PJBE 4ZPVB 3MRCB 4GT7A 5H37H 1W8OA 1FSKC 4PJ9A 1NAMB 3GMLB 4JY6A 1HI6B 4OD1L 4Y4FD 2C1OA 4RZCB 3DVIA 4IBLT 1WBYB 2WMPA 3KPRD 5C0FA 4Z8FH 4WO4A 4ONOA 1V3LA 5ICXB 3BT2H 1PG7X 1KJVA 1X6LA 5DMGC 4FXKB 4QCIB 1EJOH 5JXED 3VFOA 3VD3A 3O6FC 4AL8L 4KRLB 1I1YA 3HI1A 4ODTH 4HAGA 2JJTA 3JTSB 3WFCH 4TOYL 3EJYD 5H37G 3MRPB 4I3RL 1K85A 1RHHA 1YEKH 2AK4E 2GJ6A 2PYEA 3GMMA 4NQSB 3VGEA 1AI1H 1FORH 5I73B 1G9NL 2KPNA 3BIKA 3P11L 3UTSA 2COQA 2OX5A 4A2LA 1YMHA 3GMQB 4I8DA 5HHXH 3MRHA 1I3GL 4Q74A 3PXJA 4M00A 2Y7QB 4KK8C 3FQUB 2AV1A 2ED9A 3K1KC 5C0CD 1UXSB 4I0PD 4ZFFA 1P9MC 2YMXL 3CH1B 4F7TB 1KENL 5F3HA 1EAPA 4IMKC 4KI5C 1IM3B 1FRGH 4MNHB 5FA4A 4JY5H 3RL2B 5A1AA 4LKCA 3L3JB 3BWUC 2X40A 2Z35A 3IDIB 5K59E 2W60A 2PYFA 1GGBH 3CDFA 15C8L 5MI0B 3ULUF 1JHLH 3V7AE 3HR5B 3IS0X 4WHTA 3REWB 4OTXL 5IMKA 3OGOE 4XWOD 4TYUA 4NYLA 3U7YL 2DMCA 2F19L 1MLBB 5DR5L 1BD2E 3GSWB 4I48B 3IVKB 1JYVA 2VAAB 1U2HA 2GW5A 2W59A 4UOJA 1DQQA 4UTAH 1Q9LA 4MJIA 4NZTH 1XGPB 2BC4B 3VFGL 3DO7B 4P4KB 3WNMA 1NC2A 2DOCA 2JB6A 3QI9A 1VFMA 2MCPL 5CEYB 2J88H 5TDOB 4FNLH 5T3XE 4A2MA 2DIBA 1MHHA 2EYSB 4X4ZA 2AEQH 3BZFA 4JKKA 5MEPA 5D8JL 3UJTH 4UMGA 4U1LB 1ZHBB 1CGWA 3H3KA 4UI2A 4Z18A 5HHVH 1ED3B 1CXEA 1UWGL 5CGYD 3U82B 3ZHKA 1GGCL 4PJXF 4YNYA 2VH5H 1U36A 1ERNA 1CFQB 3ARBB 1GC1C 5E2JA 3MJ9L 1YYLH 4NBZB 3F62A 3RDTC 3EJYC 4GW5B 4XVSL 1OP9A 1F6LL 5D1XD 1GYAA 1BMGA 3EDEA 4JCMA 4RA0C 4IOIA 1CQKA 1YNLL 2X1PA 3RGVD 3WD5H 3JTTA 1G9EA 3CGTA 3QIBD 3X3GH 5HHPB 1DP0A 1I8MB 2P24B 3GKZA 1FFNB 1ZLUK 4I0PC 4RDQG 4U1GC 4TSAL 5EO9B 5MERB 4D9RD 2QQLH 2HFGH 3BHBB 4WI8A 4GAYB 1FVEB 2VO5A 2I26N 4XCFH 3I6KB 4PR5A 3B6SA 5E4IA 1G6RH 4M6ML 5IT2L 3O11A 5C0RH 4HS8H 1MI5E 3GHEH 5DURB 2HAZA 3BZDA 2GTWB 1CTNA 3EYOA 1TTGA 1FL6A 2BOBA 4LVOB 3ARXA 5ABDE 1RJZA 1PKOA 3FO2A 3VRJB 3GSVA 3BO8A 1JK8B 4PJFB 5IR1B 1HDMA 2AJVL 2B1HH 2P1YA 2VZSA 1X5XA 2X1OA 1I1AA 2JCCA 4YIQA 1I1FA 3SOBL 2I07A 3P3YA 4XP5H 5T5FH 3QRGH 1A6AA 3V5KB 5CSGA 4P2RD 1W72L 3ZKMD 4YDVA 4O5LL 1KCSH 1NCCL 4KKBD 1T3FA 4CN4A 1G6RB 4LLYB 5KSAA 4A6YB 3HRZB 3IDNA 1Q0YL 2EDTA 5DT1L 3TCLA 3KPTA 1PAMA 4EI5C 5E6ID 2JJSC 1RU9L 4WGWB 2VL4A 5DGRA 2IQAB 2YKLL 2Q86B 2HH0L 3QUXA 4PGBA 2Q20A 3K4ZA 3TPKA 3MJ7B 1QOKA 5EOQL 4J3XA 3GDBA 5DLML 4C56B 1BQUA 4DZBA 3LSOA 1RZGA 3MJ9A 4O2EA 5BZWA 5KVGL 5IV2B 3RU8L 3QIBC 5C0AE 3WEXB 3K8LA 3NCJL 2VDLL 3IDYC 3MRIA 4BQCA 1NUFA 1KBGL 3B5GA 3MCG1 2A6IB 4OZGE 4U6HA 3GSNH 1AR2A 2UYLA 4LGRB 3B2UD 1DVFC 3H0TB 1IQDA 1HWGB 4P59H 2NTFA 3FOLA 1YUHB 5IMMB 4RAUB 5GRUL 3ARFC 3MYJB 3CFBA 5IW3A 3VFTB 1MUJA 2E9IA 1JCKA 4LBEB 5JLZA 1DDHA 1JPFA 5KS9F 2ADIA 3U6RA 1S7UB 4BH8A 4X9BA 1PEZA 4R26L 1ND0B 5B39G 4OZIE 4X98A 2HT4D 1YPZA 2EC9U 2J8UE 5T1KB 4LLDB 5AAWA 1JHTB 3AAZA 5I8EB 5B39B 5HHOB 3V9FA 3I9GH 1J5OH 3QEHB 2HFFA 2DL9A 3KXFA 1K4DB 1OWWA 1UB5B 3GSNB 1HWHB 3ZKMC 1AQDB 1MCWM 3UPCA 4OCXL 4FQXA 4C54A 4HMCA 2EC8A 3UZQA 3NTCH 3O6KL 3TESA 1KPRB 2EYTA 5GQBA 3VXQA 1W72A 1TTUA 3DVNA 1IBGH 3VFMB 4NDMB 3ULVH 1QFWH 3MV7E 2OP4L 3BPOB 3WNPA 3H9HB 4FQQA 5C07A 1AY1H 1QVOB 2AABL 4KRMB 4HKJA 3C2AH 4M61B 4NKIL 3EOYG 5C2BH 3RGHA 2AQ2A 4NT6B 3BZ4B 3NIDF 3VXMD 3T65A 3TZVB 4RGMB 3HZVA 4NQCE 2VR4A 3MGTA 5DI8B 2R0WH 2XRAH 4HZLB 4PJCA 1MJ8L 3SPVA 5JXAH 4QYOA 3LKPA 5D1QB 3VWJB 3RP1A 1H15A 1BAFL 4JO3H 1TXKA 1C5DA 4JFQB 3ALXA 3DX7A 4HMEA 5L2KE 1YN6A 2JK5A 3QBTB 1BP3B 4AENA 5ALCL 5IFHL 2V5MA 4FHBD 3RPKA 2DQJL 3B2UC 4RBPK 2H8PB 3HAEA 4PJAA 4GBXD 5EOCL 3SKUD 4JFFB 3RVWD 3KR3L 3WXWH 1FYTB 1CFTA 4F33A 3INUH 5B4MD 1V3JA 4PV9A 1A9BA 1GOFA 2DIAA 4NJ9L 1U92B 4Y4FA 5I8OL 2M8XA 3FOMB 3TC9A 1HNGA 5I75C 5E00B 3ULUH 4X7SL 2H3NA 1HN1A 5E8NA 1MCNA 3MNVA 4DKFL 3PWLB 2RGSA 4RFEB 5E70A 3QNYA 4N8VA 4YBLB 4NQUA 2IJ0C 1PD6A 2I9TB 1CE6A 3CZFB 2ADGA 4PJIA 3MLYL 2ICEA 2OSLA 4P9MH 1P84K 4Y89A 5JW5B 3ARUA 1K8IB 1DSFH 1CDYA 1D3CA 5T3XD 1KEML 4JFED 4UDUA 1QRNB 3K81A 2ZSVA 5IFJA 5FKAA 2XZZA 3VCLA 4H88H 2AJZA 3QHZL 4OLWL 2C26A 2IH1B 2H32A 4JGMA 3P4NB 3VH8G 3ES6B 3RVTD 5BS0E 4D3CH 5J1AB 1QHPA 3SY0B 2VYRE 3GI9H 3CVIH 3IJHB 2FD6L 2PXYC 5GSVB 1ZE3C 3VH8B 1ADQH 4K3EL 1FVCB 4XP9L 3EGSA 4QRQB 5DRXB 2YSSB 2F5AL 2DQIL 2X89D 5BMFH 1A2YB 3SDXE 1JYNA 3EZJB 5IBTL 1BZ7A 4NNXB 3QEQB 4BSWA 3K2UL 3LRSB 5IMLA 3RHWF 3OKYA 2BNQB 3GB7A 4J3WA 3VMPA 1OAKL 1YEGH 3HNSL 4J3OC 5E8PA 4OZFH 3IB4A 4ODWA 4XAWL 3VFWB 3GIZL 3VG0H 4H8WH 4FQ2H 1KJ2L 3BP6A 1P7KB 2FEEL 3RNKA 4Z7NE 4NN5C 5FECB 5FGRA 4GBXC 5JUEH 1C1EH 3OWEA 4XHQA 3WDIA 2DRUA 3WUWB 3RVWC 2VL5B 3MRFB 4M62H 5HI3C 3UJJH 5I8CA 4IDJH 2ZG1A 2WBJC 1AQKH 1NEZA 5IVZB 1K3IA 2VZOA 1IAIH 4M1CD 3UP1A 5CD3A 3EDKA 2A1WH 1YEHH 4G9DA 1CTOA 1A14L 4AMKH 2P7TB 4YWGH 3Q5YA 1FDLH 2HWZH 3JSSA 4JFYB 4OZFG 4S11A 5CLTA 1N7MH 1JF5A 2YC1A 1N8ZA 4QHLA 5DQJB 3L5JA 4PJEB 4HH8A 4APQD 1QO3A 3WFEH 4E0RB 5HDBE 4OZFB 1BJ1H 1F11B 4ZFGH 3L3IA 1WBZA 3QUZB 4L8BA 5LXGH 2ZPKH 3T1FA 3QIUB 4ETQA 1NFIB 2HVJB 5FKPA 3WHE1 2NW3A 4NP4L 4UNVA 3MYZA 1LEKB 1Q9WA 3RGVA 1QKZL 3SKMA 3BKML 5T1LD 1S78C 2I60H 3MBEC 3O81A 3I50L 4TSCL 1A9EA 1L7IL 4FN0A 5GS0D 2YD7A 3QULB 1OGTB 2DL2A 2Z8RA 3QO1A 3LDBB 4W4NA 1BFTA 2BVEA 4X7CC 3TH3T 3L1OL 3BEVA 3VW3H 5AZ2L 4RX4A 5INDA 4OCYH 5C0AD 1J9CT 3LCYA 5C2UB 1A7RL 2FIKB 3QDGB 1Q9OA 5C08D 1P84J 4KGJA 4K7FA 5GGTH 2XTJB 3UJIH 5DJXA 4H20L 4XPHH 1OGAD 4XWGL 3PG2A 3C5ZD 3QQ4A 3STZB 2A77H 1J8HB 1KT2B 1H3VA 1JZ6A 1XF3B 4UIMB 1DANU 3GBNL 4M9OA 5CINH 2VQ1B 5D71L 2BVTA 5DJDB 3UPRA 1H5BA 4URTB 1KJ2A 4P2RA 1FGVH 4LVHB 5HVFB 4KJWD 5J6HB 4OAWA 3LS4H 1TZGL 3BSZL 3O6LL 4MX7B 3T4YA 3CJJA 4HGMA 4M1CC 2IGFH 1HHHB 3CLFL 4LAJH 4KTYA 4WV1C 4XXDB 3X13B 1IQWH 1A6UH 4PRNA 4KMTH 3T1WA 1BX2A 4DUVA 2DM4A 3FRUB 1YPZF 4LRNL 5I1IL 1IM9B 1A22B 3TYGH 2KQMA 2Y07L 3FT4A 1T21B 3W11C 3IDJA 4KUCD 5IVNA 2DLFL 1FLRH 4I77L 5E94A 3V6OE 1JUFA 5GGSB 2A73A 4JPVL 1IKNC 5CJQH 2VSDA 1AP2A 3MLTA 4ZUSA 3FRPG 4NO5B 5DD5L 2V9TA 1U2CA 3K2MC 4PRID 5BOPA 4NNPL 5GS0C 4MA7H 5AYUL 3VFPB 1VEMA 4Z0BL 2DYPA 1WLHA 1NC4D 4P46D 3SGJC 5KS9B 1UWEL 4I13B 3ARDD 2IPKA 5FF6A 4LFHD 3U1SL 2AJSH 4Y4KA 1T1YA 2C1PA 1K4CB 3O6ML 3PQYB 2NX5E 3CDGB 4OM0H 1WTGT 4FQIH 1NGPH 4I18B 5GRZA 1AGDB 1JWMB 4AIXA 3OXRB 1RAMA 1X5ZA 4QOKB 2G2RB 5DZOA 3CPLA 4DEPB 2MOVA 5DA4A 5IROA 1DN0B 3WV0A 3J8F7 4PJCF 4NRZB 2H26A 5EBWA 5EU5A 4JQVC 4UT6H 1T4KA 4JZJC 5T3XL 4BA8A 3C6LD 5F7YC 4WI5A 3VFVA 5L9DL 4PJ9B 3RBSA 2XZAH 2C3HA 1JFQH 4R4ND 2VLKD 4JY6B 3S8WA 3KYNB 4PJAF 1CD1A 2C1OB 5F9WC 2CMRL 4TUJA 4HXAH 1NKRA 4WO4B 3DURA 5D70H 4P3WA 2HN7A 5DO2D 4P3CH 3VXRD 3FL7A 4MNGB 2H45A 3D3VD 3VFOB 1W0VB 3QXTA 1KELL 4DW2H 1I1YB 3HI1B 4KJQC 4N0FB 1F4YH 2X9XA 4JEGB 2R4RL 3T2NL 4HPOL 4K71B 1VFAB 2YA1A 2GJ6B 2AK4A 3GMMB 2QHLA 5E2VH 3D39E 1A7PL 4JM2D 4X80H 3BIKB 4FFVD 4XNMA 3UTSB 1RK1A 4CBPA 4PJIF 5BS0D 5IJKC 2A9ML 2GUOA 2HTLC 5LGKA 2VLRD 1LE5A 2ICWB 1KG0B 4ZFFB 5F3HB 1EAPB 3CFCH 3X3FH 4O51A 4HUVB 3B8SA 3LQZA 2Z31C 1N3NB 5FA4B 1J05B 1M71A 4P46C 5K9KA 3WHXA 3ARDC 1IFHL 3TPUA 5JO5A 1UB6A 5EC2B 2W60B 5C8JA 1BJMA 1CQYA 5HHMB 1FZKA 1R5VB 3T0VA 4WHTB 3LQAH 4X7FC 5IMKB 1QSFD 2NPLX 3FZUC 4OD1H 3ZMRA 3RVVC 1BD2A 1NMBH 4I2XE 2OK0L 3CK0L 1TNNA 1E4XH 1ZGLA 3CZJA 1DQQB 4XXCA 1TJIL 2BK8A 3D6GA 2FO1A 4CVXA 4HK3N 4C57C 1BZQK 4AL8H 1NC2B 2YD2A 4O2CA 3FN0L 2J3SA 4I3RH 2JB6B 3C6LC 4U1SB 3W39A 1Q72H 4Y5YC 5J12C 3TEUA 4POUB 2WINB 5TE4L 5MEPB 3P11H 4J1UA 5ADOL 2Z8SA 3TO4B 3TBVA 3D2UA 4JDTH 3TYFA 3SKJL 2ED8A 3GBLA 2VDKH 5I1KL 4YNYB 2YHGA 3DSFH 3T09A 3TVMD 4JN2B 1MHPL 2EEDA 4IRSB 4QXTA 1FO0L 3HE6A 3EO0A 2XN9B 2QL1A 3ARRA 2C4FT 4IOIB 4JRYB 5HJ3A 3O4OC 4PRAA 1CBVL 3JTTB 4OTXH 4K55A 5DK2B 4FFVC 3ROOA 5DR5H 1F4XH 2ITDA 1OD7A 4DAGH 3CFJA 4ZAKA 3S98A 2YA0A 4GW4A 4KK9C 1X5IA 1UA6H 2WNGA 2IANE 5E5UB 5GRVK 3JV6A 2ARJQ 5F44A 3VFGH 2GK0A 2QSCL 4PR5B 3B6SB 1MOEA 3O11B 4ZDHB 3T0AA 5BV7C 5JTWA 4GJTB 2MCPH 1MI5A 1FL6B 2BOBB 2FLBT 4P5TC 2FB4L 2ZKHH 3FO2B 3GSVB 4X6CB 3BO8B 5D8JH 2VKXA 2AV7A 3WYRA 1DEEA 1HDMB 4PLJD 5LCVL 1I1AB 1P53A 3T0XA 2NY2C 3TA3A 2DM2A 1UWGH 1GGCH 5ETUB 4TQEL 3QG6B 1A6AB 1K5NA 4ZUWB 4QHMA 4MVBC 4PJ8B 1U95B 1X4YA 2NTSP 5E6YA 3TBTA 3MJ9H 4YX2L 3QXWA 1T22B 1T3FB 4XVSH 1N26A 3FONB 3C08L 4J6RL 4S10A 3IDNB 2AXGB 1N64L 1JHKH 2Y1VA 2L7UA 3TN0D 1ZLSL 3O9WD 4RGNB 2BMKA 5GGQL 43C9A 3SDDA 1OAYL 3WXVL 4WUUE 1VA9A 4HMDA 3PP4H 2FGZA 4TSAH 4FQPA 4KWUA 1ZSDB 3GMRA 5FDYA 4XB8A 3U36A 3RZWA 4G6FD 2AJYL 3KLAA 2VLLA 4H0IA 4MLSA 1GZPA 2XIDA 4AJ0A 4DZBB 1FO0A 1RZGB 2VDNL 4O2EB 3TBWA 4NWUL 3QNZA 1QYGL 5SX4I 4N1EA 5E95B 1D5XA 1A7NL 3MLXH 5C0AA 1T2XA 4MNQD 3MRIB 2AJVH 1T0NB 3WFZA 3DWTA 1E27A 5TE6L 4CNIA 4U6HB 2C7UA 3FAWA 2BVYA 4OZGA 4GQ9H 3CLEL 4ORGA 3PV6A 4QRUA 4ZFOL 2W0PA 3C5ZA 1IQDB 3RAJL 5MEOB 2NTFB 3A67L 2SEBA 4RFNC 5ESQB 1VEOA 3CFBB 1MUJB 1NH6A 4MZ3A 1QEWA 4LKXA 2CUHA 4KJPD 1DDHB 1U6AH 2ADIB 3U6RB 3PWNA 3MV8D 4LLAA 4X98B 3LKQB 4OZIA 1OL0A 1YPZB 4GRLC 4JVWA 3B5TA 4KU1A 2J8UA 2YKLH 1A1NA 3DIFA 2ZUYA 4MB3A 3Q0HA 4RMSA 1AGBB 5EOQH 2J6EH 5D6CA 3H7BB 1R3JA 4FQXB 4C83B 5DLMH 3UCRA 5E1HB 2MNUA 4DN3H 1NMAL 3DVNB 5KVGH 4YBQD 4R2GD 5I17A 4U49A 5JDSA 3RU8H 4UOW0 3NCJH 4PJBF 3TN0C 1GIGH 1MJJA 4QRPB 4OD2A 3MV7A 4FQQB 4XHJC 1T1WA 3HAEH 1CG9A 43CAA 1IEBB 1HXYA 1JGDA 4LVNB 1H3WM 1NCWL 1B4JL 3WS3A 4AY0A 2NY5L 5IG7B 4NKDA 1NC4A 2YBRA 4M7ZB 1S9WB 4I5BA 2XKSA 5JIPA 1KEGH 4KQ3H 2N1KA 4NQCA 2PW1B 2R0KL 3B9EA 3HUJE 4PJCB 4L3AA 3SPVB 5IWLA 1RIVL 3SE3A 3LKPB 1MRFL 4L9LC 1T89C 3IF1A 1H15B 1U8QA 3HTLX 3VWKA 4R3SA 4JO1L 3P77B 3DX7B 1NGZA 4N8CL 3U9UA 2JK5B 1P2CA 1QFUH 5L2KA 3HAEG 1QZ1A 5GIRA 3ARZA 1U93B 2GITB 2V2WB 3MREA 3HAEB 3E8UL 4PJAB 4BSJA 4XPBL 1ZGLM 2FR4A 2EDNA 5KSVA 1IL1A 4ZFOA 4NWTH 4FQCL 1JVKA 2LAGB 2RIKA 2V7NB 3K8KA 5ANMB 4PGCB 4AK1A 1A6VH 1MCWW 4DOHB 5DXWA 1BM3L 3DUUA 4QRRE 3V79C 4F33B 5GJSL 4WW2C 5F1NB 5KOMC 4PV9B 4QXGL 3THML 1GHFH 1B2WH 4PYGA 3S96B 5K59F 1ZLVH 2H3NB 2FHBA 3EO9H 5E8NB 3MNVB 4ZS7H 4GS7B 1FG2B 3V8OA 4PGDA 2LAAA 5HD8C 4Z9KB 2R1WB 4DK3A 2VIRA 5I8KH 1TETL 1VESA 1I7ZA 1CE6B 4PJIB 2ICEB 2OSLB 4HUMB 4LLWB 1GGTA 1WT5A 1TNMA 3PIQA 2NR6D 4UDUB 1E4WL 3F58H 3ILQC 2ZSVB 5IFJB 3BP7A 4YBQC 4NM4H 3VCLB 4U3CA 4JM2A 5DHYA 5LBSH 2EICA 3L7EA 35C8L 3JWDC 1BVKA 1EFQA 1BAFH 2IBZX 3K46A 3KJ6H 5BS0A 4WFEE 3KPNA 3NPZB 2VLRA 4PV8A 4D2NA 5BRZD 3EGSB 2X4NB 5EOCH 1CICB 1YNTB 3ZKXB 4IOFD 1TJHH 2IFFH 3QDHA 4G80A 2AJUL 2O26U 5DUPL 3KR3H 4JFXA 3N1GC 3IFPB 4XC3H 3HG1D 3DRQB 1KCLA 2CLZA 2K3TA 3SDXA 1BZ7B 2HLAA 3FFCB 4KKLD 4CDGC 4WRLA 4BSWB 2AQ3A 1YQ2A 5I8OH 1UJ3A 2B39A 5IMLB 5ISZE 1DBBH 1NGQL 4DKFH 2IAND 3WO4C 1TQCB 5J89A 3N9GL 1FBIL 3BP6B 3BN9C 3RNKB 1EEQA 3NGBB 2YOCA 3NPSB 2Q7NA 3KJ4C 4IRZL 1KTDA 1T80A 3MLYH 1NEZG 1KEMH 2VLMD 4X7DC 4XPTH 1IC7L 1AD0A 1WZ1L 5I8CB 5I1AA 3S35X 1FNEB 1NEZB 3LEXA 4M8VA 3WS6C 5D7SL 4NO0A 1X5HA 2ILLA 4OLWH 3QNXB 4G9DB 2FECI 2ID5A 4EN3B 2Y6SC 1IZJA 2XWBA 1UYWL 4QHLB 1I9JH 4HQQL 2BY2A 2G5BB 4LEOA 1QO3B 4XP9H 1LO2L 3HFML 2YXFA 3DXAE 4MXWH 2HG5A 4LCWE 5I0DA 3IKCB 4Y1AD 2DMBA 2EEBA 3TVMA 3L3IB 4M5YL 1WBZB 2X4TB 2DQIH 3WFDH 3U0PA 4MD4B 3T1FB 5GRWA 3UTQA 4ETQB 5FKPB 2NR6C 2NW3B 1MWAL 3LMJH 3BE1L 5IBTH 1Q9WB 4NN6B 5IHUH 1MCCA 4L3EB 4WUUD 4XCYA 4ELME 2HJFA 3RA7L 1N59B 2FZ3B 1OAKH 3HNSH 2QKIB 1FFOA 5F93C 1URLA 1MCOL 4XAWH 3NABL 5D7KE 1YEDB 2NW2A 3DO3A 3ZKQD 4MLIA 1DANT 4ZO6A 2PCPA 4RQQB 3BEVB 5DFVD 1X5JA 5INDB 4OJFL 2EXWD 1T2QL 3ZSSA 1OW0C 1Q9OB 4LPCA 5EIQA 4KKLC 3F12A 4ZS6D 5IB5A 2FJGB 2CRYA 1A14H 4G6JL 3PHQB 5DJXB 5F7MC 4YK4C 3QQ4B 4G9FD 5GGVY 1IRAY 1CU4L 1M4KA 1WV7T 4CU7A 4YDJA 2AJXH 5EC1A 3QFJB 3UPRB 1H5BB 3AXLA 1YEIL 5D5ME 1B4RA 2BXYA 8FABA 4OZGF 3SHSA 2IEPA 2LQRA 4KTDL 4P5KA 4PTUA 4NP4H 5I16A 4LPWA 4DK6A 2OTWA 4E41D 3VMNA 4Y5VA 2ARJA 1S7QA 4IRJC 3MUZ1 1MFDH 4YC2C 2J5LB 2VE6B 3O9WA 3I50H 4TSCH 1L7IH 3I6LE 1CFBA 5CCKL 5B8CA 3MCLL 1OLLA 1BX2B 5ACMA 2DI8A 4OZIF 5I1EH 3OR6A 1NJ9B 2DWDA 2J8UF 3Q6GL 2EKSB 1JPGB 3L1OH 4XCEA 5C7XL 3SE4A 4ALAH 5I1GL 1U8OA 5E94B 2QADB 5FO7A 1CGTA 3OAZH 2B4CL 3V6OA 2A73B 4Y4HD 4HIEB 3FQRB 1AP2B 1I3UA 3MLTB 1OF2A 9CGTA 1MWAA 2PW2B 3MRJA 4WFFD 2H2SD 2V17L 1CGUA 1FP5A 1MAJA 2GFBA 4H20H 3AS0A 1JPSH 3L7FA 4NM8H 1JV5A 3DOSA 4XWGH 4F2MB 4YUEL 2DYPB 5E1AA 1FGNL 5IIEB 2ZJSL 3V7MA 4FOMA 3GBNH 2IPKB 2NMSA 1MY5A 4LSRH 5E9DD 5EIIA 4Q9CA 3PGFL 1AFVL 3BX7C 4JFHD 3ZYZA 1ZVHA 1U8PA 3PGCA 2NX5A 5DFVC 4NPYA 2FBJL 1TZGH 3WJJC 1S3KH 4JANA 3R1GL 4S1RL 4WHCA 4F80A 3ZKND 1TQBC 5F96H 3MV8A 3PGDB 3VGDA 3BRGC 2H26B 5EBWB 2GSGA 5EU5B 1P4BH 4U6TA 3K1DA 1T4KB 4PGEA 4PJBB 4ZXBC 4LRNH 1TJGL 2IAMC 3OKEB 3CU1A 4LLQB 4PYHA 4CADB 2Y07H 4U0RB 2DLFH 4I77H 1LK2A 4YJZL 3IAGC 3O41B 1CD1B 1NEUA 4JPVH 5ALBL 1A21A 4TUJB 5DD5H 3DURB 2OMBA 1BLNA 4V1DB 4RRPA 5AWNH 5BVPL 3G5ZA 5A43C 3V4PL 5DVKA 2ERJB 5AYUH 5B3NA 4HC1L 1BBDL 3HB3D 3QAZB 4KY1L 4NZRL 1UWEH 4YR6B 4NSKB 2MFNA 4K3JL 1UXWA 4KKCC 3U1SH 2FJHB 2AK4B 3LPGA 2O5XL 2E6PA 3D39A 1Y0LA 1T66C 1R5IA 5EU7C 4XNMB 1JNHB 1RK1B 4F57H 2PTVA 1S7SA 2DAVA 2XZCL 2GUOB 4YEEA 4WFED 1LE5B 1D9KB 3KWWA 1IGIL 3EJJX 3ROLB 2DQTH 3H2WA 1DBML 2P48B 5CP3H 3U7WL 4L8SA 3WHXB 5CZXC 3V7AG 3FN9A 3TPUB 5JO5B 3QEUA 4OKDA 1UB6B 4YPGA 3BAEL 5C8JB 3AREC 1N6QL 5IVXE 1MFEH 2WLZA 3S35H 2FEDD 5DQDL 1JZ5A 1BD2B 1LO3H 1GGYA 3MRLA 3BZEA 2XKNB 1YEFH 4I2XA 4B41A 4HKBB 2BY0A 3E1F1 1SVCP 1R3IL 3SDXF 4CVXB 2I5YL 2VXSL 4WI9A 1HYRC 5J7CC 3WLWD 4XGZA 4ZO9A 3RY5A 4Y2DD 4KRPC 1CD0A 4O2CB 2LABA 4Q9QL 3T2NH 3FKUS 2VZ1A 4HS3B 1CR9L 4EIZC 1A7PH 4X6DE 2ZWLT 2VOTA 4J1UB 3PHOB 4Z7NF 3TBVB 3QWOA 3D2UB 4WFGE 4C4KO 1FFQA 3TYFB 1ES0B 1V3KA 4HH9A 4O02H 1KCVH 1UG9A 3GM8A 4LHUA 2X9YA 3H42H 5J3HC 5TQ2L 2Z4QA 5HGBB 1ZWIA 4FZ8H 4YE4L 4M03A 3BUTA 4MDIA 2H2PD 3EYQD 3U46B 4MCZB 4ZO7A 4QXTB 2DI7A 3K3QA 3HE6B 3EO0B 1D6EA 1RUQL 1IFHH 3FCTA 1YN7B 3BPCA 2B5IB 1LD9A 1P1ZB 3BKCL 3CMOL 3T0EB 5EB9A 3A6BL 5HDBF 3D5OF 1WF5A 1DQDL 4MMZC 2ICWJ 3CFJB 4K8RD 5KVMC 4P57A 3CSPA 4ZAKB 4EQ3A 1Q0XL 2OK0H 4AQOA 2NY0B 4XNXL 3ZDXE 1KSRA 4GW4B 4B53A 4M7LT 4K94L 1YY8A 4J4PD 2IANA 2NY7L 2GK0B 5EFIB 1GAFH 2X4QA 3DBXA 4N9OB 3GFUA 4BQ6A 2G5RA 2GCYB 3FN0H 4F7MA 1F42A 4MA1C 5JW4Q 1MI5B 3VXOA 2XV6B 4RSVA 2BSTB 1S9YB 3QO0B 3V0WH 4WNQA 2AV7B 1DEEB 4BH7A 1MPAL 3SKJH 2FGWL 4G5ZH 2Q3ZA 3GBMH 1KCRH 3EDFA 1S7TB 1WZKA 3BVNA 3TA3B 3HZKA 5I1KH 1K5NB 5JMRA 1QBMH 1UACH 2A83A 3WLWC 1FO0H 1JWSA 5DJYB 1NUDA 4Y2DC 4JR9L 5TDNA 3O8XC 4ISVA 2DQUL 1VPOH 4KV5E 3ZSTA 5HYSG 1FAKT 1R3HA 3CVHL 5C86A 4CDHA 1TMCB 3RDTA 4FFYH 5JR1L 3F5WA 4JO2H 4UDTA 2X4RB 4ZNEE 3C87A 3W5MA 5I15L 3SDDB 5EO1A 5E99L 4M43L 2R8SL 4WUUA 2MMXA 3I6LD 5EUOE 3I3DA 3DGGA 4X8JA 3EZ8A 5GJTH 2H2PC 1EFXD 2ZCHH 4I0KA 4F58H 3P9MA 3TH2T 3KLAB 5FUCC 3FO1A 2VLLB 2AAVA 5I18H 3B4NA 3GMOA 1GZPB 5FYLE 1U8LA 3HCVA 3MFGB 1FO0B 4FRWA 5JA9A 1ZK9A 3AFLA 3I02A 3Q6FA 3GNML 4K23H 2FB4H 5F7FA 3MRNA 1D5XB 2LE9A 2EDDA 4WUKL 5JZ7C 1WZLA 1ROWA 5LCVH 1E27B 4CNIB 5GHWL 5BXFA 3WN5C 4OZGB 3PV6B 4I3SL 4QRUB 32C2A 4TQEH 1UEYA 3UTOA 4G9FA 5L6YL 2SEBB 5DJZA 4YDLC 3BESR 2ZOLA 2E7MA 4YX2H 1EEYB 1RZJC 4LKXB 2C9AA 4WHYH 5C0JA 1N64H 1MCEA 4JRXE 3WO3B 2WUCL 4HS6B 1AKJA 1ZLSH 3BD4A 4GKSA 5EIVA 4LSTL 4PB0H 5EBLA 4HKZA 1HILA 4OZIB 3WXVH 1OAYH 1DBAH 4DVRL 2J8UB 4MB5A 3DIFB 5CWSB 4GUPA 3S7GA 5EU6E 4BFGA 4YHZL 5TPWL 3RWCB 1NLDL 2A6DA 1J1PL 2E7LA 5GZNC 3TIEA 2R39A 3LEYL 4TVPE 5HYJB 5FB8A 1MVUA 4WHYG 1RVFH 2AI0L 1QYGH 1D5IL 5JDSB 3OXSA 3DGCR 5HGDA 3E6FB 1A7NH 4ZTPL 1J18A 1MJJB 5T3ZD 3MV7B 3CVHA 1EMTH 1HOCB 1BQSA 1RD6A 4WW1B 1KLGA 4Y4HA 1L0QA 1WISA 3C09B 1NSNL 4GW1A 2GT9B 4KMQA 4JFDE 43CAB 1BEYH 4HJGA 1HXYB 1M7XA 3RAJH 3A67H 4N90E 4ENED 2VLJB 2KL6A 1O7SA 1QG3A 3LZFL 1KYOK 4DKEL 1MREL 5DRWB 1DVFA 4NQCB 1VACA 3DTXA 3FO9B 3HUJA 4HIJB 3ARFA 3VD4A 4G6KL 1OT1A 3VWKB 1A1MA 3U9UB 3NN8A 1P2CB 5L2KB 4IHOB 4F3FA 4KROC 5GIRB 1NBVL 4U6VL 2V7HB 4KDWA 1QA9A 4M6NL 2XQBL 4QO1A 5KSVB 3CSBA 4P2QE 1IL1B 1IT9H 3CX2A 5TE7H 5JW3L 1C5CL 5GS2D 4L3CA 1NMAH 1ZLVK 4QRRA 3N1QC 2ZUQB 4XVUC 5IEKA 4YFLI 2Z93A 5D96C 3BH8B 3FT2A 5FA3B 4PJDA 2FSEA 1Y6NR 2R29L 4M8QB 3SE8L 4PGDB 4F9PC 5I1HH 4G6ML 3QCUL 1QFWI 3O3DA 4OZHE 1I7ZB 4OCLC 4WEUD 2D0HA 4JN1L 3SDCD 1FCGA 3MMEB 4BK5A 3PIQB 2JIXA 5FGCE 3X12A 4JO4L 4OI8A 3BP7B 1HYSD 1RIVH 3QXAA 2VXTH 5DHYB 4K8RL 2FO4A 3L7EB 1BVKB 5EU4B 4JO1H 4J8RA 3KPNB 2DQCL 1HSAA 3MODL 4PV8B 1MFNA 4Y16A 2NY1B 2DLTA 4XPBH 3R4DA 5KSUA 4CRPA 1XZ0B 2NY4C 1CE1L 2OR9H 4FQCH 4JFXB 5DS8A 4KI1A 4K9EH 1BM3H 3VD7A 5GJSH 3GI8H 4QXGH 3THMH 2NXYD 5JOPD 3MRKA 1SYSA 3PL6D 1UJ3B 1VFOA 3E0GA 4KI5F 2JB5L 5GS1A 3NFNB 4UILL 5IHLB 4AEIL 4NQDD 1Z6JT 5ISZA 4YHKL 3MOQA 2JJUA 3FHAA 3WFBH 1VSCA 1TZIB 3CDCA 2WIIA 2VDPH 1TETH 1OARL 1KTDB 1T0MA 3CCHA 5ERWA 4CN1A 1C12B 3V6BR 4IDLA 3VGGA 1I3RB 4HUXA 1XF1A 4HHAA 4M7KL 1AD0B 1E4WH 3MJGX 3T3PE 3LEXB 1HE7A 4NO0B 2GSIB 4OT1H 4FXGA 5DFTA 1GPOL 1KYOJ 2MPAH 1VERA 5LAXA 3HLAB 2XWBB 5LGJA 4LCUB 1A6ZA 5KVDL 4LEOB 3AU1A 4KK5C 3T2PA 2OQJA 2HG5B 3DXAA 1PZ5A 3IRPX 4LCWA 4NCDA 3VRLE 1CFNA 1MSPA 5FXCH 3U0PB 4M5ZL 4S1QL 2AJUH 2NNAB 3BP5B 5DUPH 2XXCB 3W0WD 4UQ2A 1G6VK 2HP4A 6FABH 1HYSC 3AM8A 4NKMB 4AEHL 2HJFB 5MP6L 4ELMA 2IH3A 2R56L 1JJUA 5HHOE 3T04D 5ID0A 2ZUXA 3QDJE 4K2UL 1FFOB 2OTUA 3N9GH 4ZOCA 4XP6L 1V7ML 1OQOA 3F7RA 3K74B 4ZOAA 2NW2B 4JY4A 2WW8A 4MXQD 4IRZH 2P8PB 4HDIB 4M9PA 3TIDA 3AC0A 2HMID 3R06B 4OLXL 1R3KB 4G42A 4JZNB 1MCSA 2XA3A 5DD0H 3KPSE 1IC7H 4HJJL 3EJZD 1N5YL 4LHJB 4R96A 3F12B 3QH3A 3ARSA 2IMNA 3BXNA 5IB5B 3G5YB 2ZG3A 3GSXA 4KJYA 3BUYB 2WBJA 4X6FA 4P49A 3ARQA 1UYWH 1IAII 4YGAB 2P43B 4EBQL 5J57B 1RSFA 4UZGA 2DI9A 4YFDB 1B0RB 4JREB 8FABB 5D5MA 4M5YH 4KKNA 5K9QG 1B0GB 5ESVA 3FB6A 1CGSL 1X5KA 2DD8L 3QIWC 1MWAH 4PTUB 1AHWB 3BE1H 4NN7B 1VGEL 4MB4A 5I16B 4JVPA 5HDLA 2VDRL 2OTWB 4TTGA 1CS6A 4Y5VB 2ARJB 1S7QB 3QWQB 5F7WC 5F9OL 3WJLC 5ITFB 3ULVE 2EIEA 2N56A 2FCBA 2NY3B 1ZLWH 1CN4A 1MCOH 3DX9A 1G7JA 2R0LL 3NABH 5B8CB 2KBGA 4OLEA 3MBEA 1D5MA 4JFFE 1D6VH 2ATPA 2VRAA 3DVGB 4BZ1L 4AEFA 4LNRA 2R2EA 2DWDB 4HUWA 4Z77A 4XCEB 4OJFH 3BH9A 1T2QH 5F6IB 2FHFA 2PNDA 1KGCE 3EYVA 4IS6B 2Q6WA 4U3HA 2CXGA 1FL3B 1OF2B 1MWAB 4EKXA 4Z7VE 1PVHA 1UM4H 1FNGA 5D72L 4G6JH 4P4KD 1BZ9A 1JV5B 2BOCA 2RFXA 1J12A 2XACC 2FHCA 3GIVA 1LK3H 3VXSE 1CU4H 4NUGH 3FFDA 5EIIB 1T6VN 3HC0B 1SM3L 3IT8D 2HMIC 1MCPL 1NDGB 3TWCL 3LN5B 3PGCB 2NX5B 1M7IA 4NPYB 4OLUL 1CCZA 4KTDH 1JMXA 4U1HB 1X5AA 2CD0A 5E24E 2BERA 4HEPG 3GMPA 1CXFA 4O00A 3QDME 5IB1A 1CF8H 3I3EA 5TGBA 2F5BL 1OT2A 5F7EL 1JZ7A 5GZOD 4H26B 3ARBD 4YHML 3HUJF 1A4KA 2GSGB 3LHPH 1G7MA 3WE6B 5CCKH 5JIHA 3MCLH 3D0LA 4YO0A 4PRBA 4LF3A 4PGEB 5C1MB 3Q6GH 5I73C 4UU9A 3FB7A 5CHNA 5C7XH 5E8OA 5HYFA 1E0OB 1FH5L 3VXTB 5JPMB 4ODSH 4UT9L 1F6FB 3PDOA 3KYMA 3TH4T 5KTEH 4EI6B 5DMIH 4ZOEA 3DMMA 3L3KA 4MD5B 4W70A 4PJGE 3ZDYE 1IKNA 1CLOH 1RIUL 1F4WL 2BSRB 4YUEH 1VCAA 1KULA 1LO4H 1MRDL 2ZJSH 3RVUC 2IPTL 1INQA 5DURD 4DJMA 4K07A 4NRYA 4BUHA 5H2BA 1CDCA 1AFVH 3KHQA 5CJXC 4PFEA 3SGJA 5HVHC 1I9RH 2FBJH 3D39B 1P4IL 3R1GH 2MTPA 4S1RH 4KZDL 3EOBB 5HBBA 3L3DA 4UIKL 1S7SB 1JF1A 2Y06L 4GMTH 3W2DH 3L3HA 4QRSA 4PJEE 3SCMC 4P4KC 1RURL 3OG6B 4UV4L 4NZUL 1NGWA 3VFUA 3E3QC 3ARYA 4XPFL 2OR7A 3RWHA 1ZS8B 5GXBB 5B3JE 3QEUB 1IC5L 4TPRL 3CFDA 4W68A 2HKHL 3SQBA 5IVXA 4JQVA 1INDL 4HSQA 1U3HA 4JJ5A 4JZJA 1T5XA 4NHUA 4P2OC 2A9NL 4ZQKA 1FSKB 3LKOA 3QXDB 3BZEB 5F7NC 3ORJA 4I2XB 2QHRL 1F2XK 5BCAA 2VUOA 4J2XA 4OF6A 1RUKH 3V4PH 5CS7A 2ICWI 5CBAA 1BBDH 1H0DA 4XGZB 4NZRH 1RZKC 4C56D 1FC2D 4K3JH 1ZA3A 5DUML 4UNUA 3MACH 4OGYH 3O6FB 3SDCA 2I9LA 1NGYA 4PRPD 2O5XH 3QDGE 4LHUG 4QGTA 2NQCA 2I25N 3V4UL 4X6DA 3KPQB 3TNMA 4HH9B 3M1BB 1WQVT 3Q5TA 4LHUB 5F1IA 2O5YL 1J8HE 4MDIB 1DUYA 1DBMH 5J4MA 3U7WH 1D6EB 5DUBA 3OMZA 5DEGA 4HGWA 4LVOC 1N6QH 1FV1A 2VN7A 4E42B 4LSSL 1BFVH 3MX0A 4NQVA 2WLYA 4OF5A 5SWZD 5DQDH 1KIQA 2NCMA 3WL9A 1I7TB 2IADA 5T1KD 4LSVL 4P57B 4YLQT 5HHOD 5JHLL 3ZTJH 5BO1H 1R3IH 1YY8B 4HWZA 2I5YH 3O2DL 2VXSH 2QJDA 3L5HA 3FB8A 3KPOA 3V52H 4UTBH 4ELMF 1T1XA 2X4QB 5HI4C 3DBXB 1E4XI 3T8XB 1H8NA 2ZUUA 3VXOB 1U91B 3D69A 5DFWH 1EHAA 1V5JA 3HE7C 4Z8FL 4G8GE 1FE8L 4IJ3C 1KJ3H 5GISH 4Q97A 1QR1A 1NBZA 5D7LE 2DDQL 3ZTJG 4PTTA 3BVNB 3BGFC 3HZKB 4ZYKA 4Z5RA 4YE4H 5KS9E 4HULB 1XF2A 5J6GA 4ODTL 3TZVD 3AY4C 2ARWA 1OOAA 4QWWD 1JWSB 3LV3A 1YEKL 3NACH 5CILL 3PQYE 4HUUA 1VADB 5E6ZA 4PRHE 2M1KA 5D1QD 1FORL 3CMOH 5CBEA 3VWJD 1NFDB 1EA9C 1SQ2N 4L9DA 3RDTB 5F3BB 3F5WB 3UTTE 3A6BH 4UDTB 5BJTA 4MXVE 3ULVD 1AGFB 5D5MF 5EO1B 1Q0XH 4XNXH 5EUOA 3LEVL 1FRGL 3MOAH 3DGGB 4OCSH 2NY7H 5DZLA 4JFFD 5MHSE 1MNUH 3P9MB 4JM4L 3MRCA 3FO1B 4I0PB 4U1GB 3ISWA 1FYTD 1JHLL 1U8LB 2YXMA 1HI6A 1L0YA 3I02B 3Q6FB 5D6DC 3VXUE 1FL5A 2YUVA 2UZXB 4LAQH 1CFSB 1PDKA 5ICXA 3D25B 3O45B 4FXKA 4OZ4B 5DF0A 5DSCA 2Y25A 1HH9B 5AUMA 1XR8B 4PP1C 2VR9A 3SGKC 2P5EB 1MCJA 2X5PA 1U3YA 2FL5B 4R0LA 3MRPA 1QRND 4JR9H 3O2DA 2Y72A 2DQUH 4NQSA 4ZMAT 5I19L 5C0JB 2X05A 1QPXA 5JR1H 3GMQA 4JRXA 1AKJB 1RMFH 4X5XB 7CGTA 4GKSB 2Y7QA 3FQUA 5EH1A 4HKZB 3SQOH 1HILB 5E5MB 3ULUD 1UXSA 5E99H 2R9HD 4M43H 4HXBH 2R8SH 2EZ0C 1BBJB 5EZLA 4EI5B 4MNHA 2P42B 5EU6A 1YYML 3RL2A 4L4VE 2X1WL 1LO5B 2OYPA 3L3JA 3WNLA 3TGXA 2X4OB 2E27H 5FUOH 4HBCL 2YN5A 3HR5A 5FUZH 3WD5L 3LKSA 3QEQD 5KG9B 3X3GL 4LHQB 1MLBA 3GNMH 2P46B 3OXSB 5HGDB 2BNQD 4WUKH 3IVKA 3RZCC 3MSPA 4OLYL 1LGVA 2VITB 3MJ6A 2MKWA 1MQ8A 3CFEA 4GW1B 1J7VR 3C60C 2UZIH 3DO7A 4HJGB 4JFDA 3ALWA 1WWAX 2X44D 5C0RL 4A6YL 5L6YH 5C0EB 5GRVL 5FM5M 5BQ7A 5DMKB 3MUGA 5CEYA 1ZHKB 2AEPL 5TDOA 1DVFB 1VACB 2CK2A 5ECJE 3GJEA 4GKOA 2WQRA 4PY7A 3HUJB 3ARFB 4LLMA 5C0GB 2VXQL 4HD9A 4U1LA 4MHHG 2B1HL 1A1MB 3TT1H 2NY6C 3NN8B 2CO6B 1ED3A 4ELKA 1H9VA 3DNKA 4DVRH 2M26A 1CXLA 4F3FB 4AM0B 3UROR 4YXHH 1QA9B 1CFQA 3ARBA 4N0UE 4U7SA 5TPWH 4GRLA 2XN9E 1MCQA 4MCYB 1KCSL 3QIUD 4GW5A 4BFEA 3ARPA 3LEYH 4JRYE 1GGIH 4P2QA 1F6AB 4GH7B 3KPPB 3LB6D 2XNAB 2K1MA 4BQ9A 4L3CB 4QRRB 4LCCC 5HHPA 1D5IH 4RA3A 3B3IA 3SDAC 2Z93B 4YHNA 3FT2B 1I8MA 1CDGA 2QQQA 5IVXF 3KLHC 4EDXB 4EVNA 5IMOA 5EO9A 4X9IA 1LDPH 3BHBA 2RB8A 4GAYA 1WWWX 4U6XA 5SX5H 4IM8A 1DCLA 3O3DB 5SX4H 1CT8B 4DVBA 2FRGP 4CMMA 4DFHA 2D7MA 3P4MB 2EE3A 3LZFH 1ZVSB 3WBDA 4DKEH 2JIXB 4QHUB 2GTWA 3QDGD 4M93C 2IALB 1JP5A 1HNFA 3RKDD 4X6CE 2ZUTA 4WDIB 4KHTL 2XTJD 1JK8A 4G8IA 1SMOA 3NIGE 3GHBH 1J8HD 1HSAB 4JKLA 3S34L 2LU3A 3O0RH 1NBVH 1T89A 2DF3A 4P59L 1IMHC 4ZODA 2Y5TB 4Y16B 3OKNA 1G9MC 4M6NH 2XKUA 2XQBH 3KYKL 3TM6A 4FMFA 1ZT1A 4LLYA 4A6YA 5HDQL 3HRZA 4YHYB 2G60H 5M94B 3SBWA 5F7DB 4MAUL 1SYSB 2YPLD 1LILA 1MCHA 5LQBH 1PG7L 1LDSA 5ISZB 4GAJL 3I9GL 1J5OL 5FCSH 3SE8H 3ZE0E 3S88L 1IM9D 4H8WC 3MJ7A 2WIIB 2LTQC 3BQUA 2CQVA 4KTEL 3CX5K 4KXZH 4UUJA 5ERWB 4JN1H 4BK4A 4F8TA 3ZDXF 4HHAB 5DVNA 3LB6C 4JO4H 2ESVE 5IV2A 3WEXA 1MHCB 3ULVL 3WUZA 3N0PB 1QFWL 4JDVB 5LAXB 5FOJA 2K9UA 1S8DB 4M6OL 3LD8C 2Y4SA 3DX6A 5C2BL 1Y18B 5C9KA 5LJYH 3PQYD 1Z3GL 4RAUA 3DXAB 5IMMA 1I8LC 1PZ5B 4LCWB 3MYJA 4GFTB 4KDTC 3V6FA 1VKXB 1X6NA 1CFNB 1CE1H 2PXYB 1NBYB 2AGJL 2VXVH 2XRAL 4LBEA 4XCNB 4QOKD 5JXAL 3T0BA 1S7UA 5D2LE 2IG2H 1ND0A 4JO3L 4X0KA 4JFOA 2JB5H 4KV5F 4UILH 5T1KA 4KFZC 4AEIH 1LQSR 5ID0B 3HZMA 3IDUA 5I8EA 5HHOA 5B39A 2OTUB 3QDJA 1J88A 3QEHA 4PJ7E 1HK6A 3D18B 1UB5A 2CGRH 4PJ9D 1RZIB 3Q1SH 3ZHDA 4LVHC 4YGVA 3QFDA 4G42B 4NC1E 3GKWH 5H35A 3ZTNH 3STLA 1YEEL 3INUL 1UADC 4NN5B 3KPSA 1RV6X 3VFMA 4WO4D 4NDMA 4R96B 1M6OB 4S1DD 1II4E 5EZOL 4FA8A 2O61B 2BJML 4EXKA 1SYVA 3ULUL 2VUYA 3H9HA 5ITBH 3BXNB 4FTVE 3GSXB 4KJYB 3CMGA 3K80A 2WBJB 1WJ3A 4LSQH 4X6FB 4X9FA 2YZ1A 1EIBA 2EE9A 4M61A 5KVDH 1KF9B 2WWMC 2EXYD 3V8CA 1I9EA 4WEMB 2GJ6D 2PYED 4P9ML 3BZ4A 5CLWA 1DSFL 3LPWA 1AD9B 3STBA 3TZVA 5D5MB 5D9SB 2FX7L 4M5ZH 4S1QH 3UTSD 5DI8A 3JUYA 2Z8WC 3FB6B 3UYPA 4X9HA 4HZLA 3UBXG 2DQFB 4Z76A 4ZOBA 3VWJA 3LKRB 2QQNL 3PWPE 2EIZB 5AEAA 4AEHH 4D3CL 1ZLWK 5MP6H 3UBXB 1AGCA 1EV2E 1XR9B 3W9EB 3GI9L 3CVIL 4NQEE 4KK6D 1A7BA 1PLGL 3DX9B 2QR0A 1G7JB 1A47A 2X1XR 2H8PA 4XP6H 4GG6B 3MBEB 1D5MB 5HHMD 2XOTA 4JFFA 4TSBL 4LNRB 2R2EB 5ANME 4RBPH 5BMFL 5L0QC 4OLXH 1S7XB 3BGAA 1A02N 4HJJH 1REIA 3BH9B 1N5YH 2Q6WB 3FOMA 4LSDA 1YEGL 4HKXB 4Z7VA 2D0GA 3VG0L 2RFXB 1NC2D 4RFEA 2PR4H 4OD3H 4KVCL 3IYLW 4EBQH 2I9TA 4PB9H 3FFDB 5JUEL 1CLZH 1ULVA 3VXSA 1QACA 4PJ9C 1K8IA 5DHVH 4G7YL 4XVJL 4TUOA 3RTQC 3NZHH 4M62L 3UJJL 1K2DB 1X4ZA 4IDJL 5HI5C 3TO4D 1AQKL 1XFPA 2DD8H 4U4BA 1IAIL 3BMVA 2A1WL 4Z7OE 3MUHL 5CUSL 3GMPB 1ETZB 5J1AA 4YWGL 1A0QL 5F9OH 3QDMA 1FDLL 3U7AA 4QHKJ 1N7ML 3SY0A 2E9BA 5GSVA 4IRSD 1A4KB 3VH8A 4TN9A 5INCA 1FVCA 4IRJA 2XN9D 3MJ8A 2BNRE 2DQDH 3QQ3A 4YO0B 1U3ZA 4PRBB 4LF3B 4J12A 1AE6L 4M1DL 4BZ1H 2QQKL 1HZHH 5LXGL 2EDBA 3FB7B 5CHNB 5E8OB 1RUML 1QBBA 5DHVB 4NNXA 5C0DB 1SJEA 4LASL 4I3GA 3KYMB 3LRSA 4J23A 4ZPTB 3DMMB 3L3KB 1RUAH 3BP4A 1L9MA 3UTPD 3VFWA 1B6UA 3V5HA 5KN5A 1QNZH 4PJGA 4D94A 4PPTA 5E2UH 4LCIL 5FECA 3IJYB 1INQB 4BELD 5H2BB 1KV3A 2VL5A 3VW3L 3MRFA 1FIGL 3MPCA 4OCYL 3TWCH 4P9HC 5GRXG 1EHNA 4ODXB 4OLUH 1CI5A 4DTGH 4RDQF 2APBA 4QRTA 3LS5L 4OZHF 5GGTL 3KVQA 1NCBH 4CW1B 1CDHA 1I1AD 3L3DB 4ESKA 1FQ9C 2BZDA 1JF1B 1J11A 3WJJA 4XPHL 1DL7H 5DQJA 2HT2C 5F7EH 4PJEA 2A77L 3KGRA 3QA3A 3O4LE 4E0RA 3VFUB 4OZFA 3NCYP 3VFRB 3QI9C 1AJ7H 3RWHB 3ARWA 5KZCB 3IDMB 3QUZA 1FGVL 1OGAB 3M8OL 4LVEA 3CFDB 3QIUA 1NFIA 2HVJA 4U1IB 4OGXH 3L9RB 4RGND 4JZJB 1T5XB 1PKQE 4NHUB 4ZXBA 4HUKB 3MXVH 5IHZB 1AC6A 2IGFL 4UT9H 3LKOB 5CGMA 4QKXB 4WIQA 3RPIB 1IQWL 3OJVC 2GJZA 4KMTL 2J12B 4MQXD 1OGTA 5F9WB 2HRPH 2YUWA 1F4WH 1ZEAH 4WW2F 3OHXB 3TYGL 1WCBA 3WLBA 2QBWA 1FLRL 1NGYB 1X5LA 3QDGA 1ZANL 5CJQL 1SBSL 4KZDH 4LQFL 1G9NC 5ESAA 3AVEA 4S0SD 5I1DB 1OWRM 1ITBB 4R8WL 2Y06H 1HQRA 1J1OH 2ZUVA 1LP9F 2VC2L 4MA7L 4R7DB 1RURH 4UV4H 1J8HA 1KT2A 1XF3A 4UIMA 3QFJE 2VQ1A 4XPFH 5DJDA 4PRIB 2AJSL 5DUBB 5DEGB 1NL0L 4F7CB 5J6HA 4LFHG 4FQIL 1X7QB 1FV1B 2Z31B 3E3QE 5EORL 2HKHH 4P46B 4NQVB 2OCFD 4MX7A 3AB0C 3SGDI 3BD3A 1HHHA 2IADB 3VRLF 4OFDA 5FGBA 3PDGA 5FDWB 1F00I 3OSKA 5GGTA 1ITCA 1JRHL 4BSVB 3QPXH 4HWZB 4NKQB 3FB8B 3KPOB 4FQXD 5I1JL 3GSQA 1T1XB 3H9ZA 5KSAC 2H9GA 2XZAL 1G7HB 1EJ6A 1T21A 1P5UA 4LP5A 3D69B 5EN2A 4QRPD 3V4UH 1F4HA 1GGUA 3LH2H 4Y5YB 1A3RH 4NO5A 5J12B 1T7ZA 3REVA 2EIBA 1QR1B 1F97A 3B9KA 1XIWC 4PTTB 5D7LA 4P3CL 3QUXC 2FYYB 4FQHA 4Z5RB 4L1DA 2B0SH 1XF2B 5KS9A 2WP3O 4PS4H 5KSBE 5FYLH 3LV3B 2Y36L 1I8KA 2D31A 1QFWM 3I75B 3IXAA 3N1PC 1K4CA 3PQYA 4NGHH 3CDGA 5E2VL 3D3VB 4PRHA 4X80L 5JOFB 4I18A 1T1ZA 1AGDA 5CIPA 3KPLB 1NUNB 3OXRA 1QFOA 4JFZH 4QOKA 5BJTB 3UTTA 4HIXL 1PW3A 4MAYC 1IGCL 4LSVH 1DN0A 3O4OB 2ZP0T 4YFLF 5JHLH 3CFCL 3X3FL 2B8OT 4NRZA 3SJVE 1A64A 3O2DH 3ZT7A 3ZDZE 4NC2B 3ULVF 4X99A 5J11C 4MA3A 3LQAL 3KDMA 5I9QB 3X11B 1RZJL 4OIIL 3ILPA 3KYNA 2YEZB 5K33A 5BV7B 1FL5B 4P4RA 1NMBL 1W8NA 3VXUA 4V1DE 1FE8H 1E4XL 4D8PB 1UWXH 3OL2A 4P5TB 1QSFB 2DDQH 2E7BA 5C70A 4Z78B 3KYOA 1S5HA 4MNGA 5DSCB 1AO7E 1W0VA 5AUMB 3UEZA 1HSBB 2PETA 3MGOB 3H9SE 4N0FA 4TVPH 4R0LB 3WIHL 1WIUA 4R4BB 2NY2B 4Z7VF 3TBYB 1Q72L 2OZ4L 5CILH 2R1YA 4U1NB 1VFAA 4G8FA 2CUIA 4NOFA 4AIOA 3A6CL 4MQSB 4WWKC 3RY6C 1UZ8B 4MA8H 4DCQA 4KUZH 1Z9LA 4FFWC 3T08A 4JDTL 5E2TH 3O8XA 4JRXB 1OP3H 2UZYB 2ICWA 1KG0A 4X9GA 3ABZA 2VDKL 1ACZA 5GGRY 1OTUD 5EZLB 3LEVH 4HUVA 3DSFL 5DK0B 3EYFA 2AS5M 1CICD 4P23C 5EU6B 1ZGLP 1N3NA 2CRZA 1J05A 4M7ZC 1QQDA 4L4VA 3LRGA 4JM4H 4ACPA 1ORQA 5EC2A 3IGAA 1XEDA 4MMXC 1R5VA 4U3XA 3FFCD 3LKSB 3BPNC 1UFUA 5J06A 2KKQA 1RIHL 5DTFB 4YFEA 1SBBA 2Y5EA 5EBGA 5F9JB 1F4XL 4DAGL 4G6AD 3UYOD 5E2WH 1N0XH 1V05A 3DV6A 2HYMA 3SDYH 1I8IB 7FABL 1UA6L 5E8DH 3CFEB 4S1SL 5L8LB 1JGLL 3JWOC 4PBXA 4JFDB 4CVWA 3BWAA 3U48A 4QF1B 3VXPB 3NIFE 3ETBF 5BQ7B 3WN5A 1BVZA 4U1SA 3MUGB 2WINA 4PJGF 3ZDYF 1V3MA 3GJEB 5I19H 2ZKHL 2CRIA 4PY7B 4RFNB 4Y4FC 3HHRB 4H25B 3S5LA 3TO4A 1HIMH 4LLMB 5IESH 4PBVC 1SVZA 4ELKB 3GMNA 2FLRT 4DGIL 5JXEC 2WV3A 2DBJA 4JN2A 3DVFA 1YYMH 4IRSA 4GRLB 4N0UA 1IAIM 2Q8BL 2XN9A 2F53B 1CIDA 3GUTA 3EO1A 4HBCH 1SJHB 1L7TH 4P2QB 2DQGL 4JRYA 4PJEF 5C09E 3T0EE 5GSRA 3WIHA 5C0IA 4O58L 3MLRH 1JHKL 2OZ4A 4L3ED 5DK2A 1ACYL 3B3IB 4F7EA 5IGXH 2D7QA 1HHIB 4HW6A 2WBWB 5T33L 4YHNB 5B3JF 4OLYH 5KVFL 4ONGL 3PP4L 5SX5K 3WFHA 2EEAA 2HJKA 4EVNB 5IMOB 3ZYJA 3RX5A 1KN2L 3DROB 4U6XB 4WFHD 4MDJA 4DVBB 4A6YH 4OZHB 4RX4D 4ZDHA 4CMMB 3F7VB 5EOTA 4ZD3H 5CSZA 2AEPH 5J9PB 5FGCB 4XWOC 3QUML 3MLXL 4X6CA 2I27N 4G8IB 4QTIL 2VXQH 2Z0BA 5CD5D 4GMSH 4G6AC 3W81A 4OV5A 1QSEB 1NAKH 3B2VH 1AIFB 1OM3L 3KS0H 1N6UA 4GQ9L 1KIPB 5ETUA 4GSDL 4L9LB 3QG6A 3TLRA 3E2HC 5BZDB 4ZUWA 3NPSC 4MNQB 3QFJD 1U95A 4PJ8A 1I85A 3OKNB 4HUNB 3G5XB 3ELAT 1T22A 2F15A 1ZT1B 5I0ZA 3FONA 4JKPL 1YECL 4NQTA 1U6AL 3ZLQC 2EECA 2AXGA 1JZ3A 1A8JH 5DC4B 5IW1A 4JVUA 3HI5L 4BZYA 1OTSD 3JWDH 5FHAL 2Q76A 4WW2B 1RZFH 5CGYC 1ZSDA 1F5WA 1MFBL 2XZQH 2DLIA 5FYJE 2J6EL 3BQUB 3MCKB 2A6JA 3NAAH 4UUJB 3UAJD 2QADD 3K4AA 4DN3L 5D1XC 4P99A 3V5DA 1LP9B 3RGVC 3SKNA 2ESVA 3QWRD 3PWUB 4KHTH 1GIGL 4XNUL 1CYGA 3MNWA 3HI6L 3ULSA 1T0NA 1VEPA 2BY1A 2DYPD 4JQXA 1F3RB 2DIJA 3QCVH 4DGVL 3EOAB 3S34H 3DX6B 5MEOA 4Y4KD 5ESQA 2H6PB 3V6FB 2YA2A 1N0LA 4KQ3L 1KEGL 3KYKH 1KLUA 5HDQH 4GXVH 1F2QA 1NCTA 4NNYB 5D2LA 2H1PH 4OQ1A 4Z95L 4X0KB 4MAUH 5A2LH 5CD5C 3LKQA 4JFOB 4OFYA 5CEZH 3QUMA 1QFUL 1DBKH 1PG7H 2BX5A 1M05A 4I1NB 4GAJH 3HZMB 3ZZ1A 3QDJB 5I30H 3S88H 2V5RA 4PJ7A 1SJXA 1AGBA 4MXVF 4YDKH 4Y8AA 4KTEH 3H7BA 4NWTL 5HYJE 4YGVB 4C83A 3QFDB 4KKBC 1A6VL 2EDXA 5H35B 4D9QE 3STLB 1WVZA 3KJ4B 3KPSB 1GHFL 1B2WL 3U0WL 5E6IC 4QRPA 1SYVB 3W82A 3O3AA 1G0YR 3EFDL 1WFOA 3EO9L 1MCLA 4FTVA 4ZS7L 1CFVL 5M7QA 4UQ3B 2P5WE 4U1MB 4AT6A 4M6OH