4R26H

Crystal structure of human fab pgt124, a broadly neutralizing and potent hiv-1 neutralizing antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
231
structure length
226
Chain Sequence
b'VQLQESGPGLVRPSETLSVTCIVSGGSISNYYWTWIRQSPGKGLEWIGYISDRETTTYNPSLNSRAVISRDTSKNQLSLQLRSVTTADTAIYFCATARRGQRIYGVVSFGEFFYYYYMDVWGKGTAVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PGR124-Light Chain
publication title Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
pubmed doi rcsb
source organism Nomascus leucogenys
molecule tags Immune system
total genus 40
structure length 226
sequence length 231
ec nomenclature
pdb deposition date 2014-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r26H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r26H01
3MPCA 4FQ1L 5ITFA 5JXED 3HLAB 2X4UB 5MEPB 1KB9J 1RZ8A 1QUNA 3MRHA 4HUXA 1U8KB 4CADA 2P5EB 1XF2A 3T65A 2HFGL 1I85C 4PJ5E 3T4YA 1A3RH 4J3UA 1A1OB 2E27H 3LQAC 3WDIA 2W65B 2C7UA 4LU5H 2BSTA 2IALB 1TTFA 4HX1A 5DC0A 1UJ3B 4ZO9A 5D8JL 1Y18A 1IM9D 4KI5E 4U6HA 4PJFB 2GAZB 4NZUH 2V7NB 4Z7WA 4UILL 5D93B 1FSKC 3NGBB 4G6AC 5GPRA 1S7QA 1T22A 2H8PB 2HVJA 3O2DH 5EOCL 1G7PB 3U48A 5C08E 3D3VE 5F71A 5KN5B 3INUL 5C0CB 3QEQE 1MCIA 3ULUL 1AR2A 4JY5H 5DJ2B 5BOZG 2XZQL 4K9EC 1MNUL 2OP4H 3UJJH 1FE8L 4AK1A 1MWAL 4KK5D 1FDLL 1RV6X 1U8QB 4OV5B 5AEAA 5DQ9A 2GFBB 1U8LA 4JFEB 5BCAA 4I3SL 1IQDB 2EH7L 5F3HB 3MRIB 2FEEI 1UKSA 4X80L 1A4JB 4F57L 2NY7H 1M05A 4OZHB 4BQBA 1Z0MA 1VA9A 1WFTA 2DDQH 4XVSH 4ZUVA 3L3KB 5EO1B 3TH3T 5BXFB 1N0XL 3U9UB 3ZE2E 4FXKA 1X5JA 4PRHD 4MB5A 2HLAA 3KPMB 3BI9X 5IB4A 4C56E 1XGPB 3NH7L 3AY4A 5JOPE 3LN4A 1ZV5A 1T0MB 3EDJA 5C6TL 3O4OC 1T89C 3FQWA 1F5WA 3LN5A 4OZIB 4XI5D 4MDJA 3ZT7A 4NQDD 2AXFB 1YMMB 2ZJSL 4ZPVA 4RGMB 5HD8C 1T03L 4PGDB 3CFEB 4O9HL 4QRRD 2E6JA 3WXWH 1NL0L 4I8DA 4IRSD 2GY7B 4GKZA 1YEJL 2R2CA 1Q1JH 4HKZA 4TULH 5LVEA 1AIFA 3LZFL 4Z7NF 3OKMB 3UTQB 3UTTD 2GSGA 4JPKH 1BD2D 4KI1A 3UJTL 2VR4A 5GRVK 1FJ1B 2D0FA 4JO2L 5CLWA 2BVPB 4JN2A 1GH7A 1U3HD 2G2RA 2XYCA 4JHWL 3J8F7 1MLBA 2GIYA 1QLRA 5IBLD 1X5YA 4I2XE 3ARDB 2L0DA 3QXDB 3MCKB 4EOWL 3LB6C 1OAKL 4NPYA 4WGVB 4HKXA 3GSOB 2DYPB 2LQRA 4V1DD 1QRNA 2VXTH 3MRNA 2BMKB 3DO3A 4CVXB 4MQTB 3S3PA 5FECB 4GXUN 1B4RA 4XNZB 4NGHL 2HG5A 4KZEL 1QSFB 1W0VA 4BQCA 3Q3GB 3N85L 1HHJA 5IBTH 1FNSH 3RWGA 3J7HA 2PYEE 5JHDD 5FOBB 4IMKA 3FAXA 1R3IL 4IIQB 5GGVH 3TIDA 1R24A 4M6NL 1DBML 3C5ZD 2PXYA 1NCNA 4M5ZH 1HQ4A 3RAJH 1A2YB 4MJ6A 4AG4H 2ADGA 1JPTL 1U0QA 1SJXA 1BFVH 3KR3H 2A73B 3RL2B 4WU5A 3SCMC 4ZO8A 3VGBA 5H2BA 3GSRA 3MRDB 3MBEC 5B4MC 2OX5A 4PJHE 1SJVA 1VKXA 4QXWA 4KJYA 4XBEH 1KTKE 3B9AA 2X6MA 1T5WB 1FL5B 1I8IB 4XCYA 1YEFL 5H8DA 2VLRE 4KK8C 5E2WL 4OCMC 5KVMC 1G6VK 5D1ZA 2LABA 4O02L 4RNRA 5IHUL 4JVWA 3DX9A 3IGAA 3LMJL 1I1AA 1O7SA 3BXNA 1KIPB 1CE1H 4APQB 1SJHB 1P4LA 4KKCC 2XWBA 3CFCL 3VXMD 5T3ZD 5J3HD 5IT2H 3VXUE 1JNLL 4I0PD 2BNRD 5TGBA 1IRAY 3RGHA 5DRZB 3VDAA 4U2YA 2W9LA 5MENE 4X7SH 4GXVL 1KEGL 3L3JA 4QRTB 1Q72H 2HAZA 3AM8A 3OKLA 4JB9H 4LBEA 5GIRB 4JN1L 1EHLL 2E6PA 3BP4B 4RMRA 2FGZA 4FZ8H 1YY8A 4JO1H 3RUGA 5IMKA 1TZGL 2A9MH 3PP3H 5EUOF 3S98A 1VGEL 3W9DB 4PP2B 4K2UL 1MCQA 2BVOB 2PW2B 3TO4C 1HCVA 5KSUA 1RULL 2OJZL 2V2WA 1MFCL 3LKOA 4WVRA 3TBVA 5TH2A 1PKQA 3FRUB 3FONB 3MLWL 5E94A 1GOFA 5B22A 3EYQD 2Z92A 4JEGB 3ZKMC 1ZGLM 3DURA 3OB8A 4JRXA 5DSCA 4M1DL 3V52H 5DJ8B 3I6LD 4LNRA 5IHLB 2R8SL 4UIMA 5SV3A 3RWIA 3ESVF 2I24N 4LAQH 4QTIL 5T5NG 3TP4A 1PDKA 4X6CE 3CXDH 3PWVA 4Y16D 4LCUA 2X4OA 3NABH 1FVEB 3O41A 1G9NL 4H88H 3VG9B 3P77B 5C07D 1OTTC 1OHQA 4HV8B 2GSIB 3MRKB 2F5BH 3LH2H 2D03H 2DQDH 3WKML 3MXVH 4LVEA 3WKNA 5DYOA 3GMMB 5CJQL 5JLZA 1TVHA 2WAHA 4JO4H 1KPUA 2H26B 5BS0B 3AXLB 5BJTA 5BO1L 1GZPA 2VLJE 1QBLL 4Z5RA 2P24A 4YNYA 2YRLA 4MWFB 5D6CA 1NFDB 4Z7UE 2APVA 3F58L 4ZTOL 5LCVH 3G5XA 3VWKA 4Z76B 3CVHB 5I71B 3QH3B 1FL3B 1INQB 2DQEL 4F33B 5T1LD 3WLWD 5BQ7A 5BZDA 4OLEA 4PJ9B 1T83A 4IBLT 1MY7A 4N1HB 4PJ8D 2NW3A 2BOCA 1BQHB 4XPBL 1YECL 1B0RA 2V5SA 4YC2C 2JB6A 2GCYA 4ZQKB 1MRDL 4MX7A 5J9PB 5L2JB 5DUPH 1FFOB 1JNNL 2D9CA 3VD3A 2EE6A 3NIFE 5D5ME 2D7NA 4KK9D 1L0YA 2F53B 1WT5C 2X4SB 5KSVA 1MVUA 3ZSTA 1FP5A 2VL5A 4RFEB 4YHLH 1FO0L 5DHVA 4P2QE 1YNLL 5B8CB 2AI0H 2P46B 2KUTA 4L3EA 4ODHH 4EN3D 3IDYC 4OFIA 4QHLB 3FQXB 3U82B 2DIJA 3T4AA 2LFGA 4G8IB 5C0GA 1JRHH 4BA8A 5D70H 4RISH 2EKSA 1Q38A 3MXWH 2IGFL 7FABL 5F8RC 1OM3L 4X4MA 1I1RA 2NY6C 4K7PY 3K4ZA 3SQOL 1VEMA 3F7YA 2D0GA 2E9JA 2N7BA 2D3VA 3MJ7B 4CVZB 2ICEB 4BFIA 4FMFA 2YXFA 2MCPH 1KJMB 2O26U 3F62A 3L7EB 4G9DA 2W0FB 1FYHB 4UIKH 4YK4C 5D2NA 5LKNA 1K8IA 1B2WL 5MHSE 1BM3H 1JMXA 2MQ0A 3L3HB 4CAGA 1OCWH 1X5GA 1KT2B 4C83A 1CLZH 1EZVY 4RMTA 5AD0B 1S3KH 5D2LE 2YK1L 5KS9F 5I30H 1TQCB 2VDQH 3QIWB 4POUB 1MI5A 1TITA 3T0XA 3LS5L 5HVWA 3QIUB 3ZTJG 4F9PC 4S1RH 3H9HB 2R9HD 2RCSL 4ODUA 3QQ9D 1EBAA 3RWCB 1CFVL 5KG9A 2WV3A 1KB5L 2UZXB 3PNWA 4BZ1H 2FX7H 4F2MB 3IDIA 5FUZL 4KXZI 4WUUA 4WGWB 2JJTA 4MAYA 1BLNB 4PRAA 2IAMD 3TN0A 4L4TB 1JNHB 2QQLH 3B6SA 3PDGA 3KXFD 4L8BB 1JPST 2NX5A 1J8HD 4HLZG 1EHXA 3SKNA 1I1YA 4LLYB 2DM7A 2VUOA 4Y19E 4XCNA 4PJCE 3DUUA 4Y4KA 2ITCB 3T77A 3SPVA 4I4WB 4MNGA 5FYKD 2O61B 4WENB 2MFNA 3CPLB 1BWWA 3V5DB 4KK6C 2F54B 3VXRB 2C1PA 3JBG7 1WBZB 5HGBB 4OTXH 2IBZY 2JF1A 1C1EH 1GGBL 2ZSVB 3GSNB 3TCXA 2CRIA 4GBXA 3VI4E 3L5WB 2Z4QB 1GAFL 3MRFB 4KDTA 4LSPH 3H42L 4OM0H 3ULSA 2IBGA 4OFYA 4JRYE 3I2CH 3BN3B 4ODXA 1L9NA 3S4SG 4X4XA 1NGYA 4D0BB 5GHWH 3G5YA 4HJJH 4QHUA 3BPOC 3TWCH 3O3BB 2J6EL 3WS3A 1BX2A 4XCCH 1EERB 3P30H 1EX0A 3HC4H 5JIIA 4M6OL 5MI0C 1KEML 1EGJA 1A22B 1EVUA 4NFDA 2HJFB 3QPXL 4KTEH 1HSAA 4OGXL 1NAKH 1VERA 3ZYJA 4FZEH 4A6YA 1LP9F 2BK8A 5I1GH 3BT2H 4MB4A 1INDH 1OAZH 4X9GA 4PY7B 3S34H 2CDGA 2FR4B 2JJUA 3LDBC 5CINH 4P9HH 2DL9A 4KROD 1H0DA 4MJ2A 4XNXL 4GAGH 3BJ91 3DX6A 2WLZA 1N8ZB 2VIRA 2CDFB 1IGTB 4U6YB 4ELKB 3O4LD 1X7QA 5I75C 1UWGL 3VDBA 4XNQB 4OI9A 4R7NA 5I1AB 1IGYB 3RDTB 5JW4M 1FN4B 1RAMA 1ZWIB 2JELL 1MFNA 3VFSB 4Z95L 1KGCD 1QO3B 1P69B 3WO3B 1GOHA 1SEQL 1FNGB 1U92B 4X7FC 2EXWC 3HUJE 5FA3A 1RUMH 1OTUD 1S7SB 4U3XA 1N3NB 5DR5H 5D96C 3PL6D 3QT2A 2Z8VC 5BZWA 1N64L 3WL9A 3OAZK 2YSSB 3BIKA 2OCFD 3UYRL 4RMQA 3HI1B 2VDRH 4JQXC 2IPUK 1XGTB 2DQGH 4NSKB 4WNQA 3BPNC 1JGDA 4W6WB 4HWZA 1XGRB 4LLMB 2VRAA 1YEEL 3FQTB 1CL7L 3AS3A 1L7IH 2GKIA 5GS2H 3ETBF 4C56D 4P5TA 3WIHA 5I6XB 3VFGH 3LEYL 3TFKD 4UT6H 5CJ8A 2W0LA 3FCTB 4HKJB 4Q6YA 1AJ7L 4HIHB 4I0KA 1R0AL 3B2VH 2AK4B 1ND0A 2Z8RA 4PRIE 1JPSH 4LVNC 5J1SC 2QQKH 5HYJA 4ZMAT 4ZUTB 2VSCA 5C0BD 1KB9K 3SGDH 1SVZA 3L3DA 4OZGF 5AWNH 4Z0XA 5DD3L 4HK3N 4NJ9L 4UV4H 1CS6A 5F3BB 3BPLB 4NM4L 2CKBA 5DURB 4P2OB 4XP1H 2IWGA 1H3UA 4D3CL 4UTAH 4JDZA 1A7PL 1NBVH 2VUYA 3ZSSA 2VLMD 1XIWA 4XP4L 3O3DB 4ZODA 2D31B 1HYRC 2UWEF 3R1GL 5MP6H 1FAIH 1KPVB 3GJEA 1CGVA 4JFFA 1G6RA 4TUJB 1CICA 2CRZA 1EVTC 4GW1B 1ZTXH 3RVUC 3GMLA 3TYFB 4OLVH 4DTGH 4JCMA 1NH6A 5D7SH 3Q2CA 3LQZB 5DXWA 3V95A 5KSBB 1DBKL 1EV2E 4HCRA 3RNKA 3UBXG 5FM5M 3ARGD 1Y0LB 2YD5A 3MV9A 4Q9RL 4G80B 1N4XH 4QCIB 2H45A 2CXKA 1DBAH 3VXPA 1R3LA 2OSLA 3SDCB 3IDMA 5TPWL 5HHOD 2R1WB 3BPCB 4N68A 1A6WH 4MNQE 5KW9L 4R0LB 4X99B 5IF0B 4L4VE 1YEGL 5EBLA 4G7YL 3IFLH 3D85B 2DICA 5ANMA 4MXVE 1MCOL 1I3GH 3GSQB 5HYIA 3EYOA 1E0OB 4H8WC 3MZTA 1T5XA 3DXAA 3QEUB 3RRQA 1UH2A 4HUUB 3PV7A 2Y5EA 2ESVA 3JV0A 1HOCB 4IRJB 1JK8B 3IU3A 2R15A 4I77L 4BKLA 3MUZ1 3NCFB 1N59B 5GGUB 4M7KL 2NY3D 3AS0A 4M7LL 3KYOB 3MV11 4JANB 2GY5A 5EDXA 4LCIH 2B5IC 3MV01 1KYOJ 1WWCA 5HXMA 4FRWA 1MCJA 4P5KA 4XI5C 3OJDA 4GQ9H 2DKUA 3VFVB 5MEND 4PGCB 2ZCKH 3IJHB 3MRRA 3X12A 3M1BA 4UT9H 4IRSC 3C8KB 4PJBF 5MEQA 3QQ3A 3P9MB 4B50A 3EO9L 4LSDA 3TYGH 3GMOA 3IFNH 1DQLH 4A6YH 4GG6A 4HFWA 3S96A 3VXQB 4B41A 4LLVA 1U3HC 3ARFA 3JVGC 3RWJA 5T5FH 2IPKA 1UH3A 5FKAB 4OF5A 1IC7L 5CIPB 3ZHKA 4DFIA 4HS8L 4HBCL 3JWNC 3HPJB 2YR3A 4GH7B 1MWAB 2ICWB 4TOYL 1UT9A 2CDEB 3BZFB 2AEPH 5FA4B 4HWBH 4OM1H 3GEWB 4FTVB 4BUHA 3FFDA 1OF2B 1CFSB 2IMMA 4DCQB 4V2BA 2Z31A 5IB2B 5DEGA 3E1F1 5E2TH 5L9DL 1WIPA 2BP3A 2FBJH 3GK8L 3BEVB 2VZUA 2P8MB 2DI8A 1K3ZA 4PREB 3BH8A 3KPSD 2BHYA 1RIUH 3HLAA 1A6PA 2VZ3A 3K2UL 2X4UA 3BKYL 4HMEA 4LQFH 5B3JE 3C5ZC 2YA0A 5MEPA 3QEHA 1BGXL 2ED7A 4FXGB 1U8KA 2VDNH 3UROR 2P5EA 4HWEL 4LSQL 5JIPA 1IEHA 4MQ7B 1CCZA 1EEUA 3QP3A 3QA3B 5DI8B 3ME0A 1A1OA 3C8DA 5B39G 4TSCH 2ZNWA 2W65A 3V5HB 3MV7E 2IALA 1ONQB 2VH5L 4IJ3C 2LTQB 2YD8A 1UJ3A 3DSNA 4FQ2L 4WW1B 2N1KA 5I1IH 1DFBH 4PJFA 4ETYA 2GAZA 3KNBB 1WTLA 1PG7X 2V7NA 4M1GL 5FDYA 3HE6D 1JWUB 2H8PA 2XA8H 5HHVL 3H6JA 5EIIB 5TQ0H 1G7PA 5EOCJ 4WTZG 3C2AL 5KN5A 3U9PH 2QKIB 5C0CA 2FCBA 4HC1A 2X2YA 2JJSC 5DJ2A 3UC0H 5FGCE 4JRXD 4Y4HD 3GDBA 1U8QA 4OV5A 4PJAE 4BUGA 2ICWJ 2KZWA 5FGRA 2GFBA 4JFEA 1G1YA 1IQDA 1KSRA 3NFSL 5DJ6B 5F3HA 3BUYB 3K81A 3MRIA 3DMMB 2ZOKB 1A4JA 2YMXL 2IC2A 3C5JB 2A9NL 1E4JA 1ACYL 5IFHL 3V6ZB 4ZNEE 4PJ7B 2DM4A 4OZHA 4G9FB 3MO1B 1VB9A 1G6RH 4GW5B 5LBSL 3L3KA 5SWSB 5EO1A 5BXFA 3U9UA 1OSPL 4KQ4H 4LFHD 3H7BB 1JGLH 2A0LD 5I66B 3KPMA 1XGPA 3TBTB 1U58B 4Z77B 2XFXB 4Y16C 4EI5B 2FHFA 5IBUG 2APBA 3C6SB 1OWRM 4MMZC 1T0MA 2O5ZL 2ZKHH 1I1FB 4HCRH 3VWKD 3VGAB 4XB8A 3QCVL 2B1AL 4KJWC 1MHHB 2EXYD 1JGUL 4OZIA 2V5RA 5IVNA 2AXFA 2G75B 2LVCA 1FG9C 4X6EB 1YMMA 5SWZB 4BZ2L 4PGDA 3CFEA 4KAQL 2R0ZL 1WBXB 3HMWL 1T7VA 3C6LD 2APFA 5FUOH 1NPUA 2J12B 3CX5J 2HT2C 1WC7A 4YX2H 1NEZB 1K2DB 3WLWC 2ERJC 4PJ8C 3OKMA 3UTQA 3WFBH 5HDBF 2CSPA 2DI9A 2K9UA 3QDAA 4H1LB 4HIJB 5E6ZA 3ZTNH 1FJ1A 1LWRA 3ARBB 1ETZB 2D7MA 4L3ED 2BVPA 2EE3A 2BRRH 1A0QH 3ARDA 3QXDA 3MCKA 1IT9L 2PYFB 4GMSH 4BFEA 3WV0A 3GSOA 4WRLA 2DYPA 4G43B 4KK9C 2X1QA 2BMKA 4R2GC 4CVXA 3QIBB 1G9EA 2YKLL 3WNNA 1YQVL 1LVEA 3MUY1 5FECA 2IBBA 5AYUH 5DGQA 4P23B 4NKIL 1FBIL 1QSFA 1MCNA 1RUQH 3Q3GA 3K46A 4GSDH 1MJUL 3BGFC 4Y19D 1MCPH 3HAEB 5FOBA 1BF8A 2J1KA 4IIQA 1E28A 4HF5L 4M43H 4YO0B 1A2YA 3BGMB 4XWOD 5IP4A 1JF1B 3IAQA 1AD9B 4YHZL 2A73A 3RL2A 1VPOL 3MRDA 4WI8A 1CDJA 3MNZB 3BDYH 2R4RL 1H3PH 3N0PB 1T5WA 5E4EB 1FL5A 1I8IA 4HPYL 4LARL 5ILTH 1LGVA 2VLLB 3ALWA 1ZLWK 1MI5D 5M94B 4JR9L 1WAAA 4M5YL 1TFHA 2ARJB 1ZOXA 1CIUA 1A6VH 5ACMA 3HMXA 1RIVL 4XC3H 1DSFH 1KIPA 1EJ6A 3CGTA 1JPGB 4APQA 1SJHA 1DN2A 4TSBL 2I26N 4DUXA 1SY6A 2DJSA 4AMKL 4CDHA 1JYVA 4RCAA 2E7BA 4LP5A 5DRZA 3HR6A 4JM2C 1J5OL 2R2EB 3P11L 3HZVB 4CRPA 2AKRB 4MCYB 1JHKL 1S9VB 4WW2F 3DETD 2KZ1B 1F02I 1N6UA 4QRTA 4RFOL 5GIRA 5ACZB 3WJLC 3KS0J 4JQIH 3BP4A 4MAYD 4PGBB 2P4AB 4PB9H 4LLDB 2QQQA 5FAAA 1CXIA 4LGPB 5HDQL 3ROOB 4PP2A 4O00A 3W9DA 2R9HC 2B4CH 3QQ9C 2BVOA 4ZG1A 2PW2A 5CGYD 5FV1L 5BOPA 4HJ0D 5L2KB 4ZUSB 3FRUA 1X5FA 3FONA 4OF7A 1ITBB 4UDTB 1IBGH 5ISZD 5IWLA 4XAKE 3QQ4B 2IAMC 1YN6B 2VNCA 2WWKT 5DJ8A 1FO0B 1AGBB 5EA0H 5I8KH 5F7WC 3D87B 1DQQB 3CDGB 1CU4H 4DEPB 4GBXD 1OAQH 2AXHA 4JGJA 1XF5B 4GO6B 2VXSL 3CU7A 4FQPA 1FVEA 4OFYD 1I8LA 1Z9OA 3P77A 4LSSH 1GC1H 2GSIA 3MRKA 4HV8A 1T1XB 4NQED 2D9QB 5DVKA 4JFHD 2G9HB 4NCDA 1RZKL 3FB6B 3RPIB 1OY3B 3U4EB 2R69L 2Y9RT 1IILE 4AQ1B 3QNZB 3GMMA 5IR1B 3GSVB 4NRZB 4N8VB 2H26A 5BS0A 1CBVL 3AXLA 3ALPA 1RUKL 5HPOA 3QULB 1EBPA 4PJGB 5GRUH 2EDJA 4WO4D 4Y2DD 2HFTA 2B20A 4U6TA 3RTQD 2EECA 3RJDA 2OMNA 4MWFA 1NFDA 1RVFL 2PKDA 4FABH 2IPTL 1H8OA 2VZTA 4OLUL 2HKFH 4Z76A 2WP3T 3CVHA 3QH3A 5T33L 1INQA 1FL3A 4PJDF 4F33A 4KKBD 4PJ9A 5DD1H 3HZKB 1BQHA 2EDQA 2G5RA 4M02A 1QYGL 1Z2KA 4MA7H 3S36X 1YPZB 1WFNA 2GUOB 4ZQKA 4F15C 5GJTH 4M62L 5J9PA 5L2JA 1FFOA 2AVGA 3OGOE 4Y2OA 1D5IH 3I3DA 4PR5B 4AL8H 2A77H 2F53A 2X4SA 4DGVH 2JB5L 3B3IB 3Q48A 4RFEA 5KJRL 4ONGL 5B8CA 4JQVC 5E08H 1U8IB 3VRLE 1U8JB 1KB5B 1YYLH 4ZOBA 3KLHC 4QHLA 3FQXA 4ZDHB 3DV4B 2XPGB 4OF3A 2HT4D 1NMAL 3S35H 1A7QH 2YRPA 3MNWB 1KLFA 3DUHA 4G8IA 5HBBA 1KCSL 3D39B 4HIIA 4AENB 4XPGH 5C0ND 1FGVH 1AI1L 1LHZA 5EU6B 3MUGB 2OR8A 4S0TD 1P5VA 2OBGA 3MJ7A 2H6PB 1A3LL 4CVZA 2J8OA 3GHEL 2ICEA 4JKKA 3BAEL 1KJMA 2H3NB 2W0FA 1JFQL 4G8GB 5C0AD 1KN4L 3PHQB 1MFAH 2DQCL 3HRPA 3BVNB 2Q8AL 2W38A 5F7HA 3OGCB 4G3YH 4YHOL 1KNOB 1U8HB 3H3PL 3L3HA 2FX9H 1HKFA 2LAAA 3C8HA 1KT2A 4LHUB 5DDHB 5F6IC 5AD0A 3BH9B 1XMWA 3ARED 3MJ8B 2ZCLH 3QIWA 4JFZH 4LPUA 4K23L 3HTLX 4QRPB 1IC4L 1V3MA 5HHPB 1E4XH 3QIUA 4P46D 4GAJL 3Q5YA 4M9OA 1LD9B 3W2DL 3H9HA 2NY1D 1MREL 1V7NH 3RWCA 4WHTB 3MCLH 5D7IF 2NY5L 4F2MA 5IK3B 3PGCB 3VW3H 1D6VH 1BLNA 1OSZB 4L4TA 3TVMB 1JNHA 2WBJD 2GTZB 3SDYL 5IEHB 1KPRB 3EOYG 3B9EA 4L8BA 5L88H 2OZ4A 1CGWA 4I0CC 4QYOB 4PJIB 4HEME 3EIFA 5E6IB 1CF8L 4LLYA 2W1NA 2ITCA 1OT2A 3OAYH 4I4WA 2O61A 2DF3A 1QSEB 2AABH 3CPLA 3V5DA 5EORL 2F54A 3VXRA 3R0NA 3VXSE 1WBZA 4XCFL 5HGBA 3ULVL 4R90L 1UJTA 1X44A 4OCRH 5F9OH 3U30C 3ZLQC 2W07A 2HTLD 2ZSVA 3GSNA 3OF6A 3RWEB 3QJFB 3L5WA 3MOBH 2Z4QA 1BQLL 3MRFA 4Z7VE 1E4KA 5I9QC 2ESVD 3CDFA 3LOWA 4UOW1 5JOFB 4O2FB 4D0BA 4ONFL 4QXUH 4ZYKA 3AY4C 1QD0A 3BIBX 3CD4A 3O3BA 4NHUB 5GRWA 3TT1H 4WEUD 3U6RB 2NPLX 5EZJB 2VQUA 3RZCB 3UO1L 2X4TB 4HUNB 3VA2C 1CZ8H 5IGXL 4UB0L 3UP1A 5JTWA 1NCWH 2HJFA 3OKEA 5FYKL 3QCUL 2XY2A 5TDPB 5CCKL 1RY7B 4K8RD 3KYAA 5E03A 1ZT1B 4PY7A 2GEEA 3MV7D 2NY3C 2FR4A 4RMVA 5HHME 5C0DB 3NIGE 3U46B 3W39B 1N8ZA 4JHAH 2CDFA 4EDWL 3QAZC 2GJ6B 4U0QB 1IGTA 4U6YA 4ELKA 3KYNB 1KYOK 1JZ5A 4XNQA 4NNPL 4NJAL 5KTEH 5I1AA 2YD3A 1IGYA 3CVHH 3RDTA 1FN4A 4KFZC 1L6ZA 1ZWIA 3P0YL 2O5XL 3V6FB 4YXKL 3VFSA 3TZVB 2CJUL 5DFWH 1QO3A 1Z5LB 1DVFD 5JPNB 4LCCB 4QY8B 1FNGA 1U92A 3TNNB 4MQSB 4JFOB 4J3WA 9CGTA 1S7SA 1OAUH 1N3NA 4K71C 2I07B 2AV1B 4MMXC 2WUCH 3U7WH 4G7VH 4J6RL 3F7VB 4NNXB 3T2QA 5I8OH 2Z31D 2YSSA 3VFWB 3FFCD 5HVGB 4OD3L 2AK1H 5JMOC 4IMKC 3HI1A 5E1AB 1XGTA 4NSKA 4EXKA 4OCSH 4D2NA 5LGJB 1WLHA 2PXYC 1CDYA 4P9ML 4ETQB 5FHBL 1XGRA 4LLMA 1OP5H 1ZEAL 4XPFL 2P5ED 1D9KB 1MF2H 3EOTH 1AQDB 4RSVA 1MJJA 3FQTA 2NTFB 5I0ZA 5F7MC 4OSUL 2VLKB 3BWUC 4A2LA 5BMFH 2R29H 3N1QC 1BFTA 4Q74A 1PVHA 1U8PB 3S9DB 2B1HL 3FCTA 3KPOB 4HKJA 1QLEL 4HIHA 1NC4B 5D1ZC 2AK4A 3PDOB 2CIKB 2AEQL 1CLOL 1GSMA 1I1AC 4ZUTA 5KVGL 5DJCB 2D7OA 2XZCH 5FDWB 2Y6SD 2HKHL 4OQTL 1D7FA 2DLIA 5F3BA 2AJUL 2CK0H 4P2OA 1VDGA 5C7XL 5C0CD 3AM8C 3TJEH 3RKDC 1Q9WB 3O3DA 3RHWK 3MBXH 2AEIT 3RI5K 2D31A 4UMGA 1KPVA 5HGDB 5JR1L 1A1MB 1P4IL 5C0FB 3PG2A 4TUJA 3NTCL 5E2VL 1A4KB 4OUOA 3ZDYE 2AJ3B 1HZHL 4GW1A 4R4NC 3TYFA 2ILLA 2CR6A 4PJEB 3RBSA 3S8WA 1ORSB 3RY6A 3VFMB 2RQ8A 4XMKL 1S5IH 3MUHL 3C60B 3LQZA 3GIZL 3IJYB 3TC9A 5BRZE 5KSBA 2MKLC 2A2QT 2Q86B 3O6LL 5CILL 1Y0LA 1L9MA 3B8SA 1G9ML 4NZJA 1HQRB 4G80A 3EYFB 4QCIA 3WHE1 2NY4B 3LY6A 5I1HH 1CTNA 3SDCA 5FEBA 4Y8AA 3RPKA 5KBNC 2R1WA 5E5MB 3BPCA 2ENSA 4FQJH 5IHZB 1JZ8A 1YEDB 4R0LA 5I1EH 2MOVA 3RUGE 5TE4L 4X99A 5IF0A 2NXZD 1YJDH 2OZ4H 3D85A 1FAKT 3WS6A 3KAAA 1K5NB 5B21A 3GSQA 5FGSA 3UAJD 4OUUB 4LDOB 1XEDA 4B5EA 3DO7B 1PKQE 3QEUA 5ESQB 4HUUA 4X4YB 3H0TB 1HOCA 2Q3ZA 4IRJA 1JK8A 2OJEB 1YMMD 3U36B 1TNMA 1N59A 5GGUA 4MHHI 2HRPH 4WHYH 1UM5H 3LKPB 4QRUB 3KYOA 3PQYB 4JANA 1EIBA 2GW5A 2CPCA 2VC2L 3VWKC 1QFWH 3E6HB 3E8UH 1T83C 4U6XB 5FCUL 2RIKA 3VFVA 1UENA 3UBXI 3JUZA 4PGCA 1Q9LB 3IJHA 2R0WL 4E41B 4GRMA 1X3DA 3ARDD 1K85A 1JL8A 2ED9A 3U1SH 5GS0H 3C8KA 3M8OH 4XVUD 3HE7B 1JZ7A 2WW8A 2DYPD 3L1OL 3QUZB 4ZD3H 3P9MA 2NZ9D 3CX5K 1EO5A 4UTBH 3RVVD 3U0PB 2P5WB 3REWB 3MREB 1QSFD 1HINL 4R26H 3S88H 4RA0C 3OR7B 5KS9B 2OK0L 3VXQA 2IFGA 4U1JB 4LSVL 2ZG1A 4PG2A 3JV5A 3Q6GL 4NWUL 5FKAA 5CIPA 4XAKD 5AYQA 2IPUG 3HPJA 3L6FB 4D0CB 1MWAA 2ICWA 2IMNA 2CDEA 2M26A 3E3QE 3BZFA 3X3GH 5FA4A 1PZUB 1RZ7H 4FTVA 4NWTL 1OF2A 1CFSA 3ZDXE 4DCQA 5LWYH 5IB2A 2YBRB 1IGIH 5ICZB 2ZP0T 1PD6A 1NFKA 4JKWA 4OI8A 3BEVA 2P8MA 4PY8I 4PREA 2FJFB 3EYSL 2A6IB 2DQHH 4QKXB 4LCWE 4RBPK 3FO0L 5JW4N 4HT1L 5D2NC 3IDNA 4EZMA 1ZT4B 3W5MA 3AC0A 4CJ0A 2VZ1A 4APQD 3ARPA 4MQ7A 4YXLH 1IMHC 1B4JL 4W6YB 5ENWB 1MAML 3QA3A 5DI8A 4Z9KB 3X14B 5DC4B 1Q9OB 4R4FL 3V5HA 1ONQA 1MLCB 5GGTL 4X4ME 2ZOLB 1CDHA 1HHKB 4WW1A 3L9RB 4HGWB 1FGNL 3GO1H 3MLXL 2FZ3B 3KNBA 2EC8A 1UADC 3WFCH 4OZFB 1JWUA 1H5BB 3VFPB 4YZFF 2JK5B 5EIIA 2X42A 1TCMA 2EO1A 3QXAB 1I9RH 3WNKA 2QKIA 3HC3L 1A47A 1A6ZB 2KPNA 3NIDF 2YD6A 2JJTC 4MAYC 4DWHA 3TN0C 1BF2A 1NMBH 3GMPB 4AT6B 3T0ED 4PRHB 4H0HB 5T1KD 3T3PF 5E7BA 4YFLF 3NCBB 2A1WH 5CGYC 5JHLL 4HJ0C 3SKJL 4LPXA 5DJ6A 1A6TB 1FC1A 2CLRB 1PLGH 3BUYA 4P3WA 5FO9B 2BY2A 3DMMA 2ZOKA 4IDJH 1LP9B 4N9OB 2AQ3A 4Y4KC 1OW0A 5CJOH 4F80A 3C5JA 1EFQA 3V6ZA 4LPYA 4K55A 3RP1A 4PJ7A 4QXGH 4OKDA 4G9FA 3MO1A 3IDUA 2DWDB 3P4MB 4NQDB 1MCLA 1GYAA 4GW5A 5SWSA 5ID1B 1QR4A 4FFYL 4WUUE 5CUSL 4GBXC 3F8UB 3H7BA 3ZE0E 4HH9B 5I66A 3NFPB 4QRRB 3MLVL 2Y07L 1AC0A 3TBTA 1U58A 4Z77A 2XFXA 4EI5A 4KDTC 2W0PA 3C6SA 3HA0A 4LEOB 3CC5B 2DQUL 3QG7H 3PHOB 1I1FA 5DWUL 2NX5E 5LXGL 1K9TA 4U1KB 3P2TA 2IANE 4X83A 5JZ7D 1MHHA 1BD2B 4HD9A 3QZWG 2I5YL 2DD8L 3WSQH 1YEKH 4D9QD 5HYFA 4Q6IB 2G75A 4X6EA 1L7TH 1X5KA 3QQNA 5SWZA 4ORGB 4U6VL 2VAJA 2B2XL 4G8EB 4GAFB 4U1GC 2APXA 1RJCA 1BIIB 1MJ8H 1WBXA 5F9AC 1GZQB 12E8L 1VENA 3DI2B 4UNTA 2ED8A 2VITB 5ALBL 1NAML 4L4JA 4OLWL 4J2XA 1UGNA 2DM3A 5CZXC 4MNHB 1NEZA 2F53D 3CU1A 1K2DA 5HHNB 4RFNB 2ADFL 1H3GA 2J2ZA 3V4VL 3RX5A 2H2SC 3FN0H 4YBLC 4H1LA 3RIFK 4HIJA 5I19L 3FO2B 5JHDB 3ARBA 1ETZA 4CN6A 1NC2D 4JPVL 3VFUA 5KOVC 3MYJB 3MROB 4RAUB 2Q7NA 5FGBA 4RRPA 2YPKB 4ODTH 1OB1B 2PYFA 1SMOA 4PLJC 4K3DH 4G43A 4M3KB 3QIBA 3M07A 3OKYA 4P23A 4JREC 4GG6F 1B90A 4XXCA 4O4YH 2D2OA 1BVLB 5I15L 2YPLB 3HAEA 1EAPB 2HT4C 2OMBA 2R1XB 3CMOL 4H25B 4Z0BH 1NBYB 1RHHB 2UZIL 1ZVYA 3ARVA 1J18A 1J1XH 3MLPA 1JHLL 4YBQD 4YO0A 3TV3H 3VXMB 3BGMA 1D3CA 3PWPB 4M1CC 1JF1A 1AD9A 4PJAF 4I0PB 2BNRB 5C2BH 2ZUQC 3RWDB 3NACL 3B2UC 2VZVA 3MNZA 35C8L 3INUH 3SE3A 3CLEL 2Q3AA 3MQIA 1OWWA 2DAVA 1RUPL 2VLLA 3QIWD 4ZTPL 1QKZH 3ULUH 4FFZH 4ZAKD 4N8CL 1MHPL 4N1CA 2ARJA 3GBNL 1MNUH 4R97C 1RK0B 1FE8H 2Q8BL 5D1XD 4P5TC 3RY4A 5A2LH 1P7HL 1EEQA 1X6NA 1JPGA 1WUNT 3QIUD 1Q0YL 2E6QA 2QADD 5BV7L 3QRGH 1BECA 4I3SH 4DN3L 4KRPB 3IDGB 1JJUA 1IC5L 2HJKB 2R2EA 3HZVA 5DEZA 2AKRA 4MCYA 1S9VA 1JF5A 1I8MB 4OV6F 5ACZA 3NBNA 1WWAX 1J1PL 4TNWK 4NQCB 1QFPA 2J5LB 3BP7B 4PJFF 1DUYB 3GHBH 4PGBA 2W9EL 4LLDA 1K6QH 5D6DA 4CU6A 4YHPB 5EU7C 3ROOA 4Y5XB 4ENED 3SKUD 1XIWC 2NY1C 4KPHL 3A6BL 5L2KA 1MJ7H 4ZUSA 5IFAH 4RQQB 5C07B 4YLQT 4RZCB 1CICC 4UDTA 3VD9A 4E5XB 5HI3D 2X4NB 2VXVH 1AR1D 5C0JB 3QQ4A 3MRGB 4C55A 1YN6A 5HYJE 1FO0A 1AGBA 2YA1A 1GPOH 3WO4C 1DQQA 4I5BB 4K7PL 3LD8C 3CDGA 5DA4A 4KXZH 1MCBA 2MQ3A 1AO7E 1XF5A 4ZOCA 4NUGL 3GKWH 1CTOA 1OAYH 3DI3B 5EU7E 3ZT6A 2HH0L 1S5HB 4S0SD 3ZKQD 4X4ZA 3CFDB 5IQ9B 4OZHF 2BNQE 2G9HA 3FB6A 3U4EA 3QNZA 5IR1A 3GNMH 2HTLC 3GSVA 4NRZA 3RVTD 4HIEB 4KTDL 4N8VA 2EZ0C 2XQYG 3QULA 4PJGA 3RGVB 1MVFA 1EHAA 1IE5A 1IQWL 3JWDC 3LRSB 1YDPB 2QSCL 4X7DC 5FYLD 5MERB 5E2UH 3NZHH 3KYKL 3UZEA 4LMQI 4XNYL 3SE8H 3MV9E 4KZEH 2R2HB 4HXAH 4D9RD 3OG6B 5F7EL 4MJIB 3HZKA 4OZIF 2KQNA 5H94B 5CAYB 2MPAH 4UBDC 1L0QA 2EDEA 4MAUL 4EN3B 1F4YL 5C1MB 5DMGD 2X1OA 3HI5L 1YPZA 2GUOA 1RZJL 4PTUB 5DD6B 3QDJE 1U2HA 2WUBL 1HHHB 3BE1L 5F96L 1KTDB 4LPTA 1X9QA 5FYJD 1F6LL 2R23B 1RK1B 4PR5A 3ZO0A 5ANME 5C09B 2HFFB 1TQBB 1EH9A 1KCUH 3MLZH 3B3IA 5KSAD 3DXAE 4NC1C 4WFGE 2VKXA 1C7SA 1U8IA 2EDFA 1U8JA 1KB5A 4HUWB 5CEZD 5CHNB 2V2XB 5E2WH 3EZ8A 4LL9A 4ZDHA 3SDAB 2XPGA 4AEIH 5CEYB 4N8PA 1JNJA 4MJ4A 3LMJH 1I75A 3D39A 4ELMB 2BJMH 4AENA 3CFCH 2X4RB 3ARFC 5EU6A 1OGAE 3MUGA 1F58L 4KY1L 2H6PA 2QSTA 1U8OB 4FQXD 4XVJH 1RUAH 4G8GA 4HULB 4P49A 5A2IH 1HIMH 4XPAL 1JZ3A 3E2HC 3PHQA 4OF8A 4RWYL 2Z31C 5GQBA 2ZPKL 3MV8B 3BVNA 5DJAB 4C54A 1F3JB 1FVDB 3OGCA 4AIOA 4HWUA 1KNOA 1U8HA 3SOBL 4K2UH 1P2CB 4KQ3H 1P4BH 5CJ5A 3LQAH 4LHUA 5DDHA 1EUTA 2AK4D 3OJMB 3BH9A 3MLWH 4WHCA 3O2WL 4JZOB 1NDMB 3MJ8A 4OLYL 2UVEA 2R1YB 4ZO7A 2H1PL 4N5UA 4DUVA 4MSWB 1KBGL 5JOEA 1ED3B 3IXAB 4QRPA 1YEHL 1FNEB 2XZAL 3KXFB 5HHPA 3NA9L 2J6EA 5DURD 4P2OD 3QHZH 3ZMRA 1LD9A 5EO9B 1MOEA 1UJ3C 1J8HB 5K59F 4PJXF 1FYTE 4QT5B 1NSNL 4FG6D 1AY1H 4WHTA 3BN9C 5D93C 4X6FB 3NGBC 5IIEB 5IK3A 3W0WE 3PGCA 3U4AA 5TE6L 2EH8H 5T3XD 2Y6SC 3V6OE 4U7KA 1OSZA 3FRPG 3TVMA 4TUKL 3CK0H 1AQKH 2GTZA 5IEHA 1VCAA 1KPRA 1BJ1J 1HXYB 1BZQK 4QYOA 4FXLA 4PJIA 5E6IA 3O0RL 2EYSB 3F58H 5CP3A 4N1EA 3DROB 1QSEA 3GRWL 4JG0L 5JDJA 3T1FB 2Y7QB 5EZOL 1HWGB 4PY8J 3QHFL 4D9LH 5F7FA 1YECH 1DQDL 1GGCH 4LSRL 1UACH 4B53A 3IU4H 5ETUB 3D85D 3RWEA 3FB8B 1MRDH 3QJFA 4JZNB 3JWOL 4PJ5B 4AEHH 3O6KL 4DN4L 3I50L 1T3FB 5I1CH 1NANI 1OAXH 5I1KL 1P84J 5ADPL 1AXSB 5SX4I 4IRJD 5F1KC 4X0KB 3UJIH 5JOFA 2VABB 4O2FA 2WWMC 2E7LA 4KROB 4NHUA 4HK0B 1U93B 1MCDA 4LCWD 3U6RA 3RZCA 5EZJA 3EYVB 2X4TA 4R8WL 4JFEE 3O8XD 4XPTL 4M8QB 5JNYB 1HSBB 2IH1B 3TF7C 3BESR 4QHMB 5C08B 3D3VB 1RZIB 3THML 1NFDF 5TDPA 5F89B 3DNKA 5GS2D 3T0WA 4K94C 4OGYH 5DD5L 4XHQA 1ZT1A 4KRLB 4RGMC 3I9GH 3QEQB 3SQOH 4LOUD 4NZDA 1WJ3A 3LIZH 3KJ6H 3JV6B 1NLDL 2OR9H 5F7KC 3SY0B 5C0DA 4RAVB 1QG3A 2DWEB 3PL6B 2VN7A 4ZOAA 3UTPD 1LDSA 3WNMA 2EIEA 3W39A 3G9AB 4BELD 15C8L 3FB7B 2GJ6A 5D71H 3KYNA 1HILB 4QXTB 3MLTB 3TGXA 3V6FA 3TZVA 3ARDC 1Z5LA 4GKOA 5JPNA 4LCCA 1RIHL 4QY8A 3TNNA 5KVFH 4E9LA 2YK1H 4JFOA 2BSSB 2I07A 2AV1A 2VYRE 4WFED 4XNZC 4C56B 3HG1D 4FTVD 4WHYG 4K8RL 5GRJH 3F7VA 4NNXA 3UYOD 1IEAB 2DBJA 4WW2B 3VFWA 1FRGL 4GKNB 3PP4H 5E1AA 1M7XA 2Q7YB 4IIQC 1A14L 3EAKA 3VJ6B 5C0BB 3ESUF 5LGJA 3K4AA 4UAOB 3L5IA 4ETQA 1NKOA 3ZT5A 1D9KA 1AQDA 1TJHH 4YDVB 3ZL4L 2NTFA 1MPAH 2V5YA 3MZGB 2YPVH 4YE4L 1RJYB 2VLKA 4HUVB 4M9PA 2PR4L 4J3XA 2IQAB 1U8PA 3HHRB 3O6ML 3KPOA 1LMKA 1NC4A 3PDOA 1AGDB 2CIKA 4JY4B 2IAND 3ORJA 3BO8B 3QUML 5DJCA 1CLYL 4APQC 1HNFA 4KGLA 5ERWB 2FNBA 3O6FB 3C08L 4G42B 4XX1G 3V4PH 5FDWA 4I2XB 2HRLA 1KFAH 1DLFL 1SBSL 4ZS7L 1GGBH 4GG8B 3MLRL 4DGIH 4MD0B 3ARGB 1Q9WA 2KH2B 4UV7H 2X05A 3H42H 2C5DC 2C9AA 5I18H 3LKQB 5E24E 5HGDA 2DQJL 4MVBD 1A1MA 5C0FA 3D1MC 5HHOB 2C4FT 1I3VA 2PYEB 1A4KA 4NN6B 1MCEA 2AJ3A 1MRCL 3D0VB 2XNAB 5L8LB 4PJEA 1ORSA 3ZDZF 3VFMA 3DMMD 5CFHA 5E9DD 4ZFGH 3C60A 4M6OH 1KEMH 3IJYA 4PJDB 5IWLC 4KKNA 2Q86A 3OBAA 5D7KE 4G9FD 1HQRA 4OGXH 3SDXE 3EYFA 1P6AB 2VDLH 4PJHB 4X6DF 5SWSD 1XGUB 5HDOA 2AV7B 3LKRB 5CKGA 1LO3H 5E5MA 4XNMB 3MA7B 5IHZA 3LKNB 1S8DB 2H2PD 1P5UA 1YEDA 3SE9L 4PFEA 1I8LC 1MCFA 1AXIB 1MEXH 2ICCA 4MLIA 5D72L 3V0WL 1K5NA 1UCBH 3VXUB 3VXTA 1MRFL 3GM8A 4OUUA 3DO7A 3OZ9H 5ESQA 4X4YA 3H0TA 1F3RB 5MENB 2OJEA 5SWZD 3U36A 3SO5A 5HSFA 3TH2T 4XMPL 1EPFA 3LKPA 2EDHA 4QRUA 3PQYA 4NKQB 2VDPH 1PJ9A 4OF6A 3MUJA 2X1PA 5I71C 3E6HA 1YY9C 1N64H 1QNZL 4PJ9C 4U6XA 4RIRB 2NXYB 5TF0A 1T66D 2BERA 3I3EA 1IL1B 4R7DB 4TSAL 1Q9LA 1F45A 1HH9B 1Y6NR 2YD1A 4WEBL 4E41A 5SX5H 2J88L 1JN6B 5CBEB 4G6MH 3HE7A 2N4IA 3QUZA 3D69B 2M8XA 5IMMB 3U0PA 2Z9TA 5E8EB 3GI9L 1FH5H 1BIHA 2P5WA 3REWA 4P23D 3MREA 5B8CC 4PB0H 1TJGH 3OR7A 4OCXH 5KS9A 3KPSB 3F65A 4U1JA 5GZNC 5JXEA 4FQQB 5JXAH 2Y1VA 1R0AH 1T7XA 2Z91B 1KENH 2E8ZA 4L8DB 5KZCB 3ISWA 2JJVA 3UXFA 1T21B 4D0CA 1PYWB 2F5AH 4JPWH 5HI5D 3KPPB 2BFVH 5IMLB 1BAFL 1A3RL 5F9WB 4ZXBD 5D7IB 4U4BA 1C16B 2PTTB 3S3JA 1AO7D 2YBRA 4U31A 4LU5L 4Y5VB 5ICZA 2KQMA 4Z7UB 4G6FD 1RMFL 1A7PH 2C3VB 1SM3H 4GUPB 2FJFA 2A6IA 1HHIB 3PWJB 3VD7A 4IOFC 4NZUL 1HK6A 2FB4L 3HE6B 3OKKB 1ZT4A 4DVBB 2WNGA 1AD0B 2D4DA 5ENWA 1FCGA 2CO6B 5DMIL 3X14A 5CLTA 2VXUH 4YFLI 1Q9OA 5D5MB 1MLCA 1TQCC 3QIWC 2ZOLA 2VR5A 4JY5L 1HHKA 2Y4SA 3DRQB 3L9RA 4HGWA 4P2RE 2OP4L 2FZ3A 4Y4HB 3UJJL 5D9SB 2QL1A 1QBMH 4OZFA 1ZLVH 2KDGA 3QIUC 1H5BA 3IXTB 5TPWH 3MOAL 3VFPA 2JK5A 1WCBB 3RX7A 1J0JA 4ZUWA 5FKPB 3QXAA 4S1QL 2NY7L 5DLMH 1NAMB 1A6ZA 1MCOH 2OL3L 5LQBH 1BVKB 1D5BB 2DDQL 4GRLD 4XVSL 3GMPA 4AT6A 2F58H 4PRHA 3T2NH 2X89D 1YJDC 4ENEC 2YD7A 3VGDA 4WI5A 6FABH 3VWJB 4M7KH 1A6TA 2CLRA 1Z3GH 5FO9A 1CD8A 2YA2A 1LP9A 3IVKB 1VACB 5HI3C 4N0YH 1ADQH 4HS6B 4HK3J 3I75B 1AR1C 5EZLB 5KSBF 4E0RB 1XZ0B 2XIDA 4X9IA 5C3LD 2DWDA 3P4MA 2V17H 4NQDA 5D2LB 5ID1A 2XN9D 1KOAA 5E8PB 4HH9A 3NFPA 4QRRA 3L95B 4WJ5B 1R5WB 3C6LB 3WXWL 4L4TE 3RA7H 1O0VA 3B9KD 1E4KC 4WFFD 2OQJB 4LEOA 3CC5A 2CUMA 4X7TA 4IM8A 3PHOA 3ARTA 5TQ2H 4TULL 4U1KA 1BD2A 1QZ1A 2EYTB 4JPKL 4F3FB 4Q6IA 4Y1AD 2BOBB 1NKRA 4ORGA 4NOFA 4G8EA 4N0CD 1IC7H 4NRXB 3R06B 1BIIA 4NC2B 1GZQA 2VITA 3MRJB 4NO0B 2VXTL 4ACPA 4MNHA 4P3DB 1JZ6A 4XC1H 5BV7B 1GVIA 3EYUH 1HYSD 1FYTD 1FNSL 4KJQC 4Y19B 3FO2A 3VMNA 5JHDA 5SV4A 4LVOB 4PJCB 3D6GA 1R3KB 3RHWF 3MYJA 1F3DH 3MROA 4RAUA 5GGVL 2WIIB 2YPKA 3L3IB 1OB1A 4HKBB 2F15A 1Y6KR 3RDTC 1G7MB 4AG4L 1BFVL 3KR3L 3NCJH 1WITA 4RDQG 4G5ZL 1AGCB 1JYWA 3N06B 1TJIH 3BKJH 1P7QB 1S7UB 1BVLA 1NCUA 4XBEL 3NCEB 5DQDL 5K9KB 4JRYB 5KAQF 3T09A 2YPLA 1EAPA 3TNMB 4MA3B 1IFHH 1NGZB 3G5VB 3AB0B 4XX1E 3EDFA 2OTWB 2R1XA 4H25A 3BGAA 1NBYA 1RHHA 1WEJH 4MA8H 1CK0L 2W92A 2GHWB 4M1GH 4CU7A 3VXMA 1CE1L 2W0KA 1IAIH 3PWPA 5IT2L 4I0PA 1HKLH 2BNRA 1MCWW 1DQJB 5CD3B 1KTRL 4IMLB 4LLQB 2UWEA 5CZKA 5JO5B 3RWDA 1T2XA 3FZUC 4TRPH 3DIFA 4YR6B 1EMTH 3EHBD 4X7SL 4XAWH 4XBGA 4Y4FD 3KHOA 1UXSB 1VEPA 1SJEB 3H9YA 4FFVC 3OR6B 3PWUB 1RK0A 2MMXA 4FZ8L 4S10A 4UT7H 3L5JA 4JO1L 2FJHB 5I6XC 3F7QA 5JMRA 1N6VA 5JORB 5HGHB 1J88A 4BJLA 1FPTL 3BYTA 3IDGA 2HJKA 1P7KB 2DQFB 3GMQB 4NFCA 1I8MA 5ISZB 1C5BL 3H9SE 2A9NH 1IAOB 1ZHBB 2Y25A 2G60L 4H1LG 3L3OB 4Z7OF 3BP7A 1DUYA 5A2FA 3BPLC 4P59L 1FL6B 3QYCA 3UMTA 3A6CH 4P2OC 2X10A 5F1NB 3TVMD 1OL0A 4YHPA 4OD1H 1OSPH 1XF4B 4Y5XA 2CMRL 4Z8FH 4FG6C 1RURH 3CXDL 2ADIB 4MXQD 5E6ID 2XTLA 1UZ6E 3NABL 4RQQA 5C07A 5CKAA 4RZCA 1DBBL 4NQEB 4E5XA 2X4NA 2F5BL 3LH2L 5J6GB 1QSED 1OPGH 1QPXA 2D03L 2DQDL 4HHAB 5C0JA 5C86A 1P9MA 3MRGA 3PABB 4WV1B 3D0LB 5DVLA 2GJJA 4MD4B 3RY6C 4MQXC 3HAEG 3EGSB 2QHRH 4I5BA 4JO4L 4GRWF 4WO4B 4Y2DB 4FQLH 4X9HA 3RTQB 1UQSB 1BOGB 2R0ZH 1UZ8B 5GXBB 4WHDA 4H8WH 3SDCC 1S5HA 4DFHA 1QOKA 5E8DH 3W11C 3CFDA 4PJ7F 5IQ9A 4EIZC 4R0LC 4O51B 4PRIB 2J3SA 4KDVA 4HIEA 3CSBA 3WS6C 4KUCD 3RGVA 1UM4H 5DUPL 2IQ9H 1NCBH 3A6OA 3LRSA 1YDPA 4IRJC 5MERA 1P84K 2YKLH 1YQVH 4YFEA 1QA9B 2BVTA 4RGNE 1MFBH 4OI7A 1WCQA 4S1SH 1ZKAA 2R2HA 4YHLL 2I25N 5GGQL 4FQIH 4MJIA 2ZZUT 2AI0L 5H94A 5H37H 3ZTJH 1X5ZA 4EN3A 2R56H 3MRQB 4ODHL 4LSTH 4PTUA 5DD6A 3VI3E 2GJ6D 1HHHA 1NCTA 1KTDA 1JRHL 2JCCF 1ZT7B 5D70L 4RISL 2AXGB 4L9DA 2R23A 1RK1A 3MXWL 2D7QA 5D1QB 3BQUD 2HFFA 3A0OA 5C09A 5KOMC 2IH3B 4LOUC 5DUMH 5IW1B 2IADB 2MCPL 2EEDA 4NDMB 4HPYH 5C0AB 5CHNA 2V2XA 2R4SH 4JR9H 4M5YH 3SDAA 1BWMA 4UIKL 5CEYA 4MNQB 1LO0H 4OJFH 4ELMA 4RGOH 3VGHA 4PLNC 1V3JA 2X4RA 5FK9B 1BM3L 2APTA 1OCWL 4L1DA 3G5ZB 4PG2C 3ULUC 1CLZL 5DVNA 1J5OH 4HFUH 1JHKH 1OT1A 4BQ8A 3AREB 4YEFA 1U8OA 2CUIA 1BEYH 1T2QH 4HZAA 4NCC2 5FYJL 3CZJA 3CMGA 3H3KA 3AS1A 1BOYA 3MV8A 4P46B 4BM7A 5DJAA 1F3JA 1FVDA 1P2CA 4S1RL 4XRCB 2XI9A 2UVFA 1KTLB 3QXVA 1GHFL 5IVXE 3BZEB 5F7DB 2FX7L 3D48R 3A67L 3G6DH 4JZOA 1NDMA 2R1YA 5FHAH 4OCYL 3ULUE 3HB3C 4MSWA 1ED3A 2E7MA 3IXAA 5T3ZH 2WBJB 1FNEA 2FATL 5GSVB 3HZYB 3KXFA 2LTQC 4HGMA 5EO9A 1J8HA 4ODSH 4QT5A 3JZ7A 1HNGA 4I3RH 3DSFH 4X6FA 5IIEA 3EJJX 3DHMA 4RA3A 4FFWD 1HCFX 4NN5B 4C4KO 3IYLW 4OTXL 1C1EL 1CBVH 3C60D 1HXYA 4Z7QE 2JIXB 4LPCA 4LSPL 1V5JA 4HW6A 3Q1SH 2EYSA 3I2CL 3KPNB 4G8FB 3DROA 4Z6AT 5T33H 1BFOB 3T1FA 3OJVC 2Y7QA 5GHWL 2AEWA 1YNKH 4HJJL 3TWCL 3NN8B 1ES0B 3QUKB 2FGWL 5JW4R 1GIGH 3DMMC 3GKZA 2ZUWA 1CGXA 4XCCL 1OW0C 3P30L 4BYHA 5JQHC 3GGWB 3HC4L 5ETUA 3BZDA 3FB8A 1DBJH 4JZNA 4PJ5A 3PGDB 5E0QA 4JZJB 5IKCB 1NAKL 2BDNH 4JLRB 3BT2L 1AXSA 3QXUA 1INDL 3MV7B 1OAZL 3S34L 3O81A 3JV4B 5GS3A 4KKAC 4X0KA 4LHUG 2VABA 3FAWA 1FCCA 2H2PC 4X5WB 5CINL 4EI5C 1J1OL 1NGQL 1S7RB 3C5SB 4P9HL 4F58H 1YZZA 1G0YR 3GB7B 4HK0A 1UWXH 1U93A 5C0RL 3PQYD 1KJ2H 1T4KB 4GAGL 4PV9B 1FVCB 3EYVA 4M8QA 5JNYA 3VGAC 1HSBA 4PJGF 2IH1A 5HVHB 3K4DA 4XHJD 5C08A 4QHMA 4N5EC 3D3VA 1RZIA 5F89A 3QNYB 3QPQC 1TENA 8CGTA 4XMLL 1J0KA 1AI1H 1FNAA 3QEQA 4NP4L 5F88B 1DVFB 3VGFA 2OTUB 1CD9B 1MFDL 1KN2H 3JV6A 5FGCB 3SY0A 4RAVA 3V8CA 1RUML 2DWEA 1KIUA 3PL6A 3AUVA 5DR5L 3QUMB 4PJAB 4TNWF 3DVGB 4DVRH 4K3EH 3FB7A 1ZSDB 1YPZF 3Q5TA 4H20L 2P5WD 1HILA 3FFCB 4QXTA 3WXVH 5IMOB 1T66C 4OQTA 1CWVA 3O45B 2O93L 4DQOH 3MLTA 3ARBC 3G6JE 2XTJE 1DL7H 2I9LB 2VDRL 2DQGL 5FGBC 2DS4A 2A6KB 4NBZB 3F7PC 2XRAH 3MRPB 1S7VB 2BSSA 3QIBC 4H0GA 3K74B 4P23C 1L7IL 4C56A 1B0WA 4XXCC 2X9WA 3NVQA 1IEAA 4WW2A 1SEBB 5FV2A 1U6AH 4JJHA 5J13B 4GKNA 1FNHA 4UT6L 1YA5A 1PG7L 3G08B 3B2VL 2Q7YA 3FOMB 3VJ6A 1PFCA 1XCTB 4WI3A 5C0BA 2QQKL 1FV1B 2NY5H 3BD5A 4N0UB 2NNAB 4BK5A 1AXTH 4YDVA 5HI5C 1JTOA 3MACH 3NPZB 3NZ8B 1RJYA 2CH8A 4F7EB 5TE7H 4HUVA 4UV4L 5KVDH 4W68A 4XP1L 3HNSH 3DUSB 3CLFH 3PV6B 5F21B 3SE3C 4UTAL 5E4EC 1G9NC 1UA6H 2BXYA 2BRQA 4M61B 1RZFH 5FB8B 1AGDA 3DPBA 4JY4A 2HT3C 1FAIL 1CYGA 1NCCH 4UINL 1PY9A 3BO8A 4JKLA 1ODAA 5ERWA 1ZS8B 3O6FA 4G42A 4L29B 4R6UA 4W4OA 4I2XA 4OLVL 4XCFH 4P2CG 5DMJB 1WISA 5IW6B 3W81A 4DTGL 4OGAC 4QOKE 4GG8A 2NYYD 5D7SL 3PUCA 4MD0A 3ARGA 1JE6A 3GSUB 1NUDA 3OKOB 1PKOA 3LKQA 1DBAL 3SJVE 5D6DC 2HWZL 1AFVL 5HHOA 1N6QL 1EO7A 2PYEA 4XB7A 4R4BB 3D0VA 2XNAA 3FO1B 1A6WL 4CMHB 1JRHI 2NXZB 3T0AA 1ZVHA 1LDPH 5IEKB 3IFLL 4LRIA 3K0WA 5IGXH 1DQMH 1I3GL 1W0YT 3PIQA 4PJDA 2FWOB 4D94A 3T3MF 4PJIF 3QI9D 1ZGLB 4PJHA 4YFDB 1XGUA 4NKMB 1FZOB 2AV7A 3LKRA 4DEPC 4P99A 3MA7A 3RVWC 3KLAB 1N5YL 3LKNA 1S8DA 1OP3K 4YHIB 3HNTL 4AQOA 3VFTB 4EDWH 3VXUA 4DKEH 1EUUA 5I1LB 4PP1D 5L2KE 1A5FL 1LK3L 3RVXC 4NNPH 1QFUL 4MS8D 2RAMA 3TLRA 5MENA 3OB0H 4YHML 3LPWA 1L6XA 3PJSB 3HKFA 3QDMD 2CLVB 1XFPA 3ARWA 4MD5B 4UT9L 5CS7A 4RX4D 2UUDK 4WWKD 4KUCF 5EU4B 3DHJA 3TYGL 4ZOEA 3IFNL 1DQLL 5DRWB 4RIRA 1W72L 5D7LD 5J56B 3FKUS 1FZMB 1IL1A 1LK2B 1WFOA 4R7DA 5GGTA 5T5FL 2YD9A 4WTWA 3C2SA 1HH9A 3GI8H 3LN9A 4F37K 5HHXH 4LQ1A 2FO1A 3K8MA 1JN6A 3UTSD 3NPSB 3WFEL 5FF6B 2YUXA 4LASH 5CBEA 4W81A 5INDB 3TA3D 3D69A 5IMMA 2AEPL 4W70A 4HWBL 5E8EA 4OM1L 1A02N 4OSUH 4YDKL 1EEYB 4CU8A 3EJYC 3I6GB 1F2QA 2FBJL 3KPSA 2YPLD 4FQQA 2BXZA 1RIUL 5ABDE 2JJWA 4LQFL 2QV2A 2OL3B 2Z91A 4L8DA 5FM5O 3FHQA 1T21A 1S78D 3CSYB 1PYWA 3PWPD 3L7FB 4PJXB 5ELIA 3KPPA 5IMLA 4NO5B 2GK0B 2HKHH 2F8XC 4GS7B 4OQTH 5D7IA 4OFVA 1C16A 2PTTA 4Y5VA 1G0XA 2BCKB 5C7XH 4Z7UA 2NR6D 3SQBA 2C3VA 4N90E 4GUPA 5JQ6H 1HHIA 3PWJA 2HTKC 2PW1B 5GRXG 4NM8H 3OKKA 1DCLA 1F8TH 3HE6A 5GGSB 3Q5OA 4BQ6A 4DVBA 2Y06H 2Y72A 3R4DA 2XA8L 1BBDH 1M7DB 1HZHH 4JG1H 4KRPD 5TQ0L 1A7NH 3EJZD 3QDGE 1OTSD 5D5MA 3U9PL 2FECL 1TXKA 3DRQA 3UC0L 3O6LH 2RGSA 5CILH 4LNVA 3C9NB 3MRBB 4NQCD 1J0ZA 3T0EB 4Y4HA 5T1KB 5D9SA 4MA1B 4IOIB 4DZ8B 3IXTA 5K93A 4Q9CA 1DLHB 2CQVA 5D7JD 1R3JB 1CQKA 3C09B 5DTFB 4A2MA 5TE4H 3MODL 4NN7B 3QNXB 2R0KH 5FKPA 4ZFOL 4POZC 1NAMA 4HAGA 1BVKA 1D5BA 3MCG1 4JFQB 3TVMC 4NUJB 4KQ4L 1JGLL 1A9BB 3VWJA 3OXSB 2VDKH 4QRPE 4JPIB 2FL5B 4MXQC 3LEVL 5E6IC 4PJEF 2DMCA 5JW3H 3IVKA 1VACA 5IB1B 1I1CA 5F7YC 1YQ2A 4HS6A 4MZ3A 2BHZA 3I75A 1DQTA 5EZLA 5ACLA 4E0RA 2EEBA 5EWIL 1LO4H 1XZ0A 1JGVH 4HLJA 2WZPD 3OKNB 3S36L 2C3WA 3OQ3B 1VFOA 5D2LA 4FS0A 5E8PA 4NZTH 5M7QA 5JIKA 3LS4H 3CAFA 3RGVD 3L95A 4WJ5A 4CUCA 1R5WA 1NGPL 3C6LA 3HFMH 5FUOL 4YAQB 5C0IB 4LVHB 2Q20A 2OQJA 4M3JA 4DOHB 2E7LC 2EYTA 5EU3B 3T8XB 3QUXB 4F3FA 4PBVC 4MJID 3RZCC 1NC2B 3ZTNL 3FHAA 4L3CB 2BOBA 4LKXB 2CGRH 3IF1B 2BRRL 4X98B 1A0QL 1ZANL 4WFHD 4NRXA 3R06A 1QBBA 4H26B 1QFOA 3FB5B 3MRJA 4NO0A 5C09D 3ILPB 4Z7NE 2E9IA 2WANA 4P3DA 5AYUL 3GBML 1N2RB 1RUQL 4PGZA 2ICWI 4GSDL 5A3ID 3WFZA 4Y19A 4UQ2B 4PJCA 2CLZB 1MCPL 1R3KA 2P7TB 1CGTA 3SDAD 4KVCH 2WIIA 3L3IA 3VXSB 3G6AB 4J4PA 4M43L 3UX9B 4HKBA 3U2SB 1G7MA 1NEUA 4ZPTB 1MH5B 1WFUA 5A43C 3QR2A 3TZVC 2LU7A 3WFDH 1LO5B 1MAMH 1QSVA 4HMDA 1AGCA 4YXHH 4LCCC 4ZFZB 1ROWA 4R4FH 4Z7VB 3S37H 1P7QA 3BDYL 1S7UA 5K9KA 4DKFH 4JRYA 1H3PL 5J06A 4ZAKB 3TNMA 4MA3A 4NQUA 1NGZA 3G5VA 2OI9B 2OTWA 3VGGA 2P44B 5D1XB 1A6VL 2CRYA 4X5XB 1NDGA 4XC3L 1DSFL 1T04B 1BZ9B 5H37G 3MRCB 3MV8D 2QADB 3D5OF 3ULVD 4F7PB 4LSUL 5I1DB 1DQJA 5CD3A 4JFDE 4IMLA 4LLQA 4U7MA 5JO5A 5FIEA 4YR6A 3HC3H 1D9KC 1UXSA 3Q0HA 4TVSa 4B7LA 1SJEA 3OR6A 2I27N 2DL2A 3PWUA 1HEZB 4PB9L 5HHMB 1ZLUK 2FJHA 1UEMA 1BZ7B 2B4CL 5JORA 5HGHA 5JHLH 2X70B 3AS2A 43CAB 1P7KA 2DQFA 3RNQB 3GMQA 2V9QA 2ZUVA 4P4KB 5CD5D 1M7IB 3ROLB 4X6DB 3NAAH 4R9HA 5ISZA 1IAOA 1ZHBA 5FXCH 4RWHA 3CFKB 3OX8B 3L3OA 1FFRA 5EUOE 1FL6A 3KPRD 4FP8H 5EA0L 5I8KL 5F1NA 2Z35B 2QEJA 4CBPA 1CU4L 1Q0XH 1XF4A 4XNUH 2VLKE 2NQCA 1BQSA 5DUBB 5HI4D 5ADOH 2ADIA 5EIQA 1XR9B 2DQUH 5C6WH 4LSSL 4NQEA 1U3YA 1GC1L 4FFWC 5J6GA 4YGVB 4HHAA 3PABA 4NNYB 4RMUA 3D0LA 4WV1A 1C7TA 2EIZB 2FLBT 4MD4A 2DD8H 3EGSA 4QO1A 3C60C 4WO4A 4Y2DA 3RTQA 5GRUL 1UQSA 1BOGA 4OZ4B 4PJ5D 4AJ0A 1UZ8A 2NY4C 1XGQB 1DP0A 4G6JL 4FABL 3LPFA 1SYVB 2HKFL 3ELAT 3DTXB 2ADFH 5JUEH 3QUYD 3V4VH 4EEEA 4XPHH 1PZ5B 4O2EB 4O51A 4KI5D 4PRIA 3UPAA 4JFYB 4XTRD 2E9WA 4JPVH 3N50A 4S11A 3SDDD 2W91A 3BZ4B 4CVUA 5GJTL 5DC9B 1D5IL 1IGJB 5C08D 3D3VD 2GYSA 5A2JH 4AL8L 3MLSL 1QA9A 1W8NA 1Q94B 5KSAB 3QEQD 3QXTA 2FEDC 5J6HB 5E08L 1NANH 1T0PB 1YYLL 3DYMA 5TDNB 3KYMB 1MUJA 3MRQA 1S9KC 5SX4H 2DKMA 1R3HB 1A7QL 4XHJC 1L4IA 1U91B 3FMGH 1ZT7A 4Q0XH 5CZVH 5DK0B 3QFDB 2AXGA 4I9WE 4LDLB 5DFVC 2AAVA 3B4NA 2FECI 4G6AD 3X11B 5D1QA 1FGVL 5DHVH 4M7JH 2IH3A 5BRZB 1WWWX 5IUSA 2OXHA 2V9RA 2XWJB 4PLKC 5IW1A 2IADA 4Q58C 1I9EA 2I60H 35C8H 4FQXB 3HE7C 2BVEA 3QUZC 4NDMA 5C0AA 1KIRB 3SJVD 4XT1C 1H3WM 4JDTH 4AEFA 3GBNH 3CH8A 4MNQA 1MFAL 3LPGA 1SHMA 2HLFD 4NT6B 4G3YL 2VXQL 2XY1A 3WE6B 5JXEC 4P5MB 4LEXH 5F7UA 5FK9A 5BV7H 5JOPD 4Z78B 2FX9L 3G5ZA 2MNUA 1DANT 4AEEA 1G7HB 1QFHA 4Y8DC 1WK0A 3AREA 3WIIH 2VL4A 2ZCLL 4JFZL 5J12B 2OS7A 3GRWA 1L0XA 3TBSB 1YMHB 3BUTA 1IGMH 4P46A 5DFTA 3WNLA 1E4XL 1WZKA 1IGCH 4QHNB 4XRCA 1DANU 2EDWA 4GOSA 1V7NL 2WK2A 4MHHG 1KTLA 1QRKA 5KVEL 3BZEA 5F7DA 2N7AA 3WHXB 3MJ9L 2J8UF 2K1MA 5CJXA 3O6FD 3VW3L 5DYOB 2DTMH 2WBJA 5GSVA 3HZYA 4P3CL 1WGOA 4AIXA 1VGKB 4ALAH 5AAWA 4KHTH 4UQ3B 2VOTA 4IRZH 4J3TA 5L7XH 2X9XA 3FTGA 5AG8A 4KK5C 3QXWA 2Y36L 3HS0B 1H5BC 2PYED 5A2KH 3K7UA 4FOMA 1NCDH 4JHBA 1JF6A 4WY7H 1JPFB 2P8LB 3VFOB 5F9OL 1ZLSH 3U0TB 4K3HA 3BSZH 1D6EB 5E1HB 3HR5B 2JIXA 3X13B 3V0VB 3QCTH 1AHWB 4CDGC 3KPNA 4G8FA 3KYKH 2DKSA 4NIKB 4XWGH 1BFOA 4JHZA 5C71A 4OLXH 3ZKSD 2VLRD 4QXUL 1WF5A 1ES0A 2JE8A 3NN8A 3QUKA 4LCWB 3TT1L 2DIBA 2OLDA 3O8XB 2BZDA 4NCC1 3GGWA 1FORH 1CZ8L 5DA0B 4OB5H 3DRTB 3E6FA 5EC2B 3ZE1F 1UWEL 3VXUD 1G7IB 4OQ1A 3BE1H 3PGDA 4JZJA 5IKCA 5HYQB 4U33A 1RJZB 2R0LH 4JLRA 3F6IA 1GGYA 2BSED 3HN3A 3MV7A 3EO0B 3JV4A 1W0WB 2L7JA 2DQTH 4N90D 4C57C 4X5WA 3SCMD 3F7YB 4EBQH 1OARH 1S7RA 3C5SA 3KG5A 4HIXH 3MBED 3GB7A 4PRHE 5B4MD 5IROA 1BREA 1LQSR 1T4KA 4PV9A 1EGJH 1FVCA 1F4XH 1KLUB 4JHAL 5JA8B 3VE0B 3DGCR 4NHCH 3KDMB 1LP9E 3U79A 4MS8C 3V8OA 5KTEL 3QNYA 4Q6IC 2EDYA 2NXYD 4L9LB 5IBLC 3QDGD 1J12A 5F88A 1DVFA 3B5HA 4U3HA 2OTUA 3RX8A 1JZ4A 4NQDE 4KY1H 1MFEH 1OAUL 2P43B 3IT8D 3QUMA 4PJAA 4QRRE 4HJGB 3DVGA 1ZSDA 3HG1B 4RFNC 1ZLUH 4G7VL 4RWYH 3BEWB 5DZLA 3FFCA 5I8OL 5IMOA 3O45A 2XZZA 5J1TC 2EYRB 3UTTE 2I9LA 1UM6H 1BD2E 4ZNEA 1IM3B 1F4HA 3TO4D 2OM5A 2A6KA 2VE6B 4HXBH 4EKXA 5KZCD 3MRPA 1S7VA 5CEXB 4OLYH 1MF2L 2BSRB 3EOTL 5T1DH 1UKTA 5EOQH 2PN5A 5CSBA 3ARYA 1SBBA 2VLJD 4V1DE 2R29L 4ELMF 1SEBA 1Q9KB 3OPZL 1W2KT 3LVEA 3ALXA 2B0SH 2YHGA 4NBYB 4FA8A 3G08A 3K8KA 2IANB 3FOMA 4YDLB 1XCTA 3L5XH 2HVKB 4IDLA 4J1UB 1FV1A 3UEZA 5J3HC 4N0UA 2NNAA 5LAXB 4I0PC 3FT4B 3NZ8A 2XZCL 3WIHH 4F7EA 5EG6C 4Y5YB 2CK0L 2NR6C 3DUSA 3ULVF 2NY0B 3WN5B 3PV6A 3TJEL 5J7CC 1DE4B 4M61A 3N9GH 1B6UA 4F8TA 3MBXL 5FB8A 2YEZB 2J4WH 1A21A 1RZKC 4P2QD 4GRWB 4OZGE 1ZS8A 2JTDA 4L29A 4KRPC 1KIQB 5EZOH 2CKBH 2W59A 1LE9B 4U7SA 1X5AA 1SMAA 3O3EB 5T3ZE 3VXME 5E9DB 5IW6A 3EYQC 1S5IL 2FX8L 4LSRH 5HGAB 2BNRE 2FD6H 3O11B 1JWMB 2X44D 3GSUA 5TF1L 3KLDA 2UWEE 2J5LC 3OKOA 3QJHB 4PS4H 4WI6A 5I1HL 1JWSB 1W72B 3ARSA 4Y5XC 1URLA 4R4BA 1T6VN 4FQJL 3VWJD 3FO1A 4FQCH 4YGAB 1KC5H 5IEKA 4MJ5B 1AE6H 1KXTB 3OAZH 4NQSB 4OT1H 4HWNA 3MLUL 2FWOA 5MHSD 1P9MC 2XG5A 4YDIH 1NGXB 1ZGLA 2FIRT 2IFFL 2UYLB 3WJJA 1JGEB 4XP5H 5DD5H 5HGGS 4NKMA 1FZOA 3FQNB 5IESH 1CL7I 2NY6D 1F00I 3KLAA 2HRPL 2F8OA 4JY6B 3I6LE 1UM5L 2JCCB 2EKJA 4YHIA 5FO7B 4GKSB 3VFTA 1QFWL 2WM0A 2PTVA 5I1LA 3AMLA 3E8UL 4O5LH 3JWDH 4OKVB 5JDSB 2DMBA 2FJGB 5C07E 3IJSB 3PJSA 3RGVC 2CLVA 4KI5F 4MD5A 4K3GA 3U1SL 5GS0L 1E4XI 5IB3B 5DRXB 3RBGA 4NO0D 5EU4A 3GUTB 4UTBL 1BMGA 3V0AC 4LRNH 5DRWA 4K8RH 4R26L 4RMSA 3S88L 4HUMB 1OLLA 1JP5A 3QDHA 4EN3C 2D7TH 4HZLB 3S3SA 1FZMA 5I73B 1LK2A 1YEIL 5IFJB 5B3NA 2AJZB 4EUPB 1NLBL 4PJBE 3ES6B 4J4PD 5IVZB 5GGSY 5FF6A 5K9QI 5INDA 3QEGL 4HPOL 5DD0H 1TQBC 3X3GL 3ZL4H 4ZXBB 1RZ7L 5JW5B 1AO7B 1EEYA 1PBYA 5LWYL 1WV7T 3I6GA 2AJXH 1IGIL 4G6FB 1HHGB 1ZVSB 1P7QD 1WZLA 2AQ2A 2NY5C 3VG0H 3LQMA 3MOQA 4JRYD 2AQ1A 4NQVB 4ZFOB 2DQHL 3SDAC 2VKWA 1DDHB 4DW2H 2RHEA 4Q2ZB 4F8QA 2BNQB 2OL3A 3BJLA 4X7EC 1FZKB 4JFXB 2DLHA 4PBXA 2XWTB 3HI6H 2XKNB 3ZE2F 3CSYA 1RHFA 2C1OB 3BWAB 1TETH 3C08H 3L7FA 4PJXA 4YQXH 4YXLL 4Y7MA 3DVNB 4NO5A 4KK6D 2GK0A 2PO6B 4M00A 3IDXH 3DJ9A 1MAKA 1S9WB 4L3AA 2BCKA 5DEFB 4NO3B 4XP6L 5HVFB 1UG9A 2PW1A 3GO1L 4PRPE 5GGSA 3V4UH 3WFCL 2OSLB 3ULVC 3SBWA 3BRFA 4BFGA 2HP4A 1M7DA 5F1SA 1CFBA 2WWKO 1RQ5A 3QDJB 1U8NB 5GGVY 2APWA 4HDIB 1I9RL 3EW3B 1FIEA 4L8CB 1TIUA 1I9JH 2DM2A 2ZG2A 1QACA 4GRLB 3C9NA 3MRBA 3O2VH 3T0EA 2VR9A 5T1KA 1NMBL 3H9ZA 1GGIH 4CL7A 4IOIA 3M45A 5E99L 1R5VB 3LKSB 3UDWA 4DZ8A 4YUEL 2PUQT 1JI1A 3VFRB 5K33A 1N7ML 1YUHB 1DLHA 2A1WL 1X4XA 3PP3K 2CR3A 3WD5L 1R3JA 4TVPH 1PLGL 5DTFA 2H9GB 5CD5C 2ADJB 5ITBH 3QNXA 2FDBP 2EDXA 5CJOL 4HC1H 3I3BA 1MRFH 3DLQR 3EFFB 4ONOA 1OGAB 1UCTA 1GL4B 4KGJA 4DJMA 2COQA 4JFQA 4NUJA 2XN9B 4ODVH 3WCYA 2WP3O 4K3JH 1V7MH 4X7CC 1A9BA 3OXSA 5HI4C 2RB8A 3GSWB 3B9KB 4JPIA 2FL5A 5DZNA 1RD6A 1HDMB 3KXFE 1CXLA 2VMFA 4L5FH 3KPTA 4KZDH 1JVKA 1BBJB 1IAKB 5IB1A 1J8HE 2AJSH 2DMKA 1UYWL 3KJ4B 1IAMA 1N26A 2YOCA 3OKNA 1T6WA 3WSQL 4HG4J 1YEKL 4PJHF 2B8OT 4PRID 4Y1AB 4AIZB 1L7TL 2E7HA 5EH1A 4GAYB 1PEZA 1DUZB 3QFJE 1S9XB 1MJ8L 5TFSL 5C0IA 4YAQA 4JJ5B 4U0RB 4N9GB 3CVIH 4KVNH 1FYTB 2VZOA 4KROC 1LEIB 5EU3A 3T8XA 3FN0L 3QUXA 4K94H 4XTRC 4XCEB 1NC2A 4OLZH 4L3CA 3W0WB 4LKXA 1JHTB 3IF1A 2PTUA 4X98A 3BX7C 4ODTL 3QEHB 4K3DL 4H26A 3FB5A 1N5AB 5D1QD 3ILPA 5E7FA 5HDBE 3RWHB 1N2RA 3K8LA 3OAUH 1BAFH 3EDDA 5EBGA 4O4YL 1OTUC 3QZWB 2X40A 4UQ2A 3PL6C 5AZEL 2CLZA 3L7EA 1RMFH 2P7TA 1LNUB 4M48H 2A74B 3BYYA 2J7LA 3RJQB 2UY7A 1AKJD 4Z0BL 3VXSA 2K7QA 3G6AA 1J1XL 4LFHG 2FB4H 4MNQD 2QQNH 1TZHB 3TV3L 2AS5M 4G6KH 3U2SA 4L4VD 4XZUB 4ZPTA 1MH5A 3O4LE 5I74B 5C2BL 2MCG1 5K9OB 4HQQH 1LO5A 5EBWB 4TUOB 5DMIH 4X6CF 3RVUD 1PGRB 4ZFZA 4Z7VA 3UCRA 4Y4FB 1KGCE 2IG2H 4ZAKA 1A7RL 1QKZL 4FFZL 4UNUA 5D1XA 3RL1B 4FHBD 4X5XA 3U0WH 2HLFC 4WW2C 1T04A 1BZ9A 1H8NA 3TFKC 3MRCA 2CKNA 3VCLB 4KC3B 4F7PA 3MOAH 3QRGL 1FLRH 1MIMH 4PPTA 2XOTA 5I1DA 1FFQA 1AGFB 4YH6A 4UAOC 1G9MC 4S1QH 4WIQA 3S5LB 4Z7UF 1ZHKB 4C59B 2OL3H 3HMXH 3U7YH 1CD0A 2FHCA 3S7GA 1KCVH 3GHBL 3ARRA 1HEZA 1A1NB 2W9DH 2ZSWB 4P0DA 1K6QL 1SY6H 1QFWI 1BZ7A 1CDGA 2X70A 4PYHA 1PSKH 43CAA 3RNQA 5BVPL 1MJ7L 4P4KA 3EDKA 4MLSA 1M7IA 3ROLA 4X6DA 5IFAL 3NIFF 5J0BA 5D5MF 1KELH 4BFBD 3VGEA 2FSEB 2XV6B 5LGHL 1MCRA 3O6FC 3KPQB 3CFKA 2VXVL 3OX8A 1X5XA 4OCLC 4W4OC 4Z7WE 3NFNB 4NO2B 5C0BE 1UKQA 3OHXB 1GPOL 2Z35A 1JV5B 4PV8B 5I76B 1EK3A 2AJYH 3P9WB 4F37F 3ARGC 5I0DA 2ZG3A 4OCWH 5DUBA 1V8HA 4XBPB 2JIXD 3GKWL 2MHAB 3U4BL 1OAYL 5ICXB 2RFXB 1XR9A 2VLME 5BW7A 1F13A 1WC7B 1WSST 4NN6C 3JUYA 4YGVA 2VERN 1R5IB 2UV3A 4NNYA 3X17A 2EIZA 3UPRB 3GNML 3WNOA 4LRIC 2X9YA 2VQ1B 3BKMH 4LIQH 1U95B 4OZ4A 4OFDA 2ATKB 4F7MB 4WUKH 1XGQA 5E56A 5E2UL 2YD4A 2UZYB 1SYVA 3NZHL 1X5IA 4PRNB 4OIIH 3DTXA 5DO2D 3SE8L 3NCYS 1CGSH 4HXAL 1PX3A 1PZ5A 4O2EA 1ZLWH 3ZKND 2V5TA 4KHXH 2MPAL 4JVPA 5HHOE 2X09A 3MRMB 4JFYA 5D2LF 2NZIA 4TQEH 5CBAB 5E8NB 3BZ4A 1XH3B 1EXUB 4OD2B 3U7AA 3O9WB 4YHKH 1E28B 4WWID 4DAGH 1IGJA 3BQUB 2XXMB 5K9JH 2F19H 4U05A 4PJDE 4GMTH 1Q94A 5KSAA 3HRZB 1KCUL 3MLZL 1UB6B 4G5ZH 5J6HA 4OGZA 5HDLA 4QNPE 5DQDH 5TDNA 3KYMA 1R6VA 3SO3B 2SEBB 1S9YB 4XVTH 1R3HA 4AEIL 4BH7B 1FNLA 1U91A 5I16B 1CK0H 2MQCA 3ZZ1A 1ACZA 5DK0A 1Z9LA 3QFDA 3S35X 2NXYC 4JVUA 3IKKA 5JIHA 2BJML 1QP1A 3X11A 2BY3A 3WNPA 1PEWA 1CDCA 3LEXB 2ZCHH 5BRZA 1TPXB 2XWJA 4JKPH 5EZIH 2Q6WB 3SDXB 4FQXA 3KWWB 4PJCF 2C3HA 1OLZA 4D0DB 4XVJL 1KIRA 1K8DB 1RUAL 3MLYH 1HIML 4DZBB 1J87A 4LMQE 4ODWB 1JBJA 1QRNE 1CFTB 1ZA6B 4NT6A 5J57B 1NMCB 3EFDL 3WE6A 4P5MA 2CK2A 1YC7A 4Z78A 4KQ3L 1P4BL 3MFGB 3VI4F 1QSZA 1FPTH 3LQAL 3U83A 1G7HA 3WYRA 25C8H 1ORQB 1C5BH 3GZKA 2G60H 4KMTH 1C5CH 5F9WC 3TBSA 1YMHA 4P59H 4Y5VC 1IC1A 3QHZL 3KGRA 1XF3B 4QHNA 3D9AL 2CMRH 1F90H 1AY1L 5FYJU 3HE6C 3KPSE 3WHXA 5DF0A 1DBBH 4K9EL 1OGTB 2EH8L 1IGFH 2YWYA 4KJWD 4UDUB 1IKFL 4PUBH 5IV2B 3CK0L 1VFBB 1AQKL 1VGKA 3SGKA 1GRWA 4UQ3A 1ZGLP 3CJJA 5D7IE 3ZKXB 4Y4HC 3GBLA 1CE6B 3OJ2C 3UPCA 3HS0A 2HT2D 4UI2A 4QGTA 2ORBH 2CO7B 1JPFA 4D9LL 2ZWLT 5F72S 3BISA 2P8LA 3VFOA 3HUJF 4W6XB 1GGCL 5GISH 1UACL 1EAJA 2CIIB 3IU4L 2VTFA 3U0TA 1WZ1H 1D6EA 2VDMH 3HR5A 4AEHL 3MA9H 3X13A 1C5DB 1OAXL 5I1CL 2Q87A 3KHQA 3V0VA 1AHWA 2DI7A 3LHPH 2A0LC 5GJSL 1NCAL 1GGTA 5IQ7H 5TDOB 4R2GD 1F4AA 3PF2A 4GT7A 4JRXE 3UJIL 3VWJC 3ZYIA 4O58L 3FT3B 5GGQH 4LCWA 3GSNH 4QHKJ 3O8XA 3BKCH 1DJSA 2XKUA 3DRTA 2EXYC 3P0VH 5EC2A 1G7IA 1C12B 5INCB 4JDVB 5HYQA 5JW4Q 5DRNB 1RJZA 2K3TA 1MQKH 4HIIB 3RFZC 4OGYL 3DV6B 1RFDL 1T7ZA 3EO0A 3I9GL 1W0WA 2A6JB 4QRQB 3LV3B 2X7LB 3DARA 3C6LC 3LIZL 3KJ6L 2OR9L 4P2RB 3T1WA 3FT2B 4U1HB 4PRPD 1KLUA 3K1DA 5D71L 5I1JH 3VE0A 5T5NF 5FYLH 3KDMA 5GS1B 3FOLB 2X4PB 2NY2B 1MIEH 4L9LA 3QBTB 5CP7B 3MGTB 2DQIH 4JM2D 5KVFL 5LJYH 3DECA 4O2CB 1EEZB 3CDYA 4HJGA 4JRWA 2WIMA 3HG1A 1NBZB 5FYJH 5BV7C 3P3YA 3TM6A 5AZ2H 3BEWA 5GRJL 3T2PA 1F4WH 5EBMB 1CVSC 5ICYB 4Q9QL 4LVOC 2EYRA 3PP4L 1IM3A 1B0GB 4J4PC 1J86A 2VE6A 1GHFH 5CEZH 4L3EE 4XWOC 4FXGA 3V7MA 4JM4L