4R26H

Crystal structure of human fab pgt124, a broadly neutralizing and potent hiv-1 neutralizing antibody
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
231
structure length
226
Chain Sequence
VQLQESGPGLVRPSETLSVTCIVSGGSISNYYWTWIRQSPGKGLEWIGYISDRETTTYNPSLNSRAVISRDTSKNQLSLQLRSVTTADTAIYFCATARRGQRIYGVVSFGEFFYYYYMDVWGKGTAVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PGR124-Light Chain
publication title Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
pubmed doi rcsb
source organism Nomascus leucogenys
total genus 40
structure length 226
sequence length 231
ec nomenclature
pdb deposition date 2014-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r26H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r26H01
3QIBB 1OAYL 3HG1E 2AJ3B 1B4JL 2ADGB 1CI5A 4JFDA 2YS4A 5GS0C 4FTVD 5DK0B 3FZUD 3L3KB 4ZOAA 3MACH 1H15A 5E9DD 3DVFA 4JDZA 4HH9B 4MA8H 1S9WB 4GG8A 4YGVA 5IW3A 1D5IL 2LAGB 1RQ5A 4W4OA 3WNOA 4NBYB 1NGZA 1T2XA 4F58L 1S9VB 1F90L 3L7FA 5EG6C 4WFED 3MJ7A 2J8UE 3MLVH 5L2JB 1FBIH 1CFVL 5IVXA 4QRTA 3DETD 4XPTL 4E5XA 5CIPB 4Y5YB 5C09B 4KVNL 4OZFG 1X5FA 4X8JB 2UUDK 1XF5A 4ZPVA 3VXMB 1IC7L 4ZXBB 4IEFB 3VFWB 1N3NB 3QEUB 5M94B 4G6AC 4NFCA 5FO8B 3NCYP 1NKOA 4Q6IA 3T8XA 4DUVA 3IXAB 5E00A 4DQOH 1QACA 3JUYA 3MLTA 3UTSA 15C8L 5E6YA 4U6YA 1VPOH 5C08A 4Z7OF 4Z78B 1F4WH 2FX9L 3WFEH 4IDLA 1PVHA 3KPSE 5SWZA 4HS3A 2GEEA 5EO9A 3UTPE 3KNBB 1LE9A 3TYGL 4HT1H 1IEAA 1U8QA 2ITDB 5F9WC 5HDBF 1TMCB 1YQ2A 2YD6A 1F3DH 1WTLA 3CDGA 3QUZB 3QISA 3TF7C 3PWPA 2DQGH 4YAQB 4LSQL 1MFEH 3GKWL 3EDDA 3EYVA 1T04B 4YEEA 2O26U 4OGAC 1PQZB 1JI1A 4OFIA 2G60L 4NQDB 1CGUA 3FB6A 1SEQH 5KS9E 3MRHB 4BUGA 2EEAA 2JE8A 4IRZL 4NFDA 2DDQL 4YBHA 2ICEA 4WTWA 4F9LA 2P46B 3GK8H 3KLHC 4JRXE 1HYRC 3SDDA 4RGNE 4P4RA 1KIQA 1QSEB 1HXMA 2B4CL 4YPJA 4HF5L 1URLA 3JWOH 4C54A 2HH0L 4CMMA 5HYJD 1T20B 4QHKI 5JIKA 5GGUA 2G5BA 4GRLA 3HNTL 2IBZY 4QXTA 2X4UB 4LAJH 3ARFA 4F7PB 4ZQKA 3QI9D 3ARVA 3I6LD 4G43B 4LSTH 1A5FL 2PO6C 5CZKA 1DE4A 4LSSH 3D39E 1FFPA 3L95B 2DTMH 4UUJA 1PG7H 4MS8D 3S97C 5J4MA 2OR9L 2C3WA 3BWAB 3GMOB 4F3FB 1I8MA 3TO2A 5DRNB 3P0YL 3MJ9A 2LTQC 1SYSB 5D71L 3RWJA 2B1HL 1K2DA 5I0ZA 1BLNB 5EN2A 1QFWL 5I8EA 4PRAB 5LAXA 7FABH 2DLFH 3OKLA 2P8MA 3T2NL 3PHQA 3RNQA 4QF1A 1ORQB 4KXZI 4GAGL 5FKPB 1IGMH 4Z5RA 3CFCH 3HE7D 1VEMA 4M8VA 5DVKA 1OP5K 2EXWD 1DUZB 4XCCL 5JA9A 4P46B 4KKBD 1X5XA 5GGTH 3U0TB 3ZDYF 1HWHB 1PEZA 5GRUL 4JM4H 4GBXB 2FGWH 4MZ3A 1YJDH 5F71A 3RKPA 1L7IH 3WNPA 4C56D 1XIWA 1OSPH 3VG9B 2ORBH 4GQ9L 4IJ3B 1YN7A 3IFLH 1JIBA 2YPLD 1HQ4A 2AJXH 4W4OC 5D96C 1QFOA 5E7FA 1QLRA 4QYOA 32C2A 5AG9A 3X17A 5CHNB 3UPAA 1BQLH 5J9PA 1MJUH 1R3HA 1H3PL 4KVCL 4YHOH 4PJIF 1PFCA 1EMTH 1QRKA 4Z76A 1D5BA 2OTUA 1BZ9A 4X98B 2P7TA 4QGYA 3P40A 1KT2A 5DURD 3PGFH 4E41E 4K7FA 2ATPA 1JMZA 5HYEA 1MWAL 4BSWB 2BCKB 1OGAE 2J3SA 2ERJC 3RL2A 1LP9E 2VZTA 1I9RL 4Q6IC 4X4MA 4LCWD 1F3JA 3I75A 1Q1JH 4A2LA 2F8OA 4E41A 5I1CH 1FLRL 1O7SA 1RK1B 3VWJB 4TSAL 3BXNA 1AGDA 1CXKA 1CICC 1LEKB 3DECA 5DQ9B 1Q0YL 3G6DH 2UWEA 4X5LA 1NAKH 2O5YL 2NYYC 4LQ1A 4UNUA 4RMTA 1OAZH 5IGXL 2W0KA 3R1GL 1UEYA 5FHBL 1KC5L 1Q0XH 4K8RH 5HVWA 4PJBE 1KB5A 4XP9L 4UU9A 1MWAA 2R2HA 1VGEH 4F7CB 5BJTB 4R97B 1CXLA 4YXHL 1MLCB 4JFXA 4JREB 5LGHH 2AJ3A 2ADGA 2Q86A 3O4LE 5CGYC 4JM2A 3L3KA 4OLVH 4JN2B 1SVZA 5HYFA 2RBLA 5GRVL 5SX5H 3X13A 5FECB 2X4RA 3BUTA 4MD5A 1ZHLB 4WO4B 3SDDC 1VEOA 3HCVB 1BAFL 5C09E 4QRQA 3H3KA 4AENB 2Z93B 4XBEH 4CADA 5JW4M 5D9SB 3VXME 2RIKA 3IRPX 5L2JA 5HHXL 5IG7A 3IDXL 4LLWB 1P4IL 3ARFC 4WUKL 5CIPA 3KVQA 3P9WB 1NMAL 4X8JA 4DCQA 1YEKL 3ARPA 1I85A 2A77H 5C0AD 4XAWH 2YHGA 3L1OH 4ZXBA 1FORL 5KZCD 1B90A 3BE1H 2XTJD 4RWYH 4M43H 2BHYA 1JI2A 1OCWL 3U9PH 1WBYA 1F00I 3ZE1E 2X10A 4GMTL 5D1ZB 2BHUA 3RWCB 3UBXG 1E4WL 3R0MA 5GGSB 4M6AA 4LRNH 5EZIL 1JYNA 1L9NA 4JPVH 4D9RD 2Q1EA 1EVTC 3MCKB 4Z78A 2B4CC 3WFCH 1ZLWK 1RJLA 1KBGH 3BRGC 2R23B 3OJ2C 5F89B 4C59B 4L4TD 4YDKH 1DEDA 2Q3ZA 3IKCB 2Y07L 2Q8BH 1KLGB 5LBSH 4YAQA 1RUPH 5I1HL 1FAKT 1XIWC 1PQZA 1WICA 3HR5B 5EZOH 2VH5H 4NNYB 5F9AC 1IMHC 1QSEE 2HVKB 4R0LA 1Q72H 4NQDA 3GUTB 2BNRB 3MRHA 2DICA 3EOBB 4MA3B 1CG9B 5HI3C 1UKSA 5HDLA 4HK3J 2HFTA 4NKQB 3EDJA 1BFVH 2IADB 5GJTL 1R3IH 3MROB 4JEGB 1WFNA 4Y19E 5GZOC 4YBQD 4P5TA 4XMPH 1GAFH 1A1NB 2AK1H 2VYRE 3T3PE 3WEXB 3D5OF 3CLEL 4LRIA 1ZT4B 2X4UA 4DOHB 1N5YL 1RZFH 4ONHB 4XC1H 4KJYB 1MFAL 5C07D 1BOYA 3ZKQD 4QWWD 1FFRA 1I9IH 2QV2A 5H94B 2WM0A 4Q74A 1IVLA 3WXWL 5HGGS 4JY6B 1P7QB 4EBQH 3BDBA 12E8L 3MNVA 3QRFM 1NUGA 1T80A 4WEUD 3C5ZA 4ZDHB 3UC0H 3W0WB 3GRWH 5DA4A 4Y2DB 5DRNA 2HRPH 2OK0L 1MCRA 4J7RA 3FO0H 4ZO7A 4B41A 2ZSWB 1BLNA 2PTTB 2CD0A 3HN3A 1NUFA 3BAEL 3O3AB 2XN9A 2PYED 4PR5B 1UH3A 2NXYD 4KAQL 2YUVA 1D7FA 4P0DA 3CLFH 3O6KL 5FKPA 4PRDB 5MEPA 4DAGL 2CDFB 2XRAH 2J88H 2EYRB 2RJMA 4FQ1H 2XICA 4XHJC 3VGAC 3CSYB 5JHDD 1CXFA 1A4JB 1RZ7H 1INDL 5FAAA 3L5HA 2H45A 2LABA 4P46A 4LQFH 3BPCB 3U0TA 4LGRB 1QSFB 1KPVB 3QIBC 4GBXA 1BVKB 4WW1A 4PJCF 3MCG1 1FVEA 3EOYG 5IIEB 4HEPG 5DJ6A 4JO4H 1G7IB 4OD3H 1X4YA 1BZ7B 4DN4H 3PL6D 2K1MA 5E2TH 5D2NA 4H0IA 3X3GH 1XR8A 4XVTL 4ZOCA 4MMZC 3PXJA 5GRZA 4J3VA 3OJVC 3RJQB 4Q9BA 5I74B 1MQ8A 1KIPA 3AREB 3WNLA 5T1LD 3VXOB 1T66C 2IEPA 2VISA 3PABB 4X98A 1INQA 1DLFL 1I85C 3UJTH 5F1NA 1FSKB 3KAAA 4GXVH 2ADIB 4ZOEA 1IM3B 4ZXBC 4BYHA 5D7LB 5EULV 3G5XB 3TH2T 2BCKA 1AKJA 2C3GA 1UB5B 4M93C 3U36A 5F7HA 1UKTA 4PRHA 3NCJL 1H3TA 3GSNL 3S35H 1FYTD 5HVGB 3NZHH 4NZRL 4ZFZB 2V17H 4Y16D 3G6AB 4FFWC 5C70A 3ARYA 4JO3H 1RK1A 1G9NH 1RFDL 1DEEB 2OI9B 3ARWA 1TXKA 1LEKA 3HZYB 5K9KB 4OI8A 4JFHE 3BQUB 2HKHH 2R1YB 3BKYH 1BQHB 4PJ7F 1EV2E 3SDYH 3K8MA 3E6HB 2CLRB 1RZKH 5HVHB 4K3JL 1W72L 1DBBL 2Z0BA 4O9HH 5SV4A 3RUGB 3VDAA 1JWUB 3MV9D 5IB5A 4M6OL 2NY2B 4HX1B 1V7ML 1BJ1H 2R2EB 1QQDB 2GJ6D 1XCTB 3WO4B 4L3CA 4KQ4L 3QQ4B 3V5HB 4DTGL 2VXQH 4I77H 1KELH 3GSNA 4YK4B 5TE7H 1MJ8L 1X5KA 1Z9OA 5DO2C 3MLSH 5C8JB 1KXTB 2OJZL 4WO4A 5C0BB 5ITBH 3OF6A 2OL3L 2VR9A 1MH5B 2B2XL 1WCBB 3KLDA 1MCFA 4I0KA 4FQHB 4JHAL 4KKNA 3HCVA 4NM4H 3VXQB 4P5TC 1A7RL 2Z93A 2CH8A 2ED7A 1INEL 4RFOL 5IBLD 1QFUH 1W72A 5DMIL 4LLWA 3B43A 4LRIC 4HCRL 3VFPB 4GMSH 1XGQB 3CU7A 2NY3B 1NGXA 3NCBB 4RA3A 1YEDB 1J0KA 2C4XA 5KVMC 3RNKB 3QNZA 1MVUB 3BPOB 5TJWK 3C5ZC 2FBJH 1MQKH 4KMTH 2QJDA 3RWCA 4XI5D 4D94A 3PGDA 4LLVA 3ULSB 4L3EB 1KFAH 4NN7C 2Z8SA 5A43C 3C2AH 3TIEB 5DRWB 3NPZB 5C0DA 2CKBH 3T77B 1A14H 4WNQA 1QTYT 2OP4L 2F58H 2Q7NA 4TULL 1MCKA 2HFEB 4P49A 2DBLH 4S1QH 4HCRA 3ZDZE 4YHLL 4P46C 3STZA 3V7AG 4GW4A 1VGKB 5TQ2L 3VI4F 1KLGA 3QPXH 4GBXC 4P2QD 1ZK9A 3WKML 3SDXB 4LCIL 5D8JH 5J57B 3VG9C 2BSRB 4NNYA 2NX5B 1U93B 3MUY1 2J6EH 1IGIL 2HVKA 1U8NA 3CXHJ 4IJ3C 5D2NC 2BNRA 5FYJH 3V4PH 3T0XA 3EOBA 5IESH 2WBJB 4MA3A 4PJ5B 1A3RL 1BM3L 3QIWD 3NACL 3MC0A 5HHPB 1OP9A 5EU7E 1IQWL 2W0FA 2IADA 4JFFE 1XF2B 5GS1A 1F4YL 3D1MC 2B0SL 5JW5A 4IM8A 3C09C 2ICWJ 2D7TH 4JDVB 3MRQB 3IJHB 2ESVD 2FR4B 3DUSB 3Q1SH 4KROD 5FUCE 3WEXA 4MA7L 5LXGL 4ONHA 4D3CL 2XZCL 5DEGA 4EN3D 5B8CB 3FFCA 3BZFB 2VXVL 3DBXA 3QHFH 3TJEL 4FXGB 4JY6A 1G9ML 4ZDHA 3W0WA 3KXFA 4DN3L 1MEXH 4Y2DA 3LPGA 1CYGA 4FXKA 2CUHA 1D9KD 5J12C 3VWJC 4J12A 1CL7I 4MNQE 1G7JA 3T2OA 1UCBH 1MIEH 1PAMA 4IIQA 3BESR 5IBUB 2PTTA 1GOHA 1QSVA 1I75A 1HHJB 2VWEC 3O3AA 4PR5A 4UV4L 1AC0A 3DXAD 4DGIL 4PRPA 4UTBH 1EXUB 1QSFE 2P5WA 3DX6B 2F15A 4U7KA 2LV4A 1MSPA 2BFVH 2CDFA 2Z8VC 2EYRA 5C6PB 3FL7A 3GNMH 4NKIH 4Z95H 4R96A 3SOBH 4UDTB 3U7WL 2EDHA 5FOJA 1YMMD 3QHZL 1RZ8B 3M1BB 2IFFL 4Y1AB 1UM4L 4EI5D 1K8DA 3U48A 4R97C 1ZS8B 3CMOH 3TC9A 4LCUB 2ZKHH 5IW1A 1TZGH 4MB5A 3KR3H 4AIZA 4JREC 1BVKA 2A9NH 4WVRA 4PRID 2X4SB 5IIEA 3LEYL 3HPLA 2XNAB 1EEZB 3C6SB 1G7IA 2XY1A 5IJKA 1CGXA 5C0NC 1YEIH 1BWWA 4WO4C 5EIVA 3ZMRA 3PE9A 4HIJB 5E95B 3TNNB 1FPTH 4I3RH 2BY1A 1FRGH 3MV8D 4HFUH 2NR6C 3UYPA 4X7TB 2F54D 3AREA 4MLSA 2XG5A 1UCTA 4ZS7L 5HHOD 3S34L 3PABA 4Z9KB 1JNNH 3BEVB 2VDOH 2OTPA 1KEGH 3HTLX 2ADIA 1IM3A 2EC8A 1NDGA 5D7LA 2QQKL 1RZGB 5AD0A 4OTXL 4JHZA 4XPAH 1FCCA 5D1ZC 1ZA3A 4XNZB 3BI9X 2VAJA 2YA1A 4LSDA 1N6VA 1DQDH 5F44A 5EIQA 5IMOB 1AR1D 4LDOB 3I02B 2IFGA 5BS0D 3G6AA 4O2EA 4Z18A 4N9GA 3VW3H 4YHPA 1DEEA 3U2SA 5K9KA 1MY7A 1JZ5A 4OZIB 3EDEA 1OAUH 3BQUA 3TA3D 1JVKA 5GRJL 2FJFB 3E6HA 1MPAH 2CRZA 4YO0B 5ANME 3RUGA 1TQBB 3MV7D 4DWHA 1JWUA 4LSUH 4RFNB 2VL5B 4HX1A 3I6GA 4OIAA 4PGEB 1A7BA 1WBZB 2R2EA 2RCSH 3PJSB 1QQDA 3QULA 1XCTA 5C0BE 3LKRA 2EE2A 3EFFB 3K1DA 4RDQF 1A7OL 3V5HA 5TDPA 3RVWD 5TGBB 4RMSA 3ZSSA 4G8GA 4IDJH 4Y4FD 4MJID 3F6IA 4F57L 5C8JA 5CEXB 5IEHB 2VDKL 3QWRA 2X1QA 4N0UE 1WCBA 5D7SH 3MOBH 3SQBA 3S37H 3TBWB 3VXQA 4QRRA 1YEGL 3DI3B 4JZOB 3HZKB 3VRLE 3HC0B 3GI9L 3QXTA 4XPFH 3LS5L 2YK1H 4PBXA 2FD6L 4N0CD 1IEHA 4ZPTA 2VQ1B 3NA9L 1YPZB 1HXYA 1RJYA 4YE4H 1AGFA 1AC6A 4GJTB 5FGCE 1MVUA 4L3EE 2FATL 3AC0A 4M3JA 4S0SD 2NY7H 5KW9H 5I66A 4GUPB 4AG4H 4Y2DC 4MJ5B 3CCHB 5D7JB 3FN0H 1JCKA 1DVFD 4IIQC 4O51B 1I3GH 3LDBB 4Q58C 5DUPH 3GIVB 3ULSA 1GOFA 4RAUB 1G84A 3TH3T 3VE0B 1U8MB 4R4NC 4ZUVB 1JZ7A 5DRWA 3FRPG 4ELKA 3I3DA 3O6FD 3T77A 1G7QB 2BNQA 2HFEA 4MVBC 1NLDL 4M00A 3SDXE 1QYGH 1MIML 1IGFH 4MNHB 5LCVL 1VGKA 1KJVB 2NX5E 4NKMB 4XNMB 1JBJA 1EO5A 1AQDB 5JOPD 5I16B 1ZANH 3PDGA 1F3RB 4PJ5E 2R8SH 1ZXQA 2WUBL 2BSRA 3MLYL 5IJKC 4FN0A 1TJHL 3RDTB 4XNXH 2AQ3A 1ZAGA 3ARGD 2RR3A 2GTWB 5I74C 5HHPA 4NPYA 2V5RA 3LKNB 1ADQH 1OM3L 4N5UA 1OVZA 5JXAH 4AL8H 3AREC 1AGBB 5L6YL 4MAYA 3V6OE 3MRJB 2FR4A 3DUSA 3CFEA 1ZVSB 2X5PA 1FSKC 1G0YR 3MLWL 5GGRY 2GK0A 5B8CA 5F88B 1NCDH 4UAOB 3LKPB 3SGDH 1GGCL 3UYRH 3C8DA 4I5BB 5AUMB 3TCLB 5CGTA 1QBBA 1YNLL 4XH2B 2HTLC 4GAYB 4ZO6A 1XR9B 1DUYA 1OB1B 2DM3A 2VLKB 5T33H 3FCTA 3CSGA 4OLXH 4U7MA 3GSXA 2OI9C 2XV6B 3U0WL 4NOFA 3GKZA 1I9JL 5CZXD 3P4OA 3BQUC 1I7RA 2PNDA 3T3MF 3MFFB 2EO1A 4RMWA 1IAIH 3MUZ1 5DJ2B 4JGMA 1EXUA 3RZCA 5I1KH 3FONA 3S88H 1FE8H 5IW6B 4LDLB 2NY2C 3MPCA 1CFBA 1WZ1L 4UDTA 4IBLT 1DZBA 1U3ZA 1RZ8A 3M1BA 1JZ4A 2JK5A 4Y1AA 3WIFA 3NH7H 1T1XB 1ZS8A 4E42B 4LCUA 1RY7B 5F7KC 4WI3A 3MCLL 3WO4C 5GS3A 3IU4L 3F7PC 4I3SL 5BW7C 2MPAL 2X4SA 1D5MB 5GZNC 3NMEA 4GKZB 4YK4C 3C6SA 4J3OC 2EECA 4OLUL 3ETBF 1K6QL 2Y5TB 5E6ID 5AWNH 2JELL 3O41B 3WIHL 4HIJA 4LOUC 3VI3E 3V2AR 2VDQH 1EBAA 2R0KL 1NAMH 1I1YB 3EYSL 4LP4A 1KOAA 4JFZL 1KCVH 4X7TA 3VXTB 1S78D 4G9FB 3R8QA 1HIMH 1E4XH 3OXRB 2NY3C 4NN6B 5EWIH 3REVB 4WW2B 2IQ9H 3V4VH 5BO1H 5FCUH 5C2UB 3MOQA 4P59H 5GSVB 3L9RB 4PP1D 3RIFF 3RTQD 1DLHB 4KDTA 1RZGA 2OCFD 3QUYA 3NABH 2DKMA 4DGYH 2IBGA 5IMOA 4P3CL 3IFNL 3G08B 5IM7A 4TUKH 3WIHA 4P23B 2Y7QB 4OSUL 3G04B 1NEUA 4XGZB 1Z9SA 2CIKB 4OZIA 1DQMH 2DMCA 2IGFL 1TCRB 1JJUA 1GGYA 3OAUH 2Y06H 2FJFA 1LWRA 2VLMD 4NUGH 4YO0A 3KPRE 5EBMB 3WN5B 2AJYL 1NEZG 1DQQA 3SO5A 5CKGA 4KQ3L 3TPKA 4CRPA 4ODSL 5BRZB 1AXIB 3AXLB 1IT9H 5A3IC 1WIOA 2VL5A 2Q6WB 1IAMA 1IL1B 4PGEA 1ZMYA 4HXAL 4WI7A 1JE6A 3G6JB 2ZCHL 4Y7MA 1B2WH 1U58B 4G42B 3CVHL 5CSBA 1W2KT 2CLZB 4YDVB 4XPHH 5TGBA 4D9LH 4JQIL 1FL5B 4Z7QE 4PPTA 4X7SH 1WTGT 4G3YL 1K5NA 1RIHL 1EIBA 3BZDA 3LEXA 5IEHA 2FDBP 3OKEA 1EEUA 3P0VL 4KTDH 1B4RA 5J89A 1T0NA 1YPZE 3FT3B 2ZUQB 3HZKA 1HINL 5KVEL 1NGYB 1P7HL 1S7RA 4N1HB 1DQLH 3RL1B 2WIIA 2VQ1A 5B8CC 1E6JL 1IARB 1KV3A 2EDNA 3V6OC 4XCEB 2H26B 4DKEL 4M7JH 5HGAB 4FQ2L 4BQBA 2QEJA 3T0DA 5L88H 3CVHA 5DHYB 4MJ5A 1TVHB 2DS4A 3CCHA 2WWMC 2QSCH 2PTUA 4PJAF 5DZNA 1W0VA 5DRXB 4NIKB 3O2VH 3VE0A 3WLBB 1KGCE 1RU9L 1MF2L 6FABH 4N90E 2BSSB 4M61B 4AEIH 1G7QA 3G5ZB 3LKOB 3BP7B 3SJVE 5ACMA 1R3JB 1KTDB 1REIA 1QVOB 5CP3A 4GSDH 4F2MB 2FCBA 2AEWA 1FGVL 5JIHA 5BMFL 4NKMA 4XNMA 2R4RL 5IT2L 43CAA 1CR9L 5I2IB 5I16A 5CJOH 1X5HA 2V5SA 4APQA 2MKWA 5MP6H 1KJ2A 3BISA 2NXZD 1TNNA 3LVEA 4YUEH 3FMGH 3RDTA 3RX8A 1PG7X 1U3YA 3FQUB 2DQJL 1QLFB 1AO7B 3DX8A 1OAQH 4M7KH 4NM8H 2GTWA 3DX9B 3LRSB 3OZ9L 3WKNA 1YC7A 1WWWX 3LKNA 1NBVL 3TBYA 3F12A 1N4XL 3MRJA 1ONQA 5FYLL 3UJJL 3HE6B 3EOTH 3FO1B 1ZLSH 4A6YB 2YBRB 3WE6A 1MI5A 3BPLC 4D0CB 2F19L 4XVUC 2VLKE 1ZEAH 5DJYA 5DFVD 1N64H 4XZUB 4KDTC 1MCQA 1M7XA 3LKPA 5CEZL 3I2CH 3QUYC 5AZ2H 4M8QB 5AUMA 3TCLA 3DGGA 4I0PB 3S96B 3ULUD 4YGAB 2P5ED 4XH2A 2AABL 1N8ZB 4OIBA 4GAYA 4OV6F 1J1XL 4R2GB 3ARUA 5DD5L 1OB1A 1MCDA 5TF1L 4LSVH 1IGJB 4LPXA 1RK0B 2W9EL 4LPWA 4GKOA 4M5ZH 4URTB 4WWKB 4FQIH 1DFBH 1G7HB 1T5WB 4TQEL 1Q9OB 4J1UA 3QIUD 3PDOB 4GKNB 4HPOL 4KMQA 4U3XA 1YEFH 4ONFL 4ORGB 4RDQG 2P8LB 4HLJA 3KYKH 4XNYH 1AFVL 1M7DA 1TQBC 2DQUH 1GSMA 3IDUA 4OZFB 4P9HH 4RFNC 5IW6A 2UZXB 5EUKA 4QRSA 3UZQA 2FWOB 4FFVD 3U4BH 2BVEA 2VR4A 3ALPA 5HHNB 5TE4L 5JR1L 1GPOH 2W65A 1J8HD 2ENYA 4OJFH 4PJ9A 4LASL 4BK5A 1UWEL 1T1XA 4E42A 5IHUL 3QDAA 3NTCL 3TBSB 2VXTL 2FO4B 3PG2A 4NBZB 1FFNB 4Q9QH 6CGTA 3ULVD 2MSPA 4GKZA 1FNFA 1LO2L 1N5AA 1PLGL 2NTFB 2Y5TA 2PYFA 1YEEL 4ZUWA 4G9FE 1JGVH 5I1EH 2F53B 3O41A 5DHVA 3LZFH 3W11C 1RUML 4YX2H 4OUUB 1UWXK 3DVGA 5GS0D 1DL7H 3K80A 1I1YA 4P2YA 5B3JE 1DANU 4HQQL 3QEQD 3TO4B 2E7CA 3OXRA 3PXHA 5FFLA 4U1LB 1PDKA 4XC3L 4O58H 5FOBB 3REVA 3Q5YA 5LKNA 4P2RE 1EZVX 1TPXB 5KVDL 4B7IA 1U92B 4L8CB 5GSVA 3L9RA 4XX1E 1ZT7A 4R9HA 1NC2B 5F3HB 1VFAB 3MLRL 2H6PB 4ONGL 3IJSB 3NCMA 2KUTA 2DM7A 3A6OA 5CEYB 3G08A 5KOVC 4RZCA 4ZOBA 4G6AD 1E28A 3BKML 1A0QH 2E8ZA 2LVEA 4MHHG 2X6MA 4PJGB 2FX8L 4I8DA 4XGZA 1A6ZB 2YA2A 4UQ3B 1TCRA 4G7VH 2C3XA 3LQAL 1EO7A 4LBEA 3QO1B 1PD6A 3D3VD 5BVPH 3GBNH 3HC4L 1UJTA 5D93B 3G6JE 3LH2L 1CK0H 5LWYH 3MRRB 3UTOA 4Z77B 1EHNA 3WN5A 1A6AB 1YECL 3MMEA 4HKJA 4NZUL 5BRZA 3O2WH 1HEZB 3GSQA 3AXLA 1J86A 2Q6WA 5DJAB 4APQC 2AXFA 3QRGH 4Z7WE 4R3SA 1U58A 3V4UL 3IF1B 3WDHA 3DMMA 4G42A 2GJZA 1AJ7L 1F3DJ 4YDVA 3RDTC 1YY8B 3OGCA 2MCG1 4RFEB 3F7QA 3EDFA 2AQ2A 4OGAD 2W9DH 3MJ8B 4P5MA 3TCXA 5E03A 3NCYS 3TVMB 3QG7H 2BSTA 1TENA 2XWTB 4PJDB 1G1CA 4NNPL 2N7BA 4JVPA 3BUYB 4EUPA 2FECL 4X6DF 1JTPA 4M6MH 1EUUA 1HNFA 3O2DL 3MLPA 3KLHD 1KULA 2ICWB 4HWZA 4U6VH 1CGVA 3IETA 3QCVH 5SWSB 3RL1A 1XH3A 2NY5H 4HIIB 1FNGB 5BV7L 3RU8H 3VGEA 3U1SH 2MMXA 4XCEA 2H26A 3KGRA 3O6LL 1CLOL 3KS0J 2DWEB 1BD2D 4I13B 1NFDF 1T2QH 2EDEA 3CJJA 5DHYA 5DD1L 3O4OB 2PO6D 3QNYA 1IC4L 4M9PA 3MLUH 4I9WD 1VFOA 3QDJB 1RMFH 1BQUA 4CVZB 4PREB 5IHLB 3WLBA 2XG4A 5IFHH 4UB0H 5EBLB 1WITA 4M61A 4HBQA 2AJVH 3G5ZA 5C2BL 3LKOA 1S5IL 2UY6A 4KUZL 1RULH 1QVOA 4F2MA 3LN5B 1P9MC 2CDEB 1NCAH 1EEQA 4OCMC 1A6WH 3MRNB 5GHWH 3AMKA 2N56A 5I2IA 1GZPB 3HI5L 4Z7VB 3V95A 1AO7E 4OF0A 5IFAH 4OM0H 3QFJD 5D6CB 5MEQB 3L5IA 4GLRI 1U8IB 1ORSB 2OQJB 3L3HA 4U1NB 1KENH 1FFOA 3IJYB 4IMLB 2A0LC 4B7LA 3Q2CA 3FQUA 1I8LA 3RVTC 5ENWB 3K8LA 4N8CL 1QLFA 4HG4K 1AGEB 4RRPA 1V3JA 4JFDD 2DLTA 3FN3A 3LRSA 3SKNB 4ZTOL 4P5KB 3DRQA 4X9GA 1BIHA 2PW1B 2ZUVA 4NO2B 1CLZH 1SJXA 1UKQA 2YA0A 2I26N 4OF7A 1U0QA 2JLLA 1BX2A 3G5VA 2WWKT 3FO1A 2DBJA 1JYXA 4A6YA 1FYHB 2H32B 3EJYC 2YBRA 5E5RB 1CWVA 4RAVB 4R8WL 4D0CA 5D7IB 3PGCB 5ELIA 1MY5A 4XZUA 2AVGA 2X70B 4H25B 4Z6AT 5E8PB 3DUHA 1LK2A 1U91A 4I0PA 2X9XA 4JCMA 4U7SA 2IANE 5ISZB 4XCNB 2IG2L 3P4NB 4P23C 2APVA 1IGJA 1NGPH 1U36A 1RK0A 2ZOKA 4QEGA 5DQJB 1UZ6F 5FYKU 3MRGA 1N59B 5DMJB 1G7HA 1T5WA 5JDSB 3A6BL 3UTSD 3VA6A 5C92A 1MLBB 2V9RA 3EIFA 5C08D 1OPGL 2P8LA 3WN5C 5SWZD 2C1PA 1CICD 1JPFA 4CN1A 3ILPB 2D7PA 3O0RH 4OZFA 4KK8C 5D72H 4TYUA 2VNCA 3O11B 4GRWF 1IAOB 3FQXB 2XZZA 5HPMB 5HHNA 1JGEB 2NYYD 5GISL 3ZE2E 2DJ4A 1NGWA 3TBSA 2ICCA 3DMMC 2FO4A 2ZNXA 2J4WH 3UBXB 1PSKL 3FN9A 4M4RA 2ZZUT 2YSSB 1CQKA 3S5LG 3UTPD 1GGTA 4BM7A 1G1YA 3TM6A 4WHDA 4TRPL 4IS6B 2F53A 4FQJH 4NUJA 4OUUA 1LILA 4OV5B 4QO1A 5CGYD 2ZUQC 5CSZB 4JQXA 3QWOB 4YH6A 1T03L 4KHXH 4PJXB 4HIHA 4I2XB 5K9JH 4YC2B 2C3VB 4UIMB 3SDDD 3TO4A 4U1LA 5FOBA 1GZQB 5DZOA 3O3DB 5IKCB 1GHFL 1H9VA 1CFSA 1G9EA 4GRLD 4L8CA 5BZWB 1EFXB 1CXIA 4NHUB 5TFSH 1YEHH 3BWUC 3ARFD 1F6LL 2WBWB 3LOWA 4PJGE 1VFAA 2E7LA 5F6IC 1OAYH 3ARTA 2X4TB 5A2LH 1B4JH 4GLRH 5CEYA 1GCFA 2W0LA 2QR0B 1RUKL 4CL7A 3MUJA 3ZYJA 4K7PL 1HILB 5BXFA 1JNLL 5IHBA 2HVJB 1A6ZA 4UQ3A 4JFEB 1D5IH 4YPGA 3NVQA 3GSUB 4F58H 1U8OB 3QO1A 4ZFFA 1B0WA 1F90H 3MFGB 1JYVA 3QEHB 5B4MC 3MA7B 4TSCL 1QKZL 1FH5L 3X3FL 4Z77A 1CFVH 1KN4L 4XPTH 4C55A 4NGHL 3VMOA 4KVNH 5DJAA 2ZUUA 4TVPD 5E2UL 5HGBB 1HQRB 4KI5C 1HDMB 1UM5L 4G6FD 4L4TA 2NY6C 3IF1A 4LU5L 3O3EB 3C08L 5LQBL 4WFFD 1YY8A 1I8LC 4U1KB 1BF8A 1OD7A 1Z0MA 3RVVC 3QO0B 4JHBA 1R5IA 3C9NA 3V52L 1XIWD 15C8H 3GM0A 1LD9A 5SWSE 3PQYE 3TVMA 5GGVL 3V6FA 2FX9H 1KTRL 4CUCA 3CSPA 5F9OL 4PJDA 1MRCL 5EU6B 4NQCB 5I8OL 3BUYA 3O9WB 3OB0H 2V5TA 3WFBL 4ENEC 1RIUL 2ICWA 5HI3D 3TYGH 1MNUL 5KTEL 4HIIA 4HV8B 4UT6L 1FCGA 5GZOD 3ULUF 3V79C 4ZS6D 1L9MA 1I8KB 2EC9T 2ED9A 4I0PC 4LSQH 2DWEA 5CS7A 3UXFA 4NP4H 4R2GC 1X6NA 5DJCB 3U9UB 2N4IA 4OM1L 1KCUL 4Z7UB 5TPWL 1K3IA 3QDJA 2G60H 3WDJA 1KPUB 4WWKC 4IRZH 5IP4A 4PGDB 2DDQH 1NJ9B 4E41D 5EDXA 5B3NA 5F97E 5EBLA 3HI1B 1CBVL 1OGAD 1CT8B 4KV5F 4PFEA 5D5MB 3PUCA 1ES0A 4HF5H 4XPGL 1MCWW 1RPQA 2HH0H 2KKQA 5EO1A 3VCLA 4IRJB 3LN5A 4CVWA 2CDEA 1HHIA 3NIDE 4K9EL 3HNTH 5EUOF 2FEEL 3ULVF 3ZKXB 4Z7VA 1A5FH 3QFDA 5I8CB 5T3ZE 4CBPA 4XHJD 4FS0A 1U8IA 3SGJA 2E5EA 2OQJA 4MNGE 4U1NA 3AROA 2OR9H 2WP3O 5ERWB 1L6XA 3BEWA 3CFBB 3QIBD 3P0YH 5ENWA 2IPUK 4X7DC 4G5ZL 5D71H 3MYZA 3FQRA 3GMRB 5KSUB 2B1HH 4JM2D 1FHGA 4JQXC 2HLAA 1MFCL 3S7GA 4Y5XB 3S9DB 1QFWH 1R5WB 2PW1A 4NO2A 1KN2L 4KTYA 2WK2A 3WBDA 5ITFB 1L0XA 5D7IE 4HWEL 1F02I 3TO4C 3T2NH 3HA0A 1M71A 1T5XA 1F11B 1F6AB 4PJFF 1I1FB 4GAGH 2XWJA 4RQQA 1HHKB 4KH2A 4L9LA 3NFNB 1WAAE 4DK3A 4R26H 4XCCH 4QHLA 2LU7A 1HCFX 4Q0XL 3SO3C 1JPGB 3ZDXF 5BZDB 2HT3C 2HYMA 1HI6A 2Y23A 1T66D 1IC5L 5GRUH 2E7LC 4YBLB 4S1DC 3P9MB 2COQA 1J7VR 1WAAA 35C8L 5ISZA 1WT5A 3QDMB 1G0DA 5E08L 5KG9B 4ZXBD 4KKLC 2AJZA 5JOFB 4GQ9H 4HK0A 2AERT 2BJMH 5DQJA 4JG1L 2RGSA 3MLZL 4KRPB 2GKIA 1N59A 4M1CC 1MLBA 3Q5OA 4FFWD 5D93C 3U30B 3FT4A 3IGAB 1QRNA 4U2YA 1S7VB 1CDIA 1E27B 5EORL 2OZ4L 4HMDA 3ILPA 3HB3C 1XGRB 3O11A 4X6CB 1A3LL 2YN3A 4DK6A 5K9QI 4PRBB 2DTSA 5C71A 3OXSA 3NCEB 5EOQL 2Q87A 4D0DB 1MWAH 1AY1L 4EEEA 4DZ8B 5B39A 5AZEL 5DD0H 3MA9L 4NKDA 2YSSA 4WTZG 1BJ1J 3S4SG 4PJXE 2EDOA 2W60A 3KYAA 2K3TA 2VLJB 1JN6B 1FLRH 2AQ1A 4TSBL 5I76A 4Y4KA 1VB9A 3TVMC 1X5IA 4OV5A 2FHFA 4LCYB 4TSAH 1J10A 4NQDD 3U0PB 5IMKB 1J11A 3HZVA 1Q0YH 3QWOA 4U1SA 1TCMA 2FX7L 4I2XA 5JQ6L 2O5YH 5DO2D 2C3VA 3D0VA 4PJ8B 2BSED 5T1DL 3BGMB 5CINL 3DV4A 5IGXH 2OMBA 1GZQA 3EYUL 1H3UA 3FHAA 3R1GH 3O3DA 5FHBH 1KC5H 4P5TD 5LGKA 2AV7B 2HG5B 3IU3A 1UVQA 4XP9H 2E27L 1I1AB 1TVBA 5CCKL 4NHUA 2R56L 4YFLF 4PJIB 3U7YL 5IK3B 3O4OC 2X4TA 2C26A 2AK4A 4WU5A 4Y4HB 1HILA 4QXUH 4MDJA 3C5ZD 2MCPH 4GAJL 2DD8L 3VJ6A 4JFEA 1OTTC 3FT2B 1BAFH 3GSUA 4UDUB 1U8OA 5JW3L 1SY6H 3QEHA 3Q5TA 4S1SL 2VXSH 3MA7A 1MREL 2XN9D 5HHXH 3IDXH 3OKMB 3QUML 1P4IH 5DFTA 2A6KA 4WUKH 1MCWM 2Z92A 4U1MB 3ARBB 1NMAH 3CFKB 2R1WA 5E8DL 5ESAB 1YEKH 1HQRA 3MXVL 1HDMA 4XP6L 1YMHB 1FORH 3QXAB 4P46D 3SGJC 2ZJSH 3O3EA 5GS2H 2L7JA 3O45B 1JWSB 4V1DA 3MO1B 3FB7A 3LS4H 1OCWH 4GBXD 4GMTH 4U1KA 2RAMA 2I5YL 5EU6E 3BJ91 4NQCE 1E4WH 3M07A 3V5KB 3QO0A 5EZIH 4LLQB 3UZEA 4NNXB 5IQ7H 3D25A 4O5LL 2PUQT 2OTWB 4KTEL 1LDPL 2R69L 3D0LB 2JCCA 2A83B 3E3QE 3K1KC 1G6VK 3O9WA 3LB6C 4WUUB 4LPUA 1JGDB 1IBGH 2FJHB 4Y2OA 3GJEB 1RUAL 4K55A 2Y07H 4DKDC 1QEWB 3B3IB 5MEOA 3KYNB 4Z7UE 4DVBB 2VZVA 3F8UB 3KJ6L 1CLYL 2AEQL 4N0FB 2PN5A 4JY5L 1ZLUK 5I1HH 1WT5C 2VOTA 1S7QB 1WK0A 1ACZA 3H3BC 3RQ3A 3BGFB 3BYTA 4NJAL 5C0CB 4ALAL 3U9UA 1T83A 1S7XB 4EN3A 5FA3B 3N0PB 4IHOA 5CMAB 4PGDA 1IJ9A 3MODL 1NJ9A 5HDOA 4OGYH 3MRFB 4U1JB 4Z7OE 2AP2A 1HZHL 3HI1A 3O8XA 2CDGB 5D5MA 3TPUB 4NRZB 1JPTL 3KWWA 4M62L 2O5XL 4XWGL 1TQCB 2R4SL 2DQDL 2X09A 3JWDC 3MRIB 4KJWC 2ICWI 3CLEH 4PV8B 1S9YA 1AR2A 1IILE 1N5YH 3UP1A 1FG2B 1YQVL 5HDBE 3DXAA 1MFAH 4BSJA 5I8CA 3N85H 4QOKB 1VADA 5KN5A 3K74B 2FEDC 4OAWA 3WXWH 2D0FA 12E8H 5ERWA 4Y4KC 2OK0H 1FJ1B 3LQZB 3VXSB 3H0TB 2VL4A 5KSUA 1AHWB 1MAKA 5FA4B 5EC1B 1HN1A 4Y5XA 3BP6B 3BAEH 3Q3GB 4YC2C 5C0ND 1RZJC 2ARJB 4O2CB 4P9ML 4WO4D 4OCXL 4ZTPL 3WNKA 3OF6D 4I18B 1C08B 4MSWB 4G8FB 2X4PA 4KAQH 3IS0X 3CGTA 1F11A 1C8PA 1F6AA 3O6KH 1I1FA 1MVFA 4DAGH 1HHKA 4OFKA 2NR6D 1INDH 1QHPA 4JAMB 4BQCA 1JPGA 1ZA6B 1NBQA 3WFZA 2F54A 1MRFL 2DLHA 3P9MA 4P48A 2NY0B 3TN0A 3QDMA 5E6ZA 5KG9A 1EGJL 4AY0A 5ALCL 4JJHA 4QRPB 4MCZA 2CO7B 4I4WB 2OXGA 3VXPB 2W59A 3IRZA 4E9LA 5L2KB 4KRNA 3TT1L 4XVTH 2BDNL 4NT6B 5D1ZD 3QDGA 3B9VA 5IR1B 3JZ7A 4FZEL 1NSNL 1HH9B 4HFWB 5DVOA 1JPSH 4LMQI 2QSTA 3PHOA 3VFNA 3CZFB 1FNLA 2J5LB 5BS0A 1S7VA 3RZWA 1E27A 1K8IA 1OAKL 4OLEA 3BD5A 3SGEI 1DJSA 1XGRA 1LK3H 4X6CA 3RWFB 4X5XB 1DLFH 1PW3A 2VLJE 1OARL 1JHLL 4D0DA 5I1LA 3EYOB 2VUYA 5T3XE 3F62A 1TZHB 3MV7A 3NCJH 3Q6FB 1TVDA 5A40E 4LNVA 2VLJA 4C57C 1JN6A 3MR9A 4HH8A 1YNKL 1RFDH 4MAUL 1WBXB 2GY7B 5E9DB 2BNRD 4GG6B 3QNXB 3O9WC 4GRMB 1WF5A 1MHPL 2WSKA 4PJ8A 4Y4FA 4MJIA 3BGMA 1B3JA 4OD2A 4JRYE 1O0VA 4K3JH 4PJIE 1K85A 1JHKL 4KUCD 1T7WA 5T5NF 1DBBH 2W07A 3BO8B 4KZDL 2AV7A 4M6OH 5JIPA 1A64A 2CGRL 5AG8A 3RIAF 1VSCA 1I1AA 3BIKB 4M7ZB 1LE5A 3OV6A 2ARJQ 5IMMB 1M4KA 4KQ4H 1T83C 3LEVL 3UBXI 4JPIB 4PY7A 4DTGH 5HI4C 1WZMA 1H5BB 4HMEA 2E7HA 5D6DA 3RIAK 5EFIB 1FV1A 1P7QD 1RV6X 3QQ3B 4UIKL 4Y4HA 8FABB 1CFQB 3SE4A 3W0WD 3KXFD 3MNWB 4Y2DD 3SKJL 4F33A 2GY5A 2OJZH 2Z31B 2ZCLL 5CILL 1PKQA 2OL3H 2UWEF 4NNPH 2B2XH 4Q6YA 4BK4A 4JHAH 2IPUG 4JKWA 4HPYL 1CFTB 2GT9B 5E7BA 1U8JB 1A7RH 1DVFA 2A74B 2CUMA 1FZKB 4L4JA 4D0BB 1INEH 5DWUL 1V05A 4RFOH 4R4ND 2XT1B 4X9IA 5DMIH 5D70L 1DSFL 1UXWB 1F8TL 3OKMA 3E0GA 1BF2A 1J0IA 4X80L 3ZKXC 4HUXB 4I3GA 3CFKA 5ESAA 4MVBD 2WBKA 3SPVB 3C6LB 1MAJA 1NCNA 1YMHA 1XFPA 3T2QA 3EO0B 4AJ0A 5CUSL 1PKOA 2DMBA 1JFQL 2VLRB 3O45A 3U4EA 4JM2F 3MREB 4ODWA 3WUZA 4H88L 4EVNA 5CLWA 4LLQA 1PY9A 3UTTE 5J6HA 4Y5XC 3BKJH 2B39A 2G9HB 4OQTL 4LLUB 2OTWA 1AGCB 1IKFL 1NFIB 3D0LA 4LSPL 4TOYL 2A83A 2OP4H 1C16B 5KJRL 3RKDC 1IQDA 4LSRH 4WUUA 1JGDA 4TULH 2PXYB 1MCJA 4OLWH 4PLJC 1FC2D 2NCMA 4QNPF 4YHLH 3ARED 5C0CE 4OFYD 1QEWA 5TQ2H 5JUEH 3KYNA 2E9BA 4DVBA 4MWFB 3KHQA 4YBLC 1M1SA 5EH1A 4N0FA 3TN0C 3U6RB 4LCIH 4U6HB 5D7LD 4AYFA 2I07B 5CJXA 4ZNCD 4YDJA 1IGIH 1OSZB 5FA3A 3LKSB 3CPLB 3SCMB 4JFQB 5CMAA 2HTLD 1A7NL 1A3RH 1BM3H 1E0OB 2JTDA 4MMXC 3MRFA 4OQTA 5DUBA 2DQHH 3NACH 4QCIB 4IOFC 4PJEA 1IQWH 2CDGA 4NRZA 3MACL 1F4YH 5GRVK 4NRYB 2B0SH 4P3DB 1T6VN 5FYKD 3BQUD 3EDKA 1R24B 1A47A 3L6FB 3MRIA 4MA7H 4PV8A 4ACPA 3VXRE 3MRCB 1NGQL 4EI6A 2EDFA 1FG2A 3B2VH 5LXGH 4D3CH 2I60L 2XZCH 4OCYL 2GW5A 4YDIL 4RIRB 4OZHB 2VXVH 3TJEH 3MLVL 3DWTA 4XT1C 3VXSE 4QOKA 2BRQA 2NY2D 3INUL 3MRPA 3UJIL 5D7KD 2AJSL 1BBJB 1G9MH 2EKSB 3TWCL 4RGMB 5FB8A 3TBTB 4DN3H 4Q97A 3CK0L 5ADPL 5JPNB 4C83B 2WLYA 5L0QB 3LQZA 4OCNC 1S7TB 4K94C 1AHWA 3GMLB 5EZJB 5GZND 5EC1A 4G8GD 3BYYA 1LO3L 5AEAA 1TTUA 3Q3GA 4O2CA 4PJ8C 2YPLB 4DQOL 4UV4H 3QWRD 4G8FA 1NEZB 3MGTA 1MJ7L 4DGIH 3U46B 4LOUD 1SJHA 4HLZG 3BH8B 4NC1E 1F2XK 1A3QA 1BFTA 3B4NA 3BZEA 3U7WH 1I1AC 4JAMA 3QHZH 3WNMA 2IFFH 1UM4H 1ZA6A 2NY3D 1PYWB 5DURB 3EJZC 3HRZA 3MBEB 3IVKA 5DEFB 3MZGB 3SDCA 5DSCB 4AZ8A 3C8KA 3LEYH 2UZIL 4QRPA 5FYLE 4Y4HC 3VXPA 4I4WA 3LKQA 4QRUA 4YHNB 2OSLB 4OZGB 3QXVA 3PWUB 3SE4C 3T65B 2ITCB 3HFML 5L2KA 5B38A 4NT6A 4L4VB 1WC7B 1HH9A 3OJDA 5FUOL 5INDB 3WIIL 1TJIL 5CEZE 1P1ZB 1X5ZA 3BW9B 4ELMA 3CZFA 5DJZA 5CD5C 1CGWA 1I3RB 3AMLA 1XT5A 3S34H 2BNQD 1MFNA 5KVGL 4KGLA 2D7MA 4K71B 5M95B 2AW2A 2WWKO 2EKJA 3NAAL 4X4ZA 4FTVE 1ZVYA 4RX4D 4KZEL 1Q9LB 5D2LB 3WHXA 4OTXH 5E9DE 1TZHA 4FP8H 4PJCE 3UTZB 5HGHB 4M7LT 2H2PC 4WI6A 4HG4J 3WS3B 5FM5M 4LLDA 4CVXA 1WBXA 4ZD3L 4GG6A 4PJ5D 3QNXA 4NO5A 2DQIL 3T08A 5GRJH 3P9LB 5CBAB 3HUJB 1MAML 2G75B 2D03L 3BO8A 2GQHA 3L3IB 3DVNB 2LFGA 3QG6B 5IOPB 3JVGA 1DN0B 3BIKA 3TYFA 5IMMA 4OGXL 2ZG3A 1QG3A 3BGFC 5C0AB 3FB8B 4M3KB 1A7OH 5CJXC 4JPIA 2DJSA 5GGTL 3QQ3A 4X6FB 2DMKA 1GH7A 8FABA 5C7XL 4R4FH 5JORA 4F57H 5DC4B 1CFQA 2FGWL 3I3BA 3MNWA 1DBKL 1YJDL 2Z31A 2VDKH 4PUBL 3THML 2WWMD 4XVJL 3B8YA 1CFTA 2E7BA 1IM9B 2GT9A 1YEGH 5FM8A 1TQCC 1ND0A 1U8JA 3OKOA 3E6FB 2A74A 3GZKA 3LS5H 4PB9L 4D0BA 3IFLL 4PJ7E 1VKXB 3QYCA 5CP7B 3NCCB 2FD6H 4W70A 5DS8B 3J7HA 3RZCD 3NA9H 4HUXA 1A8JH 4H8WC 3SPVA 3ES6B 2BVQB 3H7BA 5GSRA 3WJLA 1G6RL 4KK5C 3EO0A 4HKBB 2FATH 3HMXH 4Y1AD 5E94B 3LPWA 2VLRA 1U41A 5GGQL 5IVOA 4MJ6B 2DQCL 4FOMA 3K2MC 5GGTA 4ZFOL 5ICYB 4HJJL 5JQHC 1AHWC 3VFRB 1CGSL 3NIFF 2YKLL 2VDRL 4MB3A 3RVUC 1XGTB 1CQYA 2ZPKL 5K59F 3N9GL 5KVFH 3ULUL 4LLUA 3CH1A 5CSGA 5HYJE 4Y5VB 1AGCA 1NFIA 3H9SA 4I18C 4KPHH 4Z7NF 3MUHL 5J3HC 1C16A 3MNZB 1Q9WB 4U4BA 4TNWF 5LJYH 2PXYA 2PW2A 3HRPA 1NLDH 3I6LE 5D1QB 1MIMH 3B9KB 5F7DA 1I1CA 3OR6B 3DO7B 5LCVH 1J05A 3QUXB 1F13A 1VEPA 3HG1B 2IH1A 4KK9C 2X4OB 2NY0C 4TNWK 3SDCC 3VDCA 3OAYK 3AM8A 3QH3A 4XBGA 5HJ3A 4U6HA 3UYOD 2WUBH 1FL6A 5IF0B 2VLLB 3MLYH 5J1AB 1TJHH 1OSZA 3F7VB 1TZIA 4PTUA 2DI7A 3LKSA 1VGEL 3QUYD 4JZJA 4JFQA 4MQSB 2FIRT 2A1WH 3QXDA 4F7EA 3ULVL 2J8UB 1WFTA 4ETQA 3D48R 5I8KH 3CMGA 2J5LC 4WEBL 4OLVL 2EE9A 1WFOA 3H7LA 4NRYA 4P3DA 4OZHE 3RPIB 1OL0A 2OX5A 2PYEB 2HTKD 4FQLH 3WNNA 5E1AA 4XCFL 2P42B 5CJQL 5GS0L 3E2HB 4K3DL 3MRCA 1JK8B 1FVCB 3MLWH 5MERA 3VWKB 4RIRA 4ISVB 4OZHA 3VI4E 5JHDB 4C56E 2QSQA 1GGCH 1ZKAA 1YNLH 3C60B 4NQSB 1B0RB 3TBTA 1ETZA 1QLEL 2YPLE 1N2RB 3V8CA 4AM0B 4C83A 3GBML 2VDMH 3KPSB 3BE1L 2HWZH 2YWZA 3GMLA 5DZLA 5EZJA 3U0WH 5I1JL 1I9JH 4ZAKB 4F9PA 4KUCF 3PNWA 1BREA 4YXKL 3FOMB 5T3XH 3D18B 3W11D 4R6UA 2FRGP 3SDAB 4MD0B 3GHEH 1TTGA 3BH8A 4JFOA 1YZZA 3LQMA 3JWOC 1WZ1H 4HWBH 1DDHB 3JVGC 5F7NC 5T1LB 4M7ZC 4FZ8L 2WIMA 4LCWE 4X0KA 1PYWA 3MCLH 4X9FA 2KPNA 3IU4H 4S10A 5DEFA 5KS9B 4I3SH 5J6GB 2MPAH 1H5BC 1KTLB 2C4FT 4AIXA 1ZTXL 3MYJB 4LIQE 4OLUH 1K6QH 2CSPA 2OSLA 4OZGA 3PWUA 2EICA 2VR5A 2JELH 2Z31C 5C0JA 3WIHH 4L4VA 4K3EL 5C6TL 1WC7A 5EA0L 4LGPB 2R0KH 3BW9A 4UOW0 2ZUTA 3PV7A 1AE6L 4JFZH 5F1OB 1A6UL 2XXCB 1UYWL 3DV6B 4XHQA 1A1MA 2DQFA 3AS3A 3LHPH 1I3RA 2APXA 5D2LE 5DVLA 4LLYB 3D39B 2X1OA 4P4KA 1R5VA 3GB7B 3C6LC 5J56B 1BFVL 3VD3A 3D3VA 1FO0L 1UZ8B 1FNSL 3MV9B 3OR7A 4MQTB 5A2FA 2AK1L 5F6HJ 4NSKB 2NZ9C 1Q9LA 5F93C 1IZJA 3GBLA 3PWNA 3UTZA 4XC1L 4APQD 1X5AA 3RVXC 3VG0L 4P3CH 3IFNH 5I18H 1YJDC 4BKLB 4RA0C 1I9IL 4TTDC 3CUPB 3SE9L 3WS3A 3HUJE 2P44B 4BH8B 3RDTD 4OSUH 5I1DB 1BVLB 2IGFH 3BIAX 4JE4B 3P73B 3CAFA 3H3PL 1EO8H 2PXYC 3FO0L 3P9LA 5CBAA 2BVUA 2EE3A 2FL5B 2YRPA 4G80B 2AJYH 5C0AE 4KQ3H 1S3KL 4ODSH 3L3IA 2YEZA 2XTJE 5DA0B 1EHAA 5IOPA 4HXAH 3AM8C 1MI5D 2CLVB 2ZCHH 3EBAA 2XRAL 5FDYA 3FB8A 5DI8B 4UINL 3CVHH 4D9RE 4JQIH 4BSVA 1R0AL 3RWGA 4JZJC 3SCMC 3EO9L 3IXTA 1U8PA 4G3YH 1IFHL 4Q2ZB 2YRZA 5H2BB 3I6KB 3P0VH 4PJHA 5DC9B 3GRWA 2J8HA 3RHWF 4XXDB 1IM9A 3VFTA 3Q6GH 4DN4L 2AEPL 5KVEH 3DRTA 2ZG1A 2BVPA 1VKXA 4EDWL 3EYFB 3RUGF 1A7QH 5CP7A 4WJ5A 1ZLWH 4OLZL 1HHGB 1KCSL 3FJTA 2Z4QA 1D6EB 3F7YA 1KIUA 1LP9B 3ES6A 2BVQA 4HDIB 2VABA 3FO9B 4JY4A 3QJFA 4DKEH 5E4IA 4HKBA 5HD8C 4K8RC 5E94A 3U79A 1A9EB 4RGMC 4MJ6A 5ICYA 5L0QC 4JO2H 5FK9B 4B0MM 1HOCB 5IV2B 4F9PC 2A0LD 2NW2B 3P4MB 3HHRB 3K81A 2HKFL 1RU9H 1LEGB 1X5JA 5EZLA 3RVTD 1MF2H 3S35L 4B5EA 3QIWB 3QUMB 1EZVY 4UTAL 4PJBB 2IALB 5D1QA 4CNIB 1C12B 2BVYA 5B21A 3B9KA 5C07E 3OR6A 2AKRB 1FGVH 5BMFH 2GYSA 3AFLA 2HKHL 3QUXA 2R4RH 5IT2H 3BKYL 4KROB 1NCWL 4R7DA 3HG1A 3SDYL 3MBEC 1FNHA 2X4OA 1H0DA 3O4LB 3S5LB 4O9HL 3EJYD 2WANA 2GCYB 4J8RB 1DQJB 3BP4B 1IKNA 5IF0A 2VLLA 1C5BL 5J1AA 3VH8G 4OKVB 1K4DA 3F7VA 4PTTA 4S2SA 3RBSA 3MUGB 1TETL 4OF6A 4DW2L 2PYEE 3FB5A 1V3MA 2UVEA 1LVEA 5MENB 3OZ9H 2J8UA 1KELL 1JF6A 4P23D 2P48B 2QHRL 5JHDE 1MCSA 1AXSB 4LKXB 1UA6L 3TIDA 1N4XH 4JB9L 1I1RA 5EBWB 3QQ9C 5FYLH 1HH6B 3UJJH 1LNUB 4P4KC 5CZVL 2ID5A 4XWOC 4MXQC 4QTIL 1N0XL 1JK8A 4K71C 4HEME 3VWKA 3DUUB 5BRZD 4KK8D 1OLLA 1CICA 1CE6B 1JGLL 5CEZH 3MGOA 2Y36L 4GMSL 4XVSL 2AABH 3C60A 4NQSA 4O02L 1FIGH 2CO6B 1J1XH 5DD5H 1B0RA 2EH7L 3NFPB 2P49B 1RUQL 2JJSA 3AY4A 5TF1H 4AM0A 3DMMD 4PRIB 2ZCKL 3ZYZA 3KPSA 4PV9A 2W9EH 5DD6B 2DM2A 4D9QD 4TQEH 1RI8A 1SM3H 2UYLB 2GK2A 4HPOH 3VA2C 3FOMA 3D18A 1SYVB 4ONFH 3SDAA 4KK6C 5K93A 5F9JB 4MD0A 1AFVH 3GIZL 4KMLB 3EO1B 4JPKH 4RMUA 3B9DA 3C2AL 2AAVA 3MJ9L 3KPQB 2CKBL 5A2JH 3I84A 5TE4H 5ID1B 5HHOB 1UADC 1KF9B 3L3OA 4ZYKB 5JR1H 4WFHE 5I73B 5FO7B 1BVZA 4LASH 1UWEH 5IHUH 3NTCH 3TV3L 2VXTH 3ZTNH 4S1QL 5KS9A 1KJ3L 5J6GA 4ERSH 1FAIL 3MYJA 1LO2H 1PLGH 2BC4B 5I1GL 5JO5A 4TVPL 3KS0H 4H5SA 4NZTL 3KPLB 4JRXA 1NC4B 1S5HA 1YEEH 3EJJX 5ESQB 1F5WA 2V9TA 3A67L 1RUMH 2M26A 2R0LL 3HAEA 4L8BB 1LO5B 4Y19B 1IAKB 4ZNEE 1MCOL 4L1DA 5EU3A 2YUWA 3T3ME 2J6EL 4JPWH 2A6JB 5LG1A 1VFBA 1ZHNA 4HJGB 3MV9E 4HQQH 2B5IC 3D85B 4N8VA 4ZO8A 3T4YA 4F37F 5C6WH 4XC3H 3D39A 2CKBA 3GB7A 4YHMH 5B4MD 2GJ6E 2BK8A 3BRFA 5KVDH 1AD0B 4JFYB 1Y0LB 5C0GB 3VFOA 3M45A 5J11B 4NSKA 4TUJA 1N6QL 3MLRH 5DGRA 4ONGH 3RBGA 4U6TA 2DL9A 4KI5D 3ARDB 2IQAB 4HJ0C 4MLIA 5FYJE 2NY6D 4BKLA 3CUPA 3D2UB 3BKMH 2FX8H 3D69A 1JZ8A 1IGCL 1Q94B 1BVLA 2J6EA 2VN4A 3RVVD 2CJUL 1UXSB 5DMGC 5F3BB 1NCBL 3SE8L 3HC4H 3HLAB 5D1QC 4G8IB 3B9KC 3IYLW 1MUJB 4G80A 4X6BA 3CDYA 4ZFGL 3X11B 1KXVC 4K7PY 3BDYH 3QUXC 1YECH 4YHYC 4NZUH 2IBBA 2VKXA 1EAPB 3NFSL 1U8KB 4ENED 4PB0L 3CZJA 4NO3B 1S7SB 2CLVA 4WDIB 4F7MB 1IKNC 3V4UH 2ZUXA 1NDMB 3GNML 5DI8A 5SWQB 1AJ7H 3JBG7 5HYQA 2F5AL 3FRUA 3PWVB 4BELD 4K23H 1UB6A 4I0PD 3T0AA 2VZOA 3CMOL 3GO1L 4Q2ZA 3V0VB 4R2GD 4N1EA 2MQ3A 2XZQL 2A9NL 3GDBA 2L4OA 4X7EC 4XPBL 3T0EB 4OZIF 1KB5L 3GMNB 1C7SA 4UT9L 4XXDA 4TNVF 3G9VA 1A22B 1K3ZA 5IB3B 2JIXB 3J8F7 2XKNB 4WWKD 5IEKA 1G9NC 3DTXB 3QWQB 3H9YA 4ODXB 1JNJA 3D6GA 3O6FB 4QT5B 3O2DH 3E2HC 1YN6B 4TUOB 4P2QE 1FPTL 4QHNB 3IDMB 5BV7H 1OGAA 4TNVK 3RWHA 3VWKC 4QKXB 3T4AB 5AYUL 1RZKC 1LP9A 2GTZB 5GGVY 3LMJL 1JPST 3FO9A 3BN9C 1Z3GL 4PGCB 5HYSG 1CLOH 1UQSA 3C60C 4M6NL 2OJEB 3P2TA 2I9TB 1HCVA 2VDOL 2JJSC 3AY4C 2ZSVB 5EIIB 1IC4H 4G9DA 2K7QA 1D5ZB 1CTNA 1HSBA 2YR3A 4P99A 4XTRC 2OR7A 5FK9A 4EXPX 4ZAKC 5IV2A 2NW2A 3P4MA 2F53D 3WHE0 2ESVE 5F1IB 4BZ1L 3SDAC 4R4BB 4WENB 3QIBA 3K2UL 3PF2A 5C2BH 4M03A 3QAZB 3KPTA 4KUZH 3UX9B 4PJBA 5DK0A 4CNIA 1OY3B 5IJVB 5E4EB 2F9BT 1UWGL 1RZIB 5T1KB 1VENA 1NAMB 3TO4D 2FSEB 2V7HB 4HH9A 1JP5A 1S9WA 4FMKA 1C5CL 3C5SB 1MPAL 3O4LA 3S5LA 1S9VA 3S4SB 2SEBB 4X6DB 3VD7A 5MENE 4J8RA 1DQJA 2V7NB 5BOPA 2HT3D 3ZE0F 4PS4L 1Q9KB 4RGNC 1FP5A 4S1DD 4N8CH 3MUGA 4Y5YA 5C09A 4PJAE 1F2QA 4KKLD 2CK2A 1NFDB 4ZTOH 5DTFB 3VXMA 3P4LA 1A4KB 3IDNB 1P4BL 4QXGH 3VFWA 1N3NA 3QEUA 1CXHA 1IEBB 2A6DB 4LKXA 5FO8A 4FG6C 4M1CD 5EBWA 3KYMB 1YMME 3IXAA 1TTFA 3W81A 1LNUA 1CL7L 4LIQH 4XP1L 4CJ0A 5AAWA 4NCDA 2VN7A 4R8WH 4XPFL 4PRIE 5F70A 1TNMA 3HB3D 1C5DB 1CE6A 3BPNB 5IVZB 1EERB 2QSVA 1NFKA 3KNBA 1WWAX 3NFPA 4DZBB 2ZOLB 2X4QB 2IG2H 2EDTA 2ITDA 5E99L 3GMMB 3MV8E 1CU4L 3PP3K 3QUZA 2EIDA 3VD5A 3SKOB 2XA8H 3A6BH 4AT6B 1XGYL 2UYLA 2X2YA 1T04A 5HHOE 3MRBB 3TVMD 2VZ3A 5J1SC 2Y25A 3P77B 3EO1A 2YC1B 3G5YB 1ZOXA 3H8NA 4UT7L 2H1PL 3HNSH 3KPQA 2CUIA 5ID1A 1RJZB 5GISH 1PJ9A 2XWBB 2EYSB 4ZYKA 5ACZB 5SWSD 5T5FL 4DFIA 1A9BB 1QSEA 1IGFL 2DQTL 4NWTL 2FO1A 2LVCA 3DSNA 1PSKH 4LEXL 2E6PA 1T20A 3RTQB 4BQ9A 4CVUA 4Y8AA 1NH6A 2BC4A 3U4AA 1P6FA 4TRPH 4MHHI 4EZMA 1NC4A 1WUNT 5ESQA 4OCSH 5CKAA 4F7PA 4JJ5B 3VFSB 4JFFB 1EJOL 2KL6A 4G43A 4N8PA 4Y19A 3QDJD 5DT1L 3L95A 3DYPA 3S36X 1A6VL 4RBPK 5K9OB 4XNXL 1T03H 2A6JA 3WFHB 1BGXH 2VC2L 3BWAA 4X9HA 3GMOA 4F3FA 1OTTD 3D85A 1JRHL 2JB5L 1SYSA 4J4PA 2YMXL 1GHFH 5JXAL 1Y0LA 4D8PB 5C0GA 3QQNA 4PRAA 5EU4B 1UC6A 4LHUG 1FZMB 1YY9C 3CU1A 4FNLL 5ECJE 3DJ9A 4U31A 2PETA 1NMBH 4MNQB 4NOBA 4WWID 2QKIB 1L6ZA 1ORQA 4GRWB 2IQAA 2V2XB 4WI2A 3GFUA 1RUKH 4FFZL 1RIVH 4K7PH 1DUZA 3D2UA 5F7WC 3AGVA 4Z8FL 5JW4N 4JKKA 1JNLH 1Q94A 2FH6A 5A2KH 4PYHA 5FF6B 4CN6A 5T3ZD 3QIWC 3WFDH 2NQCA 2MHAB 4HXBL 5F3BA 4NYLB 4TSCH 1QKZH 2RFXB 3X3FH 5GGRB 1TJGL 1KN4H 3QXWA 1EAPA 4NGHH 5I19L 1Z5LB 1N6UA 3LB6D 1U8KA 1YYML 5E2UH 4FQQB 1WJ3A 1UM5H 4O4YL 3S88L 5CHNA 1S7SA 4F7MA 1FVDB 4LU5H 3T0EE 3VRJB 3C08H 1T1YB 5LQBH 5JTWA 1T7YA 2ZNWA 3X14B 4Y5YC 4G8EB 1I7TB 2EO9A 2ILLA 5ISZD 3V0VA 3V52H 3ORJA 1AIFB 3LSOB 5HHMD 4HMCA 4BSWA 4L8DB 1JV5B 5IB3A 5F9OH 1MRCH 5AWNL 3DTXA 1M7IB 4WFGD 1J5OL 1SMOA 5IB4B 4ODXA 4EJ1C 3WFBH 4MQ7B 1QUNA 1HKLH 4B53A 2XPGB 1RIUH 1BMGA 4TUOA 1S9XB 1MNUH 1QRND 5JOPE 4O2FB 5KTEH 4ODHL 3ARXA 3HS0B 3VWJA 2VE6B 3S36L 3T4AA 2GTZA 4PGCA 5DQ9A 1P84K 3LCYA 4KJWD 2Y6SC 4ZMAT 1T1ZB 2OJEA 5EWIL 3PWJB 3MOAH 2XACC 2DB8A 1OGTB 2ZSVA 5EIIA 4M4PA 4OM1H 5CJ8A 1KCUH 5TPWH 4P59L 3QCTL 4QTHB 2FEDD 3QHTC 3W2DH 3QUZC 3B2UC 5ETUB 3E8UH 2WQ8A 4HULB 5BJTA 4F7CA 1RJCA 2BXYA 4Y4KD 1CBVH 5F1IA 2Q8AL 2XIDA 3ROOB 2BMKB 4R4BA 5ANMB 3OB8A 2QADB 1MLCA 3L5WB 4EIGB 4TUKL 2ATKB 2IPTH 3IDYB 1JZ2A 4JN2A 4X6DE 5IJVA 3T1FB 1DQML 5T1KA 2H8PB 1SBSL 3NIGF 4K9EH 5I73C 2R0WL 2FSEA 2V9QA 4OCWL 5FECA 2N1KA 2P45B 1ZHLA 3QPQC 3OAUL 4X83A 3UO1L 2BOCB 1U3HB 3C5SA 4AMKL 1QNZL 4NQEB 2W9LA 4NHCL 3RGVB 4XP4L 3S4SA 2SEBA 2DM4A 4AENA 1NFDE 5D9SA 2LU3A 1CZ8L 1OF2B 4M1DH 1CDJA 5L8JB 4N0UB 4EXKA 3OJMB 1LGVA 4G5ZH 5CWSB 3JV6B 3T0VA 2AK4D 3CC5B 2P1YA 1MFCH 3BT2L 5DTFA 4D9LL 1A02N 4OF8A 1KN2H 3IDNA 5J8OA 1BBDL 4HGMA 4HWEH 4JFED 4XCYB 2A6DA 2NLJB 5CFHA 3EZ8A 3KYMA 3QIUB 5D1ZA 4J4PC 5E1HB 1Q8MA 2NY1B 5GGSA 1EA9C 3WO3B 1U42A 1ZHBB 2GHWB 1T1WB 5FGCB 4JN1H 3SN6N 4Q0XH 5B22A 3MCKA 2DIAA 3H6JA 3JXAA 4KI5F 1IC5H 1CVSC 5DJDB 5A1AA 2JJUA 2Y9RT 35C8H 3ARDC 2R23A 5F89A 3TT3L 5E08H 4DZBA 2PR4H 5EOCL 3EFDL 2VB5A 4V1DD 4X8XA 3GMMA 3IKCA 3DSFL 5FDWB 1VACB 1UACL 4JG1H 4I48B 3MLZH 1CDCA 2QQLH 2XQBL 5JMOC 1U8HB 4AT6A 2ADJB 5DQDL 4FFYL 3HR5A 2OZ4H 3P77A 3G5YA 3GUTA 2IAMB 3O9WD 4TVSa 1A3LH 3QEQB 3REWB 1CG9A 1RJZA 2EYSA 3F6LA 4NJ9L 5EOQH 1A9BA 1AY1H 1R3KB 2VUOA 3MROA 3MX0A 3VMNA 4MCYB 3MA9H 4CU6A 1CTOA 1A1NA 1ZT4A 3T0EC 4TSBH 1RHHB 4JJ5A 4JFFA 2C7UB 5CD3B 4KJYA 5I1AB 4QY8B 5HI4D 1SJVA 2DWDB 1UZ6E 5F1SA 2VLME 43C9B 5H94A 1YDPB 5K9OA 5JQ6H 3GEWB 1P7QA 2EE6A 5T1DH 4N5EC 1QBLL 3O8XD 5CINH 4M48L 5CBEB 4GRWE 2ZSWA 1MCNA 4KJQC 4KI1A 2E27H 2V2WB 5EU4A 1FZMA 4N0YL 2R56H 4H1LH 3QA3B 1Z9MA 4MNQA 5JDJA 2QKIA 3I50H 2GSGB 2V2XA 4PRDA 1ZEAL 4YZFF 3CSYA 2BY2A 1A4JA 3PP4L 2AS5M 1YEJL 3BPCA 4D2NA 2Y5EA 3BP5B 4GAJH 4JR9L 2DD8H 5FF6A 1QSFA 4LNRB 1IC1A 1KPVA 1WGOA 3ZO0A 4G6KL 2C1OB 5JW3H 2MHAA 3QAZC 3ZZ1A 3OKDB 4S1SH 4NYLA 1NCCL 1CD0A 1VDGA 3QUKB 4XRCB 5E4EC 4M5ZL 1MREH 5C0FB 5GGRA 1RVFL 3LIZL 5DGQA 5I75B 1BZ7A 1AI1H 3QUMH 5ESVB 1T0PB 3RKDD 2BHZA 5CJBA 3S3PA 5E8DH 1YEFL 4FQQA 4GH7B 1QR1B 4NO0B 4PLJD 3MXVH 3KYKL 4XP6H 5FYKL 5HHVL 3LPFA 2CK0H 1FVDA 1IZKA 1P7KB 3STLB 3VRJA 2YD4A 3KPNB 2D7OA 1OW0A 4OFYA 4JHWL 1BD2B 4LVNB 2CMRL 3RPKA 3X14A 2IPKB 2I5YH 4H20L 1OHQA 3VXOA 4G8EA 2VSDA 1I7TA 3C8HA 3TN0D 3QDMD 3UPRB 3OQ3B 4PJGF 4LGSB 4O5LH 2MQ0A 2I9LB 5SX4H 2EYTB 4NFBA 1CE1L 1BPVA 3G5XA 3LSOA 4KTEH 1LDPH 2R69H 3QDGD 1M7IA 4U2ZA 1PZ5B 1UB5A 5I1EL 4HKZB 2UY7A 4MQ7A 2LTQB 5TE6L 4IOFD 2XPGA 4ZSOE 1S9XA 4ZFZA 4IRSB 3VD4A 4O2FA 3MRKB 4NRXB 4LVOB 1E6OL 1RUAH 2VAAB 2VE6A 2WMPA 1VA9A 4Z0BL 3HZYA 3KJ6H 1X9QA 3VGFA 2CIIB 1CLYH 4HD9A 1NMCB 2AEQH 1SBBA 5MHSE 3IDGB 4JY5H 2R1YA 4KHTL 1BQHA 1CDHA 1MRDL 3WD5L 4NJAH 1OGTA 2CLRA 4ALAH 3QFJB 4KJPC 3MSPA 1GGIL 1NKRA 5ETUA 3SGDI 3MODH 3ROLB 2VLJD 4MB4A 1HZHH 2D7NA 4PJDF 4JFDB 3ROOA 3KPRB 5ANMA 1JPTH 4M62H 3L5WA 3QQ4A 4XWGH 4NQEE 3BIBX 3BSZL 5BW7A 2R4SH 3JV4B 4GG8B 2DQDH 3T1FA 1G7PB 4PJ8D 2H8PA 2AI0L 2MTPA 3RAJL 1NGZB 2NTSP 5C0BA 1YQVH 2WNGA 1IAII 1NANI 1Y6MR 3ULUE 1A1OB 1MH5A 1P5VA 2BOCA 3GBNL 3MJ7B 4FQHA 2I24N 5IVXB 1L4IA 2CRIA 1B0GB 4U49A 1I1AD 1XGPB 4L5FL 2R2CA 1OF2A 5EU7C 3NPSB 4N0UA 1CF8L 3EJZD 3VFPA 2F8XC 1XGQA 1GJIA 3AUVA 1YEDA 2ZUWA 4LLAA 5DUML 4Y4HD 5FV1L 5IFJB 2PKDA 5FUCC 4M1GL 3RNKA 4Q6IB 3T8XB 4WRLA 4P9MH 1H8OA 1J1OL 2IC2A 4KV5E 4OCXH 4ZTPH 3UTSB 2W9DL 4L1HA 1GRWA 3QSKB 2CKNA 1J8HE 4F15B 1R3LB 1ZHBA 3WYRA 3S3JA 3NA4A 4RAHA 3B83A 4L3EA 3JV0A 4Z7VF 5EUOE 5CD5D 3BKCL 3ULVE 3TIEA 4HIXL 2B1AL 1E4XI 5FM5O 2E7MA 1IEAB 1U8QB 4XMLL 2IJ0C 1EGJH 5ALCH 1JL8A 1AXTL 4IOIB 1KCLA 3PWPB 3GSWB 1ZGLB 1CVRA 5FDWA 1VACA 3EYVB 4I48A 4RX4A 3SGKA 3F58L 4FZEH 4JGUA 4H26B 1I3UA 1NSNH 2H2PD 3V0AC 3QEQE 1ITCA 3SJVB 1X5LA 3SDXA 4JANB 4JKPL 3MLUL 1WSST 2ADJA 2A9ML 2X1XR 3KYOB 3FB6B 2FNBA 1J88A 3P11L 5KSVB 4WHYH 1UWXH 1OAKH 2NX5A 1U93A 2ICEB 5ADOH 5H37H 4PJFE 2IAMA 4WUUD 3REWA 2WBJA 4PJ5A 4P4RB 1HXMB 4RMQA 4CMMB 3VFGL 3ZDXE 1OARH 5DMKB 1JHLH 1MCCA 5GGUB 2G5BB 1XF2A 1F42A 1WAAF 4GRLB 4M7LL 1OW0C 5GHWL 4JDVA 3MRQA 2X05A 3IJHA 2CR6A 5GRYA 2ZUSA 1XF3B 1DE4B 2VERN 2YN5A 4MA1B 1FFPB 2C3HA 5IFAL 1RHHA 1YNKH 2C7UA 2NPLX 4MAUH 5CD3A 1PX4A 4QY8A 5T1MB 2DWDA 3BZFA 1MOEA 4LARL 4TPRL 3V6OA 4YHZH 43C9A 1HNGA 4K3GA 3TO2B 4FXGA 5ALBL 1MHPH 1ZT1B 3MJ6A 4QXWA 1D6VL 3RWJB 3F7RA 1NUDA 1K2DB 5CBEA 5KOMC 3ZHDA 5EN2B 5I8EB 4G6JL 1ITBB 4KZDH 3V8OA 1FGNH 3OKLB 2CGRH 5DLML 3RNQB 4A2MA 3KLAB 4P9HC 3VXUB 1HHJA 1EVUA 1KUMA 4QF1B 4UOJA 2EEDA 3BVNB 1NANH 1XCQB 4Z5RB 3QA3A 5FIEA 1DBML 4EUPG 2OLDA 5HVHC 4FQCL 3LEVH 2GSGA 3DX6A 4QOKD 1V5JA 4BQ8A 4KK5D 4UIKH 4CDHA 3SKJH 3BP5A 4JDTL 2ZCLH 5FV2A 1XIWB 4FQXB 4HPYH 2QADC 2HJFB 4HBCL 4XNUL 4MXWL 3OKDA 3IDYC 3RVUD 5L9DL 2XNAA 5C0FA 1EEZA 5DWUH 4XP5H 4XB7A 1HQ4B 5I15H 2EC9U 2EDBA 1DSFH 4QHMB 1F8TH 5ESVA 1QLRB 32C2B 5J3HD 3ZHLA 1BD2E 1U3HC 2VDPL 2EIEA 3TNNA 1QR1A 4NO0A 3RGVC 3VGBA 1S7WB 3LY6A 1P7KA 5CUSH 4EOWL 1D5BB 2OTUB 1K9TA 1BZ9B 1IE5A 3KPNA 2P7TB 4OGZA 1KT2B 4KK9D 2IPKA 3EYQC 2NY0D 2MNUA 4H88H 3SDCD 2ATPB 4XB8A 3BEVA 3HI6L 3UPRA 4QRPD 3RL2B 3CXDH 2I9LA 4OQTH 1F3JB 3BPOC 3I75B 5L2KD 1IKFH 2ZUYA 4LSPH 1JTTA 1PZ5A 5D4QA 5KJRH 3QIUC 4P2RB 2NY1C 4R90L 2HMIC 3BXNB 3I02A 1AGDB 4IRSA 3MRKA 4NRXA 5AAMA 3RIFK 4S0TD 1AQKL 3QFJE 5HTSA 1TIUA 1W0WB 2MJWA 2O61B 3IDGA 1DTUA 1MFDL 2EDYA 3UDWA 3VGAB 1PEWA 4JFDE 3QCUL 5IBTL 4HZAA 4UU9B 1OQOA 1MWAB 2R2HB 5FUZL 3SGKC 1XAUA 8CGTA 1F4XL 1A7NH 5CAYB 3ROLA 4JFXB 5DK3A 3RY5A 1WBZA 2JCCF 3PJSA 5JHLL 2Q86B 5F9DC 4JM2B 1JF1B 3KPRA 3EFFA 3ME0A 3PWLB 2BVOB 2KQNA 1Y6NR 4MDIB 4WGVB 3X13B 3JV4A 2IAMC 2X4RB 4MD5B 4J3WA 5IVXE 1G7PA 2WBJC 3IAQA 5CEXA 4Z7WB 1NGQH 3SKUD 4QRQB 2I60H 1A1OA 4OCYH 4CADB 4YDIH 3TBWA 4ODTL 3ZLQC 2NY5C 1X3DA 5IG7B 4JZOA 1B0GA 1DBAL 3HC0A 3INUH 3BGAA 1XGPA 2NY4B 3UJIH 3VGHA 4OB5L 4Z7UF 1XGUB 2AJSH 3TWCH 4DCQB 1F6FB 4UZGA 3L3JB 5ADPH 3CK0H 4H0GA 3NGBB 3UTSE 1YPZA 3GSVB 3GI8H 5C08E 3ZYIA 5IFJA 1LO3H 1EK3A 1WBYB 5J06A 5D5MF 5SWZE 3ZT6A 4M93B 4S1RL 2Z31D 1T21B 1KJ2L 4GUPA 1MJ7H 3GGWB 3P3YA 2RQ8A 5D7JA 2WUCH 2W92A 4NCC2 4O51A 1R3LA 2HT2C 2HFGL 5KSBB 2AJUL 3GIVA 1MHCB 1RJLB 4RAUA 1H8NA 1CDBA 1U8MA 4ZUVA 3PWPE 1KEML 1GC1H 3OAZH 3C6LD 2UZIH 1W0YT 2BY3A 4IOIA 1MELA 2KH2B 2VLRD 4MNHA 1WEJL 2NZ9D 2ZWLT 3GSWA 1ZGLA 3HFMH 1KJVA 4GRWH 4NP4L 3OX8B 1AQDA 4H26A 4LP5A 5FUOH 3RVXD 1A7PL 3WIIH 3SJVA 1TJIH 3O81A 4JANA 4R0LB 3KYOA 4TTDD 5KSVA 5I75C 3H9SD 4W6WB 5KANG 5KVGH 2PXYD 3ECBB 2FJGB 5KBNC 3NAAH 4P5TB 5DMKA 2YUZA 3NBNA 4JFPB 1AGBA 4HUWB 4KZEH 2Z35B 4LVNC 5DD3L 1KACB 5F6HI 3UTQB 1U6AL 1ACYL 5JZ7C 1XF3A 1ZVSA 4KY1H 4JO1L 5F88A 5T1MA 1YYLL 3MNVB 4ZD3H 3SCMD 3U82B 3QBTB 3C5ZB 4DKAA 4I5BA 4NQUA 4XNZC 2DQIH 2X42A 1GGBL 1ZT1A 5TDNB 3VXUE 1XR9A 3B5HA 4IRSC 1MAMH 1MCIA 4LVOC 4TVPE 2VLKA 2YD1A 4X6CF 3TH4T 5C1MB 3RA7H 5GRWA 5JXEA 2D03H 3LRHA 4RWHA 4NN7B 2XN9B 3I3EA 1LO4L 2YPVL 3KLAA 1NMCC 2IANB 3MFFA 4WFFE 2QBWA 3CX5K 3VXUA 1BJ8A 4OGXH 3BVNA 1XCQA 3AS1A 3VH8B 5DJ2A 5MEPB 3UDWC 4ZUSB 3G9AB 3GHBH 3ILQC 1VHPA 4R26L 1ODAA 4ODVL 3BN3B 2CQVA 4MXVF 3HKFA 5HD8D 3BD4A 1UGNA 1FL3B 4HC1L 4K8RD 1P9MA 5C7XH 3EKCA 1DBKH 2WQRA 4PUBH 4WW1B 3THMH 3D9AL 1FVEB 4FQXA 4XVJH 2HJFA 5DJ6B 3N50A 2H2SC 2FB4L 1D5MA 5D2NB 2BJML 1XR8B 4PB9H 2NZIA 4HS6B 4QHMA 1JZ6A 3GM8A 3TNMB 3ARRA 2VKWA 3K7UA 4DKFH 2EZ0C 2K7PA 3W5NA 1KIPB 2VJXA 2EDKA 1S7WA 1G6RH 3C09B 2VISB 2J7LA 5GGQH 3VXTA 3ZL4L 4KU1A 2EH8L 4G9FA 4X4ME 3NPSC 4DVRH 2DQCH 1INQB 3HMWL 3MBED 5F1NB 3M8OL 3HNVL 3P30L 3QJHB 3BJLA 4HJJH 4HC1A 4PLNC 1CGSH 4WW2A 2OBGA 1AKJB 2YKLH 2VDRH 2ZPKH 5DD0L 3N9GH 3ULUH 1CS6A 3U36B 2AGJL 2UWEE 4PRHB 1DLHA 1N26A 4L4VD 3RJDA 2DRUA 4P2RA 5D7JC 3R8BB 4F15C 5J12B 3DHJA 3LDBC 4KC3B 4P23A 4YHKL 2Y7QA 3G04A 1W0WA 1NL0L 2CIKA 3QQ9D 4P4KD 4JGJA 2O61A 4XWOD 3H9ZA 4MXQD 5IB5B 1EAJA 5EBMA 4TTGA 3L5JA 4XAKD 1MHHB 2DKSA 1IL1A 4L3CB 1X7QB 1X44A 3G6JA 4YFLI 3ULVH 3CVIL 3GSNB 4WEBH 2DI9A 1JF1A 1SVCP 5F1KC 3PWLA 5FEBA 2BVOA 4QXUL 2CLZA 1BEYL 4MDIA 4F9LC 2MCPL 1FL5A 4XCFH 1F97A 4LK4A 5CJQH 5GS0H 4FQPA 1XF1A 4NQXB 4K3DH 4Z7WA 4QNPE 1SY6L 4YEFA 4KK6D 1DQTA 2VXSL 3MXWL 4GRLC 3ZHKA 1W72B 3FT3A 3FAWA 4AH2B 1NGYA 5I30H 1NGXB 1XGUA 4KXZH 5DJ0B 1VFMA 3PV6B 2W0PA 4MA1C 1QLEH 2CXGA 3L3JA 5DC0A 3PQYB 1OAXL 3GBMH 4UBDC 3QNZB 3GSVA 2R29L 2ZJSL 5I1JH 4UAOC 4HGWB 3LS4L 4PJEF 1P2CB 2E9WA 5KSBE 5HGAA 2VZ1A 3BZ4B 4G7YH 3L7EB 5B39G 4YXKH 1T21A 3PGDB 3FFDB 4LLVB 1TVHA 3GGWA 5IQ7L 1IM9D 3W39B 5JXEC 3V7MA 2OL3B 2DQEH 5KSBA 5C0DB 1MHCA 1SY6A 5DRXA 4WNQB 4Y89A 1FN4B 2VDNL 4FZ8H 1P84J 1IBGL 2KQMA 2BSSA 4PRNB 1FQ9C 3ZT7A 2GSIB 3STZB 2XKSA 4GW4B 3L5XL 3BP7A 1R3JA 1KTDA 1ZTXH 4NQDE 3LAFA 2HJLB 4A6YL 2QTEA 3OX8A 1OTSC 4FQXC 4K3EH 3VXNB 5C6TH 5MI0B 4HJ0D 5EA0H 2CR3A 2H3NB 4Y0GA 1U8NB 4E0RB 1AE6H 1A6UH 1PBYA 1UYWH 3DHMA 4OGYL 4HIEB 5ILTH 1J0ZA 1XMWA 1QBAA 4DGVL 1AO7A 2IH3B 5DDHB 1CD9B 5HYSB 5DMGD 2V5MA 4Q9RL 2W0FB 1JF5A 3ECBA 3TBVB 5D1QD 5GS1B 1FO0H 3DX9A 2FJGA 1UH2A 3B9KD 5JW5B 1FNSH 4MNGB 2IMNA 4ZS6C 3QUXD 5IQ9B 5I9QB 4JFPA 4HUNB 3QT2A 4HUWA 1G7MB 2Z35A 3HG1D 2RHEA 2DF3A 3UTQA 4NN6C 3HE6A 5DEGB 5EPMB 3FFCB 3VG0H 2XYCA 4WW2C 3DBXB 1DP0A 4UQ2B 3N85L 3SE9H 3VFMB 5TF0A 5HI5C 2R9HC 4K7PX 4HUVB 4ELMF 4H1LG 2XN9E 3KXFB 1I9EA 4M8QA 9CGTA 4FXKB 3S96A 3H3PH 5TDNA 1T7XA 1N8ZA 1G7JB 4IIQB 2YD7A 1P5UA 4YWGL 4RISL 1KIRB 1Z9LA