3X3GH

Fab fragment from anti trail-r2 human agonist antibody kmtr2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
224
Chain Sequence
QVQLVQSGAEMKKPGASVKVSCKTSGYTFTNYKINWVRQAPGQGLEWMGWMNPDTDSTGYPQKFQGRVTMTRNTSISTAYMELSSLRSEDTAVYYCARSYGSGSYYRDYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPCSRSTSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Heavy chain of KMTR2
publication title TRAIL-R2 Superoligomerization Induced by Human Monoclonal Agonistic Antibody KMTR2
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 224
sequence length 226
ec nomenclature
pdb deposition date 2015-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3x3gH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3x3gH01
2QR0A 2APFA 3OB0H 4TNWF 5D96C 3GJEB 4BSVB 3O41A 4P4KD 2XN9A 1ACYH 2FEDC 2QBWA 5D7JC 4BQBA 2D31B 4O02H 5KANG 1G0DA 3RZCB 2VDKH 1JZ4A 2OJZL 1AO7E 4ZYKA 5DTFA 4J8RA 1YC7A 5J12C 3KPLA 4FXLA 4ERSH 4I4WA 1E4KA 4HGKC 1SEBA 2VE6A 3LQZB 4ONFL 1ZTXH 1KYOJ 2WP3O 4P23A 3DPBA 5FGCB 3SQOL 2EE3A 4NKDA 3VI3F 3CFEB 5EPMA 1JHLL 4F58H 4W6YB 5AYUH 4M6AA 4QO1A 1YMMA 5JA9A 1ZLUK 3LHPH 4L9LB 4NZUH 5HHME 4BSWB 3FZUD 2X7LB 4MD0B 3TLRA 4Q9QL 1NCCH 1ED3B 1KB5H 5IVXE 4FZ8L 1UKTA 2D7MA 1MRCL 2FX9L 1WBXB 1AE6H 4GG6B 4HZAA 4QRRB 3K74B 4PJ9A 25C8H 4E5XB 1BGXH 2DQTH 5L8JB 4NHCL 5CP7A 2FJFB 4JM4H 1T7XA 3KPSB 1P7QD 3HE7D 5IF0B 5IG7A 1LP9F 3ROLB 3KNBA 4TNVF 1X3DA 4F3FA 5ESVA 3TESA 3MZTA 3AFLA 1T3FB 3UJTH 5INCA 3MGTB 3EYSL 3V8OA 2O5YH 2V2TB 4L3EB 2FGWL 4DFHA 2EE6A 4QXGL 1MFEH 5DEFA 1MAMH 5BV7C 3V6BR 2CDGB 3DX7B 5M7QA 1HZHL 4XP5L 3BWAB 2HLAA 2JK5B 1FO0H 3HNVH 4S1QH 4WO4D 3TYGL 4PY7A 1XR8A 4G6KL 3EYUL 3E8UH 4M5YL 3MBEA 2RCSL 3KXFA 4FP8L 4IRJB 1CU4L 4HX1A 3DIFA 2GYSA 1FFNB 2ATKA 5IIEB 1N8ZA 1KFAL 2R9HC 1XGTA 2FEEI 3GKZA 4Z8FH 4MJ6B 1U42A 4HKJB 4K8RH 1RZ7H 2AJUH 2ENYA 4RIRA 1A22B 3HPJB 3EJZC 1HN1A 1WICA 5HYJA 3GBMH 5KSAB 5DGQA 5F1IB 1RV6X 4YAQA 1ZHLB 2IQ9L 1FCGA 3OAYH 4WW2B 3W9EA 4DGVH 1JF5A 1RZKL 5F9AC 4WUUE 3MRKA 2YHGA 3NOIA 4P2QA 4WWKA 4YR6A 1WIOA 3HA0A 4EDWH 3HPLB 5F6HI 4TVPL 4JPVH 4BJLA 4D3CH 5EIIB 4DN3H 3B9KA 5GGUA 3W9DA 3P2TA 3NZHH 4KKNA 3CDYA 1FC1A 5F93C 4YHKL 2MMXA 5D5MB 4X5LA 1KEGH 2Y06L 2PNDA 3AM8C 3RFZC 1NC4A 3VG0L 3PWPA 5I18L 3QXUA 5ALBL 1GC1C 4Y19A 1NFDF 3QWQB 5FGCE 3WS3B 4M7LL 3ORJA 2PYFB 3NCBB 4J6RL 2HFGH 2JTDA 3GO1L 5HYQB 5DZOA 2H2SC 3CVHH 3HNSH 4LSDA 2DQCH 4HXBH 1Q9LA 1A6WL 1XF1A 2DICA 4K94C 4WJ5B 3GM0A 5GSRB 4XNMB 4JN2B 4NKIL 5HGHB 4IMLB 3MMEA 5FA3A 3UZVB 4ESKA 4GG6E 4H8WL 4QRRE 3INUL 4YNYB 5EC1A 4IIQC 5D7LD 3KPSE 3UCRA 4XXDA 3DXAB 4X6BA 5GGVL 4O2CA 2A6JB 4XI5D 4AH2B 1I7TB 1A4JB 2WWMC 5KVFL 1XF3A 1TJGL 4L3EE 2NW2B 3V6OE 3RTQC 2H26B 4NKOB 3RNKB 5IB3A 5EU3B 2VLLA 2VISA 3FQXA 4XMLL 2EDXA 1CXIA 4FQJL 4QY8A 1T5WA 4Y4FC 2EYSA 2FR4A 4GKNA 1ORSA 2IQAB 2C3WA 4P4KC 3NPSB 5DMIH 4DUWA 3PNWA 1S7XB 5D2NA 4UIMB 1UB6B 5BZWA 3BIBX 3GSRB 3Q3GB 1LEGB 4MCYA 3DVFA 1OWWA 1J1XL 2EICA 5JTWA 4H88H 4OGAD 4QRQA 4PB0H 2X1XR 5DEGB 4UBDD 4TULL 3MV7B 1AKJB 5I6XB 5JZ7D 5HHPB 2DYPD 3QXVA 3T0XA 3FO9A 3FAWA 4LHUD 1BOGA 4CJ0A 5BJTA 5JIPA 4Y16B 3LPWA 4NC2B 4MX7B 1KJ2L 2EC8A 1BBJB 3FZUC 4YUEH 5CJXA 3QHFL 3NAAL 4U1NA 3MRLB 3S5LG 1U6AH 2WSKA 1P4BL 3CLEL 4JO4H 3IFPB 5GJSH 1DVFD 2ZKHH 1FO0B 1HQ4A 1NGYB 4LEOB 1OT1A 5T1LA 5E6IB 4P2OA 5DD6B 4TRPL 1ZT7A 4G3YL 1GL4B 4BYHA 5EBWA 1IGCH 4OZIA 4RFOH 3CC5B 1NGWB 3G08B 2YUZA 1KT2A 1DBJL 5TFSL 1RIUH 4LLWB 5D5ME 4XVTH 1WBYB 2YA0A 3RA7H 5I1AB 2W9DH 4KUCF 2WQ8A 3FKUS 2NNAB 3MRCB 3NZ8B 1NFIA 5EU7C 4PRIB 1A47A 3MLWH 3L7EA 1O7SA 3QUXD 1YY8A 3AB0C 4WO4C 1MAJA 4Z7VF 4JZJA 1DBKL 4XP6H 4XCFH 3VWJA 1CFNB 3EO0A 4LIQL 1H3XA 3GMOA 3IDMA 5DQDL 1P7HL 4H0GA 5CUSH 3L3OA 1KTLA 4HGWB 9CGTA 4Q58C 1IKFL 5EOTA 3TV3L 2BSTA 5BVJA 3LRSA 3WLBB 5IB4A 1HHJB 2AJYL 1JV5A 5FUCE 1K5NA 2VZUA 5SWZD 1IQDB 4OLVH 4L8CB 3VDCA 3O6ML 3V52L 1UZ8B 4NQDD 3W11D 3TO4B 3DXAE 3VFMA 1VEMA 4OFPA 5EO9A 4G6FD 4ZTPH 3RX7A 4NQSA 5ADOL 1MHEB 5C0FA 2YXFA 3LB6D 4MGXA 3O2VH 1UM4H 4U33A 1J87A 1JF1B 2AVGA 4UQ3A 4J12A 1NUDA 5IBUG 4LKCA 4QWWD 1EZVY 4JG0H 4KC3B 2A77H 5D1QB 2BY0A 4R4ND 4HEPG 4QTHA 3V6ZB 1QSED 2AK4B 3C5JA 5FECB 3AC0A 3A6BL 1MCKA 3D25B 4M7JH 4HWBA 5D6DA 5LG1A 2BSED 4WI5A 2ICWJ 5L2KA 4OLEA 5ICZB 5MEPA 1R0AH 1CTNA 3WIIL 4P2RB 4KK8C 1LE9A 2C1PB 4WW1B 2AJXH 3CVHB 3CAFA 2AJ3B 5HSFA 2C9AA 1U8PB 5F96L 3IXTB 3VXMA 4LSRL 1TDQA 3FONA 4TQEL 3EUUA 5L0QB 3UTQA 3DVGB 5C0AB 1RUAH 1JI1A 2LU7A 3TBWA 1HXYB 2W60A 1Z0MA 4Z78A 3MV7E 3O3AA 2DQIL 5E08H 3BPNB 3STLB 5JPMA 2NY3D 2OBGA 4PJIB 3TN0A 2PYED 4KI1A 5DJXA 3VGBA 3BSZH 5ADPL 2CR6A 3MRGB 1LO5A 4I0CC 1RURH 4TPRH 4ODUB 4NO2B 5I66A 2R2BB 4PJ5B 4ELMF 2B20A 4GRMB 4LPYA 1I3GL 3AROA 5LGHL 1T20A 1DL7L 1HHGB 5DJ8B 2W91A 3WDJA 2KZ1B 3D48R 1FLRL 5ANMA 3ZDYF 2GTWB 3ISWA 1NCBL 4OT1L 4AENB 4N90D 1AGBB 2R56H 2NXZB 3KYMB 4L4VA 4WY7L 5E4EC 4CW1B 5I1LB 5F7WC 4X98B 3BFOA 4XI5C 3ETBF 4OZGB 1ZWIA 3BJ91 4QOKD 1UQSA 3DECA 3GMNA 4XMKL 5I1IL 3V5KB 2E8ZA 3G5VA 1KGCE 4RNRA 5EU5A 3HNTH 4JDZB 3A6OA 2IPTH 2Q6WB 3U36A 2H8PB 1CR9L 3JXAA 4PRIE 1BX2B 1RIHH 1MLBA 4UDTB 3QH3B 5L88H 1INQB 1ZANL 4OCWL 1WEJH 1BF8A 5MI0B 2IGFH 3QUMH 1OSPL 2ZPKL 1C1EH 1S7SA 2VO5A 1S7RA 1HKLH 4J3SA 3GSQB 4OGAC 1TVHB 5F7DA 1N4XL 1CDJA 2RFXA 5JPNB 2XKNB 3F7RA 1KPRB 5C2BH 4NZTH 3JVGA 1RQ5A 2P7TA 3KPNB 1BM3L 5I8EB 1JZ8A 1T89A 5HGAB 1IGIL 5ISZB 7FABH 4M7LT 4YHYC 4X9IA 4DWHA 5I1EH 5B21A 4RX4A 1N3NA 1AI1H 1XH3A 3H6JA 5I1CL 4LOUD 2AK4E 3UP1A 1JF6A 4RFEA 1ADQH 1DVFC 5SWSB 1KIQA 1YEKH 5E5UB 1Y18A 4Z7WF 4JANB 5K9JL 5EN2B 1GYAA 5MEQB 4JRYA 3MRJB 4OUUB 4P2RE 1AY1H 2R1WA 4GKZB 5D8JL 2Q86A 3DTXA 3V4PL 4LHQB 4JFZL 4DVRL 5H94A 3TWCH 3G9AB 4UNTA 2PETA 1EHXA 3MLRL 3GIZL 5HTSA 5C0AE 4IRZH 2R2CA 3PDOA 4RQQB 3KJ4C 2XZCL 4M02A 5T33L 1KCRL 4PJHF 5HHOA 2VXVL 4KV5E 2D9QB 1D5BB 2I60L 3W5MA 2DM3A 3B9DA 3QUXC 2OMNA 4GQ9L 4PJIE 3UYOD 1FV1A 5IESL 2JELH 4NNPL 3NA9L 3KPOB 5TE7L 2YMXH 1XCQB 5IB5B 1K2DB 4V1DD 1ZVHA 3HMXH 5F7EH 1A3RL 2FSEA 1Q9WB 4B5EA 4PJ5E 2ESVD 4QHNA 3GKWL 5I71C 3HI5L 3IJSA 4I8DA 5DHVH 1DQDL 3FFDA 1SEQL 1PY4A 3IU3B 3BVNB 4O00A 5EC2B 3I9GL 5B3JE 3LKNA 3VFTA 1A8JH 3W11C 3WJLA 1UYWL 1P2CA 2BNQA 4S2SA 1DN0B 3GI8L 3L3IB 4BZ2H 2F53B 4X4ME 1RIVL 4PB9L 5D9SA 4OZGE 1TCMA 3LB6C 1RMFL 3VU2A 3BGMA 3WKML 3D2UD 4WFGD 3R06B 4QWWC 3VXUB 1IC1A 4PGDB 2A9ML 2R1XB 2VLJA 4R4NC 1P53A 3EO1B 3KPRB 2F54D 1J86A 2V7HB 2LE9A 4QRTA 3REWB 4FS0A 2J8UF 3BEVA 3WXWL 2MOVA 1C7SA 2BZDA 4XPFH 2VJXA 5EZJA 3CFCH 4Z7QE 5CJOL 4OF7A 4XT1C 4KI5D 3QWOB 2BFVH 4XAKE 5EWIL 4MDIB 1QBLH 4N0RA 1HOCA 4MMZC 3HCVA 2M2DA 1F4YH 1CLOH 4LASL 3A6CH 1MCQA 4XC1H 1YN7B 4DUVA 4XC3L 1F4WL 5T1MB 4PG2A 2UZXB 2Q8BL 1CBVH 3HZKB 4LCIL 1PKQA 3TBSA 4AQOA 5ITFA 2VABB 1TNMA 3AMKA 1JYVA 3V0VA 1G7HA 2NY3C 3BD3A 5JQHC 3UTZA 4XPAL 4BQ9A 3LEXA 3MSPA 5ISZE 2V9RA 3HG1B 3BUYB 1J0JA 3KJ6L 5DFWH 4LVNC 2JKXA 3V5DB 3F8UB 1JN6A 4XB7A 1UCTA 1XCTA 3GBLA 1DQQA 3P73B 3KLDA 5C0RH 2X4SB 3A67H 1T4KA 2Q3ZA 4AY0A 5SWSE 2BHUA 5IMKA 4S1DD 2BOBA 3FQUA 1S9WB 2AEPH 4R96B 2PXYB 3QHZL 4HIIA 3QUMB 1P4IH 1Z3GL 4JFYA 4NPYA 4XAWH 5B39G 4PV9A 5HD8D 3MRFA 4X80H 1OGTB 2EIZB 3N85L 4FZ8H 4ORGB 5C0JA 2E6QA 3T2QA 4K7PL 3QXAA 4AG4L 1U36A 1MRCH 2APTA 3DGGB 3MV9A 4NN6B 4NHCH 3PGCA 4YHZL 1NCWL 4KRNA 3T3PF 1VB9A 4HEME 4M6OL 5HPMB 3VFUA 4U05A 3U30B 2EDKA 2D4DA 1A14H 1QNZL 2ARWA 2X5PA 1RJCA 4K7PX 2BERA 4M7KH 3RVVD 1BWWA 4FXGA 4FRWA 2B4CC 1HZHH 2KBGA 4XP5H 1R5WB 2DLGA 2IPKA 2Z31D 3TYGH 3UTTB 1J5OL 5CBEB 5DJAB 4PREA 3ZE0F 1JRHL 1ZV5A 3PP3K 4M5YH 1VACB 2NW3B 2D7TL 3BD4A 3I75A 5DD0L 5I75C 2OXHA 4XNUL 5FYKD 2ZG2A 2F53E 4U31A 4FFZH 4EI5B 5IR1B 4I77H 1FVDB 2Y36H 4YFEA 4D0CA 1NGZB 3VXUE 4JKMA 4FZEL 4LOUC 4HC1L 5IGXH 2GHWB 3KPRE 3VFSA 2PO6B 4BH7A 4GH7B 4HBQA 3P77A 1PX4A 3PHSA 4X4YA 2B39A 2BNUB 3ZYIA 1AR1D 3CFIC 2AEIT 1CLZL 4MD4A 1L7IL 4MAYB 1CG9A 4Q6IC 4BFIB 5TF1L 3MJ9A 4JVWA 5B38G 5DHVB 1X4XA 2IBZY 3O2DH 4LVHB 4GRLB 4JKKA 3WIHH 1N26A 8FABB 1IM9B 4C4KT 3T4YB 1CFVL 1LP9A 2UZIL 5ACMA 5F1SA 4OFDA 2VIRB 3GMRA 3L9RA 2XN9D 4DZBA 2UZYB 4JFEA 4O2FA 5AYQA 3ZL4L 3L5WA 3HG1E 5TJWK 3QIBA 1RUKL 2R4RH 2W9EL 3VA6A 4WHDA 5FYJL 2Y1VA 1A21A 3WD5H 3WS6A 1EMTL 4LHUG 5ALBH 2EIDA 3NIDE 3L3GA 4QYOB 2Z91B 1IGJB 5KSVA 3ULUH 4QT5A 5JNYB 3EDKA 5GRJH 2CLZB 4GBXB 1YMMD 1UXWA 2OXGA 4ZFOA 2NY5L 1MCSA 3IETB 1I8KA 4U2YA 3V5HB 1IEAA 4X6CB 2X9XA 1ODAA 2JLLA 3FRPG 4HHAA 4Y5YA 1IC7L 1VGKA 4K9EH 5MEOA 1A6ZA 3OKMB 1A7BA 2HTKD 4NQXA 4R6UA 1H3TA 2CO7B 1FFOB 1JZ2A 4QRPB 2K7PA 5D1XA 1NFDB 2KL6A 4XP9L 1G9NH 2ZNWA 4L1DA 1FVCB 3IKCA 5FF6B 5EU6B 3VI3E 4JHWL 4KI5C 1TFHA 3B9EA 3BEWB 4HSQA 5C7XH 1FGNL 3EOAA 4WU7B 1QFUL 2BVOA 3QCUL 2GCYB 4BELD 3WFDH 4DOHB 4HS8H 4XMLH 3VFNB 4FQQA 5IT2L 2A1WL 1FL5A 3RWHB 1FHGA 3VGDA 3UTTE 1HQRA 3NCCB 4K3EH 5F89A 2MKLC 4NHUB 4H20L 3QISA 1BFVH 1P4LA 3MBED 5H37G 3KXFD 3TJHD 4M43H 5SX4I 1MQKL 3IXAA 3OKNA 3GSUA 5KANI 1IGYA 2A6IB 1LO3L 3P0VL 3AXLB 4XNXL 2EKSA 2E7LC 1BPVA 3DSFH 3RWEA 1UM6H 5J13C 3V4VL 1VSCA 4OF8A 1VFAB 1A6AA 1BD2B 4NGHL 4K23H 4S1DC 4XMPL 1EO8H 3T65A 2CUHA 3UZQA 3F12B 3H9SA 1BJ1H 2FECL 5HYJD 4PY8J 4OZ4A 3HI6L 3QDAA 3ALWA 1FBIL 1NSNL 5K9OB 1P6AB 5HD8C 1AGEB 3QHFH 5IHLB 4LL9A 3RP1A 2D9CA 1WCBA 5IW6A 2NX5E 3FTGA 2UVEA 3HC4L 2AKRB 5JOPD 3ARWA 5GS2D 3G5ZA 3EYQD 1D5XA 1RZGA 4WWKD 4UOJA 4KU1A 1QD0A 3TNMA 2GI7A 1LO2L 3MGOB 4M6MH 2YPVL 4IJ3C 1Q9OB 1MI5B 3B9KD 3LY6A 1NDGB 1T0NB 1QBAA 2VDPL 4XWOD 5TFSH 1AHWC 4F57L 3DX9B 4GKOA 1IGTA 5JLZB 3FMGL 3RVVC 4XPHL 3CPLB 3PWPD 4X8XA 3PL6B 5AWNL 4UIKL 4I0KA 1HHIB 2JJVA 2A6DB 3LKPB 1Z5LB 5BV7L 4LBEA 2G9HA 4Y19D 2JJUA 2Z31C 3ARFB 3HR6A 4PTTA 2IPUG 4KROB 2ZCLL 2MHAA 1H15A 3C2AH 4F7PA 3NGBC 1K3ZA 4QHLB 1IGFL 4XZUA 4ZNCD 4P4RA 3DROB 1JHTA 3FQNB 2NQCA 1I7ZB 1J10A 4PFEA 4YGVA 5HDQH 1E4WL 2DWDA 3UTSA 1BQHG 1QSFA 4NQUA 4X6CE 1D9KA 4PBXA 4Y5VC 2O61A 4XHJD 5DMKB 1NC2B 3C6SA 2ZCKL 3TV3H 3E6FA 1FAKT 2UWEF 1JGUH 1X5AA 4GAGL 4TTDD 3STBA 4YXLL 3BGFB 5HI5D 4QRPE 1OY3B 1CK0H 1AGCB 1NFDE 3FOLB 1OPGL 3EYFB 1YEFL 3KVQA 3SKMA 5I2IA 5CCKH 4O51B 5EU6E 2RIKA 1AR1C 4I0PA 4ZTOH 2VL5B 3EIFA 1U8LA 3FN9A 5DS8B 4PGJA 4DOHE 2OM5A 3LZFL 1PGRB 1MCIA 3A6BH 1I8MA 5SV3A 4RFNB 2ZUWA 1FG9C 1N64L 4EUPA 1RVFH 1DBBH 1RUQH 1F6AB 4OF6A 4QXTB 5FO7A 4H5SA 5IFJB 1UWGH 3QDJA 2EYTA 2ATPA 2AI0L 5E1HB 4TNVK 2EDEA 5AAWA 4OTXL 2F74B 1QSVA 3SQBA 1MIML 5E5MB 1JRHI 4GW5B 3C60B 4PRHD 4OLUL 3WUWG 1I3UA 2NR6D 4HJ0D 1E4KC 3P4MB 2DQIH 1IE5A 4PJCF 5AAMA 1BD2E 3IB4A 1GC1L 4MB4A 1EJOL 5C3LD 4LP4A 5IVXA 5J0BA 4MXWL 5DZLA 1U8JB 4PJ8A 1FSKB 5AZEH 2F5AL 3IDXH 2YWZA 5DUBA 3O3EA 5T3ZL 4I18A 1D3CA 5IB1B 2NY7L 1XGRB 2LV4A 4K94L 3ZKQD 5C9KA 1I3GH 5DZNA 2I5YL 2HTKC 4LSSL 3RVXD 4FQLL 4OZFA 1FZKA 3BZ4B 4M9PA 4J3WA 4RGMC 2D03L 4H0HB 5J6HA 4I2XA 3WNMA 1N0XH 2EIEA 3O0RH 5T1LD 1F11A 4OT1H 3KLSA 1FE8L 1U92A 3P4NA 1YQVH 4ISVA 4UINL 4P2OD 4CU7A 1HILB 1MI5E 1FZOA 5GXBB 4R4BB 2V2WB 4PJ7A 1EFXB 2HJKA 1I3RB 1NEZG 4L4TB 5DURB 1K8DA 4KQ4H 2XT1B 5FO9B 3HI1B 5DUPH 3QCVL 5MENA 1X6LA 1A7RH 4H0IA 4Y1AA 2AV7A 5CJQH 1B4RA 3GI9H 3W81A 1DP0A 4XCEB 1YQ2A 3FJTA 3OV6A 2ADFL 4NQCD 2OK0H 4XTRD 2H3NA 1Q1JL 3IT8D 1A1NB 5FHBL 4LPXA 2X4OB 3CSPA 5DI8B 4X9FA 3MACH 3MBEC 3VWJD 3TJHC 2OTUA 3X3FH 3CMOL 5F9WB 5IHZA 3HAEH 3VXOB 4YPGA 4FXKB 3OWEA 2CJUL 1E6JH 5HDBF 5I0DA 4PGEB 4HF5L 2FHCA 4MNQB 4XBEH 3H0TA 4XVJH 4LMQE 3OG6B 4L3CB 5IOPA 1MVFA 3OAZK 1T1XA 4TVPE 4U1LA 1ZLSH 5LWYL 4UILH 2J2ZA 1IILE 3MLUL 4XRCB 4Z7VE 2EDFA 4PG9B 1PLGL 3BPLC 3CGTA 1S9KC 4MJIB 4GG8A 1UH3A 1XZ0A 4ELMA 4P5MA 3K4ZA 3QCTH 4XVUD 4IOIB 4X7EC 2DOCA 1RSFA 1YEDB 4MA8H 1IBGL 4NN7C 1JWSB 3WNPA 5I1CH 2E9WA 4ZMAT 4LU5L 3VFPB 1OM3L 3EYQC 4WWKC 3L3HA 4PJAB 4QHKI 5K9JH 3JUYA 5ILTL 1KJ2A 5CEZD 5L2KD 5I1HH 3ULUE 3H7BB 3HR5B 3GMPB 2XQYK 4HIXH 5HHXH 1OAYL 2ZJSL 3O4OB 1F90L 2V6HA 4JFZH 5DRZB 4XWOC 4HAGA 5EFIB 5E8PA 3VXMD 2ADGB 3D6GA 4L8SC 3GIZH 3MGAA 1MNUH 1JHKH 5I19H 3DUSB 1MVUB 4OCLC 1FQ9C 2DKMA 5DC0A 2VLRA 3I6LE 3H2WA 5A16B 4MWFB 1GZPB 1Y6NR 3U82B 4KQ3H 1IMHC 2I60H 2KQMA 1A7NL 1ZGLB 4KAQH 3MLTB 1ED3A 1DSFH 1U3HA 1VHPA 3TN0D 3MOAL 3VG9C 4PUBL 1WBXA 3D0VA 2Z35B 3FT2B 2BY2A 2HFFA 2FJFA 2VR4A 3KPSA 5DMGD 4XHJC 1EJ6A 2FECI 3HI5H 1BOYA 4JFFA 5F6HJ 2ITDA 5CGYD 4TTDC 1J88A 5GS1B 3IU4H 1NH6A 1QA9A 2BOCA 1BBDH 3KHOA 5HI5C 1QFPA 4PJHB 2GK0A 1LWRA 3WFBH 5HYSA 3LN5A 4JGUA 2V2TA 4MA7H 3L3DB 3QDGB 1VKXB 3TA3B 1NAKH 3PGDA 5IFHL 1RIVH 1S7UB 4PB9H 2CDGA 3DX7A 4NC1E 1G6RH 4L4TE 4AK1A 3QEQB 4CVZA 2AV1B 4YHLH 4GUPA 2X2YA 4Z9KB 3FB6B 1W72H 3K8LA 3BPOB 1MIEH 4F7MA 4ODSL 1MHPL 3ZKXB 2RQ8A 4Z7WA 3WXWH 1Q38A 3ZDYE 1QFOA 2ITCB 3C09B 3T1FA 1AQDB 2GJ6E 1R3LB 3WBDA 4IS6B 2HVKA 4HJJH 5EWIH 4EXKA 2HH0L 2HG5A 4NUGL 4Q2ZB 4EJ1C 1IJ9A 3HPJA 4LASH 1JUFB 4N8VB 3CUPB 1U8KB 1NMAL 1F58H 3RHWF 1SJXA 4MNQE 1YNTB 3P4OA 2NR6C 3MJ7B 4HJ0C 4ZS6D 4E41A 1FNEB 4KKLD 3TH3T 2QQLH 4WW2A 2J8UB 4U1SA 5IQ7H 3RKDD 1WK0A 1ZVSB 2BVPA 2CRIA 4MJIE 2X05A 3MYJB 1EHNA 3F7YA 1FFPB 4RX4D 5CJXC 3K3QA 3KDMA 4G8GB 2AABH 3OKLA 5E9DD 1LK2B 3FFCD 3VFGH 3W2DL 3B5GA 1QYGH 4PJAE 2ZZUT 5I74B 2UUDH 2FB4L 4RAVB 3SGEI 1WLHA 3ROOA 5DK0A 5DWUL 4JRYD 5LAXB 1TVBB 4Y4HD 3QHZH 4YBQD 4P2OC 4HFUH 3UDWA 4LIQE 3S98A 1ND0B 1QP1A 3JTSB 1JZ6A 3HAEB 3MROB 2YPKA 3LN4B 3T0EA 2P8LA 2XFXB 4NWUL 5DF0A 2YD2A 3KLAB 2ICEB 4JB9H 3BDXA 3KG5A 3C8KA 5F1OB 3LEYL 4OFYA 4JPIA 4XCNB 5HHOD 5TF0A 1HH9B 3SGDI 3SO3C 4XTRC 4ZS7H 1WBZB 1LEIA 1J18A 1YY9D 4PJXB 4JZJC 5MP6H 4WJ5A 2JCCB 1KJVB 3QEGH 4XNMA 3VWJC 3G5XB 5HGHA 5CBAB 1IC4H 1IARB 5K93A 4JPKH 5GZND 5FAAA 1WAAE 3DHMA 4NFBA 3ECBB 4HFWB 3CFJB 1A9EB 4LLUB 1HH6B 4ZFGL 5C0DB 3CH1A 3M1BB 4BKLA 3DURB 4LLDB 1EGJH 1NL0L 3G6JF 2A6JA 5TQ2L 1MWAL 4G8FA 4LCWD 1A4JA 2Q3AA 4PJHE 4WHTA 3RWGB 3S96B 1UJ3B 4DEPC 4K71C 1F00I 2ZUQC 2D7TH 3QDGE 1L0YA 3KWWB 4JPWL 1ZK9A 4XNUH 4GXVL 3WFCL 3RU8H 3VRIB 4S1RL 4NCDA 5SWQB 3QEQE 2VDLL 4YHIB 1MFDL 3SDCA 4HJGA 2VLJD 1PZ5B 1S7XA 4NO5A 2WBJB 4L8DA 4PRBB 5LKNA 3QUYB 3NH7L 2B2XL 2X4NA 2HT4D 5KVGH 3Q3GA 1S7WA 3UC0H 1KB5A 1S9YA 2WINB 4LQFH 4ODTH 3BW9A 3W0WB 4ZO9A 1QQDB 1DUYA 2OR9L 5GHWL 3MV7A 1TLKA 5D2LF 5IVZA 3VWKA 5IV2A 4OZHF 1FYTA 1SVZA 4WNQA 3SJVA 4DAGL 3REVB 5HVWA 3L3JB 3IAGC 3MRIB 3LQMA 4POZD 4Q0XL 4QHUA 4BZYA 1DQML 4NYLB 2GEEA 5C0BA 4MX7A 4KJWD 2NY2B 3E1F1 2UZIH 3CZFB 1YEHL 3QBTB 3MR9B 3MLSH 4W6WB 2J8UE 1DBAH 1CN4A 1CDIA 3TN0C 2BMKB 3MNZB 1KN4H 1TCRA 2G60L 1AIFB 1WV7T 2WWKT 4XX1G 1R5VB 3ZTJH 1FN4B 5EZLA 1F6LL 1BZ7A 5DMGC 5E6IA 4G8GE 5F7MC 2FO4A 4X83A 2HKFH 4NOBA 4FQ2H 1UKSA 5CGYC 4LARH 3CC5A 1PYWB 1WBYA 1MELA 5C6WH 1X5KA 32C2A 1DANT 4QEGA 1QG3A 3VJ6B 2R69L 4FQCH 3AU1B 1VCAA 1GSMA 2NY5H 1G7PA 2NNAA 4O9HH 1WZKA 1PQZA 1NCDL 3E0GA 1NMCC 1SM3H 4HK3N 4R3SB 2XZZA 1X9QA 5IM7A 1A3QA 3OGCB 5GJTH 3LKSA 3SKNA 1BQLH 4MJ5B 3MV9D 4XP9H 2FRGP 3ARXA 5EUOB 1I1AB 3GSNH 1RI8A 2B1HL 4YXKL 4OD1H 4YDJA 4JHWH 2JCCE 1MJ8L 3ARZA 5TH2B 4XNZB 3U1SL 4MMXC 4YGAB 1PZUB 1TTGA 3WLBA 4HQQL 5K59E 3CK0H 3X13B 2YUVA 1IQDA 1YEGL 3U4EA 3LH2L 3IFNL 4D9QD 1JGVH 3MRQB 3TO4A 1TJHL 4CMMA 4M5ZH 3N0PB 3I6KA 5IT2H 3GIVB 2WIIA 5BXFB 4ZS6C 5FYLH 4KKLC 1JPGA 2CSPA 1QFWH 3JVGC 4YC2C 1MCOL 3T3PE 3I2CH 5D1QA 1T89C 4FQIL 3RKDC 3V6ZA 2QEJA 3O6KL 1MCLA 2XA8H 1B6UA 4OB5L 4DCQB 3QJFB 2V17H 4HS6B 3DOSA 1DUZB 2X4RA 4XNXH 3MA7A 5ICZA 4OCXL 2M26A 2F5BL 4MNHB 1WFOA 5GGTL 3GRWH 4JCMA 2E9JA 4ODBD 1OAUL 3F62A 1PG7W 3CVHA 2AJ3A 4Z0BH 4YX2L 1F3DJ 1Q9KA 3IXTA 3GMMB 1QBMH 1A1OB 5C9JA 4Y4HC 4YBQC 5EOQH 1H5BC 5C0AA 3QAZB 3WDIA 2DJSA 4K3DL 1U8HB 1NSNH 3TBTB 4NO0B 5KVDH 3ARGB 5DHYB 1MPAL 3C08H 3FB5B 1MLCB 3P9LA 3W0WE 2NMSA 1FORL 3DRTB 4ORZC 3TVMD 5DK2B 3IJHB 1QVOA 4NRXA 4JREB 4XCCL 5E8OB 3ULVD 1TQBC 1XGYH 1NBQA 3WFHB 1ITCA 3HC4H 4U7MA 3BP6A 5I8OL 5J11C 5I73C 2X70A 2P44B 1P1ZA 1E6OL 5JO5A 4EIZC 1TXKA 1YY9C 4WFEE 3TO2A 2W1NA 4JFED 3RY6A 3ARTA 1RU9L 1UWEL 4N0FB 3VE0A 1HHGA 2LQRA 5GZNC 4P2YA 5A2IH 5EBMA 4OJFH 2J4WH 3BKCL 3FMGH 4HIJB 4GSDH 1NJ9B 2VL4A 4ZPVB 3ILPB 3U7WL 1YUHB 4AENA 1K8IA 1AGBA 3RJQB 1JP5A 4GMTL 4H25B 3UO1L 2B4CL 4J3UA 3WN5B 5IB2A 1HKFA 4NM4L 1YEEH 1YMHA 3JV4A 1LO0H 3VFRB 1V7NH 1JWMB 2PW1B 1R3IL 3CU1A 4PRAB 2ARJA 1K6QH 3WJLC 5ECJE 5EBLB 2VITB 1JTPA 5DT1H 3C87A 1KCUL 2Q6WA 2UY6A 2EDBA 3QG7H 5IW1B 3BP5A 4U6HB 1BX2A 2H2PD 4OF3A 1JGLL 5C71A 3GFUA 2ZCKH 5IJVB 1YNLH 1CL7L 43C9B 5J56B 4RA3A 4DVBB 5A1AA 3UYRH 1BZ9B 2YKLL 1HI6A 2IAMA 3OR6B 5TDPB 1CFSA 2HT4C 5EUOE 1ZGLP 5D1XD 3O11A 2VLME 5KOVC 3QIWB 5JW3L 5JUEL 4M4PA 2XKNA 1OAQL 1NGXB 1BJ1J 1KCLA 1LEKA 1ZHNA 3QNXA 2DJUA 4RZCA 1OGAB 4M1DH 4XPGL 5D93C 3QIUA 3ALPA 1LDPL 3IRPX 4AMKL 3DYOA 4NNYA 4POZC 4NQVB 5ACLA 2R2EB 4PG2C 4MVBD 3NN8A 4KJWC 4HKZA 4BUHA 2VXUL 2H1PL 3ZKND 3RGVA 5KG9A 2FLRT 2V7NB 1MEXL 2AI0H 3HE6A 2HAZA 4Q9BA 3RWFB 4HUWB 4OTXH 5JIHA 3SDAB 1OLZA 4LVOB 1MIMH 4OQ1A 4MA3A 1NUFA 3RUGB 3DVNB 3MRPA 2A6KB 2GT9B 4OLUH 1P7KB 3Q5YA 2LTQC 4GKZA 1AR2A 5E8DL 4IOFD 2UY7A 1NGQL 2OTWB 1M05B 5KN5A 4ONHA 4UAOB 1YECH 4JHAH 3ULSB 4X7SL 4QRSB 4PJGF 4MXWH 1PBYA 3P30H 2J1KA 2VN7A 1JNNH 3NFNA 5E8NA 3U48A 3OZ9L 1T1ZB 4KWUA 2ARJQ 1N6VA 5JXEA 4V2CB 2XTJB 4S11A 1J0IA 1D6EB 3D3VB 5KAQG 3KPOA 2UWEA 4P5TB 3VDAA 3CFKB 1XCQA 2MFNA 3UPAA 5J3HD 5LJYH 3NPZB 3D85B 3C8DA 1Q0XL 3MCLL 4APQB 1Q9WA 1FE8H 1KN2L 5E8EB 1H8OA 5LXGL 2BVUA 4LAJH 4U2ZA 3OKOB 4IRSA 5D7JB 4XP4L 1KB9K 4WHYG 1T80A 4H26B 1NCAH 1CGVA 1I3VA 1J8HA 3IU3A 2IG2L 4YQXH 1OQXA 4EVNB 4MQ7B 3T4AB 5J12B 4K3JH 1DN0A 3E3QC 1DEDA 4ZQKB 4YWGL 5JW5A 3S5LA 1GZQB 2F53A 2GAZA 1SVCP 3G6AB 3ARPA 3X14A 1FDLH 3VXUA 4PGDA 4ZSOB 3VRLE 2R8SL 3MXVL 3ARDB 4RMSA 3KPRA 3JTTB 4CKVX 3X11A 4Q9RH 1D6VH 1QSFD 2CJUH 3REWA 1U93B 2CLRB 4D8PA 2PW2B 4HF5H 3IDYB 4KJQD 2GJZB 3PJSA 4R90L 1GOFA 5AZ2H 4R2GD 1NAML 1SJHA 4HULB 4JR9H 4PJDB 3QWOA 3EYVB 3G6DL 3PHQB 4PJCA 1F5WA 2OX5A 5IHUL 5IBUB 1WSST 1KPVB 2VERN 5JR1L 4LRNL 3VW3H 1PLGH 4BH8B 1WUNT 3B3IA 5J1AB 3F7VA 5E99H 5HY9B 2AEQL 4LSVH 1EHLL 4I0PD 3TVMC 1A6VL 1RK0A 5C0IB 3DO3A 1OGAE 4LU5H 3ULVC 3U6RB 1ZS8A 4QRUB 5CINL 2PN5A 4B41A 3JWDL 1QRNA 1UCBH 3WLWD 5IFAL 2PTVA 5I8CA 1S7QB 1F45A 1N2RA 1NQBA 5DDHB 3AAZB 3MODL 1T0MA 1ZHBB 1KENH 2DTSA 5E2TL 4WUKL 4JY4A 4AIZB 4XBGB 3QHTC 5IW3A 1KXVC 1YDPA 3QDJD 1FL3B 2Y25A 1T22A 4OKDA 3VFOA 5CILH 1CD1B 1FAIH 2F19L 1U95B 1W0WB 1V3JA 3RUGE 2NXYD 1MREH 1S9WA 1PAMA 3LMJL 3WS6C 1AP2B 5K9KB 3BRDA 5F7KC 5HHMD 1QKZL 3EOYG 1AGFA 2P5WB 3AREC 2A74B 5GQBA 4ZFFB 1JYNA 1O7VA 3MOAH 4JQXC 5KJRL 3LIZH 3DGGA 4PUBH 4CN6A 3UTPD 5DRWB 4AZ8A 3I3DA 5FYKL 2Q76B 4AEIH 5CWSB 4MXVE 4OKVA 2XTJE 5GRUH 1UB5B 2H2PC 3NFPB 2E8YA 3D3VE 1M6OA 1L7TL 8CGTA 2VXTH 2K9UA 5EOCL 5I1GL 2LU3A 2Q7NA 3DYMA 5FYLE 1FZMA 5JHDB 3QZWA 5D1XC 1I85C 3HZYB 1FP5A 4WCYH 5IFHH 2N1KA 1ADQA 2VZ1A 1MCPL 4IBLT 2X89A 1DDHB 4X6DF 4EN3D 1JPFB 2X10A 4PJFF 5MEND 5IBLD 1NUGA 4DQOL 4G7VL 4KHTH 4Y1AD 4ODSH 3V9FA 4RAUB 1EA9C 1MHPH 4GW4B 2GSGB 3GBNL 4MVBC 1LD9A 4YHML 3SGJA 4D9LH 5ALCL 2BSRA 2AJVL 4EI5A 2BVTA 4PP2A 3ZKNC 2Y5TB 3DMMB 5C0CB 1BZQK 1QOKA 3TBVA 4WEMB 4KI5F 4CDGC 4C83A 1MCNA 1NGZA 3L5JA 5HHVH 2HH0H 4ZSOE 4NUGH 3CXHK 3QFJA 1Q8MA 4YBLC 1QPPA 2E6JA 1ZA6B 5TGBB 1A2YB 3EFFB 1BIIB 1PEZA 5MERB 3SPVB 1LE5A 3O6FA 4XB8A 5EB9A 3U9PL 4JGJA 4C56B 4PTUB 4IOFC 1OAKL 1WZMA 1KCVL 3GNMH 1CXLA 4IIQB 1N0LA 4MAYA 4KMLB 3MLZL 2FZ3B 5JHLL 1JYWA 3B43A 3L7FA 3AM8A 1OD9A 1XMWA 1U3JA 3WNNA 3RTQB 2YPLA 5DJYB 1RZ8A 3QDMB 1HIML 4N5UA 1Q72L 1UM5H 5DJ6A 4F37F 1JK8A 4PJEF 1CDHA 2ADJB 4Y4FB 1MRDH 3WIFB 3S36X 3I02A 3C5SB 3NBNA 4QHMB 5DVKA 5F8QC 1KLFA 4M1CC 4NWUH 2VC2L 2ZUYA 4QYOA 4NC0B 5ACZB 1KB9J 1IGJA 3BT2H 4F33B 5JNYA 2VLRD 1I9RH 2QHLA 4KVCL 4XP1H 2IADB 3TBYA 2P5WE 1G7QB 2GK2A 1IL1A 2WAHA 5GISL 1U3HD 5A2JH 1QLEL 1AD9B 3OKMA 4WFFE 5TE4H 4RRPG 4TOYH 3B6SA 1EBPA 1XEDA 3BP7B 1OP9A 3MV8B 4LSPL 4Y2DB 2P1YA 3KPSD 4F7CA 1EUTA 3Q5TA 3KYOB 4KJQC 1CF8L 2ZSVB 4JFFD 1M1SA 4R2GC 2CH8A 2FX7H 5HGDB 3H3PL 4P4KA 1IKNA 2FH6A 2R29H 3IF1B 5JHDE 1GGCH 1P7QB 3HE7B 1OP3K 4M7ZB 3C9NB 5DJDA 4JPWH 4L3ED 5D7SH 2G5BB 3WFCH 1I7RB 1XIWB 3ZT7A 4EI6A 3K7UA 1JGEA 1MUJA 3EW3B 5I17B 3U7AA 4P9MH 5BS0B 1A3LH 1T1YA 1XF5B 4JFOB 4I0PC 4F7TB 4WEBL 3OX8B 4ZDHB 3LKRB 4GAJH 2BCKA 3WLWC 4OI8A 2Y7QB 3NH7H 3QG6B 4HT1L 3G6JB 4WO4B 4OV6F 5C0CE 3IJYB 3U0WH 5DK3A 1WT5A 1MHHA 5FA4B 4M6NL 4MQSB 2VXQL 4U6VL 5CZVL 5CP3H 5ELIA 1XF4B 3D69A 2C7UA 1VFAA 1QACA 3MRBB 2CIIB 3F12A 2NXYC 3P11H 1DQMH 4UUJB 5KSAD 2BVQB 3ES6B 1P84K 5CSZB 4C56E 2JB6B 5K9OA 1CGSL 5DLMH 3HC3H 4P9HC 3MRHA 1QTYT 2B0SL 3G04B 4KRLB 1WIUA 2NY0D 1VERA 1S8DB 4ZUUA 5A2KH 4BZ1H 3H9HB 5HI4D 1CGWA 5DQJB 5CEXB 4FABH 3HN3A 3Q6GL 3QO1A 2FLBT 4K2UH 1YN6B 4I18C 1N5YL 3F7QA 2ZNXA 2BRQA 1XGUB 3QDME 4RDQG 3CD4A 4P46B 4JO3L 2YC1B 4NZRL 1NBVH 3NVQA 3S34L 3ZHLA 1IGML 4G9DB 4OQTL 1GGBH 5JLZA 1ACZA 1BVKA 3WE6B 1GIGH 5TDOB 5FOJA 3DUUA 5GS0D 2IH3B 1MFCL 3RL2B 3T0ED 2XQBH 4UDUB 1FIGH 5KTEH 1V8HA 1W8NA 1CICB 1T1WB 3HS0B 1V5JA 4RWYH 4EN3C 2P8PB 3GGWB 1SYVA 3U2SA 5IBLC 4PGBB 4ALAL 4MCZB 4QHLA 2VXSH 2XNAA 4B53A 5IVNA 1OTUD 4LCCA 2Y5EA 3NA4A 4EQ3A 1VADA 2E3VA 5L6YH 4OCYL 1HEZB 2DM4A 4TUOA 3X3GL 3ZSTA 3O2DA 3GM8A 2VZVA 3U7YL 2DQEL 3G9VA 1YEJH 5D2LA 5IBTL 3MV8E 3WIHA 4HWZA 1YEGH 4OZHA 3IFNH 3X17A 3WL9B 2E7CA 5CIPB 1NGPL 3DO7A 3W39B 5B39A 3CXHJ 1P6FA 3EYFA 1KIRA 1J1OH 3ZTNL 2D0FA 1OAZH 2Q87A 2BSSB 2Z92B 3FO2B 1EEZA 1MCOH 2AJSL 1G7MB 2BC4A 2QSCH 3KYKH 4F7EB 4K07A 3PXJA 2VAAA 3TNNB 1CLYH 6FABL 1KELL 3MJGX 5DRNB 2Z0BA 5BS0E 1HXMB 4OB5H 3KLHD 3ARBB 4KPHL 3V8CA 1AFVH 2CGRH 2O5XH 2KZWA 4G7YL 3NACH 4KJYB 2F5BH 2E7HA 3UBXG 4IHOB 3DUHA 5EU7E 5KSBB 1H0DB 1H3PL 3G6JE 2F74A 4HUXB 3KYNA 4JFQA 3VXNB 4K3DH 4LK4A 5F3BB 1G7JA 4Z76B 2XZQH 1IQWH 2GIYA 3FB8A 3LAFA 3B83A 4TN9A 3VWKD 3MV7D 4YHPB 2HKHL 4Z5RB 3D39A 1AKJD 4KRPB 5CD5D 1FYTD 3SJVD 3VFVB 4NJ9H 1LK3L 3X12B 4LLYB 3GSVB 3T8XB 4YE4L 3FOMA 4OFVA 4Y16D 1V3KA 1U8JA 5C0BD 3TH4T 1FGVH 5ID0B 2HN7A 4J7RA 1DFBH 12E8H 3MUJA 4P5KB 1U3HC 3BH9B 3VH8A 1FZJB 5C07B 1ITBB 4PS4H 4ZAKA 2BK8A 3S4SB 4JO1H 1DZBA 4TUJB 3FQTA 3F58H 5E6ID 4QHKJ 5I1JH 4GMTH 4U7KA 3UO1H 3GJFH 4JM2B 3RWIB 2UYLB 3ILQD 1DVFB 4JY6A 4NO3A 5TPWL 5GRVL 1EXUB 3Q0HA 4HLZH 4KJPD 2FATL 4W70A 3V6OC 5KW9L 1YEIH 5C0ND 1KGCD 2DS4A 1OVZA 3MRNA 5IMMA 4K8RD 1T21B 1I8IB 3QNZA 4P2CG 3ZKMC 5F88B 1LILA 4NJAH 4G42B 4PRNA 3WEXB 4MLSA 4UU9B 1CL7H 3JWOH 5DI8A 2CXKA 4JG1L 5T1DH 1VPOH 4TTGA 5J6GB 1YJDC 3QUXB 1Q94B 4FXKA 4MD5A 4L8BA 4HWBL 4OV5A 5CEZL 4O4YH 4PGEA 3EO9L 4MNGA 3HB3D 4OI9A 4MNQA 2OJEB 3P3YA 2IH1B 5ETUB 1CIUA 4JQIH 5GGQL 3I6GB 3IKKA 1TNNA 5C70A 2KUTA 1X5JA 2QHRH 3IDJB 5D72L 5E03A 5I71B 3TO4D 4ZPTB 4R7NA 5KSAC 1I1FA 3F6LA 4U1IA 1B88A 1U8MA 1M7IB 2CUIA 4NT6B 2H1PH 1IAIH 4U1HA 4X6EB 1IAKB 1P84J 1UVQA 3BYTA 3MA9H 4W4OA 2NY0C 4WW2C 1MEXH 1B0RA 1JPTH 1JWSA 2ORBH 5D1QD 1FL6B 5HI4C 4Q9CA 3BZEB 4QXUH 2AK4D 1GCFA 5IQ9A 2BHZA 4GMSH 4PJAA 1T0PB 3MO1A 4OCNC 5LQBL 3BXNB 5L8KB 3QUKA 5INDB 3HR5A 4HWEL 4NZDA 5B8CA 1QSEB 1EH9A 4JKWA 3AS2A 5KSBE 4CVUA 4A6YH 1HSAA 4TSBH 5DRZA 3BMVA 1EVTC 1ZLUH 2EDYA 5C0AD 5E94B 3UDWC 2A38A 5F1KC 3VGFA 2Z93A 5DR5L 5E24E 5EO0A 5C08B 1XGPB 2QV2A 2P4AB 3U0TA 5GS0C 4JFHD 4MWFA 3IS0X 4NSKB 4X8JB 1GZPA 3T0EC 3TJEL 4ZNEA 1R6VA 5E2UL 1DLHA 1NLBH 4U6XB 1CT8B 3LKQB 3P9MA 5SWZA 1X7QA 3HMWL 2A9NH 4NFCA 1JPST 3MCKA 3RIFF 4NCC1 3MCLH 1OTUC 1WAAA 1HSBA 4J1UA 4UTBL 2NY3B 2XWJB 2FJHB 4PJ5D 4S0TD 5JQ6H 2PYEB 3MXWL 4OZIF 1B0WA 2F58H 1ZT4B 5GSVA 3NCYS 1MJUL 5GIRA 1CE1L 3MOQA 4X7FC 5C0GA 2DQHL 5ESQA 5EA0H 4PRDB 3IDIB 4LSQH 5J4MA 4UQ2A 4F9LA 3BOVA 4YWGH 5JXAH 4JZOA 2J6EH 5TE6L 2PR4L 3WSQH 2EE9A 1S7UA 3W5NA 3LS5L 1RZJH 3ZDZE 3TT3L 4LSUH 4HPYL 4LPTA 3BHBA 3D5OF 1N7MH 5BMFH 2CMRH 3FB6A 4ZFZB 4GXUM 4UV7L 1AXSB 4OIIL 5FDYA 5J1SC 3KLHC 4QOKB 5KS9A 4H1LH 1BQUA 5HVGB 2B1AL 4U1KA 1AQDA 2R4SH 3NPSC 2CXGA 2IAMD 1PG7X 4Q2ZA 2A0LD 4PV8A 4PJGA 5FK9B 1IEBB 1FVEA 1JUFA 1RFDH 5IUSA 3GSXB 4RISH 5TQ0H 1DBMH 2AEQH 1NLDL 1CZ8L 1RZIA 2P46B 4R9HA 3MRDB 2O26U 2ZUUA 3DX6B 3VWKC 5CD5C 3OKEA 3LS4H 1T04B 3QIUD 3QEHB 5E2WH 3JWDH 4ONOA 5I76A 2EH8H 3RKPA 1X5HA 1YPZB 3FQRB 4Y16C 1NBZB 3IFOB 1ZVSA 5D7KD 4GW1B 3DVIA 1HINL 4JZNA 3VXQA 1NDMB 3MQIA 3RGVD 4NDMA 1UT9A 1YNKH 1EEYA 3WUWB 3BKYL 5I75B 3HE6D 3ZE2E 4BFBD 1IM3B 4I48B 2ZCHH 1MJJB 2DBLL 1FNAA 3UJJL 2PTTB 2F19H 5SWSD 5GS3A 4KXZH 3G5YB 3FHAA 4JN1L 5E6IC 1AQKL 1JWUB 4CGTA 1QSEE 2XPGB 4NKMB 4KUZL 2W65B 3ILQC 4N1HB 3HAEA 3MROA 2YEZA 2IFFH 4MAUL 3ZDXE 1YZZA 3VCLA 5FUZH 4XBPA 4JDTL 5CMAA 4KJPC 3KLAA 2YRLA 5KJRH 3BZDA 5GRWA 2P5EB 1HCFX 3FB7A 4X6FA 5C08E 5C0NC 3GSWB 1CQYA 2GITA 3LQAH 4K8RC 3UJIL 5JXED 4Q6IB 5B3NA 1A7PH 3PABB 4PJXA 1HHKA 5HDOA 4GAYB 1A1MA 2VDMH 2JCCA 3SKUD 3NABH 1CFQB 1NEZB 3AY4C 4DTGL 2HLFD 3BP4B 1R3JB 1BEYL 2Z4QA 2X4QA 1CQKA 1S3KL 3MJ8B 1CE6B 2PYEE 4HIEA 5FB8A 1QHOA 4HFWA 2XXMB 4LLUA 4JY5H 4PRPB 4IRSD 4R26L 2P24B 3HB3C 4V1DB 3JV0A 1WZ1L 5IMOB 3RPKA 1KTRL 4AQ1B 2ESVB 1J8HD 5F7FA 4D0DA 1DQTA 2AXFB 3U9UA 4DQOH 5EG6C 3TO4C 5F9DC 2CKBH 5I30L 2F53D 1D5MB 5ALCH 1ZMYA 1BLNA 1TZIB 3C5ZB 5FO8A 1FRGL 3LSOB 4NP4H 1U8QA 3VXUD 5J57B 1OLLA 5D1QC 1YYML 4OM0H 2H6PA 4OLYH 3KPRD 4ZUWB 1QSZA 1MFBL 1C12A 4OLZL 4QOKE 2MCG1 5KBNC 3OXRB 3D2UB 3J7HA 1E27B 4WDIA 5HYSG 2Z8SA 4X6DB 3TYFA 4HLJA 4KK6D 4P59H 1IT9L 5DD5L 3IDGB 1OAKH 1QQDA 1SBSH 3PQYA 2A2QT 4YDKL 4ZUSB 3SKOB 5C8JA 2FEDD 5FKPB 3REVA 1WTGT 3L3JA 1L0QA 5JHLH 5AUMA 1GVIA 2DIAA 2QTEA 2Q7YB 4TSAH 5D7IA 4LF3A 4PGZA 5DA0B 1X6NA 2AXGB 1RJZB 2IALB 1F4XL 3K80A 3BI9X 4XPTL 4HUUB 2XRAL 3C2SA 5CJ5A 1QRND 2DQFA 1YPZE 3CNKA 3FN3A 1G6RA 3KPPA 1WITA 4I3SL 1VFUA 2HWZL 2QSVA 3EOBB 1W72A 1MHCB 3Q1SL 3U4AA 1M71A 2ZOKA 1WGOA 3OXSA 2WZPD 3RY6C 3CLFL 4YEFA 3K2UH 1GOHA 2RGSA 5EU4B 4TUKH 2APXA 2XWBA 3S88L 4H1LB 4Z7UB 2SEBB 3MLPA 5B4MD 4PJFA 4N0YL 2F54A 1MJ7L 1XGQB 2FYYB 2PXYD 4LQ1A 5J13B 3VD3A 4KVCH 4U0RC 1S9XB 1U8IB 3IAPA 4XNQB 3TIEA 1XR9A 3C8HA 1A9BB 4RGND 5DSCA 3FL7A 3WO3B 2P5EE 2Y07L 4ODHH 1R5IB 4XCYA 2YBRB 4NNXB 3DX8B 3FCTB 2OMBA 4N1CA 2ICWB 3T2OA 3RDTA 1BFOB 4FQXB 1UKQA 3BZFA 1FYHB 3QUZB 1CF8H 4POYA 3L1OH 2YRZA 2DQUL 5MI0C 3KPMB 2IAMC 1X5LA 2A0LC 4YK4C 2BJML 4WU5B 2E7MA 5F7YC 1MRFH 3RI5F 4F2MB 4YXHL 4ZUTA 3T0AA 4HDIA 4V1DE 1AHWB 2VDOH 3PHOB 2FD6L 4G6ML 4DKEL 1KPUA 1NAMA 2X89D 3IS1X 2ESVE 5T5FH 3UTTD 1JPSH 4PD4K 2IPUK 3QIUC 3ULVL 4NIKB 3E2HC 3MJ9L 4G80A 1GGIL 3K46A 4PJEA 4HT1H 3TH2T 1R24B 4FFYL 5EUKB 1C5DB 1NANI 4EI5D 4X7TA 4JE4B 3QJFA 4F15C 3RGVC 3U0PA 2Z8WC 3NGBB 1A7OH 2R0KL 3HE6C 4MXQD 4WVRA 1J05B 1WWAX 2O5ZL 4DGYL 3MRRA 2OZ4H 5ESAB 2AK1H 4WFGE 3Q6FB 4X6DE 1KG0A 4ODXA 3O6FD 2RR3A 3TBTA 4HUVA 4NO0A 3SKJL 1X5YA 2C3VA 2R23B 5IP4A 4ZO6A 5TDNB 4MAYD 4LPCA 1S5IL 4BK4A 4FQ1H 4KI5E 2DWEB 2JIXB 2R0ZL 3SE9H 4ZFOL 4GRLD 4R7DB 4U3CA 3SBWA 5JXEC 3KYAA 4UB0L 2G75A 1FJ1A 2YPLD 2YR3A 4R4FH 2CKBB 4G6JH 1OCWL 4JO3H 5A2FA 4HV8B 3V0WL 5DQ9A 3QRFM 4N0FA 3TGXA 1ZLVK 1B0GB 3SE3C 1E4XL 2HLFC 3CDGA 2QR0B 3BAEH 4GRWH 4HPOL 4FTVA 4TSCH 3B8SA 3O41B 2QQKH 3ILPA 3SDXA 1EAJA 1UXSA 1KIPA 4IRSC 4H25A 1MFCH 1GAFL 3S6CA 1QLRA 4QNPE 1S7TA 4ZYKB 4Z7UE 4HW6A 4J8RB 4HBCL 3EHBD 1KJ3L 3KPLB 4ALAH 3KR3L 2DL9A 4I4WB 2I9TB 1SEBB 2VE6B 1IZKA 1H8SA 4NM8L 4P23B 4UV4H 4NKDB 5EPMB 4F80A 2AAVA 2OP4H 1W0VA 1YMMB 5IJVA 4WFHD 1EAPA 3QO0A 3LV3A 3FT3A 4WUUB 1NGPH 4CMHC 3BJLA 2Q8AL 4S1SL 3T1WA 1A0QL 1QFHA 5EU6D 3O3DA 4PJ9B 1J12A 3BKMH 5KVMC 4HK3J 5CP7B 1NGXA 1ZHKA 5AD0A 1X5FA 3MUGA 5EZIH 5IG7B 2Y4SA 1OGAA 2DQJH 5KSUB 3KNBB 2EYRB 4FG6D 1CD8A 5F9JA 4ZOBA 2GKIA 1A5FL 5INCB 5E56A 2E6PA 3HFML 2A83A 2DQDL 2BVYA 3UMTA 2XY2A 2OCFD 5DEFB 4HUWA 4OD3L 4G9FA 4PY7B 4RDQF 1KF9B 2APWA 1XR8B 4JFPA 3DVNA 3MBEB 3KXFB 3SE8L 4DW2L 1U8OA 3ULVF 3DBXA 3UX9B 5F8RC 1BD2D 1N8ZB 4O58L 1F8TL 3GSNA 5B4MC 2APBA 2A73A 4GQPH 3VGAB 2YK1H 1OL0A 2PXYC 2FX8L 2NPLX 1J11A 1LO4L 1HCVA 2FBOJ 1T1ZA 3DRQA 3ZMRA 1OB1B 4RGNC 3TPUA 1RULH 4LSTH 3SEPA 3GK8H 4YAQB 3BKJL 5L9DH 5ENWB 2EC9U 3VI4F 3W9EB 3BUTA 3MRKB 5BZDA 1MI5D 4IDLA 4P2QB 4WWKB 3OKOA 4G43A 4YR6B 1BJMA 3T2PA 2R2HA 1N6QH 1G7LA 4D9RD 3F7PC 3NMEA 5C0EA 4OCRL 5KW9H 3B9KB 5GGUB 3W9DB 4MQ7A 4KK5D 3PWLA 1Y6KR 3GRWA 1I9JL 1ZA3A 1K9TA 2IWGA 1JMZA 4D2NA 1WWBX 4L5FL 5I16A 3ARFD 4ZUVA 2IEPA 1NC4B 3PWPB 4HCRH 2FIKB 3MBXH 4CVXA 4PD4J 4S10A 4Y19B 3SGJC 3JTTA 4KHXH 4EI5C 2DQGH 4Z77A 4PGCA 3CFBB 2EH7L 2PW2A 1YMME 4MXQC 3H42L 2MWCA 1UFUA 2BY3A 4PJDA 3PHQA 1Q9LB 5BRZA 1V7MH 4JFDB 1K4DA 5F3HA 4Q97A 1PX3A 2VLKA 3O6FC 1DQLL 4KK8D 5EC1B 2E7BA 3HZMA 1KEMH 1PKOA 4GRWB 1C5BL 4P9HL 4MAYC 5DJ2B 4MDJB 3GHBH 4X6BB 5HYFA 2ILLA 3I3EA 1BAFL 3L5XH 4O2CB 4L8SA 1QFWM 4LVHC 1CWVA 4GRLC 3MOBL 4UTAH 5LQBH 3AAZA 1GPOH 4U1JA 4BFEA 3RVTD 1U41A 3IFLH 3ULUD 4HWEH 5IB3B 4AIZA 2VLLB 2VISB 4LLMA 3FQXB 5LCVL 5D71H 4QY8B 1QO3B 2EYSB 5DVNA 2FR4B 4GKNB 1E28A 5DC9B 4KZDH 1MCCA 4CL7A 3E6HB 2DI8A 3PNWB 1UACL 3KXFE 1QR1A 5D2NB 4ZO8A 1AP2A 3TJEH 4DGIH 2P43B 3S35H 4WWID 1YYLL 3D39D 4MCYB 5FCUL 4EOWH 2WUBL 2A74A 4U3HA 3JV6B 4QRQB 1ZLWK 3QDHA 3EHBC 4OQTA 4GBXC 2VH5H 4HUKB 1F3JA 5CWSA 1RK1A 3IYLW 3FO9B 4M3KB 1BOGB 5BJTB 2X1OA 2DD8H 1OARH 2MKWA 3QRGL 4ZAKD 4LKXA 3VDBA 4M48L 4N8CL 2ZP0T 3WXVH 4U1NB 2YZ8A 3QXDA 5DJZA 5JOPE 3LEVL 3ZE1F 2VTFA 5FHAL 4P2QE 2P8MA 3CCHA 3PP3H 1EFXD 4AT6A 5T1LB 1IKNC 3RBSA 2DLFL 4P2OB 1ZT7B 4W6XB 4FG6C 3CDCA 3PGFL 5EBWB 4OZIB 5I1DB 4RAUA 1G7IA 4WTWA 5GGVY 4OSUH 1U91B 1E4XI 4PRHA 4DK6A 4OGYL 1TVDA 3DMMA 3PWPE 4DN4L 3UBXI 1AC0A 1GHFH 1NFIB 2DDQH 4A2LA 5L8LB 4Y19E 1I1YA 2BNRA 3L7EB 3N9GH 4P49A 4XNYL 4HKBA 4JZJB 3B9AA 5TGBA 1WT5C 3P0YH 3PWUA 3VWJB 3RVUD 3L5IA 1CZ8H 3EO0B 2JB5L 3N50A 1G0XA 4MNQD 4YDIH 2NY1B 5C6TL 1KTLB 3HZVA 3WYRA 4JFDE 3ZZ1A 5JW4M 3OHXA 4YFDB 4M8QA 4YO0A 4AEHL 5EOTB 1Z6JT 5BVJB 2BSTB 2ERJC 3LRSB 5BO1H 5IB4B 1SY6H 3ZT6A 1JV5B 1IAOB 1K5NB 2GJJA 1F02I 4GRWE 3U46A 1ERNA 3MNWB 1A7QH 4LAQH 2ZG3A 2ZUQB 3BKYH 2B8OT 4KTDH 5JW4Q 3VFMB 2CK0H 3IVKA 4NQSB 2GUOA 5C0FB 1U58A 3T04D 4UQ3B 2QQNL 3DYPA 3S37H 4QCIA 4BM7A 1KXTB 3OKDB 3B2VL 4DK3A 35C8L 4QTHB 4NQCA 1J7VR 1KBGH 3T2NH 1JCKA 4MAUH 2I25N 4UT7H 3ZYZA 1HNFA 1CDCA 5IVXF 4JDTH 5L2KB 3KHQA 5MEPB 3RY4A 2DIJA 1DCLA 4LNRA 4KK5C 4GLRI 5D2NE 2W0PA 4KMQA 4WI7A 3UJIH 3VXMB 1PY9A 2IADA 5EZOL 3FONB 3THML 3BDBA 1DTUA 4I3RL 3UTQB 3ARFC 5LBSL 2BP3A 3R1GH 1G7QA 3STZA 1FPTH 5EORH 2J12B 3TBWB 1RUPH 1ZEAH 2W60B 3BP7A 3O3AB 1J1PL 4YLQT 3SOBL 3MV8A 4LCCC 3AVEA 4DKAA 5JPMB 4RGOL 1YJDL 3MLXL 1S3KH 4ODVL 3C6LA 4Y2DA 3KPQA 3TN0B 5DJXB 4KKCD 4PJ7F 4R26H 3PWJA 1REIA 2DLIA 1T2QL 2E27L 1LO5B 2X4TB 2I07A 4NBZB 3RAJH 5L7XH 3RPIA 4Y5XB 5I66B 4LRIA 2V2XA 2FJGA 4HZLA 1DLFL 1I4FA 4M62L 1TJIL 2EEDA 5ANMB 5BS0A 5D70H 3OBAA 1G1CA 2I9LB 5I15H 1IZJA 3PWNA 2XZAH 4L4VB 1YYMH 4OZIE 4PLJC 5FUOH 2GQHA 3SY0B 4AEEA 1ZWIB 2CIKA 1UQSB 3GMNB 1SYSA 1G9MH 4OAWA 1KTDA 3IJYA 3QZWG 3RVTC 3ULUC 3OKKA 5EU5B 3NFSL 1LDSA 3SDYL 3U36B 3K4DA 2EE2A 4KMTH 4YDKH 5BOPA 4KZEL 1MLBB 4ZD3H 3ESUF 4PP1D 4K9EC 2CIIA 1IEHA 3BDYL 3U4BL 3QPXL 2BVQA 4K55A 4X5XA 4NFDA 5GS0L 2R0LL 4RMTA 4Y4KB 2AXHA 1X44A 2VR9A 3I50L 3JWNC 1G9NC 1KJMA 3RWCA 5F7DB 3R8QA 5A2LH 2RFXB 3HC0A 5EO1B 5AG8A 1FSKC 2DKUA 4I3SH 2IBGA 2IANA 5ITBL 2V5YA 4N0UA 2P7TB 1YN6A 2VN4A 3FN0L 1CXHA 2DLTA 5CEYA 3Q1SH 5DMJB 5EOCJ 5IMLB 2ENSA 4G8GD 2FBJH 4JKPH 1XGUA 3CLFH 2WUCH 1SJEA 4LGRB 1I1CA 5I1KH 4ZAKC 1KIUA 4OCSH 1N3NB 2V5MA 3VXPB 3GSOA 1YA5A 1EEQA 3RX8A 4RFEB 1ACYL 1GGTA 3O6LL 2X4PB 1Y18B 2VDRH 4O02L 3RL2A 4UDUA 3BQUB 5L2KE 3FT4A 2J8HA 4JRYB 5CEZE 1CICA 2VDKL 3AS1A 3NCJH 2R1WB 1KLGA 4GG6F 5E2VH 2V9TA 2Q86B 3DTXB 3RWJA 1RAMA 3OTTA 3VXME 4WI2A 4QF1A 3VMPA 3SCMB 1ZTXL 4BSJA 3NTCH 5J11B 2X6MA 3PDOB 5DUMH 5AYUL 1MQ8A 2ID5A 2VZSA 3LHPL 4BFGA 4NZUL 5HHOB 1N5AA 2OQJA 4OD2A 1FV1B 4RMRA 1NCCL 2VWEC 1KB5L 5HHQA 3RVUC 4PJBA 1DEEA 1E4JA 2JJTA 3VXRA 1AE6L 2FSEB 2HJFA 2BSSA 1BGXL 2DQTL 5E9DA 4RMWA 2Z92A 3FFCA 4F7EA 4JM4L 2AS5M 3CZJA 1D5IL 1C5CH 3IJSB 4P3WA 5T3XH 2XY1A 3FFDB 1MCEA 5ANME 1TETH 4Y4HA 1H5BA 4AM0A 3ARBA 4GKSA 4XH2B 3UJTL 3VFTB 2ZSWA 3RIFK 4W4OC 2O5YL 3M8OL 3TZVA 1P2CB 2BNQB 4KJYA 4L4VE 4S2SB 4DGYH 1MAML 3ABZA 1MFAH 4M93C 4ENED 5HHNA 2HP4A 2Y23A 1N59A 3BGMB 2OSLA 4S1QL 1FO0L 4Z7OE 4EDXA 2QKIB 2VLJB 4ZODA 2VR5A 5F3BA 5B8CC 3E8UL 3SKJH 2ADIA 4QRTB 4WW2F 3BEVB 1TZGH 3PQYD 4YHPA 2DF3A 4KY1H 5DJ0B 2CQVA 2PCPA 4WI6A 5EZJB 2W07A 2PF6A 5ID1A 3X12A 1K4CB 3T8XA 4Z8FL 4KDWA 4NRZA 3HRPA 2NY2D 4K8RL 1RZ7L 2V9QA 2AJUL 5D93B 3IGAA 3V0WH 1IC5L 3BH9A 1XF2A 4LCWA 1T66C 2Z9TA 5C07A 1A6TA 1PKQB 3TBSB 4EBQH 2N56A 3T0BA 1OAXH 1MH5A 5GRVK 5ITFB 3V0VB 1G7HB 1CFTA 3UTZB 4DGVL 4HG4K 3PIQA 4KKCC 4ETQA 4HH9A 4JM2A 5GS1C 1ZSDA 4K7FA 4UT9H 1JN6B 1XCTB 5IEHA 1DQQB 5B22A 1HHHA 2LTQB 4HK0A 1H8NA 3VGGA 4JPVL 4F9LC 3RWDA 4D3CL 4DN3L 4JDVA 5CP3A 3NZHL 4E9LA 4DZ8A 3ZO0A 1JGDB 3PDGA 5IMKB 3GHEH 4X5WA 4LEXH 2BOBB 3FQUB 5E00B 3D1MC 4KTEH 4WV1A 4JRYE 2VZOA 4HS3A 2HA1A 3WEXA 1KEGL 4J2XA 1X5ZA 4HIIB 4P0DA 2J5LB 4JFYB 4NPYB 3O45A 2L7UA 4PV9B 3MRFB 3ZKXC 4JFXA 1FNGA 5GZOD 1OTTD 3RDTD 3FO0L 1I1AD 4Z18A 5C0JB 3QXAB 1T7WA 3OAZH 3N06B 5HVHB 1TQCC 3MV9B 2HFGL 3L5HA 4L9DA 3PGCB 5HHOE 2OJEA 3BISA 3CVHL 3HNSL 2DQCL 3I6GA 2H32A 1QEWB 4PP1C 1RZFL 1T5XA 3MNVA 1C08A 3VFUB 4ZPTA 1TZHA 2OJZH 3R0NA 4RRPA 4MQTB 1VFBB 1OW0C 2DQDH 3F5WA 3VXSA 4L29B 4FXGB 4ONFH 3K1DA 3Q5OA 2QADB 1FL6A 3SQOH 2IPKB 1JHLH 3PWVA 3B2UD 4OBSA 4PREB 1TIUA 1VEOA 2WMPA 2BNQE 3I75B 4DW2H 4Q9QH 4P3CL 4NQEA 2XOTA 5J8OA 5I74C 1F8TH 2FX9H 3M45A 3NIGE 4D0CB 4ODWA 1RJLA 3DV6A 2DN7A 1ZAGA 2VLJE 3OF6D 3SE4C 1AH1A 3TP4A 5DMIL 4NO0D 2DKSA 4Z0XA 3TM6A 3VFSB 4YIQA 4NSKA 4BH7B 1HK6A 1WC7A 3P77B 4U1MA 4XXCA 4X4YB 4N8PA 1AGDA 4H88L 1J8KA 1JVKA 3EYSH 3LKQA 4PB0L 2EZ0D 1QR4A 2FGWH 4MD4B 4CNIA 2CDFA 4QXGH 1CG9B 4KKAD 2B7DT 3BMWA 1DE4A 3T77A 1WIPA 3O8XB 1ZT4A 3CMGA 3T0WA 3R8BB 1EUUA 4K7PY 1WWWX 1PKQE 1H3VA 4G6KH 3EYUH 4GO6B 1UEYA 2RCSH 4FP8H 1LP9B 4FTVD 4YUEL 1XT5A 5M94B 1MY7A 1CU4H 3UPRA 1U6AL 1DN2A 4DZBB 3L5WB 1I9JH 4JO4L 1KFAH 4RAHA 5D1ZA 2RAMA 3HUJA 3NCEB 3QIBB 5GJSL 2C1OB 2IBBA 4OM1L 1BF2A 3ZYOA 1MF2L 1CTOA 1ZT1A 1P9MA 4OIAA 2W0FB 2WBWB 3VH8G 2UV3A 5FKAA 1AXSA 4RFOL 2XACC 4EUPH 1RIUL 4XVTL 2IQ9H 4QT5B 4I5BA 3RA7L 4JLRB 5C6PB 3TVMA 1UXWB 4ZFOB 2MPAL 3IDNB 2P45B 1RZKH 1IEAB 2NX5B 4R0LA 4ENEC 2BRRL 3QUYC 3QB7C 4HHAB 4X9BA 4Y5YB 5D6CB 1QLFA 1GH7A 1VGKB 3MLWL 2GY5A 4NQXB 3V6FA 3QIWD 4XP6L 3MV9E 4TVPH 4XCFL 2HYMA 3PP4L 3I84A 5CUSL 5D1XB 4LLQA 1OGAD 3IKCB 2YZ1A 3QULA 4YHKH 1J0KA 1DR9A 3S37X 5FGSA 3GJFA 2HVJA 2Y06H 3FQRA 3EOAB 4XWGL 1F3DH 3VG0H 2NY2C 5I18H 4OLVL 1D5ZA 3QNYB 4D9QE 1H3WM 3E3QE 2GTZA 3AREA 4OZFH 4FQQB 3BO8A 4M7LH 5JDSA 4NQTA 4MSWA 4J6RH 3SDAD 4JQXA 3GO1H 1HQRB 3O2VL 1UM4L 4G9FD 4X0KA 4HD9A 3D18B 3G5YA 5F89B 3K8MA 2PKDA 5GRZA 1P4LB 1A6WH 4NWTL 4KV5F 3IXAB 3RI5K 3OKNB 1YYLH 2WUBH 1IGYB 4PJIF 1INDL 4NKIH 5EIVA 4M7JL 4HG4J 4C55A 1ROWA 2GSIA 2OL3A 4H8WH 3INUH 4PYHA 2EKSB 5E70A 3RWEB 3L6FA 5T1KA 2P5EA 1X5GA 1I85A 5K9QG 2AJXL 1A6AB 1DQJA 3UBXA 5GGVH 5H35A 3T65B 3H9SB 3PABA 4OZ4B 2CLVA 4GAYA 1CDUA 5KVFH 1TJGH 4LPUA 4P5TD 1CFQA 2NZIA 1NCUA 4LCYB 4N8CH 3D85D 3CFDB 5FYLD 4APQD 5GZOC 1OTTC 3RDTC 5E08L 1R3JA 1WCBB 5HJ3A 5IW6B 4NUJA 1I1AC 1KC5L 3FTGB 4FQJH 5DJCA 5T3XE 2BX5A 3G5ZB 1RZGB 4PRPA 3WJJA 3TNMB 4XNZC 1KNOA 1HE7A 2HT2D 1RURL 4TPRL 1LP9E 1BFTA 2EDWA 4M4RA 1G6VK 3HRZA 2N7BA 1U8NA 4I1NB 4CUCA 1J1XH 3K4AA 4A6YA 4KKBC 1AD0A 1LNUA 4EIGB 2YD5A 3TEUA 4X4XA 3QI9A 2Y9RT 3O4LA 4TULH 4Z7QF 1TZIA 1ETZA 1B6DA 2VAJA 4YDVA 2CDEA 2R56L 3BIKB 2X44D 5CZXD 4LBEB 4KK9D 2G9HB 2NY4D 5BQ7A 2GFBA 3ARDD 3DWTA 2W59A 3B2UC 1KJ2H 3D9AL 1F2XK 4PTTB 3ZLQC 2MHAB 3VGEA 1S7VA 2W92A 4HMEA 4F7PB 3TCLB 4XZUB 3NAAH 1BREA 1FLTX 4P4RB 3IDGA 1JHTB 4YGVB 5FDWB 5C6TH 3UTSB 2COQA 3HNTL 2DWDB 1P4BH 2X9WA 1UH4A 3CLEH 1QSFB 2K3TA 4MJ2A 1D9KB 5BRZD 2IPTL 4EQ2A 2O61B 1RIHL 5FKPA 3E6FB 5E6ZA 4L1HA 2VLKD 5L88L 4R2GB 3MJ6A 1WEJL 1L9NA 2Q7YA 4TRPH 3QUML 4C4KO 4G3YH 5MHSD 1C1EL 5J89A 2YUWA 1JZ3A 2HRPL 1HKLL 2YSSA 2AXGA 3SKMB 2C4FT 5I2IB 2IALA 2NTFB 1DBJH 1L6XA 4HUUA 3O2WL 3CX5K 2J6EA 1M7DA 1IAIM 3EGSA 2EZ0C 2NLJA 4FQHA 3SBWC 5C2BL 4KKAC 1U8LB 4NZTL 5ICYA 1T7YA 3EOBA 1W0YT 3OAUL 1I7UB 1R3HB 5FOBA 1I8MB 2HT3D 1TPXC 7FABL 1DBKH 5DRXA 1O0VA 5I1EL 4EUPB 2RJMA 4TNWK 4JJ5A 4LIQH 5DQDH 3CSGA 1K3IA 4FMFA 5FO7B 4H5SB 1EEUA 1AI1L 3QDJB 1F4HA 2ATPB 3WN5C 1IKFH 1EFQA 3RBGA 4U6YA 4XNQA 1ADQL 2WP3T 1YEKL 5LBSH 2HJLA 1KCSL 2AJYH 2CRYA 4R8WL 4HKXA 4G8EA 3TIDA 3O6MH 2IC2A 3V52H 1AY1L 3WHXB 4WFFD 2FL5A 3L95B 3K8KA 4R97C 1OWRM 2YBRA 2YOCA 5EIQA 5JMOC 3MLXH 4Z7VB 2ICWA 3GB7B 1INEL 3H9SE 5ADOH 5IEKA 4IRZL 4M61A 3FRUA 4PJ8B 3MFFA 5DUBB 3O3EB 3AS3A 1T6VN 3HAEG 3EYOB 5JHDD 4WU5A 3DSNA 1RHHB 3M07A 2JELL 3QIWC 4OZFB 2YMXL 5HBBA 3WIIH 1AO7A 4I2XB 1CGUA 3HMXL 5F7EL 1F11B 3QQ4A 4QKXB 2DM7A 5F96H 2XWTB 4LSRH 1FZOB 4TQEH 4PJ7B 4LCUA 3OJDB 1K8DB 1R24A 3DMMD 5MENB 4Y1AB 2AV7B 3SDYH 2NY5C 3UZEA 4BZ2L 3ZE1E 3ME0A 2H3NB 1TITA 2BNRD 4KDTA 4LGPB 4LVOC 3SDAC 3WNLA 4E42A 5ADPH 1PFCA 1OSZB 5CZKA 1RJYA 4EEEA 4YDLC 3UTSE 1CS6A 5IWLA 1QSFE 1OF2A 3UPCA 3OMZA 5LGHH 3SDDA 1MFNA 1DL7H 3LD8B 2DMBA 4UAOC 5TDNA 4E0RA 2R0WL 1FG2A 1WVZA 1FLRH 5CFHA 3DHJA 3H0TB 3CFCL 1NCBH 3QR2A 1UWXK 1S5HB 2DWEA 5IOPB 2BFVL 1T1XB 4U1LB 4WY7H 4OLWL 5ITBH 3FN0H 1QBLL 2X4UA 1F4YL 1CLOL 3A6CL 4X99A 4WI9A 2CKBA 4XC1L 2X40A 43CAA 4HV8A 4IDJL 4P5TC 4XMKH 3TT1L 5I1IH 4GG8B 3VGHA 4EN3A 1CBVL 1XZ0B 4ELMB 4P5MB 4APQC 2N7AA 1CR9H 3CSYA 4CADA 1CD9B 3CDFA 5CJBA 4OFIA 3O6LH 3L3HB 2VMFA 2X1WL 1ZANH 4OCWH 2HT2C 2GJ6B 1KJ2B 2WBKA 1OSPH 2ZPKH 1X5XA 3QDJE 2QSQA 1F3RB 5HGBB 3AS0A 2I9TA 5C0RL 5E8PB 1BVLA 3A67L 4N9GB 1UG9A 1N4XH 2EDOA 4HIHB 4XGZB 2XA3A 1CDBA 2AEPL 2VLRB 1OP5K 5CKGA 1O5DT 5CZXC 1BM3H 1P4IL 4KK9C 2FHBA 2NY4C 3ARDC 3MV8D 4C57C 4XAWL 1IGIH 4WUUA 2VRAA 4X80L 1JNHA 3C6LD 2CO6B 4Y2DD 3VMNA 1U3HB 3IDYC 4OF5A 3M17B 3UTPE 1I8LA 3D0VB 4UMGA 5FV1L 3GJEA 4BSVA 2HFFB 1D5IH 1J9CT 3BH8B 3S3SA 5KSUA 2EYRA 2D31A 4JFFB 2H41A 2ITDB 1XIWD 5E5RB 3RZCA 1QA9B 2BOCB 5BS0D 4I2XE 4YJZL 1A14L 2GK0B 5D8JH 5HYSB 1Y0LB 3M8OH 2LVCA 3LN5B 4G6AD 4M7KL 3V4PH 3PGDB 3LQZA 4DVRH 1Z2KA 2DI7A 3MLRH 4PJ7E 4IM8A 4CVZB 3CFEA 2EDJA 4GUPB 2XZCH 3CX5J 5T33H 2C5DC 1KCRH 4L9LA 4BSWA 3FQWB 2VXVH 3BGAA 5MENE 4J3VA 3NIFF 4Y1AE 2X7LA 4GQ9H 4MD0A 2HT3C 4F7MB 5IESH 4Z7WB 4NNPH 3NA9H 5TE7H 4FQPA 4FFZL 4IEFB 4I77L 3T1FB 1A3RH 2Y36L 4GG6A 4QRRA 2HVKB 4E5XA 2HG5B 5IGXL 5IF0A 3GKWH 4Y8DC 3ROLA 5SX4H 1DQDH 2WM0A 4ZG1A 3GMQB 1OB1A 2KQNA 3LRGA 1IC5H 1SEQH 1T3FA 3P4OB 3I9GH 3BX7C 3MGTA 1UYWH 4P48A 4E41B 4RWHA 4L3EA 5ENWA 2IAND 3GI8H 3V6OA 4U0QB 2NY0B 1LHZA 4U1SB 2XG5A 5I9QC 2VZ3A 1RMFH 3BWAA 4LGSB 2EEBA 2R1YB 2BVPB 4P46D 3WKMH 2JK5A 3O2DL 3BN9D 5F7NC 2A9MH 4ELME 4UOW0 3F7YB 3WIHL 3FO1B 1MCFA 3KDMB 1U9KA 2XTLA 3OKLB 2N4IA 4IRJA 2MQCA 3MZGB 2W38A 4YHNB 4P57B 1FFNA 5IIEA 4X6CF 2R4RL 5CJOH 2OZ4A 2G2RB 5FM8A 5JW4R 3ROOB 5DK0B 1CICD 4WGVB 4MJ6A 4HKJA 1ONQB 3WD5L 5KZCB 2FIKA 2DTML 2YPKB 3T0EB 2P8LB 4XC3H 1F4WH 3FO0H 5KSAA 2Q8BH 3O9WB 5F1IA 4LCIH 3DMMC 4BUGA 1HNGA 3C8KB 1ZHLA 3CFBA 3ULUL 2VLRE 4U7SA 5GRJL 2WNGA 4JPIB 4XPAH 1LEIB 2WQRA 4JFDA 3DGCR 1RZFH 3KJ6H 2J7LA 2AEWA 5JORB 4K9EL 2C3GA 1BQSA 1II4E 3HPLA 3VXRD 4WI4A 4YFLF 5EIIA 5DJ2A 4MDJA 1G9NL 3CH1B 4JFFE 4BKLB 3HLAB 5CLWA 5D5MA 2DRUA 1RPQA 4G8FB 5C7XL 3A0OA 3ARBD 4NKQB 4WHTB 2YD6A 1Z3GH 3TZVD 5CKAA 3WFDL 1PDKA 4P3CH 4HS8L 3N85H 2LVEA 1DJSA 4K7PH 4AG4H 3WS3A 2PYFA 3QWRA 3ZTJG 1QO3A 3SDCB 4HJGB 5HYQA 3E6HA 4K3EL 4YHZH 1EX0A 1NCWH 1BFVL 4NO5B 3QJHB 4M43L 4L8DB 2NCMA 4Z7WE 2QQQA 2X4NB 4M6OH 5GSRA 1S7WB 4KRPD 4JN2A 1KB5B 1S9YB 4IMLA 1QNZH 1SBBA 3JV6A 4DKDC 2OR8A 3EDEA 4YNYA 3BW9B 3DSFL 1UM6L 1DUYB 3VWKB 5IVZB 1EBAA 5IV2B 1FYTB 3DXAA 4WNQB 3SJVB 4K23L 1EO8L 4QHUB 5DEZA 1ZVYA 4YHOL 3QQNA 4AH2A 1J5OH 1I7TA 5IHBA 2D3VA 5C0BB 5C07D 1JRHH 4E41E 5DD0H 1FH5L 2NW2A 2H26A 4NKOA 3RNKA 4ZO7A 5EU3A 3C6LC 4Y2DC 2V5TA 1TCRB 4POUB 4MLIA 5E6YA 4JM2D 4PLOB 4OM1H 4FZEH 5ICXB 4HC1H 4LRIC 2IQAA 5EZLB 1BZ7B 1MF2H 2YD4A 3HE7C 4ZXBB 1FIEA 4M7ZC 2FO4B 4M6ML 4UIMA 4CU8A 1UB6A 3GSRA 4U1GB 4JHZA 1XIWC 1LEGA 2IMMA 2NZ9D 5I1DA 5GGRY 2FCBA 1U91A 4G6AC 32C2B 1CLZH 5DEGA 1L7IH 2MPAH 3S9DB 2DM2A 1AKJA 1G7PB 1PQZB 3SHSA 5TF1H 5HHPA 3T0EE 3D0LB 2BRRH 1F13A 2C26A 5IM7B 5A3ID 4DUXA 3LKSB 4Y16A 4G8IB 3SKNB 2E5EA 5HPOA 4CN1A 1BBJA 3C2AL 1CFVH 3PP4H 5AEAA 3MRLA 2BY1A 5HDQL 3ZL4H 1RUKH 2W9EH 4JAMB 2XYCA 4YDJB 3IFPA 2VQTA 1KACB 5FYJH 4YFLI 1FO0A 1NGYA 4LEOA 4XWGH 1JGUL 2APVA 4DFIA 3ARQA 1IAOA 5DD6A 1EMTH 3U4EB 3ULUF 3VXSD 1EZVX 3MNWA 1CK0L 1EO5A 4CMMB 2CD0A 1NGWA 3G08A 5CCKL 4F9PA 3I6KB 5H2BB 4LLWA 2WIIB 3TPKA 3S3JA 2L7JA 5I1AA 1JPGB 4NN5B 3MCG1 4ZTOL 1K85A 3MRCA 3NZ8A 3OKDA 1N6UA 4HCRA 4NWTH 2DMKA 4PRIA 1IC7H 4GXUN 5D4QA 4P46C 4NQED 4PIRF 1INDH 3BN9C 1QZ1A 3UTOA 1D7FA 2X4RB 4BA8A 3MA7B 1RVFL 3VD7A 1DBBL 1RUQL 3AY4A 1CFNA 2MCPL 5FM5M 1CYGA 1P69B 1UWGL 5C08D 4HGWA 2DB8A 1Q9KB 2HFEB 1CICC 5C9JB 1FGNH 1QFUH 3QXTA 1HHJA 3EOTL 5JOEA 3QCUH 5IJKC 3P9LB 2RBLA 4L8CA 1UZ8A 1VENA 3VXTB 1QVOB 4NRXB 3ZHKA 1FYTE 3SJVE 1KC5H 4FN0A 6CGTA 2A1WH 3BP6B 2X70B 1MHEA 1P1ZB 1WWCA 5C0BE 1JF1A 2X4TA 1OP3H 5JO5B 4H20H 5AZEL 3IDXL 4Y5XA 1MQKH 2AK4A 3TO2B 5FECA 5F6IC 1CGTA 3D25A 1LO3H 3P0VH 1KUMA 4RBPK 5D1ZD 3VE0B 2JJTC 5EBMB 5BW7C 2I9LA 2YD3A 4P2RA 4K3GA 1ES0B 2D7OA 3V4VH 1N0XL 3O0RL 2C1PA 4WW1A 1K8IB 4NGHH 1YQVL 4XMPH 1U8PA 4U0RB 5IB2B 3WO4C 5IKCB 3SY0A 3DVGA 3HI6H 4LMQI 3WV0A 1YMHB 3JV4B 1FBIH 3ARBC 4Y7MA 3D9AH 4UZGA 3ZE0E 4KQ4L 2ARJB 2C3HA 3TZVC 5DUPL 1HXYA 1A7RL 5CJQL 3STLA 3V2AR 4PJIA 3GI9L 3BP5B 2OK0L 4XPBL 3HHRB 3MRGA 1LO2H 3MACL 4NO2A 4ODUA 1HI6B 2R2BA 2IAMB