3X3GH

Fab fragment from anti trail-r2 human agonist antibody kmtr2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
224
Chain Sequence
QVQLVQSGAEMKKPGASVKVSCKTSGYTFTNYKINWVRQAPGQGLEWMGWMNPDTDSTGYPQKFQGRVTMTRNTSISTAYMELSSLRSEDTAVYYCARSYGSGSYYRDYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPCSRSTSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of KMTR2
publication title TRAIL-R2 Superoligomerization Induced by Human Monoclonal Agonistic Antibody KMTR2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 224
sequence length 226
ec nomenclature
pdb deposition date 2015-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3x3gH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3x3gH01
2EDWA 4OD1L 3IETA 1U92A 1TVHA 4Z8FL 3TA3C 2GK2A 3QPXL 1BD2D 1SBSL 2ZOKA 5C0GB 4PR5A 1G7LB 4NN6C 4GAGH 4ZUSA 5D93C 5GGRA 5KAQF 1AO7E 4ZSOB 3MCKA 3P73A 4XC3H 3FQUB 3ZKSD 2XWJB 3HNVL 1FDLL 3E1F1 4UT9L 3FKUS 3GI8H 3OKDB 2V17L 3ZLQC 3QNYB 3MLZL 4BA8A 3CFEB 3AUVA 3IXTB 1IC7H 3QEGL 4PREA 3TNMA 5ILTH 3SPVB 4O2CA 1TIUA 1RK0A 1WIOA 4PRBA 1QBMH 3REVA 3OJMB 4XCYB 1S9XB 2JELH 3ORJA 1RK1B 5H37H 4FG6D 2GJ6E 1WAAF 2BVPB 1FGVH 4BQ6A 5D1XD 3TFKD 4M8VA 1FZMA 4FQCL 4P2OD 3D85A 5IQ9A 1SY6H 3PWPD 3EO1A 4FZ8H 1JGDB 2AV7A 2E27H 4YK4B 5ACZB 5CAYB 5I8OL 4IMKA 3WN5B 3UDWA 3MR9B 1ZGLA 4QF1A 2FX7L 2WIIA 3HC3L 5JHLH 3U0TA 5I71C 3WEXB 5C92A 3D87B 1LGVA 4P2QA 1P2CA 1I8IA 5E9DB 3V5DB 2DQTL 1GGUA 3SE8L 4J3SA 1N64L 3MNZA 2BOCB 1DEEB 4N0CD 4OGXL 1BZ9A 3BIKA 4OBSA 5J3HD 1F3JB 5J6HA 2XNAA 1AXSA 3WIHH 2DQUH 4D8PA 5I17A 4RAVA 1CS6A 3VD3A 1PKQA 1A9BB 1KBGH 4GAFB 2V7HA 4X4MA 2BY0A 1IC1A 1C5BL 3DUUB 5E2VL 4JN2A 1XIWA 1O5DT 3FRPG 5DS8A 1HH9A 4JGUA 4R3SA 1HILA 3B5HA 4I3GA 4Y16C 1CFNB 3VI4E 4UAOB 5IMLA 1J05A 2ZWLT 2C1OA 3FFCD 5IGXL 4ETYA 3BN3B 5C08B 3QIWB 3CDGA 2A9NL 3UBXB 3FOMB 1KCRH 3MFGB 4XP6H 4HDIB 4PJHB 2BSED 1G7IB 2J1KA 3T2NL 2JELL 3H3PH 1BLNB 4AEIH 4WI8A 4HGMA 1FGVL 3IRZA 1R3JB 2A6IA 3VMNA 1IGJB 3MGTB 4OCSL 2H41A 1N3NB 1IGYB 3VFPA 3T3ME 1TZHB 3V0VA 1J7VR 1UWXK 1NGQH 4WHYG 3DARA 2QQLH 3AU1B 2PO6C 3RKDC 4Z0XA 1EFQA 2FO1A 3HZVB 5ITFB 4YDKL 5IP4A 4WDIB 3VA2C 4JAMA 1RU9L 3L5WB 5HYJB 1P1ZB 3C8KB 1OWRM 2DL9A 3ECBA 1U8IB 2ICEA 3QQ4B 4FOMA 4MLSA 5D9SB 4QOKB 3MJ7B 2CO6B 2VXUH 3QDME 1JFQH 2VERN 5DGRA 4BJLA 3GSWA 3HI6H 2VAJA 4E41D 5HHOB 3VRLE 2VDKL 4OLXL 3SE4A 3IKKA 1IGIL 3SKJH 4QTHB 3W5MA 1FJ1B 2BK8A 1J8HB 5D2NB 4U7KA 3UTZB 2P8MA 4Y5XA 1S78D 4CAGA 3NFPB 3KJ4B 1T5WB 4X4XB 4QWWC 4NNYA 43CAB 4POYA 1LO3H 3D2UB 4KC3B 4UQ2B 4RSVA 5AZ2H 1QFOA 4POZC 4UIKH 1UKTA 3DIFA 4LLWB 3FFCE 4Z78A 2FNBA 1RZIB 4IRJD 4WFED 1N4XL 1NJ9B 3KNBA 2FLBT 3DTXA 1A8JH 2O93L 2CXGA 4HV8A 5GRYA 2D03L 4DN4H 3QO0B 2PXYC 4YHZH 2VLLB 5INDB 4UV4L 4ETQB 3FN0L 1HCVA 1GPOL 3GSQA 2D9CA 2DL2A 5IT2H 4Z7UA 2XN9A 1VKXA 4GW5A 1LQSR 1D9KD 3RTQC 4OLVL 3RUGE 3O4LD 4PLJC 3P11H 1G7PB 3SE9L 25C8H 3REWB 4PJEA 5FK9A 3S37X 1GRWA 3G5ZA 3VFTB 2B1AL 3NAAH 3T4YB 3QIUB 4U6YB 4XVTL 1KG0B 3D3VE 1OPGL 1I9RH 4MCYB 4NZTH 4XVJH 3BDYH 1W72B 5GRVK 5IESH 5DGQA 5SWSD 4JJHA 3VDBA 3VH8G 1WFTA 5IB2B 1JIBA 1WGOA 5MP6H 1GAFH 2EXWC 3BP7A 4HWZA 4YXHL 3FAWA 5TE4L 1IL1A 1FNSL 2GK0B 2HT3C 2DD8H 4E41E 15C8H 3CPLA 2IAND 3L3OA 2XWTA 2YSSB 4LPUA 1IVLA 2BVYA 1HHJA 4YAQA 3S88L 1JFQL 5L7XH 2FWOB 3HI6L 1CK0H 3LDBB 3PGDB 3KPTA 1H8SA 5D96C 1K2DB 5DRZB 2DTSA 4WWKD 4NO2B 4HPOH 4TRPL 4NQCB 2XA3A 1C16B 4U1GB 3DX6B 4PLNC 5AYQA 1QLEL 3PWJA 4Z18A 1SJHA 5KS9E 5AZ2L 1A5FH 4WFEE 2M1KA 1OAKL 3W0WD 1T22A 2EH8L 3QXDA 4U6VL 5I73B 5CBAA 1MCHA 1CD1B 2H8PA 1MJ8H 3ZKQD 5C0AA 2AEQL 2ENYA 4Y2OA 1QLFB 3VFGL 5IKCA 2D7OA 1T6WA 3NCBB 2OTWA 2OBGA 5CEXB 3U7WL 3I9GH 4M7LL 4PG2A 1MWAB 5TH2B 4I18B 3EFFB 2IFFL 1MIEL 1F58H 3O4LE 5EPMB 4L4JA 4FZEH 4PRID 1JYVA 5DMGC 4YHLL 1JPFA 5DR5L 2Q76B 5DO2C 3MLXL 4ODHL 4GG6A 5IMKA 3MA7A 2Y06H 2MKLC 2BY3A 4I0PA 5C07B 25C8L 3HNTH 4X6DA 3QZWG 4YNYB 2ESVA 2R2BA 3VJ6A 3HE6D 5SWSE 4WHYH 2XYCA 3QBTB 2DQHH 3W2DL 4F15C 1N8ZB 2EIZA 2VE6B 3CFIC 5DQ9A 5IVXA 4ONHA 1JPGB 3T0WA 3SKMB 4PYHA 2F74B 2IANE 3VDCA 2A2QT 5I66A 3EGSA 2K3TA 1H3UA 3ZKMC 4F9PC 1TETL 2G2RA 3U9PH 1RJZA 3CDCA 3W39B 5E5MB 1F97A 2ICES 4H20L 5IBLD 1UZ6F 2DKSA 5DI8A 5F1NA 5E1HB 1A1OB 2B7DT 4YPGB 3HG1B 3SDXF 1DUYA 3DVIA 4ISVB 5FYKU 3O3BB 5T1KB 4FFVD 3RVTC 4U3HA 1WBXB 4NM8L 5IOPA 1A7QL 2PTTB 3F6IA 4NWTH 4P2RB 4MNHB 5EO1A 4EKXA 3W0WE 2RFXA 2KDGA 3K8LA 1A0QH 1U8OA 1MHPL 1XZ0A 4HMEA 3CCHA 1RD6A 3DROB 3EOBA 4X4YA 2YXFA 1TTUA 4GRWE 1RVFL 3X12B 3OBAA 5C0ND 2WP3O 2BC4A 1T80A 4X7SH 4X98B 5JXEC 4H1LB 4NHCL 1LMKA 1RPQA 5CMAA 4PRIE 3I9GL 2VL4A 2IGFL 1N5YL 1WICA 2VIRB 4D0CA 5DFVD 5FYJU 4DVBA 1VACA 2PN5A 4Y5YA 3LPWA 1AGBA 3QP3A 3KPSB 5F1SA 4EZMA 1PSKL 2GITA 4FFYH 3A6CH 3IDNA 5BCAA 2FX8H 3D48R 4E9LA 5B39G 2DJSA 5IEKB 4WY7L 3QCTH 4ZUTA 3LKPB 4LHUB 2M2DA 3BKCH 3WFBH 4A6YL 4O51B 4C56B 3ROLA 3S37H 1J0HA 3RGHA 2P4AB 4PG9B 3UPAA 3VWJC 5CHNB 4MNGB 1IAIH 2FDBP 2OYPA 4M93B 3HR5A 4LCUA 5GRUL 1BGXH 1QBLH 3RWIA 4Z76A 3S98A 4WI5A 2H26B 5CKGA 3WLBA 2B39A 4P4KC 4WVRA 3OHXB 1UFUA 2HKHH 3IF1A 4R4BB 1D5XB 4MQ7A 1WT5C 4PR5B 4XVUC 3TJEH 5GRJL 2V6HA 2Z0BA 1I7UB 5GGRB 1GGCL 5HHVH 3AY4A 5EWIL 3V7AG 1HWGB 3P73B 4DCQA 2GTWB 4YQXH 3IJSA 1ZT4A 3QULA 1ZMYA 5E8NB 2R0LH 4LCCB 2NZ9D 4CJ1A 3E6HB 1YYLH 1A0QL 4OM1H 3B8YA 4ZXBD 2GSIA 4L8BB 4DN3L 4NOBA 3OB0K 2HYMA 5LKNA 1RURL 5F7UA 3RVXC 4OV5A 1WIUA 2HTLD 4HGWB 5F9JA 1CG9B 3QJHB 1JUFA 1I8KA 4YR6A 4CVXB 1I3VA 2J6EA 2H9GB 3UYRH 3DYPA 2GFBA 1OM3H 1PW3A 3GSVB 4M7LT 1P4LB 2AS5M 3FB7A 1KTDB 4OM0H 4PS4L 1FQ9C 4L8DB 4ZTOH 1A3LH 3D85B 4YBLB 1MCCA 2GAZA 4D9LL 4Z7WF 4HUWB 4BQBA 1VFBB 4OKDA 1BFSA 4HUVA 1PEZA 3U4BH 4QF1B 2WIIB 1EEZB 4X6CB 3GI9H 2AJVL 2AJYH 3S3PA 1FL6B 4KRNA 4P2QB 2FCBA 2V2TB 5HHNA 2R0WH 4KAQH 3IDJB 1C5DA 1LK3H 1S7SA 2CLRB 4R90H 5DWUL 2OI9B 1WWWX 5GGVL 3Q0HA 3X11A 5FF6A 5F1OB 1J11A 4L3AA 4O2FB 3RIAK 3MROA 4WTZA 4FN0A 1BZ9B 2Z93B 4IHOA 4HIXH 5J89A 5AD0A 4OCNC 1XF3B 2R29L 3B9KD 3QRFM 1JWSB 1K3ZA 1X5KA 3IDIA 5CJ5A 1NGWA 1UXSA 3A0OA 5J6GB 1GGBH 2HKHL 2MCPH 4GS7C 4NO0A 4X80H 3U4EA 1NGYB 1JV5A 4WW2A 3WO4B 2YD7A 3IXAA 1G6RH 2OK0H 1UEMA 2ADFH 3BPCA 2JJWA 5DS8B 4YQXL 3ULVC 3AS1A 4GRLC 3CC5A 1F3DH 2YD9A 3D39A 4HZLA 5IROA 2IH1A 4G6ML 3C9NA 1J05B 1J9CT 1A9EA 2DLHA 2C1OB 1LNUA 2AK4A 3IDXH 4LRNH 2XZQH 4KWUA 3EAKA 3DPBA 4HF5L 4APQC 5EZJB 5IWLC 4MD0B 2HJLA 5DFTA 2Q3AA 1KLUB 1EEUA 1AXIB 2ICWB 3QEHB 2WBJB 1I3RB 4S11A 3ARUA 2X4NB 2VLKD 5EUKA 3WFEH 3JTSA 3ULUC 4WCYH 4OFVA 1HHIA 4ZFZA 2ADJB 3DVNA 4PTUA 2DIBA 4R7DB 2QHLA 3O6LH 1T03H 3QUMA 3MRCB 3DXAB 3SGEH 4EEEA 3O2VL 1MQKL 3VFRA 4U1SB 4K55A 1QSEA 1W8NA 3HC0A 1OY3B 3NGBC 1L7TH 4OJFH 3KR3H 1AP2B 4PP2B 5IW6A 4IRSD 2NXZD 3RGVC 1HNFA 3SDCA 1WAAA 2OSLB 3QH3A 4PRPD 3U4BL 5GZOD 2AXGA 3T2QA 1FVCA 4G6JL 4E5XB 4EI5A 4XNZB 4OLZL 4KU1A 2N7AA 1X4ZA 1AC6A 4V1DA 3STBA 1LE9B 4ZG1A 1C5CL 2MOVA 4L8SA 5D7IA 1DQMH 2A0LD 3ECBB 3QIBC 4AMKH 2V9RA 1DE4B 1S3KL 2R0WL 4PJCF 4KAQL 3GO1H 1ROWA 4ZOBA 3UO1H 3BZEB 1G9MC 1RZ7H 5JIKA 3A67H 1KCKA 4WJ5A 4KHTH 5TPWL 3SO3B 3EDKA 2DKUA 3WBDA 3JV4B 3GSWB 3I3BA 2HTKD 1TPXC 4HIXL 2ATKA 1MCOH 4WI4A 1CGUA 3K8KA 3FT4B 2IWGA 1DBAH 5F97E 2NXYD 3FQNB 1T04A 1GGIH 3VFNB 2JJSA 4G6KL 4S1DD 4X9IA 3DMMA 1HDMB 2OK0L 5A1AA 5JO5A 5E2WH 4H5SB 1Q0YL 5JXAH 2HLFC 3KNBB 1DBJH 5CIPA 1NCUA 1U93B 4G8EB 5D2LA 3DYOA 3MBXH 3MRFA 4LRNL 2XZQL 3RY6A 1T21B 3D69B 1UZ6E 1F8TL 4OIAA 4TPRH 1CD0A 5KZCD 3G04A 1C7TA 4OQTL 1ZT7A 2J12B 2VLKE 3SDXE 4DKDC 1A6VL 3RVWD 3U6RB 1N59A 5ADOH 3CMGA 3T0EA 1QACA 1U2CA 4NN5B 1ZLVK 4WCYL 2G5BA 4LVOC 4WFHD 1C8PA 3L3IB 4GXVH 3MJ9H 4Y19A 1T2QH 3I50L 3IJHB 5DJAA 3F5WB 3MLVL 5EFIA 3G5ZB 4PRPE 2L7JA 4F7MA 1L7TL 4PJGF 2PW2B 3I2CL 3TJHC 1EJ6A 1UT9A 2E9IA 4KTEL 2A1WH 3QDGD 5A2JH 4YZFF 1S9KC 1A4JB 1H0DB 5EOCH 1QPPA 4PJFA 3L3HA 3ROOA 3CFKA 3UO1L 3CPLB 2AKRA 1Q9KA 3L3OB 1QTYT 3A67L 4M02A 3P0GB 1N0XH 4KHTL 3EO0A 2FR4A 1ZHLA 5EORL 4O02H 1SY6A 4QHUB 1ETZB 3JWOH 2I60H 5HGAB 5IB5A 3PHSA 3MUGB 1DBAL 2J88L 3F6LA 3QUZA 4DZBB 4UTBH 1GGIL 4RMRA 5IBUB 3PWJB 2NY7L 4KI1A 4Y8AA 2A77H 1EJOL 5T1MA 4ZAKD 4GJTB 5KSAA 4NT6A 4RMTA 2W60A 2H8PB 5E2WL 4F3FB 4LCWB 5C0AB 5ID1B 2V2WA 2NY6D 2NY3D 1HYSD 4QTIL 2KKQA 1UWGH 1JF5A 2A9ML 1OGAE 1CLZL 3SDDA 3WIHA 5F9DC 3OJDB 2I5YH 3MLYL 4FXGB 4Z9KB 3AM8A 4KUZL 2AXHA 3RRQA 3JV6A 1MSPA 4XAKD 4WFHE 3V6FA 2PUQT 3L6FB 4JKKA 4Y16A 3K3QA 5FDWA 5CJBA 4HS8L 4J6RL 2XWBB 1YQVL 5CEYB 2ZCHH 1UZ8A 3MA7B 1AXTH 1QRND 5I1JL 3B2UD 1JK8A 4MAUL 1D6EB 5CZKA 1T2QL 4LAQL 2ESVB 2R2BB 5E5RB 5BQ7A 2R15A 3ZT5A 1Q38A 1JPSH 5TF0A 3RPKA 3MYZA 5BXFB 4I3RL 3UJIL 4HS3A 3IS0X 3EYOB 3OL2A 3SKNA 5T3XH 1MNUL 4QXUH 2EIZB 5KVEL 1V8HA 4I13B 3LV3B 3HRZB 3B6SA 2CKBB 5I16A 3WXVH 1TQBB 3QAZC 5I66B 5T5FH 3EGSB 3MRQA 3VW3H 5IBTL 4G6FB 5I0DA 4QT5A 4GUPA 1S7QB 3QUXA 4LKXA 4Z7WE 5IFJB 1A3RH 1NCBH 5E00B 2LE9A 3G08B 5D7JA 1I3GL 1N0XL 1NGZA 1NCDL 4OFDA 4RGND 1DUYB 2NY5L 1S8DA 1KTRL 1Q9WB 2I60L 4KK5D 1KT2A 3HZMB 5INCA 4MJ5A 1EMTL 2N56A 5CWSB 5IMOA 5D1XC 3TFKC 4PJ5A 1W0YT 3RAJL 1G6VK 3U0PB 4UTBL 4NKDB 1IT9L 3CCHB 1FNGB 1PDKA 4TOYH 3AXLA 1KFAH 4X4YB 2W0PA 4M5YH 3QDJD 1HIMH 1HI6B 4L3CA 1R3LB 1U8MB 3X3GL 4BZ1H 4JR9H 1CICD 1UWGL 1PY4A 1YPZF 3BP5A 4PGZA 3PV7A 1IC5L 1EUUA 2XXMB 3QRGH 4PJIA 1MCIA 4D0CB 2FB4H 4N0CC 2AV1B 3ES6A 1JZ8A 4DVBB 1VACB 4RX4D 5J3HC 3IVKA 1IM9B 3P4OB 3NA4A 1E4KA 1PEWA 1BJ1J 5HVWA 1FC2D 3VXPA 3PQYD 2APXA 3HI5H 1KJMA 2FATH 2R0ZL 4ZNEA 1J88A 2I9LB 1JNNH 5EU3A 2D7PA 3TN0B 3WIIH 3V5HA 3MPCA 2H2SD 3GM8A 4ODXA 1XGPB 5A43C 2JK5A 1OCWL 3HR5B 4MB5A 3LN4A 4LCUB 4XNYH 4HWUA 5E6ID 3EFDL 5BV7H 3RNQA 4RGNE 4XNQA 1Q9OB 2B4CL 3WLBB 3MTRA 3IF1B 1BZ7A 2WUCH 5BV7C 1WWAX 4F80A 4MQ7B 2DLTA 5EU5A 3O6FC 5TDPB 5JHDB 3SJVB 1HSBB 4G42A 1HHGB 2PR4L 3MRNA 4N0UA 3OX8A 1YY8B 1QFUH 1UM6L 1ZT4B 2DM3A 4MXQD 3QULB 3W11C 3CK0H 4LSVL 5TQ2H 4AENA 3QDJE 1NC2A 1S7RA 4PJCE 4UUJB 1RZFH 4MVBC 5D7LD 1QO3A 5HYSG 5I1CH 5EU6B 2HWZH 3CXDH 5KBNC 3V5KA 4M5YL 5HGHA 4R7NA 2ADIA 2Z92A 3C5ZC 4MDJB 5BRZA 4JM2C 3FB8A 5ENWB 5F9JB 1KELH 4M9OA 1RAMA 1I8KB 4M6MH 5F9WC 3RHWK 2PF6A 3QWOA 3RJQB 4WEBH 3H9ZA 1LILA 5BW7A 2O61A 4GH7B 1AKJA 4KVCL 5DRXB 4PJ8B 5ADPH 3L9RA 1TNMA 2GAZB 1U8NB 3DSNA 5FM4A 2DYPB 1H9VA 3PQYE 5FGSA 4QRRD 2C3XA 3HUJB 1FL3B 3OV6A 1S78C 4MS8D 2W0KA 2JB5H 1P53A 5E9DD 3T65A 4N68A 3HI5L 2YKLH 2JE8A 1TJIL 2FATL 4HK3N 4UQ3A 5EOTA 3ZKND 1JNNL 5JIHA 3ISWA 3DBXA 1NGPL 1S7SB 2VXVL 2PYEB 1QOKA 4XPFH 1Q9LA 1I7RA 3DRTB 4IRJC 4GW1A 3MROB 5SX5H 4PUBL 3LSOA 3PL6A 4RDQF 2VDNH 3WL9B 4XNYL 1NBYB 4X99B 1KF9B 2ZUWA 4FQHB 1MOEA 1GHFL 4XPBH 5EZLB 4TYUA 1A7NH 4LSSL 3O0RH 4PJGE 4MA8H 4UB0H 3WUWB 2NY4D 3CAFA 3ZL4H 4NQDA 1JV5B 3HZYA 4HK0B 1D9KC 3JV0A 4YZFE 5D7LE 1QFUL 3S4SG 2A6JB 3MRLB 5C0BD 2G5RA 3D39B 4OTXL 3PJSA 5C08D 2JIXA 3C9NB 3LKRA 4P49A 4JFXA 1RZFL 5EZOL 3ILPB 2R56H 2AERT 1K4CA 2XZAH 1NBVL 1BMGA 1NCTA 1A7RH 4G9FB 1NDMA 3MODH 3QPQD 4N0YH 1OP5H 3D9AL 3V4PH 1VADB 3WSQH 2R2CA 1DUZA 1NQBA 2D7QA 4HFUL 1A6AA 4M6ML 3VFMA 5BVJB 3JTSB 5I9QC 4ZFZB 5KVMC 4C83A 3VGAC 1LK2B 5ADPL 5DD0L 3L5JA 5DF0A 4RRPG 1QSEB 5GGRY 2AI0H 2Q8BH 3VXMB 4WWKC 4JVWA 3V7AE 1MFBH 1JMZA 3SDCB 3CFCH 3BPNC 3CZJA 3HE7A 3QH3B 3RIFF 3HI1B 4MJIA 3IFPA 3TWCH 2AXGB 2F19H 2JB5L 2APBA 2VITA 4M5ZL 1KGCE 3BWAA 2R8SH 1JPST 1L0YA 4KKBD 4QOKD 5FCSH 3H9SB 2A6DA 3QQ3A 4OGZA 3RKPA 1RZ8B 3MUZ1 3S6CA 5LGHH 2X6MA 2EYRA 4XPFL 4JKWA 1V05A 4L1DA 4NZUL 2R1XA 4Z5RA 1J8HD 1J1XH 2DOCA 5E4EC 4X5XA 3P30L 2ATKB 3OKLB 5IR1B 1QFPA 4GMSH 1CD8A 3D2UD 3ZTNH 1T0NB 2X4PB 3QUKA 5IJKC 3ZL4L 1KPUA 5C0BE 5A16B 5D6DC 3DMMB 4R2GB 3OF6A 5KSUA 3VFUA 4RWHA 3DO7A 3NPSC 2UZYB 5GRXG 3VH8A 3ZYZA 1CZ8H 3RX7A 1UENA 4HKZA 1G0YR 1TJGL 5F1IA 3Q48A 1E6OL 3TA3B 3HE6C 1I4FB 4P57B 2R56L 1WT5A 3MGOA 4NDMA 4NN6B 5D93B 3BUYA 4JCMA 2R1WA 4LSQL 5I1DB 1N7ML 2CH8A 4LDLB 1WEJH 5HJ3B 4Q7DA 1N59B 5CSGA 4GAJH 1HZHL 4NO3B 2GT9A 2AQ2A 3SGJA 5JORA 1CLYH 5BS0D 2BSTA 2G5BB 1DP0A 1PVHA 3M1BB 5IBLC 3DO3A 3OZ9H 5LG1A 2HKFH 1QR1A 5DHVH 4OT1L 5DJAB 5EFIB 3QJFB 4P5KA 2AI0L 3IU3A 3O41A 5CGYD 2Q8BL 3MRKB 4FFVC 3GHBL 5C2BH 3TWCL 2NNAB 2ORBL 2PYFA 1YECL 2DBLH 1ED3B 3GSRB 4X6BA 1NMCC 5C6TL 2BMKA 1LVEA 2DTML 2WZPD 4XPAL 2AKRB 5C0NC 2QADD 4QXTB 2LU3A 1SEQH 3X3FH 1I9EA 4HCRL 5L8KB 2CIIA 4JHAH 1FO0L 4OFYD 2IPUK 3MRIA 1MFCL 4X9HA 4DZ8A 5DSCA 5DFVC 2MPAH 1OF2B 1RULH 4PRAA 4HC1L 1X7QA 1MY7A 3RWHB 4QHMA 1X9QA 3L7EA 2CDGA 3SEPA 2RGSA 1ZHBA 5EU4A 1OAUH 2OL3A 2V2WB 4YX2L 2P5WA 1MCBA 3VD9A 2C3VA 1KC5H 4NGHL 2C4FU 5H94A 3LIZH 2EDLA 3ARQA 2Q87A 1QVOA 1KNOA 2D3VA 4XCEA 5BS0E 1U8PA 5TQ0H 1FVDA 1ZWIB 1H3GA 3G5VA 4GRLA 1PD6A 1WEJL 5EO0A 4Y16B 1G6RA 2RQ8A 3LHPH 5IK3B 1JGVL 1CBVL 4WEUD 4BFBD 4EUPH 5B38G 4DGVH 4R96B 5IWLA 1J12A 3C09C 5FUZL 1ZANH 2HFGL 2F54D 4LCYB 3LS5H 1H3PH 3O2WH 1IKNA 1OTUD 3UZQA 2NZ9C 4MA7H 5H35A 3UPCA 2YA1A 2EC9T 5TDOA 4MCZB 2VN4A 5CINH 4ZXBC 3DGGA 4GUPB 3HG1D 2OP4H 5L8LB 5C0EB 2HTLC 3RGVA 1NGZB 5IB3A 2PO6B 3PXHA 5T1KD 5DUMH 1SEQL 4GSDL 4P2RD 4CW1A 2EXYD 4LCIH 1JZ3A 5IMOB 4H26A 3WS6C 2W9DL 3QB7C 3IDUA 1F00I 3VXUD 4BK4A 3BAEH 1Q1JH 2QKIA 4JZOA 4B7IA 1SYVA 1KENL 1JP5A 3BRDA 4CDGC 4CKVX 1IQDB 1J0IA 1NC4D 3C60A 4NZDA 3ARGA 3VWKB 5DD6B 4D9RE 4QEGA 5B22A 4EVNB 5L2KB 1M7DA 4O9HH 3LEYL 2J3SA 1KIRB 1NCCL 2EIBA 4PJIB 1Z9SA 4F7EA 2E8ZA 3UTSA 1JF1B 3G6JF 4M3JA 3KPSD 1U3YA 1G7MB 5C0CA 1MAKA 3KLAB 3LHPL 1YMMD 4RZCB 2AXFA 2ZOLA 2VTFA 2W59A 4G8GD 1P4IL 4PY7B 4LLYA 4YDJA 1L7IL 4ZUVB 2G75B 2NW3A 3GJFB 2F54E 2FECL 2PXYB 1B6UA 3VXPB 2O5ZH 2A73A 1ZANL 2VLJB 1A1NA 1XF4A 2QSCH 5EU3B 3SN6N 1U8HB 3F12A 3LS5L 2VC2H 1NAML 3V5HB 1RZKL 1ZTXH 3RTQB 3O9WB 3L3DB 1U6AL 3FAXA 3GMQA 5BO1H 3NCYP 1IJ9A 3TNNA 2UYLB 1NCWL 3TYGH 1NFDE 4KI5D 1I1AA 2EICA 3UTOA 3T1FA 3MJ9A 4DTGL 4G7VH 4NQXA 3MRJB 1BZ7B 3D18A 4P9ML 3LMJH 1C08B 2VDMH 4G8FA 5DUML 5LCVH 5E99H 1TTFA 2XG5A 2GW5A 4KTDL 3VDAA 3V0WH 2R2EA 5DMKA 1B2WH 3OX8B 3VXUE 4HAGA 4LEOB 2WNGA 2ICWI 2XPGB 4YDIL 1KB5B 3F7YA 4I5BB 1LP9B 1EEYB 1D5IL 3JWNC 2IF7A 1HHHA 4NC0B 5DJ0B 4LLMB 4MXWL 3TZVA 4IRSC 2NXZC 3V5KB 2W65B 1TVBB 2BHUA 5FO8B 5HYQB 2ADIB 3FZUD 3PDGA 5GZOC 3MV8B 5FO9A 4IDJH 4UBDC 2I07A 4F33A 3QFJD 1K8IB 3FOLA 1CGWA 3QWOB 4HJGA 3KHOA 1UWXH 2JCCF 3UYOD 1C12B 1AKJB 4HWBL 5C0FB 5KG9A 1C7SA 4UT7H 4OF0A 2VAAB 4G8GE 4PGJA 3MV9A 4B53A 2DWDA 3ZDYF 4XXCC 1YPZA 4PJBE 2NX5D 2ED8A 1T2JA 1JRHL 4JDZA 2D9QB 2VLRD 4JE4B 3AFLA 4YPJA 4HEME 2O5ZL 4S1DC 3VXNB 4KZDL 2PTVA 4UQ3B 3EOAB 1AQDA 5EOTB 1YEFL 1YYMH 3O2DL 5D5MF 1A1MA 4ONFL 2X1XR 5F7YC 3RDTD 4Z7OE 4DOHB 4M1GH 4YGVA 1X4YA 4Y4KD 1FGNL 5HPMB 1BD2A 1D5ZA 1OAZH 3BXNA 3E8UH 1A7PL 3JTTA 5E8PB 4F15B 1FCGA 1KCVH 4F8TA 2CLVA 4PD4K 4WI2A 3RVWC 1Q72H 3DYMA 2W91A 3Q6FA 1S7UB 3V0WL 2P8PB 1L6ZA 3LKQB 3T4AA 5ESAB 4PD4J 1RUML 5T5NG 5DEGA 5I1IL 3VXRE 1AGFA 3B43A 3QEQA 4JFXB 4UT6H 4BFIB 4QRPD 3LY6A 3NABL 1HSAA 3QFJE 3IFOA 3QWRA 1ITBB 2J8UF 4YHPB 1AGDB 4U3XA 1BWMA 1R5VB 1WWCA 2CMRH 4ZOCA 4X9BA 1G84A 1A6AB 3GRWH 4M03A 1RIHH 1KEMH 1NFKA 3W9DB 4RBPH 5GZND 3LKSA 1A6WH 3B2VH 2BFVH 3PWPA 3RZCA 2BNQE 1QYGH 2Y4SA 4LVHC 1OSPH 2NX5E 4UT7L 2YC1B 5E56A 3JXAA 1AI1L 1DBKL 3V6ZB 2VLRE 5GGQL 1J8KA 4GKOA 4NWUL 4ZFOB 4JPVH 3IFPB 1CDHA 3GNML 4G9DA 1JMXA 4ZUWA 1NEZA 1R3HA 2VITB 4LSTH 3ARXA 3BWAB 4XBPA 1WK0A 5F3HB 4ZAKC 1B9ZA 3H2WA 1CGYA 4GKSA 3MV7D 3HMWL 3UJJH 1B3JA 5FHAL 2NY6C 2NY3C 1HYSC 1MRCL 3IFLH 1ZKAA 1U8QA 1IZJA 2EDKA 4CN4A 4P2YA 1FN4B 3ARDB 4HKXB 3NA9H 1GIGH 1QSFA 1CIUA 4KQ3L 3DJ9A 1JRHI 4PY8I 3T0VA 1F6AB 2BNRB 3S34L 5IQ7L 1ULVA 1JGLH 3L3GB 3Q1SH 4R6UA 1B4JH 3V8CA 1Q72L 2E7BA 5KSUB 1EO8H 3H6JA 3VWJB 1IGFH 2LAGB 1HHKA 4QRPE 3B2UC 3MLSH 5E24E 3H0TB 4JDTH 4RFEB 4PJAB 3RBSA 3CSYA 4P4KB 4X5LA 4WNQA 2X4QA 3O6FA 3RWGB 3OGCB 4HK3J 4LRIA 2F8XC 4KVNH 4UNUA 5HGDA 5IM7B 1YEEL 4AL8L 5TE7L 2NLJA 5DRWA 3WDIA 5HDQH 2NY2D 5D1QA 3UZEA 3NOIA 5I76B 1RIHL 5DHXB 1FLRH 1KEML 1JYXA 5HHXL 5GRVL 2YRPA 3C5ZA 4RGNC 1AY1L 1Q8MA 3BZ4B 4JM2A 3PWUA 4WFGD 4MD4A 4KK5C 1OB1A 1YUHA 2YBRB 4PRHA 4Y2DC 3CJJA 1XGYH 3PP3K 5I8CA 3UX9B 3I6GA 4XZUA 4I2XB 3UBXG 1WUNT 5A2KH 1MCWW 3PDOB 2L4OA 2OJZL 4L4VE 3MV7E 1DTUA 1JZ6A 4YUEH 3CMOL 1MCPH 5I1HL 1VFAB 4OCXH 3G6JE 3LS4L 4HH9B 1JPTL 3V95A 1ACYH 1YNLH 4XC1L 1YDPA 3H7BB 1CICC 4P3WA 4PV8A 2UWEB 1CXEA 4M43H 1FH5H 1V7MH 2K9UA 1QFHA 1R5WB 2CIIB 3CIQA 1Z0MA 1HQRB 5DURD 5LWYH 1WFOA 4LPYA 1A22B 5LGKA 2E6QA 1JZ2A 2CXKA 4G5ZH 2AEIT 2Z4QB 3N85L 5I1GH 3QI9D 4BZYA 2HFEA 3QNZA 4LCWD 4GKZA 3S96A 1ZHBB 3TBYB 1NMBH 1KIQB 1KXQE 1PLGH 2W1NA 2OL3B 4Q0XL 5DMYA 2P5WB 1BX2B 2QHRH 5T1LB 4GS7B 3FFDB 2W0FB 2E5EA 4KVNL 4JFHE 1ZHNA 2H2SC 2DS4A 2FBJL 4KHXH 3Q5TA 4YJZL 3BO8B 2ATPB 2DLFH 1MFEH 5E6IC 5DQJA 3NFNA 4WFGE 2WQRA 3GMOA 4WI3A 3S35X 4APQB 2X1OA 2BHYA 3EDJA 4NNXB 4WHCA 4LSUL 5DVNA 4YHIA 3EYSL 1F4WH 2HT4D 4RMWA 4X7DC 3U7YH 3E6FA 3F58L 4MXQC 2VDRH 1MLCB 5CEZH 1CGXA 5IMMA 4Y4FD 4H0GA 4NSKB 4JQVA 3R8BB 4LF3A 4NFCA 2ARWA 3IFNL 4DKFH 4AK1A 2P43B 4P46D 1ZEAL 4G7YH 5BZDB 1RJLB 3NGBB 4JRYD 1S7WB 3CH1B 4RQQB 5EB9A 1GXEA 4D9QD 4HBCH 3AB0C 5GS1C 5C86A 2EDOA 1J10A 3OB0H 3CX2A 3MBEA 4U1HB 4XRCA 3QIBB 4K7FB 2C3GA 1ONQA 4G5ZL 2FJGA 3KPQA 4GRMB 3BPOB 4TTGA 1PKOA 4Y4HD 5D5ME 4YDVB 4DQOH 5F71A 1J1PL 3Q2CA 3KJ6L 3UXFA 3DX9B 1TPXB 4QHLB 2Y5EA 3MLRL 3QO1B 2FL5B 3WUZA 4LLDB 1CLOL 3GIVB 1U91B 4NQSA 5GHWL 3WHXB 4BH8A 1VFMA 3N0PB 3BSZH 3ZKNC 4R0LA 3V4UL 3O4OB 5F7EL 4TSBH 5IJKA 5D6DA 4U3CA 3L3JA 3OJVC 5CJQL 5FUOL 4P9HH 1A4KB 1U58B 4BKLA 2RHEA 3BQUA 2HVJB 1CVRA 3HE6A 3SOBH 4PJXE 1BOYA 1TVDA 2XTJD 3F7VB 2HG5A 4N0RA 5HYSA 4XAWL 1P7QD 2NY4C 2J8UE 3IAQA 1CU4H 3VCLA 2A83A 1VGKA 5DVMA 4UAOC 5HVGB 5SWQA 1S9YB 3U7YL 3R0NA 4RAHA 2VXSL 2VQTA 3IAPA 2VL5A 2BP3A 3TV3L 1YEDB 4LLQB 1R3IL 3SDAA 1VEOA 4IOIA 1DSFH 4XH2A 3MRMB 4XTRD 1WLHA 3L95B 1F3RB 3M07A 3HB3D 1R0AH 2WW8A 2MWCA 3O3EA 2VISB 4G7YL 5CBEB 3KXFA 3FQRA 4NQXB 3QPQC 5TDNB 5DHVA 1JGEB 2VDLL 3M45A 4OUUB 2DDQL 1ZLUH 5D70H 1AO7B 2IPKA 2IADA 4NRYA 1MFDH 1VHPA 3HZKB 1FPTL 4ZYKA 1OVZA 4KPHL 1DLFL 1NL0L 1S9WB 3P0VH 3PHOB 4P5MA 3CVHL 4Z95L 3WNNA 3U9UA 4M8QA 5ERWB 5B21A 1HHHB 4DQOL 2NY5C 2OXHA 5I75C 1K6QH 4AM0A 4K94H 4JDVA 4G8IA 4S0TD 2QQNL 1RUPH 5GGUA 4YFDB 4NM4L 1MHHA 1AGEA 2I07B 4ZDHB 3THML 4QNPF 4KKBC 4HXBL 4MYWB 4HJGB 3UTPD 1S9VA 1KCUH 2APFA 2GJ6B 4GO6B 1JNLL 3P77A 2BSSA 5J9PB 4OB5L 5KG9B 3GMLA 3K46A 2EH7H 4JFDA 1ZT1A 4KMTL 2DWDB 3MA9H 5DA4A 3MOBH 4FTVD 1LE5A 3GSUA 1MEXH 1HNGA 3G5XA 2NY1D 2J5LC 5SWZD 4PYGA 2CLZA 3TPUB 5FGBC 1ZVYA 3SOBL 4K9EL 1JL8A 1FFOB 4JY4A 2DWEB 3HNSH 4DKEL 4HUUB 4N8CH 2HJKB 5FB8B 4P3DA 4CU6A 3S35H 4ODTL 4WUKH 1OT2A 5IUSA 1KTLA 3RIAF 3DV4A 3NCFB 2QR0B 3Q3GB 3K2UL 1JWMB 1NCAH 3K7UA 3R1GH 2V9TA 4PJ7A 1HWHB 3B4NA 5D1ZA 4EUPA 2JTDA 3UTTD 3R0MA 3GMMB 3HPJA 3JTTB 4DW2H 1TZGH 4JFFA 4LMQI 4BH7B 1NGXB 4PJDE 4M1CD 4C4KT 2Y07H 3TIDA 4J1UB 3C6SA 1FSKB 3QAZB 4GBXD 1ND0A 4WU7A 3MREA 4YO0A 2G60L 1W72H 3QIUC 3IAGC 1NFIA 1RHFA 5CGYC 1EHAA 4Z77A 5DQDH 5CKAA 3IFOB 3LEVL 3UCRA 4CADB 1RZJL 4ZTPH 4JN1L 1RFDH 2PTUA 3JVGC 2QSTA 4K07A 4I8DA 5D1XB 4L3ED 3WS6A 4P2OB 2APWA 3O45A 1AHWB 2VQ1B 4ODUA 3VFSB 1MPAH 1CGSH 2QADC 2O5XH 5SWZE 5HGGS 4YHYC 4XT1C 1S5HA 3BOVA 2VSCA 1NLDH 5JPNA 4OV6F 2VDPH 2JCCA 5F8QC 1VFOA 1N2RB 1NKRA 4KGJA 4JANB 4JREC 4ZUWB 4O2EB 4Z7NF 3W5NA 4A2LA 1KPVA 1YY9D 4HJ0D 1FFQA 3LQAL 1QA9A 4HXAH 2XI9A 3GSNL 4DAGL 2VDQH 4XPGH 5K93A 1CDIA 4WUKL 5HI5D 3SDYL 1EVUA 5T33L 4AEFA 3UTTE 4H25B 4XPHH 1UQSB 4U4BA 1URLA 4OIBA 2AJ3A 4MAYA 5D72L 4L4TA 1YEHL 2FHFA 4Y5VC 3K2MC 4DGYH 1A14L 3S5LA 2VXQH 4R2GD 1GZPB 1MRFH 2HLAB 5CD3A 1OAXL 4KRPD 1IAOB 3GMRB 1FYTA 3MJ8B 3OKOB 4OZHE 5LAXA 1KSRA 2Q8AH 1DFBH 1JYNA 3FFCB 4MNQA 1KJ2L 4LEXH 3NZ8A 4YHOL 1CN4A 3FO2A 4HT1L 5MEND 3CSYB 5JNYA 3P4NB 4LGRB 5IV2A 2AEPH 5DQDL 1YEKL 4XP1H 3HCVA 4L3EE 4OGAD 3VGFA 1OTUC 4MA1C 5HGDB 1RFDL 3V6OE 1U2HA 3B5TA 5TFSL 5C0DB 4M6OL 1FLTX 5I30L 3LQZA 2XRAH 3RUGB 3VXTB 4EDWL 1AJ7H 4Q74A 3TBWA 2IBZY 4JLRA 2CIKA 4IRSA 4GXUM 2HVKB 2O5XL 5DJDA 4HIJB 5EO9A 5CUSH 1UXWA 1RIUL 2EXYC 4LARH 3MUJA 2NTFA 4FXLA 1T5XA 3Q6GH 5F9WB 1CCZA 1HXYA 1CF8L 2IC2A 2YK1H 4ZO7A 4J3UA 3R06B 5JOFB 5EA0H 3G5YA 4H1LH 2Q3ZA 1E4WH 4L1HA 5I1KL 4N8PA 3BP6B 4UDUA 3LQMA 4E41B 2YPLE 4XXCA 3P4LA 1MWAL 1IGTB 1KCLA 2EKSA 3AGVA 3VXSA 5DEFA 3TO2A 4FMFA 4EN3B 3KWWB 4D0DB 4HHAB 4NQED 3I84A 5K9OA 2X9WA 4XB7A 5GS0L 3W9EB 1YJDC 2WANA 3PGFL 5CFHA 3MUHL 1X6NA 4KV5F 3QCUH 4YFLI 1PFCA 3TO4A 1X5GA 4ZSOE 3SGDI 3VRIB 5IB1B 2JJTA 5KS9B 3C5JA 1WISA 1BJMA 4IRJB 3JSSA 1ES0A 1QSZA 1DFBL 3KS0H 5MENE 3U2SA 1SBBA 2P24B 4RA0C 5IB4A 4JRXD 5HHPB 2V2XA 3HLAA 1ZGLP 4IEFB 5I19L 2K1MA 3U79A 1TITA 1F4YH 1LO5A 2ZKHL 4QY8A 1T7ZA 5BVPL 3I3DA 1B6DA 1D9KB 3H42H 2B2XL 3HKFA 5EBMB 3O4LB 1CVSC 5BJTB 2X4SA 4YE4H 2FYYA 1BM3L 1WZKA 4KI5C 2ZG1A 3QDHA 1AJ7L 3NFNB 1RJYB 3AAZB 3HRPA 1EAJA 4KH2A 1A6UH 3SCMB 2D7NA 3MXVH 1LO4L 1QFWI 3AC0A 4OGYL 3QDGA 4Q2ZB 4XGZA 5CUSL 5SWSB 2BSRB 1G7HB 4OF5A 4X7FC 3E6FB 4WW1A 4X5WA 5F9AC 2FEEL 4L29B 5ANMA 4QNPE 4L8CA 2YK1L 1TXKA 3N9GL 5DD5L 1ZS8A 5I9QB 3T3PF 2X4RA 3ZMRA 3TCLB 3WHE1 2ICCA 2IANB 3GRWA 3VGAB 4ELMA 3E0GA 1DQQA 4JCLA 1S7TB 5T3ZH 1BFOA 3MMEB 1KJ3L 4NQEE 3FZUC 4XWOD 4LDOB 2R4RH 2VR9A 5FO7A 3PG2A 4MJ2A 4WWKB 3MRDA 3BPNB 4MWFA 8FABA 1D3CA 1HH6B 5ITBH 4WU5B 1A2YA 1TMCB 4RGOH 1LWRA 4XMLL 2R39A 3WFCH 1R24B 4YEEA 1AD9A 3BEVA 4ZAKA 5I1AB 4GG8A 3W0WB 4LLVB 5F7WC 1FE8L 2ITDB 2CGRH 1XH3A 4JRXE 4KZEH 4NPYB 4MZ2A 1EZVY 5HI3D 3BW9A 1J18A 3BE1H 1T0MA 2VWEE 5E4EB 1H3VA 4GRWB 3OKNA 3VWKD 2BVQA 3BEWA 3J8F7 1GC1H 4BH8B 4LASL 3RNKB 3G6DH 1PX4A 1U41A 4PRIB 3ZSTA 1SYSB 3RDTC 1DBMH 1GC1C 2FLRT 3U83A 1OLZA 5C8JA 3TESA 3NPSB 2R23A 2DMCA 4Y4KC 2P5EA 1QRNA 3GSOA 3MYJA 4BKLB 2ZSVA 2WWKO 4LKCA 3P9MB 2Z8WC 2D7TH 4XMPH 3RX8A 4F2MA 2ITCB 3WO4C 2VLJD 2XQBH 4OZGE 3CUPA 1EO5A 3CD4A 3NH7H 3ULSA 3W82A 3GHEH 5JW4Q 3O9WD 4WHTA 4EXPX 5HYJE 1OW0A 2VL5B 3VD7A 1OAYL 4I9WD 4YXKH 4YWGH 5SX4H 5HVHC 2DQJL 2WV3A 4M48H 1U3HD 2AJSL 3AROA 2YMXL 4WUUD 4K3DL 1EXUB 3NIGF 1GJIA 5GGSA 3O3EB 2WM0A 4EXKA 2CRYA 4JQIH 2F53D 3FQRB 1MRDH 2BRQA 4K3EL 4Y2DA 5F96L 5DDHA 2C3WA 3HAEB 3OR6A 4U0RC 4J8RB 5ITBL 1M6OB 1NMCB 4Z7NE 4LP4A 5GZNC 4JO2H 5J1AB 1G9NH 4WFFE 2OXGA 2FEEI 4U2ZA 1G7JA 2Y7QB 3BT2L 3O3AB 5DD3L 1K5NA 2KQNA 1BOGA 4F7TA 1TCRA 3ARED 2PW1B 3V4VH 3BE1L 5IJVA 4Q9CA 1CICA 4XNZC 4BZ2H 1D5BB 1MIML 1MHHB 4LK4A 4R8WL 1E4XL 5J7CC 4MD5A 2GTZA 1AGEB 4X6CF 3RHWF 3MV11 3MUY1 4OI7A 3EYFA 3OAUL 4OSUL 2AJZB 3MLWL 5T1DH 2P7TA 3G6DL 4PB9L 5HVFB 4RX4A 2F58H 3P77B 6FABH 3LVEA 4OLUH 5KVGH 4UDTB 5FCUH 5FUCE 4N90D 1KUMA 1MI5D 1ZT1B 2X4OB 5FGCE 1NANH 3GSUB 5GS0D 4J12A 3RWFB 1SEBA 4ZFFA 3WFHA 3CU1A 3NIFF 1TLKA 1XF5B 3T77B 4JY4B 3MZGB 3PNWB 3B9AA 4DK3A 3RWCA 5I6XB 5J11C 4D3CH 3O8XD 3NH7L 1YMHB 2X44D 4P3DB 1UA6L 3K4ZA 4U6TA 4MDIA 1T20B 4WUUE 4NFBA 5DMIH 5E6IA 3EDFA 5C0GA 4M48L 4F9LC 2F53E 4B5EA 1HXMB 3LEXB 3PP4L 3EJZD 4EUPB 2DQCH 3WFDH 3C09B 3BIBX 4PTTB 3FQUA 1SJXA 1P7HL 1RZKC 2XWJA 3NCJH 4ZFGH 5E8DL 4GLRI 4PB0L 2B20A 2WIMA 3OKDA 4NQCE 3CFEA 2NY2C 5DJZB 4XBEH 1WBZB 4B0MM 1ND0B 3IXTA 4YO0B 2AEWA 3KYNA 4ZXBB 2YUXA 1XGRA 2VH5L 2X5PA 5FOBA 2Z35B 1FAIL 2MHAA 2LABA 4XCYA 5GSRB 1S9XA 2AGJL 1H3WM 1RK1A 2BVPA 4DUWA 3UTQA 3NFSH 5C09D 1UB6A 5JR1L 4NQUA 4XNUL 3BKML 5J06A 3DSFH 1TQCC 4DVRL 2X7LB 5GS2H 3UZVB 2QQKH 1JGDA 5ACZA 4KV5E 7FABL 1VPOL 1DQDH 4N90E 1MI5E 3WN5A 2F58L 4RFOH 1UG9A 4JB9L 3MR9A 1LDPL 3PWLB 4QRRA 4RMSA 4KTYA 3WEXA 3U1SH 1OGTB 4KK8D 1KLGB 1LDSA 1NUGA 2E7CA 5E9DA 2KH2B 3V5DA 1DVFD 1MHEB 1ZVSA 2WSKA 1JJUA 3LZFL 1DEEA 4FP8H 5KVDH 2CJUH 4S1RL 4ODSH 1F5WA 1EFXD 4QXGL 5IHUL 2AABL 3QI9C 5JMOC 1NH6A 4O5LH 4ODVL 2E9WA 1NMAH 4HUNB 1UJTA 5DMIL 4GXUN 3B9KB 1XCTB 3FL7A 1T7WA 4FQJH 4LSRL 1S5IH 4NKQB 4XPTL 4Q9RH 4U05A 4W4NA 4QO1A 3WFDL 1YNTA 1IKFH 4ZFGL 3OAYH 4M7KH 3S5LB 5AWNL 4Z7UF 3WS3B 3F7RA 4HPYH 5F7HA 3GK8L 4HH8A 5C0BA 4JGJA 5C08A 3C08H 3T3PE 3QIWA 3BHBB 2G9HB 2VXTH 3FOMA 4PJEF 3MLPA 5GJTH 4PJHA 1G7IA 5IFAL 1C1EH 2CKBH 1FAKT 4HIEB 5JNYB 2FGWH 5HHQB 1BLNA 4WTZG 2HT4C 4TSCL 1GGTA 3HCVB 4BSVB 3PIQB 2EZ0D 1XGQB 2VLKB 3SDXB 1R3JA 1IBGL 4Y4FC 1IGJA 1RUKH 2HMID 3BKYH 3MGTA 4PRNB 5FHBL 1N3NA 1FIGH 2CRIA 3KPLB 4RGMC 5DTFB 3U46B 2IPTH 1XGUB 1TZHA 4KQ4H 5DUBB 4P46C 4WI9A 3AU1A 5C0RL 2B1HH 3HZVA 4IRSB 4WDIA 3OR7B 5DK2B 4PRPB 1NLBH 1P1ZA 3C8KA 3U1SL 1DBBH 1UXWB 2AVGA 5EBWB 1U8IA 1I1CA 3QQ4A 1IEAB 3B5GA 3CSBA 5D9SA 1I1FA 4QOKA 3WCYA 2EIDA 3N1PC 3DV6B 3G5YB 3WV0A 4DGIL 5FECB 4C56E 5HHOA 4F58H 4MXVF 1XCQB 4QTHA 1FJ1A 1J8HA 5D2NA 5FA4B 3VMOA 5EG6C 4UTAH 3T08A 2EKSB 5DEFB 3NFPA 5FYKH 2E3VA 2W9LA 1T5WA 4HUMB 5SX5K 2NCMA 4CMHC 4X4XA 4JG1L 1IMHC 43CAA 2NXYB 4UQ2A 3D2UA 4W81A 4AH2B 5C9KA 3QFDB 5K9OB 3QQNA 2XFXB 4LLWA 1A02N 4TULH 3MOAL 4LSPL 1RZIA 1NJ9A 4EOWH 4NJAL 3QR2A 3VXOB 3CFBB 1QG3A 1L4IA 1A6TB 1ES0B 3C08L 2D31B 3QO0A 1XIWD 2VLLA 3OKMA 3G9AB 2X42A 2XTJC 4X6DF 3MRRB 3T2OA 2VZUA 2V2XB 4A6YB 4ETQA 2XZCL 4E0RB 3O3DB 5KZCB 3B3IA 3NIGE 1U3JA 5B3NA 1CYGA 1OGAB 4FQ1H 1JWUB 4JHZA 2O5YH 4QY8B 2UY6A 4ZO8A 5FYJH 1G7PA 4P48A 4NC2B 1OP5K 4KXZH 3WKML 4XTRC 5TGBB 3VFTA 2FYYB 5GIRB 3B8SA 4PRDB 4XHQA 3KLSA 3QIUA 4HUKB 5KSBE 3HB3C 4HIIB 4RIRB 1KG0A 4MCYA 4C55A 5HGBB 4JG0H 1W72A 3CDFA 3OTTA 1NCNA 3F65A 4J4PD 4ZQKB 3GIZL 1NLBL 3JVGA 1S7VB 4JKPH 4HUXA 1JGUH 4X5WB 1K3IA 4R26L 1I1RA 4H88H 4FQ2L 4P2QE 4XP9L 2YSSA 4E42B 5IFHL 3PF2A 2X4RB 1OL0A 2FWOA 3TEUA 2P46B 4KDTC 1DQQB 3DHMA 1G0XA 3ZDZF 2EO1A 3PGDA 2M26A 5J8OA 1F6LL 4UINL 4HLZH 5DRZA 4XVSL 3ZDXF 4NO2A 3KPOB 1C16A 1KCSH 1VEPA 5L6YH 4JFZH 3DX6A 3NIFE 1W0VA 4JHWH 3VFWB 4OFYA 4TSAL 4HFWB 2F5BH 5MEOB 1CIDA 4V2CB 1J5OL 2EYSA 1MUJB 1PKQE 5DYOB 2YA2A 4X4ME 4W6WB 1CD1A 4OCRH 5TJWK 1QLFA 1BBJB 3NMEA 5CEXA 2EE3A 4OFPA 4KK9D 4CN6A 1OLLA 1T1WB 2NY3B 1MLBB 2NY1C 1T0MB 4I18A 3OKNB 3TYFB 3UPRA 2YHGA 1FNEA 2ED7A 5DJXB 3BEWB 4P0DA 4Y5VA 5EPMA 3DVGB 4M62L 4HJJH 5FM5M 4I0CC 5DJ6B 4FQ1L 3ESVF 2RCSH 1FNLA 2DI9A 4KY1H 4XCNA 1CFBA 5C07A 2MQCA 4YFEA 1MY5A 5C8JB 1F4XL 2XQYK 1QRNB 1QBBA 2XN9D 4Y1AD 4LHQB 4XB8A 4LKCB 1N8ZA 3ARPA 4KRLB 1TJHH 3UEZA 1GCFA 2VE6A 4EIGB 1BVKA 4HG4K 5KVFL 1JPGA 4JO4L 1S7XB 5KANG 3SKMA 5I1LB 3HS0B 2X4TB 2F74A 2FZ3B 2Y36H 4M1CC 1KB9K 1U8LA 3K4DA 4JPWL 4HG4J 3ZKXC 4GBXC 3W39A 4GMTH 1UM5L 2X05A 4KKAD 1KB9J 4Q9QH 2GUOB 3FB5B 1NEUA 4YPGA 4DFIA 3HG1A 4I4WA 1IM3B 4NP4L 3GMNA 3KLDA 1LD9B 4ISVA 2EE9A 2J6EL 4F37K 5T1KA 4AG4H 4B50A 5I1EL 4RGNB 5GGSB 1WV7T 1WBXA 3ESUF 4ONGH 4F7PB 1JVKA 4MNHA 4P2RA 1F13A 4KJWD 4IM8A 5KW9H 4CN1A 4AEHL 2N4IA 4JHWL 3QUYD 3DROA 1UVQA 1IQWH 3V6OC 4ALAL 1LHZA 3HFMH 4OCYH 3AVEA 3X12A 2IBBA 3MFFB 4OI8A 4X98A 2W0LA 3KPMA 4H1LA 4RAUB 3QDJB 4EQ3A 3MXWL 1R3KB 1I85A 4F7TB 3BKJH 1TCRB 1CE6A 3U48A 2C1PB 4LNRA 5FEBA 1NC4A 3HUJF 1CICB 1L0XA 3LN9A 1I9JH 2VIRA 3KPRD 4MD5B 1DDHB 2GTZB 2EEAA 3EYFB 4K8RL 4HJJL 2XKUA 4CUCA 1TCMA 4PP1D 1YY9C 4HJ0C 1BQLH 1ZGLM 3KPSA 5AEAA 4HAFA 3CGTA 1H5BC 4Z7UE 3V52L 5HI5C 2XN9E 1I9IL 5IEHB 1YMMA 2ZCLL 2PCPA 4NKIL 2DQIH 3CLFH 4NKMB 2VZTA 5E8EB 1M7XA 4R4ND 4PJEE 3LKPA 4LHUA 3PQYB 5HDBF 4O51A 1TJHL 4K3GA 4NN7C 4EJ1C 4I0PD 3DX8B 3FRUB 2P49B 4K3HA 4R2GC 5E2UL 2YPVH 1MCFA 4JPKL 4PG9A 4KRPC 5CHNA 5C7XL 3PHQA 4MNGA 4CNIB 3QXUA 4D94A 2LTQC 2LVCA 5FIEA 4MZ3A 1RJCA 4MDIB 2H26A 4X9GA 2DQEL 5FYLL 5CJXA 3OHXA 4TUOB 5E6IB 2BZDA 2YEZB 4R4BA 4JZJB 1QLRA 1D5XA 3FO9A 4KKLD 1FFNB 1I7UA 4HKJB 4AG4L 3RY5A 5JW3H 2GTWA 3FONB 5CILH 4OGAC 1V3JA 1RIVH 1X5YA 2YN5A 4ONGL 5E8NA 4J7RA 4LCCA 4PJGB 5EC1B 3QUML 1CL7L 2X1WL 3E6HA 5L0QB 5KW9L 3MRHA 1BJ8A 4M7JH 4L8BA 3S8WA 5D7LB 2IMNA 4NJ9H 3KYNB 3BMVA 1OD9A 3FJTA 4MXVE 1OARH 1XGRB 3DETC 5FOBB 2MHAB 4HGWA 3T0AA 1CG9A 1P5VA 3QJHA 5ESVB 5B39B 4CVXA 3KPRE 5C0AE 2DM2A 1QKZL 2H9GA 4XXDA 2FJHB 3AB0B 5GS1B 3GSVA 1P4LA 1KTDA 3HN3A 4UV7L 3UTQB 1UB6B 3HMXH 2P8LB 4L8DA 4LIQH 2OCFD 1YEGH 2P48B 5D7IF 4HUWA 2VR5A 1BQLL 1VFBA 3RJDA 3PP3H 3SBWA 1RUQH 3ARBB 1E4JA 2ILLA 1UYWL 4QHKI 4M6NL 4QRRB 1EEZA 4X6CA 1Z3GH 4GG6E 5F3BB 5CCKL 1FL6A 1OQOA 3RA7L 1SQ2N 2V2TA 4X6DE 3P9LB 2ESVE 3DVFA 2EDRA 3MACH 1HQ4B 1ZVSB 2AK1L 3ZHKA 3IDJA 2CLRA 5CJOL 4JO3L 4AQOA 4J3OC 1V7NH 3PXJA 3KYOB 4O2FA 2Z93A 3H9HB 4NNPH 5IVXE 5DUPH 4RNRB 1XF3A 5IVOA 5CS7A 4MX7B 1JWSA 3QDMD 2Y5TA 4N1EA 4ERSH 3HC4H 5K9JH 1DN0A 2ZSWA 5J6GA 1UM4H 4QHNB 5L9DH 3IKCA 5D2LF 1NGYA 2VWEC 4GAGL 5ALBH 2NY4B 1YNTB 3N1MC 4XC3L 1QNZH 1I75A 4WIQA 4QYOA 3VG0H 3O3UN 3GI8L 4QXWA 1CT8A 5C0BB 1FZKB 2XTLA 5BZWB 4M7JL 3OXRA 5EZJA 2OTUA 1IC7L 4MD0A 3L1OH 2DQGH 5K9KA 5ILTL 1MFAH 3QA3A 3ZDZE 1KLUA 3J7HA 2ZUVA 1Y6MR 5FXCH 3MV01 1QBML 1PG7X 2ICWA 3EYQD 2WBJA 3QEHA 4PV9B 2QQQA 3ZDXE 4AY0A 1I3RA 3BJLA 2X4NA 2IBZX 2YR3A 1II4E 2ADJA 4U49A 4R7DA 3ILQD 3DXAA 3MRCA 4LIQL 1YN6B 4U1SA 1BAFH 5ACMA 4PJFF 1SY6L 3FN3A 4FZ8L 1BREA 2E27L 2WINB 1AP2A 4PP2A 5KJRH 2GCYB 4MQTB 1RZJC 3ZTJG 5I75B 2OSLA 4XWOC 1Q0XH 4E5XA 5JHLL 1BPVA 1LE9A 3D3VD 2XZZA 1EAPA 2C9AA 1DE4A 3LCYA 4OCWH 3CXHK 3BZEA 2DBJA 5IIEA 1I1FB 5ACLA 2BXYA 3VXQA 1F45A 3BD4A 3JV4A 3SQOH 4AIZB 5CLTA 2IAMD 3CXHJ 3MV7A 4NUGH 4KFZC 5HI3C 3WIHL 2DQUL 4EN3D 1FFPB 3QNXB 4ERSL 3I75B 5K9JL 3FT4A 3VWKC 4WTWA 5E7BA 3RZWA 3STZB 2J5LB 3FQNA 4K8RD 5ICYB 3VFNA 1KBGL 3HR6A 3LQAC 3CX5K 4S1SH 1HDMA 5L8JB 4HWEH 3GBNH 1AE6H 1QNZL 4H5SA 3CX5J 2Q86B 1VSCA 5LJYH 1Z0NA 3GJFH 4NO0D 4F7CB 1U8JB 1W8OA 4NZJA 1U93A 3UC0H 4G8EA 3VG0L 2CK0H 2AAVA 1I8LC 1T21A 3D69A 1A64A 2UZXB 1M05B 4D2NA 2AW2A 4K23H 4F9LA 2LQRA 3OKMB 5FUCC 4JVUA 1JF6A 1KCRL 2DQGL 2N7BA 4XP6L 3FCTB 4RWYH 3TC9A 4LPXA 4MHHG 3U82B 3B3IB 1QR4A 3GFUA 3EJJX 3QDAA 3U6RA 1AIFA 5A40E 3MCLH 2AK4D 1QFWH 3H3PL 4AEIL 4J2XA 3O9WC 12E8H 4W6YB 1SJVA 5FYLD 4FFZH 4GW4B 3L3IA 3DI2B 5E08H 5BS0B 3I6LD 4JQXA 3U0WH 3IJHA 2LVEA 5AAWA 1BAFL 3F5WA 4CGTA 1U3HC 4Z0BH 2W9EH 1GSMA 1GVIA 3SCMD 2PW2A 2HH0H 1NGQL 5D71H 4RBPK 2QQLL 1FNAA 3MNWA 1P4BH 1XT5A 2MCG1 1OSZB 5ESQB 4WV1C 1A4JA 1H0DA 5ID0B 4OZIA 1KB5H 4JFPB 4G3YH 4KKCD 1H15B 1WITA 3WE6B 4HUXB 1J1OH 1ZLWH 1KIPB 3PWNB 1QEWB 4N8VB 4EI5D 2VXUL 1X3DA 1ETZA 4QHUA 4V1DD 2QADB 4TNVK 4C57C 5MEQB 3SKJL 4YHYB 4HKBB 5HGAA 2E7LA 1Z6JT 2WUBH 1AR2A 1JI1A 1UJ3C 2IBGA 2DMBA 4QCIB 3WIFA 3MUGA 1CFSB 1EZVX 4DZBA 2I24N 1I8MA 5HDBE 3BGAA 1W0VB 3TCXA 4OD2A 2YUWA 3KGRA 4JREB 3N1FC 1LO3L 2APTA 2EYSB 3X17A 4AZ8A 4UIKL 5GGTH 3SO5A 3L7FA 4PJIF 5GS3A 4IRZH 4F3FA 4LCWA 4ZPTB 5ID1A 4M4PA 5JZ7D 2WAHA 5K59F 3RFZC 1L9NA 3AS3A 4I3SH 3WLWD 3X14A 3D39E 5GS0C 1T3FB 4NO5B 4DN4L 3OJDA 4FXGA 2J8HA 4YHZL 2AK4E 2C7UB 3CFDB 3QXTA 4RWYL 3UPRB 1FCCA 3GJEB 1IGCH 1FNEB 5KN5A 4GQPH 4Y5VB 2HA1A 5FYLE 5IT2L 3L6FA 4LGSB 5ALCH 3O8XC 3I6LE 3MRGB 2BY2A 3PABB 5L88H 2XWBA 2UZIH 5CEYA 3BZDA 3P11L 5B8CC 4XCNB 3K81A 1D6EA 1PG7H 3Q5YA 1N6QH 3G6AA 2LU4A 3T0ED 3BZFB 3NAAL 5BXFA 3EJZC 3ZTJH 5BOPA 3EYOA 2QTEA 1I9RL 1QSEE 4NZTL 1EGJH 4XVJL 1BQUA 1BVKB 4RA3A 3BDYL 3T1WA 5IESL 2F54B 3LV3A 3HRZA 4Y19D 2CKBA 3MLTA 1U3ZA 2Q7YB 1WAAE 3EYUH 4MA1B 1U8LB 5MP6L 1GAFL 2BJMH 1BQHB 3C2AH 1J1OL 1S7QA 2DD8L 1IGMH 15C8L 4V1DE 4ZOEA 5IFJA 1P9MA 5D7IE 5E00A 3G08A 4TNWK 5L7XL 4ORZC 2VYRE 4JRYA 4I4WB 1HEZB 1CK0L 3GMNB 4HIHB 1TTGA 4ELKB 2V5YA 1Q9WA 1NFDB 3HZMA 5CWSA 4HPOL 2EDYA 3U0PA 4NKDA 1J0ZA 4CVZB 5FA3B 1DN2A 1FNGA 4PBXA 1UVQB 4U6HB 1A5FL 1KPRB 2I25N 3VXUB 4NRZA 2BX5A 4ODBD 1HI6A 5I18H 1MJ8L 5ICZB 1R3LA 1KV3A 1U8MA 3F62A 3KPMB 3QUZD 1X5XA 5EN2B 2PNDA 1CE6B 3DUHA 4KK8C 1RMFH 4F8QA 1NUNB 2SEBB 3VE0B 4LNRB 1DVFC 1NC4B 2OX5A 5KSAD 2V5MA 5D2LE 2K7QA 2AJXH 1MCQA 1F58L 2HN7B 2AV1A 1NAKH 1T1XA 1P84K 4FZEL 2BVOB 2VOTA 1IM9A 3SDDD 5L88L 4YH6A 3P4OA 5DJYB 3QHFH 3T0EE 2Y06L 1P84J 2K7PA 1SHMA 1YMMB 2PCPB 2A38A 3HNTL 4G8GB 3ARDC 1QP1A 2RBLA 1CFTB 1PZUB 4Y19E 1ZHKB 2I9LA 3W81A 2DQHL 4PJBB 1UKQA 3KG5A 4LNVA 4JY6B 3TN0A 3EHBC 3TVMD 2DQFB 3HPLB 3VGDA 1XGPA 3PHQB 1CE1H 1EV2E 4Q6IB 3BGMB 2BJML 2R69H 3U9PL 3C2SA 3WD5H 1AR1D 3VRJB 1Q9OA 4PJFE 1QLRB 5EU7E 3FO9B 5GGVY 5TDPA 5JHDA 3CU7A 2Y6SD 3SJVA 4FQLH 1HSBA 4U31A 4LIQE 4JM4H 1HHGA 3R4DA 1YY8A 3QUXD 2EZ0C 4QRQB 2IG2H 4GAYB 4NWTL 4NYLB 5D7JD 2HMIC 4UUJA 3MRHB 3TM6A 3STLB 3O6KH 3MGAA 3ALWA 4WGWB 5EU6A 1BBDH 1U95B 4BYHA 3WXWH 3LB6D 4MJ6A 3T8XA 5J13C 1T6VN 1UCTA 3KPPB 4MDJA 3TP4A 2NMSA 4X7SL 4PJ5D 5ENWA 1CXFA 3VXRB 2UVEA 3JUZA 2FD6H 1I7ZB 1RMFL 2VABB 3QFJB 4XXDB 5IHZB 3VFOB 5KSVB 3TGXA 4N9GA 4OBRA 3UDWC 2YS4A 5DRXA 4PJ8A 4ZD3H 1REIA 1U8NA 4YEFA 2DYPA 3BVNB 5GGSY 4UMGA 3HUJA 4FFYL 3SY0B 4FTVA 3A6CL 2FX8L 2BNQB 1T4KB 1FL3A 2VZSA 3IYLW 2NX5B 4POZD 3BD5A 3LKNA 2JJUA 1FO0B 2XY1A 2X9YA 2VLRB 3WNKA 5C6WH 3QCTL 2UVFA 35C8H 4YXLH 4U2YA 3BKCL 3WFBL 1U9KA 3M8OH 4J3VA 2PYEA 1DR9A 4XWGH 3DRTA 3S37L 3IDYC 2EYTB 4RCAA 1NDGB 3RDTB 2OL3H 3DHJA 1IAIL 1NUFA 1MJUH 1CFQA 3WL9A 1BGXL 1QBLL 1NBYA 4Y4KB 4X99A 3NVQA 2Y5TB 1XIWC 3WD5L 5ETUA 4FQHA 5EZLA 1A6PA 1DN0B 2ZSWB 4U0QB 3WUWA 2V9QA 3TJEL 1CXHA 3IKCB 3ULVH 4EDXB 1WFNA 2EEBA 1D6VH 1MF2H 4HK0A 5DRNA 1YC8A 5HHVL 3INUH 4M61B 4P23D 3FQWB 2WLYA 3WKNA 5F44A 2A6JA 2DRUA 1L0QA 3MRLA 4NRXB 2R0LL 4GBXA 4QYOB 1YYLL 3GKWH 1CT8B 3ILPA 4PJ5E 1HKLH 1BBDL 2UV3A 4OM1L 3UP1A 1ZLUK 1SM3H 5HVHB 3OXRB 4AEEA 1KEGH 2OTUB 4QRPB 4G9FA 5K9KB 3QA3B 2GSGB 1HOCB 4G6AD 4FXKB 2BCKB 4FNLH 1VADA 3ULUH 4J4PC 1NC2D 2FD6L 4WO4B 1XMWA 1XGTA 5BVJA 3UYRL 4KJYB 5F1KC 1OM3L 4YHNB 4S1QH 4U0RB 4OM0L 4P99A 1UB5B 5BRZD 1LK2A 3WJJA 4ZTOL 1A3LL 4ODWB 4WENB 4PJIE 1JHTB 2MQ0A 1RZGA 4QGTA 4NCDA 3VXMA 3TT1H 2H1PH 5K59E 3VI3F 4I77H 3HI1A 5JOPE 3U36A 1T83C 3GI9L 4BELD 4TUKH 2AJYL 1EAPB 1G9MH 3SE4C 1Z5LA 3QEUB 4YXLL 3H9SA 5E8OB 1HN1A 1RZ8A 1LK3L 3BPOC 3P0YH 5IIEB 5EBLB 4R90L 4MHHI 4ZNEE 3EIFA 3VXQB 2M8XA 2OQJB 2OL3L 4J3TA 3MV7B 4KK9C 5F93C 5DC9B 5GQBA 4R4FH 3G6JB 3OKLA 4U1JB 5M95B 3P4MA 4PBWD 5IR1A 1GGBL 4X80L 2MCPL 4G80A 4LOUD 2ZUQC 4X83A 1T0NA 2X4PA 3O4OC 3PL6D 5A16A 1DQLH 3P2TA 1G6RL 4W4OC 2P1YA 2ADFL 5J11B 3TBTA 1WCQA 3I02B 1JZ5A 1EHLH 5E2TH 3ULVF 1PY9A 4RFNC 4N0UE 1TFHA 5E1AB 3L3KB 3TA3A 1I4FA 4NQDD 4P57A 3IDXL 1NEZG 5F6IC 3OKKB 1WZ1H 1A6ZB 4TVPH 1OGAD 3GKZA 5I1DA 1FFRA 1NAMB 3ULUL 1FBIH 2JIXD 4M1DH 4YHKH 4PGEB 5HJ3A 1AIFB 1GZQB 4HMDA 5BRZE 4NO3A 3D0VB 3WFEL 3EYVB 4IDLA 5CSZB 4ZO9A 3M1BA 2R2HB 3MQIA 1Y0LB 3O6LL 4NKOA 1T03L 2NY2B 3FO0H 4KKAC 3ULUF 4FABH 3JWDC 3IGAB 2BHZA 3QJFA 3SQBA 1RUAH 3X13B 4OJFL 3KR3L 3MRKA 1Z9MA 3IJYB 4RDQG 3DURB 1A47A 3MNWB 2X40A 3LD8C 4OD3H 4KJWC 2NNAA 4NBZB 1ED3A 4OZIB 3GSRA 3DUSB 3QUYC 1BWWA 3S36X 1DQML 4AMKL 1TQCB 3GO1L 1RZ7L 3HMXA 4P59H 3HE7D 4MJID 3BYYA 4QXTA 4XP5H 3V6BR 2E6PA 4HSQA 4OAWA 4DOHE 2ZCKH 2E7MA 1MCOL 5J12C 2CDEB 1CTNA 3WIFB 1EBPA 1I8MB 1OF2A 5DURB 2YD1A 4OD2B 4PP1C 2IFGA 1B0GB 2ZJSH 3RWHA 3CNKA 4IJ3B 3QI9B 4PG2C 4NQDE 3L7FB 1IC4H 1YEJH 5LBSH 5JXAL 2I9TB 1DBJL 2JKXA 4NQTA 5D5MB 5TF1H 4R4NC 3X14B 2A6KA 3MBXL 3QHTC 3QXAA 4TPRL 4NZRH 5IG7A 3EOYG 5C0IB 1FL5B 4I0PC 2R9HC 2NPLX 5KN5B 1ZWIA 1IFHH 4OZ4A 5ADOL 3LH2H 5EULV 3TT3H 5IK3A 4XMKH 3C5SA 2PETA 3GB7A 5EBGA 2ARJA 3FO0L 4GXVL 1ZOXA 3MJ9L 5BMFH 4R96A 5J1TC 1CI5A 2FH8A 4KKLC 2CRMA 3G6AB 4OCLC 1DZBA 1NPUA 1T2XA 4LCYA 2MMXA 3NTCH 4PJXB 2A1WL 1LO2H 4LGPB 3MLTB 5DJ8A 3TBSB 1FSKC 5EOCL 2F8VA 4MJIE 3DX7B 4MCZA 5EIVA 3K1DA 4Y4FB 1VCAA 4FFWD 4RGMB 4HX1A 3BFOA 5C0EA 4P46B 5H2BB 4D0BB 3SGEI 2PO6A 4O02L 4JRYB 3JWOL 3MNVA 4FG6C 5EZIH 1BVZA 1UEYA 2HJFA 1UACH 4P2OC 1AHWC 2A77L 1E6JH 4Y4HB 1DQJB 5JQ6H 4NRZB 5B38B 3IDMB 1MHCB 5LBSL 1IQDA 2XIDA 1JTOA 3VWKA 2V5RA 4Y5YC 5DD6A 2EDNA 4EVNA 5L2KA 2I5YL 3CFJB 4NZRL 5DJ2B 4CMHB 1KIRA 3IS1X 1JF1A 2XV6B 2C4FT 4F57H 1T1XB 1G7MA 4XHJD 3KS0J 5DLMH 1G1CA 5EC2B 3KLAA 3TT3L 4RZCA 2Z31B 4N9OB 1EUTA 1HINH 2GQHA 2ZCHL 3FB6B 4PY7A 1F90H 1AXTL 1K8DA 2OJEB 4JY5H 4ZUVA 2G75A 1DJSA 4H0HB 3GJFA 2OZ4H 2PXYA 1WZLA 1H3TA 1KN4H 1FRGH 4RMQA 3CVIH 2XTJB 1JPSL 4C54A 2Z91A 2VLJA 1P7QB 3ZHDA 1INDH 1ORSB 2Z8RA 1U8HA 5T3XL 3E2HC 4QXUL 2EDQA 5EOQH 3RTQA 3O9WA 3L3DA 5FKPB 3WXVL 5T5FL 1ZA3B 3VW3L 4BM7A 4H8WH 2UYLA 3AY4C 3GM0A 3KYMB 1U3HA 1TDQA 1YQ2A 4TQEH 1A3RL 1NCBL 4H8WC 3VI4F 3L5XH 3MRJA 5HHMD 3RWDB 4FQXD 1X6LA 2OTPA 3O6MH 4KK6D 3IT8D 3S36H 1C08A 43C9B 3ZZ1A 4MQXD 1M4KA 1CFVH 3GSXB 4LEOA 3ILQC 2BOBB 2XPGA 1KB5A 4I5BA 1LP9A 1EEYA 2XKSA 4PJDB 4TOYL 3JUYA 5DJ0A 1KFAL 1UCBH 2X41A 4LLMA 4ZS6D 3TIEB 4LU5H 4MJ6B 3T8XB 2W65A 1TVBA 5FO8A 1HIML 5HYQA 4X6EB 1WCBA 1XR9A 1A7OH 5I8KH 3MV8A 4ZPVA 3D5OF 2IQ9H 4BZ1L 4JR9L 1UJ3A 4N0FB 1CDBA 1K8IA 3LRHA 2XQYG 2A74A 3T3MF 1AFVH 2P5WE 5DHYB 1C12A 2PKDA 4N9GB 3NZHH 5C0FA 3QRGL 2FB4L 4YHMH 2EDHA 2VAAA 4XI5D 2FSEB 4DFHA 2IAMC 3OSKA 3C60D 1IEBA 3ARGD 5DXWA 3ARBD 5FAAA 1E28B 5GGTA 1WBYB 1YEIH 1N5AB 4EN3C 5LXGH 4FTVB 4N1CA 5B4MD 2NY1B 3K8MA 2YPKB 3KVQA 3LKNB 4K8RC 4X7TB 5ICXB 5SWZB 3UTSD 2CKNA 3CVIL 5C0CD 3VXNA 3LKOB 3EOAA 1O7VA 5C2UB 1KGCD 4BQ8A 3WIIL 1BZQK 4NQVB 5EOQL 2VZOA 1EEQA 4ZS7H 5HPMA 4S10A 4JFYB 4WW2C 5HHME 1CFQB 3O11A 5BV7L 3GBMH 5ETUB 5D8JH 5E8PA 3UTTB 1EK3A 2WUCL 4OD1H 3O6ML 5IROC 3U4AA 4Z8FH 5DRNB 3QPXH 4P5TB 4FMKA 1S7UA 1CFVL 1SBSH 1H8NA 2P8PA 1EGJA 3LKQA 5ESAA 3D6GA 1I1AD 3F8UB 1IAIM 4F9PA 2DLIA 1MCWM 3ZKXB 3CK0L 2ICWJ 5TQ2L 4GBXB 4C59B 2FIKA 1VFUA 4BFIA 1J0JA 3HNVH 5DK3A 1FDLH 5I1CL 4OZHB 3IU4H 2BVTA 2HWZL 3SCMC 3CXDL 3PWVB 1AGDA 4YHPA 2V17H 2GI7A 3MLZH 1MAJA 1R5VA 4XNMB 1ZV5A 5HYEA 4X8JB 1BQSA 1OHQA 1KELL 3QEGH 4JM2F 1XGTB 5C09A 5L2JA 4JZNA 4KKCC 4WEBL 3C6LB 3TZVD 3W9DA 3CDYA 4L3EB 2R0KH 4EUPG 1XF2B 5AUMB 1P7KB 4EI5C 2YC1A 3V6ZA 4TVSa 2GJZB 1V5JA 5JXEA 4L8SC 1RZGB 4FQCH 4LLUB 4OUOA 3UTSE 3KDMB 4ZFOA 2X89D 5LXGL 1FC1A 5C0CE 5JA8B 4BSWA 1OD7A 1P6FA 3U36B 8CGTA 5ELIA 3AMKA 3MV9D 1CXKA 2YKLL 5BOZG 5F3HA 1Z5LB 2FX7H 1Y6KR 3HC3H 4Z7VA 5K9QG 4GRWH 4LHJB 1KJVB 2DQTH 3SE8H 3B9DA 1N64H 1H5BB 4QRUB 5JZ7C 5KS9F 3LRGA 5JLZA 2JJSC 4JFED 1F11B 3U7AA 3WLWC 1YN7B 2VDNL 4BUHA 1FN4A 3ARDA 4HKXA 1G7QB 4OGXH 4U1NA 3P4MB 2YPLB 4XPBL 4RISH 5C1MB 1A7NL 4DEPC 3O0RL 4XP4H 4YIQB 4G80B 4MA8L 1F6AA 2BNRA 4UB0L 3L3GA 4PGDB 4NN7B 2QV2A 3C8DA 5EIQA 3RY6C 4PPTA 4KRPB 2NW2B 3VWJA 1CXIA 2X09A 1C5BH 2LTQB 3TBTB 1MJJB 5LGJA 1AGCA 3H0TA 4KUCF 5E2VH 4RFEA 4PJAA 1CDCA 4HS6B 4P4KA 3T0EC 2ZUUA 3IU4L 2XZAL 4Y0GA 5MENB 5T3XD 3RWGA 3OGCA 1A7RL 4X7CC 5I15H 5IGXH 3MODL 4N0YL 4YBQD 5IM7A 3V4PL 3WSQL 2A9NH 3QEQD 3P40A 2H32B 4U1LB 4GT7A 2QSVA 5I76A 3RWJB 3PE9A 3QWRD 3SKUD 5F88B 2UY7A 2R0KL 3T2NH 4NKOB 1T1ZB 1W2KT 4JJ5B 3WO3B 5J56B 3MO1B 5E03A 3ETBF 2HFFA 3S5LG 3BZ4A 3HAEH 5KSBA 2YBRA 5F89A 3MV9E 4OCSH 1MFBL 5EU7C 4L9DA 3CFCL 3RZCD 1YPZE 4I2XA 2F19L 3PDOA 2XACC 2R8SL 3CVHB 1M7IB 3MC0A 4YDKH 1VFAA 4CMMB 2DM7A 4UIMB 4JFEE 3R8QA 1RU9H 1DEDA 4HH9A 5C6PB 5LGHL 3D0LB 3RPIB 2BDNH 3RL2B 3QUZC 5JW4N 1J1XL 5JQHC 1DANU 3H7BA 4OAWB 1N6VA 2Z9TA 2VJXA 2UWEA 1JNHB 3AS2A 1MVUB 1ITCA 1O7SA 5E94B 5KSAC 1R5WA 4GRWF 4NQEB 2VDKH 4OLXH 4RISL 1HQRA 1IGIH 4PY8J 2ZNWA 4GMSL 1BD2E 4XP4L 3ZTNL 2Z4QA 1T1YB 4NUJB 4WWID 1GGYA 3LOWA 4CVUA 3SDDC 3T2PA 1QSFD 3AM8C 3TBYA 1CZ8L 1KIQA 2FO4B 4JEGB 2APVA 3OAYK 3PGCA 5T3XE 2Q6WB 1BX2A 4JRXB 5T1LA 2A6KB 4YC2B 3FFDA 2VZ1A 3QXAB 2W0FA 1N4XH 3QEQE 5IG7B 5I15L 1JTPA 2BNUB 3TVMC 2D03H 2VNCA 5I6XC 5JPMB 4D9RD 2IH3B 3M17B 1CGTA 3BO8A 4OZ4B 4UV4H 2ATPA 5C3LD 4GAJL 5DVKA 5EUOA 3FN0H 1GPOH 1CLYL 2FJFB 3C5SB 3O6FD 4LPVA 3GB7B 1AR1C 2ARJB 3GUTB 3OZ9L 4APQA 4OLVH 2HKFL 4NNXA 3PWPE 2Y6SC 3WFZA 3SE9H 3W11D 3DI3B 4J4PA 4OLWH 5D1QD 2XA8H 3BJ91 4MVBD 3QUXC 2B1AH 1MLCA 2XKNB 5C2BL 4XVTH 5D7JC 5DJ8B 4OZGB 1FG2B 1OPGH 2DBLL 4NSKA 3VU2A 3C5ZD 4JM2D 3LPGA 4PRHD 3LB6C 5BZDA 1MELA 1RJLA 4HX1B 1S7WA 3LRSA 4YXHH 3CH1A 4RQQA 5TE4H 1FNSH 2BDNL 1YA5A 4F37F 2WK2A 1T83A 3MNVB 5F6HI 3X3FL 3S88H 3QG6B 4C58B 1MCLA 4JHAL 4U1HA 3QIBA 2HJFB 2YRZA 4K7FA 4MSWB 1QSFE 4GRMA 2EDFA 2MPAL 1RULL 4YDVA 4TRPH 2EDEA 3S9DB 3BRGC 4FRWA 4OCMC 1X5ZA 3CZFA 1B0RB 1QLEH 3U30C 3DX9A 4QHLA 3QO1A 2FL5A 1KTKE 1OAKH 4EQ2A 1OAUL 4LLDA 5HY9A 3GIVA 2EH8H 1U91A 4U6VH 1EA9C 3WHXA 2X70B 1FIEA 1KC5L 4NCC1 3V8OA 2AEQH 1NBZB 3VFGH 3D25B 3VGHA 1E4KC 3LIZL 3GSNB 1NUDA 2QBWA 3U7WH 4W4OA 1JE6A 5DZNA 4M7LH 5TQ0L 3FT3B 1A4KA 1U58A 2IFFH 1LEGB 1MIEH 1XF1A 3OKEA 2CR6A 1X5IA 4NHUB 3B9KC 2CSPA 4AT6B 2HVJA 4DGVL 1K8DB 4KROD 4YHLH 3V7MA 4Y1AA 3F7VA 3IDGB 5I2IB 2H45A 2X9XA 5I8EA 5DR5H 4KUCD 3MLXH 4ODHH 4PJ7F 5FGCB 3BH9A 2Z91B 3BI9X 4P23C 4OLWL 2XA8L 1S9YA 1H3PL 3O2WL 1CGVA 4OI9A 1YEDA 4LLQA 3W2DH 4PRHE 4MA7L 2X4UB 3MRMA 1KJ2B 2R4SH 3MLUH 1XR8B 3L95A 5CINL 3I6KB 2C26A 4K71C 1U3HB 2VISA 4WUUB 5CBEA 1QQDB 2NYYD 2OP4L 4G6AC 1TETH 5TDNA 3OAZK 4U1KB 1JGEA 2F53B 4H20H 4OUUA 3RI5K 5F7DB 1G9EA 1AO7A 4WV1B 1CXLA 5JOEA 4LCIL 3QUYA 1BEYH 3HZKA 1S9WA 3PHOA 1CTOA 3QISA 4NM8H 1CQKA 1A7QH 3BAEL 1Q1JL 5ERWA 2YZ1A 3VXRD 3NCEB 1MHPH 5BW7C 1WCBB 1XR9B 3MBED 3AREB 4ZPVB 4U6XA 4ZDHA 3KLHD 2NTSP 1UJ3B 1RVFH 2A74B 3I3EA 3KPRA 2A0LC 4NHCH 4O9HL 2GJ6A 2F9BT 2H6PB 3OQ3B 5J9PA 1CD9B 3T0BA 2IGFH 1N5YH 5FOJA 1IEBB 3QT2A 2HTKC 3NN8B 2BNQD 1LEKB 1MI5B 1R5IA 4BUGA 4U1MB 3TPUA 1DLHA 4OF8A 3TF7C 3OMZA 2NXYC 1FFOA 4LOUC 2DWEA 1PSKH 2C4XA 4LBEB 4HUUA 3PL6C 5H8DA 3DGCR 5F21B 3VD4A 2HJKA 3BQUD 5FB8A 5GXBB 1K4DB 5C3TA 4KKNA 2QSCL 2VC2L 4WY7H 3O8XB 1ZTXL 2QR0A 3Q3GA 1JWMA 4A6YH 5B8CB 2R4SL 4S0SD 5BO1L 3MLUL 1P5UA 3O11B 3TYGL 4OZFB 4JKMA 5IW3A 3GMMA 2FEDD 5GRUH 4G7VL 3MRPB 3T09A 3SDAD 2FECI 4BH7A 1NGXA 5EH1A 3LMJL 2VDML 5LCVL 5E99L 4J1UA 4EI6B 1H3XA 2GKIA 1B2WL 4IS6B 5GRJH 1BEYL 5ISZD 2Q1EA 1GGCH 3KXFD 5EWIH 2VLMD 4PLKD 4PGCB 2FIKB 3VD5A 2CK2A 3FQXB 4P3CH 5D6CB 5K9QI 4CADA 4WO4D 2CO7B 4IDJL 4DN3H 1PYWB 2V5TA 5FKAA 4LQ1A 1EX0A 5D1XA 1RURH 1M71B 5C09B 5L2JB 4JZNB 4P2OA 3FQTB 3FMGH 5DK0B 4IMLB 4FQQB 3VFSA 1AHWA 2VQ1A 1PG7W 3HE7C 1FVEB