3X3GH

Fab fragment from anti trail-r2 human agonist antibody kmtr2
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
224
Chain Sequence
b'QVQLVQSGAEMKKPGASVKVSCKTSGYTFTNYKINWVRQAPGQGLEWMGWMNPDTDSTGYPQKFQGRVTMTRNTSISTAYMELSSLRSEDTAVYYCARSYGSGSYYRDYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPCSRSTSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of KMTR2
publication title TRAIL-R2 Superoligomerization Induced by Human Monoclonal Agonistic Antibody KMTR2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 224
sequence length 226
ec nomenclature
pdb deposition date 2015-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3x3gH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3x3gH01
3KPMB 5IEKA 3SKJH 3D0LA 5FOBA 1F4YH 5D7IB 1CLOH 4LPTA 1T04A 1CGYA 4QTIL 1R3JA 5I1CL 2NX5E 5SX5H 2EKJA 5FHAL 1RVFH 4DKFL 1J1OH 2FHFA 4DK6A 5IM7A 1JPFB 4D94A 1DQMH 2NLJB 1G7PA 5C3TA 3TJEH 1BFOB 4HPYH 1JZ6A 3ARDB 4XPTH 4ONHB 1PFCA 3VD4A 3O6FA 2R2HA 2J88H 1DFBL 5I1JL 3MBXH 4YUEL 4W6YB 1QOKA 1FZKB 5BMFH 3BDBA 1AC0A 1UJ3B 1F3JA 2Y07L 1VGEL 1XCTA 5J57B 1KIRB 1A7QH 1U3HA 5K9OB 3ZTNH 1ZGLB 2X4NB 3VFVA 4MA7H 3FB7B 5DA4A 2WZPD 3MODL 4D9LH 1MJUH 4H5SB 4LQFH 1PSKH 2GITA 3MOBL 2JCCE 5I76A 2DL2A 5EU6B 3VCLB 3NN8B 1F4HA 3GI8H 4Y19B 3BE1L 4A6YL 1CFNA 1FNGA 1RZJC 4XNXH 1MIML 1JHLH 5HHME 4GUPA 4HIHA 4AIXA 4R96B 4Z78B 3O6KL 1CF8L 2F19L 1U8HB 3RWHB 3FB6B 2CUMA 5GS0D 4GO6B 2AQ2A 1CXFA 5CP7A 1C7TA 3EFFA 1AP2A 2Q87A 1RHHB 3T4AB 1PG7X 2DM7A 2BX5A 2DQUL 4WUKH 3QAZB 3PGFL 4PG9A 2XG4A 4LPUA 2XQYK 1FN4A 2C3HA 3VW3L 3DRQA 4W6XB 4M00A 1N0LA 5IMMA 1HEZB 4JY5L 4WENB 3AS1A 4CVXA 2NX5D 1F90L 2A9ML 3EYVB 3ME0A 3JV6A 4PJ8C 3PIQA 2QBWA 2ZOLA 4TUKL 3RBSA 3IDGB 4Z0XA 1A3QA 4F9LA 5EUKA 5IB3A 5D1QC 3B8YA 1N4XH 2JTDA 1YYMH 3BZFA 2OK0L 4X6BB 1X5JA 1FO0A 4WGVB 1G0DA 4RIRB 1G6RL 3RTQC 2LAGB 5DK0B 1QR1A 2VXTH 4JJ5B 5CEYA 3WNLA 1W0WA 5DQJB 4RRPA 3VXUA 2YD5A 5F7KC 3VMNA 3THMH 1BX2A 1VEOA 1BQUA 1LO5A 4Z7UA 4PP2A 2XZCH 5TH2B 3TPKA 2EKSA 1KB5A 2WNGA 1I3VA 2NY3B 5L2KA 1MCKA 3OKNB 1LGVA 4PJ8A 4TRPL 1ZANL 4H0IA 3CVHL 5HHMD 5FYLL 4LCCB 3JZ7A 5IF0B 5JHLH 2I9TA 3GMNB 1CFSA 3P73B 4I4WB 4LKCB 2F58L 2D7MA 3GDBA 4H1LA 4LSDA 2YWZA 1DE4A 3BXNB 1CGSL 4NQEA 4Q58C 5K93A 5F9DC 4E41A 1KTDA 1R5VB 3HNVL 4IHOA 5FA3A 2DQFB 1VKXA 2C9AA 1G7JA 4ONOA 2WSKA 3VXMA 4GG6E 2CLZA 5IHUH 4PV8A 4JRXA 5F6HI 1IE5A 3D87B 4Z95L 7FABL 5FXCH 1UCBH 3WJLA 2V7NA 5JA9A 3FONB 3VXSB 1CICB 4LASH 3RNQB 1G7LB 2DLHA 1IM3A 1A02N 4I3GA 5CD3B 5HI5D 4C4KT 3SDCC 2BXYA 2D31B 3DTXB 1RQ5A 4MVBD 4XCEA 3W39B 3F7YA 5JZ7C 3H9SA 5HPMA 3U0TB 3LKQA 3CFBA 5IW6B 4L4VB 4QGYA 3SDAC 3WLBA 3KDMA 2VH5H 4L29B 5ERWB 2HT4D 4N90D 4QHLB 2DWEB 1YEEH 2VDML 5DHVA 3VFMB 1HOCB 1U6AL 2XY1A 3R06B 5ITBH 2EO1A 3TIDA 5GS2H 4N8PA 3MUZ1 1FQ9C 3V4VH 4L3CA 4P9HC 5KSBA 3QEQB 5HJ3B 5C7XL 2MPAL 5FECB 5C2UB 4UB0L 4DVRH 1BVKB 2A6JB 1NGWB 2C7UA 4KJYB 1OT1A 1JUFB 4PFEA 3O8XB 4KRPD 3UTTB 3SDCA 3FN9A 4OZ4A 2FD6H 4YXKL 5IVOA 4LPYA 4XBEL 5MEPB 1HKLH 3DGGB 3MNVB 1P9MA 1CE1H 3TYGH 3SDAA 2PTTA 3QUYB 1FDLH 2OLDA 4X9BA 4Z7VF 3VXQB 2NY7H 3HNSH 4PRBB 4BFEA 1NCCH 1WCQA 3QXAA 5IR1B 5B21A 3B4NA 1WT5A 3PGDA 2CD0A 2YWYA 3AFLA 2BCKA 2GK0A 4NJ9L 2QSCL 3HMXA 4X5WB 5EU3A 4I5BB 2ICEB 1WZLA 3IJYB 1HCVA 3ARBD 4HXAL 3EYQD 3LEYL 2B1HL 2H2SC 5CKGA 2LVEA 4I13B 4RISH 4HC1A 2NZ9D 2VR4A 3VFNA 4P3DB 1ZGLM 3OR6B 3B9DA 1WGOA 5I1HH 2J4WL 5J13B 1U36A 5DGQA 3LV3B 1S9WB 4HUWB 3CDFA 5IB4B 5BZWB 3LS4H 2RFXB 3D3VE 1HINL 4PJ5B 4MNHA 3ULSB 3H7BA 4MJIA 4OF3A 2X4PA 4HUXB 3RGVD 4M48L 5EC2B 4P4KB 2HJKA 2AAVA 4Z7VB 1X7QA 2GTZA 3N1GC 3BH8B 5GZOC 3QBTB 1R3KA 3BGMB 3LAFA 4UQ2A 3QB7C 3DX9B 2XXCB 2G5RA 4L5FL 4M5YH 4JQXA 1ZHLB 5CSZB 4PJDA 4JRYE 1QSFA 4GQ9L 1BZ9B 2FHBA 4U6VH 2C3XA 1QRKA 4NM8H 3ROLA 1J1PH 3W2DL 2J8UE 3AS2A 3B9KC 4GRLB 4PLKC 1T21A 3GIVA 1HYSC 2HYMA 2YA1A 5KSVB 2NW2B 3TN0C 3I6GB 5JW3H 5GGVL 4WVRA 2PNDA 2VDQL 4APQD 4XPFL 3OKKA 4OZHE 4X7TA 1NDMA 1JBJA 2ENYA 4WTZA 1V3JA 4QRRD 2C4XA 4R7DA 4LQ1A 4I3SH 4ZO6A 3CK0H 4OF8A 5KVFL 1MCLA 4Y2DB 1I1YB 4MDIA 3OXRA 3ZZ1A 1ETZA 1DVFB 5EOCL 1T5WA 1RMFH 4G3YL 5I71C 1X4ZA 5E9DA 2JB6B 3PWNB 5FB8B 1G1YA 4DCQB 1CDHA 4NQCA 3VFPA 1UM5L 4LVNC 1JV5B 2APWA 1Y6KR 4XAKE 3MRLB 4N9OB 3ZKXC 5CBAA 2CDEA 4XCYB 1T22A 2EEDA 5DZNA 2Y06L 1JGLH 1NFDF 4ZG1A 3QFJE 2QQLH 1NGPH 1H0DA 2H9GB 1D3CA 4JZJC 1BOGB 2N4IA 1QFUH 4OV6F 3HE7D 5AUMB 3PDOA 2AGJH 2MMXA 1K5NA 4QXGH 2AJUL 1CG9A 4YDJB 5ICYA 1QBML 3KGRA 3G9VA 3SBWA 1FGVH 4X7SL 2GK2A 2P24A 4K94L 3AM8A 4JRYD 2FECL 4X4XA 1IL1B 4NQSB 3DBXB 1NAKL 3T0EB 2A9NL 3TO4D 3UPAA 4G9FD 3KYMB 5IB5B 1KC5L 5I1KH 4LNRB 4PD4K 5IVXB 1G9MC 5E1AA 4L9LA 1FG2A 3GGWA 2FH6A 5ICXB 4EI5B 1BJMA 1MWAB 2X89A 3FQXB 5D1XC 3HI5L 1P2CB 3V6FA 3D18A 2OQJA 4AEHL 1AGBB 2Y5EA 3ARVA 1CR9L 5JOFB 3HR5B 1NFDB 1EJ6A 2ZG1A 3OKDA 4MQXC 1WZMA 3HG1D 5CZXD 3KPSB 1IGJB 1MHPH 4F15B 1JZ2A 1Z9OA 2FWOA 3UTZA 1II4E 1MRFH 4X5XA 2IADB 4LLYA 4R0LB 3TVMB 3VXPB 1D5MB 1OAYH 1RJLA 5E8EA 3NCMA 5I2IB 4K55A 4R26H 1PW3A 2FJHA 2OJEA 1YQ2A 4JM2C 4GW5A 2Q8AH 4HJGB 4R90H 4XAKD 2IAND 5L7XH 1NLDH 2JK5B 1FFQA 3KPPA 1GGYA 5FF6B 2VLLB 4ODXB 4G6JH 3P9WB 3QFJD 1S7RB 3RPIA 3BT2L 3DXAB 5D1XA 3CC5A 2XWBA 4M6MH 5L2JA 3KJ4B 1NLBH 1CYGA 1TNNA 4K7PX 1SJHB 4F7TB 4CL7A 3HFMH 4BSWA 1BBDH 1HKFA 1G7IB 1IGTA 2H26B 1U8IB 1XGUB 2CKNA 1ORQA 4WUUB 3S5LG 3U9PH 1XGTB 1DBJH 4GRWF 2DQEH 3DMMB 4CDGC 1FNEA 5GS1C 4NQDB 3ULUH 4MDJB 2YUWA 4L3EE 1TZGL 3TBSA 2Z9TA 3HPJB 4ZS6D 4X99A 5FUZL 3MC0A 4PG2C 1DUZA 4JM2A 5E99L 1KEML 1EHNA 3L5XL 7CGTA 4KWUA 1DQQA 2BVPB 2V5YA 3VE0A 2R29H 2XQYG 3X13A 4BH8B 4CNIA 3GUTA 2EIDA 3E8UL 3RVWD 3V52L 2FJGA 1AXSB 1FLTX 1NC4D 1ZT7A 3MLZL 2F5BL 3MRGB 2YPKA 2AJYL 5EZJB 1KOAA 3GBMH 4LFHG 2X05A 5DQDH 5GS0C 4PGBB 5FYLE 4IIQA 1NEZG 4XVJH 5GS1A 4RAVB 3P9MB 3QPQC 1IZJA 4TSBH 4FFZH 4OD2B 3DUUB 2J3SA 2JB5H 1SMAA 2A6DB 2HFEB 3Q5TA 3ET9F 3D2UB 4YE4L 2EEAA 3QG7L 4P4RA 4BZ1H 5F9WC 2GAZA 5D7SH 5BQ7B 4F57L 3RWGB 5L6YH 1KJMB 2R2BA 1INQB 2HLAB 4MD5A 4LSPH 3GMRB 1WIPA 5C92A 3IVKB 1M7DA 2BSRA 2UUDK 3HE6D 1KJVA 3MRPB 5EFIA 3P11L 4K71B 1R3HB 5DMYA 3LRGA 2X9WA 2H8PA 2YC1A 3A6BL 3U2SB 2W1NA 3MRFB 3T1WA 1U8OA 3KYNA 2YPVH 5ETUB 4EDXA 3WUWA 1T0MB 4JGJA 4WHYG 3MJ9H 5IHLB 1H5BB 3QCUL 3IDNA 2CRIA 3C5JA 3O9WD 3SKOA 3BVNA 3PXJA 5F88A 3UYRL 3WD5L 5HYQA 5KS9B 2VNCA 1DN0B 5HYJB 4L3ED 4OLXL 5D9SB 3NIFF 2PYEB 5D96C 2F74A 3L3KA 2BVQB 5GRYA 2DKMA 3QXDB 4XWGH 2DM4A 2F5AH 2EEBA 4QRSA 2R1XB 2FJFA 4BQBA 2QEJA 1JF1A 1MI5B 5A3ID 2G2RB 3E3QC 3FQWB 4OCXH 2HLFD 2NX5A 5B8CB 1FCGA 4QY8A 1JGEA 4LCYB 3MJGX 3VXNA 1KTKE 4H8WC 5C71A 3QEGL 4X9HA 1RZIA 4YHML 1A4JB 1S78D 3N06B 2YMXL 4D2NA 1OP3H 2CJUL 5CP3A 1GZQB 5IW1A 5FYLD 2C1PB 1RJZB 4PRHE 2VZ3A 1ZLSL 4QRQA 3L3HA 1UT9A 2R56L 1RUAL 4IMLB 3K1KC 4PJEE 4YAQB 3VFRA 4YH6A 4LCUA 3BH9A 2L7UA 3FT2A 1A6WH 5IEHB 3IF1B 1T0NB 4UIKH 1JWMB 5INCA 4OLUH 4OLVL 1LE9A 2XWJA 2Z92B 4MHHI 4PPTA 3EYUL 4M1DH 1U8PA 5EOQL 1CZ8L 1RZ7H 4IS6A 4JY6B 2W65A 2IALA 3N85H 3MLTA 1YJDH 5HI5C 2JCCA 1I7RB 4MVBC 4YBQC 3NH7L 3I75B 3BPNC 1JRHI 2JELH 3BD3A 3MUGB 5LG1A 2HG5B 5D2LA 1OTTC 1MQKL 2BXZA 2AV1B 4P0DA 2GT9B 3O6MH 5MI0C 4BSVA 4OFDA 3L1OH 4KTDH 4NZJA 4PTUB 3S5LB 4MYWB 2Q1EA 1I7TA 2HT4C 4XH2B 4XP1L 2NXZC 4V2CB 1Q72H 4OIIH 4TVPD 2OS7A 1AY1H 1HSAB 3VGDA 1YYLH 1I3GH 5F44A 1KPVA 1ODAA 2BFVH 3WIFA 2CUIA 2GCYA 1E6JL 4TUJB 2AEPH 1F4YL 4LGRB 4NQTA 1CLOL 3MJ7A 4K7PY 4N0CD 2R15A 5J56B 5GGUA 3ZYJA 3PQYE 1U8QB 2BMKB 1A21A 4JPWL 4G8GB 5E6ID 1HHGA 1J1OL 3JWOC 3I50L 4KRPC 3AY4C 4YHPB 1DQML 1QHOA 1RPQA 4IRJD 3TJEL 3C8HA 3FOMB 5HGDA 5C0RH 4HJJH 1P1ZB 1J86A 3VGGA 4XPTL 1AR1C 3FQUB 2DI9A 5C0FB 2BHUA 2BSED 1WVZA 1S7XB 5DD3H 5F7YC 2Q86A 3VFSA 1JGDB 3O6LL 4M43H 4N9GB 4Q97A 3MBXL 4E42A 2APBA 2DLTA 5K59E 4LSTH 4PRHD 5CBEB 5EWIH 5GRXG 3OHXA 4P3CH 4B50A 5BMFL 3P30H 1QPXA 2UVFA 2OBGA 1NEZB 2VOTA 5CAYB 3HUJE 3ZTNL 3VU2A 1AD9A 5IHZB 1N2RB 4D9LL 1VACA 4YFLI 1EGJH 5L8JB 4LQFL 3ARED 3ARBC 1F45A 3EYQC 2DQCH 3SCMD 3UC0H 3GI8L 2NZ9C 1E4WH 2XN9B 3LPGA 3PP3K 1IGCL 4JPKL 3AY4A 4ELMB 1U8NB 4XNXL 4MB4A 4X6DB 1JHLL 4UDTA 3RX5A 4MMXC 4KDTA 3IS1X 3RHWF 5IROC 5IMOB 4WWKD 5CJXC 5JA8B 1P4LB 3BDYL 3ILQD 4CVUA 1OM3H 4U1IA 3U4BH 12E8H 4OF0A 4OLEA 5FM5O 1BF2A 2Y5TA 3MXVH 1ZLWK 3VFUA 4WUKL 3O2DH 5HGBB 4JHZA 3RGVC 4MCZA 5BVJA 3SDDD 4U1HA 3JSSA 2ZSVB 3O0RH 5EO0B 3PWLB 3S37X 1Q9LB 1TQBC 3E6FB 5KOMC 4CDHA 4GG6A 4PGCA 4FNLL 1CI5A 2ENSA 3E2HC 5CS7A 5ID0B 4G5ZH 3I84A 1RZGA 3OKMB 4P2QE 3CX5J 5T1LB 3WIHA 4LSUH 4HF5H 4U1MA 3OSKA 5EORH 3QDJE 4WU7A 5A2KH 4WNQA 3GMQB 2QHLA 4JDTH 4U1JB 1AC6A 3F6LA 4I0KA 1LEKB 2GSGA 5HGGS 3MX0A 5HHNB 1N4XL 1A7PH 3VGFA 1TQCB 2N7AA 4LU5H 1PKQB 4OGAD 4E9LA 1JRHH 4HKJA 5CJXA 3FT3B 3FO1B 1XGYH 1KPRB 4LPXA 5BZDB 4PJHE 1AD0B 2VXTL 1JTPA 3RGVA 3S4SA 5FGSA 4APQC 3DARA 5A2LH 1JZ8A 1OP5K 5TE4H 3LKRB 3W0WE 1JYXA 3BYYA 2X9XA 1UZ6F 2XZCL 2YOCA 3LKNA 4ZDHB 4LKXA 4NWUH 4DFIA 3E0GA 1X4XA 3JVGC 5IQ9B 1IGIH 1JL8A 5DVLA 1K8IB 1S9KC 5K33A 3IFLH 1IILE 2LU7A 1A3LH 5EB9A 1U9KA 3SO5A 1KF9B 3SKNB 1YMHB 2L7JA 25C8L 3HZVB 2EYTB 5C0BE 4OIBA 4M7KH 3FO0H 4CMMA 4FN0A 3D1MC 3TLRA 4WW1A 1PAMA 2X41A 5IHUL 1C7SA 3HE7C 3HI6H 3GMOB 1GAFH 4WFGD 4APQA 4MWFA 2AJZA 2DI8A 3U7WH 1JI1A 1UCBL 3H6JA 1HQ4B 2UV3A 5DD6B 4LASL 1IARB 1CL7I 3DIFB 4HFWA 2EDEA 1JHKH 1T7ZA 2V6HA 4BM7A 4P2QD 1RSFA 5FCSH 2HH0H 43C9A 5E8OB 4XPGH 3JVGA 4W81A 2A6KB 3QDJD 2J5LB 2BOCA 3TO4C 3V6OE 5L9DH 1QFOA 2GUOB 1EZVY 3MLWH 1HH6A 2VH5L 3D3VA 1Z3GH 3ZTJG 1YEEL 1K85A 2CIIB 3T0AA 5DC0A 5GJTH 5HXMA 1Z5LA 4LEOA 4NO3B 4UOW1 5ITBL 1ZSDB 4QHKJ 3R1GH 3V4VL 4MAYD 4NOBA 1YN7A 5CZXC 1YPZF 4N8VA 1LNUB 2VIRA 3W0WD 5ESVA 2ZP0T 2WWMD 4GMTH 2W9EL 4DVRL 4TTDD 4U6TA 4NZTH 1SEQH 1DQLL 5BO1H 2V9QA 1KLUA 5A40E 4JRYA 2FD6L 4N5UA 1X5KA 3L3IB 1SEBA 4M4PA 1CE1L 3TIEA 3TYGL 3QXVA 3TO4A 1OSZB 1FDLL 5IWLA 1EHLH 5HHOE 3MRJB 3VRIB 2NY7L 3HNSL 4HH9A 5C0BD 1NCCL 1CFBA 1FE8H 2VDNH 4ZFZA 3HKFA 5AWNH 3RVXC 3GJFA 4P2OD 1ED3B 1CLYH 4FQXB 2NW3A 1CXHA 1C08B 3EOBB 4OTXH 3K2UH 1T1WA 2J7LA 4GFTB 3HG1A 4OZHA 3HI1B 5EU5B 3T2NL 3MUHL 1KENH 4PP1C 3TBVA 1YPZB 4P57A 5T3XH 4NSKA 1IEBA 1M7IA 1C16B 4RISL 1MF2H 4ZUSA 1MQ8A 3QQ3A 4XGZB 2X40A 5MEOA 2X1OA 5T5FL 3RZWA 2DB8A 3OJ2C 4FQHA 3OR7B 3LS4L 4GW1A 4P5TC 4ZS6C 1DL7H 4MJ2A 3GSWA 2KDGA 2OCFD 1GYAA 5CJOH 5ANME 1TVBB 2IANA 5FDWB 3G6AB 4L3AA 2OP4H 3MCLH 5F1NA 4ZTOH 2VR5A 4C4KO 3QFJA 5EBWB 1T7YA 4N8CL 4TN9A 3FT4B 1T83A 3O2WH 1N3NB 3BUYB 2WINA 3V4PH 2VL5B 4NRZB 4QTHA 4M5YL 3MJ6A 3VWJB 3V5DB 5HGHA 3ZMRA 1JZ3A 3C9NA 1MUJB 2C3VB 1PQZB 2DM3A 3QIWD 4PJBE 2Z8VC 4NM8L 2ZUSA 2AK1L 1J1PL 5IEKB 3D0LB 5D72H 5FOBB 3DJ9A 4HMEA 1R3JB 2VMFA 3NVQA 1LE5B 1JNNL 5HHOD 2X6MA 5JW4M 4YC2C 4HKZA 4ZSOB 1F97A 4GG8A 2MTPA 1N8ZA 3CH1A 5J12B 2E3VA 4YHNA 2VXQH 4YQXH 3S36H 2R4RH 2XPGA 2R2HB 1BM3H 4JFHE 3MV9B 3HRZA 1CLCA 2OL3L 1NC4A 3CK0L 5IVZA 1GGCL 3S36X 1RZJH 4A6YA 2A6IA 2EDYA 4LBEA 1F3JB 1RMFL 3O9WC 4HCRH 5L88H 3PDGA 4Z7NF 1U3HB 4EVNA 2CSPA 2IGFH 3VFVB 4CJ0A 3I9GH 1D7FA 4Q6IB 2GY7B 4ZFOL 1FYTB 2QHRH 5DQ9A 2GITB 5I76B 4UNUA 1K8DB 5EZIH 4QYOA 4I18A 1NFIA 1JGLL 3S6CA 5IJKC 2QQLL 1NGPL 4BFGA 1FNGB 5A3IC 1QFUL 1JWSB 3DRTA 2HLFC 1KJ2B 2AGJL 4GUPB 5DTFB 2M8XA 3HE6A 2FL5A 4PJCE 1F4XH 4GBXB 2IMMA 1LD9A 5FUOH 3MGOB 1AP2B 3OAYK 4RZCB 4LLUB 1FGVL 1NCBH 1YZZA 3CDCA 4J3VA 4DQOL 4PG9B 3QXUA 4JANA 3MFFA 4XX1E 1DBAH 1PEWA 3C60D 1FN4B 5F8QC 5I73C 3O9WA 3S7GA 3BUTA 3T2PA 4ZQKB 5GRWA 1GOFA 3AVEA 4L3EA 3QUXD 5IMMB 5I1KL 3OL2A 4P5MA 5JIHA 32C2A 2EH7H 2HP4A 1QKZL 4CVXB 4JZNA 1ZXQA 3R0MA 4PRAA 1G6RA 1FCCA 3JV6B 3RUGA 4UTAH 3PIQB 2GW5A 2EE6A 5IJKA 4JG1H 1HHKA 2CPCA 4Z0XB 4MA8L 1F3RB 5EUKB 2DQHL 4MQSB 3QDGB 3BZFB 1FZOA 2X4RA 1FO0B 4X4ZA 1MRFL 3WJJC 1RFDL 1QR1B 2Q6WB 2F53E 3SO3C 1CD0A 1OAYL 3PHOA 4CADA 1W0VB 3EHBD 1TPXB 2XI9A 4R26L 3QEUB 1BFVL 1BX2B 3QUKA 1LO5B 3QUZC 3VMOA 4Z7UB 2EE9A 2ZSWB 2Q8AL 4R90L 5DJDA 1KB5B 4HGMA 4LHUD 5L7XL 1NLDL 4QHNA 1MRCH 3CZJA 3JWDC 2V5SA 1B4JH 4KC3B 4G6JL 4N0CC 3STBA 4IOIA 4WHCA 5E6IC 4M6ML 1NLBL 4JY4A 5HDLA 1C12A 3HFML 5FHBH 1BBDL 3Q5YA 3FQTA 2W0FA 2ICCA 5F93C 4IRJC 1CDBA 4NQEB 4I0PD 2VQTA 2XZQH 4O5LH 5B3JF 3U9PL 2PETA 5D5ME 4E41B 1DBJL 4IHOB 2OI9C 2DQEL 3QFDA 4UV7H 1VKXB 2VERN 5I9QC 4WTZG 3SE9H 4OJFH 5HGAB 5E4EC 2CLZB 4JLRA 4PV8B 3ULUL 1ONQA 4HLJA 1M7XA 2GY5A 3T04D 2P5WE 3QG6A 4S0TD 2X70B 2V7NB 4Z7OE 1IM3B 3MZTA 4QNPE 3OGCA 3X14A 5FO9B 2OTPA 4XP4H 4XCEB 4ZS7H 3F7YB 3IYLW 4HULB 4M8VA 4FFVD 3MRDA 3H9SB 1U2HA 3CX5K 3PWPE 1I8KA 2R29L 5HPMB 1GZPA 4MJ5A 3LKQB 5E6IA 4K3DH 3WLBB 1T3FA 2V2WA 1NH6A 3KDMB 1ND0B 2FIRT 1PZ5A 3GBML 5DQDL 4WWKC 5DHVB 2VLKD 2NY6B 1FNSH 1NBYA 2GJ6E 5IESH 3TIDB 3QO1B 1P84J 1HNGA 4XVJL 4JDZB 2UWEE 3QNYA 3F7RA 4L3CB 3P4OB 3QXWA 4TSBL 5KSBB 4PRHA 2B8OT 2X9YA 4FFZL 5DRZA 1IQWH 2JB5L 5JQHC 4PJEA 2ADGA 3VDCA 4BZ1L 2C7UB 4LPVA 5D7SL 1UA6H 5DJ2B 4EIGB 1MHCA 4LLDA 2BNRD 3H0TA 4LSPL 4AEEA 2DN7A 5KZCB 4U2ZA 4E5XB 4PJXA 3TPUA 2HTKD 3AREA 4HQQH 3UTQA 4HBQA 1AXTL 3HZKA 4WO4D 1UCTA 3SCMA 2FEDD 4UMGA 2NY4D 1B0WA 3WBDA 1HXYA 5JOEA 4J8RA 2YPVL 5FKAA 4IJ3C 3MJ9L 3NIDE 3U30B 2Y6SC 1YDPA 4GXVL 1BZQK 3PGDB 5KSAA 4NN7C 1CD1A 3X3FH 2GK0B 4WIQA 4B41A 4Z7QF 1F58H 1GGIH 1NBVH 5EU3B 3SDDA 4XWGL 2F5AL 4GS7B 5D71H 2E7HA 1OB1B 4U33A 1EERB 1RJCA 4J4PD 1JIBA 1S7WA 4QCIA 3VFNB 5BRZE 4Z6AT 4OCXL 3VFGL 1BJ1H 2WUBH 1I1AD 3PQYA 4R7NA 1RUQH 1CVSC 2ZNXA 2MCPH 1MCWW 4MNHB 5MHSE 5L8KB 2B5IC 3CZFA 1MJ8H 4HHAA 2IMNA 2X4PB 3CSYB 1J9CT 2HJKB 2R9HD 1X7QB 4R4FL 2GJ6D 4R9HA 3FOLA 2VITB 3D9AH 2KQMA 2WMPA 3A6CL 3GHBH 1R3KB 2HJFA 3MXWL 4GRMA 3DYMA 2R1WA 3I6KA 1TZHB 4DWHA 5ICZB 1JFQH 1LO0H 3UEZA 1QO3A 1A6WL 3LOWA 1NMAH 4UIKL 3UBXA 1EHAA 4NPYA 3MREA 4OLUL 5I8KH 3HUJA 4AQ1B 4TOYL 4PJDB 4M1DL 3HCVA 1QSFB 1EO5A 1RZ7L 2HKFH 1FHGA 4YHZH 4HX1A 3N85L 4PIRF 1YJDL 2BC4A 4HEME 1T20A 3W5MA 1KCRH 2V9TA 2JELL 3FO2B 2R0ZH 3G04A 4YDKH 4N68A 3O6ML 3L1OL 4KTDL 4PY8J 1GJIA 1JMZA 3QNXA 1RJYA 1Q72L 4KUZH 1NDMB 4OIIL 1AY1L 4LP4A 1YYLL 4YO0A 4MAYC 1SBBA 2AEPL 1XCQA 3IS0X 2EICA 3OXRB 3P0YH 5TDNA 3VFOA 5J4MA 5GS2D 4OCYH 5FGRA 2WWMC 3RY5A 5FK9A 2XZZA 5BRZD 5H35A 4TTDC 4UV4L 5E9DB 4MNGB 1QZ1A 1MWAH 1U3ZA 4NQCB 3CFEB 3VFPB 2D7QA 4P2QA 1QSED 4Y2OA 4EXPX 5KANI 2YK1L 4HJJL 4LIQH 3MLRH 2BVEA 4LHQB 5DD5H 5CBAB 1I9RL 2CDEB 1T22B 5MHSD 3QDJA 2O93L 4XVTH 3K81A 5DD3L 3T08A 1QQDA 3TWCH 2XKSA 5J3HD 1VGKB 1H0DB 4TTGA 5MENE 4M43L 3RX8A 2WV3A 4JG0H 1K5NB 1JN6A 4LSTL 2WBJD 5EWIL 1CG9B 1G9MH 4P3CL 2NNAA 3P30L 2D0HA 4KXZH 3V5HB 3WUWG 3ZDXE 4PJHA 3H9YA 1GL4B 3MV11 1Y0LA 4P2OC 5FM8A 2IJ0C 2XQBH 5BS0E 1R5IB 5KW9H 2P24B 4UAOB 4MAYA 1UH2A 3U46B 1YNLH 4WDIA 1FVEB 1F8TH 2IEPA 1EGJL 1CE6B 3W0WA 3TBWB 4XB7A 2DQCL 1HIMH 3UC0L 5TQ0H 4QHUA 3VI3E 1E4WL 4PRPE 1I8LC 1KG0A 2VLRE 4L9LB 1FG2B 3GGWB 3SGEI 1H3PH 2R0LL 3V6FB 1J8HB 2XTJC 2AJXH 3D18B 1A7RH 3SGJA 1OM3L 4NZDA 4Y0GA 1IC5H 3MXVL 4P46D 3B3IB 3O2DL 3OKDB 5JQ6H 2VZTA 5ALBH 3TT1H 5C0BA 1DSFH 4WJ5A 5CJBA 3O0RL 1AGDA 2FWOB 2MFNA 3UTZB 3PGCA 3WLWC 1PDKA 2OXHA 4P2OA 3QIBB 1JYWA 2D7OA 1M05A 1ZA3A 3TO2B 4G5ZL 3K2MC 1Q0XH 3B9AA 3V7AE 1TFHA 2KZ1B 3P4NA 1VFAA 1WF5A 5E5MA 3Q6FA 1EA9C 4LSUL 4AMKH 4BQCA 2FJHB 2OJEB 4WFFE 1G7HA 4GW5B 3QIWC 4Z77B 2FO4A 3QWQB 4ZUTA 3STLA 1J10A 3KPPB 5IVNA 1A7PL 2L4OA 3BSZH 5I1LB 4LU5L 3RPIB 4TPRH 1JRHL 3V6OA 2Z35A 3CC5B 1XGYL 2ITDA 3OMZA 5MEND 3REVA 4W4OA 3ELAT 4HBCH 4S0SD 1IGTB 3VGHA 4LLQA 5K9QI 1ORQB 3DYOA 3DUHA 2AI0H 3DI3B 2NY0B 1P7KA 3KG5A 5TE4L 4X4ME 1FNEB 4BA8A 4H0HB 5CIPA 4LLVA 3IDXH 2KBGA 4GMSL 4R2GB 2FGZA 2Z4QA 4NWUL 5I1IH 1QG3A 3KYKL 2HRLA 3TBSB 1IGIL 4PRPD 3GMLA 2YEZA 3QIWA 2VLRD 1RUML 4PJGE 5D6DC 1A3RL 3TZVD 3IFLL 4ZFFA 3WFHA 1FFRA 1A3LL 2IPKA 2D7PA 3HAEA 3FN0L 3BPCA 4Z8FH 1DQQB 5CINH 1CDUA 4M7KL 3FO0L 3X13B 4CNIB 3GUTB 4HT1H 5HHOA 4U0RC 5I19H 4WV1A 2FJGB 3HI6L 1E27A 1GAFL 1RV6X 1MCDA 2WW8A 2YPKB 4NKDB 3UMTA 1IEAA 1XF3A 5C0IA 4IIQB 1UB5A 3BRFA 1JHKL 5EU4A 4L8DA 5C0AE 4XT1C 2HH0L 3MRNA 4WFFD 3C60C 3WHE1 5D1ZD 2GAZB 3EIFA 3VD7A 4K3JH 4MD4A 3ULUE 4G8IA 2X1WL 4MD5B 3MLWL 4JDVA 1M7DB 4JQIH 1TJGH 2BSRB 1KJVB 1Z3GL 1QFWH 5EFIB 3FFCE 4JREC 2OMBA 4FTVE 1Q9KA 5EO1A 3SJVE 5ANMA 2YKLH 1ZMYA 2H8PB 2M2DA 4Q2ZA 3S8WA 1FSKC 4NDMB 1U8OB 3KYNB 3R1GL 3R0NA 4EDXB 4LP5A 3WUWB 3AU1B 1A6AA 2LTQB 4FG6D 3IDNB 3SE3C 5J11B 1R0AL 3C5JB 4GMTL 2IBBA 3BWUC 3BVNB 3MBED 1OLLA 3L3JB 3U0PB 4H8WH 5HYQB 1JP5A 4QOKE 4NZTL 4RAUB 2GTWA 1SEQL 4ZODA 2VLJE 2PO6D 2V7HB 3MV8E 5BO1L 2CXGA 4KJQD 2BJMH 2I07A 2F74B 3L3KB 4Y4FB 2UY6A 5F89A 3WFDH 1YMMB 3EHBC 5J6GB 4OT1H 1HHHA 4XP9H 4PJBA 1FFOA 2FJFB 4KGJA 4WW2A 1JF1B 1PX4A 5I8EA 4DVBA 1L7IH 3QUXA 1EHLL 1DP0A 3ZE1E 2NX5B 3QDME 2XOTA 4QY8B 1FE8L 2VDNL 1JGEB 2VISA 3MOQA 3RL1B 1OGAE 4ZO7A 2IFGA 3K46A 4WI8A 5EC1A 4F7EA 3GSRA 2X2YA 3MUY1 4YHOH 1CLYL 5FEBA 4Q9RH 1A64A 1URLA 4OTXL 5D2NC 3OKLA 1QYGH 1DEEA 3OJDA 4DAGH 4I0PC 2P5EE 3SE3A 3S4SG 2Q76A 4PTTA 5T3XL 5C0AD 2NY5H 4QRQB 3L3HB 2JJSA 2YS4A 4O2FA 5FM5M 1P84K 4KJPD 4LCUB 4N0UE 3BH9B 2P8MA 1T5XA 3EO0A 2ERJB 2AK4E 3V0WH 5INCB 5FGCE 1LE9B 2F54D 2XWJB 5GSVA 3ULUD 3WN5A 1U8PB 2BVYA 4RWHA 5FYKU 2HAZA 5HHQB 2W65B 3MLXH 1BQLH 3WDJA 4PGJA 4EXKA 3MLTB 4LHUA 2JCCB 3NIGF 4FTVD 3BGFC 1AO7E 2OP4L 3MCLL 3SJVD 4CMHC 1MCNA 2P7TA 4GW4A 4NNYB 2AJSH 2DDQH 3MRKA 5JDSA 3N1QC 3BQUB 5J1TC 1LEIA 1MFAH 3DURB 5HHMB 3O2WL 4BSVB 2AQ1A 4PJ9D 4PJCA 3V4PL 4XI5D 4I0PA 4JJHA 5I66A 4QOKD 1IFHL 3MV8D 3ZE0F 2BOBA 5DSCA 3UYOD 1KPVB 3NPSC 3FQRA 3LDBB 4JFFE 3WIFB 1YN6B 1VESA 5D72L 4XNYH 5I30L 3TESA 3MJ7B 5LAXA 5LCVH 5TF0A 4LCIH 5GGUB 4ZYKA 1KIUA 1I7UA 1HHGB 4NN5B 3QDMD 1IMHC 4RMTA 4ZUVA 1FAIH 2AXGA 4GLRI 4NFCA 4J3XA 4OQTL 1OGAD 4TNWK 4G42A 4WHYH 2CMRH 2HTKC 5F3BA 5ISZE 4NBXB 2R4RL 3QZWA 4ZAKD 4DUXA 3RVUD 1BM3L 2Q86B 2CR6A 1E4KC 1OSPH 4XMPH 2P5ED 1LO4L 4E42B 4HMDA 1NCWH 1RZJL 1UENA 2VWEE 4HIJB 3I02A 3OHXB 3VXTB 3L95A 4EIZC 3UX9B 2VLKA 1H8SA 2EDBA 2F53A 5L88L 2X10A 4CAGA 4ISVB 1AD9B 4AZ8A 3RVVD 5IOPA 1VACB 1BIIA 3SPVA 4AL8H 2QHRL 1HILA 4K23L 3KPRE 2FH8A 2Q7YA 3HPLA 4KRNA 5E08H 1AO7D 4J4PC 1B6DA 1E4XI 1I1AC 2V17H 3ZL4H 4JVWA 4M93B 1F4XL 2VJXA 3IDMA 3KPQB 1FIGL 3GRWL 4WO4A 3WFZA 5FUOL 4R4BA 4U1IB 4RMQA 3NA9H 2EYSA 1FL3B 2Y5TB 4X6EA 4M4RA 1LILA 1M6OA 4MCZB 5BVJB 1YEJH 4U1HB 5D5MA 1DBAL 1AQDA 1QLFB 1VPOH 2R9HC 3MOAL 2Y36H 4M6NH 2ZUTA 3RBGA 4U6XA 4P23D 4GG6B 4LLMA 4PGCB 4NRXA 3WEXA 1W8OA 2EH7L 4JM4H 4ONFH 4NBZB 2WBWB 5EUOE 3IRPX 1D6VH 4UTAL 4U1MB 5C6TH 1D9KD 1D5ZA 4JG1L 4RMUA 2FX8H 1JK8A 4WNQB 4C59B 1H3VA 4QRPE 5ISZD 1SQ2N 5E6YA 3JTTA 1I1AA 1KELH 4FQPA 4MA3A 3SDYL 4YNYA 2BDNH 2EH8H 4HKJB 1T1ZA 4CU6A 3JV5A 2R8SH 3DX8A 4EN3D 2O26U 1B4RA 3S4SB 4Y4HD 3OXSA 2GJ6A 2YR3A 4NOFA 3W9DB 5DWUH 2UWEA 1CT8A 2YBRA 4R8WL 3LKNB 2R2EB 3SE4A 1MRCL 1DCLA 1JNLH 4LHJB 4JAMA 5TDPA 3DNKA 1CGVA 5DHYA 1YEIH 1TTGA 4MXVF 2CK0H 4G9DA 3AB0C 1CBVH 4C83A 5ALCH 4L4TD 1BVLA 4N0YH 2HJLB 3Q1SL 1YY9D 5SV4A 1VENA 2QL1A 3ES6A 1A6ZA 1RK1A 5C07E 2XZQL 3C6LD 4O5LL 1QSVA 4Y5XB 1OT2A 5E8NA 5HYEA 4CMMB 3SE9L 4HGWA 4OJFL 5J3HC 3L6FB 3F8UB 1XH3B 2W92A 4IMKC 2WBJC 4AQOA 3LRSB 3FRPA 3C6SA 3QQ4A 2AJZB 3LY6A 5E5RB 3H7LA 4YK4C 2FNBA 4XBGA 4HFWB 2YRZA 4LVHB 3QHZH 4XP4L 1UEYA 3MYJA 4ZS7L 4G6MH 4F2MA 43C9B 1E28B 1OW0A 5CWSA 2J8UF 4U05A 4QRPD 4HK3N 5BRZA 1EEYB 2H32B 3P4LA 4U49A 2YHGA 4OBRA 5JXED 2VUOA 4K3DL 4L8SC 5FV2A 3CSGA 1T66D 2CLRB 2W60A 1G9NH 4RGMC 3F5WA 3FB5A 5I1AA 3D3VB 2RCSH 2ESVE 4WEMB 5DD1L 1XGQB 2QSQA 2DOCA 1Z5LB 4LEOB 1FNSL 3MUJA 4NYLA 5J06A 4V1DD 4P46C 3V79C 5I6XC 5GHWH 2EE2A 1YN7B 3HZMA 3KPLB 1T2JA 2WBJA 2VIRB 5KVDH 4U2YA 3PWVB 5ESVB 5CLTA 2A1WL 5T1MA 4KV5F 3UTSE 4HWBL 3AMKA 3MCG1 3S3SA 1RIVH 1P7QB 5KG9A 4NKIH 2OSLA 1BD2D 5ENWA 2RB8A 4TYUA 3S96A 4HQQL 3Q48A 1S9XB 4N0FA 1KIQB 4NJAH 1SY6H 4XPBH 4JFYA 3TIEB 2J8UB 1ES0A 4NC1E 1KNOA 4U1SA 2ZUQB 3SGDI 4HH9B 3MROA 1JGUL 4FQ1H 4ZFZB 5F7NC 1XIWD 1B90A 3C5ZC 1F6AA 2FGWH 2DBJA 5F6HJ 5I8CA 1OAUH 2I24N 4OGYH 3X3FL 4X6CF 1T1WB 1F58L 1GGIL 3O3EA 4OZHB 1NBVL 1FZMA 5GRUH 1B0RA 4GAYA 3TH4T 4KI5E 2EC9U 1AFVH 3ARFC 4M5ZH 3TBVB 4P57B 4NSKB 4NUGH 2XRAH 3ZDZE 5ADPL 5EIQA 5C0CE 1WC7B 1Y6NR 4ETYA 3QQ3B 1XGRA 5EH1A 5E5UB 5MEOB 2WUBL 3IKCA 1RUQL 5AG8A 1K6QH 4FQHB 4GW1B 5JNYA 4XNMA 2X4OB 5IKCA 3TZVC 4ACPA 3HZYA 3NFSL 4HJ0D 1PG7W 1MJ8L 2ESVD 5FGBC 4Y5VC 1K4CB 3W11C 5CZVL 5F1NB 5DJ0A 3QFJB 5C2BH 3D9AL 1SYSB 3MNZA 5GQBA 3MA9H 4RFNC 5MENA 1I7ZA 5K9KA 3KPOA 1AKJA 3KNBA 4KKLD 1I3RA 4Y16A 1JFQL 1LO0L 5F71A 4XTRD 2WINB 2HMID 1HWHB 1NMAL 3H9ZA 4X6CB 3UTSD 4DUWA 2VR9A 1A14L 5HGHB 1T03H 1S7QA 3QDHA 5BS0A 2IQ9H 4XXDB 4YHZL 2I27N 1C1EH 5FV1L 1DBBH 3Q6GH 3RP1A 4FQJH 1MVFA 1XAUA 3CLEH 1KCRL 5T3XE 2OL3A 3DPBA 3ZTJH 1KJ2H 2R0ZL 2O5XH 4PRPA 4YDKL 1P6AB 2MSPA 2VLRA 3TZVA 3OG4B 3ILPA 3H3PH 4IRSD 2VSDA 4ZUWA 3QI9C 4GG8B 4KPHL 4PBWD 1N8ZB 2IPTH 5FGBA 3CH1B 2FX9H 2Z91A 3VWKD 1BVZA 4KUZL 1JGVH 2XPGB 3C8KA 1LO2L 3HRZB 4FFYH 4HLZH 3GSUA 4ZFOA 3GBLA 4XB8A 4KI5D 3GSOA 1FNHA 1RIHH 5L0QB 1T1XA 4M7ZB 5HDBE 1WWCA 3TCLA 3IFPA 3P0YL 1KGCE 5FUCC 4FG6C 4A6YB 3BKCH 3QO0B 4NWTH 3EOAA 1OGTA 2JIXA 2HRPH 3L7FA 2Z31C 3CUPA 5A2FA 4EVNB 2PO6C 3MGAA 2C4FU 4UQ3A 5F1IA 4X98B 4LIQL 5HI4D 2EIZA 1OQXA 5DD5L 3MLYL 1T2QH 3HC4H 5I1EH 1YEGL 4QYOB 5D1ZA 4I18B 1NFIB 5F6IC 3LEVH 4XVTL 1FO0H 3TWCL 3UYPA 1F11B 5C6PB 4BFIB 2VZSA 3HE6B 1G9ML 1BREA 4YGVA 3VGAC 3D25A 5MP6H 4LVOB 5I17B 3L3GA 1LD9B 5JPMA 1U8KA 1IEHA 3EJJX 1A2YA 2XQBL 4X7DC 5AZEH 2CUHA 3RVTD 1F8TL 3MFFB 3N50A 1KB5H 4N5ED 1U2CA 3QWOA 1JJUA 3D69A 2XNAA 3LPFA 4X4MA 3MBEA 3IFNH 1UM4H 5TQ0L 5ILTH 1NKRA 4KJPC 4WHDA 3RI5K 4DOHB 2HT2D 2PO6A 2Z0BA 4P5MB 1RUPH 1VFBA 5T3XD 1KBGH 4C54A 4JZNB 4G43A 4PRAB 4AENA 3BDXA 4EI6B 4L8CA 2XFXA 3P0GB 4PJGA 1NANH 3VDAA 1KCKA 1Y18B 1A7RL 3MRIA 2AXJA 1HHKB 1AJ7H 1IC5L 5IFJA 5JQ6L 5ALBL 3ARDD 3DROA 3M1BA 1FZOB 2X4RB 1T1YA 4FFWD 3JWDH 3WE6B 1T7WA 3EDEA 2XIDA 2UUDH 3BD4A 4GAGL 3O41B 3PHQA 1Q0XL 5MERA 1KGCD 3BP6A 3EYOA 4OCMC 4PJ9C 2ATPA 3OJVC 1QBLH 4CADB 4GKNA 5CLWA 4CVWA 3GKWH 2FIKA 3VRLE 3UBXG 1RZFH 3QUKB 5C0AA 3I85A 3NZ8A 5DJDB 4P59H 4QHNB 1CD9B 3VFWA 3BSZL 4JO3H 5EU6D 5DEZA 4TPRL 2F54A 3RY6A 3FB8B 2OR7A 5EZLA 2LU3A 1A22B 1C12B 2F8OA 4HSQA 4U1LB 5FYKE 3FQTB 2W0FB 4HBCL 3A67H 4FTVA 4MZ3A 4R3SA 1I8IB 3EJZC 3SJVA 3HHRB 4PY7A 4K3EL 2AI0L 3NTCL 1GCFA 1WIUA 3QFDB 4ZAKC 2VDOH 2DLEA 2V5MA 4Q9CA 5GXBB 4JLRB 3MV7B 3IDXL 4PJ9A 2AXFA 1ONQB 5JMRA 3LS5H 4ZOBA 2DAVA 5TDOB 4QOKA 3BO8A 1H3WM 1BOYA 1PYWA 3GSQB 2VLJA 5IIEB 3MV8A 3RDTB 3X14B 4DEPB 4J12A 4Y8DC 1HZHH 1OF2B 1NDGA 2NY2C 3MRDB 2OX5A 1I8KB 3P0VH 5CINL 1GZPB 4MJ5B 4XP5H 4KI1A 4HT1L 5D93C 5LBSH 5I19L 3QDMA 3M45A 4L4VE 3B83A 3LKPA 3ORJA 1OGAA 3ZKND 1JZ4A 4D3CH 4JO1H 1L6ZA 4ORZC 5IGXH 1BQHA 3NFNA 2HWZH 1GGTA 1MCCA 4ZAKA 3TBTA 4MJ6A 5J7CC 1NBYB 1Z2KA 4PJAF 2OXGA 4QXTA 1CTOA 5DEFA 2VKXA 2P5EA 5M95B 1WZ1H 4HC1H 4XC3L 4HIIA 4PRHB 2ED7A 5E0QA 4MCYA 4PJEB 4KQ3L 4P23C 3OKOA 4CRPA 2AVGA 2ADGB 2ICWA 4N0UA 1F00I 5IB1A 4OCRH 4K3JL 4XPAH 1T80A 4LLDB 1VA9A 3H0TB 2AK4A 2N1KA 5JXAH 1MPAH 1ITCA 6FABH 1TJGL 1WV7T 3TPUB 1NFKA 1PLGL 2EDQA 1QFWL 2HFGH 3AREB 1VADA 1S7TB 3HZKB 4JKPH 3RTQD 3SCMB 5ITFA 1D9KC 3GMPA 4NN6B 1AO7A 1HXYB 1OAXH 3HMWL 4J8RB 1YEDA 3CFJA 2EZ0D 2D0FA 4I8DA 5I1GH 1PX3A 1XEDA 3RKDD 1TETH 1YDPB 3O3AA 1J11A 2D9CA 1AGFA 3DECA 3LHPH 4JFDE 5K59F 5KSAB 4ZTPL 4H8WL 5I74B 2D7TL 1L0YA 1X5XA 4O9HH 3ZHLA 2F15A 4M6OH 4PJAB 4TNWF 4EN3C 4YR6A 3SDDB 3WFDL 3SY0A 2DYPD 4OT1L 3VXSD 4HZAA 5IQ7H 5C70A 1CICD 4XP9L 1MH5B 1W72H 3O11A 3DO7A 4JFFA 2FX7L 3U6RA 2P49B 1L7IL 4QCIB 1YEKH 5IMKA 4OCSL 4MJIE 5F9JA 3G6JF 5T33H 1MCPH 1N59B 3PQYB 2A83B 4R7NB 4PRIB 1FL6A 4OAWB 4L4VD 1MRDH 4YHOL 4NUJB 1QRNE 4Q9RL 3GSVA 4U7KA 4QLRA 1NL0H 2APFA 1NCUA 1YY9C 4OV5B 2A73A 1QYGL 5ISZA 1ZA6B 1BF8A 4DAGL 3PP3H 5LKNA 3MLSH 1G7MB 3FOLB 3I3DA 4PB0L 2DD8H 2NY5L 2OM5A 3LQAH 2HJFB 4RSVA 3P40A 3HC0A 1FRGH 4GRMB 5HBBA 2R1WB 5FYJH 3I6KB 2W9LA 1A0QH 5JZ7D 1QO3B 1Q9OA 4Y4HA 3UBXB 3V0WL 3MREB 1ZLWH 2DJ4A 1WBZB 4AIZB 4LSVH 3HCVB 2ID5A 3MLXL 1BQLL 3UTTD 3CFCH 4KKNA 4S1DC 2BC4B 5TE6H 1TIUA 3KPRA 1T20B 1MHEA 2DDQL 4LVEA 1E4JA 3G6JB 1UB6A 1NJ9B 4OQ1A 4G8EA 3L5JA 4PS4H 4E0RA 3QUYD 5CHNA 3X3GH 5JXEC 3S3JA 2PCPA 1T66C 3OAUH 2QQKH 1MLCA 3PWUA 3JWOL 4PJHF 3QJFA 3QNXB 3C6LA 3IETA 1IC4H 2AQ3A 1EJOH 4ODWB 5FKPA 4WEUD 2DLFL 4RMRA 4P2RE 2W59A 3MA7B 1UXWA 3ARGC 5JIPA 2HN7B 1XCQB 1IAIM 3DVNA 4O00A 4XNYL 4CW1A 2VXVH 5TDNB 3VFOB 1U8JA 5LCVL 4LCIL 3REWA 5FK9B 1CDCA 3OWEA 4J3TA 5H35B 1JPGA 4PYHA 1AI1L 5DMJB 1FAIL 3LCYA 1OP5H 3GSNL 1VSCA 1NGXA 3D39E 4BUGA 5DJXA 4JPVH 4DZ8A 4EDWH 1SBSH 1B0GB 5EUOA 3QRGH 2JJTA 3WV0A 3RIFF 1QRND 3QDJB 1UEMA 4QXUH 4QRPA 4GSDL 4NHCH 4WFHE 5KSUA 1KPUB 1IJ9A 2VZVA 1QQDB 4CGTA 5JXEA 4JFPA 5AEAA 3GKZA 4OZGF 1OSPL 4XMPL 3KHQA 3S35H 4AJ0A 4I3RL 4P4KD 3O45A 4LRIA 1NCWL 1Z0NA 1FJ1B 4LOUC 2NNAB 1MAMH 4S2SB 3MNWA 2IQAA 4LSQL 4RGNC 4PJHB 3W9EA 4F33A 1GH7A 3KJ6L 5D8JH 4NC0B 4GKZA 1I75A 2Y4SA 2AJ3A 4WDIB 2GHWB 5IJVB 2IBZX 2I60L 3VG0H 2DQIH 3O2DA 5KBNC 3QUMB 3WS6C 1WIOA 4QHUB 2FBOJ 5E08L 3KLSA 1ZHNA 3K3QA 1KG0B 1TLKA 4GRLD 2G9HA 2V17L 4Q74A 4YHIB 5D7JA 3ZL4L 3WL9B 4WY7L 1BFSA 4U31A 4CN1A 1BWWA 5ID1A 2F8XC 3NA9L 4XBPA 5I18H 5C07A 3EJYD 5C0BB 1YEJL 5D70H 1VPOL 4WJ5B 3KPSE 4OFYD 1AGDB 1XIWA 2DTMH 4M6NL 5HVGB 2ATKA 3PGCB 3FO9A 1T4KA 1QPPA 2PR4H 1X5GA 4Y89A 3BPOB 1M05B 1EAPA 1Q94A 2DTSA 1NC2B 4KKLC 1FZJA 3O4OB 4Y2DD 3B9KD 4XTRC 1CXIA 3P4NB 4PLKD 1VFAB 4JM4L 5E5MB 1DVFD 3Q6FB 3CCHA 1HYSD 5ESQA 2A0LC 4ONFL 1S7SA 3GEWB 4LCWB 1KTLB 1D6VL 5J1SC 5C6TL 3D39D 3WS6A 3HC3H 4LPWA 2FX8L 3KWWA 1DBMH 3O81A 1EHXA 2FO4B 1TVHA 4ZUTB 35C8H 5F7DA 1KELL 4LHUG 4WFHD 4HS3A 2BDNL 3V2AR 2EH8L 2OTWA 5DVOA 2Z35B 3SQOL 4LDEB 1NQBA 2Y25A 4NC1C 2QSVA 3OJMB 1V5JA 3PWJA 4Y5YC 4IRSC 2R8SL 2BZDA 3NACH 3C09B 2ESVA 4UBDC 4LLQB 3DUSA 3VWKC 1IBGH 3QYCA 5JW4R 5DWUL 5EBMA 1F4AA 3HA0A 1Q1JL 1DBKH 5D6CA 5CSBA 3UO1H 1N26A 5CIPB 1S3KH 4XX1G 3UTSA 4HWZA 5E56A 4FABH 1YEIL 4G6KH 4XNZC 1JTOA 2VKWA 3GMLB 3T0ED 2YEZB 2BY0A 2CO7B 1CBVL 2BNQB 4N0YL 2IPKB 5DK2B 2WIIB 3HAEB 2Z93A 4FMKA 4XXCA 1PKOA 5KN5A 1ZVSB 3L5WA 4LEXH 2LABA 3I3BA 3U83A 1UQSA 3BRDA 3DOSA 2E6JA 1WJ3A 4WV1B 3QZWG 3NPZB 4JFEB 3KPSD 1E27B 3NGBB 4Z9KB 1ZT1A 3VWKA 5LGJA 5H2BA 1BQSA 3WXVH 3RWEB 5D7LE 5C0IB 4HFUL 4X8JA 5EU4B 2X4SA 1QACA 3FZUD 3QHZL 4GRWE 5GGTL 2GQHA 3CU1A 3DGCR 4N5EC 3MRNB 2FZ3B 5C0CA 4KMTH 3X11A 1WWWX 3OV6A 4AYFA 3CPLB 4MD4B 4G8IB 1MCFA 5F7WC 2HT2C 3D6GA 5E94A 5EZOH 1G9NL 4HDIA 3DXAD 4BH7B 5CP3H 2DQJL 5ANMB 4HMCA 4Q2ZB 4F9PC 4RAHA 4PBXA 5GHWL 2DM2A 4WUUD 1MEXH 1NAMB 1A6AB 3ARDC 3TNNA 3AGVA 5KVDL 4UUJA 3QQ9D 4D0BB 5EOTA 3DMMD 3AXLA 3EKCA 3FN3A 3R8QA 4PD4J 3S34H 1A9BA 1AGEA 5IBLD 2GTWB 4NQDD 4OD3H 3ZLQC 5HYJE 2R4SH 1F5WA 4KKCD 2DI7A 4WTXA 2I07B 4NM4H 3T1FB 5F89B 1GIGL 1UJ3C 3EOTH 1HHHB 4PJBB 1FFOB 1TITA 3EYFB 4NFDA 1SY6L 4WW2B 4L4JA 1FH5L 3KPMA 5I8EB 3V4UH 3IXAA 4DVBB 3QUXB 4NKOA 5D7IA 4MQ7A 4AT6A 1UWGH 5IG7A 3OKEA 3S98A 5IT2H 5E95B 5EC1B 4N1CA 3GSRB 2FGWL 2I25N 3BN9D 3WKMH 1OAUL 4F9PA 4F7MB 1JPFA 1D5IH 2B0SH 2IBZY 3QEHA 4OCLC 2NLJA 4FQQA 5CKAA 3OKLB 3HLAA 5E2UL 1J0JA 4HH8A 1SYVA 5GRUL 1DEEB 2VSCA 3OJDB 1EBAA 1AFVL 5F3HB 5D7LD 2WQRA 4C55A 1INDL 4ONHA 1CGWA 4M5ZL 4YEFA 2NR6D 2DWDB 2Q76B 3N9GH 3O3DA 3BJLA 4NP4H 4ZOCA 2XRAL 1X5ZA 1D5XB 1OARH 3QAZC 5E2TH 3E3QE 3EO0B 3OAYH 1NGYA 1RAMA 1UJ3A 3D2UD 1K6QL 3NIFE 5GSVB 3WN5B 2VDLH 2PXYB 3OPZL 3F7VA 5D2LE 5K9OA 1Q9WA 5GISH 4PUBH 5F97E 2X4NA 1ZGLA 3FB7A 1EEZB 1PG7H 4BKLA 4LHUB 2BP3A 2A2QT 3RIAK 3QULA 4GW4B 3T4YA 3MRKB 5JDSB 3H9HB 1AQKH 3G5XA 5C2BL 1V3MA 1LEIB 3MA9L 1R3IH 4ORGB 4LK4A 3BKMH 3M8OH 5TQ2L 2ARJA 3QPQD 1U41A 3RI5F 3WYRA 1F2QA 2YD7A 4R96A 4PJCB 3ZKNC 3T65A 5DURB 3FB6A 5JLZA 4ODTH 1T03L 4OQTA 3RX7A 5HYJD 2IQ9L 3T4AA 2BOBB 4JKLA 3OF6D 3LIZH 5EPMA 1NSNH 3FQRB 3Q6GL 3GO1L 1YUHB 4KKBC 4YDIL 4NGHH 5F70A 3ARPA 3RPKA 5HHXH 3ZE2E 3CLEL 4DKAA 4Z7WF 1VDGA 4ZOEA 1KJ2L 4ZYKB 4KTYA 1X4YA 1MI5D 1I7UB 4ODUA 2YA0A 2YD8A 2ZUVA 4G8GE 1CLZH 4GKOA 3H3PL 3KPNB 2AXGB 3M17B 1JNHA 4ZUVB 4YXLL 2NY3C 3TEUA 5C08B 2IPTL 3P4MA 2FX9L 2H1PH 4G42B 2OZ4A 5F3BB 4N90E 4C56E 4DN4H 3J7HA 5KAQF 1JGVL 3DV6A 3QZWB 4LCCC 1QBBA 1FPTH 1J8KA 2DQDH 1XT5A 2AEQH 1RIHL 1TTUA 4HS6A 1QFHA 4JE4B 2EZ0C 2E7LC 4CVZB 4EBQH 3I02B 3BKCL 1DANU 1G9EA 3RKDC 3FKUS 4NWTL 4KZEH 3L95B 2C4FT 2HRPL 2F53B 5IFHL 3IDJA 5IOPB 2RAMA 3GRWA 1Z9MA 3SPVB 1BIIB 3UTOA 1T2QL 1FLRH 3HC4L 2D2OA 1EEUA 1CICC 1S9VA 3KXFE 2VZUA 4Z7WB 4O4YH 3LEVL 5TH2A 1NMCB 3GK8H 3HPLB 5D1QA 4PBVC 2X1QA 2XN9E 2XY2A 1R6VA 3MZGB 3OKNA 3PL6B 5HVHB 5J9PA 2V5TA 3IDMB 4WO4B 3GB7B 5CMAA 1KLGA 3RTQA 3PJSB 5IF0A 5LWYH 1RD6A 3GMNA 2NY4B 3P73A 4NZUH 1UFUA 5AZEL 1SJEA 3BXNA 1CQYA 4A2MA 4MXWH 1M6OB 3U82B 5D5MB 1AQDB 2UWEF 4Z0BH 1R5VA 3RU8H 4B0MM 4U6XB 1H8NA 2EDJA 4LLMB 4WEBH 4M3JA 4NRXB 1UM4L 5ILTL 3IDIA 4YBQD 4ZO9A 4OLYH 1MSPA 1RUPL 2P5WB 3V0AC 4PGDB 2DMCA 2DYPA 2IAMB 1OTTD 4G8GD 1CICA 1G7LA 2ADIA 5SWZE 3CAFA 3O8XC 1D5ZB 4TVPL 1JK8B 1AJ7L 5CD3A 1DQDH 4B5EA 2D31A 5JUEH 4RWYL 2A74A 3PWPB 2NXZD 4C56D 4OZFA 1IC7H 3JTTB 1OAKL 2EYRA 1GPOH 5JPNA 3CD4A 3QPXH 4YNYB 3JWDL 3B6SA 2DQTH 1T1ZB 4JFOA 3RFZC 1OPGH 3IDYB 5CUSL 4NHUB 1O7VA 4L4VA 5IP4A 1OCWL 5GSRA 3QUYC 2DQGH 3ARUA 4KROB 4LFHD 4L29A 3T3ME 1A7NH 4BSJA 2DWEA 1CVRA 1QBLL 3OXSB 1LHZA 2GJ6B 1HOCA 3RA7L 4FQ2L 2ADFH 1RZFL 2UWEB 2VLME 5DFWH 1CT8B 2APTA 3TBYB 1MJ7H 2E7CA 5DA0B 3U79A 3SOBL 4UU9B 4M7LH 2H32H 4P59L 3GJEA 5HJ3A 4QHMA 1AR1D 3KXFD 4JAMB 5DHYB 5DUMH 5FECA 3BPLB 4JO3L 5DMIH 1BECA 3GM0A 2EDKA 2ZOKA 2XN9D 1N7ML 5HYSA 3VDBA 2H6PA 2QJDA 4G9DB 3LKSB 4C83B 1BVLB 5J13C 3A67L 4NNXB 1BGXL 3ES6B 4ZMAT 1A6ZB 3RAJH 1RK1B 5MEPA 4WI3A 2QV2A 4HS8H 5E8NB 2VDOL 4QRRE 4OD1H 3QUYA 4HGWB 4HK3J 3VXQA 4DTGH 4JZOA 3MO1A 4PRBA 4O58H 4P4KC 3LS5L 5IR1A 4JFDA 4KZDH 4KFZC 5DFVD 4F58H 3C6SB 2P1YA 2YZ1A 5MEQA 4XMKH 1TZIB 1NMBH 4XBGB 2P43B 2X42A 1RURH 3V7AG 1HHIB 4X5WA 1BAFH 3MYJB 2XWTA 5T1LD 4F2MB 5DS8A 1HZHL 3NCFB 1UZ6E 5SWZD 2J1KA 4GKSB 1KXQE 5CWSB 3P0VL 4Z76B 2MHAA 5BRZB 5JOPD 4XP5L 5LBSL 1EAJA 2MQ0A 5C6WH 3DWTA 4NRYA 2I5YL 2ORBH 1N5AA 4GRLC 3F5WB 4HWBA 3FB5B 4ODHL 5I1AB 2HVKA 5IMLA 4D3CL 4JO1L 2XA3A 3K0WA 3ARYA 1QRNA 5IGXL 2HWZL 1MFEH 4FMFA 1DZBA 2BSTA 4JPIB 5EN2B 4BZ2H 4X0KA 5EC2A 4W68A 4P4KA 3EJYC 1WZ1L 3V8CA 2UZIH 2VLMD 4R97B 1X5HA 3UXFA 5T1MB 3LKOA 4UT6H 1AXIB 4XPAL 3VGEA 4G9FE 5KG9B 2P8LB 4Y2DC 3M07A 1MPAL 1U93B 5ENWB 1DVFC 2B39A 6FABL 5CSZA 3S96B 9CGTA 2YD1A 2HFGL 3KLAA 1M71A 3LH2L 2IWGA 4JKPL 4N0FB 3B5HA 2ZG3A 4JFYB 2V2TB 3MLVH 2B1AH 3QXTA 2VB5A 1ES0B 5FIEA 4AM0B 1IGFH 1OAXL 2JKXA 1DDHB 3X17A 1KNOB 3NAAL 2WIMA 3MR9A 1O7SA 4U1SB 1S5IH 3MROB 3HG1E 5GIRB 1HH9B 4MS8D 2NW2A 1F6AB 4DKFH 5I8CB 4Y7MA 4O9HL 2KKQA 4PLNC 4M6OL 1FZMB 4Q0XH 1LP9F 4KUCD 1P4BH 4OFYA 4P2RA 5IQ7L 5SWQA 3CXDH 5IVXF 4YZFF 2ILLA 1W72L 3UPRA 1YPZE 2E7MA 1GSMA 1DFBH 3BD5A 3EYSH 4J2XA 1YEKL 4YUEH 1Y6MR 4Y2DA 3B9KA 1XGRB 1I1YA 2IANE 3EDJA 5E8PA 4MX7A 3UJJL 1DVFA 5T33L 1MCPL 3E1F1 3TN0A 5DI8A 2KPNA 4QF1B 5JNYB 3LD8B 3T0EC 4R4ND 4XNMB 5FB8A 1MRDL 4J1UB 4ODSH 3D39A 5IKCB 3HZYB 2X5PA 4EEEA 1NL0L 2C3GA 4LAQH 3MRLA 4YX2H 4DFHA 1C5CH 3WNKA 2H41A 4EI5C 1U95A 3MLSL 5DJ0B 2DD8L 4JKWA 3LQAL 2H3NA 4POUB 4A6YH 1I7ZB 5K9KB 1NEUA 3PG2A 3KPOB 2H9GA 5FYJL 2NXYB 1AKJB 4Y16B 3TJHD 1A0QL 1JCKA 3ULVF 3GSXB 4F15C 4YDJA 3LQZB 3BP5B 4YBLB 1LP9B 5F96H 5BS0B 4LSVL 1HXMA 2DQUH 4R0LC 3QH3B 3TVMC 3PGFH 3CFCL 3FZUC 2M1KA 2WQ8A 4I2XE 1KCSH 2Q3AA 1BP3B 1K3ZA 2OL3B 3ULVC 4NQSA 4PRPB 4JO4H 3T0EA 4G7YL 4PS4L 3X3GL 4JZJA 2ICWI 2EDRA 1JPST 4JGMA 1UWXK 3VXOB 4ZUWB 4ZSOE 4M7LT 4Y4KB 5ICXA 4OB5L 2Z91B 1XR8B 2EE3A 1MVUA 3FQXA 4ZPVA 1P2CA 1AGBA 1IC4L 1TCRA 4TUKH 1EJOL 3KJ4C 4FQXD 4GAFB 3HR5A 1NFDA 4ZFOB 3GSUB 1BQHG 3GSOB 2Y7QB 3MV9E 4G80A 1MFNA 3KPSA 2A38A 3EZJB 3TCLB 3IFPB 2VXVL 1CFQB 3QQ9C 1XR9A 3DMMC 3EOAB 2JIXB 3L7FB 4PJ7F 4QXWA 2IADA 5GGSA 4K7PH 5IBLC 3CUPB 3EDFA 5CD5C 2HT3C 1D5MA 1JVKA 3ROOA 5F1IB 3BX7C 4KKCC 4UQ3B 4JPVL 2K1MA 4EDWL 5I2IA 3QRGL 3VRJB 3RVXD 3BW9A 1NBQA 4KAQH 4K8RH 5D1ZB 4NO0A 4QXUL 1JZ7A 4NHCL 3QRFM 4HJGA 2CDFA 2YRLA 5KVEH 2X09A 3BGAA 1WWBX 2JK5A 3S35L 1KUMA 1P5VA 4XCNB 5FF6A 4PP1D 1MELA 4KH2A 4P2YA 2EECA 4YGVB 1MAML 3DXAA 1IAIH 3A0OA 3HNTL 4ZXBB 2QSTA 3L3GB 4F7TA 5JPMB 3BN9C 1U8KB 5FYLH 3IRZA 2GJZB 4P3WA 1A2YB 2ED8A 4NQUA 4O02H 1U8IA 1CGSH 3VWJD 2W9DL 4P5TD 3IAPA 3QWOB 3VG0L 3HNVH 2NR6C 2XNAB 3DMMA 2DQIL 3RUGE 4HUVB 3MBEB 1FFNA 3BESR 1LK3L 2H45A 1N5YH 4IOFD 3P9LA 1A6PA 4M8QB 4R6UA 2ZCKL 4PJ7B 1VFBB 1EXUB 4P5KB 4Z95H 3D48R 4Z7NE 4G43B 4AENB 1WISA 2XKNA 3HPJA 4L8CB 2XFXB 4PJGB 4PJFF 2NTFA 4Q9BA 1PD6A 3MRIB 1CDYA 3LSOA 1WAAF 3K7UA 3ZDYF 4J3WA 5DJZA 5I18L 4MA1B 1WZKA 2BSSB 3DROB 3M1BB 5D70L 5KS9F 4D8PB 3RWCA 4K71C 1T1YB 3T0WA 3TYFB 3RZCB 3MV9D 2PR4L 3STZA 3FTGA 1H3TA 5GRZA 3PHQB 5MERB 4B7LA 1ZGLP 1CD8A 3SN6N 2FB4H 1H5BC 2ATPB 5DXWA 5ABDE 4JKKA 5D7LA 3WMSA 2QTEA 2NY1B 4PGBA 4PG2A 2FIKB 3BKJH 2B7DT 3H2WA 5C0AB 4UT7L 3T8XA 4F3FA 4RAVA 3HC3L 3IU3A 3NZ8B 1J5OL 1DBML 3P9MA 1A4KA 2VABA 3DV4A 35C8L 4OD2A 5C7XH 1FYTD 3JWNC 2I9LB 3MFGB 2A6DA 1Q0YH 2HFEA 1QD0A 3D2UA 3UCRA 3ZE1F 5KVMC 1UKSA 1CDJA 5BQ7A 5I1DB 3RWGA 1KJMA 3G6DH 1DR9A 2IH3A 4B53A 4PJFB 3BHBA 2O61A 5IB2A 4MNQB 3NACL 5B8CC 3BWAB 3FFCB 4FTVB 4ODBD 3SJVB 1NCAH 4GBXD 4X8XA 1EFXD 4W70A 2M26A 1TJHH 2BERA 4JQVC 4TVPE 2CRZA 5ESAA 3U2SA 4DKEH 1DBKL 1ULVA 1JI2A 3UO1L 1T0MA 1G7QB 2AXFB 3DVGA 3F12B 3FHAA 4QEGA 2B4CC 4FABL 4QOKB 1X6NA 4PY8I 3BO8B 2CDGA 1PYWB 1FVDB 1BLNB 5HYJA 2VLJB 1M1SA 2PYFA 3OF6A 2QSCH 2WP3T 2BVQA 3VI4F 3H42H 1X44A 3E6HA 2J6EH 4HXAH 1FG9C 4LEXL 4HV8A 2R1YA 3LEYH 1MCQA 3ARSA 3HN3A 3QDMB 4J3UA 4HPOH 2G2RA 3LKPB 1OGAB 3QDGD 3FFDA 4TSAL 3TH2T 3NABH 3AMLA 3WXVL 1BQHB 3NFNB 3TBTB 4X7FC 4MJ6B 4QXTB 3RNKB 2VDKH 2YD6A 4A2LA 3HB3C 4YXHH 1YECH 4YDLB 4PJXE 1A1NA 3OKOB 3U36B 1YY8A 1FIEA 4N0UB 4YAQA 4OLWL 2X4UB 2AK4B 2NZIA 3IF1A 4L5FH 5FGCB 4ZUUA 1JWMA 2NY5C 1H3GA 1HQRA 1VADB 1GRWA 1MY5A 4XHJC 1VEPA 4JY6A 2W07A 4DK3A 5ITFB 2EIBA 5DRNB 3VMPA 4UIMB 2EXWD 3WFCH 1OOAA 5GRJH 4OSUH 2OR9L 4NQED 3I75A 1MEXL 3SGKC 3QJHA 4JKMA 3QUZD 4E41D 4MHHG 3O3BA 5BV7B 4KRLB 1AGFB 5I0ZA 5CJ5A 3S34L 2QLVB 5DUBA 4OD3L 3SKJL 2X4QA 2VDQH 1CFTB 4PTUA 4WU5A 4EKXA 4XCCH 1IAKB 3QIUC 4NM4L 2VUYA 4XPFH 4YR6B 3SY0B 1RVFL 4X4YB 4ELMF 4X6DF 3O11B 1U0QA 3FHQA 3MRQA 3DO7B 1FNAA 3B43A 4JFFB 3U6RB 3V4UL 2MKLC 3LQMA 1G0XA 3MPCA 4TUJA 4HPYL 5IMKB 5F9JB 5JORA 3MTRA 3WNOA 5IT2L 5E03A 4G3YH 2BMKA 4G8GA 4NO5A 2J88L 3WKML 2BRRH 2FR4A 1IKFH 4IM8A 5E2VH 3GSVB 1REIA 4YHPA 5AYQA 3QIUB 4M6AA 2A73B 3EO1A 4K07A 3QISA 4C56A 3SGKA 2EDOA 1HN1A 5C0FA 4L1DA 2DS4A 2NY6D 2YUVA 3N9GL 4NP4L 4YGAB 1A7QL 5HY9A 4GOSA 4GXUN 4P99A 4MA7L 1JGDA 1OARL 5E2TL 1MJUL 5EU7C 1Q9OB 1DTUA 1PSKL 5DD0H 3DI2B 4PJIE 3PF2A 4Y4HB 1HDMA 5BW7C 4OFIA 2FEEL 5DFVC 5C9JB 4Z7QE 3PV6A 4ELKA 5GISL 4PUBL 1YEHH 5IHZA 5KZCD 5SWSE 1PY4A 1N2RA 3ALPA 2IFFH 3AROA 3KPRB 3KXFA 1MHEB 2ITCA 2QADB 1WTLA 3C5SB 1UB6B 3S37H 1NBZA 5I75B 1R3IL 2XN9A 5CHNB 2HFFA 3BKML 3M8OL 1U8NA 5J8OA 1XF2A 4BYHA 3PWUB 1YNKH 1TQCC 4NQVA 4PRDA 2NTSP 3QJFB 5IMOA 3C6LB 4WFGE 2PF6A 1P4LA 4AEHH 4WI9A 3GSNA 5FKPB 1CR9H 2SEBA 1KCUH 4ZPTB 3QUMH 3LIZL 1NSNL 3TM6A 4WI2A 3CSBA 1I8MA 5HHXL 4NGHL 3DVNB 2ZSVA 3ARBA 4CW1B 5EO0A 1ROWA 3PWLA 1U8JB 1Q9LA 3E6FA 1VCAA 3G5VA 8CGTA 3KLHD 1CLZL 4MNGE 2DIBA 1NGXB 1YYML 5DJXB 3EW3B 5GGRY 4DZ8B 4NO2A 2Y6SD 5IROA 2H1PL 5SWZA 3ZKMD 4YIQB 4DN4L 4MLSA 4QRPB 4RMVA 5GJSH 5KSUB 3GMQA 3DSFH 1DANT 4KUCF 5HHNA 2AEQL 3O45B 1PKQA 4EBQL 3THML 4MS8C 2IQAB 4AK1A 4KZEL 3W9EB 4JFQA 4G6FB 1KPRA 5BZDA 3H3BC 4GKZB 2H2PC 2GEEA 2X7LA 2AJ3B 1I1FA 5DJ6B 1FLRL 5SWSD 1X5LA 4RCAA 5IV2A 5JHLL 4AY0A 3HS0A 3GK8L 5EBLB 3KPTA 5F7EH 1EFQA 2VDRH 1ZHNB 5H37G 4U1KA 1MNUH 1ACZA 4O51A 3TA3B 3VXRB 5D7JB 5EIVA 1UZ8B 2J5LC 1U3JA 4R4NC 4YHYB 1J8HE 5ID1B 1QFWM 4QT5A 4NZUL 4U6HB 3L5XH 2DJSA 3INUH 1H15A 3KHOA 4XP6H 5C07B 3SKNA 2AJVH 1WFTA 1YMHA 3TC9A 4MXWL 4ALAH 3G5YA 3HZVA 4Z0BL 2EYTA 4QRRA 3CFDA 1XIWB 3RU8L 2ATKB 5EIIB 3FO9B 1T4KB 1S9YA 4WEBL 1EAPB 1Q94B 3BIBX 3ABZA 3TJHC 3GMOA 4OLYL 3ESVF 3WO4B 5ESQB 5FYJD 5DD6A 5DDHA 2C3WA 2XTJE 4OGXH 1XF5A 2BVOA 1L4IA 1YNTA 3KWWB 1MOEA 1TVHB 1DQDL 5JUEL 5K9JH 2ZUUA 3CXHJ 5F7DB 5E8OA 2V2XA 1ZKAA 5T1KD 2PW2A 4HKXB 4LARH 1GPOL 3QPXL 4HS3B 4YE4H 5I16A 1U91B 4YFLF 1OPGL 3GMMB 5HDQH 3PWJB 4J6RH 3HE7A 4LMQI 4DUVA 4YFEA 5DF0A 3AC0A 5GGVY 3VFTA 3P11H 1V8HA 3KYOA 1EBPA 3ARRA 1V7NH 5AD0A 2ADFL 5KTEH 1IQDA 1G9NC 4FQXC 5EBMB 1MJ7L 2K7QA 2AXHA 1KACB 4LLWA 3TT3H 5D6CB 3T0XA 2E9JA 1AHWB 2AEWA 3ZDZF 2ZUYA 3IT8D 1OD9A 5A16A 5DUML 1HKLL 5DMIL 3UYRH 3KVQA 1GXEA 4G9FA 2LVCA 1NCTA 1ZK9A 4KJWD 2CKBB 5B4MC 3QT2A 4CJ1A 3SDXE 4H20H 4RMWA 2Z93B 3BP4A 3RAJL 3L3IA 5KN5B 5AAMA 2RQ8A 1J8HD 1UQSB 1NAMH 4HS8L 5GGTA 2WBKA 3L3OB 1OSZA 4OD1L 4FZEH 3MRJA 4OZIF 4O58L 4XCFH 1HK6A 1MAKA 4KZDL 2Y1VA 5LGJB 5H2BB 4F58L 3ECBA 1RK0A 4RRPG 1ED3A 1OHQA 4U1GB 3QIBD 4XMKL 3T77B 4FQXA 1TDQA 1NMBL 2YPLB 3P3YA 1C08A 4X8JB 3U1SH 1RURL 5I1HL 1G1CA 5CSGA 2X4SB 3VWJC 1BAFL 4KGLA 4HK0B 4H25A 1YPZA 2XTJD 4IDLA 1A8JH 5C0CB 4O2EA 3DHJA 2R56H 1RUAH 3X11B 4IOFC 4LNVA 2ORBL 2VE6A 4H1LG 3JUYA 3VG9B 3WLWD 5LGHH 4EQ2A 3OR7A 4HDIB 5EOQH 2D0GA 4TUOB 1F3DH 1CZ8H 1LK2B 1MFEL 4BZ2L 2LFGA 4LGSB 3OX8A 1AGCA 3G6AA 5J12C 3ZT5A 3FAWA 4JFZH 1SY6A 4OZIB 2UZIL 3ARWA 5HPOA 3TNNB 2NY0D 4FQCH 1RULH 5EOTB 3AXLB 3VD9A 5JHDE 3RWIB 2YXMA 4U6VL 4UT6L 3GFUA 4X5LA 1A9BB 1Z6JT 2WWKT 5DO2D 2VL5A 2BHZA 4NRZA 1V7MH 2W38A 1T04B 3VWJA 4D0CA 4FA8A 4P5TA 5INDA 1YMME 3CVIH 2C3VA 5JW3L 1U3HC 2ARJQ 2B1AL 3K8LA 3MLVL 5IM7B 1QUNA 3IXAB 4I2XA 1G7PB 1IGFL 1E6JH 2DBLH 5E2JA 4NKOB 4Q6IC 1HYRC 1S5IL 4MQ7B 5IG7B 4AT6B 3NBNA 3OKEB 1LE5A 3O6FB 4OZFG 4JPWH 4I3SL 2DKSA 4ZSOA 3I50H 3OTTA 5T1DH 3QEHB 4FQQB 2PW1A 3HLAB 1SYVB 4Q0XL 3WKNA 4GBXC 1P4BL 1HE7A 1XCTB 3CXDL 3O3DB 3MV9A 4MJ4A 3DX6A 4Q7DA 3EYSL 5BJTA 4UOJA 3U9UA 3O6LH 1K4DA 3ESUF 4PREA 3OKYA 1FC1A 1NGYB 1J88A 4XWOC 2VYRE 1CFNB 2YUZA 3F7VB 4ODSL 1Q9WB 1WUNT 3U48A 2WLYA 4HIHB 5HYSG 4QXGL 4BKLB 4Q6IA 5D2NE 4LAQL 4YX2L 3SHSA 1FYTA 1SM3H 1C5CL 3QULB 1K8DA 1RUKH 3T4YB 5DJAA 5JO5A 3T3PF 5CP7B 3G5XB 1X5YA 3EFFB 5JW5A 4JPKH 1IGCH 2ARJB 1J18A 4F9LC 1JWSA 1KJ2A 5DTFA 4Z7UF 3T65B 5JHDD 3DRQB 1AE6H 4GBXA 5JLZB 1EFXA 3BDYH 3MGOA 3PXHA 5F96L 4RZCA 4LLUA 4OLZH 3VRLF 5EPMB 1PBYA 4Y4FD 5IK3A 1YMMD 1TPXC 2BRQA 1KCSL 4FXLA 1IGYA 1MCHA 2ZOLB 1OVZA 4FNLH 4JO4L 4ZQKA 4L9DA 1W2KT 2P44B 4ODUB 4WTWA 3O3UN 5IB3B 4F37K 1JNHB 3OB8A 1MHPL 3P4MB 3NIGE 5E00A 3DV6B 2VLKE 4P2CG 2EXWC 4HZLA 5CEYB 3X12A 1J87A 1W0WB 2B20A 4HS6B 1HSBA 2IH1A 3CVHA 3QDGA 4M03A 3VXUB 1IAOA 5F1SA 3FQNA 4HG4K 4PP2B 2EKSB 4HKBA 4K7PL 3V7MA 2Q6WA 3IDJB 4RNRA 4YHKH 5L2KB 4OIAA 2BNRE 3WFBH 4PJ8B 1W0VA 3VGBA 3ZE0E 2DMBA 3QEUA 1EK3A 5EBGA 3WJLC 4KAQL 2W0LA 4K8RL 1S9VB 2ZSWA 2I9TB 4X83A 3HRPA 1J05A 1CFSB 3V6ZA 5KVEL 5D1QB 4H1LB 1FYHB 1DE4B 4NNPH 1R24A 2ED9A 1KTDB 3BQUD 5J9PB 5FA3B 1IAIL 3JTSA 1G7JB 4XZUA 5H8DA 3MACH 5CMAB 1KLGB 3RTQB 3WJJA 3VXMB 4BELD 5KSBF 5E7BA 4RX4D 4JRXB 4O02L 1SJEB 4QWWD 4WGWB 25C8H 3BN3B 1M4KA 3QUZA 1YC8A 1JYVA 2NY6C 2EC8A 1N5YL 5HGAA 3VD5A 4P49A 3IDIB 5BXFA 1FGNH 1NUGA 3JV0A 2X70A 2DYPB 3RHWK 3CFBB 4OCNC 2ZPKH 3EDKA 2ADIB 1A6VH 1H9VA 3WCYA 5FO9A 2ICES 1UH4A 4IRJA 3KS0H 3AS0A 3IAQA 4OF5A 2A74B 3WNNA 4OZFB 5GGRA 2EYRB 2R2CA 3S97C 3RWJA 1B88A 5JPNB 1P9MC 3B6SB 4WI7A 3CGTA 4GAJH 4JFOB 1MCSA 5GSRB 5E1HB 3S3PA 3AS3A 5EG6C 1KFAH 2GKIA 1ND0A 1LO3H 3U30C 2FB4L 4I9WE 3PE9A 3NCBB 1ZV5A 1WT5C 5L6YL 3BKJL 1QEWA 3QO1A 1BZ7A 5M94B 4JDZA 3SDCB 3P4OA 4OZ4B 3GJEB 4QHMB 1Q0YL 4GS7C 2W9EH 3SDAB 2PTTB 5DJ2A 1INEH 2ZOKB 1KYOJ 3G6DL 3NCYP 5HYSB 1DQLH 2H6PB 3KLHC 5DYOA 4E5XA 4KXZI 2AV7A 5B38A 4PB9H 3QXAB 1H8OA 1MCWM 1NCAL 4WWKA 3ZKMC 5BOPA 5HHPA 3WFEH 1TJHL 2BCKB 3NCJH 4DKEL 4JN1H 4JZOB 2UVEA 4L1HA 1RU9H 3MO1B 2J2ZA 4PJDF 3IJSA 4JFDB 2XV6B 4TVSa 1ZLUK 1L9NA 4DZBA 5MEQB 4KVNH 4MAUH 2Z8RA 3T2NH 1QVOA 3H42L 1WBXA 4NCC1 1QSEE 2XWTB 4JQXC 4OFKA 5DS8B 2J6EL 3U4EA 2QR0A 1OB1A 3F58H 4XHQA 2MHAB 2EDWA 3CJJA 5J0BA 3H7BB 4MJIB 4HPOL 3Q0HA 1J1XH 4JCMA 4NRYB 2MQCA 3ZSSA 1N5AB 3O2VH 4MXVE 3CXHK 2GTZB 3K8MA 1MCOH 2HVKB 5T5FH 5IMLB 3NABL 3N0PB 1LDPH 2QQQA 5EOCJ 5KJRH 2KUTA 1QRNB 4UQ2B 2OJZH 1U8LA 2QKIA 4CN6A 4F8QA 1HHJA 2BSTB 2HKHH 3BI9X 5DK3A 2VDKL 3EOYG 4I9WD 4X0KB 3CSYA 4YXHL 1YECL 4HW6A 3GJFK 2VITA 5FM4A 4N8CH 4IOSD 3B2UD 3LKOB 5LJYH 1OAZH 1TZHA 3OB0K 5ICZA 4BUHA 3ROLB 4ENEC 4PJIA 4UDUA 1RZKC 3IJHA 1I9JH 1T21B 3LQAC 3GIVB 1FNLA 3PUCA 4UOW0 4ZD3H 3KLAB 3LRHA 1M71B 5SWSA 1L0QA 5F7MC 1Z9LA 8FABA 2AK1H 3WFCL 4N1HB 5GRJL 4OSUL 3MR9B 1W72A 3V5KA 5LQBH 3OKKB 4X7TB 3FO2A 4NFBA 2CH8A 2RHEA 1JNNH 4R7DB 1I3GL 1PZUB 2BFVL 4NCDA 4ONGH 4MDIB 4MXQD 4XCCL 3WNPA 1ETZB 4ZFGH 1T5WB 5ECJE 2GJJA 4P2RB 5SWQB 1W8NA 4OBSA 4MLIA 3UPRB 3SBWC 2OL3H 4UAOC 1GGCH 5C0RL 3B9KB 3QP3A 4KV5E 1N6QH 3AM8C 4JR9H 5E8PB 4MX7B 3K80A 1T2XA 3WDHA 3TN0B 5DI8B 4Z18A 2FBJH 4MNGA 4KJWC 3D39B 2BRRL 2WUCH 4QKXB 4RFEA 3CFEA 1IKFL 4U3XA 5E2VL 3PDOB 4L9LC 5FFLA 3D3VD 1L9MA 3CNKA 5T1KA 2B2XH 5ICYB 1U95B 1WBYA 2WP3O 4G8FA 5TJWK 4OFPA 3RRQA 2H3NB 1VGKA 3K4DA 4X7CC 2YSSA 3LN5A 3ULVH 1OQOA 3H8NA 5KANG 4X4XB 5DD0L 1E6OH 3V5HA 3ZYOA 4JN2A 5I71B 1B3JA 4X6CE 3QSKB 4K2UH 4YEEA 5GZND 5TGBA 3QIBC 5C3LD 1LDSA 1P7QD 1HXMB 1YEHL 4LVNB 1J12A 1R5IA 5E1AB 2GSIA 1ZT4A 3U46A 4DQOH 1FVEA 5C0DA 1QFWI 1QLRA 2ADJA 3ZKXB 3UTPE 1CE6A 3TBWA 4DKDC 2IFFL 2OQJB 3S37L 3U4BL 12E8L 3CFIC 4JZJB 2BY2A 1QKZH 4TSCH 5IBUG 5FOJA 1YNKL <