1MNNA

Structure of the sporulation specific transcription factor ndt80 bound to dna
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
303
structure length
290
Chain Sequence
b'VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*CP*AP*AP*AP*AP*AP*C)-3'
publication title Structure of the sporulation-specific transcription factor Ndt80 bound to DNA
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 83
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2002-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 1mnnA00
2EVHA 2EVJA 2EUWA 2EUVA 2EUZA 1MNNA 2EVGA 2EUXA 2EVIA 1MN4A 2EVFA 1M7UA 2ETWA 1M6UA
chains in the Genus database with same CATH superfamily
3VGAC 4IKIA 4J3OG 2QZQA 4YDLC 2Q87A 3W3BA 3I6LE 5HYQB 2WQUA 1UUSA 1NFIA 2VO8A 3EH1A 1OAQH 4I9WE 4A7TA 1OB1B 1FLRL 1FGVH 2OL3L 4XP1H 5EBMB 5CEYA 3TBSA 1ILUA 1BBJA 1I4FA 1D7CA 3GMQB 4UCFA 1BV8A 2VLRB 1CU4H 5AVTB 4ODXA 2K78A 1WBXA 1RK0B 4GOSA 5JR1L 3Q9QA 4X4KA 3SB3A 2N7BA 4CUCA 1ICTA 1QUNA 3MUHL 1NIDA 1M4KA 3JTSB 5DGRA 4MRCA 5E4IA 1OTUC 1KIUB 3QFDA 3L13A 1HIML 1AIFA 4L4VE 4PP2A 5EO0B 5J7CC 3WS6C 2EH8L 4FTVA 4KJYB 5DYOA 4ZFZB 3VI4E 4H5SB 2GT9A 3GI9H 43CAA 1I85C 5C0AA 5JZ7C 1AQDB 3C09C 5I15L 5FGSA 4Y88A 3PF2A 3LKRA 3L5WA 1I82A 1NSNH 1UQSB 3CK0H 3SKOA 4RX4A 1QTYT 2VLJB 3MV01 4ELDA 4PWFA 1QVOB 2I32A 3QZBA 4RAUA 5JOEA 1LTXA 3IWUA 4HIEB 4HUUB 1P53A 3A6BH 5FFGA 3FO0H 3LKNB 3SIKA 1FBIL 2BSEA 1TT6A 1J8RA 1QSEA 1HAUA 3TTYA 3PABB 4LOUD 5I8EB 5EZIH 3HRZB 3HZVA 4R96A 4X6FA 1N8ZB 3ARYA 4GSDL 4K7PH 5BS0B 2X2UA 2E59A 1OT4A 3SODB 4WO4C 2I5YH 1T7YA 4JGNA 1XAUA 4JB9H 1G9NL 3FTXA 3G6DL 5HDBB 5HYQA 3N06B 4U1LB 2QFRA 1EGJH 3OD3A 4OZGF 3GMQA 3ECUA 3WKPA 3QI9D 2VLRA 1T2QL 2WTRB 2MSPA 5L2KD 1WIUA 2OW6A 3EH5B 4LNVA 4TRPH 4P2QB 1RK0A 3EYOB 4XZ4A 1UENA 3QDMB 4QHKI 2NTSP 3JTSA 2BRRH 4G72B 1HL5A 4XPBL 1QACA 1K2DB 4DPBX 1KXQA 5EO0A 5C0CA 4KJYA 2M83A 1KTJA 4ZFZA 5BRZE 4ISVB 4H5SA 1AMYA 1T7ZA 3GT6A 1AQDA 1WEJH 2ITCB 2R69A 3NCJL 5CXPA 3B2VH 3KBEA 1OWWA 3BAWA 3O2DH 4JUTA 1UQSA 3TX4A 3BRDA 1BG9A 1KJ2H 4DK6A 2JB5H 2VLJA 4WKXA 1QVOA 2O5ZL 3HAEA 2DWDB 4HUUA 1HZKA 1GJIA 1ZVSB 4GG6E 3NBNA 1ET8A 3LRKA 1YYMH 2J6EA 5IKCB 3PABA 3LH9A 4FG2A 5I8EA 3A22A 2ZP9A 3MUZ1 3HRZA 1KBGL 2YD6A 4HS8H 1N8ZA 5BS0A 1T89C 2NR6C 3GHBL 5LVEA 1GOGA 1ACYH 3JWOL 1INEH 2WLMA 3IGLA 3VWKC 5EIVA 2Q10A 4OBSA 4WI3A 4D7PA 4YHNB 2H1PH 3MRPB 1A6AB 3BQVA 3RFRA 4PLOB 2FX8L 1Z3RA 2NUPB 5D7EA 5IT2L 2MPAH 2ZX5A 3GWJA 4DP7X 4NNYA 3B5TA 4G6AC 2WTRA 4RFNB 1U8CB 4HWBL 1OGAD 2XG5A 4P2QA 3EYOA 3SDDB 1RZKC 3QDMA 4S1QH 4QHPA 4Y2NA 2FEDD 4E41D 1PW3A 4JO1H 3AMKA 4WEBL 4GG8B 1ZVNA 1CLZL 4HA1A 1T7WA 2AK4E 4MB5A 4UTBH 4ISVA 4AEHL 5FKPA 4C4UA 2A9NH 2G2PA 3N43F 2ARJQ 2ITCA 5F89B 1T03L 5HD8C 3KEDA 4XMXA 2MQCA 2Q6WA 5EF0A 5M7QA 4ZODA 3P3TA 4HZLB 5GISH 3ULVE 2V2WB 1CC3A 2W9EL 4UIKH 2DWDA 1QEWB 3LKSB 3TA3C 2X9WA 3UYRH 2OP4L 3A6CL 2NY0D 4YDNA 1OSYA 2VDMH 4PJIF 1U8PB 4M93B 5HHPB 3HVDA 3AG4B 3OPZL 2YD4A 1YPZB 4WTXA 1N6UA 1TU2B 2E7BA 2K8QA 3LAFA 2KS0A 3QJRB 3VQLA 3WTXA 3L81A 4NZTH 5TDOB 4D9QD 1T1YB 3FUKA 3SZ6A 2BC4B 4C56E 3CIAA 2I25N 4L4VB 3MJ8B 1UXSA 4YHNA 1VCBC 1BM3L 3MRPA 1E4WL 1HXYB 2ZCKH 4IM8A 3ZDXB 2NUPA 3E6HA 1SLVA 1WUNT 5DUMH 3VI4B 3B7YA 3OZKA 3DDFA 3T9WA 1CURA 4HHWA 4IBZA 3HE6C 2A1WL 2Z7WA 1Q1PA 1CE6A 3H9ZA 2D3JA 3HFML 4RGNE 5FA4B 3SDDA 1EO7A 3MBWB 3TH3T 2Q7YA 2N1KA 1B4JL 2UWEB 3ZBMA 4X7CC 2V17L 5FB8B 1MVFA 1EXGA 3LB6C 3POCA 3GSVB 4H8QA 4JVUA 4OF0A 5GS0L 3MLVH 1BYOA 2OQJB 4ZO9A 3V4VL 4LLDB 1ADQH 4S0HA 2FIKA 2ISDA 1EFXD 4N2FA 1S3KL 3CTTA 4GS7C 3D4CA 5F89A 1QPPA 3E3QE 4FQXC 4P2OD 4AQOA 4WWKC 2YAOA 3L5HA 2YBGA 1S7UA 4XVUD 1A4JB 1X7QB 2B8OT 4HZLA 3FTGB 1MJ7L 1HSBB 2V2WA 3ARRA 3FT4B 4ZD3H 3K6SA 1KBKA 2WXHA 4PEEA 5M95B 1QEWA 2XXGA 1PEWA 3V9CA 4JFEA 1I8KA 4H8WL 1IGIH 2NNXA 2ZWNA 1IAIM 1D9KC 4LMQE 1ESOA 1U8PA 2QTVA 5LDSA 3LQZB 1YPZA 5CGMA 1TU2A 2AANA 1HINH 4IOSD 4PGBB 4GLRH 1LYQA 2D31B 5TDOA 1T1YA 4TNEA 2BC4A 1CR9H 2AJ3B 2VDLB 2OYMA 3MJ8A 3S96A 2HLEB 2R0ZH 1HXYA 5DRZA 3MRLA 3QCUH 5DVMA 4D9RE 3L9EA 4L9LC 4KBPA 4EZLA 1WWCA 2APVA 1ZANH 2BWDA 2WOBA 4NQDA 4YVNA 2J8OA 5I0YA 4FG4A 3PV6B 3HB3D 5FA4A 2IANE 4L1BA 2X44D 3MBWA 4FQXB 1RZJL 2UWEA 4HSCX 4Z7QF 4YS4A 5FB8A 3CXDL 3DNKA 3L3OA 1J1PL 2AAVA 5HJBA 4TTGA 4GG6B 1FL6B 2OQJA 3HNSH 3LVTA 4PQXA 3QZWG 4W9FC 5JW4Q 1P84J 4NKIL 3AQXA 4OGZA 3OAWA 3P02A 2YXMA 1D9KB 3VGBA 5L8KB 1A4BA 1FFNB 4RH4A 5GPRA 1HYRC 4W9LC 3W9DA 3AWGA 1IAMA 4JDVB 4YXLL 3I02B 3ULVC 1A7QL 1IGML 1U8OB 1X7QA 2LABA 2PP8A 2XICA 4FKHA 4K23L 3ZTNL 3FTGA 3NGBC 2OJZL 1HSBA 1PKQB 3FT4A 4L4TD 2CK2A 4WTZA 1PSKH 4JANB 4J4PD 2NY7H 4XPTH 2F18A 3I9GH 4MA7L 3KWVA 4TSBH 2F54B 5EOQH 4Z6AT 1OF2A 4ZMQA 1T7VA 4PRHD 3RJQB 4Z7OF 4CJ0A 3CDCA 3IMBA 3H7LA 4WZ9A 2FB4L 3LQZA 2BXYA 3BP6B 3DBSA 3DOHA 5EZOH 2OXHB 4X6BB 1G0DA 1KCBA 1H6FA 3J8F7 4UBDC 1IQWH 1R5VB 2CU9A 3Q6GL 4N2DA 2ENYA 1C9SA 4LLYB 4OGQC 5K93A 1SQMA 3EFDH 1EHNA 4ZS7L 2V3FA 1DO5A 5C0EB 1FAIH 3IE4A 4RGNC 2J73A 3ETTA 1MFMA 2IC2A 2J88H 1HE8A 3PV6A 4UOW0 2OV0A 3EBHA 3NPSC 1KGYE 2HRGA 1I31A 1LO5B 4QGYA 1CGSH 2A83B 2CJUH 4Z7UE 4BWUA 4NQXB 4PY7A 1NZRA 2BPBA 4HMCA 5E2TL 4XPHH 5FK9B 2CE6A 5AEAA 4F7CB 5TF1L 4HCIA 3VYNA 4NDMB 1KGIA 3DVGA 1FL6A 3MOAL 3KPTA 3V7MA 2IGFL 1CFBA 1E40A 1P7BA 4XGZB 3R4RA 3E3QC 4AYMC 1FFNA 3ATAA 4DTGH 2X2HA 4J3VA 4G7YH 2YGVA 4JDVA 2OW7A 1DP0A 4PRPB 1YQVL 4U6XB 3RWCB 1PKQA 2H3NB 4QRRE 3KE0A 4JANA 3FULA 3NK3A 2CPCA 2GSGB 3Q0HA 3VFWA 4H0IA 2F54A 3WE1A 3LS5H 1J8HD 4OJFL 4JVPA 5SV3A 3EYUH 4Y1SA 3IJSB 5F9OH 1CLOL 4FQJL 2AC0A 4WSJA 4LPCA 2CM5A 3QHZH 3WLBB 2CNZA 3DRQB 3BP6A 1PLAA 1ZSDB 3WGVB 3JVGC 2ZKYA 4LXFA 3B9DA 3HE7A 2OXHA 1F2QA 3HS0C 1NLBH 1Y6NR 4M6OH 4QXVA 3NPSB 4X6BA 5AVSB 3T0EB 1HWHB 1R5VA 2B14A 2R4SL 5T3ZL 5CCGE 4M6MH 3LIUA 1Y18B 4LLYA 3IDYC 4WI7A 3FOMB 4R83A 4BZ1L 1R47A 2JB6B 4O4YL 1CU4L 2LU3A 2BFVL 3BKCL 3VSUA 4XXCC 1JK9B 2EDOA 2O1AA 4NC0B 2O5YH 5CJQL 2V5YA 5KW9L 4HCRA 2WV3A 2A83A 1N2RB 1ZAGA 4NQXA 1TFPA 2IWFA 5IMKB 3UEZA 4HF5L 2BZDA 1N18A 1QKZH 4QY8B 1F11B 4Y4KB 4AL8C 4WW2B 1TG8A 4F7CA 4NDMA 2P5WA 1TDQA 4AITA 2BP0B 1GW6A 3BT2L 3GI9L 1F3RB 1QSFB 1KJMA 5DQJB 4OB5L 3ESOA 4XGZA 1HESA 1P4BH 1Q90A 1YY9D 4M8UA 4FOMA 4XBEH 1B4TA 3VNYA 4OZIE 3TV8A 3TYGL 3CK0L 3WFCL 2EILB 4JFSA 5ALCH 2OMXB 4PRPA 3D34A 2ZP8A 3NCYP 1H3PH 1AXTH 2H3NA 4HWBA 2ARJB 3EJTA 4N2IA 5D4IA 5DZNA 4QOKE 1UJ3B 2GSGA 3BP7A 2VQTA 1FZKB 3EYFB 2WXNA 4I48B 3MLSH 1NCNA 1H9DA 3IDYB 3CX5K 5B3JF 3FT0A 3K8MA 3IJSA 3CJJA 1DVFD 3G5YB 3ZIMA 1CYGA 5G4MA 4K7PL 3ZYJA 4ATWA 1DCEA 3T4AB 2IVFC 3I9AA 9PCYA 1PG7L 1ZSDA 5D93B 4L8SC 4ABVA 2D2OA 3V4VB 3T0EA 1IFHH 4PG2C 2JKLA 1KYDA 4U3SB 3M1BA 4K07A 4K5MA 3ILPA 1WFIA 4KK5D 2O72A 1GY1A 2K9FB 2JB6A 2J8HA 5GRUH 3MYJA 3HBGA 4LPVA 4HX1B 1HK6A 3VGGA 1JK9A 2BVYA 1WFNA 4RRPM 2Z8WC 3KJ4C 1BMGA 2A0LC 3FB7B 4GUPB 4C4KO 4OM1H 5G5DA 1O6VA 5DWUL 5C0DB 2G30A 4Y4KA 4QY8A 1F11A 2EDKA 2ATPB 4WW2A 4OF8A 3NG5A 3ZL4L 4YJZL 4JZJB 1JBJA 4YSPA 5F7YC 4BINA 1QSFA 4EZKA 1CE1L 1S7TB 5DQJA 1MUJB 2W91A 5JOFB 1CS6A 4XN7A 2OK0L 2XC8A 5I6XC 1YY8A 4XHJC 1NUDA 5D4QA 4BHUI 3S48A 1KJ2L 2AW2A 1TMQA 2RHEA 4H7VA 5FLUA 4OI7A 1D6VH 1JZDC 2OMXA 3ZKMD 2ICWJ 4L8SB 4RA3A 2C9XA 1YLBB 3CFUA 3HUJF 1SXAA 2RQ8A 3BMVA 1DN0A 1UJ3A 4FA8A 4PMEA 5LBVA 4I48A 2FEEI 1TQUA 1AY1H 4BJLA 2C5DC 1NJ9B 4HS8L 5C9JB 3MBXL 1ACZA 3G5YA 3TC9A 1NFDF 4NZRH 1J88A 2O5NA 3BZDA 3T4AA 4DK5A 1ACYL 1HEZB 4Z0BH 2HFEB 4YHMH 4XNYL 4F27A 1MH5A 2IBZY 4NENB 3FSVA 2X7LB 3V4VA 2H1PL 4MA3B 3WL9B 1HEJC 4UF7C 3KH3A 3QWQB 1ZV9A 4X6EB 4PJ8C 4U3SA 5HPOA 2MPAL 3WTVA 4W6WB 2JTDA 2GHWB 4YDJB 1I75A 4X2UA 4KTEL 4BM7A 5AVZB 1BD2D 4KKLC 1J0YA 2G4EA 4S1SL 5K9QI 2VOTA 5L2KE 3FTVA 4HX1A 1GC1H 4YDZA 1UD8A 4A2GA 5FM5O 3K2IA 2EIBA 2IQ9L 4YEEA 4IBYA 5EWIH 3FTWA 3FB7A 5I6XB 5JQHC 5KSAC 1X5ZA 1C5DA 2X9XA 3EIFA 5C0DA 3W0WB 3FB8B 1M7XA 1OTTC 2ATPA 4FCAA 4JMXA 4RMBA 3UJIH 1BQHA 3AGVA 3GRWA 4JZJA 4L5FE 4J3OF 2LAGB 1S7TA 1KELH 1A3RH 1MUJA 5JOFA 1U8HB 5EPMB 2CBOA 1WPCA 3CHPA 1YJDL 3DETD 2HFTA 1WFTA 4YHOH 2HKHH 4W9CC 4KRMB 1F97A 1L3NA 3NMEA 3QUGA 5GISL 4OIIL 3SGEI 3CD4A 2HZHA 2Y7QB 1K3ZA 4UIKL 3UH8A 4L8SA 2LHAA 2AZAA 4KY2A 3TXAA 1OK0A 3OKNB 1WAPA 2IV8A 2A77L 4ODVH 4NJ9H 1PS3A 2DMBA 5LO7A 4LKCB 1NJ9A 2FECI 3MLXL 4PB0H 3GXPA 4U05A 5C9JA 5JW5B 3SQRA 4BFBD 4P3WA 1RIUH 2CBPA 3L3GB 1AI1H 2XWBA 4NZTL 3ZMRA 2HFEA 2DM2A 4IKKA 1N7MH 4M8RA 2WBWB 3V52H 3ULUD 1JGEB 2P8LB 3PPSA 1E8YA 2X7LA 4I3SH 3RKDD 3VFPA 3WL9A 5KSAB 1AGDB 4X6EA 1RU9L 1PL3A 4OGYL 4Z7IA 4L9DA 3PWVB 4X9HA 1UURA 5I19L 1MXDA 4CVZB 5LNGA 2DKUA 1RIVH 2TSBA 3OBAA 2YLHA 4X98B 5LQBH 5KOVC 1AZBA 4NRYA 4OBRA 1NC2D 5JDSA 1OGAE 1JS4A 2X0VA 4XNXH 1R0AL 2NW3A 1MVYA 4K8RH 3Q5OA 1CLCA 3QIUB 3D0VB 4JS7A 5HDRA 3X11A 1DEEB 3V4PB 3W0WA 4E41E 3FB8A 4KVPA 2GFBB 5L7XL 3MLVL 3FTUA 1G9EA 2XY1A 3O3DB 4LIQL 1NDGB 2UXVA 2FUTA 2X41A 5DT1L 2YXFA 1ADQL 1JI1A 1U8HA 4MA1C 5EPMA 1SHSA 1C16B 5CN3A 3KYKH 3CFIC 2PYED 4GXVH 5ITFB 2J5LB 4XHQA 5C1MB 2YD9A 3SHSA 5GIRB 2H3KA 5F7BA 1Q72H 5ESQB 1JGVH 4P57B 4FG0A 3MRBB 5AW0B 4LEEA 4TS6A 2AEQL 3ARGB 4WEEA 1BAGA 3TZVB 5KN5B 1IGIL 1R3KB 4LOUC 3WEXB 5DCCA 1G9HA 1KCSL 2DQIL 1KPVB 4LKCA 1BIIB 5JW5A 5T1JA 5BUPA 1X7SA 2Z6FA 4YHYB 4BFKA 2C1OB 2AGJH 1MJUH 1HINL 3L3GA 3KGUA 1ERNA 5IJDC 1H8SA 1CR9L 1JGEA 1TCMA 2P8LA 1SRDA 3NSJA 3NCBB 3QFGA 4D9QE 4PJCB 2G5RA 3TCXA 1E43A 1AGDA 1AHKA 3QCUL 4XMWA 3V0VB 3P0VL 3NSYA 2KQMA 4X7SL 1KB5L 2HA1A 3L7FB 3HOGA 3QI9C 4CVZA 4WJ5B 2O6FA 1RJYB 1JNLL 4KPHH 4PUBH 4UQIM 4K3JL 3MV8B 1UT2A 3MXVH 4FP8H 4XVJH 4FNRA 2AXHA 3QIUA 3D0VA 1KXHA 4GI8A 2R29L 3V4PA 1GYVA 2GFBA 4P2AA 3T65B 2PWFA 3MLWH 4W1TA 3V4LA 4OJDH 3O3DA 4TUUA 1NDGA 2ZSVB 4ZPTB 5AOIA 5FEBA 1RJLB 3QULB 4D9LH 1FO0B 2FE0A 1C16A 1MFBH 1KLUB 1B2WH 2DLHA 1IC4H 2TRHA 2ZWKA 3D48R 4FULA 5F7DB 4FXGC 1JMZA 3S35H 4EVNB 5ITFA 3KMDA 4NI3A 4Q9CA 4BZ1A 1XMEB 5GIRA 5KSUB 2AXJA 4GQ9H 3LRMA 3WBDA 5ESQA 3TO2A 2QFPA 3VFVB 3MRBA 2NY7L 5EUOB 3CZUB 3B1TA 3ARGA 3TZVA 1C8PA 1R3KA 3WEXA 2BSTB 1TVBB 2F58H 2IWKA 4JM0A 4RFOH 2A74B 1BIIA 2PF6A 3ZK0A 5L2KB 5IQLA 4HWUA 3MJ9H 1OAYH 5EZOL 4N8CH 3NA9L 3WY2A 5JIQA 3C8HA 3VG9C 3S37X 1IQWL 1XL6A 1QEXA 4TLKA 1EJ8A 1PZCA 4PJCA 4ZX3A 3DSFH 1TTFA 1X3DA 2L4OA 4FFVD 3V0VA 5DHVB 3JV6B 5IR1B 4HALA 4Y4HA 1U8MB 1YNTF 2X88A 1Z5LA 4XPAL 5ABDE 3PXHA 4BZ2L 1RJYA 3MV8A 2DBJA 3MXWH 4PRID 3CPLA 5GJSH 5JQ6L 4FXGB 1CGSL 2CJUL 4JL1A 5EN2B 2FEDC 3GM0A 4AEIH 4D0CB 4JUSA 4XPHL 2BNRD 5CP7A 4XN4A 2M2DA 1PX8A 3PJNA 1QMUA 4DKEH 2DJSA 2X53A 2Z7ZA 2XZAH 2ZSVA 3BVWA 4Y5XC 1YEDB 4FLQA 4A37A 1RJLA 2SEBA 3FONB 3QULA 1CQKA 3ML8A 3BIAX 4KVNH 1KLUA 5EBWB 4NM4L 2WQAA 4DTGL 3WIIH 1QABA 3VTAA 4P04A 1UWYA 3KXFE 2EVJA 5I5RA 3C2SA 1MIMH 5KSUA 3NP3A 1DN2A 3UBXI 3VG9B 1QP1A 3E1ZA 5DJCB 4HFUL 4PJEB 3VFVA 3WMQA 4L4TE 1KCWA 4PVMA 4V33A 5EUOA 3N0AA 2DQJH 4GW1B 1FFRA 3H54A 4XC3H 1OT2A 3L4VA 3WY3A 2GC7C 3K91A 4Q8BA 1T6BX 2NY0C 3E2HC 2BSTA 1TVBA 3EYUL 5IJKA 2BVPB 1AMXA 4PRHE 2A74A 4XN9A 1YUHA 3BKJH 3QHZL 3M7FB 4ZQKB 1LO2L 3MRRB 5B1JA 4NBZB 1MCPH 4M6OL 1A1NB 1ML0A 4XBMA 1I7ZA 1P6AB 4CGTA 4L48A 1NOAA 3US9A 4E41B 3WY4A 3IDUA 2Q8AH 4M6ML 3JV6A 3NZUA 1U3ZA 3GDCA 5IR1A 1U8MA 1DJWA 1BPLB 4OLWL 1EQWA 3CHOA 4JFOB 3IJHA 5TH2B 1OB0A 3WEAA 3ECWA 1N64L 1JZ8A 1FP5A 5E9DB 4AQZA 2DV6A 5EN2A 1WTLA 4PJXA 2LU7A 1PBYA 4R7XA 4D0CA 1IM9D 4OKDA 4AQAB 5CR8A 3BPOC 3EW3B 2K6WA 4MYPA 1OAXL 3RQ3A 1YEDA 4X0KB 3MODH 1P4BL 2GTZB 2GUYA 2K6ZA 3FONA 3HPLB 4J3SA 3ABLB 4L8BB 2NY0B 3E2HB 1S9XA 4P2OC 4LT7A 5EBWA 4KOCA 2YUZA 4ZNEA 4MQSB 4AE1A 3DJTA 3QPKA 2EEDA 2WGXA 1L9QA 1RCYA 4IRSA 2DWXA 5IBUG 4G8GE 4HPYH 1F0LA 2K4AA 4R5VA 5DJCA 4PJEA 3CHXA 5KYWA 2BVUA 3K6OA 2Y2WA 2P8PB 4PSRA 4HG4K 4Z7NE 1D5BB 5JORB 5E8DL 2JK5B 3PU7A 4LF3A 5BV7H 3F6JA 5I23A 2OSLB 1J8HE 1C1EH 3KYOB 2HFFB 3MRFB 1JZ2A 2PCFB 1HILB 2WBJD 1C12A 4HEME 4I4WB 4KKBD 3UC0H 4JHUA 1CZ8L 3QUYB 4ZQKA 3T0BA 1QA9B 2DBLL 1SHXA 3SO3C 4WU5B 1O7DE 5EEZA 4Y9BA 2ZZUT 1A1NA 2A4ZA 3ETBJ 4R4BB 1NL0L 4AVJA 4KRNA 1U2CA 1GZHA 3KPQB 1QWUA 1YEJL 2EXTA 5C09B 1KC5H 3GTVA 5DXWA 3TT1L 3U83A 4MD0B 5GRUL 3PS6A 1B88A 4OZFH 3N44F 4P05A 4DVBB 5C0RL 5IREA 4JFOA 1OE1A 2FHBA 2Z64C 5TH2A 1R19A 4JFQB 1Y1DA 2VR8A 4JHBA 4QYOB 3HB3C 2CO1A 1NINA 1JV5A 4S0TD 4P2OB 1G6RL 5E9DA 1E8ZA 5FM8A 4WF7A 2ED8A 1E9QB 4MKMA 1AOHA 2V5SA 4ZAKB 4AQAA 4QRAA 2B77A 4ZXBD 4J7RA 1EDHA 3GXNA 1URIA 3MI6A 4XCFL 2BRQA 1XSJA 1EO8H 2F8IA 1BHGA 2I9LA 4X0KA 4L8BA 3HPLA 4LCYA 4YSUA 3K6IA 5IQOA 4NKOB 5E99H 1CBVL 1QOKA 1U36A 2YK1H 4ONHB 3IAPA 1QFWH 3FTSA 4IW4C 1VFBB 3SO3B 2ZONA 4J4PC 3HI1B 4EI6B 1Q9LB 5EZLB 5H2BB 5H37H 4TUJB 2P8PA 2P24B 1D5BA 3P11H 1DHKA 5JORA 2JK5A 1T5WB 4OQTH 1N67A 2OSLA 3MRFA 4OD1L 3T8VA 3H6AA 3QISA 4NZRL 1YSOA 1YEFH 1QYGH 4MBRA 3QUYA 3P9LA 5FOJA 4EJ1C 2ZOTA 2EXWD 4WU5A 3OXSB 4K5PA 5KYYB 3D8MA 5B7FA 5I8OL 4R4BA 1SEBB 3KPQA 3FUIA 4AJYV 4N6QA 2XQBH 4KDWA 5IJKC 5DJDB 1D5XB 5C09A 2BS71 4U1MB 1NTDA 4MD0A 1BBDL 4JR9H 4YE4H 4DVBA 4K55A 5I5IA 4WK2B 2PWDA 4JFQA 4N26A 1LDSA 4G80B 3NAAH 1X5YA 4HLJA 4FFYL 1HKLL 1FVDA 3VD9A 1YVLA 4NQCD 4F8NA 1TNNA 1T83C 4ZAKA 3QWRA 1BJ1H 3MUGB 1Q94A 4L4TB 4D7BA 2B15A 4QRUB 1WFMA 4AEFA 1ZHNB 5DEGB 4LCCC 2WO4A 3GXFA 1KG0B 3GDBA 1NH6A 1JL8A 3SGKA 5GS0D 4TV3A 4AVIA 1DJZA 1KYOJ 1GJUA 4NKOA 2DJ4A 2ADGB 4L8DB 1UM6L 4FXKB 4O02B 4ONHA 2FR4A 4LRNL 1KB5A 1VFBA 1H8LA 2J1ZA 2FAUA 2UZIH 3DIDA 4EI6A 1Q9LA 3OZLA 4JO2L 4F20A 4QJ4B 1AZCA 1EEQA 3VI3A 2P24A 4JVWA 4LHUD 4ODVL 1XBDA 2AERT 5FX3A 4GNKB 1T5WA 1QSZA 1WD8A 1WD9A 4OUUA 3PFUA 2R29A 4XVSH 4F8LA 5FDWB 4RISH 1O7DC 1KEMH 1OARL 2CGRL 3AG3B 3V52L 4GMTH 2J8UB 4HETA 4GAJL 2RIKA 3OXSA 5C0FB 4PW3A 3LEYL 4I3SL 1ZOXA 3O6FD 3RIFF 5KYYA 2NTFB 3WO3B 2DQHL 4FQPA 2ARWA 1SEBA 1BLNA 1T2JA 2ENJA 1OOWA 1N70A 3NIDF 3BGMB 3QJXA 5DJDA 1D5XA 4QTIH 2Y0SA 1BEYH 4U1MA 1RIVL 3RTQB 2WNXA 3QC6X 3HC3L 1BD2E 2FJHA 4IK7A 3RE0A 1IKNC 4ADIA 4G80A 3A4EA 2NY5L 2QGCA 1I7TB 2LE9A 1IM3D 1ASPA 4H4NA 5FGRA 2VLKB 4B7LA 3MLRL 1Z0NA 1BVZA 4G8FB 2DQCL 1HI6B 5KVDL 3QEHB 2HVBA 5GRJH 4QRUA 3SDXB 1ZHNA 4GAGL 4PFEA 1KG0A 1YY9C 3VGEA 5ILTL 1M05A 4RNRB 1G7MB 2ADGA 1KLFB 3PAYA 2Z31B 1UWGH 3QGVA 4FXKA 5I74C 3BCDA 3O8XD 3PLYA 1RZGA 3AADB 4UV4H 4BZ2A 2WVUA 3M86A 2QSCH 4FQIL 4Q97A 4K73A 3GJFH 3U2JA 2X4QB 1N0XL 2DQTH 3UMTA 2NYKA 2WC7A 5D5MF 1DVFC 4QRBA 4O2CB 4L2YA 5KVFE 3UTTB 1XVSA 2G5BB 4PJ7E 1MJUL 3UZQA 4OLXL 1KN2L 5EO1B 2DWEB 1A1MB 3CZNA 2J8UA 2WXKA 3ULUE 4IS6B 1M2VA 1QLEL 3UAEA 2BIQA 3JBG7 5C0FA 5I1KH 1M56B 2NTFA 2H47C 2B59B 3WFHB 4ZMTA 2EE6A 3H3BC 4LSTL 4KK5C 3FFDA 4NQVA 2DLEA 5AAWC 3WTWA 3RTQA 4ABWA 4PUBL 2V3DA 3MXVL 4FP8L 1OKEA 3BUPA 4M7KL 2XXMB 4XNZB 1I7TA 5FA3B 2G2RB 5CJBA 2VLKA 3OSVA 4U1IA 1GMIA 2JMRA 2VL5B 3PWNB 1N4XL 2CO3A 1HI6A 1BOYA 1WAAA 3QEHA 3SDXA 4WHYH 3SY0B 2JKNA 5FGBA 4QXGH 3TEZA 2ZAIA 3S35L 1G7MA 3HR5A 4YSEA 1KLFA 3L5JA 2Z31A 5JDJA 5KS9A 2PYEE 4GQ9L 4YGAB 3ZZSA 3ZKMC 2VMEA 3C5XA 3QUHA 4CC4A 2L7UA 4OLZL 3HZMB 4FQ2H 5LCVA 3GRBA 4GAYB 4ZO6A 5H4YA 3KNBB 1T1XB 4EE2A 3WFEH 5AVRB 3V0EA 2VH5H 4PJFE 4O2CA 3UTTA 3MJ9L 1GOHA 2G5BA 3NN8B 5F0MB 1UH3A 5CP3H 1DVUA 4N8UA 1ZSHA 2W0FA 4IS6A 3MLYH 4GRWB 3TL5A 2Z1KA 1W6LA 2B59A 1T80A 3OPUA 1PU0A 1PNCA 5GRWA 1L9TA 1RAMA 1JRHH 1M71B 4OLEA 4ZOBA 1MLBB 1DDHB 5AUMB 1VDGA 3VYPA 5IFAL 3OR6B 3TVMD 3CE1A 2BJMH 4IDLA 2FQDA 4UM8A 4AEIL 5ACMA 3ULSB 2O26U 4ZOCA 5FA3A 1A7NL 2G2RA 3MO1B 2VL5A 3PWNA 2ZKWA 1A1OB 2XZAL 2R4RH 3B7SA 1RFDH 1Q1JH 2WVSA 4M7LH 3SY0A 1WHPA 4JRFA 2VJXA 3GPEA 2V5TA 4HDIB 4ZMAT 4KVNL 3JWNE 4U1JB 3DETC 3WIIL 4DEWA 4FLHA 2Z0BA 2Q2EB 5JW3H 3GXMA 4G59C 1HX0A 3QRFM 4DGVH 2DB8A 4LNRB 4YFLF 1MHPH 5I73C 1CN4A 4WKZA 3HZMA 1WUZA 2J12B 4JHWH 2AK1H 5EO9A 4ZTOH 4APQB 5DURD 1L0YA 2LOEA 3MUUA 3BEVB 4KUZL 1G7JA 3NSXA 2V9UA 3KNBA 4CDGC 1T1XA 1DJIA 4BEIA 4PTTB 5C7ZA 1KBVA 3TH4T 3NN8A 1GPOL 5I16B 2NY1D 4WUKH 3JQOB 4JPWH 2LFEA 4UM9B 5C8JB 3RKDC 4GLRI 1E5AA 4C58B 3WDIA 1CL7H 3SPVB 1MZZA 2EDNA 3BGFC 3JZYA 3AWFA 2PABA 1M71A 1Z9NA 3VFOB 1MLBA 1DDHA 4KOBA 1IJ9A 4GBXA 5HDOA 5AUMA 3ZQ9A 4LARL 4MS6A 4MNQD 4PWEA 3ROOB 3OR6A 1MRCH 1A6UL 3ZE1B 4FABH 4JO5A 1S5IH 2IG2L 3IGKA 4WJG3 4PRIE 1D6EB 4P46D 2XNAB 2QSTA 4O9HL 3ULSA 4AQ1A 1Z3GH 4NT6B 5LUMA 2BNRE 2KQNA 1ZT1B 3MO1A 5I73B 1AIZA 3JWNG 4PJDB 1HCFX 2X40A 4AK2A 1WRFA 3EOAB 2EJ1A 1X4XA 2AAAA 1L6XA 1CXKA 4P9HL 3X12B 4ZMNA 2AMUA 4AW7A 3H3KA 1GAFH 5IHUH 3OMNB 3U1PA 4PIBA 4LNRA 3FSAA 3FC8A 2WTPA 3AROA 2K4WA 5JW4N 4Y2OB 3BJLA 1HTYA 1FG9C 3MCG1 3KWXA 4APQA 4RSVA 2Z91B 3BEVA 2WZ0A 1XZWA 5T5FH 1Q9WB 2WZ6A 3S5ZA 1G5AA 3K2MC 3RGVB 3QQ9D 1L0QA 3D85B 4PTTA 3UC0L 4X6CA 2C9SA 4JFFD 4U31A 4XP4H 5DO2D 5TE6H 3NIGF 3VRLE 3WD5L 3D1MC 4J3OH 5EDSA 3BC9A 1P7HL 4FJ6A 2YC1A 4FI6A 4UM9A 3W5NA 4YHKH 1DQIA 3BUYA 2GIXA 2IMNA 3CN1A 1IBBA 1U3HD 3R8QA 3QDJD 3SPVA 3IN0A 1UA3A 3CFMA 1KC5L 3NJIA 4KNQA 1PY4A 3SOBH 3VFOA 4NUPA 1E5ZA 5IHWA 5FO9B 4NOBA 4UQ2B 3ROOA 4XNDA 1JZ4A 4PWJA 5CHNB 2MNWA 2D8KA 3B2MA 4IDJL 4WAFA 4I13B 1D6EA 2XNAA 5F7LB 5IEKB 4NT6A 1A4AA 3I2CH 2P5ED 4FLRA 1J5OL 4GI9A 4PJDA 3RVTD 1T5XB 4FGMA 1EO8L 5HGGS 3EOAA 3JWNC 4H20H 2VDRL 5CF3A 1IGYA 3X12A 3WJJC 3QJSB 2ZKMX 3MV7A 1QFWL 1QW9A 2OMUB 2VDKB 2Y1YA 2CLRB 5GZOD 4HJEA 4S2SB 3D05A 1OXYA 4F7PB 1M7DB 1ZMYA 5IHBA 4URTB 3CFKB 4KXBA 1O9ZA 1PZ5B 2Z91A 2WXOA 4K7PY 4XH2B 2YAPA 3QHTC 4OQTL 5SWQB 1J0KA 1Q9WA 2XVLA 2EAEA 3RGVA 1DFBL 1YEFL 4OF7A 1QYGL 3D85A 2PTVA 3NK4A 4ZRGA 3RNKA 3VD1A 1NGYB 3W81A 4OFKA 3BAEL 3L54A 4JFWA 3U9UA 4FFVC 5TE7H 5KSBA 2UXFA 4GKLA 2Q0ZX 3IDGB 3NTCH 2NY3D 4ZUVB 4B96A 1OP9A 5FO9A 4HKJB 1RUPL 4PJHB 4UQ2A 3DKHA 2JCCF 4NZFA 1MRDH 2FT8A 4HP5A 1VGKB 3NAAL 3PWPD 4KO9A 4CN6A 1DEDA 3ESPA 4MD4B 2VAAB 5IEKA 3ZOAA 2YWYA 1DJGA 2W5PA 4DGYH 5I75C 4MHHI 1TITA 1T5XA 4BYHA 3DHJA 4PWHA 4ZJ9A 1Z9MA 4YDIL 3WSQH 2FZ3A 3S8WA 5DJ6B 4FN0A 3X13B 4KQ3L 1GSKA 3A3YB 1JHKL 4JCMA 1JXFA 1M6UA 4M6NH 2Q8BH 3MUJA 3LH2H 2OMUA 1OO2A 2CLRA 5IHZB 1N59B 4S2SA 5EF1A 1MI5D 2UZIL 4F7PA 1W91A 1M7DA 3PP4L 5FUZL 3CFKA 3MUY1 2KUTA 3DYOA 1PZ5A 3REVB 5IM7B 4NAMA 3DX9A 2WKGA 4XH2A 1F1DA 5SWQA 1EWHA 1W6WA 4HOWA 2XZCH 2Z0UA 4JPSA 2ZNWA 3SEPA 1X5LA 3SBQA 2R8SH 1ZT7B 1A6ZB 4YZFE 4RISL 1H6TA 1A0QH 1IZJA 3TJEL 2XQYG 3MLZH 1JTOA 5J6SA 3K5RA 5FO2A 1NGYA 5C6TH 4F2MB 3E8UL 2KBGA 4C57C 5KANG 3ZX1A 1ID2A 1L9PA 3RB7A 2IDCA 3ATDA 1DSFH 1RLBA 3HG4A 4ZFFB 1CVSC 4ZUVA 1LWJA 4PJHA 3ARDB 4YL9A 3OAZH 5E0QA 5EG6C 1D7FA 4U1GC 2EDJA 1A7RL 1VGKA 4PGZA 2RFXB 3H9SD 2XN9D 2Y06L 5C08D 2CUAA 3EO0B 1A9VA 1JUFB 3K0WA 3D39E 3C6LA 4L37B 2VAAA 4MD4A 1UASA 5LGYA 1LEGB 4CVWA 3QSKB 4NQCE 5F9DC 1OCOB 2PN5A 5T1LA 4BHUA 4YSSA 5GRJL 2EVGA 1ZLEA 1J1XH 2EIEA 3CMOL 4GY4A 4TNWK 4WGKA 5C0BD 4F58L 4GMSL 2WZ5A 1V7ML 2YD0A 4POZD 3G6AB 1KTDB 3SD2A 3UG4A 3ML9A 4BXSV 5IB3B 3RHWK 4JDZB 1HDMB 1FVCA 5J1TC 3BZ5A 3V9EA 3VO0A 4B97A 2BH0A 1MPAH 4B9YA 4X6DF 1N59A 5DMJB 3CG8A 3MRIA 3KS0J 2QSCL 1DUYB 2LLNA 1PJ9A 3BZFB 1BVOA 3L45A 3REVA 5IM7A 4JL2A 1SN0A 1I53A 3QB7C 4DP8X 3JUYA 3LEXA 2WBJC 1MCDA 3PFQA 4RMRA 2ZUQC 4KKBC 4JGJA 5L0QB 3GGWB 1JNHB 1NAKH 2AJYL 2D03H 2VLLB 4U1GB 1SJMA 2Z92B 5I1KL 1SVBA 3HC0B 4F2MA 5F9WC 3FB6B 1IM9B 3IU4L 3T8XB 5FLVA 4X4XB 1VFAA 2XHNA 4X50A 1KCVH 3AM8A 4L3CB 4OCNC 1PG7W 2QBWA 4X5PA 4Z7NF 5C9KA 4H1LA 5FV1L 4ZFFA 2H45A 2I7OA 2QPEB 4U4BA 4A7VA 4CILA 5CLYA 3HLAB 4MA8H 4MJ5B 3X2QB 1T1ZB 2Z7YA 2IFFL 3ARDA 3HZYB 1AOZA 1V7NH 3TBWB 3BPNC 3KPLB 2RFXA 2Q3AA 2VDNB 4N2KA 2ZG3A 4YLBA 3ELQA 4HXAH 3IXAB 5SWSD 5CLWA 3UIZA 1OL0A 1JUFA 3ORJA 4L37A 4FQHB 5J8OA 2ESVD 4ZXBC 3WCYA 3ECQA 2A9BA 3EJRA 3QXDB 1E9OB 1WITA 5FAAA 4EUPH 2XYCA 3G6AA 4I77H 3GQFA 5IB3A 1UYWH 4X5WB 2B3IA 1LD9B 4JDZA 1ET5A 1HDMA 3WEMA 2WBJB 2DIJA 3ILDA 3MNWB 3HW7A 7PCYA 2MOGA 5HGHB 4FMVA 3DLQR 3FRUB 3UBXG 3ZDZB 2X6VA 4FQ2L 2Q20A 2CLZB 3WAKA 1DUYA 1JWUB 2YAHA 2BZ7A 4HQQH 5F9WB 3BZFA 1BZ7A 2DS4A 3FTZA 1JXGA 3FNKA 5DEFB 1AE6H 3NOIA 1AC0A 3BUIA 4KZDH 4O2FB 5G55A 2EXWC 1VENA 4JKKA 1JNHA 3TWCH 4G8IA 2XWRA 1J5CA 5IGXL 3BPNB 3RJOA 2Z92A 1G6VK 4OT1H 1YN7A 1SDYA 3FB6A 1MFNA 5AG9A 3T8XA 2DMCA 1UZGA 4X4XA 5CGYD 3CXHJ 4XBPB 1TJIH 3P69A 4MJ5A 3A4DA 1T1ZA 3LZLA 3D4ZA 3HZYA 1WZKA 4ZMPA 3FBQA 3TBWA 5IV2B 1P84K 3KPLA 3N2JA 4K7FB 1X5HA 3KDPB 2VERA 5D1XD 2I26N 2E9JA 5F8QC 5JYLA 4LKXB 5MP6L 4FQHA 1CDGA 2NYYD 5A2IH 4WGWB 1A9BB 3ABKB 2R56H 4AUYA 2D3VA 3A6OA 1RFDL 2A6KA 2Y36H 3L8QA 4LFHD 5LGHL 1E9OA 5FDYA 1F4HA 3V4UL 4EI0A 4YWGL 5K1JA 2OFQA 1DQLH 2LQRA 1FI8C 1ZE3C 5GS0C 5LBSL 4X5WA 1LD9A 3AXHA 3ARBA 5F97E 3MNWA 1G9MH 1GL4B 1LK2B 1A21A 2N7SA 3TN0D 5SX4H 1BXAA 1MHPL 3QNYB 3FRUA 4K3GA 3X1NA 3FQWB 3HI5L 5DR5L 4CSPA 1EBAA 2WYIA 5IW1A 2IAMD 4ZTOL 2CLZA 4OLUL 1ONQB 2DLIA 1VIWA 3LH8A 3LN9A 3KPNB 4LDOB 4XWGH 2FBOJ 2YFOA 3SQOH 1OTSD 2UZYB 1TPXC 2HFGH 4WUKL 2FO1A 3CSYB 4UU9B 2RR3A 2WSKA 4O2FA 1XR8B 4JGMA 4JPWL 1WLHA 2G60H 3O6FC 3CFJB 2BVQB 1CL7L 3R0NA 3GZOA 4G5ZH 3DXAD 2AHIA 3IRZA 2ED7A 2CUHA 3HN8A 1SYVA 4H0HB 5HHMB 4OZHB 1TR7A 4Y16A 1U8IA 4XBPA 5B7MA 4O00A 5CS7A 1GGCL 3EJSA 5HHOA 5KAQF 3CAFA 2XN0A 4HC1H 2GIYA 1ZPLA 1J5DA 5IV2A 4K7FA 4WFFD 3QIBA 1Z3GL 4YE0A 4P3DB 5BQ7B 4LKXA 5LBGA 4N5ED 1L7IH 4K15A 2IH8A 3V0WL 1A9BA 3TH2T 3UBXB 3BEWB 2EDBA 2VISB 3DJSA 2PWEA 4LHUB 1Z9SB 5IFJB 1FE8L 2VN3A 2EE9A 4KROD 5DTFB 2PXYD 3QDAA 3OSKA 2GJRA 5IW3A 5IHUL 1LK2A 1TPXB 4WEUD 3O8XC 1R9FA 2ZXBA 2WD0A 4AYFB 4MCZA 5B3NA 3QNYA 1AKJD 4HIXL 2R59A 1NANH 3IGAA 3C5ZD 3O6FB 4TVSa 4NC1E 3CVDA 3PQYB 2MKLC 4PW4A 5DSCA 3RWCA 1ONQA 1XXDC 5KBMA 3VSVA 5T5FL 4Y89A 5DK2B 2VN7A 2W9DH 4OV5B 2NZIA 4RSYA 4NM8H 3QQ4B 4Y0GA 2DKMA 1P1ZB 2C3GA 3T2NH 2UZYA 4PM1A 3CSYA 2W0KA 4UU9A 3D3VE 5D1ZA 1D2PA 1XR8A 5F72S 2BOCA 3DV6B 4UNTA 3B2PA 5D1QD 3TIEB 4MD5A 3CFJA 4Y2DD 1E8XA 3RU8H 1IM3B 4GEJA 3IMWA 1ROWA 2ZOKB 2AQTA 3DUHA 4NCC2 2JJTA 3SDCD 3VXRB 4OZHA 4Y2LA 1WGVA 1EZVX 4UYPA 2VXSH 4PJ9B 3FO2B 4HS6B 3NT0A 5MERB 3FSZA 1T20A 4MNQE 3ARTA 1J7VR 5EV7A 2X1QA 2A3TA 2OCJA 4NZUH 3HZ3A 5D7LD 4P3DA 3ULUF 1JGIA 3I2CL 4MZIA 3Q8BA 4PRAB 1CICD 3BEWA 2CRZA 4JN1L 4H20L 5T8IA 4DQOL 4GRLA 4LHUA 4WY7H 1Z9SA 5IFJA 4KK6D 3OV6A 3PYCA 9CGTA 4JZNB 5DTFA 1DL7H 4MQXD 4N0FB 4NAJA 3OXRA 5AKSA 1OW0C 3QUZA 1BGXL 5DJ0B 4AYFA 3U6RB 3HG1B 1ITBB 1A64A 3O6FA 3CFBB 5GRYA 3WU1A 2F1EA 3PQYA 2CBQA 1JYWA 3UFIA 2H6UA 4KX7A 3LZPA 3Q2NA 4ZK8A 2WAQA 3UXFA 3T6QC 1LEIB 5DK2A 2X2IA 1OD9A 5MEQB 3Q13A 4G6MH 5DD3H 1KIQB 3S6CA 4OV5A 3QQ4A 3WLWD 3P3UA 3H6JA 1E50A 3EF4A 2UXGA 4PS3A 5CJ5A 2HX9A 4YXHH 5IB2B 3SKMB 1OCWH 4LCIH 3HKZA 1Y0LB 7FABH 2PNDA 1RD6A 3CZGA 3BP5B 1EZSA 3DV6A 3ZHKA 1YN6B 3TIEA 3GBNH 1NBCA 3NYKA 5F0LB 2JQZA 2ZOLB 4DN4H 2ZOKA 3QDJE 4Z95H 1ZJBA 3S37L 3IJ8A 3NTCL 3VXRA 5DQ9B 2R1XB 2E86A 8FABA 4PJ9A 1UCTA 1YO4A 4NJAH 4HS6A 3TVMC 1A8JH 3SYQA 1CFVH 1MRDL 4PJFF 2QPUA 1NM9A 4OD3H 4KI5D 5ISZA 1DJYA 3A4FA 1AGCA 5EOCH 3FUNA 4MDRA 3B6SB 4DGYL 1SUJA 3KPSD 1IBGH 1AQKH 3L9RB 2P5EE 3LRSB 4K8RD 1AR2A 2LAAA 3E7JA 4PRAA 3U9PH 4JFPB 2RBLA 3WSQL 5KYXB 1W72H 3CFNA 4FRWA 4JZNA 2HX8A 1BFTA 2H5UA 2Q8BL 3KLAB 1M42A 1SXCA 1XGZA 3UTPD 4QXTB 1UM5L 1AACA 5DJ0A 5FCUL 2WO2B 4MJID 4UT9A 3U6RA 3HG1A 1UVQB 1TLKA 3LMJL 4NC1C 1MFVA 1QZ1A 2R1WB 4RMVA 4WV1C 3ZDWA 3QDGD 4BFNA 2AQRA 3CFBA 2V5MA 1KFGA 3V6FB 3G08B 1QUPA 4FQLH 4HUWB 1LEIA 3VXMA 1UEYA 4QAMB 3MKGA 2XZCL 4NQSB 2WLNA 1TIUA 4M62H 2SODB 3F58H 4KH2A 1A0QL 2WK2A 4KZEL 3KH4A 2NY1C 1YPZF 2AQ2A 4JFXB 4Z3IA 1HHJB 5IB2A 1WIPA 3SKMA 4YDKH 1Y0LA 5B21A 4XMPH 3BP5A 4AYGA 4HJJH 5DMIL 1YN6A 3L2LA 1KTKE 3FQXB 2ZOLA 1WZ1L 2Y69B 3KYNB 3BFWA 3EJQA 3T0VA 1BZDA 1NUGA 4N3TA 4NWTH 1TEFA 5L8LB 3O2WL 2L04A 5DQ9A 2R1XA 2HVKB 4J6RH 1EZLA 3C8KB 1FG2B 3FCGA 3II3A 3GMPA 4NO5B 2H32B 3TCTA 2L8AA 4WFHE 4IBVA 3FN0H 4P9MH 2CK0H 3ZYZA 4J2XA 4P46C 2UWEF 5IHHA 2VR3A 2IPKB 4CMHC 2QQLH 3O4OB 1OW0A 3L9RA 4GO9A 2ORBH 1J1XL 4JJOA 1NUNB 1F4WH 4ODUB 1AD0B 3QDHA 1U3NA 5E5MB 5I5JA 3NCYS 5JW4R 4LSVL 5KYXA 2EXYD 4LQFH 4RA0C 3EYSH 3F7VB 1EDYA 1ZGLB 3KLAA 3JSSA 5AZ2L 1MRFH 4QXTA 5B4MD 4QTHB 1UVQA 4JPVH 3SE9L 1MI5E 2QADB 3DIFB 4U6YB 1ZIBA 2YUWA 4U3XA 2BW5A 3WS3A 3V6FA 1UM4H 3U6XA 3T1WA 2ZXQA 4HUWA 4M7LT 2H41A 3N0PB 2HJFB 1P7QD 4NQSA 1T22B 2FSEA 2XETA 3P2DA 3QQ9C 4OCYH 3RIAF 3WFBH 5AZUA 3C9NB 3QYNA 3IF1B 1B0GB 1FPTL 4DUXA 5DO2C 1IRAY 3HVNA 3VDAA 1HHJA 2D03L 4E2OA 2XBDA 3S9DB 2FVNA 2IADB 3CSBA 3ECVA 4K9JA 1GYAA 1A2YB 2IAAC 2YD2A 2KZWA 4GIAA 4CMMB 5BVPL 5L4MA 1U3HC 1SBSH 3OF6A 1YQ2A 3CVHH 3KYNA 3LRHA 2GVYA 4P3CL 4A7UA 1MCKA 3PHQB 4CDHA 2CKNA 2O4EA 3C8KA 4AEEA 1CVRA 2H32A 4LGRB 5ALBL 5KVGH 3CGTA 4P0DA 3VRLF 3L1EA 4KV5E 3V6OE 5AKVA 3H9SE 5ADOH 2XN9E 5C08E 1O5DT 2IPKA 4XXWA 5I24A 1H8NA 1AGBB 2JVUA 2F5BH 3OB0H 1OP3H 5EUKB 4FYTA 2GQHA 2W88A 2WIIB 5BMFH 3RVTC 1AD0A 2FDBP 5ANMB 5C0BE 5I30L 2CAKA 2G75A 5E5MA 3N9GL 3LPGA 3JVFC 4C54A 5AVQB 5DVOA 1CD0A 5D72H 1IFGA 4KKAD 1NCCL 2ZUSA 3K74B 4MXQD 4MMXA 3F7VA 1ZGLA 4JFFB 4TQPA 5I1HH 3ARED 4M8QB 1E2VA 1MJJB 4NO2B 5GZOC 3O4LB 1PQZA 3CDFA 2K6YA 4Y5YC 3F8UB 1GGBL 5AW2B 1TTBA 2PCYA 3QDJB 4P5TD 4AIXA 1R3IL 5I2IB 2Y5TB 3O9WB 5AENA 2CR0A 2ODHA 4LSRH 2OTUA 1NAML 3OKYA 3QP3A 4G1MA 3BUDA 2B2XL 4G6KL 1F90L 2AITA 2WO3B 1B0GA 1ZLVK 2X1PA 1X5FA 1EGJA 1NDMB 3MRDB 4MJJA 1V5JA 3TWCL 8PAZA 3WKML 4FX5A 4Y9GA 2IADA 3KYMA 1GJWA 1A2YA 3BSZL 3OKLB 1A9EB 3WKQA 1SLXA 4LLAA 4TKWA 2W1NA 1OM3H 1CTOA 1KXTB 4AOFA 5HHXH 1CMOA 2NY3C 1TJIL 1FL3B 3BZ4B 1NGXB 5F44A 1GHFH 2VC2L 1CFTB 3MRGA 3SYCA 3V0FA 4ELME 1WWBX 4LASH 2NY2D 4QHMB 1MWAB 3D0AA 3HBZA 4XOAA 4N25A 3VJ6B 2QPDB 4G43B 1AGBA 1FN4A 4X7TB 5EUKA 2X4SB 4Y5YB 3ZU8A 2WIIA 3PWJB 4PVBA 4ODSH 1DQTA 5ANMA 2EDDA 4ADJA 1JPSH 5T5NF 2X4PB 2FWUA 3UL4A 1NBYB 3NFNB 2G3MA 3T3PE 4NO0D 1F56A 4OFIA 1RZPA 5IVOA 2EDMA 4JFFA 5JHLH 4KKRA 2OCFD 3OQ3B 1MJJA 2Q86A 3O4LA 1KV7A 4YSCA 4X7EC 3TEYA 2IOIA 2B4CL 2EUXA 1BMWA 1NEPA 5IESH 4QNPE 5K39A 2P5PA 2CKBL 5I2IA 2Y5TA 4XWGL 3O9WA 3SD5A 2DQ6A 3E9UA 5DHDA 1FNEB 3DTDA 4IEFB 1WJ3A 4PJBB 1ND0B 2LGNA 4DIXA 1NPUA 5IVXE 3LV3B 3BN3B 1JPTL 1NDMA 3MRDA 4ZOAA 4A67A 4HIHB 2G60L 2YKKA 4Z7VE 3PWPB 4L1HA 3OKLA 3WUWA 4XMVA 4JY6A 1A9EA 5F7NC 1IQDB 3EOBB 5CCKH 1LK3L 4ODBD 5HYFA 3ZMNA 1KXTA 3H56A 1CXIA 4MMYA 4X8CA 3AQYA 3BZ4A 1NGXA 2DYPB 2HAZA 3ILEA 1CFTA 3GSWB 3SOTA 3V6OC 2OJ1A 4QHMA 4KQ0A 2F7IA 1MWAA 4KX8A 3RA7L 2ZCHH 3VJ6A 4ORGB 3VXTB 2GKIA 4U1KB 5D1XE 2A73B 4G43A 1L7IL 5CZRA 1MI5B 4X7TA 1NKRA 5B39G 2BVOB 3BW9B 3VG0H 5E5UB 1NGQL 4POZC 3ZKND 2E7DA 4PJGB 3B3BA 5DZVA 3WNJA 1JVKA 1RIHL 2NSMA 2E7MA 3QFJB 4NAQA 3KLQA 2BOLA 1T6WA 1Z9LA 1YC8A 3BRFA 3UABA 4YAQB 1L9RA 3WNPA 4Z78B 1FH5L 4J3UA 2CH8A 3VD4A 2WVVB 4BRJA 4AJWA 1BSIA 3UO8B 2OZ4L 4K94H 1MW3A 3GZQA 5AFAA 1A6TA 3BD4A 2AFNA 2VQUA 4AC2A 1FCCA 2AJUH 3LZFH 2Z8SA 2XDHA 1IBDA 1O9WA 1FNEA 1RMFL 3WFDH 2WNGA 3KHOA 4PJBA 1ND0A 3T2NL 5AW7B 5I1JH 1K3IA 3LV3A 3PY9A 3LXCA 1JV2B 2IF7A 4HIHA 1WV7T 3F7QA 4D0BB 4ZMYA 3GSOB 3H9SB 2XN9B 3PWPA 2YPVL 1ULVA 4W4OA 5IVNA 3B3IB 1Q0YL 3RU8L 1XF3A 2FGZA 1S9VA 1IQDA 4LCWD 3EOBA 5E00B 3NZHH 5GSVA 4HUVB 5C0BB 1DQMH 1MOEA 2VXSL 1E4XH 1JRHI 1MNUH 2DYPA 3SBRA 2XWXA 3ARFB 3GSWA 5A2LH 3DX4A 2KKQA 4Y19B 1BQUA 2YD3A 4H8UA 4V1DD 1HHIB 3DMMD 2OR8A 1ZLUH 3G04B 3ZKXC 2G2NA 4WFFE 4A2EA 1I8LC 2NX5D 4FNLH 4RMSA 4ORGA 3VXTA 2XOTA 4U1KA 2AP2A 2A73A 4LFHG 1ED3A 5CCHE 1M57B 5CZVL 4U6HB 2X6BA 2BVOA 3BW9A 1IV8A 1T4WA 2EIZB 5CKAA 4I89A 4G11A 2F53D 3PCYA 4PJGA 3SDAB 5D8JH 1QR4A 1DL7L 1AZVA 1QNIA 2PCPB 2P48B 3U4BH 4URKA 3KM1A 3QFJA 3FOLA 4NZDA 5FCSH 5DEJA 2VZ3A 5MENB 3QJZA 5DJXA 1V55B 4YAQA 4Z78A 3RVWD 3ARWA 2WOYA 1U33A 2ZYHA 1LO0L 2WVVA 3L4ZA 4YC2C 4YSRA 2NSQA 2PUQT 1E2WA 3U4AA 2MRYA 2CHWA 1J18A 3MNVB 2IOOA 4NS0A 1AHMA 4G6ML 5DD0H 4KKZA 5FGCB 3UTSE 5M94B 4ELMB 3U7AA 5B8CB 1NLDH 4JKMA 4LCIL 1JV2A 7FABL 1CDUA 4D0BA 3GSOA 4XO5A 1AHWC 5SWSB 3GBNL 2EP6A 4AENB 1NEUA 4NLHA 2B1HL 5D1QE 4CC1A 3QWNA 4DN4L 2VDPH 2L7JA 4PCTA 4QRPD 4QCIB 5T1DL 1AYRA 5E00A 3OMAB 3REWA 2ESVB 3L2NA 4HUVA 3DX2A 5CGYC 2ZPKL 1A6WH 4AJ0A 2HUEA 5AD0A 3ARXA 5B39B 1KTRL 2E6QA 4B0MM 2YO3A 1M7UA 1XB8A 5TQ0L 3ARFA 1Z5YD 3HMXH 4Y19A 1HHIA 5ERWB 5AB9A 3CSFA 5DD6B 5D1XC 4MDJB 2VERN 3L5XH 1S46A 5D7LE 5HDWA 3ME0B 2NYYC 1B6UA 1TYEB 4U6HA 3MJ6A 4DUWA 5KVMC 4R8WH 4YC2B 2AJVL 4HU8A 2BDNH 5E23A 3BPCB 1W72L 2APTA 2N56A 3SE4C 4ZFOB 3SDAA 4DKTA 3IJYB 2PCPA 3AC0A 3CCHA 4MAYD 3SZKC 5HVFB 5L88H 2H4EA 4DHLA 1GKEA 4KFMA 5EU6B 5GZND 3L3JB 5MENA 1WAEA 3QNXB 1SYSB 3HKFA 3HS8A 3IRPX 2IAMC 2FGWL 4PD4K 3P4OB 4EKXA 4NEHB 2J4WH 1F3JB 1IEHA 4FQLL 4PCYA 1XF2B 4P4KB 3MNVA 1JGUL 5T1MB 2YD8A 2X87A 2XLLA 4X5QA 4LQ1A 4M62L 1X6LA 4R2GB 3CFCL 1OTSC 2EDEA 4NYLA 5B8CA 1LNUB 3NJLA 1J0HA 4ALAH 2H2SD 1EMTH 4TL4A 4DZBA 4EBQL 4JFDB 4DCQB 5A7EA 2QLVB 4XN1A 4GFXA 4YDKL 1I1CA 4B3VA 5AB2A 4XMPL 2ZX9A 3F84A 5DHXB 5SWSA 4RGOH 4AENA 2N01B 2O61B 5D7IA 4QCIA 4R9HA 5KYNA 1RHHB 2ESVA 4JRXA 1TTUA 4LSQL 4NWTL 3GO1L 5I17B 1WZMA 1CI3M 2E27L 1AS6A 2FX9L 2BWQA 3GMOB 2ODIA 3QEQD 4HKBB 3LXAA 2PR4L 4I0PA 3VTTA 1WA0X 2CKBB 4KI5E 3D25B 5I8KH 3T2OA 5EA0H 1MIEL 2QQLL 4E68A 3MCKB 3QEUB 4XVTH 4MDJA 1E30A 1OE2A 1NGPH 4N5EC 3ZTJG 1NAMA 3ME0A 1KYOK 1X9RA 4HLEA 3KPSE 3ISWA 1F4WL 3G3LA 3QH3B 1R6VA 2P7TB 5GGTL 4F3FB 3BOVA 4HIJB 3MJWA 5C2BH 3BPCA 4MMZB 5JHAA 3BSZA 3C12A 3HN3A 4KROC 3LPFA 2APFA 3IJYA 4ZFOA 2PXYC 2WLZA 2ZCLH 1FORL 2R0WH 4QPEA 3L4CA 1TZIB 5DI8B 4MCYA 5EU6A 3L3JA 4IOIB 3UTPE 4F9LC 4MJIE 4GSRA 3C5ZC 5AW4B 1MFAH 3ZRSA 4BKTC 1XF4A 2XN2A 2OBGA 3H53A 3DXAB 3QDGE 3P4OA 1JE6A 1F3JA 1FZJA 1XF2A 2P49B 4P4KA 1U93A 1KZYA 3GK8H 1OANA 4OCYL 3DTUB 3QAQA 3G5XB 4Q74A 3EYVB 2QSQA 3VXSD 3EHBD 2J55A 3UDWC 1LNUA 3DECA 4TVPH 1UWFA 1UD3A 2WWNA 3O0RL 4JFDA 5FHBL 2EE2A 2D7OA 3FXIC 5DK3A 4KK9D 5IIEB 5D1QC 2EDWA 4WSKA 3EZJB 3AB0C 4Y2DC 4AK1A 3NCMA 4RBPH 2ZOUA 4PJCF 4HW6A 2O61A 4FFTA 1CD8A 3MAWA 4XCEB 2ROYA 3SDCC 1RHHA 3EYQD 4AYID 4G8AC 4G6FB 4X4ME 5DS8B 4Y4FA 4BUHA 3OL2A 1S7VB 4Z3TA 1NIEA 3K72B 4WENB 1FFOB 4N20A 5F1NB 5HVHC 5I17A 4IOFD 4A2MA 4G9FB 2AQSA 3QBTB 4TQIA 3GMOA 1OM9A 5KVGL 4H2AA 4KROB 1IC5H 3J7HA 3RRQA 2PXYB 4OFPA 2CKBA 3E8VA 3D25A 1GC1C 2E7CA 2KZKA 4HT1H 4UQDA 3MCKA 3QEUA 5FR3A 1AKJB 3IXTB 4HK3J 5AAMC 3GEWB 5F3FA 5BMFL 2D7TH 3DK2A 3I6GB 2AXFB 2Y22A 3EO1A 1CICC 3Q01A 3QH3A 4F3FA 4QT5B 4HIJA 5CZXD 4B9PA 1ASOA 4KK6C 5D72L 4MMZA 1SLUA 2J2ZB 2V6HA 4GQZA 4CADB 1REIA 5A6LA 4MQXC 3NP4A 4DN3H 2RCSH 1MELA 1L7TH 1TZIA 1JPFB 5C71A 1BFOB 4IOIA 1LDPH 4FQCL 1XF5B 3WDJA 4KO5A 3V0IA 4NOFA 5D1QB 2EDXA 3AW5A 4Y2DB 4HV8B 5EUOF 4AMKH 4FERA 4P5SA 1RZFL 3SDCB 5CEZH 3U36A 4PLKD 1BQLH 4LSRL 4GQRA 1DLFH 2WQSA 3IETB 3QYMA 3WLWC 2E9BA 2Y07L 5T1KA 3UPCA 1YMMD 2HJLB 4JCLA 4R7NA 1AVAA 25C8H 1JGDB 3US1A 1QFWM 2ID5A 2R69H 4M7JH 3OKKA 4XCEA 1OM3L 3B9KB 1PEZA 1U3YA 5HHXL 4EPSA 5DZPA 1A4KA 4XNMB 2XTJB 2DY2A 3K72A 1FFOA 3RUGE 2D7NA 5F1NA 1GHFL 5LGKA 4G9FA 3HAEH 4DW2H 5EEXA 3T0XA 4LASL 2CUIA 3V55A 4PS4H 1KJ3L 1R5WB 3BPLC 4PJXF 1A14L 4LSUH 3PNWB 4JFVA 2Q7NA 4DZ8B 2VXTH 3IXTA 4NHUB 4K8RC 3I6GA 2AXFA 4QT5A 3SE3C 1JPSL 4PY8I 5F9JB 2W95A 3U0WH 2YPVA 1IAOB 4CADA 1XX9C 3QUXD 3D7PA 5E95B 2UVFA 1JF6A 5JHLL 3UDWA 1JPFA 2Z65C 1U92B 3VXUB 4MCMA 1XF5A 1ZPUA 4KTDH 3U7YH 3RLSA 2XG4B 4PJEF 1OVZA 1H6UA 3L1OL 2FRGP 1TMCB 3AY2A 5B1BB 2PPFA 2I69A 3GIVB 2CLVB 3WE6B 3SDCA 1NMAH 5HDQH 5E1HB 4JFUA 1NCTA 3DBXB 3ULUH 2EZ0D 5HHQB 1BLIA 1PD1A 5I1CL 3FFCD 4OH2A 2HJLA 5JA9A 5LJYH 5AW1B 2A9CA 3LNGA 2QLYA 1JGDA 3QR0A 3BLBA 4M48L 1X4YA 3T1FA 4AXWA 1F6AB 2LR4A 3KPSB 2I60H 4J3OD 4KJQC 5EN3A 3AXLB 1SXSA 3B9KA 4NQEA 3DHMA 4AH2A 4DKDC 5FYKH 2CCWA 3MPCA 4MSWB 1R3HB 4AIOA 1AR1D 2EUVA 5ENWB 1CFNB 4GKSB 4IJ3C 3D06A 1I3GL 3AT8A 4HOMA 2O6CA 3P9WB 4LOVA 4DOHE 5EU7E 5CD5D 2G0KA 4NUQA 1R5WA 1L6ZA 2ZCHL 2IALB 2QVFB 5JPNA 4DZ8A 3PNWA 4YHZL 3O6KH 4YSDA 4F37F 3RZWA 2LU4A 3VG0L 4NHUA 4FXLA 2V8MA 3QEGH 4PLJD 3THML 4GKNA 3DVFA 1KPUB 1RVFH 4UNIA 4RVBA 1F8TH 5F9JA 3CFDB 1W2KT 3OMZA 3ZO9A 2R2BA 3L4XA 4Q9QH 4JFZH 1T3FB 5B4MC 1U92A 3LN4B 3VXUA 4PGEA 2E7HA 2XG4A 4EI5B 3FDWA 4BFEA 3IK2A 2OMZB 3DJ9A 2Y4SA 2CLVA 3ZE0E 3WE6A 3R8BB 3CZLA 4CA4A 4UAOB 5HHQA 4N8PA 4IJ3B 4X42A 3MJGX 1QPXA 1N0LA 5F1OB 2EADA 2VE6B 2ED9A 3FFOA 3NZHL 1F6AA 1PTZA 4S1RH 4S0SD 1JP5A 3PDDA 2DL2A 1HE7A 3AXLA 4TPRL 1THCA 1IE4A 2YPKB 35C8L 1E4XL 4MSWA 4N8VA 1CFNA 3H85A 3CQPA 3FQTB 3LKOB 4GKSA 1H15B 1M1XB 2D0GA 4JQIL 3Q7JA 1NIBA 3R4DA 2BCMA 1JG9A 4OCWH 2UY6B 5IK3B 2ICWI 2JJSA 4K3EH 3TASA 4E0RB 2EYTB 2IALA 4FNLL 3UAJA 1XIWD 2KDGA 2HWZH 3BMWA 4EXPX 4UQAA 1W0VB 3NFPB 3FH7A 3V2AR 1SVZA 4TLTA 1JYNA 15C8L 2DL9A 2J6WA 3MSPA 3MR9B 4KKAC 3CFDA 4PJIE 3LQAL 1P7QB 1UJTA 5E8EB 4MXQC 4DO4A 2ERJC 1LE9A 2O5XH 5FECB 1BZ9B 2NMSA 1NCGA 2GUOB 3AREC 3FHEA 3LN4A 5EEUA 4YR6B 2BY3A 4YVUA 5SX4I 2GI7A 4JQVA 1WISA 5CO1A 2KYIA 4EI5A 3QJFA 3IFLH 3HHMA 4FHKA 4P5TC 1QFUH 4R97C 4EN3D 3QJHA 3VI3F 3WIFB 3IFNH 4IKNA 2CR3A 5GHWH 4PGJA 1C5CL 2C7FA 1WO2A 4U1SB 4ZTEA 5LWYL 4U6VL 1P6FA 1HH6B 1ORSB 3DX3A 1NLDL 4A68A 3JYBA 4GXFA 3GIZL 5GGTA 4M6AA 3EFFB 4PI2A 4K2UL 5C86A 1PMYA 5IWLC 2VDPL 3S4SB 2VE6A 4PWKA 3TEUA 2AXGB 2JIXB 1FLRH 4LCWE 3RWHB 3L2MA 3FO1A 1ZTXL 1A6WL 2YPKA 4PRBB 5H94B 2WGNB 1J9CT 4OZFG 3LKOA 3FQTA 3TU6A 1H15A 1M1XA 2GJ6B 3HMXL 5INCB 3WNNA 4HULB 3IPBA 5EU7C 5JR1H 2NY2C 2UY6A 4PCSA 5IK3A 2ERJB 2DH3A 4V1DE 5AB0A 4E0RA 1I1YB 2ALWA 2EYTA 2YPLD 4BFJA 3L5XL 5C7XH 3AREB 4F9PC 3DVIA 2NX5E 4KO6A 1RZ8A 1Q4NX 2CA4A 1ZY9A 1W0VA 4PV8A 2DOCA 1I3VA 1TQVA 4OZGB 1P6WA 3FQNA 1E6OH 2QL1A 5AALA 3C60C 3WXVL 2F53E 5TQ2L 2VDLH 3MR9A 1P7QA 5E8EA 5L88L 4PBVC 5BCAA 2A9DA 1ZWIB 4UILL 1BZ9A 3TO4D 1T0NB 2GUOA 4XB8A 4L18A 4RAHA 1KPRB 1B90A 4Z5RA 2YWZA 4YR6A 4X9IA 3VW3H 1KCUH 1KACB 2ILLA 3NSFA 4N0RA 1NANI 2X38A 2GSIA 4WI6A 3WIFA 4RDQF 5H37G 1FBIH 4M61B 4JRLA 3MNDA 5DVNA 2KI6A 4IGBD 1QO3B 3K4DA 4NBXB 4U1SA 2DF3A 5E03A 4ZSOE 4N90D 5SWZD 1HH6A 3T3PF 4ALAL 2QKIB 2V7HB 4BFIB 4NPYB 5BV7C 2QQKL 3O6LL 4NPJA 1XGUB 3ZUCA 4B7IA 5DK0B 4BFGA 3DV4B 4Z7QE 3KL0A 3G6JE 4RGOL 2WJ5A 2DWTA 1L5GB 2EDYA 3S4SA 1G9NH 4FF9A 3UPAA 4XCNA 3G6DH 2AXGA 2Y1ZA 4QRPE 2JIXA 3ESMA 3RWHA 4QNPF 2VIRB 3JUZA 2PCXA 4PRBA 3GZKA 1U8LB 1KYUA 1T2QH 1I9EA 2GJ6A 4QXUL 3C60B 3GTNA 3JYCA 5INCA 4EOWL 3RVUD 3QUKB 5I0WA 1MG2C 5I8KL 5E2VL 1AGEB 1TCRB 3BAJA 1NC4B 1I1YA 3F5WB 2QTEA 4XVTL 4Z7VF 2AXWA 1TQBB 3FJTA 4BFOA 5BXFA 5BZZA 4XPBH 3RBGA 4UWQB 4EZMA 1DR9A 5C2BL 1Y6MR 3H4FA 3ZKNC 4OZGA 4Z7OE 5GGQL 3I74A 2ZCLL 1TJMA 4D8OA 5ETUB 3RI5K 2FD6L 5KS9F 3KPPA 1U21A 1ZWIA 2DWYA 3PDOB 1T0NA 4BK8A 1MFAL 3NZ8B 5JHDB 1PCSA 2O5ZH 4K3DH 5JMRA 1EBPA 4Q6IB 3S3SA 4HMEA 4OQ1A 3GK8L 4HCRH 1OWRM 1JPST 1E90A 2BSDA 3N43B 5CLZA 1BZEA 4HIQA 2YZ8A 1FFPB 4TVPL 4BFIA 2QKIA 2V7HA 4FJYA 4NPYA 2Y5EA 5DRXB 1XGUA 4KKPA 3Q3GA 5E6RB 5DK0A 3JWDL 3DV4A 3JWOH 3A67L 1BAFL 4ICXA 3QNFA 3QG7H 1L5GA 4OR1A 1E5BA 3GXDA 3RWFA 3RGBA 2FX8H 3Q8EA 4UI2A 2VIRA 3EJJX 3Q8CA 3INUL 3IDXL 1UA7A 1U8LA 4PJIB 4QGTA 4HWBH 1AG6A 1OLZA 3C60A 3V6ZB 3QUKA 3QEQE 3DMMC 4XBGB 1AGEA 1TCRA 3O3BB 4HT1L 2YOCA 1NC4A 1OCZB 4WQOA 3MC0A 4ZUTB 3EXJA 2ZE0A 4WEBH 3LPOA 3UYPB 3VE0B 1N5YL 2D7TL 2VSKB 2WP3T 2LVEA 4XP6H 1TVDA 1SY6A 4BBWA 1YYCA 1UZ8B 1IX2A 2VN6A 1PYWB 1V3LA 1KGXA 1MN4A 1BJ8A 1SF3A 4L3ED 1ACCA 5ETUA 1L7TL 1FQ9C 4R90L 4WCYL 3PDOA 2YEZB 5B1KA 1LDPL 4F1SA 3B2UD 3RVWC 5CZKA 1WCBA 5D2NA 3QXWA 5JHDA 2GK2A 2ZXGA 2W9EH 2W8CA 3W9EB 4Q6IA 4KHTH 2OAAA 4LCWB 1W15A 1BQLL 2OP4H 2WQWA 2CDGA 3A6CH 1ZD6A 3O11B 4UIMB 5ESVB 2ZIDA 5DC4B 2DKSA 1I7RB 1J0IA 4LLWB 3QZMA 1I3RB 3E9TA 3PP3H 1FFPA 3VXSE 5AWNL 5DRXA 4P8QA 4YEFA 2CIIB 3N5AA 4K5NA 1E6JH 1MDAA 3OTTA 2F8OA 3DTXA 4HISA 5CFHA 4I1NB 4UOJA 3ZL2A 2NXZD 1KFAL 4GRWF 4I88A 5GGVH 2WXPA 1BM3H 4HGWB 2X4RB 3TCLA 3SGDI 4B41A 3VDCA 2YFNA 1UCBL 1FJ1B 4KKNA 3VFTB 2F7RA 4UDUB 1J9SA 2XZZA 2A1WH 2VWEE 1ZHBB 4OJYA 4ETQA 3HFMH 2J6EL 1G7PB 5GS2H 4XBGA 4R7DB 3O3BA 3GS0A 3IU3B 1B4JH 3O45A 4ZUTA 3VFSB 2DM4A 3GNML 3UYPA 3RPKA 4QO1B 4WDIB 2AEOA 1HFUA 1H3TA 3T77B 1BXXA 2W0LA 3BISA 3MV9D 4ANXA 2BZCA 3V4VH 1PYWA 5C0GB 1S3KH 3OJ2C 4MAYC 1YMHB 4Y5VC 2C7UB 2OMBA 1KDIA 3V8OA 4ZOEA 5GZNC 4KDTA 3CLFL 1TTRA 3VFNB 3RIAK 4BQBA 1AP2A 2AKRB 2AV7B 4P23D 4AGNA 4QD2E 4JQIA 1K4CB 3W9EA 4GW5B 3EH4B 4QRPB 5GGSY 1FSKC 4H0LC 3CQFA 4GP4B 4OF5A 4H8WH 3GMRB 1R17A 2P46B 2RJMA 3O11A 5ESVA 5HYSB 4TMPA 1I7RA 4LLWA 5DGQA 1I3RA 1L0PA 4X6CF 1XHHA 5TK4A 2H2SC 1P1VA 2FTAA 4NRXB 3RDTB 1YMME 4PJAA 4NIKB 2C3VB 3GRWH 4ZUSB 1LP9E 4AIZB 4JRYD 4ECNA 3CXHK 2CIIA 3MRNB 5AVXB 2IXQB 5F96L 3HG0A 2F68X 5F70A 4E9QA 3RX7A 1XGRB 4HGWA 2X4RA 1FV1B 4U0RC 1QTSA 2ZJSL 4HHAB 3RWDB 1YYLL 1VRSA 4Z7OB 5L9DH 4ABUA 2IIJA 3VFTA 4I8DA 1WF5A 4YFLI 2WPGA 1ZHBA 2QR0B 4UOW1 3ZE1F 1YEGL 2P52A 5JPMC 3AUWB 1RLWA 1RZJH 4R7DA 5ID0B 5JIPA 3VFSA 3O6KL 4P4RB 3KGSA 2J43A 1CTMA 3QT2A 3FRPB 1ZS8B 3SGJA 4WDIA 1J1PH 4PJDF 1RVFL 3T77A 4K5OA 5I6OA 4A2HA 1FFQA 2BP8B 3TBTA 4CSZA 12E8H 3P3YA 3BESR 4HPOH 5E6IB 1YMHA 4TQEL 4Q9QL 3QIWD 2C7UA 3KCWA 2MQGA 4PYGA 4YXLH 4PRNA 4KI5F 3VFNA 1U8QB 3I6SA 1A7QH 1IGMH 2AV7A 2OJZH 1R24B 2BHUA 2B9BA 3GXTA 2K1MA 1K4CA 6TAAA 3NCEB 4GW5A 4RAVB 1RPQA 2V9QA 4MA7H 1KYFA 1CGVA 1MEXL 3QJVB 2CMRH 1QZNA 1CBJA 3GB7B 3GMRA 5K59E 5HYSA 1BJ1J 1H19A 3ZT6A 3EHBC 3BWAB 3QQNA 1KUMA 3RNQB 2FB4H 1PZUB 4NRXA 3RDTA 4ZUSA 2BHFA 2NNRA 3F62A 5CJOL 2V4LA 4AIZA 3P3SA 1U91A 4N2CA 4KK9C 5CJXA 3MRNA 5JNYA 5LXGL 1UWXK 4OKVB 4W4NA 1DVXA 2IXQA 4E9TA 4LCUB 3P77B 4HJ1A 4PHXA 2HTLD 4CU7A 1S8DB 1XGRA 4C47A 3EYQC 5BOJA 5KSBF 1FV1A 2WWKT 3CFEA 3RWDA 4HHAA 3ZSTA 5KZCD 1FZOA 2OTPA 2XQYK 4IOFC 4ZS7H 5B7EA 2VWEC 1FYTD 4H0GA 2FCBA 5MHSE 3PRZA 4OCWL 3GXIA 2OZNA 4ZX4A 1NCOA 3PAVA 4JHAL 1UH4A 4YPGB 1P7KA 3CXFA 3VA2C 2CQVA 2IGLA 3QRLA 5ID0A 2HWZL 4LLQB 5E2TH 5D2LE 1PIFA 4LSPH 2WWMD 2DQEH 2X3BA 1ZS8A 3FRPA 5TF1H 3ZIYA 2F0CA 2WZAA 1ZT4B 5J11B 4WIQA 5CZXC 2UYLB 1RZKL 2PPCA 3MOAH 3VD3A 1G7LA 1VF5C 32C2B 5AOMA 2BP8A 1E8WA 4F5CA 1TOXA 1OPGL 4R7VA 3MGAA 2WKLA 4GO6B 3H3PL 3OHXB 5E6IA 2PPAA 1TJHL 4M8VA 5E8NA 4G3YL 3EHBB 3OKOA 4XMTA 1XTLA 4FFZA 2ITEA 4AQ8C 3R06B 5FWRA 1U8QA 4TSCL 1YQVH 2OMYA 2XTSA 4S10A 1R24A 4KHXL 4OGXL 3TOPA 4GRMB 3TP4A 4RAVA 4J5VA 5GHWL 4PLKC 4AW4A 2FLRT 4Z7WE 3GB7A 3HI6L 1R5IB 4P5MB 2ZWZA 3V4PH 2X4TB 1CLOH 3B83A 4FQJH 3J27A 4W9GC 3DJZA 4FHBD 4WI8A 5DZLA 3LZNA 2DQMA 1CGWA 2IH1A 2RACA 2ZXAA 3Q2LA 3IFPA 3Q9PA 3QORD 3LHPL 4OKVA 3S3CB 4EQ2A 4LCUA 5IROD 3P77A 1CG9B 2R4SH 5T3ZH 1S8DA 3WMPA 3AXIA 2FSDA 3ARSA 4BZ1H 1J11A 5DVPA 4HWNA 3RGHA 4AZ8B 4MAZA 4O4YH 4RGMB 3KG5A 3PP3K 3BUQA 2BFVH 2WLIB 3VFMB 1FAKT 4LSDA 4NKMB 3TEWA 3BKCH 1GW0A 5MI0C 5CJQH 4YPGA 4ZMWA 1Z32X 3IJEB 5KW9H 5B38B 5C7XL 2ICES 3KWUA 3C6SA 4IBTA 5GRXG 1NBZB 4XP9H 4BSVA 4HF5H 2NQCA 3WN6A 1NFAA 1E5YA 1GIGH 1DE4B 3LIZL 1ZT4A 1E3XA 1L9SA 4K5LA 3DARA 4A63A 3BT2H 2UYLA 1E6OL 3PL6B 32C2A 3N55A 4PI0A 2VDLL 3RUGF 4OB5H 3VH8B 3WGUB 3QUXC 2ZT9C 3WUWG 3R19A 4UQ9A 5BZDA 3OHXA 3TYGH 4AGQA 3I3DA 4L1LA 4HVBA 3S88L 3WFCH 1Y6KR 2RTTA 3D50A 3EBGA 2H1XA 3VW3L 1KCUL 3VGAB 2XRAH 1A66A 3B8SA 4R0LC 4YDLB 5L4JA 4N87A 4N2NA 5C0JB 4JM4L 2YSSB 2WXRA 5FYLH 5E1GA 2EZ0C 5ESAA 4P5MA 2Y1AA 4LZKA 3FAXA 1VFOA 1PCXA 1LWHA 2FQGA 1GCFA 2VXUH 3P4NB 2P80D 1HZHH 1S7XB 1PG7H 2A5UA 3P3RA 1SOSA 3H42H 5E5LA 4XOCA 2JF1A 3IDIB 4KUCF 4APXB 3N04A 2JH2A 2Y7MA 4GP5B 4OV6F 2DW5A 1MY5A 4J3OC 5CSGA 5BW7C 1CG9A 1OB1A 2I7SA 1TEGA 3HUJB 3TJPA 4N3UA 3FU3A 5EBMA 1CXLA 1AR1C 3UERA 1JJUA 5HI5D 5INDB 3VFMA 2WLIA 1NFDB 1E4XI 3C09B 1YECL 3VXQB 1S7QB 2NPLX 1F58L 1EDQA 3IJEA 4D8PB 5B38A 1KIUA 3MRJB 2YPLE 2VJ8A 3E6FB 4Q89A 1G84A 5DWUH 1TSHA 4QIRA 2E6JA 3MRMB 4Q6YA 1XB3A 4HCFA 4BE6A 3FT1A 4PLJC 4R0LB 1DE4A 3ZL4H 5I9QC 4UOZA 1F86A 5IQ9B 1S3RA 4AQEB 3SJVD 1CE1H 3PL6A 5CNHA 4XMUA 1NPNA 3VH8A 3ATFA 2DYSB 1XT5A 2WIMA 4ZUWB 2B1AH 1FL5B 3B9VA 2VDOB 1RPUA 2OK0H 3T3ME 2BNQD 5HYJB 3FFCB 2JJWA 3PAZA 5FF6B 1Q8MA 3LN5B 5I1LB 4ZYKB 4WO4B 3T09A 4K3DL 4BXVA 4M1GL 4HIEA 3CSTA 1AZZC 1LO4L 5C0JA 1TZ8A 3HC4L 3LKNA 1SEQH 3FU7B 3OG4B 2B1OA 4HCRL 5F88B 1X5IA 2YSSA 1HAWA 3NJFA 1JZGA 2IDQA 3ULVL 2GG1A 2WVTA 2VZTA 2GEEA 4YGVB 5B1AB 1AR1B 3MBXH 4ANVA 4N90E 5SWZE 1NICA 2CG9X 2XV2A 3IB4A 3P4NA 1S7XA 5GGRB 4UQ3B 3M6DA 3QG7L 4XNYH 3IDIA 4APXA 2GBUA 3L9YA 3FL7A 4U1LA 3KPRD 2Q1EA 3HUJA 4GUQA 2AEWA 4LL4A 3ZTCC 3WS6A 4KTEH 3ZE0F 1P69B 4S1SH 4J3BA 3N3EA 2PO6D 1I85A 1NFDA 4JZOB 5I1GL 1MAJA 1AZUA 1VZHA 3FU5A 5HGDB 4EIBA 3H9YA 2IQ9H 1S7QA 5H35B 2W65B 4D8PA 1XIWC 2F1AA 2K9UA 3VGDA 1WS7A 3MRJA 3E6FA 1KGWA 4JRWA 3S8GB 2F7PA 1K2DA 3HZKB 2WKOA 3MRMA 6PCYA 4XP6L 1FNSH 4R0LA 2ENQA 4G7SB 2LLLA 5IQ9A 4HH8A 4AQEA 3NJVA 2YR3A 1YEKH 4ZUWA 1FL5A 5SV4A 1GMEA 3KJ6L 5JOPD 1YJDH 1AG0A 2ZXEB 4GXUN 4NC2B 3FFCA 5HYJA 4MJ6B 2NQDA 5FW7A 3SDYH 3DGCR 1FIEA 3G5ZB 1QW8A 3CZSA 2X9YA 4OIIH 4XN5A 5FF6A 3LN5A 4JG9A 4WO4A 1IT9L 3VWKB 3ZDZF 1O6SB 4KHTL 4EN3C 2BY0A 1ZVSA 3X14B 3FU7A 5F88A 2ZX7A 5IKCA 1ZRUA 2A77H 3KVDD 5TFSL 1L9MA 4FNUA 3JT0A 4YGVA 3MLXH 4QJ3B 5FHAL 2F7QA 4YBQD 4WNQB 4W6YB 1E6JL 5GGRA 2VLMD 4UQ3A 5IVZB 1CFSB 4LVNC 2XJLA 5DJ8B 5GGVL 4HUKB 4X0NA 3OAUL 3FCUB 1EHAA 3RURA 1A6AA 2G3ZA 1RU9H 2XKSA 4ZDHB 2VN5A 4OGYH 5I19H 3GHEH 4J3XA 2UUDK 1D5ZB 2YD5A 3L4TA 1K5WA 3AG1B 1U8CA 2ZG1A 2D73A 5KTEH 3FQ1A 2K70A 1U41A 1NPJA 2OR7A 3BIBX 4X9FA 2DH2A 5HGDA 1R0AH 1TSRA 5H35A 3UGUA 2LVCA 2ATKB 2W65A 1OP4A 5DVLA 1OT1A 2MCPL 2CHXA 2YHGA 4YHLH 3VFRB 1CT8B 1D7BA 3R1GL 3HZKA 1LEKB 4GG8A 3I75B 5FUOL 2MH4A 5L7XH 1XCTB 4F8QA 2JTYA 2A99A 4LIQH 4CW1B 4EN3B 2WQVA 4YUEL 3OZ9H 3TA3B 5DT1H 3FQUB 5DO8A 3INOA 4EUPG 2QHRH 5E70A 1HNGA 1A3QA