1MNNA

Structure of the sporulation specific transcription factor ndt80 bound to dna
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*CP*AP*AP*AP*AP*AP*C)-3'
publication title Structure of the sporulation-specific transcription factor Ndt80 bound to DNA
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 83
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2002-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 1mnnA00
2EVHA 2EVFA 2ETWA 2EVGA 2EVJA 1M7UA 2EUWA 2EUZA 2EUXA 1MNNA 1M6UA 1MN4A 2EUVA 2EVIA
chains in the Genus database with same CATH superfamily
2VXUH 4UV4L 1J8HE 5KVGH 4BK5A 1V8HA 4GG8B 2IQAB 2FQEA 4F7EB 5JR1L 1PYWA 4HLZH 3VTAA 3VQ1C 1N0LA 3BZ4B 2X6CA 4FHBD 2DJUA 1ZTXE 3PAZA 4FI8A 3D4ZA 3TA3D 2C9SA 2VGLM 2GTZB 2XT1B 1CFSA 3S5LA 5DUPH 2OXHA 2YOAA 3E80A 3QI9D 4TVSa 3S3CB 3PXJA 1OSPH 4JE4B 4F8QA 2LVEA 3S4SG 3OAWA 4ODWA 2ADIA 2DMCA 4MB4A 2AJUH 3WNIA 4HC1A 5DC9B 2X88A 4J8QA 1U8QA 3EJQA 3WELA 1A7RL 1Q0YH 4E9WA 4JG5A 3T3PB 3TBVA 4HV8A 4WF7A 2A0LD 1E6JH 2VO5A 4LEOA 5T5NG 3BWAA 1B9ZA 1E4KA 3JT2A 3LNEA 5DC2A 4BXSV 1OF2B 3RL1B 3UTTA 2XETA 2IC2A 2FEEL 2IAMC 1T5KA 2QV4A 3BHBA 3MRJA 2XQBH 5LJYH 2BIMA 5C07B 2DWXA 3CSYA 3EO9L 3MJ8A 4K5NA 3BI9X 4M4PA 2LFEA 4WY7L 4JGMA 5IREA 4PRNA 3RZCB 2EYTB 2X4TA 1C7SA 3HFMH 3MHZA 5E9DA 5GGSY 3ZY7A 3I9AA 5IBLD 1YY9D 3HMXA 3DARA 4EXKA 2KPWA 4GRMA 4RMWA 2F6AA 5CJQH 4ZK8A 3DMMA 4WV1C 5LUMA 5E8NB 4JKLA 3V9FA 2IADA 1GGIH 3WJJC 4Z18A 5EV7A 3EYQD 2XXFA 1U3ZA 4WSGA 4IRSA 3CHQA 4LLAA 4L5FL 1L6XA 3MNMA 2J57A 2EYRA 2VN3A 4XB8A 1VDGA 5TE7H 3CFUA 5AG9A 1C1EH 5KYUA 3QQ9D 1FV1A 3SE3A 4XCNB 4Z3GA 3AT9A 3CQFA 3OGCA 4ZUWA 4X8CA 4QCIA 5A3IC 3FUHA 1E9PB 1GR7A 4G3YL 4RRPG 5KSAD 1BAFL 3EBGA 3GIZL 1U58A 4N3UA 4L8SB 2X89D 4A7QA 5SX4I 5T1KA 5CJXA 4YDIL 3PWPB 2QSVA 5GGRB 1T83A 4FN0A 1S78C 4YSUA 5I1CL 3NK3A 3BIAX 2R0ZL 1T22A 4LGSB 3DOSA 3C2AH 4X7SL 1A22B 4XPAH 1F3DH 4IGBB 4L3EE 5FDWB 4OZIB 5BO1L 2R0WH 1D6EB 4D3CL 2Z92B 3QE5A 5CAYB 3PPSA 2R4SH 4M5YH 2BRQA 1ETZB 1JJUA 1OAUH 5AYTA 3IS0X 2BINA 4QHKJ 5G55A 3SDAD 2FT7A 3EYUH 2H1PL 3U0PA 1Q9WB 5MHSE 1KENH 4YHPB 2Y69B 1MHPL 2ZUWA 3DX4A 4W81A 3U36A 1NMBL 2PF6A 3L45A 4IRJC 1U4FA 3B5GA 1VZHA 3OKOA 3WNLA 3A4FA 2V0AA 2BRRH 5I5IA 2Y7QA 1IM9B 4CC4A 2QVMA 3D52A 5I24A 3IE9A 1GZPB 4HMDA 3FDWA 3WKML 2HJFB 5FYKU 1NUDA 5F93C 4EUPA 1MIML 1MQKL 5IM7B 2J1XA 1VFBB 3EOTL 3FB8A 1T20B 3F12B 4HS6A 4XBMA 5LNEA 5B3JF 1BQRA 1E4WL 3MV9B 4QMEA 2WV3A 4AI7A 4NKIH 5AOKA 2J8OA 2YA0A 3M1BA 4M56A 3RFRA 1KT2A 3QPXH 1SYVB 2BIQA 1EXGA 2DH3A 3I9GH 3QH3A 3QUMH 4RMSA 3VXTB 2H1XA 2HMIC 3AT8A 3JWDC 4ZX3A 5ABZA 1MW3A 5E2JA 3MLZH 4JK0D 4KUZL 1K2DA 3HZVB 3MRHA 1S5HA 1OARH 3K8KA 3FN0L 3QUZB 1H6EA 1IKFH 4KRMB 1LK2B 2IBBA 4QTHB 4UYPA 4H8WH 4XPTL 4JPWL 3EUUA 1VB9A 5D7KD 1KV3A 1GJWA 1YO4A 1NGWB 4ORZC 3STZB 5MEND 4BSWB 3S2AA 1ERNA 4XMWA 3WN5C 3PIQA 3TH2T 3ILQC 2AQRA 4AL8H 4XR8C 2AEWA 2J6EA 2Z7UA 2Y7SA 2WUCH 4GW4A 4TSBH 4Y89A 2OSWA 4YLCA 1PU0A 3MRRA 3ISWA 3MR9A 5HJBA 4JGUA 1R3JB 3CZEA 2B7DT 1FIGL 1FLRL 5D2NE 4V1DE 3J27A 4J7RA 5EU6B 4U1JA 1VGKA 5JA8B 3S3BB 4OCSH 2DOCA 1JGLL 2F7PA 3GKWH 1PJ9A 5D2LE 1QI5A 3QG6B 3X1FA 5EO1A 1B0IA 5AQ0A 3ZE1B 1NGZA 1D3CA 3ZIMA 5CJ5A 4PJ5E 5IKCA 1UB6B 2F58H 4L8BB 1VEMA 2ATPA 5E8DH 1IEBB 1RZ8A 4IU3A 3CHXA 2OSXA 4HC1L 2ED6A 1EZUA 3U83A 5IMMA 2YD6A 1MFEL 3ARUA 4FTVD 1J1OH 1WIOA 3HUJA 1RIHL 4P57A 5EH1A 3VFMA 3ZDXB 3RVVC 2APVA 3QG7L 4OLYL 2ZF8A 2JSFA 1KEGH 2OJEA 4JDZA 2XN9E 4L23A 5HDRA 3WDIA 4PVMA 4HCFA 3Q9PA 4JMNA 5D71L 2YD9A 3NJHA 5K9QI 4OZ4B 3UJIL 4P23A 3A5VA 3KE0A 2CPCA 4B7LA 1TJXA 4S0SD 1MFUA 5E4EB 3QUMA 1YC7A 2A9MH 3OR6B 1UXMA 4I1NB 2FJGB 1ZHNB 2EO7A 3HMXL 3SDCB 7CGTA 3SO5A 1U4EA 3QULA 4RWYL 4BDVA 4FA7B 2Y1YA 3O2WH 2AC0A 4M8QA 2E7HA 3PYCA 4YX2H 2FO1A 3IFLL 2VJ0A 4QRRD 4ZMYA 4OM0H 5CSBA 4NXKA 4CBPA 1WFIA 3U6XA 1XGPA 4G7QB 3NABH 3VFVA 1LEGA 3QEQB 1QNIA 1JWUB 1G87A 1FF5A 1DFXA 4HJSA 2EH8H 2CDFA 2BSSA 3F58H 4APQA 5BCAA 5J9PA 3FT4B 4PD4K 3I74A 1E5ZA 1CDCA 3V52H 1NCTA 5I8CA 2I60H 3ZE2F 4ZO9A 2EEBA 3ARGC 4FFWD 1QSEE 1JPFA 1KTRL 3N50A 5DQ9B 3MREB 1R3IH 3SPJA 1JN6B 4HH9B 3SZ6A 1A3LH 5BXFB 3CDGB 4P5TC 5IVZA 5I8EA 2LABA 1IGYB 1LWHA 4EZLA 3FO0H 1UYWL 4FQQB 4KH9A 1YNTF 5TH2A 4PG9A 3FTZA 3BH4A 4IBSA 1O6SA 2PXYD 5B38B 4PRIA 3CCHA 4MRCA 5LGKA 4GRWH 1DTUA 4XXWC 5INCA 2BSCA 3MRKB 5D2NC 4D0CA 1LGVA 4S2SA 1LO0L 3GO1H 5IW3A 3RGHA 1B0RB 1J1XL 2NLJB 4HPYH 4WJKB 5AOIA 3H9SD 4P4KB 1VJSA 4X4XB 3AB0B 3S96A 2KL6A 4OUOA 1RPUA 2DJSA 3HC4H 2XWBB 3KPRB 3VCLB 1L9NA 1RIVL 1JVOA 3D0LB 1R24A 3FQWB 2JB5H 1KIQB 2W0FB 3OG6B 1ZSDB 3UBHA 4F7TB 4Q9CA 1IBDA 3KPPA 2EECA 1SN5A 2DPKA 3DYOA 1SHXA 4NKDA 3MSPA 2AHIA 3R06B 1DVSA 4P2RE 5BZZA 4IDLA 5FYLH 3L2MA 4D0DB 2IOMA 3RDTD 4HOZA 2VSCA 5IJVA 1RXLA 3HE7B 3PDDA 4XX5A 4F3FA 2L04A 4PRBB 4A04A 5JORA 4MAZA 1LM8V 3F7YA 4KKLD 3RTLA 4UTAH 3E2HB 3G5XB 3MUUA 5L8JB 4GJTB 1N7MH 4ONFL 4OCMC 1KULA 4HALA 5KBNC 1A5FH 3QHZH 4UM9A 4RAVA 5DEFA 4YPJA 3PJSA 2B1OA 4PJXE 4LHUB 4XC3H 4ERSH 3GUTB 1HHKA 4DH2A 5GZOC 4MNQE 1ZGLA 5FGBC 1I7ZB 1A9VA 1E43A 1MFCL 4RGMB 1Q94A 4WTXA 3P30H 2R0KL 5JXAL 4N26A 3V0GA 4TLUA 1FN4B 2R0WL 4AYFB 1BF5A 1XMWA 2EEXA 2R7EB 4PJ9A 4FLHA 1VAHA 5F89A 4U6VH 3RA7H 2OV0A 1OLZA 3N41B 5E6RB 3ARXA 1VIWA 2J6EL 2XXCB 5AW9B 5TE6L 1UH2A 1XHHA 1XF5B 2VLME 2VXVL 2OMYB 2E3VA 1ILUA 1ZA6B 1KENL 1CICD 1WHOA 2JCWA 4Y19B 1JVKA 3LDBB 2BMKB 1ID5I 8FABA 1T4WA 5GISH 3NP3A 5DTFA 2YK1L 1BG9A 2RBLA 3F7QA 4FQHB 5DDHB 1H3VA 2FX8H 2VLLA 3JTSA 3VFGH 1JUFB 2BRRL 4ONHA 1IGIL 3D3VB 5FOJA 4FAAB 3MV01 2V6HA 3DXAD 5IHUL 5CGTA 4KTDL 4Z3EA 4X9HA 4UNTA 1JSYA 4WWKD 4LCUA 1NANI 1U8MB 3C5JB 4XI5D 2IH1A 4NI3A 4ZO7A 3SPVB 2UYLB 3T8XB 2JI1A 2XFGB 3LHPH 3P3RA 4H25A 5DEJA 3VH8G 5JZ7C 3JTTA 4V2CB 1TCMA 3FT9A 1QD0A 2X4NB 3QPXL 1W72B 3TT1H 3NCYS 4LPTA 1X4ZA 5F6HI 2QQQA 3IGAB 4BA0A 2ZOOA 4FYTA 2OI9C 1HHHA 4YL9A 5DHYA 1S7QB 4ZDHA 2Z4QB 3FQNA 1XF4B 1PZDA 3HG1A 1FHGA 1ZK5A 4WFHD 5EWIL 1EUTA 5LCVA 2PP9A 2C9XA 2QSTA 3B6SB 3UX9B 4OZFG 2VTFA 3V79C 4Z7WB 1IKFL 3DO4A 1BA9A 3O9WC 2PPDA 3D48R 2DQ6A 5EUOA 4IBVA 2HJKB 2I7OA 1AAJA 1JGDA 4KJYA 3II2A 4XPBH 3RKPA 1XIWC 3MUGA 3MGTA 1UB5B 1AZVA 2PYFB 4KK8D 4BKLA 2FE0A 2WIIA 3OKNA 3QUYC 2IAMA 3KXFA 4X6EA 4I5BA 2E27L 2DQJL 4JVWA 4M02A 5F7WC 3RWHA 5FA3A 2RGSA 3GMOA 2O26U 2WUCL 2Y7NA 2P5WA 2OZ4A 1G9NH 2ZKHL 2CHDA 4LVHB 3U9UB 3FRPB 1UHVA 1JWSA 1VF5C 4ETYA 1YEKH 1JK9B 1DQQB 3KLHD 1NIDA 5I30L 1FUNA 2F58L 3QDGB 2PETA 3HN8A 4P2QA 3WJJA 3ZDZB 4P04A 5CCGE 5B8CC 1NC4A 2VQ1B 3UFIA 2ITEA 4Y5YB 4G82A 5IB5A 1KEMH 1PG7L 1IEAA 1QRNB 3VGFA 1J1OL 4K3JH 1J8SA 5IEKB 1YAIA 1AIFB 2WD0A 2WQSA 4HWZA 3DETD 2APXA 1U91A 1D7CA 2ZD0A 3NSXA 3SE9H 2OXGA 4NJ9H 2AQQA 4XMLH 4PU2A 3VX1A 4EBQH 2CPUA 1VFOA 4I77L 5GS0C 1HI6B 3I85A 3L5XL 5FGSA 2YEZA 2WINA 3RVXD 4MDRA 3VNYA 3DO3A 35C8L 4MA1B 2Y36H 2FO4B 5C7XH 4HGWA 4YDMA 4A7TA 4CVUA 3AU1B 4S1DC 3US0A 3OQ3B 4R7NB 3SY0A 1KXTA 1J8HA 5EOCL 4ZRGA 1A1OA 3DX1A 3G5VB 3PNWB 2EE3A 4TSCH 1G1KA 4J28A 2QL1A 4DOHE 4YLBA 4YX2L 2EVGA 1T2QH 3TO4C 4EI5D 4HIEA 3D4YA 4HWUA 1WEJL 3DTUB 4OM0L 1E90A 5DFWH 2W9EH 2F54E 3B2UC 4QT5B 2NZ1A 5FAAA 5HHPB 5I8KL 2ZXAA 2GTWB 3P02A 4R96A 2B1AH 2W9DH 1GMEA 2P46B 3GZKA 2MWCA 5H37H 3F58L 4PRDA 5A6IA 2VAJA 4JHWL 4NWTH 2F5BL 3EOAB 2ENYA 2O5XL 4DEWA 4IRJA 1GVIA 1DLHA 5AD0A 1CL7L 4L0PB 4X5XB 2GAZB 4H0GA 4HCRH 3ECUA 5DJ2B 1S5IL 5T3XE 1A3LL 1CTMA 1NJ9B 3GDCA 1L5GB 4ORGA 2ZYIA 2Y06H 2X9ZA 4Q7DA 3J8F7 3NCJH 3RX8A 4R4BA 3TV8A 1LO5A 1SXCA 5KG9B 4WW1B 4NENA 1MAKA 3PP3K 3BT2L 1TPXB 2CUAA 1HILA 3KGSA 4JRWA 4O02H 5D9SB 5D2LF 4DP2X 5E8EB 1XF3A 1BMZA 1DE4B 2NTFA 4RZCA 5EC2B 5CLWA 5DGRA 5IR1B 4FLSA 43CAB 5DRNA 4JDTL 1L3NA 1ZE3H 1Q1JH 3E6FB 5T5NF 3F7VA 4F1ZA 1KB9J 2BHYA 2VZVA 1JTOA 2GEEA 4EPSA 1QLFB 2JB5L 2WJ7A 3BIKB 5GJSL 3O3BA 3Q13A 3AWFA 3FCSB 1M6OB 2J1YA 3RKDD 1TEFA 4NAMA 2XKUA 5CKAA 1OAQH 5CEXB 5CJOH 1T7YA 1N0XL 3MRPB 4QRSA 2FGZA 4A7GA 2D7QA 5FYLL 4PLKD 1NAMH 3AREC 1U6AH 4GEJA 4TXVB 2WWMD 4ZOAA 3T6XA 3EJTA 3S36X 1MRFL 2Y7LA 2NY3D 5SX5H 2Y1AA 1M1XB 4ODTL 4OFDA 3KYOA 4CU8A 3DRTA 1ZANL 3P77B 2K70A 5T1KD 3RGVC 3UAAA 4NQXB 5LCVL 4YHOL 4ODSH 3SDDC 3DHMA 3RWJB 5IVXB 5E2TH 2NY2C 4KZDL 4ZT1A 3B3IA 2OS7A 4HCRA 5JO5A 1X5YA 1T1WA 2VISB 5CLZA 1GS6X 3P30L 4UINH 2VDMH 3DVFA 1X44A 3LPPA 2F74A 4ONGL 3WTUA 4G7VL 3MJ7A 1UFUA 3ZLQC 1IGJA 4G7RB 5B1BB 5ID0B 5JHDE 1YA5A 2BNRB 3K0YA 3ABGA 3NCMA 4KKPA 5JUEH 1BM3L 2ZG2A 3UPCA 4AEHH 1KTJA 2VL5B 3NOIA 2VW4A 2ZOLB 4UT6H 5EF2A 2OZ4L 3EJZD 1SM3H 1QTPA 5ESQA 3EH5B 2D3NA 2UY7B 1K6QH 3ZR5A 1C9SA 1MH5A 3VB8A 1KSRA 1U8CB 1CK0L 1DFBH 2IOOA 5LBSH 1OGSA 1BFSA 3I6SA 3ULVC 2HAZA 4E41B 3D0VB 4JFEB 3PGCA 2A9AA 4ZFFB 5IW6B 2PLTA 3QZMA 1EMTH 4JDVB 3W0WE 2P8LB 2DRUA 4FQXA 1BEYL 1OXYA 3EFFB 4K9JA 4MJJA 1MREH 5DJAB 3SYCA 3UCRA 2YD1A 4IOFC 1NINA 1FLTX 2Z8VC 2YBRA 3WFHB 4AYBA 3UPAA 4P4RA 3NZHH 4NDMA 1YYMH 3C5ZC 4G42A 5CXPA 4CNIA 5AW0B 1NA8A 1WHPA 1A6WH 1O75A 2R8SH 3HE6D 2PNDA 4MX7A 5JW4R 5SWSE 3OSVA 1PKQE 4ICWA 1A4KA 3SYAA 1FZMA 4TULL 5CZVH 4RMQA 1HCFX 3RWEA 3CUPA 2VR9A 1KPRB 3MLTB 4P5TA 2YEQA 2EIBA 1T66C 1TMCB 1MPAH 2VDOL 4DCQB 2ORBL 1P5UB 4D8PB 1XB8A 4DPRA 4HOMA 4GLRI 3X3FH 2NXZC 5CILL 2I24N 1KPVA 3B56A 4NZTL 1IL1A 2A4ZA 3C12A 1L0XA 2VIRB 1PPIA 1ZTXL 4JHAH 4FFVC 4M62H 4XMPH 1MFAL 5D2NA 4G70B 4PJXF 3SDYL 4NCDA 2DWTA 3U4EA 4HJJL 3NSFA 4DFHA 2VDNL 3HC0A 5AZEL 5LAXA 3WO4B 2NY0D 1CE1H 3WDJA 4PIRF 1TZ8A 4WW2C 4Z7QE 2JF1A 3D2UB 4ONOA 4U3XA 1NKOA 4JZNA 4XAKE 1Q90A 4GS7B 1YEKL 4OQTH 5LBSA 1WE5A 2P5EB 2EDFA 3UERA 1W16A 5T1LB 1A9BB 1ZSHA 5EOQL 2WVVB 2R2HB 1MWOA 1T21B 1RUPL 2GFBA 3LNDA 5ICZA 4N2KA 1AGCB 3O6LH 4QUOA 5DMGD 4W9IC 5CHNA 4ANWA 1ML0A 3DUSB 4JN2B 5DGQA 1NMAL 4K3JL 4DP4X 5LXGL 2NXYB 5EIIB 1SLWA 4OGAD 4FNQA 5T3ZL 4F33B 2W07A 4EAEA 3L17A 2FYVA 2I9LB 4PRPB 4XE5B 1E4XL 2GJ6E 2V2TA 3N55A 5CCKH 3VXMB 4JQXA 4R97C 4BSVB 4M8UA 1TTCA 2P47B 1YEJL 1FVDB 2IANE 4M6OH 4HF5H 4NUJB 4GG8A 3GSWA 5FO8A 4WWOA 2VLRD 3SQOH 4B9ZA 5J1AB 3N2JA 1X4YA 5I2IA 4YBHA 2Y36L 5GZOA 5FGBA 3REWB 5F44A 4B7IA 1AJ7L 2CO6B 3UBXB 1TQWA 3VG0H 3X14B 1ZA3B 5G4MA 1J5CA 5JHBA 2GTZA 1AGDB 1WPCA 1WF5A 3OL2A 4N0YL 2D7TH 3EO1B 4AENA 1XR9B 3CX5J 4XP5H 1RUQH 4KKBD 3GDBA 1ZS2A 4HJGB 2JK5B 2P26A 2FSEB 3QUKB 3WE6A 1E4HA 5FHBH 3QUXD 3NGBB 4FABH 3O45A 1ZT7A 2ZQKA 1XGQB 3F83A 4M5SA 2FZ3B 1IGTB 3MGOB 2B1AL 5FYKH 1BQHB 2KHAA 1PY4A 2JJSC 4K5PA 5ALCL 1Q38A 4KHTH 3QEGH 2EADA 4GRLB 2XWTB 3MA9H 3IS1X 3GK8H 3QDHA 1FE8L 4P07A 2CIKA 1NCCH 2K9FB 4Q0XH 4XVUD 5D93C 1XXDC 2N7AA 4XC1L 5DZ9A 5C07A 3ZO9A 3HBGA 4PJEF 3QA3B 4HCRL 4P8QA 3BDYH 2GIXA 1WIPA 2ED8A 3OKMB 3OAYK 4R9HA 1BWWA 1MHEB 1I9EA 2YQBA 2VKWA 3AWEA 4OQTA 3IF1A 2EYTA 5FF6A 4KZEL 4JFXA 3TT3L 2K0RA 1XZ0A 3KPTA 3NMEA 4J2XA 2DI8A 2DLEA 2H0FA 5AALA 4KUCD 1DBAL 4KNTA 2PYEB 5FGRA 4YNYB 5I19H 1ONQB 4BQBA 3JWNC 3LCYA 4DVBA 5MI0C 3NEOA 2EVHA 3LQAC 2ZJSL 4MNHB 2Y1ZA 3OVUB 5GGTA 3ISYA 4FG0A 3KPQA 4K3EL 2DQGH 4QRBA 9CGTA 5IJDC 3EJPA 1Q1JL 1QFWM 1LDPL 2DWYA 1TMQA 3H3KA 4OKDA 4BBWA 5E6IB 4Z77B 4KXAA 2VDPL 3JV4B 3I50L 3O9WA 4I3GA 1EJOH 4AUUA 1Z0NA 4E9LA 4GO6B 1E6OL 3PWPA 2NNAB 3QDJA 2DYPD 1XIWA 5J11C 2VZ3A 2X1PA 5GGRA 1Z6JT 1L6ZA 3V6ZB 1ZHBB 3VXUE 3INOA 3NFSH 2GI0A 5DHVB 3ZE2B 4YDKH 1HN1A 2IF7A 2ALWA 4OZIA 5EF0A 1O7DE 3NJJA 1D9KC 4G8IA 4LDCA 2Z92A 4BCXA 2BSTA 3IAQA 4TUOB 2E76C 2WYHA 3WOVA 5T1JA 1ETZA 2XI9A 4N24A 3OBAA 4Z7NF 2EQDA 1YNTB 3H55A 1Q9WA 2J43A 1J12A 5IJKC 5DD5H 3MN8A 3OZ9H 3QXAA 5B8CA 3EZ8A 4JFYA 5DYOB 1GS8A 2VDRB 3BZDA 3L9EA 1TT6A 2P4AB 1JF1A 2R2CA 3GKZA 6FABH 2WXFA 5ID1B 3KBPA 4KJQD 5CO1A 2EUVA 1G4RA 3CK0H 2W81C 4PJ9D 5HY9A 1IM9A 2OCFD 4QRUB 3I6LE 3DJZA 3ETBJ 1DVFD 1GZPA 1UA3A 4PTTB 2IALA 1JHLH 3C9NA 3DHUA 1MRDH 2CBQA 2ZXWB 3CC5A 4JFQB 2BCKA 2V33A 4MKMA 1T20A 3F12A 4WWID 3FQ1A 4XP1L 1JWMA 2BHUA 2E9GA 2JIXB 4JRYD 4X8GA 3DJRA 4P5SA 1IC7H 5HHNB 1K6QL 1GYAA 2HG5B 3RDJA 2R1XB 1DFBL 4XBPA 5LBSL 4KDWA 2D31B 5K39B 5IOKA 4FXKC 1LYQA 3TJEL 2XPGA 1BZQK 1EMTL 1SGKA 1SOXA 2X4PA 3QIUC 2CUHA 3LKPB 2OR9L 1IARB 3PPEA 4R4NC 4YFDB 5C09E 5ISZE 2BNUB 3GM0A 3QUZA 1O9ZA 1T7VA 2DEYX 3LNGA 4EDWL 3FF7A 5KSVA 1VA9A 5C0AE 3GWJA 5FYLD 1H6FA 5C0GA 2BSED 3SODB 2YMOA 4EKXA 3IGKA 3P0VH 5L2KD 3MNZA 3STZA 2J88H 3FCTB 4BSWA 1SBSL 3QJZA 1I3RB 4XPFH 4AM0A 5C3LD 2QMJA 3FBQA 4UTCA 1SF5A 3EF4A 3NSDA 2HKHL 3P0YH 4QHNB 1YRKA 2GY5A 3K0WA 4FD0A 1T6WA 1TG8A 4X83A 5F1KC 5EZIL 2Y23A 5HGGS 2OMTA 1OTSC 4FF9A 2CCWA 1RY7B 1JGIA 1A47A 2M83A 5ESAA 2L7UA 4EE2A 4Z1PA 2CKBB 4PRHB 2V3DA 1H8NA 5K9OA 4IK7A 1O7DC 4FFYH 3IYLW 4JY5H 2CLVB 3BPCB 5F72S 4OBSA 3VU1A 3IE4A 3KR3L 3GZOA 4M62L 4XMPL 4DW2L 2DS4A 4A68A 5GSRA 1KJ2H 4W68A 1XD0A 4E9SA 1IU1A 1DBJH 3JZYA 2DQFB 5B1AB 1GY2A 4NWUH 1XF1A 2NQ3A 3HKFA 3CVHA 3QB7C 4G72B 4WW2F 2CA4A 1OTUD 2YRBA 4FP8H 4ODXB 1Q0XH 4PJIA 1ZLUH 3HZKB 2QQNH 2XVKA 3GJFB 2XTSA 1H3UA 1H5BB 3PABA 4OZ4A 3CPLB 2F2HA 4HK3N 5IB4A 2V4LA 1DN2A 4OQTL 3WMSA 5EZPA 2APFA 4KDVA 4P2QD 4MS6A 5IB3B 1FC2D 1QWNA 3G9VA 3OR6A 4P2OC 1F86A 1W0VB 2FJGA 5IBUB 2RQEA 3O6LL 4JRLA 4OD3L 5KWYC 4UOQA 3C60D 3AREA 4M93B 2YGOA 4ZW5A 3ME0B 4CVZA 3NFPA 4MXVE 4TTDD 4HBQA 4NRYB 4KQ3H 4ZZKA 4O5LH 1USQA 5GGTL 1HIMH 2K6ZA 5GGRY 5CCKL 4IBQA 2N1TE 2FJSA 3X1GA 2Z3FA 3X11A 3RGVA 3RWGB 4AXWA 4Z76B 1JWUA 1FNFA 3BFOA 2FYYB 4JFOB 4LCWB 3VUAA 3ZO0A 4F9LC 3SDDA 2C9RA 4MJHA 3SD2A 3FT4A 3N43F 1L0QA 2ZYHA 4LQFH 4GKSA 4FQPA 1QI3A 1NOAA 2F54A 1MCOH 3FOMA 1V5JA 2AVFA 4WO4C 3QYCA 5DQ9A 1F4HA 4YGVA 3T8VA 2VZTA 2ZXDA 3MLRH 3OJ2C 4HH9A 5DFVC 4XP5L 3CDGA 1Z9SB 3IN0A 5MEPA 4FQQA 5LKNA 2XA3A 4O2FB 1RFDH 4P3CH 4FABL 1E28B 5E7FA 2FVNA 1G7IB 4HLJA 3ZW3A 3BKCH 5AB2A 2PCPB 4X99B 2W9LA 4Y5VC 2DKUA 4R8WL 4N0FB 5ADPL 4J3TA 2XVLA 1DSFL 2QADD 2FH8A 3H85A 2VQTA 2ZUQC 4UT7L 3MA9L 1OP4A 3PWVA 3H4FA 1B0RA 1NCCL 3VM7A 1GGBH 4BGLA 1BM7A 1AGFA 1E3ZA 2J12B 3LSOB 4PBXA 1AO7E 5DJXB 1QUPA 2CO7B 5KTEL 2K8MA 5E1QA 2J6WA 3H2WA 2XWBA 1COBA 2XQYA 4D9QE 1DLFH 3LZFL 4KC3B 1KIQA 1X9LA 1XBDA 3ESPA 5F7DB 3FQ2A 5KJRL 4F7TA 5IQ9A 1WBZB 1D5ZB 2HTKC 4I1PA 3VQMA 4W9JC 4U2YA 3AG1B 4Z7QF 2WYZA 3N1QC 4GAFB 1OP5H 1CYWA 4JO4L 5GS0L 4ZMOA 1LVEA 4HX1A 4IRZH 5I1GH 5I6KA 2CAKA 5J8OA 2CLRB 5MP6H 1RIUH 2H4EA 3HE7A 4RH4A 3D8MA 5CN3A 4NQEE 4PVLA 2DQGL 3ISRA 1KACB 1W72H 2N7SA 4HUMB 2WZPA 1KB5B 1BHGA 3CFCH 2Y5TB 2WQ8A 2BVQB 3IMTA 3QDAA 5C2BL 2YD0A 4MJIE 2BZCA 3BFWA 4Y1TA 3VXRB 4FQLH 5LGJA 3MBEB 1NLDH 2G75B 2EZ0C 2XRAL 1JOIA 4D0BB 5GGVY 4LGRB 1BDYA 3GHBH 2CJSA 4LHUA 3N9GL 4TSAL 2OW6A 5IG7B 4GAAA 2J5LC 2GSMB 1QEXA 4S1SH 4ZTPH 3KEDA 4ALAH 3IKCB 2QZQA 5TFSH 1I7ZA 1XSOA 2C4XA 2I7SA 5L0QC 1WS7A 3SYQA 4JFZH 2QR0B 3LRKA 4GI9A 4KKCD 7PAZA 2Z8SA 5LN4A 5F7UA 2HFFA 3QDMB 1FAIL 3NAAL 5GGVL 1MNNA 2H41A 3UZEC 3FFDB 3V6FB 1PEZA 3GLDA 4Y7MA 1TTGA 2E9WA 1KGJA 4LKXA 3U9PL 5K9QG 2EXWD 1XF5A 3HHSA 4F27A 2FLBT 1XCWA 4ZPTA 5AUMB 1QFWH 1G0DA 1ZA6A 3MFFA 4CDGC 2WNGA 4DGVL 3EGXB 3OZ9L 1BFVH 2H0JA 4XHJC 5JHDA 2W60B 2VW6A 1XH1A 5E2VH 3S4SB 3L3JA 3T2OA 4FQHA 3S3JA 2QV2A 3T2QA 3ZHFA 4XH2B 4LMQI 3BWSA 1JI1A 2VLKB 4LHJB 1JV5B 1S7SA 3MRLA 4Y4HD 3U30B 2WXQA 3QIWD 3OF6D 2C9UA 1JHLL 4PM1A 1DDHB 3MV8D 1KY6A 4JFHD 2WLZA 3CVHL 4RGNB 1HNYA 3JT0A 3E38A 1JPSH 1U8NB 1Z5LA 4PAZA 3L1OH 1ZPUA 3W0WA 2C1OA 5A6MA 2IFGA 2EDKA 1F4WL 1RH8A 3L8QA 2AKRB 4MA3A 4UT9A 3FW6A 4HCGA 3MRNA 4ZTEA 3ARDD 3ILEA 2YD8A 1B4RA 4Y9GA 1SMAA 2Z91B 4XMKL 3IGAA 3QNZB 4M5ZL 2HWZH 4JFFE 3WS3A 4FQXD 1KFAH 2BXZA 3M6DA 4P2AA 4LAQL 5IK3A 2NZ9D 1OW0C 1P1VA 1Z1WA 4ZI8A 1Z9PA 1XF4A 1T1YA 5JMRA 2B8OT 1IZKA 3PWNB 4U1IB 5JHMA 1ZEAL 3F64A 4HA1A 3L16A 4FLRA 5IV2B 2PCFB 3BPNC 1UUSA 1ACYL 5SWSA 5JIIA 1PKQA 5DLML 4Q8BA 1SNRA 4FQCL 2NQDA 5CKGA 5EMYA 5EU5B 4Q4IA 1YNKH 1R46A 3ZTJH 4OCLC 5LN8A 1Z3GH 1X4XA 1UB5A 2PYFA 4NOFA 3L4XA 1FFOA 2QPDB 1U93B 2O4EA 1U8LA 2Y6SC 1JZ7A 2B9AA 5AOLA 5HHOB 2NY4B 4HT1H 2QHLA 3RIKA 3WNMA 2VYRE 5CEYB 4KTGA 1OGAA 3CFJA 3VG9C 3DC0A 4PJ8D 1CFTA 4ELME 4W4NA 3FRPA 1QSEB 5HSFA 3ASOB 5C3IA 1JK9A 2BC4B 4XP6L 2UWEE 3Q5OA 3TBTA 2YGQA 4JAMB 1IAKA 1MCBA 4Y5YA 5CGMA 1DBMH 2I32A 4LLUB 1QAWA 2DBLL 4H2CA 3X1EA 1U95A 2ALAA 1QRNA 4KVNH 2XKNB 3QZWA 4NO2B 5SWQB 5IEKA 3AXHA 5T3XL 2TSBA 3MQIA 5F6IC 3SKUD 4YDJB 1LP9E 1UADC 3NCXA 4X7CC 3FUJA 4PB9H 1IM3A 4NJAL 4TVPL 4RFEB 1T1XB 1I8KB 4JHBA 4G8EB 3RHWK 5CR1A 3ULVL 2G4GA 1RSYA 3QIBC 4NUGH 4Z7UB 5JLZB 4NAQA 1XQ4A 1KGIA 2WZ0A 3UO1H 4PV1C 3V0WH 4QXUH 4OGQC 2YXWA 1HI6A 1EJ8A 1N5YL 4MLIA 2FBJH 4AJVA 3KWXA 3CFKB 3ETSA 3IJEB 4S10A 3V2AR 2PCYA 2Z7ZA 1MAML 2GJ6A 2DM7A 4ZQTA 4PP2B 4HIXL 4P9MH 5KBLA 4CSPA 2BY3A 4AGNA 4NZDA 2EIZB 2IANA 2D0FA 3T0BA 2R56H 3MBXH 3ZZLA 1LD9B 3F2LA 4B5EA 4XVSH 4DN4H 1UJTA 1I7TB 1HE8A 5DRWA 4IBTA 4JPKL 4QT5A 4WHCA 2NY5H 4C4BA 2GTWA 4A39A 4YC2B 1OCRB 5D7SL 3V0IA 1GTNA 5IJKA 1WUZA 2J2ZB 2JXMB 4J3WA 2VXSL 5A1AA 5ERWB 4LQFL 4P59L 1Y18B 3W9DA 2IFFH 3QC5X 3T71A 2YA2A 3P4LA 5KS9F 4KHXL 1YEIL 3DPBA 3BN3B 4JREC 4X98B 2GAZA 2AITA 5DHEA 3JVFC 2B0SL 5IQ7H 1P6AB 4JKWA 4UANA 5DJ2A 2JI2A 1FPTL 2WAHA 4J12A 2E74C 3I3DA 2IQ9H 1MDAA 1KIRB 1L5GA 1QBLL 4A7SA 1H0DA 3MCLH 4HDIA 4GSQA 5JNYB 4FQ1H 2B2XH 4PSPA 1BWMA 4KO9A 3UROR 5D5MF 1MCKA 2LR4A 3MLVL 4KQ4L 1KLFA 3LEVH 2R9HD 5EU4A 5EC2A 4WEEA 1RU9L 4AMKH 3BFQG 1G7JA 3WUZA 1C8PA 3JVGC 4QY8B 1NZRA 3O3DB 4XZ4A 4FXKA 4BFOA 2MCMA 43CAA 3RIFK 2EUWA 2NDFA 4HHWA 4XRCA 2P3YA 4L8CB 3E6FA 3RQ3A 1NIFA 3WSQL 3QIUA 4HG4K 3RZCD 1LE5B 1A6PA 1AANA 1XV8A 4ZTOL 1ACXA 4JRXB 4G7YH 1BQ5A 1PZ5A 4IKNA 5D4QA 1UWXH 5LHDA 3FCSA 1M6OA 1RK1A 3VXSB 1JF5A 1KYOJ 2EIEA 3QCVL 3WMQA 5EU3B 2Y3NA 4Y5XB 4N25A 3S34H 2DI9A 4HPOL 4DN3L 5CEXA 2H32B 1XEUA 3PL6B 1JZGA 3W9EB 1JNLH 2GHZA 1HSAB 3KS0J 4F2MB 4J1UB 4X0KA 4TNWK 4AWJC 5E1HB 3PNRB 2H3NB 4TM9A 3QNXA 4XNMA 5KVMC 2RCSH 4PVBA 4UT9L 3ZIYA 4XTRC 3MOAL 5C3TA 3I6GB 3WS6C 1YJDC 3CFCL 3QORB 1DDTA 4PD4J 1PTZA 3SKNB 5FFOA 2Z31B 4FQLL 1NLDL 2YD7A 4XOCA 1TTFA 3ZQXA 1IE4A 3P77A 4DTGH 1ZHLB 3PWPD 4NQXA 4RX4D 3GINA 4CMMB 3M17A 2EO1A 3LH8A 4LPUA 3I02B 1FL5A 2VXTH 5IVXA 3FT1A 3B83A 3IJHA 1MEXL 4S1SL 1QNZL 1B3IA 2FATL 3D08A 5DD1H 2GJZB 4IGBD 4JFZL 3ZT6A 1A7NL 1HYSD 3F7LA 1P4LA 2Q8BH 1NGPL 4H20L 4J3BA 4PBWD 4PJEB 3WFZA 1XCXA 2CR3A 3CFIC 3HZYB 5FYKD 2X05A 1TSRA 5DJCB 5ID0A 1FBIH 2AJZB 2ZOUA 5EBMB 4Q89A 2YSSA 3QYMA 2PP7A 1SLUA 4I2XE 2XG5B 5FV2A 1XSJA 2XBTA 2ZOLA 1I1AC 3HG3A 2TAAA 1CXHA 3SGDH 4AYSA 3WL9A 3H53A 4LOEA 4P2OA 2R23A 1U8JA 3ZUNC 2E7LC 1U8CA 1SEBB 2KS0A 4XN8A 2J25A 2XPZA 1DQMH 1M4KA 1AS6A 1JTPA 5TD4A 2DMBA 3D0VA 1RI8A 2OA9A 2P8LA 3MLYH 3V4PB 3V7AG 3LQAL 5D7LB 2C7UB 4L3CB 2XTJE 3UTSE 4Q6IB 2DQIL 2ITCB 3MV9D 1N5AB 1H6UA 1JCKA 1YQVH 3RPIB 1CT8B 4KO5A 2H8PB 2YC1A 3HI6L 3QFDA 4H8PA 4HJTA 3WKYA 3TCLA 4UQ2B 3OHXC 1AH1A 4N0RA 5E03A 4K7PL 1ZVSB 4XB3A 2XA8H 3QP3A 5AAMC 1WCQA 5A2IH 4NKMA 2BCMA 4GQ9H 1NM4A 3FU5A 4XGZA 5C0AA 3GEWB 4WO4A 2L7JA 3IMSA 2J4WH 3QNFA 2OX5B 5FW7A 4ANXA 5DHDA 5DJ8B 3IGFA 1R5IB 1S2EA 1YUKB 3ZMEA 4CN6A 3LAFA 3IJYB 3IJSB 1HH6A 3LZPA 2BIIA 2V2WB 2H0EA 3L3OB 4D7PA 3SDXF 2X09A 3L6FA 5TK4A 1PFCA 1JZ8A 4Z7NB 5EA0L 2YXVA 2VIRA 4X80H 4P06A 1R3LB 3TXAA 4ZQKB 4UQ9A 2OKMA 1EA9C 1KTCA 1NCWL 4YDVA 1VACB 4HZAA 5J89A 2R2EB 1KBBA 1DYZA 1NCAH 4R5VA 3TJHC 1CLZL 3WHE1 2XZCL 4Z3IA 2XFXA 4Q52A 5EU6D 4BFJA 4OR1A 3U7WH 4KXZH 3CSGA 2Q7YA 4IHOA 4JM2C 4NQCB 3TV3H 1U8PB 1JD7A 2VERA 5I1HH 4HYTB 4EI0A 2G0KA 1A9BA 1XH0A 4AMXA 1E27B 2R51A 2R2HA 5DD0L 4HUWA 1AKJD 1ED3B 1R4XA 4LARL 3KW7A 5FLVA 2E86A 1RJCA 5HJGA 2QHRH 4LCYB 3T0VA 3BRGC 5FFGA 2VQ4A 4KZ0A 5FC9A 2WXJA 3GTTA 3TZVC 4AV0A 1C16B 3QAQA 2OPCA 2YQ3A 3V95A 3D25B 1FNEA 5BOZG 1GW6A 4HWEH 4HAFA 4OZHF 1SYSA 3NCEB 1FVDA 4NUJA 3UZVA 5EEUA 2B5IB 1TIUA 2KQMA 1OHQA 3SHSA 5JHAA 4N0UE 2FBJL 5J1AA 3SDCD 3IEAA 4NRXA 4OD2B 3DNKA 2JMRA 3QXDB 3RY5A 1E9QB 4HQQL 2ICWI 1AFVL 2XTJC 4HWBH 1BZOA 3WTTA 1FSKC 5IF0A 3UBXA 4XNXH 2QPUA 5DFAA 4MAYC 1KIPB 2X70A 3ZTNL 3ZKXB 3GHEL 1MUJA 3VH8B 3U48A 2YXMA 4YAQA 2LGNA 3TYGH 4WGWB 3AXIA 4NI6A 3DWTA 4FEIA 4QNPF 2FX7H 1HSBB 5DHVH 5AVTB 2JK5A 3FQYA 4PQXA 3IDMB 2PPAA 3IK2A 3QUKA 1NBYB 4WDIB 3QEQD 4XZUA 1JZFA 3GLAA 4N68A 5SX5K 2CRMA 1CF8L 2ZWYA 2I26N 1XF2A 1TLMA 2LTQB 1XGQA 1C12B 1CGTA 3I9PA 2FZ3A 3MGOA 2VRQA 1BQHA 4X6CE 4TUKL 4LCCB 4JFDB 3VGAC 3RIAK 1ZLDA 1UQSB 1EEYB 5FO9B 4GSDL 4I4WA 4OZFB 2IFFL 1N70A 4XXCC 5DMJB 3HAEB 1CJYA 3A67L 5E56A 3DBXB 4U3SA 4F2EA 2VDRH 2ENJA 1FYTE 2Q1EA 1EGJH 2G2NA 3TN0B 4QHPA 3TPUB 3FQTB 3MCLL 3GIVB 1N2RB 1Q72L 4GMSL 1C8QA 1NDMB 4MDIB 4MMZC 2FAUA 3C6LC 4NQDB 5F0JB 3C8KB 2I07B 5HGBA 2DL9A 2PYEA 1WZMA 1SDYA 4FNRA 1AC6A 1S8DB 2CDEB 4YNYA 4Q4EA 3BP4B 3V4LA 4AIZB 4KXDA 1DUYB 1OQOA 3FAWA 4RRPM 4ELMF 3BP7A 3FFCE 1GSMA 5PCYA 3N04A 2RFXB 4P4KD 3TBCA 1E65A 5FOBA 3NSJA 1WFNA 1A4BA 4X6FB 2FGWL 3T6VA 2UWEF 3QEHB 3KPRD 1Y1DA 3IXTB 1OW0A 4A38A 1J87A 9PCYA 1OB1A 4RWHA 5AG8A 1GGYA 1RZ7L 5C0JB 5IFHH 5HJ3B 2VZUA 3QR1A 4G2AA 4ZXBC 1LP9F 2HRPH 3PAUA 3C09B 1AOZA 3DTXB 4NQEA 4OCYH 5SX4H 3NIDB 4AQ1C 3CXHK 1DO5A 4NNXB 2FBRA 1A6UH 1IAMA 1ADQA 3NH7H 5ICYB 1JNLL 2JTYA 3HE7D 4HIQA 1BLIA 1KTDB 4I3SH 1NAKL 1ZHBA 3FT0A 4MXWH 3Q0HA 3PJNA 3VU2A 4GFXA 4MQTB 1RULL 3VSVA 5C0NC 1BV8A 1B0GA 1GAFH 2AW2A 2EDLA 3AQDA 3CBKB 3H4HA 4N90D 5CM1A 3CMOL 1HVXA 1F42A 3U2SA 3WGVB 5EO9B 1XGYH 1XCTA 4LHUD 1J0JA 3VWJB 3FTSA 3P4NB 5CD5D 3BCFA 1A1NA 2H0PA 5IIEA 4B97A 4ZUUB 1E7VA 2EKSA 2WNKA 2VXTL 3FZUC 3MRFB 4JM4H 2CKBH 3HOGA 1XB6A 5DD1L 4H0IA 4KROC 1EGJA 5I5JA 4GNKB 2BVYA 1FWXA 2IPTH 3T1FA 1RQ5A 5GJTH 3GPEA 4BFNA 4QRUA 5HHXH 4DP0X 5HYJD 5A2BA 1IGCH 4DAGL 2NYYD 3RU8H 3DYMA 1IBGH 3DURB 2P42B 4TQEH 5I1AB 1WWAX 4NQVB 3T2LA 3U9WA 4AUJA 2JKJA 5K9KB 2VWEE 3F6JA 3ARFC 4GXUM 3B9DA 4CKVX 3GJFH 4N6RB 4Y19D 5J5EA 5JOPE 2KDGA 5GIRB 4O2EB 4Z7QB 4B53A 3AMKA 1N64L 2XWJA 1VPOH 3P9WB 4G6ML 4N1CA 3D3VD 4UNIA 3OMIB 3QQ4B 4NQSA 3ULAB 2EC9T 4B0MB 2PO6C 3MLYL 4JPVH 3JWDH 3TS8A 3HLAA 4IU2B 4I85A 1QRKA 2Y3AA 1WAAE 4FI6A 2ZCLH 5I6MA 5I15H 2WBWB 4ZUSB 4JFFA 4G43B 3D39E 2WMPB 5D8JL 1MCEA 4IOIB 3KDMB 1PG7X 4ENEC 3QFJB 3BW9B 4LF3A 4NO0B 1JYXA 2X7LA 3UC2A 3FSZA 4OCXL 3MI6A 3RILA 4QHNA 4OFQA 4UQIM 3C6SA 5CU9A 5D1XE 1DJZA 4QIRA 2OMVB 5CLTA 3QEUA 1IVTA 1OOWA 1MFDL 3TWCH 2Z0BA 1LMKA 5DI8B 5I26A 3VSTA 3CLFL 4LSTH 4HHGA 1K5NA 5ITFB 1N68A 2IBZX 4PP1C 4LEEA 5E2UL 1P53A 4LRIC 5DJ0A 4IMLA 4NZJA 3IAPA 2JWYA 3BPCA 4MB5A 5BV7B 4S0TD 3JVGA 1NCAL 1PVHA 4WNQB 3E9UA 5K33A 2MKLC 4Z7OF 2G9HB 4ODXA 3HZKA 2CCVA 4LLVB 1AR1B 2H5UA 4JM2F 2DM2A 5IMKB 4A6YB 1FJ1B 3FH7A 3IXAB 1MI5B 3QDGD 3GJEA 2G5BB 3VWKC 3ALPA 1UZ6F 1JV2A 2LFGA 1A25A 2KZKA 2CJTA 3KPSD 4G8GE 3IFNL 5I1IH 1QRND 1W0VA 3O0RH 15C8H 4U6YB 4WKZB 4I48A 2DIAA 4I18B 2HLFC 4JO5A 5C0CD 3EYVB 5IW1B 2CA3A 3VI3B 1MLBB 3ML8A 2ZSVB 3VXOB 3O8XC 4OJFH 1PY9A 2ZUTA 4NRYA 3S35L 3WS6A 4KKZA 3BLKA 1S7TB 3PUCA 2CGRL 3ARBD 4P3DB 4HIHB 1NFDB 1Y07A 3ARTA 1KB5H 4D2NA 4U1NB 4Z76A 5FUOH 1FFPA 3EBAA 3Q01A 1NBQA 1YEHH 2FYYA 4HFUH 4LCWA 1DZ0A 4CDHA 1YEWA 5EBGA 3X3GH 2VAAA 1QATA 1J5OH 5BRZE 4M1DH 3PHAA 4KRPC 1JXJA 4F8PA 3AGWA 1SHSA 2K7QA 1KTLA 4J2QA 1ADQL 2PTVA 3M07A 5EBLB 4J23A 4FA8A 4MJ5A 5JYLA 1P7QD 4Q58C 3FHAA 3ATDA 3CIQA 5JPMC 3VXUB 1XGUA 3FAXA 4YHYB 4MDJB 2IGLA 4TNFA 3EH1A 1IC0A 2L7QA 1I1AA 2YGNA 3DUUB 1CYXA 3E1F1 1SJVA 3JUZA 3KPOA 5I28A 2PCPA 3MUZ1 1AMXA 5DC0A 2E7LA 1JCVA 1U2YA 3DHJA 4AQAA 4U0RB 4PGEB 5AVQB 4KI5D 3KW8A 4R0LB 3LSOA 5DT1H 3ETBF 2O30A 2CO7A 3U6RA 2DKMA 1JZIA 5FKAB 3RBGA 1DUZB 2ZNXA 5IQOA 4PJ7F 2ICCA 4NFCA 1EGJL 2CXGA 4F8OA 1MG2C 3HI1B 4KGLA 3G6AB 3TBWA 5KYXB 2EXTA 4RAUB 5KVDH 2BVPB 2IGFH 4MMXB 4K94H 5F7DA 3S88L 1MCQA 1J9CT 1WBZA 1KPUB 4G6KH 4XB7A 1P84K 4N0CD 2D0GA 1NBVL 3P3TA 4Y4KB 5I17B 3OHXA 2YN5A 3PWUA 2AJVL 1ZRUA 3NA9L 3RNKB 4X4YB 4OZGF 5ADOH 2CLRA 4U7MA 3AZUA 1QYGL 3ZJAA 4YSTA 2I5YL 4BFGA 1FZKA 5C0RL 3Q6GH 1NDTA 2QSQA 4B9IA 5HVFB 4N8CH 4QHUB 3Q6FB 2Q7NA 2A9BA 3WXWL 1HJBC 1UEYA 3FS9A 2ZYSA 4MQXD 1PZUB 4AJ0A 4L29B 2G75A 1QSFE 3DV4B 2Z1PA 2HRPL 1UJ3B 5D1QE 4AY0A 4D0BA 7FABH 5F96H 3H1ZA 5BS0E 1A1MB 3GMQB 5DJDA 5C09B 2GBAA 1CXEA 2HSIA 4I87A 3ZMRA 2IH3B 1HZKA 2W91A 1ETJA 3OZLA 2Z8RA 4I3SL 3PQYB 2BHZA 3HEIB 5KANI 5INDB 5KS9B 4JX0A 5I1EH 1LO3L 5LQBH 2JFCA 1HK6A 1FQ9C 1UGNA 4JO2L 2WWNA 3FFDA 3INUH 3V6FA 5ITBH 5ENWB 2J8UB 2ZXEB 3LQMA 4CUCA 4WFGE 1ZVHA 1UM6L 5I6XC 2ICEB 1XGYL 1CFBA 4HUUB 3AS3A 4ZJ9A 2OZNA 4FMVA 5AUMA 2CIIA 3RG1C 1S7RB 3OXSA 5D5MB 3U4KA 1NCHA 3EGXA 4WEMB 1ZDSA 1OAJA 3H3PL 4JM4L 4N86A 3IFOB 2XICA 4PUBL 4O51B 4I2XA 3S37H 2YJQA 4GG6E 1E5YA 3I6KB 2OL3B 3QRGH 1RJLA 3WG7B 3IMRA 5FCUH 4YR6B 3KPNA 3TZVA 5GJTL 2FK9A 5MEQA 2F19H 2F1BA 3NACH 4P46B 2BNRD 3PWJB 5HHXL 2P45B 2P7TA 2XUWA 3NRQA 3CZUB 4JHZA 5HHME 3VMOA 1R0AH 2E7MA 2AQTA 1DDHA 2QKIC 3KJ4B 3RWFA 1NANH 3NQKA 4BCZA 1ADWA 4QHLB 3GSVB 1U8NA 2WO2B 3CZKA 2AK1L 5EO0B 1I31A 5DZNA 3KLSA 3LEYH 3ABKB 5AVXB 1T5WB 3GSRA 4ZSOE 5AWNH 4QO1B 3RYMA 1NSNL 5IOPB 4GKOA 1RUAL 2WTPA 3DA0A 1T0NA 3CE1A 4C56E 4E41D 1SUHA 4JFED 3UTSA 3UAJC 3X1BA 2F7IA 4ZMXA 4OAWB 5GZNC 4MAYA 4W9LC 5L7XL 4EJ1C 1MJ8H 4E5XG 3ULUF 2AI0L 4EN3B 3P3SA 5EB9A 2H3KA 3AUWB 1URIA 4U1IA 3GBMH 4N5UA 2FHBA 1LO4L 1ZD6A 2VH5H 1O5PA 5CEZE 4X6BA 2ENSA 1LEIB 2ILLA 1YJDL 1B2YA 5I15L 3A4AA 4QOKD 3G6JF 1KNOB 3G9AB 3MNWA 4JO3L 5EOTB 1LHZA 5EU5A 3WE1A 1ORQA 2BM3A 4QRQA 3KWTA 3LKOA 3TFKC 3LQZA 4FADA 1TUPA 4JJ5A 4LSUL 1FL6B 3M88A 3GMPA 5AVYB 3FL7A 4MCZA 2ZOTA 4HWNA 2I85A 4X8XA 4XXCA 3Q2WA 5D1QC 3HHRB 4DKFH 1U93A 2B4CC 5CF3A 1NDGA 1WIUA 4DP5X 1SXZA 1TTAA 4UOZA 4NQUA 5LBGA 1IKOP 3MODH 3CZNA 2HTLC 3MDJA 5CEYA 1MIEH 2QGEA 4NS0A 2KDYA 4MMZA 4N2EA 3WKNA 2CBPA 1WWCA 5DJ6B 4Z7VE 2P1YA 4WQOA 2BC4A 1QW9A 1L7TH 3IJ7A 1D6VH 1GPOL 3F3HA 4GUCA 4PG2C 5I73B 4JAMA 3OHMB 4GKZB 1A3RH 2QPEB 3P1VA 4LLUA 5T1DH 5ACZB 1U8HA 5CFHA 1G9EA 2XKNA 3A21A 2NUTB 1BREA 1MJ7H 2XCMC 4IOSD 2VDLL 1NGQL 3GMRB 5FYJU 2UZXA 1NCNA 4XN5A 1PD0A 3K6IA 3L9RA 3D2UD 1I8KA 2OMUB 1YDPB 4G8EA 4OGXL 4Z7UA 5JLZA 4ZXBA 1QVOB 4D9LH 3LIUA 3O4OC 4QRRB 2P5ED 2LE9A 1I9JH 3QCUH 4G8FB 5T1LD 3TASA 1AO7B 4BK4A 1QFHA 1T1ZB 2Q8AL 3BUPA 3FO1B 3TIDA 1TQCC 4AQ1A 3BUQA 1K4DB 4WGVB 2KLSA 2V17H 3DX2A 4R26H 5AZUA 3VFWB 3QZLA 4YPGA 2E75C 15C8L 1JERA 1LK3L 4PP2A 2NXYD 2H32H 3SGEH 1OP5K 1IGMH 3WV0A 5D96B 1JZ4A 1VADA 2GCYB 1F00I 3NIGE 1ZLWK 4OI8A 3VRIA 4N0UA 1IQDB 1LD9A 4PRPD 3U1PA 3VTMA 3FB6B 4QPEA 3VXMD 2O5ZH 1YYLH 4L9LC 4MNGE 1I7TA 4DZ8B 2X6VA 4LOFA 3SPIA 1CS6A 5F7BA 3E6HB 3SDXB 2AGJH 3EYFB 4TF4A 4FQIH 2EDDA 4XNBA 1T7ZA 2VSKB 2J2ZA 4Y2DC 1TETH 1WRFA 4TQHA 4N9GB 4N8VG 3T8MA 4AEEA 5DSCB 3MBWA 1OAYL 4KVCH 4PV9A 3C87A 4X7DC 1HESA 4MA8H 4E9RA 3FU9A 1QFOA 4X6CA 2NSQA 4ZX5A 5LVEA 5DUBB 1KIRA 5C0BE 4N2AA 5JNYA 1RZGA 4GYBA 3HNTH 1KXVA 1TJHH 1TTRA 1PLAA 2Q3AA 5LAPA 4CSTA 4EOWL 5MERA 5AZ2L 3ARFA 3LEXA 5BVJB 2I25N 1INDH 1D5MB 3NUKA 1YPZF 4L1HA 2FH6A 4G9FA 4P9HC 1I1YB 3UO8B 4GRLD 2E59A 1U3HC 1E5CA 5IB2B 3ZE0E 2WWKO 3S8GB 5T5FA 2O6CA 3FTGB 3T77B 2XOTA 2QQKH 2WBJB 3UOAB 4G6JH 4NB7A 3IFPA 3RDTB 6TAAA 1KBGL 1B88A 2NY6B 3CGTA 5IB1B 5LWYH 4X50A 5JOEA 4BH8B 4JRXA 4LZKA 5BRPA 3F7RA 3FFCA 3PWLB 3SYOA 4R4FL 4QTFA 2DQCL 3CBJB 3GPSA 2PYED 3VXSA 1D7BA 3ZHNA 2D2CC 4OZHB 4YO0B 3V4PH 5EU3A 3ZKMD 4Y5XA 4E9QA 5D7JD 2B1HH 2H32A 5I8OL 3PL6A 3QCTL 4HXBL 4POZD 4RDBA 3W9EA 4E0RB 4LSQL 1EAJA 1E0OB 4MXQD 4J1UA 3W3BA 1X5MA 2R0LH 1I4FA 4R7DA 1PW3A 4ZMQA 1QR4A 2H45A 1J0ZA 1WCBA 2UZYA 1U42A 4Z8FL 3BJLA 3SE8H 1NEUA 3Q6GL 4IMKC 3TA3C 4MZ2A 4FNTA 1J86A 2IO5A 4U4IA 5E6ID 1MJUL 1XFPA 2DJ4A 3C08H 3ZL4L 3IDNB 3QI9C 2KH2B 1PLGL 4Z0XB 2GT9B 1SJEA 5AW8B 4M43H 5F96L 4Y8AA 3QARA 4CMMA 2BWQA 3REVB 4LVNB 3I02A 5ECJE 3MYJA 1N3NB 2AK4B 1ASPA 3FRUB 4M3KB 5TQ2L 2A0LC 4TLTA 1OHZA 4Y4FB 1KC5H 2QVKA 4YHLH 5E5MB 1KCSL 1DN0A 1A6TB 4QHMB 2Q86B 3GFUA 1CGWA 3K6SA 1WO2A 5F9AC 1L9SA 3V9EA 5I1EL 3BEWB 1UKQA 3HZYA 3HC3H 5E08H 25C8L 1AKPA 3INUL 3F7PC 2BJML 4LAJH 5EBMA 4TNEA 3BP6B 1CBVH 2X38A 1OP3H 2XG5A 2PMZA 5F7EH 3VFTA 4WWKB 3VWKA 5IBLC 1YY9C 4W6YB 1TZHB 2CHWA 3QAZB 1I8IA 2JJUA 3VFNA 1NLBL 3NG5A 4I0PB 2C3VA 3V6OE 4YHZL 3EYQC 1M6UA 3CZJA 1CFNB 2OJZH 3LKNB 4NNPL 3HLKA 4XWOC 5F9JA 3C8HA 3OZKA 4Q6YA 4A7VA 2B9BA 3O8XA 5D7KE 3NACL 3QQ9C 4M48H 1R0AL 4LRNL 2C7UA 3TBYB 4LIQH 4Z6AT 2JELH 3OMNB 4H13C 1PBYA 2JIXD 4H1LA 4XVTH 4WI0B 4U1HB 1CT8A 1XXFC 3HCVB 1UH4A 3IDYB 5KSAC 4L8DA 4L2LA 3LEYL 1ZIBA 4UQ2A 3QJFB 4QJ3B 3Q3GB 1ZVSA 1N18A 3V0DA 4MD5B 5JHLH 4MJ4A 5I66A 1VZGA 2CMRH 5K1NA 5EORL 1ECZA 1WAAA 4LSPL 4YXHH 4DSYA 5DVNA 4W9GC 3QS3A 3UCQA 1IGFL 1MJ8L 1KELH 2OX5A 3K46A 1VGEH 2ARJB 5D70H 2AV7B 3NJGA 1M7DA 4PJCE 3IJSA 4XNYL 5GS1B 4TQ8A 1REIA 5HYSA 4A67A 4HJ0C 2ODIA 2NX5E 1BAWA 3OJVC 2VH5L 1NL0L 1OVZA 5JPNC 2ZOWA 3MRMB 3SDAC 5AVSB 1AYRA 4U6XA 2A4EA 1HXKA 2AQSA 1I3GL 2AABL 4XN9A 3CVBA 3DIFB 3NTCH 4QF1B 3G04A 4LOVA 1RMFH 3EDJA 2R2EA 3LN5B 4JCWA 1F3JB 3AAZB 4WUUE 5B1CA 2X4OB 1S6NA 1BG1A 2O5YL 4OZFH 4XCEA 3P4MA 4N2CA 4RVBA 1S9WA 4WU5B 4KKNA 1TVDA 5CBAA 1MIEL 4PRHD 5HYQB 1NKGA 1M42A 4HPHA 2ISDA 1RZPA 3GSUA 4F91B 3MRCA 5BQDA 2CE6A 3NFNB 3PP4L 3QQDA 1UM5H 3SE4C 4GB9A 2YLHA 3VRLF 1E27A 2ZWLT 4YH6A 5HHQA 2BY1A 1SVZA 2WP3T 4L4VB 3A6CH 1A3RL 3QHFH 4K2UL 4R2GB 4BZYA 1VFAA 2X4RB 2YPLB 3NJXA 1G7QA 5EBWA 2EE9A 3UC0L 5HDQL 1JGEB 5T5FL 1NPNA 1QA9B 1USZA 3PGDB 4P5RA 2FIRT 2FR4A 2A74B 3EHBC 4G8GA 1PQZB 2DMHA 4J8RA 1OV8A 3KHQA 3T4AB 4N2BA 4GG6F 3V6OC 4TLKA 1JBJA 3T08A 1K4CB 5D72H 2VR7A 3MLXL 4D9LL 3QCUL 5JHLA 3R4DA 4KI1A 3AACA 5I6OA 3BXNB 2A99A 2MJWA 4YIQB 2WXPA 5DWUL 2C9QA 2VMCA 3L08A 4AGMA 5EOCJ 1FL3B 4GMTH 2P24A 3BN9D 3GNML 3QXDA 3OC8A 3ILPA 3E3QE 3TVMB 5BW7A 4PS4H 1IVLA 1KJ3H 4BFIA 4MCMA 1URLA 1EAPB 2EDRA 3M7OA 3RVTD 3L4WA 3H2QA 1CXLA 3DGGB 5L6YL 2ZKXA 3EJSA 4HXAL 2HFTA 1NBYA 4WDIA 4OTXH 4WI9A 1C5BH 4XN7A 1Z32X 3DOIA 4WNSA 1F4XH 1UXSB 3M86A 3H9SE 4LLMB 3H0TA 1QLEB 1IT9L 2XV0A 1JGVH 2EEAA 4BHUI 4L1BA 1IFHH 4K5MA 3VYOA 1KZYA 3DSNA 5KYWB 3HAEA 2Q76A 2G4EA 5I71B 3ARSA 4LBEA 2H9GB 1F1GA 1RV6X 3NVQA 3WLBB 2ZF9A 5KSBE 2JTDA 3BZFA 2OSLB 3TBSB 3O81A 4Z7OB 4GAGL 3TN0A 3VXQB 2EDJA 2MEJB 1WZAA 4DKEL 2CDGA 5E4AA 2QKIA 3TOPA 2NNCA 1XH3B 4L3ED 1NDMA 1A14L 1GXEA 3C8KA 4M7LH 2MHAB 1MHHB 1INDL 2EUXA 1P5VA 5C0EB 1NTDA 1XAUA 1SEQH 2E7BA 3POHA 4K73A 4AIZA 3JQOB 1WVZA 1DUYA 3RVVD 3BPOC 2C7FA 2EO9A 1EFQA 3EAKA 1G1YA 1KLUA 3I3EA 4O00A 1IE5A 3UAJA 2FECI 1FCCA 1SXSA 3IDGB 2VMEA 2FD6L 5GZNA 1OF0A 4NLHA 3IXTA 4HSCX 4J6IA 2EVIA 5LWYL 2FIKA 4XO3A 5HJ3A 2ZSWB 2VLJB 2NY3B 2ID5A 4HZLB 3DDGA 4HFWA 2LLNA 2GC7C 3S5LG 2DDQL 2M26A 3DTXA 3C2SA 4WEBH 3TYFB 1WTLA 5FKPB 2E6PA 3FT2B 4AW7A 4XCFH 1UD3A 5ICYA 3F6IA 3QO0B 1KTDA 1NFKA 5D1QA 1XF2B 5I76B 4Q9RH 3DHPA 3JWOC 3RTQB 5BS0A 3SE8L 4Y16B 3DROA 4JPVL 4TS6A 4FFWC 4HULB 5IJBC 1F97A 3U0WH 1KCWA 4DO4A 1ES0A 3VXRD 3MBED 5DS2A 3B2MA 1ET8A 3AY2A 1X6NA 2MQ3A 2WKOF 3E3QC 5IHHA 3R7QA 1ASQA 1BIIB 2LLGA 5AVZB 1G7LA 4AW4A 5A6LA 2ITFA 3NIGF 2C9PA 4E9VA 4U4BA 4AYMC 1DQDH 5I5RA 3P4NA 5K5YA 3G5YB 1XCQA 2KT6A 3V5HA 4AOFA 2OQJB 4PG2A 2PXYC 1BP3B 2RAMA 2V7HB 4APXB 2F7RA 4OLWH 4EDXB 2R1YA 3CXDH 3WFCH 3ARGD 3DXAE 1BFOB 5EF1A 1KC5L 3L3IB 1I8UA 4PSRA 5IMLB 3DX7B 3PAYA 2G3MA 3QDMD 5BV7H 4L5FE 4ZFZA 2IBGA 4PH8A 3C75A 2X2YA 5E00B 2FDBP 2ESVE 1TLKA 3HC3L 3KZ8A 1U3JA 4D9RE 2DTML 4PJ7B 4LSVL 1IBBA 4J3OG 4NQVA 4ZAKB 4K23H 5F7EL 1TZGL 1B9KA 2B16A 3CSBA 3V4VB 4Z23A 4V1DD 5B22A 3U82B 4K3DH 4F1SA 4XAWL 4A6YH 4CW1A 3D9AL 4TUUA 1D2PA 1MRCH 2AEPH 3NCCB 4WFHE 2BDNH 3TLRA 4OZGB 1BBDH 2VLKD 3ZTEA 1WC7A 3QQ4A 1QFPA 4AK2A 2WNXA 3GRWH 2BZ7A 3RNQB 4N8UA 4Q56A 4JVUA 4WTWA 3N40P 3P0GB 1F5WA 4IU2A 4KKLC 3O4LE 4RGND 7PCYA 3QQNA 4L9LA 1JYWA 4C56A 4LIQL 2XN9D 3DX9B 3GSXB 4XVTL 1MZYA 4ZUSA 2VE6B 4G43A 2YD2A 4XWGH 3KDMA 3HVDA 3LJ3A 4QRTB 1F0LA 1TSHA 2A6DA 4Y2DA 3QFJA 2A83B 4NO0A 1BMGA 1J05B 2ZXGA 4U1GC 1T0MA 1EO7A 3N0AA 3BVDB 3HRZB 2PCXA 4G1EB 2AQ3A 4O9HH 5DD6A 1BGXH 1KELL 2D0HA 1RZFL 1S9YB 1VGEL 3N1GC 3QFGA 4ZUVA 4BUHA 2XYCA 3JZ7A 2OMVA 1IAIM 4ZNEA 1CGSH 5F9OH 2YAQA 3K2UH 3W57A 2XY1A 1J9RA 1S7XB 2WXLA 2VABA 4HUXA 5ITFA 3NPSC 3ELQA 3LS4H 2HJLB 1P1ZB 4TPRH 4XCYA 3U30C 3ETTA 1L3WA 4GBXB 1U3HA 4O58H 1F45A 2HUHA 3DOHA 2FQDA 2R2BA 1WZ1H 3NJMA 4EUPG 1CICC 4KTEH 3DJSA 5AOMA 3CZFA 1LLAA 2EDQA 4UAOB 4Y7OC 3ZHDA 1RMFL 3WLWD 5HHOD 4DK5A 4Z7VA 4OM1H 2NY4D 3IN2A 3FPXA 3L5JA 3KHOA 4A2MA 2XWEA 5SWZE 5F7YC 4ES9A 2YJLA 1HDMB 1ZGLP 4RNRA 1QSED 1KJMA 3T5WA 1S9VA 1T0PB 4NHUB 4AYGA 2Y7OA 4A6YA 1FJ1A 2ZKMX 1MI5A 2KC0A 1HZHL 2VR8A 5TDPA 2G5BA 4Y1AB 1FYTB 2VR6A 4XI5C 3NT0A 4K15A 3F84A 2YD5A 2PKDA 1VKXB 3NJFA 5D6CB 1TTBA 1DBBH 1A9EA 2G5RA 1QR1A 1SFHA 3V0JA 1OKEA 4AC4A 3ATBA 4F7PB 2PPFA 1K3ZA 2JB6B 2UX7A 3VI3A 4RQQB 2DWDB 2C5DC 4IMKA 3TA3A 3VXOA 2V8LA 4DQAA 3B7UX 3DLQR 2HT3D 1S7TA 3BUYB 4P99A 3QI9A 3ECQA 1AE6L 4RETB 4HIHA 1NFDA 5D72L 3QQ3A 1KCLA 3O2DA 2AFNA 2DQTL 1L7IH 2DD8H 4KK9C 3A22A 5GRWA 1LO2H 4BWTA 4RGOH 2DQEH 3G6JB 4NC1E 3JYBA 1KV7A 2C9AA 4MB1A 4MNGA 4HLEA 1G9MC 2APWA 2WYIA 2XNAA 4WI3A 2YAEA 2YPVH 3WCYA 4KK8C 5CINH 5H35A 4HETA 4IIQC 4LQ1A 4B50A 1IZJA 5LG6A 1FFNB 2ATKA 4ILDA 5KBDA 1AQKL 4LKCB 4LNRA 4S11A 1QTSA 5KZCD 3UTTE 4MDJA 4B9CA 4X9GA 4Z3TA 2OP4L 2ZNWA 2P44B 2MQCA 2CLZB 3PDOA 2G2PA 1FG9C 3IJ9A 4PJCF 3U46A 3B9KB 4RLDA 1U36A 4KJWC 4FNLH 3DV6A 5DZOA 1G7HB 2ENQA 3FFOA 3QUYD 1AHWB 5C9KA 1DQLH 5L88L 1S7UB 1OP9A 3PY9A 4PGEA 2JKWA 2AEQH 2IWKA 4ZW8A 4YXLH 4WEUD 5FGCE 3MNVA 4KQ0A 1BX2B 1E5BA 1IBZA 5FW8A 1YNLL 4MNQD 1Y6KR 3ALXA 2IAAC 3TEXA 1Y6NR 3GSQB 3HBZA 1BF8A 2V8MA 2OL3H 1HNGA 4PJHF 3G6AA 1D5IL 4HW6A 5HI3D 5C0DA 4RAUA 1AP2B 2BVPA 2IWEA 3R4RA 5J1TC 2KPNA 2IPUK 2X1QA 5KN5A 2D2OA 4QLWA 5KSAA 5I17A 2PW2B 4N20A 3RVXC 2X89A 4HK0B 2CK2A 4JFPB 3GJFK 4NPYA 4AEIL 5J13B 4RDQG 1J0KA 5F7KC 3RNKA 3SPHA 1RL1A 3DX6B 2YXFA 3DO7A 1UD5A 2W5PA 2VLMD 1M1SA 3HI5L 1KIUB 5HPOA 3FHEA 4OCWH 4ELDA 4PCSA 1T3FA 3OKDA 4AZ8A 4JNXA 3QRBA 3WJMB 2ZPKH 4C83B 3I84A 3UACA 3DV4A 4EI5C 5JIHA 2I27N 3L81A 4OT1H 1IC5H 4WO0A 3SJVB 2E7DA 4NBZB 2ZUVA 5HXMA 1RLBA 4I9XA 3KYNB 3OLIA 5LG1A 4JG0H 4JN1L 4UMSA 2DV6A 2A4CA 5HGHB 5DC4B 1AXSA 4AITA 1D7FA 3D39B 3MJ9H 4EQ2A 3TO4D 5D1ZB 3QORD 5AKVA 3D07A 4RZKA 2A77H 4QKTA 1FNLA 3WIAA 4NC1C 2Z31D 1CZ8L 1EPFA 3JV5A 3LZRA 4OB5L 4CVXA 5ENWA 2J8UA 4N87A 4W9DC 1WS8A 2ZICA 3Q48A 3QJTB 1TXKA 2ICEA 5FYJH 2APSA 5BVPH 1ITCA 5D1XB 1YPZB 1QFWI 1S7RA 2Z8WC 1HFUA 2N01B 1II4E 4Y1SA 4JRYB 1SQ2N 1ECYA 3T0EB 1CE6A 4PV8B 3IFOA 1ILSA 5HI4C 4YSPA 2LU7A 3RAJH 4EKJA 4ETQB 3RUGE 4P9HL 2OL3A 3VI4B 1Y0LB 2AF2A 5BV7L 2ZTBA 3U7AA 4YR6A 1CDGA 1PIGA 5EZJB 3PJLA 3PWJA 3BWZA 3TNMB 4KZCA 4Y2NA 1OLLA 5K9JL 3N42B 3V6OA 3FOLB 1UD2A 3GSVA 5KSBF 2D9CA 2VC2L 4DQOH 3LIZH 5C0FB 5DS8A 1JRHH 3ORJA 1Y1UA 4X6DB 3DMMC 5KYYA 5L2KB 1T5WA 2IH8A 2UVEA 4K3DL 4P2YA 4QO1A 4BFFA 3N91A 5IOPA 4A6YL 3RP1A 5I16B 5MENA 5JQ6H 1KZQA 3OTTA 4JM0A 2FB4H 3HNSH 1UTDA 1CDHA 4PLKC 5GHWL 1OGTB 2XXMB 3CXHJ 2PR9A 3L3DB 5D7LD 3WUWA 4A37A 3UPRB 1EDHA 3V4UH 1RZKH 5DQDL 4YBLB 5F3HA 1QFUH 4YDNA 5J6HA 3EGDA 2PP8A 3LD8B 5CJXC 1HAUA 1L0YA 3O2DL 3CNKA 4KK6D 2BW5A 3GXFA 4FTVA 4O9HL 1RZJH 2BH0A 4KAQL 1BZ7B 1E8XA 1R33A 1BD2B 4PRAA 5BRZB 3O2VH 5IESL 1CGSL 5F9OL 3O3EA 4Q9BA 4NM4H 5IBTL 3NK4A 1R47A 4FLQA 4NSKA 4PJAF 2MCAA 4TPRL 1L9QA 2YFOA 2J56A 3EJZC 1JK8B 3GI8H 3SO3C 3LVEA 4AEFA 4GKZA 1P2CA 3LH2H 2NOYA 4H5SB 5ACZA 4Q9QL 2AJXH 3KNBB 5C08B 3PGFL 1XTLA 3WHE0 4EZKA 2KBGA 3F7KA 2X40A 3BVXA 3GMRA 3PXHA 4CC4C 1KF9B 5ELIA 4U05A 2VLRE 1YDPA 3CVCA 1Q9KB 4NQCD 4WJ5B 3U4BH 2OMXB 3A6BL 5IMOA 4CADB 4QRRA 1WGOA 4GEIA 2HKFH 1K8DB 3TP4A 1MCIA 1A7OH 1YY8B 5E7BA 4U33A 1IEHA 2ZCHH 3QXTA 1IAIH 4GAJH 4JQIA 2DQUL 1X7QA 3WEOA 3HE6C 1N59A 1ZLVK 4FYSA 5HDBE 2GCYA 3ERXA 4JY4B 3KPMB 2J21A 1IQDA 2EAEA 2QTEA 3MV7B 3VFPB 4ZO8A 4PYHA 4U1LA 2IVFC 3D18B 3C5ZD 5DQJB 3K1DA 1OK0A 4O4YH 3IDXL 3E6HA 5GS3A 5ILTH 3OAZH 5LNGA 2OLDA 2FQGA 1LO2L 1F56A 3EFOA 4RGOL 2PXYA 2XJLA 3BVNA 2H6PA 4HKZB 1FNGB 4NHCH 5F88B 3EJCA 5FO2A 2TRYA 3GLEA 1DVYA 5FUZH 3V7MA 2OCJA 1CFQB 3AITA 3OV6A 4FG6D 4PRIE 3AW5A 2X6MA 3H9SA 3UGUA 2MPAL 3QUGA 1T66D 2Y7MA 5TTRA 3GMLB 4HUKB 3O6FB 2DQDH 2NY0C 1NC2B 1SFDA 2VDKL 4U1SA 3VFRB 1AC0A 3E8UL 4L48A 1QZ1A 2HFGH 4OJDH 4OSUH 1HHGB 3HPJB 3ZTDC 1UACH 4KY1H 4Z7IA 5I75B 4JFDD 3MCKA 1I1YA 5JXED 1EXUB 2CNYA 1SY6H 3LRHA 4P5KB 2LU3A 4PB0H 1QKZH 3WFEL 3FO9B 5IB2A 1AY1L 4DFIA 1F3RB 3ZQWA 3M1CA 3RDTA 1OT4A 4TNVF 4FXTA 5FCSH 3TN0D 2FBOJ 4LU5H 5IB1A 2WUBH 3VRJA 3AGVA 4FL4C 2FL5A 2JLLA 4NQDD 2OL3L 2FWUA 4JZJB 2GSGB 3QW9A 3BE1L 4P23C 4GG6B 3W2DH 3MLWH 3QWRD 1DO6A 4YO0A 4XMVA 1IBYA 3L3HB 1RLWA 3QISA 2JI3A 3QWOA 3AABA 3MO1A 3IGLA 1T04B 1KUMA 1UVQA 2YGVA 4B27A 5HHMB 5ALBL 2GABA 1NBCA 5GGUB 2ZCKH 3BSZA 1VRSA 1PLCA 1MCPH 2EVJA 5EIQA 1DBKL 4DETA 3UG5A 3IWUA 4H8WC 1EZSA 2BVEA 4JJHA 4UUJB 3P73A 4CA4A 2ZPKL 3IDNA 3ILDA 5I1JH 1Q9OA 4KKBC 1H6TA 4Z0XA 2Q10A 3MOBL 2R69A 2WCPA 4YWGH 2WLLA 3IM1A 4P05A 3WFBL 1NM9A 5E8OB 3QUXC 3MRDA 2MQGA 2HVKB 3REVA 1BVNT 3OX8A 1JI2A 1JNNH 1V10A 3FRUA 4NZRH 3ARQA 3MRQB 1EZVY 4UZGA 4FQJL 4OJYA 4ODUA 4Y2OA 5ANHA 1CICA 5JW4N 4MD0B 4ZD3L 5T33L 2QSCH 5E5MA 4U7KA 2BY2A 2ITDA 4GRWE 5BJTA 3JBG7 4XVUC 3MLUL 1J9TA 5HP5A 1TJGL 2CJUH 3DXAA 5DEGB 3VWJD 4NRZA 4Y4HB 3K5SA 3UP1A 4K9EH 3GMNB 4GW5A 4I13B 5FO7B 4WWKA 1EDQA 5JMOC 1VEPA 4LSSH 3SGDI 2CH8A 2E6QA 2WLIB 2XV6B 2V5TA 2L7EA 1PCXA 3CIAA 4MSWB 3WKQA 4LP8A 4FQ2L 4CMHB 5F3BA 2X1XR 4F93B 1HXMB 3D85B 3QUHA 4KMTH 3MZTA 5J6GB 1AGEB 5FYLE 2IDSA 4ABQA 4QTIL 1TFHA 5L4MA 3VW3H 4KPHH 2O6DA 3AQYA 4ISVB 1GGCL 2DY2A 3TBYA 4G59C 4KWUA 1GJIA 2AQPA 1KG0B 4PREB 3UTZA 1QBMH 2ZAGA 4U1HA 1DEEA 4GUQA 3VXPB 1NIEA 1IQWH 1YMHB 2YKLH 3NP4A 4OVUA 3ZOAA 4B95C 5D7IE 1LEKB 2G0LA 4XAKD 3NJKA 3LRSA 5JOFB 1T4KA 4J3OF 4W93A 4QAMB 2WIMA 5JQ6L 1W0WB 4HMCA 3Q9QA 5EIVA 4OIBA 3BKMH 4IIQA 3K2IA 3STBA 3S8WA 1BYNA 4JQIL 2ARJA 4M7JH 1T2XA 5EUOE 2AV7A 2JCCE 43C9B 4ZFGL 1U8IB 5B4MD 2BFVH 2IEPA 2OMNA 4OIIL 4GQRA 3MRMA 2M2DA 3T4YA 4G5ZH 2K4WA 1SOQA 3CVIL 2R15A 3LS5L 4TUJA 2C3GA 3ZT5A 4YQXL 4A2FA 5J6SA 1QLEH 3S35X 1D9KD 3LN5A 2C4FT 1F3JA 1FH2A 3AAZA 5C0IB 4NZ8A 3S8FB 4LVOB 2X4OA 4EN2A 2D3JA 4KJQC 3UJTH 5TE4L 3FC8A 1OCWH 4YDLC 4WAFA 4P2QE 4PJ9C 4WU5A 2X53A 1NICA 4KXZI 3VGHA 2UUDH 1DVFC 4OW6A 1UURA 3QVAA 3CN2A 4PJFA 1YEGH 5IZ7A 4AMWA 5AAWA 4FE9A 5MEOB 3RRQA 4XOBA 4A63A 3TESA 4N3TA 1OAZL 3FT3A 5C0BB 4K8RH 3NJIA 1QBBA 3SCMB 4JB9L 4S1RH 3LH2L 1RHHB 3L95B 4QXGL 2NW3A 4L4TB 4ZMTA 2R39A 1CFVH 2Z65C 4GUPB 4A7UA 4CBZA 3FB7B 4BQ9A 4XCCL 5GRJH 5JYMA 1AR1D 3PGDA 1QA9A 1EERB 2A74A 2KYIA 4OJCA 5CN1A 4J5VA 3IETB 1JPTH 3OXRB 2W8CA 1I1RA 3RURA 4EI5A 1IC4L 5DMKB 3WIFA 3RZWA 4FXGC 1ZWIB 1RP8A 3X12B 2FEDD 4RMBA 1KGYE 3AY4C 3QSKB 4NN5C 4JKPL 4FFTA 4PGBB 3U2JA 3CDZA 3ZX1A 1F58L 2EILB 1JHKL 3K4AA 4YSSA 2UY6B 4EVNB 3HBQA 4R4ND 4UDTB 5LNDA 1XGRB 1KGUA 2VXQA 5AVRB 2VL4A 3NIFE 1OE3A 3BSZL 4NM8H 1W15A 1RURL 3OKLB 4X4ZA 1GIGL 2DLTA 4JKMA 4XNDA 4O4YL 4N2MA 3B9VA 5HD8D 5ILTL 3VFUA 1IFGA 5DD3H 4JANA 4E5XB 1TU2A 1LE9B 2R69L 1HL5A 4XVJL 12E8H 4NHCL 2F15A 4G8AC 4GPVA 5EN3A 1ZOXA 5KYWA 1DCEA 1TQBC 4S0HA 2O6EA 2FTAA 1THAA 3WLBA 3NZ8B 4LLYB 5DJZB 5E6UB 1QHQA 4HJIA 3VXUD 3AC0A 2FJFA 4B3EA 1A66A 4FFZA 2N1KA 1HJCA 4X5RA 1OTUC 5HPMB 1RUML 1FHNA 2JJTC 5T3ZE 4MRBA 3R1GH 1DQIA 3QR0A 4DZBA 2Y25A 3GSNA 3FTUA 1FGVL 1T7WA 4WKXA 1MHHA 5J56B 5E70A 3JTBA 5C0EA 1UACL 1MFBH 4PWHA 1OP3K 1PKOA 3BEVA 3KPLB 1NEZB 5ANMB 1F8TL 1S3RA 1QKZL 2Q6WA 2YUWA 4PTUB 1I9RH 3HUJF 3C5XA 3ROOB 4IHBA 4HIJA 2UX6A 4Z78A 4DKAA 3V4VH 2X4UB 1UWGL 1F4YH 3BVUA 5M7QA 5C2UB 2QBWA 4HMEA 3B7SA 4ZYKB 3C60C 3NZSA 1CGYA 3CD4A 3EZJB 3GLZA 4RFNB 5F1NB 2WUBL 4S1QH 1HXYA 2J73A 3MA7A 4TTDC 2WC7A 4HZLA 1U92A 1ZS8B 4UM8B 3OM3B 3FONB 5GRZA 3W2DL 3L4VA 1PD6A 3KGRA 3OJMB 3MLWL 2ICWA 1HU8A 4F7MA 4Y4KD 3TYFA 1PSKL 5FKPA 4F15C 3VJ6B 3B2VH 4IDJL 3BGMB 3BO8B 3QO0A 4YZFE 5FW6A 3WIIH 4G9DA 4IW4C 2N59A 2ETWA 2VM9A 5TPWH 4A2HA 2KI6A 2J5WA 1R5WB 3CFDA 1MWAB 3ECVA 2DQMA 1G9ML 5E4IA 1Q4NX 4YHIB 4DEPC 1H15B 1MCNA 3WDHA 1N6QL 2QQLH 4RDQF 3CC1A 4QXVA 4LASL 5HDBF 1T7XA 5L2JA 3UTQB 5KAQG 4ESKA 2HN7B 3MNDA 5C09D 5ISZD 2WNWA 4OCRL 4BZ2H 4NP9A 2C8NA 4AGPA 3Q05A 1PDKB 2J3SA 2V7HA 4RFOL 3PQYD 4EDXA 1ODAA 4WK0B 3BCDA 1YEDA 3FQRA 4BH7B 1JPGB 1KWKA 1XR8B 4AYDC 3L3IA 5DRXA 2QSCL 5KW9L 2QADC 3NDYE 3DX7A 5IMLA 4NYLA 3LKRB 1G9NC 1N8ZA 1R5VB 5HI5D 3BVVA 2JJWA 2PWGA 2WLJA 1JXKA 3H2PA 2CJUL 2X3AA 5B7FA 1NCBH 3T09A 3APFA 3VTTA 4PGCA 4MZRA 4K9EL 4M6MH 1DQJA 4PJHB 3RUGA 2SEBB 3BQUB 2KUTA 2GJJA 4WUUB 3FO2B 1OCCB 4W6WB 5E51A 2AERT 3V4VA 2ZX8A 1CMOA 3U0TB 3N40F 4GUOA 5E1IA 3U1SL 2AXFB 4IBLT 1B3JA 4HKJB 3ZKND 3SEPA 4BA8A 2FX9H 3SQBA 3VD9A 4XP9L 2QDWA 3HE6A 3LN4A 1OB0A 4KMTL 3LPGA 2ZT9C 4P46D 3PLYA 1EFXD 3HMWH 4NN7B 1A0QH 5E99H 1SXNA 5I74C 2VRKA 2O61B 2J20A 4ATTA 4B3VA 2X4QA 1U8KB 4PJBE 1SHWA 3SKJH 5F0LB 1EJ6A 2IG2H 3ZZQA 2CGZA 3OKKA 3ULUH 3WBDA 1X5AA 5H94A 3DJ9A 2NT1A 3N44F 4PY7A 4R3SB 1QUNB 3GBNL 2A83A 3MACL 3BVTA 3I9IA 1UCTA 2NY7L 3O3AB 4XO5A 1CU4L 4JUTA 3A47A 2EIDA 4LLWA 4EN3D 4G1EA 1JTTA 1UASA 3LOWA 5B21A 4AIEA 3KL3A 1RVFH 1ASOA 5AYUH 1QP1A 3R8BB 4KKCC 2NPLX 3H7BA 4OLZL 4ANVA 2P8PB 2D03L 2VXQL 5DS1A 1M2VA 4YGAB 3B3BA 4AL8C 5KVEH 1CPUA 1TOXA 2HJLA 3CU1A 1LQBC 4M7LT 4UI2A 5DR5H 2JKXA 4K5LA 3HR5B 1INEH 2EXWC 1I7UA 5TK2A 2XWCA 4XNZB 1OSEA 3FUDA 3QZPA 4YUEH 2R29H 1JHTB 3HB3B 3G3LA 4YFEA 1AKJB 2PW1A 3QZOA 2WXMA 1QLEL 1INQB 5FYJD 5H2BA 1QQDB 1SMDA