1MNNA

Structure of the sporulation specific transcription factor ndt80 bound to dna
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*GP*CP*GP*AP*CP*AP*CP*AP*AP*AP*AP*AP*C)-3'
publication title Structure of the sporulation-specific transcription factor Ndt80 bound to DNA
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 83
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2002-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 1mnnA00
1M7UA 2EUWA 1MNNA 2EVJA 2EVFA 2EVHA 2EUZA 2EVGA 1MN4A 2EVIA 2EUVA 2ETWA 1M6UA 2EUXA
chains in the Genus database with same CATH superfamily
1QLEL 3AREC 2IWKA 2KQMA 5F0PB 1UADC 4J12A 3CU7A 4P5SA 1D3CA 1UGKA 2BXYA 2DYPD 1FG2B 3BFWA 4MCZA 1SXNA 3QAQA 4QRFA 4MZRA 4LGSB 5T1KB 2V7NB 2EDRA 1EAPA 2Z3FA 3GMRA 1SOXA 2VQ1B 4NM4H 2WXNA 1C5BH 1OP5K 3VA2C 2KDGA 1ZOXA 2V2WA 1OTUD 3WIHA 2VN3A 1RP8A 4KVNL 1I8IB 2W0KA 1YEGH 4UQEA 1CLOH 3F64A 4GMTL 4AGPA 2B1HH 1AR1D 1JGDA 3V0IA 4GRWH 5J12C 2ZXCA 3ARPA 5KVDH 2DQTH 5A2KH 4QMEA 5I1LA 3DOSB 3BD3A 4H1LB 3OKKA 4IRSA 4PBWD 4D0BB 2VDQB 1FSKC 1SOKA 3DX2A 1G9MC 2IH1A 3QAZB 4S1RL 1PD0A 2DPKA 4NKOB 3RWHB 3BWUC 3Q1SL 2C1OA 2F19L 2LR4A 4NQCD 5TDNB 1MCCA 1YPZA 3NJHA 1M9SA 2LV4A 3P30L 4NDMB 3RNKB 1HESA 2DYPB 1T83C 2YKLL 2FB4H 4X6DA 4LHUD 2DWDA 2WLHA 5LNEA 3T77A 1DUZB 5FECA 1T20A 4HHWA 2XTJD 5AVYB 3JBG7 5BUGA 3U0PB 4M43H 3DXAA 4MXQC 4RRPA 2I7OA 1A2YA 2J8HA 3LNIA 3QDGA 4HJTA 1IGFH 3HS0A 1A6WL 5E2VH 5I15H 4B3EA 1OB1A 1PLBA 4L8CA 3QHTC 3O41B 3QORD 3VCLB 4BE6A 1AR1B 3WUWB 1HFUA 2AEOA 2ZD0A 3QJSB 4ZYKA 1SLUA 1I82A 2KS0A 4U4BA 3RX5A 4I0PA 1JPST 1RIHH 1JF5A 1E8YA 1ESOA 4UU9B 4LPVA 1MCDA 1HC1A 3VI4E 3ARTA 4DVBA 5EU7E 5ADOL 4JPIB 4BKTC 1A02N 3IETA 3JWNC 7FABH 5CP7B 5GGQL 4NQCB 2ALAA 3QR1A 8CGTA 3U6RB 4W9KC 4LHUB 3OAUH 1BF5A 3OGCB 2ALWA 4PIRF 4MA7H 2H26B 2BCKB 3LSOB 2XTJB 2FIRT 1IQWH 4N0CD 1AXIB 3GZPA 5C0AD 3VI4F 5EO1A 2CO7B 2DMKA 4LVOB 1PNCA 4H40A 2IJ0C 6FABL 5MEOA 3E6HB 1GGBH 3EOYG 1A14H 3GTVA 1N59B 4QRBA 1SY6H 1MFCH 2X0WA 3QIWC 4R4FH 3AACA 4ZAKD 1KT2B 3D0AA 1KELH 3ZE2B 1E2WA 4IHOB 3DUUB 4WEBL 4XI5D 4L0PB 5AKVA 3N43B 3ASNB 3PXHA 2AW2A 3FT3A 4G7RB 1FYTA 1PG7W 3KBEA 3AG2B 4Q6IA 2CK0L 2HFEB 3DPDA 2A74C 4JO4H 5D7LA 1RIUH 5FK9B 2V9RA 5DSCB 4P59H 3MREA 1DJIA 3DO3A 5EZOL 4PJGF 1AGFB 3O4LA 4F15C 4UDUB 5E1QA 1T0OA 5INCA 3S96A 4YHYC 1F5WA 5K9KB 1IAMA 2GJPA 3F5WA 1K4CA 3TA3A 1NLBH 3O45A 1TTGA 4TSBL 4ZTOL 5E8PA 2BWQA 5CU9A 3F2LA 1K8IA 1AGDB 1CS6A 3I9PA 1LWHA 2J20A 1AXSB 4NP4L 4PHXA 3HZ3A 4XVJL 1JXKA 4U3HA 3OAZK 2UVEA 2DOCA 2QGEA 5J57B 2FX7H 1CCZA 2DB8A 2WQXA 4ZAKB 1KYAA 2YWZA 2G3NA 3FB6B 3HMWL 5DUJA 3AQZA 4JKNA 3LKQB 2IPKB 4AJVA 3QEUB 3LOWA 1X4ZA 1CVRA 4NGHH 2XWXA 4U7MA 5KSUA 1JZ6A 3OG6B 4B9GA 1KYUA 4Y5XB 5HJDA 4N2AA 4J2QA 4UYQA 3TN0A 4XHJC 2BVQA 3QORC 1P5VA 3UTQA 2AVGA 3A4AA 1QVOB 4KHTL 4ZT1A 1AHMA 4HK0B 1Z5YD 3DIVA 3FFOA 1U95A 2HJFA 1A8ZA 5IFAH 4P23B 5HXMA 5EC2A 2EDHA 1OARL 1JJUA 2VKXA 1MRCL 1DJSA 1PKQA 1PIGA 2WXHA 32C2A 3AG3B 3FQWA 4G9FE 5ESVB 4B96A 2R9HD 5HHQA 2BJMH 5D2NB 2AITA 3ABZA 3STLA 4AGLA 5FS5A 2HRLA 3UO1H 2OR9H 1TQWA 1OCWL 4IMLA 1P4LB 2YIHA 4CVZA 1B4TA 4YR6A 1MUJA 4FQIH 1U3HA 1U6AL 3G6JF 4KQ4H 4NQSA 2GIMA 4R7NB 2QKIC 3JWDH 1E6OL 4L29B 3L5XL 3Q6FB 4NKMA 4UDTA 2BH0A 4PJEE 3N3EA 3SJVA 1DFBL 2BVPA 2Y6SD 4MAYC 3LNEA 1L6ZA 1CFQB 4Y9GA 5F7NC 4PJHB 3WKQA 4AZ8A 4OCRL 5I18L 5DEFB 1ZLEA 3KDMB 1CVSC 4G8IB 1H3WM 4ZMWA 1JYNA 2EIEA 3GSXB 3IJ8A 1Z9SA 5E8EA 3VA6A 1DVYA 2WXFA 4AXWA 4PJEF 4ZMPA 4BZ1L 1NFDE 3NQIA 4QRUB 2DM7A 1Q72L 5G4MA 2J12B 4A2GA 4EI5A 3DLQR 1XWVA 3ZQWA 3RIKA 4FXTA 4TQHA 1LDPH 3KPPA 1VGEL 3M46A 5DQJB 1HHIA 4OCSH 3PHOB 1KXVA 3KYKH 2AV1B 3CFMA 5H37A 2AGJL 1NFDF 2X6VA 3EYOA 1VACB 4PJ8A 1UD4A 3BE1L 1TZAA 4G1EB 3A6CL 4ACPA 3MJWA 4XMPL 2B5IB 4Z95H 2HUHA 2G9KA 3LKPA 1EJ6A 3SDDD 2WXLA 4KHXL 1QW8A 1M7IB 2P8LA 4HPYL 3HTLX 1WK0A 4YFLF 3V6ZA 4HOWA 4TSCL 1N64H 1HSAB 3POCA 1KCUL 5E2WL 2BOCA 1XF4A 2YPLD 3NRPA 5HYQB 4F8LA 4YSSA 2ITCB 3FU6A 3QA3A 4KZDL 2PPEA 2KI6A 4R0LC 1JV5A 5DLMH 5E5MA 4QRSA 3W3BA 3IDIA 5FUCE 5HHPB 5DVNA 3CZEA 3ZHLA 3VRIB 3D08A 1C9SA 4PJXE 2AJYH 5I6MA 4HOZA 2FX8H 1YEEL 1BWMA 3QFDA 2KYIA 4LCWA 3N41B 3QQ3B 5F9JA 3GSVA 1MAMH 2VDRB 2XZZA 3ZX1A 4NJ9L 2G3XA 3ZLQC 3VI3A 1T0MB 3L3IA 1HS6A 3CD4A 3X1BA 4PRAA 5E23A 4XXCC 4NOBA 5I0DA 2CGRH 1JNHB 4PJXF 3PP3H 3I3BA 2FHCA 3NTCL 5FGSA 3SO3C 3SDDB 2OPCA 2Y7NA 4Y9CA 1XO8A 3AZUA 1J5IA 1VA9A 1IC0A 4K7PH 3H9HB 3W2DL 5I76B 3SYPA 4S1QH 1W80A 1UJTA 4PMEA 5FGCB 3JVGC 1PAZA 1BZ7A 4HD9A 4FMVA 4RGND 2BRQA 3UTTD 1S8DA 1OAXL 4RAVA 4H8QA 3VXQB 4EIZC 2MQCA 4Y2OA 4JGNA 4ZMQA 4G82A 3E6FB 1AQKH 2VJ0A 4HJGA 4I18B 3QO1A 1A65A 3WFCL 5J13B 1R5IB 3ZTDC 4OUOA 4Z3HA 3MYJB 2A5UA 1QSZA 5D7IE 3RL2B 3M45A 3ROLA 1TVBA 3AREA 4GI8A 4F2MA 4J8QA 3UG3A 4GNKB 1EVUA 1BLNB 1PEWA 1VFAA 2WD0A 4PTTB 3RL1A 3V0FA 3N9GL 3GKWL 4FZEL 4M7ZC 4UT7L 1OAZL 1BVKB 1DBJL 3DVGB 5EF1A 4M00A 3V0VB 2FTAA 5D7IF 1OCZB 4AT6B 3BO8B 5GS1B 3QI9D 2YSSA 1QO3B 1FO0H 2DI7A 5IIEB 1DVTA 2GUOB 4HFUH 3JV6B 3D3VD 1MVUA 1Z9OA 3K7UA 1ES0A 3LKRA 3LS5L 4RGNB 2DQCL 2W0LA 3QPXL 4YHML 1CE6B 2LLGA 4TUKL 2CDGB 1RZFL 4YDVB 1CBVH 3BN9C 4L3CA 4Z8FL 3K6SA 1X5HA 5GZOC 5E08L 4M02A 1ZS8B 1V3LA 4ZPVB 4MLIA 2XWJA 3BDYL 3MRBA 3NT0A 4IRJA 3BAWA 3WL9B 3A4EA 3QISA 4JFEA 4JHWH 3WIIH 4XN4A 3MRFB 5DJ0B 3K1DA 1KPRA 2DV6A 5FGRA 3WMSA 1ZY9A 2FSEA 2MPAL 4Z3EA 1ZE3H 4NHCH 1XL4A 4OQTH 1EA9C 2OAAA 1R3HB 1B88A 1B0RA 3L3HB 4L1HA 4P46C 5TQ0L 3MROB 3P2BA 2J6EA 1EGJH 3UBXB 5IEKB 3QI9B 3V4LA 3OLIA 2YFNA 25C8H 1QKZH 3CFCL 4JQIH 2BP8B 1ORQA 1JRHH 4M3KB 3ALXA 3D3VB 1LMIA 2EZ0D 1WZKA 2A6IA 3KYMB 4GS7B 5T3ZD 2PP8A 3VH8G 1UWEH 2BOBA 3A6BL 3HJ0A 4XXDA 3KPLB 4GXVL 2GJJA 3G5XA 2ZCKL 3K0WA 3LIZL 5C3LD 2HVKA 1RUKH 1X5AA 2LLLA 4NRZB 1KC5H 3L3GB 4R4BA 4NRXA 2MOQA 3G6AA 1LP9A 3T1FB 5ICZA 4KGJA 4G3YL 3D0LA 4HF5H 2NZ1A 2X88A 2YZ1A 3EJYD 3C2AH 2QPUA 5C6TL 1NIFA 3D18A 4TLKA 3ZOAA 1VPOH 5EOQH 1AIFA 3NJLA 4JJ5B 4W6XB 3V0WL 5F1NB 1KTLA 1MJJA 1DJXA 4NQCE 4JRLA 3P3YA 5F6HI 5CMAB 4OZHA 4OD2A 2VXQH 5GGVH 2VWEC 3ECVA 2PCPB 3BZEA 2HXAA 2DJSA 2XPYA 1TCRA 3FB7A 2XTJE 4XODA 3FQRA 4LEBA 5AB0A 5BVPL 1HHKB 3FO1A 2DIEA 3MGTB 4JFQA 3VRJB 5IQ7L 2CHZA 2Y7QB 4JVPA 4A67A 5I66B 4X4XA 1TU2B 1ZGLB 3SE8H 1Q4NX 2J2ZB 5FYLD 4OLXL 3T6VA 1CGUA 1F3JB 3REWA 1CO1A 3BH9A 3T65A 3T4AA 5MI0C 2A74A 4WKZA 1RJCA 3ZE2E 3ARDC 2DQDL 2XKNB 4C59B 4FHJA 1S7RA 3HC3H 2VW7A 1JFQL 5EB9A 2HMIC 1TQVA 4RSVA 4LARL 2IV9A 4XN2A 4U3SA 4FERA 4PV9B 1W0WA 3UYOD 4MJHA 4DGIL 5L6YH 2C9PA 3W0WA 4P4RB 1GY1A 2YGPA 1N8ZA 2IG2H 2NUPB 3IJSB 4XO4A 3VNZA 2VDPB 2A9ML 4MVBC 4M48H 4NT6A 5I0YA 3N43F 3BIAX 2Y3NA 5HYJD 3BT2H 1KB3A 1SVCP 4XXWC 1UQSB 5D1QE 3UJJH 2BERA 1CGWA 3D52A 1YMHA 4KK8D 2D31A 1S7XB 4KITB 3O9WD 1I53A 5CN3A 1XGTB 3L9BA 3MUJA 5GRZA 4XOEA 4A7GF 4XH2A 4BFGA 3V7AE 1T0PB 4LAQL 3ESPA 3IXAB 3TNMA 1ADWA 3SKOA 1IRAY 2CKNA 2RH0A 1O6TA 2HJLB 2JB5H 3HG3A 5IQ9A 4S1DC 4TS6A 4WQOA 1WDAA 4YZFE 1Q9LB 2DLGA 2YAQA 4GG8B 4GUPB 5J6GA 1MCOH 1L9RA 2O6PA 3OJDB 1KV3A 1IGIL 2ICEB 5BOZG 1EIBA 1QBML 4XPHH 2ILLA 4OLUH 3OBAA 2R69H 5IMOB 2OL3B 4D8PA 1QRNA 3BP6A 2GTWA 4ZD3H 2FATL 2CCLA 2WSDA 4QXGL 1G7PA 4YZFF 3ASOB 4NEHB 1N5AA 2QMJA 2NQCA 1MLCB 2QKIA 4ECNA 1J0IA 4B27A 2NLJA 1F00I 4M6AA 1I7TA 1AZCA 4O5LH 2X3BA 4IOIB 3D2TA 5H94B 3RWGB 3VGGA 3E8UL 4E0RA 2ZKHL 3Q9PA 3V10A 3IJEB 4PI0A 4UILH 4TQIA 5TD4A 1MQ8A 2V9UA 1F90H 4KI5D 1SXBA 4EIUA 3BJLA 4AQ1B 2IH9A 5C0CA 2A4CA 3KWUA 4NIKB 1CFVL 4N22A 4NKQB 4MAUH 2FEEI 2EIZA 3RVVD 2VE6A 4C4KT 3WKYA 2JLPA 5KYXA 5IW1A 1JAEA 5FV1L 4JVUA 2IANA 2R2HB 3HG4A 1OSPH 2IQAB 3BH4A 2D7PA 2IBGA 1FL5B 4JRYD 4G8GD 1HXMA 4RNRA 2QT6A 3ARGA 1Y18A 4WU5B 3FSAA 3AB0C 2NZIA 3FFCD 4M7JH 4XTRD 4PJHF 4MJID 3LXUX 3VD4A 3HZVB 1L0PA 1MIEH 3GSQA 3VGEA 5GGRA 3X13B 3ZPDA 3WO3B 2OMTB 1EMTH 3FCSA 4QUOA 1E0OB 4KRLB 3BIBX 3DTDA 2V3EA 1PQZA 3MA9H 4NM4L 1C5BL 4TULH 1FFQA 4NQDA 4DWHA 3LYRA 4ZO9A 3F7YA 5CLTA 4FA6A 4TUOA 4LHUG 1YEGL 4OVUA 4R0LA 3O9WC 1CLOL 5JDJA 2BP0B 4F5CA 2Q7YA 2B1HL 3MMEA 4U6YB 2H2PC 3V4PB 4ONHB 4ZMYA 2C7UB 4HEPG 3CN2A 4ANUA 3NGBB 1IBGH 1G7MB 5KVDL 3GJEB 4U6TA 1JDCA 2DQTL 3NOIA 4XMXA 2GTZB 2FEEL 4JRYB 1L0XA 2Z7ZA 4RGOH 2GY5A 4HIHB 2F8XC 5DHVA 3S88H 3OMIB 4XXCA 4G9DA 4MJIB 4NQVA 5IOPB 4MMXB 3RX7A 3GF8A 2BNRA 5D5MB 3U25A 2CUMA 5I9QC 2NMSA 2FB4L 5K1JA 3G04A 3IMSA 2HVBA 5I71B 2VW6A 3RTQA 4M43L 4O51A 4XMUA 4LRNH 2QEJA 1MWOA 3JVGA 1PL3A 5KYNA 4AMXA 3NEOA 1U42A 1OAKH 1Z9MA 3BPNB 4KX9A 4DK5A 3N41F 5I15L 1JUFA 5HGBA 1WAEA 2D7TL 2LAAA 3INOA 3K74B 5E94A 4ZFFB 5GS2D 1HTYA 1GR7A 2X9WA 1DBAH 3BZ4A 2GHZA 3BVDB 4KKAD 4L37B 1CXHA 3NFNB 4LK4A 1PBYA 4Y7OC 1OTSC 3V7AG 1T7XA 1KACB 4YWGH 3CK0H 1RIHL 3N1GC 4OAWA 2NXZC 5JPNC 5IBUB 3VGBA 3K6FA 2K3HA 3L81A 5FA3A 4ADGA 5B7EA 4FQLH 5C08A 3OKMB 4C83B 3RVVC 7FABL 1PEZA 4BA8A 4ENED 3GXNA 3OHXB 4AQZA 1JERA 5KYWB 5AAPA 1GIGH 2IH8A 3OAUL 4TMPA 2N1TE 3SKMB 4MA7L 4A2MA 4H25B 3A0OA 2YOCA 4I3SH 4MBRA 1IQWL 1KBBA 4F2EA 4WJ5B 1I1FB 3N06B 5A3ID 4XTRC 4Y1SA 5DC0A 5I1AB 5KANG 3BP7B 1QFWM 4N87A 4BZ2H 5EO0A 1WBZB 2R2BB 2YMXH 2IH3A 3C5ZD 3U9PL 4J3OC 4Y2NA 4QHNB 3UFIA 3NP3A 4BWTA 5CFAA 4X99A 2CJSA 4O2FA 2WCPA 5F7UA 1GGBL 4LESA 3FQ2A 4OGXH 4UT6H 1A14L 1G6RB 5BZZA 1SY6L 1MFCL 4R4FL 4MNHA 2XWZA 1KELL 2AMGA 1GYCA 2QDVA 3LKOA 4RGNE 1IVLA 3FN3A 1IBDA 1QPKA 1FVEB 4KK6D 3VM7A 5E9DD 3OLEA 1RLBA 3GXIA 3OMNB 1WISA 3D2UA 4M7LH 5J06A 3T1WA 2WWKT 2P26A 4X0KB 3VX0A 4NO2B 2OSYA 4G6FD 4JO4L 1A6TA 1RIUL 5JOFB 2YJLA 3SYAA 4P59L 3FRPG 3PGDA 2C9SA 3D0VA 5IQMA 3MRQB 1ZSDB 4BZ1A 4LCUA 3F7VB 3PWUB 4NN7B 1OPGH 1S9YA 3I9AA 1G1CA 1UA3A 2W65B 4PS3A 2WYHA 3L9EA 4IBTA 1NLBL 1U8PA 2LU7A 3HZMA 4LL4A 3M7FB 3LJ3A 2AXWA 4OI7A 2CO6B 2VDLB 2ZSVA 3C5ZB 5TK4A 5CCGE 2E6JA 5F97E 4UOQA 1CGTA 4APXB 4LSQH 4HBCH 3K2KA 2WTOA 2FX7L 5JO5B 1NGXA 4N2OA 5EBWA 3D3VE 4IDLA 4XGZB 1AGCA 2H7WA 1XH0A 2Y7OA 4GKNB 4JZJA 4NGHL 4F7TA 5E9DB 4KZEH 4AIZB 3LVEA 5C6WH 2E86A 1QZNA 3CFDA 2CHXA 3TBBA 5JIPA 2GJZA 4G6FB 2Y2WA 5TH2A 1JGLH 5IFAL 4KUZH 1QBLH 5B3JE 3K8LA 5DK2A 2P5ED 5CBAA 4JKLA 3HG1D 4DZ8B 1U58A 4ZXBC 4OCWH 2BJML 5FUZH 3MCKA 4PY7A 2VAAB 5GISH 2OZNA 3GTTA 2OR9L 4LCIH 4QHPA 4WJG3 2LVCA 3UO1L 3FULA 4J39A 3VXRD 3KVQA 3STZB 1ICTA 4FQIL 2WIIA 4KQ4L 4N0FB 4Y19A 5KS9A 2EC8A 2ODHA 3JWDL 3BFOA 3TF7C 2QR0B 2AEPH 3PV7A 3FNKA 4U31A 1NCBH 4PGEA 4DO6A 2ED7A 3RY6C 4QDGA 4QKTA 1S9VA 3SDAD 1WG3A 4FX5A 1FNHA 4XN8A 4YHNA 1KMGA 3QNZA 3T8VA 5T3ZE 3OM3B 3II1A 4AIXA 3VVVA 2HKFH 4HUXB 2R39A 4O02B 1JGVH 2BY2A 2VSCA 2J43A 3AWEA 3MR9B 3P4LA 4L3EA 3WHE0 5EBLA 4E5XA 5I1JH 1HOCB 2YXWA 4I88A 1XDTT 4GLRI 5KSVB 4QT5B 1OOWA 5FO8B 3P73B 3O11B 3PAYA 4FXGC 1W8NA 1LDPL 2P5EB 1A7OH 1R3KA 3HG1B 2EXWC 3FOMA 4JM2D 4LEEA 4CN1A 1LTXA 2EEXA 2BXZA 5LGHH 2GC4C 3KYKL 1O7SA 3IDGA 4HSCX 5DJAA 3QXVA 2V8MA 3X14A 2XPGA 4OKDA 3RTLA 4I5BA 1V05A 2FR4B 1RULH 1P7QD 5B3NA 5DS2A 2JFCA 4WTQA 4Z95L 1DSYA 1YAZA 2CM5A 5ANHA 1AP2A 1JWUB 2JXMB 3OD3A 5TPWH 1FDLH 3SDAB 4LLDA 2BHUA 4U1JA 3L9RB 1SDYA 1JVLA 1WQVT 3H2QA 3ME0B 3QXDB 4PR5A 3ZR5A 3IVKB 5I16A 4JGJA 1KJVB 1MJ8L 1N64L 1QUPA 1X6LA 1XX9C 5DJ6A 3U7YH 1VKXA 2CBOA 4GP5B 2YMTA 2APFA 3ZYZA 2OMVA 5E00B 1MW3A 2ZOKA 2K45A 5AVZB 2BSED 5IVZA 3VM5A 2N01B 3U30B 1B6UA 3ZVVA 2IGFH 5DLML 4U6XA 4OM1H 5I6KA 3K4DA 3WIAA 4MB1A 1PS3A 3FSWA 5SX5K 1BVNT 4PU2A 4BA0A 2AJYL 5JOEA 1P6AB 2FX8L 4JM2B 15C8H 1TJHH 4MKMA 3MRNB 1MAML 1SXAA 1N6QH 4WI2A 1Q9WA 1T5WB 3DBXB 2FHBA 3L54A 2R8SH 2CGRL 3TCLA 2R7EA 3VW3H 5IBLD 3BP4A 3V5HB 1ZRUA 1PZ3A 2FWOB 3S98A 2W95A 3HI6H 1LE9A 2C9XA 1GZQA 2M2DA 5BRZA 5FW7A 3VMPA 1ZMYA 1RU9L 4JDVB 4MNGE 3HR5A 1AANA 4S1QL 4R96B 3QS3A 2ADFH 3KPOA 5AW7B 4JNXA 1V3KA 2WVTA 3HCVB 4H88H 1YYMH 5GS0D 4Y4HD 4IGBA 1MHCA 1MFEH 2VYRE 3E2HB 1M71A 2GJ6A 3UBXG 4HPHA 3RDJA 1IKNA 2CNYA 2A6DA 1VADB 4KAQH 1AQKL 3FT9A 2DDQH 4O9HH 3PGCB 1QTPA 2JQAA 4YFLI 2Q6WA 3X12A 4HKJB 4N8PA 3W38A 1Q1JH 4DEWA 2I60H 3EO0B 3SN6N 2FE0A 3LIZA 4WK4B 3EJJX 2CR6A 3CFUA 5DMJB 4ZQTA 3RGVC 1WJ3A 4HWZA 3ZRFC 1K6QL 1DLHB 1HXKA 2X70A 4JPQA 4PGJA 4HC1A 3H7BB 3NCMA 2WBKA 3ZUCA 3BIKB 3TPKA 1WZ1H 3QXWA 5HHXL 2WQUA 3HLAA 4A2LA 4G83A 1CFNA 1I85A 3T2NH 1RZ8A 1E42A 1FO0L 4L48A 1O6VA 4OFQA 3T0WA 4HFUL 1N0LA 3HC4H 3MJ8B 1X7SA 2IGLA 2OA9A 1BJ1J 1BX2B 4ZX5A 4TL5A 5D1ZI 4Y4HB 4G6MH 5C09D 5HGDB 4WNQA 1CBVL 4KROD 1CTOA 4N0YH 3JWDC 1BQHA 1AFVH 3H0TB 4X5WA 4CADB 1X9UA 4AJYV 4WGVB 1C8QA 3WIIL 4JHWL 3C5SA 4KI5F 1SUHA 4MD0B 4JRYE 3MA7A 1DQVA 4F3FA 5BUAA 3N1QC 3OX8B 1YUHA 1A3QA 4WDIA 3ZZQA 4PTUA 4E41D 3N1MC 5BS0A 4HGKC 4NHCL 4AVJA 5FFGA 4OQTL 3V0EA 3ABMB 4Y2DD 4KO9A 5D5ME 2RQ8A 2WO3B 3MRIA 3Q1EA 5IW6B 1SLVA 1X9QA 5EU7C 2X6CA 5FO2A 3E1ZA 5C9JB 3R1GH 1EGJL 4YS4A 1HHJB 1RPKA 2VGLM 3GSWB 4HKXA 25C8L 1QKZL 4JQIL 5HGGS 1I3VA 2DM4A 5B39B 3MJ7A 1JRHL 1NMCC 3VYPA 4O2EB 2NY4C 4QCIA 4NAMA 3I6KA 1UWEL 3M1BB 1CB4A 4AGNA 4CC4C 2Z64C 5BZDB 5D5MF 3OKEA 4AI7A 3DTXA 4JO3H 3QUXD 4KROB 3BLPX 5AB1A 1SVZA 1MJ7H 1S7QA 5E6UB 3SO5A 4DH2A 1UOVA 1RUKL 2VC2B 1KC5L 5T1MA 4BFIB 4HF5L 3GGWB 3WMPA 3EYSL 5E1HB 5LUMA 3ESVF 1KNOB 4GEJA 4L8SB 4R7LA 5M7QA 3WU1A 3B2MA 3C2AL 4IU2B 2F54A 4RBPH 3HI1A 1VPOL 5EOQL 4BDVA 4E41B 1T7YA 4WEUD 1VJSA 4PS4H 3U0WH 3WEBA 4Y2DB 2DH3A 1KSRA 2EDQA 4OW6A 4TVSa 3EGDA 1EEZA 2VXQL 1BYPA 5IK3A 4JFFD 1IGJA 5EBGA 1P5UA 1ZPLA 1ZT7B 3G5VA 5BRPA 4GRMA 2CRZA 4HU8A 2JSFA 5C2BH 1IUZA 1PD1A 5ECGA 1CMOA 4ODWA 4CBZA 2XVGA 3SE8L 4R7DA 5ITBH 2X4QB 4AQOA 2WGNB 1QFWH 2AK1H 3OSKA 4M8VA 2F68X 3QUXB 4N2NA 4OD1H 4OJYA 2B16A 4PRIE 4AY0A 5D96B 5F7AA 4DO4A 2X53A 1WZLA 1QI3A 3D9AH 3V6FA 3HC3L 1JVOA 4PLNC 2H0JA 2WN2A 4UQ2A 2ZOWA 5A40E 3BUPA 2OK0H 1U91B 4DQAA 4ZZFA 5L6YL 3CHOA 4NZRH 2IG2L 3RRQA 2FT8A 1MG3C 3EYQC 4J6IA 4WUUB 3QJFA 1OANA 4GW5B 4HMCA 3SBWC 4BZYA 1JIBA 2OSLB 5I1KH 4M48L 4HKBA 1G7IA 5F3BA 4PJ5D 4JFFB 1PG7H 3BT2L 1AS6A 1MZZA 3UJJL 3WJLA 4JY6A 1LVEA 4AYFA 4Z77B 4QOKD 1C16B 3FCTB 2X4SA 1K4DB 1Y6KR 1X9LA 2UYLA 2R83A 1LD9B 1NCCH 3P0YL 3MRRA 3LV3A 4UTAH 4FKKA 3EGSA 4JHUA 5C0DA 3WEOA 1P7KA 5HYEA 2JB5L 1A6ZA 4WTXA 5KSBB 2Z93A 4B6ZA 1U92A 3U2SA 3ZMRA 1MCOL 4PB9H 3E1F1 1S9WB 2P46B 3I9IA 1BLIA 1N0XL 2HJKB 4P2OD 4TQEH 4XPHL 5CP3H 5EUKA 1TTUA 4N0UB 2MWCA 1IZKA 4ZXBA 2EKSB 4OLUL 5DJCB 4XO3A 2I5YL 5DYFA 4JFDA 4ZD3L 2LOEA 4URKA 1UZ8A 4OLVH 5I8EB 1XVSA 2YA2A 4BH7A 1II4E 4PJ5B 5LGJB 4Z7UB 5EU6E 1DVFB 2IALA 5EEZA 1F97A 1NWPA 3H4FA 4OCMC 2GK0B 3DK0A 4O5LL 3SE6A 4R26L 2J5LC 4GKSA 1O75A 3TZVA 2X0VA 5DRZB 4QOKB 1B4JH 1UXMA 1NDMB 5JZ7D 5GRXG 3LN9A 2ZYSA 4UILL 1QNZH 5IEHB 1ZE3C 5JPMA 1A47A 2WN3A 4ORZC 3UAJA 4PFEA 1W8OA 5IKCB 2YD8A 4P2RD 3WKMH 4MAUL 4QTHB 1HN1A 1A5FH 5CEXA 4JCWA 1V10A 5HJGA 4I87A 1NOLA 1E5AA 5AKSA 1HE8A 1HEZB 3A47A 4KO5A 4P2OB 2YGVA 1JPFA 1RXLA 1BYOA 1SEBA 2BIIA 2CJ3A 4LSRH 5FIEA 1KCSH 2F7RA 1OSPL 2ATPB 4GY4A 1T5XB 1UC6A 3ZQXA 1WYJA 4O58H 4DP0X 1DJGA 4M7JL 3PFUA 3JUYA 2P5EE 4K5LA 4CSPA 4K5OA 3WTXA 1XH3A 3WIFB 1PKOA 1JPGA 1U36A 1MIEL 2XN1A 3QG7H 3EDDA 3UCQA 5IBUG 1EMTL 1WZMA 2ARWA 1XGQA 3NSDA 3MRKA 2BZDA 3MA9L 1Y6NR 1EAJA 4TULL 3OC5A 4N86A 1HYSD 4Y16D 3IDMA 1ID2A 2X38A 1IAIM 4XCNA 4JRXD 2YK1H 1HWHB 1E28A 5HVGB 4AUYA 4M7KL 1PU0A 1DHKA 4P2RB 1NCWH 3BGFC 2GSMB 4RVBA 1CLYH 3GMMB 2WAHA 4U6VH 1FFNB 4YDMA 5GRUH 1THCA 6PCYA 1IBGL 3KNBA 4LCYB 1SY6A 1MCFA 4PD4K 2G4EA 5AOJA 1AHWC 3W56A 4PJBB 2Q76A 2EH8H 2X42A 4RGOL 3F6IA 4QPEA 3VFUB 4ORGA 1P9MC 4YDLC 3S88L 4JHZA 3UIZA 1P2CA 1OB0A 5KJ4A 4WU7B 2B14A 2G5BA 3IEAA 2AJZB 2B39A 1OTTD 1RL1A 1MH5A 2Z92A 4WTZG 1HQRB 5K9JH 3LNGA 5E1IA 1HEJC 4NCC1 5CIPA 5DZVA 1FNLA 3QGVA 1FL3B 3UTPD 1LWJA 3H3KA 4LRNL 1BQ5A 2H2SD 3K5SA 4CMHC 4WK0B 2FO8A 4Y16B 3FH5A 4ZO8A 3UAEA 4Q6KA 1OAKL 4JM2F 4JRXB 1KJ3L 5DUMH 4OFKA 3PHQA 1N5YL 1JI2A 4JFSA 3QXUA 1YZZA 1DBAL 1DE4A 4YSTA 3U9UA 5DHYB 3CFKA 3ABKB 3CSYB 4FQXD 3BCDA 3CK0L 4H20H 4LSPH 2V9TA 2XQYK 2ZXDA 3DJ9A 3NIFB 3LRSB 3RGVA 4YXKH 3I6GB 4JHVA 2VM4A 4NSKA 4G8EB 4FQLL 1W72H 4N25A 2Z31D 2VLJD 3FK3A 2WBJD 3KJ6H 2P80A 5IFJA 3VACA 2XETA 2K70A 4GIAA 5IV2A 1MQKH 1JD9A 1BGXH 5K93A 3S48A 3HN8A 4HV8A 3A22A 4KZCA 4LLVA 1GIGL 2XI9A 1G7QB 4Q9QH 5DVPA 4I3SL 4HOMA 3B2XA 1KJ2H 2N7AA 3VXTB 1U8CB 2NQ3A 4I4WA 4BZ2L 3QW9A 4JB9H 3DX4A 3U0TA 3F58H 2IDUA 3ZTEA 5IMMA 2O6DA 5D6DC 1PY9A 1UUNA 3ZRSA 2NY3C 5L9DH 5LXGH 4OGXL 4UT6L 4V1DB 4X2UA 1N67A 2Y5TA 4AUUA 5JW3H 3V4VL 1XH1A 4KY1H 3GXDA 4WY7H 4FQXB 4HCGA 4YLBA 5F88B 4YFDB 5JNYB 1DQMH 5FYJD 1KLGB 3CZLA 3ZL1A 3NSYA 4M7LL 2WVVA 4N6RB 2QQQA 4LVHB 1YDPA 4N5ED 1Q9OB 3S37X 2DIBA 4QR7A 2GITB 2Z31B 5DZNA 2E7MA 2VLJB 4BCZA 5FFLA 1RZQA 3KLAA 4IM8A 2WBJB 3FO9B 3ULVH 4WLCA 1WD8A 1SJXA 1VEMA 4C56B 1OPGL 3LRLA 4X6FB 4AKOA 3VWKC 3NUKA 2MNUA 5J1AA 2X2JA 2ZG3A 1BG9A 3RB7A 3MRJA 3TIEB 3FHEA 4YAQA 4YMPA 4LU5H 4FQQA 4TSAH 3WDHA 4CC4A 5AENA 4RA3A 2AQQA 5HJ3A 4LSQL 5DRWB 2N1KA 3G08B 4HBCL 2YEQA 4EDXA 4FXKC 3SPCA 1DQJB 3DX8A 3S3JA 3IGLA 1KIUA 4Q4EA 1F1GA 4JGMA 4OLZH 2VSDA 5IVNA 2F1AA 4EVNB 4WI9A 4CSZA 5ES4B 3CSTA 4KZEL 4A6YL 1PLGH 2NNAA 1NDTA 1K8DA 4OZFB 4ODXA 1TTCA 1YQVH 2ADIA 2CAKA 4ABVA 1ACCA 1JGLL 4P05A 4X7TA 1XH2A 1CYXA 5T1DH 1XHHA 1PJWA 2PWFA 4FQJH 4IRZA 5IR1B 3AY2A 4KUZL 2IGTA 1QBLL 2IC2A 4FG6D 4AYEC 3UTSE 3BPCB 5LAXB 5K1VA 4OCWL 1ODUA 2EYRB 5FUZL 2HT4D 1WC7A 1OGPA 2A6KA 4Z9KB 5GISL 5LCVA 2IWEA 4Z7IA 4E41E 2FIKA 4LCIL 3VDCA 3BW9A 1SVBA 4OLWH 5IZ7A 2OLDA 4YL9A 2X6UA 1SEQH 5EC1A 5TDPA 4LPUA 1YMMB 1NC2A 2GI7A 1JZEA 2AEPL 3NJKA 1NCBL 1U8IA 1WV7T 2IAMD 3KYNA 2C9AA 5L8LB 3IS1X 4NX0A 1DANU 2GBVA 1S7WA 3B5GA 5MP6H 2X1WL 3FUFA 5D1QC 3US0A 3TURA 1EZLA 2YKKA 2HKFL 3NEEA 3TVMC 2WXQA 3RBSA 4PJ7B 4AENA 4P5TA 4H5SB 4NUMA 2R23A 1JGVL 2XWDA 3MDJA 4HDIA 1OK0A 5I1JL 2FEDC 4KRMB 2HRPH 4JFOA 2JCWA 5BW7C 3QCUH 3FTUA 4NAJA 1MJUH 3MX0A 3ZR6A 5I8CB 3PL6D 3BPLC 5AOZA 1LYQA 2A9DA 3CUPA 3QJOA 1A7OL 4LVNB 2OXGB 2NR6A 2AJ3B 1CYWA 4N5EC 4B97A 2GBUA 2VMEA 5LGHL 1D2OA 1A4AA 3UBXI 4G9FA 3GS7A 2B59B 3DMMD 4WUUE 4ZMAT 5CCKH 1DJYA 1ZHNB 2FCBA 5GSVA 4RMSA 5DFAA 3D51A 4Q2ZB 1RULL 4X98A 5HDOA 4DNLA 1KEGH 3SPHA 4P23C 5TPWL 2IAMB 2H4EA 2GAZB 1SJEA 1FDLL 1VIWA 4MMZA 3T8XB 2AXHA 2WKGA 4J3BA 3ARBD 4JG9A 4XNQB 1ORSA 1R5VA 5ID0A 1FZOA 1QSVA 4IBWA 1RJZB 4WWPA 4JDTL 1SHWA 3U7YL 5KSAD 4DVRH 3GB7B 4U1GC 1FO0A 2EADA 3OQ3B 1QLFA 4ABUA 5EOTA 1DZBA 3GM0A 3O3DB 1QACA 2IGFL 3SQBB 4OM1L 4IIQC 5AG8A 2V7HB 3GJFB 3VSQA 4YHOH 3PL6B 1F3DJ 1L9SA 2JK5A 1MVYA 1NFDA 2IWGA 1SNRA 2G9HA 4N8CH 2CALA 3TYFB 3RVTD 4MA1C 4N0UE 5CINH 2ZKMX 1PG7X 15C8L 4GSUA 4X6BB 1TJHL 5JHMA 4JFYA 4FXLA 2R2EA 3DMMB 5KSBF 2A73B 1N6QL 4BWUA 1NANH 1Z66A 4PJ5E 3DI2B 1CK0H 4Z7UE 4L1SA 2R8SL 3VW3L 1Z3RA 2FSDA 5BVJB 5BOPA 1JHKL 3VH8A 4OQTA 4ZFOB 3ARBB 5C07E 1HNYA 1AMYA 3UBGA 1TZHB 1D5MB 1SXSA 4AKQA 4ZNEE 2ADFL 3PV6B 1EGJA 3MO1A 3EF4A 5KSAB 5T1LD 2APVA 4H88L 4Z7UF 5AW9B 1YYML 4JQIA 2Y22A 5EIIB 1MFEL 1YNTA 1T6BX 3MRGA 1BMGA 1DVQA 3EF7A 4KAQL 3CSGA 1H8SA 2DDQL 4CU6A 2ZWSA 5DMKB 2I60L 3LKNB 2VOTA 2QQLH 1QBBA 1UD6A 3VG0H 2P7TB 4TVPH 3Q9QA 3SBPA 3FSVA 3R0NA 1R1CA 5DURD 3QQNA 4PJXA 2YC1B 3C8KB 4X4ME 5AZEH 1K72A 3GEFA 3FJTA 4RISH 1VZGA 4PVMA 2WKOF 2H5UA 4XNMB 1H3GA 2V17H 4RDQG 2MHAB 1NM4A 1LO0H 2CD0A 3GHBH 3D06A 1WZ1L 3MRHA 1DN2A 1TTBA 3NZ8B 4DKDC 1OAUH 4L9LC 3X11A 4ZX6A 1BOYA 3O4OC 3CBRA 3T2NL 2KZWA 2OMYA 3SDYH 2VXQA 3MACH 1EBAA 3MRLB 3HC4L 3FB5A 4U6HB 1QHQA 2VAJA 1ASQA 3SPVB 1TJMA 1H8NA 4G6ML 1QAWA 4PD4J 1AHWA 2VLLA 2VR5A 1Q9KA 1G5GA 2ZUQB 3B9AA 3MLVH 4P2RE 1E6JH 2DS4A 4K8RH 1ZA3A 1N68A 2ZE0A 3KLQA 3Q43A 4FYRA 1NCUA 4XVUC 1HI6B 2ODIA 4L18A 2XWTA 5K9QI 1JWSB 5DURB 5IMLB 1A1NB 5JHDD 4UNVA 4TNGA 1LE5A 2VL5B 1NTDA 1TT6A 4HAFA 2YHGA 2O30A 1KJMB 4NCC2 4I1PA 2VO5A 1RVFH 1OL0A 3RP1A 4HIJB 3N0PB 3TBYA 1AD0A 2J56A 3R1GL 35C8H 2GQHA 4P04A 3ZE1E 4DJMA 4AYMC 2V2TB 4WWKD 2ZICA 4PJBF 2HFFB 2AEQH 5HI3D 3BRGC 5KN5B 1FG2A 1L7IH 1PJ9A 3ZGHA 2NY6D 4HLJA 1EZSA 4DN3H 1NUFA 5AW4B 4FA8A 1H9DA 1JK9A 2EIJB 1G5AA 3KPNB 4M61B 5A2LH 2ZF8A 4FL4B 4JO3L 2VTFA 4NO5A 4QY8B 1MJ7L 5KEZA 4BQBA 1HOEA 4DIXA 1D7CA 4WFED 3DO4A 4OJEH 1W2KT 1IJ9A 3WTVA 2MQGA 3ATAA 3HG2A 5DJ8B 3L4WA 5JHDB 3QHZH 3O3BB 4ZUUA 5H2BB 3W11C 4EZKA 1FFTB 4OF0A 2PKDA 2X4NB 2Q3XA 1Q38A 4F8PA 4G5AA 1V8HA 3DOSA 3U0WL 4JFUA 4Y5VB 1AOHA 4RRPM 2R69A 3TGXA 2VJXA 4JN2B 4JZNA 2Q86B 1ID5I 1UD3A 5A16B 5CGMA 1A4KB 1HHGB 4TOYH 4HS8H 1YY8B 5TDNA 3I74A 3US1A 1H5BC 3NIFF 2JKLA 4PS7A 3NPSC 3RNKA 1GGTA 5C2BL 1JMXA 2NY6B 5ITBL 4MYPA 3DK2A 4Z3FA 1QFWL 2AK1L 1CDUA 4ZMXA 2OMXB 3EGXB 4V1DE 4OD1L 4YBLB 2DJUA 4AEEA 2KH2B 4YXHH 2KLRA 3QDME 3C5JB 2OJEA 3D9AL 1S4IA 1P6FA 2A77H 2WY3B 5LWYH 2EDWA 4MCYA 5C0GB 3L17A 3MLRH 3FONB 1ZDSA 2OK0L 1IT9H 4RMRA 3ILQD 3VWKA 1IZJA 2EDNA 4NZRL 4YSPA 1YN6B 3P40A 1GA2A 2J8OA 4XNBA 5CCHE 3I02B 4JO5A 5SV4A 4WI3A 5I1KL 5DUPH 3MZGB 2Q20A 4PJ9D 1S9XB 4QLRA 1AH1A 1G0XA 4C56E 4EUPB 2P9RA 1PG7L 5CP7A 4FYSA 2JV6A 3FL7A 4G7VH 5ISZD 3GUFA 1TQBC 2SODB 4FXKA 4M93B 4P5KB 3QWQB 1V7NH 5DUBB 4LHUA 4I85A 1E8ZA 4QI3A 1NCCL 2H26A 2BCKA 4UTAL 4P07A 5FOJA 5CD5D 4HEPA 3WCYA 1S7SB 2CO7A 2WLYA 3AXLB 3F83A 4WWKC 2E5EA 3Q7JA 2I26N 4HH9A 4K3HA 4LVHC 3PWPD 5IHBA 1I1RA 3CHXA 3ESOA 3RHWF 2D0GA 4U1SB 4H26B 4PB9L 5FYJE 5I6NA 3HJEA 4KNTA 4TQEL 2PTUA 3DUUA 3CU1A 3L3KB 4WEMB 5B1JA 1FZMB 3JZ7A 2QSQA 5F1IB 3D34A 4OLVL 2LFGA 3PWNB 1AZNA 5GZNC 2Q2EB 4W4NA 1JZ2A 1I7UB 4DP7X 4YVUA 2AHIA 1PZ2A 2O26U 4PJ9B 4YE0A 5CSGA 3OF6A 1S5IH 5AYQA 2NY0D 2OMWB 4WGWB 3FT0A 2D7QA 3MLZL 4M56A 1AGFA 4GQRA 4OIFA 2NW2B 4UDUA 5ISZB 3T0ED 3UO8B 5I19H 2W0PA 1GVIA 3SEPA 1RUAH 2DWTA 4NN6B 1B4JL 2KLTA 4ZPTB 5IQLA 2XXFA 4PJCB 5D1QA 1KDIA 4TNWK 3VD9A 1YMME 4QRPE 4JPSA 1FCCA 3AT9A 3CLEH 5AAMC 3VSVA 1QNZL 3SGDH 1DBKH 4X8CA 3ETTA 3T4YB 3IM1A 3IMWA 4ENZA 3QT2A 3WKML 1CD1B 3O8XC 3PWPB 3QZPA 5BW7A 1A5FL 2WXRA 4RMUA 4L4JA 4PJ7E 4PWGA 4K9JA 4TN9A 2OTWA 3P9MA 1D5RA 2IXQB 2NOYA 4LSRL 1KCSL 3ZKXC 3WEAA 1V7MH 5SV3A 1AOZA 1U8MB 4GUCA 4O58L 3DARA 4IMKC 4HW6A 5L0QC 3S2AA 4AQEA 2J5WA 2TSBA 3BGMA 4HK0A 1FUNA 2NY0B 2PYEE 4PJ7F 1MAJA 1UH3A 5CJOH 4P23A 2YN3A 3T0EB 3RY5A 3IGAB 1KPVB 2A99A 4X9FA 3VG9B 4BSVB 1WGOA 1BD2A 2AKRB 5KVFE 3ZHNA 1GTNA 1P0SE 4NKIH 1R3LA 4BKSC 1EBPA 1EJ8A 5E0QA 4ODVH 3OWEA 3QSKB 3GLZA 4K5PA 1IM9D 5AFAA 1E4XH 2A9AA 4NYLB 3WO4B 2AV7B 4R7NA 2BC4B 4BZ2A 4G5ZH 1L9MA 4L29A 4PHZA 1NCWL 1YUKB 1MZYA 2CLRB 1CLYL 1R3JB 4IIQA 2ZX9A 4PCKA 4G7SB 4D0DA 1Z7JA 1ZIBA 2EDLA 5GRUL 4KTEH 4UT6A 3FRPA 1CFQA 4M5TA 4FYQA 5ICYB 2FJFB 2XX0A 3GMLB 5D6CB 5F7FA 2EH8L 4AQAB 3JTSB 2DWEB 3NIDE 3IXTB 4K7FB 1XMEB 4AVIA 1YVLA 3O6FC 3TS8A 2N3JA 3KXFD 5K9JL 4GP8B 3OJVC 4LEOB 3Q5TA 2XN0A 3TBWB 5CGYC 3UL4A 4NLAA 3LZOA 1YQ2A 1CC3A 2O6CA 2AV1A 3DX0A 4Z7WB 3BSGA 4QEGA 1HWWA 1VLXA 3CFIC 3HHRB 1IM9B 2XYCA 3LN4A 1J18A 1VACA 3AW5A 2GW5A 5DUML 4ZG1A 5IJVA 4UOJA 2ROXA 4R3SA 5K9OB 1A3ZA 1YRKA 3KJ4C 4Z5RA 1EZVY 3WN5B 1QMUA 1SMOA 1OQOA 4XCEA 2R2CA 4AK1A 4FC3E 2AABL 4OZFH 3V0AC 1WBYB 2RA1A 4LSPL 2W9EH 1HSAA 1W6WA 4YXKL 1ZHKA 5HYQA 2EXTA 4MHHG 4BCXA 1W72L 3MUUA 1MI5E 3KJ6L 1MQKL 5HHPA 1BGXL 4X7DC 3W5MA 4A1RA 2OZ4H 5DMGC 4PGCB 3RVWC 1WCQA 4OZFG 4HHAA 3HAEB 4Q9QL 1IC4H 3QQ3A 4CJ0A 1UM6H 1M3IA 4U05A 2BSRB 4GBXD 1KJ2L 2FWLB 3PP4H 1KCBA 2DL2A 1XGRA 4JB9L 1T0MA 3FQYA 3F58L 3AM8A 2LT9A 3BPOB 2V5RA 1L9OA 4N1EA 5L9DL 5LXGL 1BVZA 4QF1A 3BRFA 1JNHA 1XIWD 3TEZA 1IEBB 3FB8B 3L4VA 3ILEA 3GSUA 3MV7D 1OE3A 5IF0B 5JW3L 4KY1L 3NSJA 1BF2A 3VD1A 4KQ0A 5SX4I 2NSXA 3NPZB 1NAMB 1DQML 5HHMD 5I76A 7PCYA 2GB2A 4EKJA 1TSRA 1Y0LB 3BQUC 1EVTC 4JO1H 3SPJA 1W91A 1UCTA 3FUEA 5A7BA 5JR1H 3L7FB 3V9EA 5EU3A 4Y5YC 4AM0A 3ULVL 4PREB 1ZANH 3VXQA 2MSPA 4KJQD 3CZSA 2EYSA 4HK3J 3E6FA 4I18A 4KKCD 2X09A 4BRVA 1XAUA 3FU7A 1S7UB 4N28A 2VDOB 1R5IA 2IQ9H 4OIIH 3AU1B 1UZGA 3ECQA 4I89A 3RL2A 4PJAB 2JVUA 3U2JA 3U4AA 4GBXB 3PS6A 3S36X 2ZAIA 2OJZH 5KVFH 1RSFA 1FI8C 1U30A 3WY4A 1HJBC 3AWFA 1IBHA 4LU5L 4PTTA 1SBBA 4A2HA 4TSAL 5DLLA 1XIWB 3DVGA 2ZNWA 1KXTA 3V0VA 3WIHH 3MV7B 1IKFH 1D7BA 5IJDC 2Y36H 2K6YA 3O6KH 4X8GA 4MKTA 4HS6B 3O81A 3DX3A 2QBWA 4YHPA 5T3XH 5HDQH 1J8HD 1P7BA 1B2WH 1PLGL 1ZJAA 3DRTB 3IN0A 5C0IB 1G4RA 1YQVL 4AWJC 1O7VA 1U93B 5K59E 5D93B 1DQQB 2AI0H 4WV1C 1CE6A 5KOVC 5T1DL 1LK3H 1JK8B 2CDGA 3K4ZA 3N85H 4FQJL 4YDVA 5I1IH 5L2JB 1EHKB 4B9JA 3BUDA 1ZPUA 3IKKA 3MJGX 5AW5B 1MHHA 3PQYD 1ETZB 2HA1A 1WHOA 2QLVB 1N19A 1PZDA 3ZT5A 1H5BA 4KXCA 1KENH 3WL9A 4LE8A 4OFYA 3L48A 3MRFA 4OLWL 1QPPA 5K59F 2XN2A 3CN4A 1SEQL 5DJ0A 3TT1H 3FYIB 1UD2A 3IYLW 3P1VA 2YD2A 5BV7B 4X9YA 1R3HA 3PABA 5J6HB 5MP6L 3RZCC 3UBXA 2WO4A 4GKLA 1JPTL 4HHGA 3FO2B 3GXTA 4HLEA 3BXNB 4KKRA 4AE1A 1NPNA 1J9QA 1QWUA 1HINH 3DC0A 3IFLH 3QUMB 3WY1A 2VM3A 4LPWA 5CJXC 4GXUN 4RZCB 2HRPL 3AROA 4FQPA 3EOAB 3KPLA 5F7EH 5DMIL 4HQQL 5ABAA 3HA0A 2FX9L 2MOGA 3QCUL 3UYRH 3H9YA 1QSEA 4BCYA 5KBPA 1I1AD 7CGTA 3PQYB 3EBHA 4MS8D 3DURB 3FAXA 2Q3AA 4LSVH 1IGTA 2D0HA 1NGZA 3K5RA 4OLYH 3TJHD 1IM3D 3WJMB 2JB6B 1ZLUK 1T21A 4CVXB 1T4KB 3EFOB 1T0NB 4AM0Q 4NP9A 3MI6A 3ZU8A 4ZS7H 5FEBA 3DJZA 2D9CA 1HZKA 3QWRD 3QDJD 4CMMB 3DIFB 1KEGL 4FCHA 3KWXA 1XR9B 4XCCH 3IDNB 4FCAA 2K7QA 5CMAA 5B8CC 2X4RA 4Y1TA 4ZS6D 2VQUA 3E3QE 1WZAA 2FL5A 3KLHC 2Z8SA 4GRLD 2G75A 4DVRL 1M6OB 3BVNB 1HL8A 4BFEA 2Y7QA 2LABA 4YIQA 4H7VA 3RVUD 1ZGLA 3F00A 1INDH 4I2XA 4FLOA 2VITA 3MV8D 2E9IA 1LNUB 1F3JA 4U0QB 5CJ8A 5GZNA 2H6OA 5CEYB 1TQSA 4P9MH 2ADYA 4GJTB 3QEHB 3APNA 4PPTA 4YHOL 2KZ1B 3UC2A 1C12B 3I2CH 4N8CL 1I7ZA 4WI0B 5I1HH 5CINL 2XKNA 4A7TA 4QYOB 1OXYA 3EDJA 1G0YR 2MCMA 4K0OA 3U4EA 4LDLB 2GBAA 1IM3B 3IFPA 5TF0A 1VEPA 4I8DA 2EECA 3ZXAC 1UXLA 2WLIB 1RZGB 3UEZA 3UG5A 3WUZA 3P9WB 3HNSL 2XV3A 2W59A 1CK0L 4P4RA 4ZUSB 4FQ2H 5ICXB 3QDJB 5DO2D 2QQKH 3NCJH 1OP3H 2VN7A 3QP3A 5B38B 1BIIA 1F02I 3SPGA 3ULVC 3L95B 1ULVA 2WWMD 5ISZE 2R1XA 3Q13A 4X0NA 1XTLA 3QG6B 2I9TB 1EDHA 2OKMA 2WNGA 3O8XA 3QJZA 3KCWA 4FFZH 4PJCE 4OZ4A 4GRLB 5HPMB 3SCMD 1S7XA 1UOLA 4I9WD 5DA4A 4ZI8A 5C0FB 4YBQD 4L8BA 4QD2E 3RWCB 5AOLA 4CA4A 2I69A 1CFMA 3ISWA 1FJ1B 2YA1A 3MV8B 3PWPE 5E0FA 4POZD 3I6SA 2HJLA 4YHKH 4PUBH 1ROCA 3GO1H 2X3CA 4PJCF 5DS8B 3QPQD 1UT2A 3UTZA 3LD8C 2QQLL 1DDHA 1Q9LA 1XEDA 4GG8A 4GUPA 2UY7B 1FC2D 4TVPL 3VG0L 2NUTB 2XWRA 3OJDA 1X5XA 5AZEL 2ICEA 4RISL 3FTGB 2OJ1A 1PZUB 3K72A 1I1AC 3OXSB 1MCWW 2V17L 4TQPA 3CFNA 1LO0L 3GHBL 2C4FT 3NCBB 2GIXA 1UJ3B 4OKVA 3VFMB 4LLUA 3T0EE 4PAZA 2ZCLH 1MLCA 4YO0B 5HI4D 2F1EA 2QSVA 3SDYL 3MACL 1EDQA 1MIMH 2NQDA 3HE7C 3QFJE 1Z3GH 3LRGA 4IOIA 5L8KB 2W07B 1J9SA 2QFRA 1PDKB 4XP6H 5F6IC 3HHMA 2WBXA 3L6FA 4MNGA 5L88H 3S7GA 3T3MB 5CSBA 3LTVA 1T1YA 3MLVL 2CR3A 5E5UB 1E6JL 1GGYA 2WQWA 5I73C 4JDZB 4K8RL 4FULA 4AQ1A 5FKPB 1NBVH 1JV2A 4CNIB 3IDYC 4XO9A 3B2UD 2E4FA 4N2IA 3QQDA 3O6FA 4UZSA 5C8JB 1FZJB 4N20A 1J5DA 2EXYD 4HU2A 2R2HA 2PW1A 5LN8A 2IQAA 3IDUA 2BSTB 4DGUA 2A9NH 1FL5A 3T6QC 3KS0H 1RVFL 4Q58C 3P4NB 4HUUB 5H37H 1YYLH 1S78C 4WU5A 2IIJA 3K80A 4YGVA 2W81C 2Z4QB 1H3XA 1CF8H 4F24A 3HZVA 3WHXB 3HOGA 3RKPA 3X3FH 1F56A 3KPTA 3DV4B 2H47C 2J3SA 3VB8A 4AYSA 4PWFA 2AEQL 4UQIM 1I1YB 4LEXH 2OMTA 2YEZB 1L7IL 1QFUH 4Z7WE 1U9KA 4XR8C 2WJ7A 3M07A 4LPTA 2C9QA 2ZG1A 1M7DA 4E68A 4EUPG 4KZ0A 1IL1A 4GO9A 2GT9B 4BQ6A 2LGNA 4MWFA 4UTAA 5AW1B 3VSUA 3CMOH 5B1AB 3UADA 4JREB 4ALAH 4L4VA 4BGDA 5DT1H 3SCMC 2BP0A 3KCPB 1R0AH 1ZV5A 4JW3A 5EF0A 1JGEB 1QP1A 2C7UA 4Z7WF 4OFVA 4MS6A 3UYPB 3QHZL 4KJPD 1G7MA 4PGDA 2J44A 4X8JB 2MEJB 3GJEA 3D85A 4OIBA 5CP3A 2OTPA 1OSZB 4GAGH 1TIUA 1YHPA 2FJGB 5L8JB 1FYHB 1GZHC 4TOYL 4HS8L 2QTEA 2R59A 3TFKC 2VDNH 5D7JC 3SKNA 4F37K 1C08B 2F2HA 3P9LB 4M4RB 4NZFA 4PRPD 4XX1E 5D5MA 3QUHA 2XICA 1G7LB 4LL9A 4WWOA 2MKLC 5LQBH 3D8MA 2J55A 4LMQE 4JPKH 1NIAA 5IB2B 3L3OB 1D6EA 8FABB 1Z0MA 4K73A 4ZQKB 3BQUA 1R6VA 3BWAA 4LOFA 4JY5H 1XSJA 4Y5YA 2E0PA 5IJKA 2J8UB 3OXRB 5E7BA 4PRBA 2A77L 3DX6B 4ZTPH 4AUJA 5LWYL 3MLRL 5E8OB 1JWMA 1NCAH 3CG8A 3OWRA 1IT9L 3FW6A 2IDFA 3TCTA 4MDJB 1WICA 5F1KC 1XF5A 43C9B 4GW4B 1SDDB 5IVOA 1HDMA 2A9CA 1LXMA 2UY6A 4QO1B 3AXHA 1LHZA 5DUPL 5DA0B 3LQZA 2X7LB 3OKLB 4C83A 5FB8A 1ACYH 4L5FE 5GIRA 1Q94B 4G7VL 4PJAE 4PRPB 3NABH 3EJZC 2OW6A 1CICD 5KYWA 4G71B 4NBXB 2VUKA 5INDB 1V7NL 2VMJA 1FFOB 2Q1EA 3SKMA 3OZLA 4H25A 2FO4A 3UACA 3QXTA 3RWFA 3QNYA 3FUNA 5IHZB 4MJ2A 4N2DA 5CR8A 1WBZA 2R2BA 2PXYD 4JZOA 4PJAF 5FA4B 1NPUA 3ARFD 2EUZA 4ZBJA 1MHEA 3DVNA 4QGTA 4PRIA 1NJ9B 1C7SA 2E6PA 3V0DA 2V2XB 3DBSA 4AOFA 4JAMA 2NZ9C 3S34H 2XFXB 4B9KC 1J86A 4K3GA 2EVFA 4WTZA 3RB5A 1HL9A 1TMCB 4KK9D 3HN3A 2JIXD 4DEPB 2CSPA 2BVTA 4FNSA 5A1AA 4GKZB 1S5IL 3MNVB 4K8RC 3TO4C 2O5YH 3WKPA 1ND0B 1ZSDA 2AK4A 1CICB 4XVOA 3F7VA 3MNMA 2P3YA 1WWBX 1E4XI 2J6EH 3RZCA 1IBYA 2HX7A 2O61B 4AE0A 1HH9A 4F57H 1MWAB 1AZRA 2XWBB 4J8RA 3CLEL 3FFDB 4JBSA 1BV8A 4DHLA 4GT7A 1H6EA 1DBKL 4GSDH 4UBDC 5CJXA 4MZ3A 1U8KA 2CO6A 2X1PA 4AH2A 4Y2LA 3RVXC 2CJUH 3ARFB 4HLZH 1UM4L 4APXA 1OCOB 4K9EH 5AL0A 4F7EB 4LXFA 4WW2B 2BW5A 2RALA 5BMFH 1CZ8H 1IC1A 4QXTA 4RFNC 5L2KD 3SE3C 4XGZA 3QULB 2ZYIA 4GKNA 4WIQA 1AKPA 1V7ML 4MA3B 1KCKA 4AIZA 3VFOA 1LM8V 1KULA 1KF9B 3T2QA 4UINL 1GPOH 1GHFH 6TAAA 3PQYE 1EQWA 4HLZG 1QFHA 4BHUI 5D1XC 5HGAA 5F9AC 4IS6B 3UPRB 2RTTA 5CJOL 1W72A 4RFOH 3VMOA 2G2PA 5B8CA 5EU6A 1FFRA 2W94A 4ELDA 2ZUSA 1HIMH 4MJ4A 3SOTA 4PBVC 1U8OB 4WUKH 4NKIL 4ODVL 2B9AA 2JKWA 3C8HA 2CBMA 2HG5A 4WI4A 1F8TH 1KJ2A 1DBBH 1E4XL 2DLIA 2WLLB 2ZUYA 4HJUA 2F7OA 3C75A 4HWNA 1DVFC 4Y4KD 4G5ZL 1BVNP 4XX1G 3OB0K 1EEUA 3SQOH 2PMZA 2RFXA 3GXFA 4BD4A 4LNRA 5IW3A 1JDDA 5CGTA 1T7WA 4KTEL 3H6JA 2OMZB 4Z7QE 5L2KB 4QAMB 2P45B 4XP1H 3T0AA 4HUXA 2PXYC 2H45A 1T1ZA 3MR9A 4UQ3A 3FDWA 4TUJB 1GAFH 4EN3B 4OY9A 1BFOB 1HOCA 4L05A 5E99H 4Y89A 4JY4A 5KSVA 5DJZB 2VDOH 3LNHA 4NFDA 5FO8A 3D39A 3P73A 4LPXA 4F58H 3BLKA 4HZLA 3VE0A 3KBPA 3L5WB 4UIMB 1B90A 3LPFA 3E8VA 4X4YB 3IS0X 3QDJE 4G6JH 3D69B 3HBZA 2DYRB 2WK2A 3QXAB 2AP2A 4MD4B 1I9JH 4FA7B 1JXGA 4X4KA 4Y4KB 2XG4B 5SWSD 3WDIA 1IBFA 2DD8H 3ZKSD 1JWUA 2JXMA 3QEQD 1I9RH 1IFHH 4HEME 2ENJA 2LE9A 4PP2A 3QQ9C 1E9OA 3ME0A 2W9EL 4KDVA 4E9TA 3MBEC 4OZIF 3IVKA 2GHWB 3ISYA 2XTSA 5MERA 5E00A 3RWEA 4H2AA 5EPMB 4FNLH 1F3DH 2VISA 1GZPA 1U8LB 1KBKA 1ECZA 2PWHA 4UM8A 5EU4B 4C47A 1U33A 3DECA 4G6AD 4W9ZA 2OZ4L 4BH8A 3WEXA 2F8VA 3C60D 4RX4A 4HPOH 2Y06H 1IC4L 2EXSA 1J9TA 3B7YA 1T6WA 1CL7I 1UM6L 4EDWH 3PWLB 1AACA 1B9KA 1L9TA 1TENA 2ZX6A 3G5YB 3PP4L 3BISA 1SGKA 4GAYB 3HE7A 5K33A 4EO5A 4B41A 1CDCA 2FBOJ 5DEZA 1A7NH 2W91A 1CPUA 5SWSB 1CI3M 3MTRA 3F85A 1HXYB 4XBPB 2VZVA 3C6LC 2FWOA 2CDFA 2H32B 4MB3A 4OGAC 4P2QD 3V6OC 3PDGA 5IY5B 1RZIB 1ZTXH 4ZUTB 2PR4H 4M6NL 4R96A 2QTVA 3F05A 2XV0A 4NO0D 2QVFB 3MRCB 2A0LC 3AQXA 5JR1L 2NYKA 2YBGA 2EDBA 3FS9A 2B1OA 2WUCH 4OR1A 4DKEH 1ZANL 5DZAA 2EIDA 1KTRL 3HZYB 1Z2KA 4G8AC 3WNMA 3UBFA 1DANT 1FIEA 1T1WA 2UX7A 5AAWC 2BCMA 4BQ9A 1ET8A 3VFSB 4NUJB 3C60B 4KDWA 4HKJA 3T3MF 2OYPA 2AQ3A 3EO0A 2FQDA 3AY4C 4CUCA 1WGVA 4E9XA 4XWOD 2OJZL 5KVFL 4HGMA 3APDA 1EHXA 3PIQB 5TK2A 1DLHA 1WE5A 4JFPA 2VLRD 3PDOA 3H7BA 4IIZA 2CKBB 2XUWA 5B1CA 2ZWYA 2AQTA 4RIRB 3EHBD 3WIHL 1A4JA 2O5ZH 4M9OA 1IKFL 1KIPB 1UEMA 3L4XA 4P2QB 2Y36L 3O6KL 1KPUB 3APCA 3EYVB 3LPGA 5T3XL 1CQKA 5HDQL 3KGSA 1B2WL 5EOCH 4NO0B 1FL6A 3HHSB 5F9DC 1ZK5A 3MJ8A 3NCWA 4UV4H 5DHXB 2F53D 4LOEA 2VDMB 2X28A 2AI0L 4Y4HA 4UM9B 3R8QA 1LK3L 1TZIB 2MTAA 1BFSA 5HGDA 3N85L 3R19A 3MXWH 5KJ7E 3U2IA 3ESMA 4B0MB 1B4RA 3H0TA 2QLYA 1GZHA 2CCVA 2P49B 3P2TA 4Y8DC 2CO2A 4Q9BA 5D7JA 4UT9H 1J1OH 1KENL 1R3IH 1F4YH 4NC1C 3CH8A 1XCQB 2CO3A 2ZUXA 2OR8A 5B4MD 5IG7B 3JV4B 3TT1L 3OX8A 5I26A 4W9DC 4DO5A 1R33A 3TP4A 4MX7B 1FORH 2VLRB 5A2JH 1IGYB 1JPEA 3CCHA 3KD4A 5F7HA 4G70B 1MCQA 1IGMH 2HKAA 3APMA 4U0RC 1C1EH 4YHIA 4ZFOL 2WZ6A 4N1CA 4LLMB 5KVEH 4P2AA 1ZV2A 3EHBB 1ZLWK 5LLIC 1E50A 1TTFA 2ZP9A 1OQXA 3OTTA 4HAKA 4WI6A 4KQ3H 4LCCB 4W6WB 3GSWA 4OZGB 3OAYK 3T2LA 1HINL 3IFLL 4QIRA 5B38G 4O2EA 3RIAK 2F53B 4PV8A 4R9HA 2XJKA 1L7TH 5HHNB 3GSRA 3II2A 5F7EL 5AG9A 1HZLA 3GINA 4P4KC 4RMBA 3UYRL 1SXCA 3WD5H 1ZS2A 5DDHB 2H41A 4K3DH 4F33B 3PGFH 1A22B 2B1AH 3LH8A 4LLYA 4XAKD 2YAFA 2OMNA 3CVHH 3S6CA 4OJFH 4LSVL 4LKXB 1XBDA 4DF9A 4BFIA 4IRSD 4OLYL 3S9DB 3WGVB 3UTSA 2XQYG 1AMXA 2D3LA 3P3TA 1KNOA 5IVXB 1T6VN 3TT3L 4ZS7L 4KNSA 4IU2A 2A83A 2J8UF 1JXJA 2CLZB 4HIQA 4IOFC 2EE0A 1E4KA 1NWOA 2O5NA 3B4NA 1QQDB 3NRQA 3OJ2C 4KV5F 4PRPE 4XCCL 4Y2DA 1PIFA 1VFBB 3BP5A 4MCZB 3FTVA 2Z6FA 1UT1A 4YXLH 2XV2A 4XWOC 1OWRM 4C55A 2HT2D 4O2CA 4V2BA 5HGHB 4BFJA 2C3GA 4PI2A 1L3NA 4KXZI 1MCRA 3QDGD 2V2WB 5E4EB 3FT2B 1TTAA 3L4YA 1E3XA 4J3XA 5J3HC 1PNDA 1IEAA 3IJ7A 3LZRA 1QEXA 1INDL 1H6FA 4XX5A 2F18A 3EUDA 4KVPA 4AIEA 2RD0A 4BXVA 1GKOA 4CVXA 4P9ML 1TPXC 2YA0A 3FC8A 3NFSH 5DYOA 5KVGE 3I2CL 4I0PD 1TYRA 5I1HL 2FLBT 3HPJB 4RFEB 2K9FB 3TO4A 3O3EA 3DGCR 4IRSB 4ZK8A 1TXKA 2YAHA 4G2AA 4RMWA 5IT2H 1GGUA 1U91A 1CFSB 1ROWA 2IH1B 2L7UA 2FEJA 3HB3D 4FQ2L 2WXGA 4WUUA 2QQKL 3NCJL 2R29H 1JHLH 3IJHA 4R97C 3WJJA 3QNXA 5D4HA 4AV0A 3CC5A 1KB5H 1TQCB 1WHPA 4XCFH 1T20B 3T77B 2EIKB 4XAWH 5AVRB 3KW7A 4YDKH 3CVIH 1WF5A 3RDTC 5B4MC 5CZXD 2WTPA 3L8QA 5DGRA 4KK5C 1UYWH 1Y1DA 3FCTA 1B3IA 9CGTA 1G7HA 3ELQA 3SE3A 4N8VB 3WTUA 2XA8H 1YN7B 2DAVA 2VXSH 1E27A 1YNKH 4B5ZA 4G1MA 4PUBL 4AMWA 3GO1L 1QUNB 3ILDA 3WN6A 1DP0A 1YAIA 1DTUA 4I0PB 1IE5A 1FYTD 2YBRA 3IPBA 4S2SB 3K91A 1VEOA 1AC0A 3MNZA 1S9WA 3RNQA 2ED9A 2HJKA 4OGYH 5D7LD 4GW1A 4DVBB 5FYKH 4N0UA 2EJ1A 1FWXA 1C5DA 3HB3B 4WW2F 1KLUB 3PRZA 4WI5A 3AGWA 3U6XA 3ZTCC 5B3SB 5ACZA 2DWSA 1WFUA 2VRAA 2ZCLL 4PJ5A 5GSRA 4Z7UA 5LGJA 1DVFA 3FUHA 2NCMA 3TA3D 4D7PA 2GK0A 2Y1YA 3FQ4A 1MIML 1CFBA 3Q2CA 2X4UA 3JUZA 1Z3GL 2DQHH 1I3RA 3EW3B 1MW1A 5DRZA 5C07A 4XP6L 3SBQA 5IQOA 5L88L 1NDMA 4LSSH 2WYTA 2YZ8A 5TDOA 4ZNEA 5I28A 3ROOA 1QZ1A 4RGMC 3SDCC 5IEHA 1NCHA 4DETA 2EUVA 3IF1B 1NBVL 4ODBD 5DC4B 1P1VA 5AVXB 5D7HA 2BSBA 3TIDA 3DGDA 3FT3B 2A6JB 3DHJA 4ZUVB 1FYTB 4NLHA 5L2KE 3HS0C 4GXFA 2WKOA 3KPMB 2AJXH 5ABZA 4R8WH 3CZNA 4Q6IB 4F7CA 1XSKA 3TN0D 1T89C 1YC8A 5D7LB 2B15A 4E9QA 2ATPA 4WHCA 3VXSE 2BY0A 2A9NL 3S5YA 3TBVB 1AHKA 1YYLL 5INCB 5AWNH 1CGVA 2Y6TE 2LTQB 5HPOA 3ATBA 2FLMA 1F6AA 1CF8L 1E9PB 3F5WB 3X3FL 5T5NG 1K4CB 3TA3B 1U8NB 3D25B 2JJSC 3O45B 4LLWA 1Q0YH 4N1HB 2CRMA 4GSRA 2BSDA 1BXAA 2VR4A 4LEXL 1QFUL 4NI6A 2ORBH 1K8IB 1U3HD 4ODHH 2VW4A 1G1KA 3QO0B 3TCXA 3M6DA 2E9WA 2WMPB 2WQVA 4MJ5B 3MBEA 4JRWA 4Q9CA 4A37A 1MF2L 4DN4H 2HTLC 5TE6L 3SJVD 2ADGA 3UBHA 4LSTH 4QRQB 3CMOL 2X9ZA 1FLRL 4ALAL 3MU3A 2E6QA 4FTVA 4JUTA 5DWUH 5DT1L 3TPUB 5CZKA 5KVGH 2E9JA 5KSUB 1R0AL 2H0PA 3D4GA 3ZDZB 3GMMA 2VN6A 1FFNA 2NY5H 3TN0B 2BVQB 4FLSA 4WGKA 4XMVA 4ZO7A 3RKDD 2GFBA 4HT1L 4LCYA 1IC7L 2ZX7A 1J05A 3UZEC 1D9KC 1J8KA 1U95B 4EI5D 2FUQA 4JR9H 5EC2B 4GAGL 2VLKB 1ZVNA 32C2B 3F01A 3FQWB 3VFUA 4QHMA 2PPAA 5D7KE 5HHQB 2WPGA 5EUOE 2VDNL 4WU7A 1V3MA 4FADA 3KPRE 5CLZA 2UX6A 4K07A 5F9OL 4IMLB 4D7BA 4CVZB 1HQRA 5LQBL 4YR6B 1KY6A 1BZQK 4PJ8D 1U3HB 3RFRA 5GJSH 4JG5A 5TE4H 4BIKA 2X40A 4NKMB 3KL0A 4NUQA 2VQTA 4YUEH 2YRLA 3NK4A 3HBQA 1OP9A 2BY3A 2Y07H 3SJVB 5I0ZA 4Y16A 2BVPB 2EACA 4JY5L 3DNKA 4K3EH 5H35B 3WFHB 4AZ8B 3HG0A 1URIA 1UH2A 2C3XA 3IGKA 4ZTPL 4DUVA 5AZUA 2Y1VA 5JXEC 5GGSY 1NCAL 3ZSSA 1J10A 1O7DC 1H3PH 2YQ2A 3IAGC 4ACTA 3VD3A 5ID1A 1E8WA 3AITA 1MRDH 3JYBA 1GOGA 4EI5B 1PCXA 4KO7A 3LRSA 3P3RA 4OM0H 2XZCH 2Q10A 2X3AA 3EJTA 4LCWD 3H56A 4DW2L 4HC1H 1X4XA 4YHZH 1ACYL 4ZW8A 3NABL 3NIGB 2NY1B 3K6OA 4NNXA 2W92A 5DFWH 1FFPB 5FWQA 2CBPA 3ZQ9A 3EYOB 3RE0A 3LEVH 1BQLH 2XY1A 2D0FA 1HCYA 3GSOA 1BA9A 2DBJA 3SZKC 5CEZD 1PPIA 3LKPB 2RJMA 2XY2A 3RIFK 4X9HA 4JJHA 4KOBA 4HZ1A 3VFNA 3Q06A 1FH2A 2P8LB 4HKZB 4PWEA 5DCCA 4P2QE 2FNWA 4N2CA 5DZLA 4CRPA 2AQ2A 5GQBA 3V6ZB 43CAA 4V1DA 4KXDA 3INUH 5HDRA 1QR1B 3QDMA 1GYWA 5EU5B 3QA3B 1BFVH 1LLAA 4OJDH 1F1DA 1JV5B 5E5MB 3S34L 5JNYA 4LHQB 1D6VH 1P4IH 3IDIB 4M8RA 1KLGA 1EV2E 2PCXA 2A4ZA 1KDJA 4XOBA 4N6RA 4HJEA 3UZQB 4FHKA 5AUMA 4PWKA 1Q9OA 2XN9D 2BNQE 2YOAA 4KRNA 5F9JB 1TNMA 3BKMH 3HRZC 3ARED 2N0MA 4LMQI 2WBJA 2I9LB 3FO9A 2O5YL 3GI9H 2BX5A 3Q8AA 1INEH 2DQUH 3WFDH 3RKDC 2OCFD 3F7PC 1TG8A 2BMKA 3SE4A 4C56A 2J6EL 4PRAB 1MCHA 2BZCA 3L5JA 4X6FA 2GCYB 2VLRE 3WKNA 3MZTA 3OZKA 4BHUA 1ZCRA 3TIEA 5HSFA 4GSDL 4OGZA 1LEGA 5L4JA 5AW3B 2L7QA 4S1SH 1KXVC 2CJUL 1AG6A 3VO0A 4H4NA 1RPUA 4G43A 3GZOA 4K9EL 3G08A 4PJ8C 4W9HC 1TF4A 5DRWA 4Z76B 4IJ3B 2ESVD 3U4BL 1TLKA 5MHSE 1F3RB 5BMFL 1CZ8L 4I3GA 4LDEB 3E3QC 1Q0XH 4TNWF 3HC0A 1S8DB 3CJJA 4RAVB 1RZ7H 2F53E 2X44D 4ES9A 2ZUTA 4EVNA 5AD0B 3E38A 4Y2OB 3UPCA 2EIBA 4HWBA 4HJGB 4OZFA 4MD5A 1UH4A 2DYSB 3QO1B 1GPOL 2XN9B 3DYMA 2V5SA 3ABGA 1GHFL 4UAOC 3AREB 3ULUH 4OZGF 4F2MB 4NZJA 2A4EA 4GINA 4JFED 1EO7A 3D4YA 3QRFM 3QRGH 4ALAC 2BVYA 4PCSA 4RFOL 2DQ6A 2K4WA 1VFAB 4E2OA 3PAVA 4MSWA 5IVXE 4KVCL 1HIML 1D2PA 2OZ4A 4MXQD 1NAKH 2EO1A 4WUKL 4WFFD 2QVKA 3CH1A 1XB8A 1F8TL 1KN4H 3B7SA 4Y9FA 4POYA 2G30A 2OX5A 1YMMA 4QRPA 2M83A 3NESA 4MDIB 3F8UB 5J12B 5IOKA 4LIQE 5IVXF 2ESVB 3JTBA 1DUYB 4LL1A 3LKRB 2FBRA 5DO8A 2AMUA 1YEIH 4WO4C 5EBMA 4XP1L 4YSUA 3QQ4A 5D2LB 2AF2A 3NFPB 4L3CB 3FT4B 4PJ7A 2E7CA 5DK3A 3OV6A 5E5RB 1UWFA 5EN2A 1FSKB 4K5MA 3RFZC 2XV6B 1GAFL 2YMOA 4JE4B 2XWJB 3MRBB 5E99L 4XB8A 1JNNL 3MJ9H 4JFEB 4YDJB 3SZ6A 3SE9H 4F58L 2Z91A 3MBWA 4OF8A 5I8CA 3HUJB 3UGUA 3VSTA 1G9HA 1KPRB 1LDSA 3BHBA 2FSEB 4F8QA 1MFBH 1X44A 2PYEA 3JQOB 4M8UA 2R0LH 1KG0A 1JVKA 4WRLA 4M5ZL 3ZTNH 5DJDB 4G6JL 2B59A 3QE5A 1I9JL 1XB3A 1B0RB 1ZHNA 3N1FC 3MV9B 1EUUA 1AD9B 4NM8H 4Q2ZA 5DXWA 5E6IC 3P77B 1OKEA 2DD8L 1ORQB 1DJZA 1QNIA 3QIWD 4E9YA 1IFHL 4F9PC 3T8XA 4HWEL 1KFAH 4XXDB 2VR3A 2BOBB 2E27H 3WSQH 1G9EA 4XNQA 1EFXA 1RJZA 1NSNH 1SRDA 2OR7A 1RSYA 2FRGP 5ELIA 1EWHA 2VLMD 5FLUA 3GB7A 4DK6A 5EG6C 4PRDA 3REVB 4FNLL 1F11B 2OSXA 3O3DA 3G6AB 5DTFA 1LP9B 3RA7H 2XZAH 2IMMA 2VMFA 2V7HA 5JHLA 1AGEB 2WOYA 1BXXA 3PL6A 3GIZH 3QJVB 1KYDA 1VRSA 3L16A 4HPOL 2Y06L 5J4MA 3W0WD 3OMAB 4ANXA 3DGGA 4EDWL 1AIFB 5G55A 2HPTA 1OAQH 4X6BA 3BZFA 1MJJB 2OTUA 2P8MB 2JJTC 4K55A 2V33A 4IRJC 4OZHB 2Q2LA 4OD2B 2A73A 4LP8A 1A7NL 1IAOB 2OW7A 1F4AA 1TCRB 3FB7B 3FQRB 3IPFA 3BAYA 5BVJA 2BK8A 3SDCA 3QIWB 1BPVA 4X4XB 1KGUA 4ZFOA 1ZTXL 4JS7A 1HEHC 5I5RA 3CSBA 2PR4L 4ZX3A 1S9KC 1XZ0A 5C1MB 1BZEA 2COVD 4OJCA 1KTBA 3REWB 3BH9B 4KJWC 5KSAA 3WTWA 3T65B 1T89A 2A74B 4XHJD 5E2TH 5BUPA 5ETUB 4DKEL 3IMRA 3NN8B 5ENWA 1E4HA 3BAEH 1CG9A 4F15B 5CUSH 3ZW3A 4U3SB 5CFHA 3MNWA 3DUSA 5F89B 4K9EC 2BVEA 1MI5A 5D7LE 3MCLH 3LKNA 4MZ2A 1N8ZB 3HPLB 3DKHA 2JJSA 1YJDH 1AKJA 4EN2A 3L4CA 4P5RA 1A21A 1TJIH 1S6NA 1OF2A 1OZTG 2YC1A 3DX7B 4I7ZC 4B9YA 1U4FA 4MQ7A 4YX2H 2GSGB 2BM3A 1QLRA 1SYSA 2LVEA 2D31B 4LGPB 5HD8C 3CHRA 3IJYB 1QLEB 3QUZC 4MAYD 2O5ZL 4ZMZA 2D3VA 5HYSB 4XH2B 4XNDA 4LIQH 2O5XH 1HKFA 5AVUB 5TE7H 3AQYA 1W16A 4GQQA 5FO9A 4X7EC 3U46B 2AAAA 5EOCL 2G0LA 3MRLA 2X4PB 1WLHA 4UV4L 5C0CD 3QORB 4U6HA 1MCLA 4MMYB 4D3CH 5IQ9B 1MFVA 3SPVA 1L9QA 1O6SA 1OK8A 4PGBA 4PJGE 3UZEA 1D9KA 3EOTH 5IP4A 5J6GB 5DZOA 2Y2TA 2N7SA 3GNMH 1OOAA 2EDTA 5CR1A 5IHWA 3A23A 5EHFA 1P84K 2IAND 3WY2A 3SSGA 3BAKA 3T4AC 4HCRH 4UT9L 3WY3A 1J1OL 2GTWB 1R3IL 1F4YL 1JWSA 1PZ5A 1NUGA 1UM5H 5FLVA 1A1NA 1ET5A 1G7PB 1ETB1 2VLKE 3NDYE 5CIPH 2PLTA 1N5AB 3EBGA 1MREH 2QKIB 1PF3A 2DQFA 3TEXA 4S0SD 2NLJB 3ZDZF 3LH2H 4MZIA 3ECUA 1WUNT 1I7TB 5DEGA 1IGML 1N3NA 2GG1A 1VF5C 3TNNB 3WHE1 3ARSA 2XBZA 5KVEL 1AIZA 2FWUA 2IOIA 3GSNH 4MAYB 5C0AB 4E0RB 4NQEE 4KQ3L 1MY5A 3BSHA 4OV6F 4X80H 5ECJE 2V2TA 3GUTA 5CO1A 4TLSA 4N2LA 5JXEA 2NY2C 3VXSA 3BH8A 2X4TA 2ZG2A 3CLWA 4NQDD 2FDBP 3GXPA 3WNKA 5KN5A 1NEZG 3SJVE 4FFZA 5C0CB 4GQPH 1L7TL 1D5ZA 3PP3K 2UZXB 4A55A 3WD5L 3WMQA 4K3DL 3IGFA 3PGFL 3PDDA 1Q1PA 2B1AL 2VE6B 4ODUB 5CGBA 1IIKA 2WZPA 4QY8A 5A7EA 5KYXB 5IW1B 5DC9B 2IANB 3CVHL 4PSPA 4OJFL 1SBSH 4ANWA 1L6PA 3EH1A 4N8VG 1B2YA 2P5PA 3OPUA 3G6JE 1E3ZA 4AEHH 3F7QA 3MHZA 5ALCH 5CILH 2OCJA 1L4IA 1MXDA 4EIGB 2YAOA 2BNRD 5FM4A 3GSQB 4Y5VA 2ZWKA 4TTDC 2R51A 3EO9H 4HXBH 1N18A 1N6UA 3NIGE 4W9FC 3FCSB 1D5BA 4XNZC 4YXLL 1PLCA 5A16A 4WKXA 3RTQD 1GS6X 1YY8A 1PQZB 1A7RH 2ZIDA 1PX3A 4A7QA 5LDSA 1JN6A 3O6LH 4NNYB 3WXVH 1U4EA 1QI4A 4TUOB 4OTXH 4RCAA 4NBZB 4R0LB 4OIAA 4WZ9A 3MMEB 4RH4A 3NIGF 4AVHA 2OMXA 3EGXA 4UTCA 3NFSL 1EO8H 3WFBH 4O4YH 2Z1PA 5IB4A 3C5JA 3HRZA 3B2PA 1Z5LA 3RWJB 5C0GA 4KPHH 1UCBH 3V9CA 2BO0A 5DHMC 5JUEH 4Y0GA 5DHVB 3KPSA 5C08D 1ZT1B 4G9DB 2ZSWA 4NQVB 4U3XA 1GJUA 3FHAA 4LP5A 1R24B 1YN6A 5F2FA 4HG4K 4BBWA 2R29L 1JHLL 3DPBA 2XSKA 3I02A 1J9RA 3KGRA 1A0QH 3SO3B 4HJ0C 1L0QA 1CLZH 4HYTB 4M1CC 4XCFL 1KB5L 3G04B 1JD7A 4XAWL 4YDKL 3CVIL 4MNQE 4M03A 4EUPA 3ARGC 4LQFH 1XR8B 1QWHA 3VD2A 1YEDB 3ILPA 1XF2A 1FG9C 4KH2A 3S3SA 3SGEI 5DEJA 5CEZE 1ED3B 3TV3H 2HWZL 5DUBA 3UCRA 5DWPA 1JUFB 5HGBB 2DJ4A 4L0YA 1AJ7H 2VXVH 4XO8A 2NSQA 3BN9D 2VXSL 1QRKA 4QXWA 1FAIH 1YNKL 2WZ5A 3BZ4B 4IQHA 4JVWA 5GZOD 3AXLA 3RG1C 1CIDA 3ZHDA 1CT8A 4YSEA 3MOBH 3O3AA 3Q2NA 4OAWB 4IRZH 5AW0B 3V8CA 3D2UD 4J6RH 3V5KB 3MRDB 1BCIA 2DTMH 4H26A 4KBPA 3KYOB 5FA3B 4OGYL 3HMXA 4KTYA 5FYKL 1WP6A 2XN9E 4NJAH 4K3JH 3UMTA 1FZMA 5I74C 1X5KA 4OH2A 4M7ZB 5F1IA 5LCVH 5A2IH 3X1EA 4HJJH 3GS0A 4F2ME 1T66C 1L0YA 1CDYA 2VDKH 3PWNA 3LQMA 1AYRA 2NSMA 4GLRH 1I7UA 2DJMA 4P46D 1UD5A 4H0GA 2JCCA 5J89A 2MQ3A 2OMWA 3VUAA 4JE0A 1L9NA 3KLKA 4WFHD 4JX0A 3EXLA 3IB4A 2NW2A 2DQHL 2NYYC 4AV5A 2IH3B 1LO4L 4ZPTA 3JT2A 3B9EA 4LSSL 4WO4A 4PJCA 4UB0H 4R2GD 4X99B 3HKFA 2YPKA 1BEXA 2ROYA 1LO2L 4MNHB 2VABA 3RTQC 3RFZA 3C09C 4A68A 2ESVE 3LKOB 3QWNA 3T4YA 1IX2A