2J21A

Human p53 core domain mutant m133l-v203a-n239y-n268d-r282w
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
193
structure length
188
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDWRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Understanding Oncogenic P53 Mutations and Designing Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 43
structure length 188
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j21A00
4IBVA 3WTWA 2BIQA 4HJEA 2J1ZA 3QYMA 3D08A 1GZHA 2AHIA 2X0VA 4G82A 3VD2A 2IOIA 3D0AA 3US1A 4L0ZA 3WU1A 1HJCA 2J6WA 3D05A 4QO1B 5AB9A 3TS8A 1YCSA 4IJTA 5AOKA 2X0WA 1EAOA 2XWCA 5ECGA 3QYNA 4AGNA 3ZMEA 2RMNA 4IBYA 1TUPA 3EXLA 5A7BA 5AOMA 4AGPA 2J1YA 1UOLA 4L0YA 4IBSA 3VD0A 1T4WA 3Q06A 1EAQA 4A63A 4AGMA 5LGYA 4G83A 4GUQA 3WTVA 5G4NA 2J20A 1LJMA 1CO1A 3D09A 3D07A 4MZIA 4IBQA 2J1WA 4L18A 4AGQA 4AGOA 3WTSA 4IBTA 4IBUA 3WTUA 2J21A 2BIPA 2ATAA 1GZHC 3Q05A 4KVPA 1EANA 5AOIA 3KMDA 4IBWA 1H9DA 3D06A 5AOJA 2MEJB 4IBZA 1CMOA 2PCXA 2FEJA 4LOFA 4LO9A 3US0A 4GUOA 2P52A 3Q01A 4AGLA 1E50A 4MZRA 3WTTA 2AC0A 3EXJA 2BINA 1HU8A 4LOEA 2IOMA 5LAPA 5KBDA 1HJBC 3IGLA 5ABAA 2ADYA 3WTXA 5AOLA 5G4OA 1IO4C 3KZ8A 1KZYA 5BUAA 2VUKA 5G4MA 2IOOA 2X0UA 3VD1A 3WTYA 2YBGA 2OCJA 1TSRA 2WGXA 2XWRA 3IGKA 2J1XA 2BIMA 2GEQA 4XR8C 2BIOA 2H1LM
chains in the Genus database with same CATH superfamily
4N68A 1JXFA 3SY6A 4WDIA 5KJ4A 1JWMB 2DQGH 5JTWA 3QXTA 2DLEA 1LP9B 1ZA3A 4MXWL 2NTFA 3X13A 1DQQA 1II4E 4F7CA 2H3KA 4OCMC 2FX7H 3GXMA 2ZOKA 1NUFA 3SIKA 4ZX6A 1DVFD 2Y23A 2VZUA 3Q9PA 4QOKB 2FWOB 5KBKA 1TPXC 3QFDB 3EDJA 1X44A 1YA5A 4XP5L 1RK0B 4KKAC 3PGCA 3VI3E 1FL6B 4E9VA 3Q6GL 1AXIB 5DMKB 5FA3B 1A6ZA 2QQNH 3X12A 43C9A 2F7OA 4OZGB 5T3ZD 5CU9A 3RL1B 5AQ0A 1FZKA 1Z5YD 2VLRB 4Z8FH 4HKJB 1ZS8A 1RIUL 3O81A 4Y8DC 5FAAA 1L5GA 4KWUA 3BP5B 4GAAA 3SN6N 3VMNA 1DSFH 4HUVA 3QXDB 2L04A 1IJNA 4E9RA 3RFZA 1SXNA 5TDNB 3JSSA 1MI5D 4G43B 2VRQA 3RU8L 1YJDH 1TZAA 2VERN 3QBTB 4XGZB 5IJVB 2SEBB 3WBDA 4ODWA 4GAFB 2V5RA 1KB5H 1NEZA 3D69A 1UB6B 3BRDA 3AY4C 3DETC 2Y36H 3TGXA 5D1ZC 4QRRA 4IBQA 1NCOA 4GG6E 4WW2A 2VW7A 4L18A 2NY5L 1QA9A 1AYOA 4PRNB 5FV2A 2D9CA 1XCWA 3RFZB 2YEQA 1WD8A 4FERA 3G6DL 3G04A 4LCCC 4LDLB 4Y4KC 1SNRA 4Q9RL 3WFHA 2X2HA 5I5JA 1KV7A 4GMSL 3VE0B 1HXMB 2A9DA 4H2CA 4LO9A 4JQIH 2NY2B 3WMSA 5F7LB 5HPMA 5J1AB 4P4RA 2P5ED 4YBHA 3QQ3A 1MJ8L 1D9KB 2WLLB 2FAUA 2PTTA 2E6QA 4FHKA 1LEKA 3VRJA 1KEGH 2WQRA 2AEWA 2H6UA 5C07E 3RIFK 4AUYA 4Z7OF 1S8DA 5JA9A 1EWHA 3QIUA 4BZ1A 5TGBA 3SDDD 2P8MB 4PJ8B 3N40P 2GHWB 1OAXH 4HT1L 3C12A 5D7JB 5TE7L 2AXJA 1CFVL 2WBJC 1HI6A 3MV8E 4HK0B 1A4KA 4OSUL 4ZDHB 4GAJL 1A6UL 1Z9PA 1A14H 1CZ8L 3ZE1B 1EFXD 2Y6TE 2E9JA 4FQ1H 3WTYA 2MNWA 5H37A 3KYNB 1T7VA 3FKUS 1OGAE 3LD8B 3QPXH 4FA6A 4NRXB 3MRIB 4PJFB 3WOVA 3Q13A 2VQ1A 4NPYB 4JDEA 5DZAA 1ZLVH 3WXWL 2UYLB 5IW6B 3T9WA 1KC5H 4KDVA 5C3IA 1GGYA 3LIZL 3MLRH 2IVFC 1IM3B 4ZMPA 4GRWE 1UH3A 3WEOA 5DZPA 3RVTD 4XPTH 3SDCC 3WAJA 3UBHA 5K1NA 2PCFB 3QXVA 1DTUA 4PY8J 5D1ZI 3A4FA 4NYLB 3CZFA 4HCRH 4L4VA 5C0BA 4Z3GA 2HH0L 1AR1D 1L9TA 2P9RA 2NLJB 5DJ2B 5C6TH 5I1CL 4M7LL 4PJAE 3IPBA 4FZEL 3V0VA 4ZOEA 4ZNCD 4K8RC 1KTBA 3KYKH 4KFZC 3SKOA 4BKLB 1ETZA 2MIZA 3IFNL 1MRFH 2DJUA 4HJUA 4F20A 5FCUL 3DO3A 1ASQA 3RPIB 3T0EB 1XF3B 4XB3A 3U4EA 2JCCA 3P11L 1NLDL 5PAZA 4N2NA 3CZFB 2CDFA 2R1WB 4HKZA 2ZOLB 2BY3A 4PGDA 5DJAB 2H4EA 2YUXA 3ZKXB 2IMNA 2ZXDA 4JQXA 1RFDH 5KWYC 1TTRA 3MV11 4QRPE 5LG1A 2JKTM 1QLRA 1H3WM 4U1HA 2H2PD 2DM3A 5IB4A 1U58B 4XP6H 4K94L 4GKSA 3MLTA 4NO5B 3MRIA 2L8AA 1CU4H 1XF3A 2ZUXA 3ABZA 4HC1A 1JTPA 1I8AA 1MUJA 2KH2B 4ZQKA 1CXHA 4M6OL 2PYFA 3HFMH 1OB1B 5E8NB 3L5JA 4LNRA 1KLFA 3DIFA 2ICES 3LKPB 4YX2L 1FL3A 2NPLX 2GITB 4W1TA 5D5MA 2EIDA 1MQKL 3ZPDA 3KS0H 4EDWL 3FQXB 3JTSA 4XMLH 2CLVB 1SJVA 1UVQA 4GKSB 4JHAH 5HHOB 4QYOA 1CFSA 1ZVSA 2J1KA 3F7VB 3KLQA 3L1OL 4AITA 1BD2E 1ORQA 1FN4A 1QW8A 3VMOA 3AJ7A 2G60L 1Q1JH 3QJFA 3VSQA 2XQYK 4QRBA 3IS1X 1UOVA 5J56B 1KLUB 4X5WB 5FA4B 4DVBA 2K78A 1YUKB 1U8OB 4IGBD 4K3HA 1T6VN 2F54E 1BMZA 1A6AA 1P5UC 4RETB 1JHLH 2A38A 1WYJA 5DUPH 1W72H 4JKNA 3CBJB 2FHFA 2QSCL 3Q1SL 3DX9B 1QSFA 2AGJL 3WXVH 3H9YA 4HCIA 5HYEA 1I1RA 5K1JA 1L3WA 4FG2A 5D7IE 3V9EA 5DLLA 2B2XH 3MO1A 1XCXA 2DEWX 1N59A 3PUCA 1A9BB 1UQSA 3QYMA 1YY8B 4E41A 3O8XB 2VDNL 2QLYA 3NZHH 3FYEB 5F7EL 3PJNA 3FUFA 1BHGA 3QUYD 4L1DA 3P1VA 3MBED 5DHDA 1PCXA 1UWXK 4MNQD 3RHWF 3N44F 1KB9K 4OLXH 1ZLDA 1WFUA 1A7BA 3NK4A 4BFFA 4GI9A 1E4XL 3U1SL 3NPSB 5CILL 1T89C 3SQBA 1PCSA 2GG1A 4XPFL 1QI3A 3BIBX 3HPLB 5DLML 5KVFH 4XB7A 2AGJH 3H1ZA 4UIMB 3O3BA 4HC1L 4JREB 5JORA 3BD3A 5CN1A 1J88A 4MX7B 1SLWA 3TV3L 1MIEL 4EE2A 3MGTA 4IU2B 5EFIA 2OV0A 4WKXA 1PY0A 2FHCA 4WHTB 1PZ5B 4I2XB 4XNQB 3OR6B 3TVMD 1P84K 1WBXB 4HEPA 2V17L 3RWDB 5DQJB 3K3QA 2FR4B 5FM4A 5EU5A 4R2GC 1U8OA 4Z3HA 4CSTA 5AB1A 5KBPA 4EIGB 3BDYL 2JJWA 3SPVB 3N91A 1SM3H 3UBGA 1IAIL 1NBZA 2C9SA 3B7YA 1WIOA 1MN4A 1J87A 1NBYA 1HX0A 1AC0A 1NUGA 2R0ZL 5BZWB 1I3RA 1OOAA 4PS3A 3TO4D 1BGXH 4DKTA 3QDMD 3L4ZA 5DHXB 4CRPA 3F7PC 3LRSB 1T3FB 4LSUL 4W6XB 3MFGB 5E99H 3US0A 5BZZA 4QRTA 2NXZD 4WJKB 5CO1A 1KJ2H 4PYGA 3EDEA 5DJXB 3ZSTA 4U49A 4F3FB 2ZAGA 5FYLE 3WNKA 5B39B 5A6MA 2VDMB 4NCC1 1KJMA 1E65A 1OWWA 4HYTB 3HZMB 1VEOA 4G8FA 5J11B 1KXQA 5LWYH 2OYMA 2PMZA 2IWEA 4JZOB 1VGEL 4DESA 1E4WL 4J4PA 3I02A 4UIMA 3CNKA 3PWPB 4YPGB 3S88H 3OXSB 2HRLA 1NFDF 4HBQA 4X6DA 5IB5A 4MX7A 4OBSA 5DZOA 3BPLB 3VW3L 3I9IA 4PS8A 1I1YA 3DX4A 4R0LB 1KJ3H 1I53A 2NY5H 3DURA 3TPUB 1M7IA 4B97A 3I75B 2V7NB 2PYEA 4H25B 3UIZA 4NENB 2Y36L 4WI7A 4XVJL 3HN5A 5BW7C 5CCKH 5DFVD 3VTAA 3O3AA 2IQAA 4NP9A 4FQXA 5ALBH 5BOJA 3CHQA 3OKOA 3ETSA 3VJ6A 3IXTA 5EZLB 1XHHA 3BUTA 4NLAA 4ZW5A 4GMTH 3FQNB 5AVYB 1WH0A 5ESVA 3HG2A 1D5MB 1ROCA 4PLKC 3EYQD 3RLSA 1SY6A 2Z1PA 5DUML 5EU6D 2OZNA 1J1OH 4L37B 2HAZA 3RX5A 5IMMB 4YC2B 2XG5B 2MSPA 4IMKA 5CINL 2NY7L 2YZ1A 2B1AH 2XVBA 2PLTA 5FO8A 4OAWB 1PLAA 1NIBA 4UDUB 3V52H 4M6NL 2CXGA 2XZQH 4YL9A 4AK2A 2OZ4A 1D9KA 2WLLA 1EHXA 2AJXL 1BQKA 1WT5A 1MI5E 2BCMA 3I6GB 2YXWA 1NIEA 4B9IA 1LEGB 3GXDA 4QHMB 2FNWA 2R2BA 3DO4A 3N06B 1E9PB 4K4KA 1IM9D 4L3AA 1FZOB 1U8LB 5I8EB 3V4PB 4X5XB 1E90A 3OKEB 3KYOB 2WJ7A 1N2RB 1ZIAA 1IL1A 2J20A 1L0PA 2OMWB 4HBCH 4D94A 1G0XA 5IW3A 5CN3A 1OSPH 4M6MH 1T1YA 1DQQB 2X53A 3AG1B 1L6PA 3MBEB 4Z7VE 2CNYA 2YJQA 3I6GA 1IEAB 2UZIH 4NUMA 3NJMA 3MYJA 3N3EA 4BE6A 2DWYA 3LCYA 1O0VA 4PJAF 3T6XA 2I60H 3FT4A 4D9LL 3UADA 1OPOA 3EO9H 4OLYL 3VXUB 3PL6A 1EGJH 1VPOL 2P4AB 2ZSWB 3O2DH 4N8CL 1MRCL 2IH9A 2GIYA 4UQEA 1K6QH 1RHFA 3TURA 4P8QA 3MREA 4DOHE 2A6DA 4GO8A 5ESVB 2EABA 3QHFL 2A73A 2XTLA 3DYOA 3CXHK 4LNVA 2CKNA 4PS4H 3S5ZA 4Y4HB 4JFZH 4RGOH 4P3WA 3TZVA 5KVMC 1A0QL 1KCKA 1KGUA 3I50H 3W39B 5A3IC 5DT1H 4Z7NE 3SE9H 2H1PH 3KCPB 1ZDSA 3MLYL 4AMKH 5EB9A 3QG7L 5ICXA 4JHZA 1XGTA 4BKLA 1V3MA 2DI7A 5IB1A 3LYRA 4YK4C 1VESA 4EAEA 1YY9D 2ZOWA 1T1WB 4ZAKC 4P46A 3II2A 3ZE1F 1MRDH 1XMWA 1D5RA 1P5VA 3PDGA 4PRNA 1DR9A 4W70A 3TYFA 3FSAA 4K5MA 1TZIB 2BIQA 3BW9B 5IEKB 3ATFA 2J1ZA 1JZ7A 1AGBB 4QY8A 4FQJL 5HP5A 4PJBE 2XVKA 3NDYE 1NGPH 3SDYH 5EN3A 4KKLC 4LIQH 3H0TA 4NZRL 1C16B 1PLGL 3C5JA 3WU1A 4X6DE 3RIFF 3DO7B 5CD5D 2CLRA 4LP8A 4UT9H 3BQUC 4Q0XL 3SPHA 2J57A 1AKPA 3APNA 3PHQA 5IB3A 1T6WA 5K9QI 2Z92A 4O2FB 4QHLA 4ZTOL 4NZFA 2EDJA 4ERSL 3LV3A 4NHCH 5AAPA 2ED9A 3HHMA 3ZQWA 3Q7JA 1MKFA 1BOGA 5E8DL 1RLBA 3VGGA 4AY0A 1LE5B 1OGAD 1XCTB 2R0KH 2WCGA 4JN2B 2OL3A 5AW0B 1INQA 5IBUG 3S5LG 5FB8A 2NY4B 3O6FB 4JB9L 3L4VA 1D5IH 4APQD 4GG6F 1HEZA 5K33A 3QDGE 5I1GL 4IDLA 1ND0B 3FQ1A 4R2GD 2WLKA 3GMOB 4JREC 3RWJB 1BJMA 1OKEA 2ZXAA 3IEAA 4GKZB 3VWJC 1K85A 2N7SA 1IZJA 3S34H 1JF5A 4UTBH 5AAMA 1HH6A 4QJ3B 1U3HA 3LDBC 3J7HA 3X1GA 1ESOA 1HHIB 2X4PA 5BRZB 3KXFD 2Y2TA 3DI2B 4DCQB 3PXJA 3NPSC 2N7AA 5KS9E 1A6VL 2VJ8A 1PTZA 2V2WB 8CGTA 3O6FA 3DX9A 5AVSB 5IBTL 4P3DB 3UOAB 2OTUB 4LP4A 1E5BA 1KDIA 2DQDH 4U6HA 3DXAD 2DL2A 2RFXA 3FUIA 2HRGA 1XR9A 1I1CA 5E8EB 5ADOL 2J25A 1M9WA 2YMOA 4K3EL 4HIHB 5HD8D 1JV5B 4MS6A 3PUUA 1UM5L 1KIRB 1IC7H 2GHZA 3ZRCC 3BPCA 4ABVA 1R33A 2DYPD 4LAJH 3TBVA 1KTLB 1UCTA 3QEGL 1A5FH 2NQ3A 3D2UA 5CCHE 3F8UB 4YSCA 3IDGA 5JIPA 3F3HA 4WEEA 4FEIA 3IVKA 2VLRD 4PYHA 2BFVL 2FEEI 4YHKH 1GR7A 4BELD 3LRGA 3WDJA 1D5ZA 3T0DA 2CJTA 3NCXA 2OMZA 4OF5A 2ADGB 3QJTB 3EIFA 4CMHB 5D6DA 3I9GL 1IO4C 4LL4A 5LKNA 2BS71 2WQSA 3FUEA 4UTAA 1Z2KA 2OK0H 2YXVA 2DQDL 2YEVB 1W72A 4MAUH 5DDHA 5E03A 5ADPL 3MAWA 2E7DA 3OGCB 4MD4B 4GIPD 3BI9X 1A21A 5KOVC 2VR7A 3EGDB 1HOEA 2H1LM 2NY3D 1AVAA 5B7FA 4HUNB 3MCYA 5AW8B 4OB5L 3VXUD 4Z3JA 4PJ7F 4HPYH 1Q8MA 2QADD 4NAQA 1YJDL 1A9EB 1MHEB 2D73A 3MNWB 2IPTL 2HG5A 3R8QA 4FAAB 5DR5H 2G75B 4QO1B 1E30A 2P8PA 2WC7A 3WIFA 3W37A 3VXSA 3T1FB 3SPIA 3DX0A 2BP0B 4JFFE 4P23B 4S1SH 1INDL 3MBEC 1VFAA 4MDJA 1JPGA 1HL9A 2CK0L 2E56A 3SBWC 1VGKB 3F04A 4IBYA 5I17B 5IKCB 2NY6D 3P3TA 1BFVL 2CR0A 4UAHA 3LZFH 4KROC 1L9MA 4HUCA 3BGMB 3IAQA 5CZXC 3ZKXC 2QPDB 4FHJA 3ZBMA 3IKKA 4TSCL 4FADA 1SMAA 2MFNA 1NFDA 1HNYA 3QUGA 2QV4A 3HAEA 4G83A 4G1MA 1LD9B 4HFWA 3Q5OA 3WHXA 3Q1EA 2VIRB 3QEQE 4LOUC 1W6LA 2BC4A 2MQGA 5DMIL 1VCBC 2X4UB 2YRZA 1N59B 4R2GB 1FNLA 5EZIL 3BGMA 4JHWH 3DC0A 3NJKA 3SD5A 4YC2C 3GZKA 1OOWA 4E36A 4R90H 5ILTL 2H9GB 2PNDA 5I30H 4Y16C 2NMSA 4H26A 4FQQB 3WKML 4HS3B 4B27A 4Z77A 1MJ7L 3EUDA 1U8NB 2HTLC 1U3HD 5C8JA 2AAVA 4E42B 3WS3B 4FOMA 2KUTA 1NJ9B 5CZRA 5DT1L 1TJHL 5ISZA 1RSYA 2CUIA 2GYSA 2R29L 4N2IA 1RVFL 2EDMA 3ARXA 2G75A 4QO1A 2YD4A 4U1HB 5E2WH 5IB4B 1GOFA 4BHUA 3KPNA 3OGOE 2VE6B 1A7NL 1G6RA 2JNZA 3DHPA 1R1CA 1W8NA 2J5LB 3GXIA 5CLYA 2BNRA 2MPAH 5IQ9A 3LKRA 5CBAA 6FABH 2LT9A 2ADYA 4UT9A 5SWQA 4WUUA 4O02B 3UDWA 4CNIA 1SXBA 5T1JA 4YMPA 1A02N 1PDKB 4AYMC 2A99A 4AIEA 1BLNA 4UIKH 3UAAA 3LPPA 5DK2B 1CR9H 1X6LA 2PPFA 4OD1L 3QS2A 3BRGC 4OLXL 1SVZA 5I73C 1T66C 3CHPA 4WENB 2XPZA 4WWKA 4DQAA 1KIUA 1YN6A 2IQ9H 3PU7A 4B41A 4BCZA 3O41A 2VDNH 3AM8C 5JO5A 2F5AH 4J3BA 4ZPTA 3RWIA 3SKNA 4L4JA 1A4CA 1FL5A 2BXZA 1WWAX 5KVGE 3IDXL 2NOYA 2FGWH 3QORC 4PW3A 2OCCB 3RAJH 35C8L 5I1KL 2MJWA 1R19A 1BMWA 2G5RA 1Q94B 2F68X 3ZN6A 2AEQL 4Z7WE 5DHVA 4M6NH 3FCTB 1YYMH 1WEJH 4YFDB 4PRDA 5HDRA 4ESKA 2ZOOA 2ZAIA 3P73B 1L6XA 4X6BA 3TU6A 1RUKH 1DJSA 1IUZA 3PGFH 4LAQH 1E42A 3AUVA 4G71B 1AG6A 3W9DA 4DPBX 1KGIA 4NQVA 4Y19B 3Q06A 2OMNA 1AZCA 3BN3B 3PGCB 5EA0L 3SO3B 2KT6A 3STLA 4NSKA 1UJ3B 5G4NA 1G6RH 2PR4L 4Y9FA 3VFOA 4DP2X 5FM8A 3NIFE 2K7PA 1NCWL 4UQIM 1P5UA 3PL6D 4F2FA 5JYMA 2C3WA 4JR9L 4R5TA 5CJQH 5TDOB 4M29A 3D85A 5GIRA 4CN6A 4PV8B 4D3CL 5DYOA 4HPHA 3BP5A 3DHJA 4MNGE 4YNYA 2ARJB 1H6TA 4M1CC 1ODUA 1A3LH 5DUBB 5C0GB 3VB9A 1HOCB 2V6HA 4P4KD 2ZCLL 1KJ2B 4O51A 5FC9A 4NNYB 4ZFGH 3QUXA 1B3IA 3S88L 2X2YA 1TVHB 4TPRH 4AW4A 2DAVA 3MGOB 5T1MA 1H9DA 1X9LA 3BD4A 5CZVL 3D06A 3WNPA 1RHHA 1DBAH 4AVHA 3QUYC 1FRGL 3AVEA 1AI1H 3WDIA 5GIRB 3TNNB 3SDAB 1RJYB 2FWLB 3MCKB 4PJIB 1NPJA 5F9WB 1F0LA 2H6PB 4LP5A 1UEMA 3FH8A 4U6YA 5CEZD 4YR6A 1OLLA 1ZIBA 4NKIL 1PD0A 1G7JB 2UWEF 1CB4A 5IBUB 3S5LB 1E43A 5DFTA 4X5RA 3VQMA 3FU8A 4MCYA 2BP3A 4OQ1A 5LBGA 4U31A 4X7TB 1U8PB 4HGMA 4AG4H 3KZ8A 2FX8H 5G55A 4OZIE 4OIIH 4AEHH 3BP7B 1MCQA 2VMFA 3NIDE 1C7TA 2IG2L 1JZDC 3FQWA 4JAMB 1Z5LB 3LNGA 3GM8A 4JG9A 3OTTA 1B3JA 1AHKA 1NICA 3J8F7 4KI5F 5GS0L 1QR1B 2CPCA 3CCHB 3MBXH 4X6CA 3VI3B 1N8OE 1SQ2N 3MJ7B 1KYOK 1ADQL 1HHIA 1OQOA 1Z7JA 2RH0A 4I0PD 3EBHA 4Y2OB 3T8VA 3JTBA 2G2NA 1W0WB 1KCVH 3Q8EA 1CMOA 2WUBL 3WO4C 1J8KA 3BRFA 3MREB 4N8VG 4JFFA 2W91A 5DHYB 5IHBA 1IQDB 5HHQA 4PRIB 4JN1L 2A4ZA 4AV5A 3FU0A 3TN0D 4ZTPH 3ZO0A 3FBKA 5I1KH 1NGQH 1LO5A 3VTMA 1XGPA 1RAMA 2V7HA 3QDGB 3FTSA 2W92A 2E27L 2G3NA 4X6CB 3MFFB 5HGDB 5ANMB 1GKOA 1A6PA 3IFPB 2VMJA 4XBMA 3EJZD 4J3TA 3WKNA 5ICXB 5GZOD 4JFXB 4WEUD 4LPUA 5F2FA 3IFLH 1OM9A 2OKMA 4YEFA 1YYLH 3MXWL 5AW5B 2ZUUA 3HJEA 4PBXA 3S6CA 3CWGA 3NP4A 1OP3K 4IRJB 3CZGA 5FOJA 5CJXA 3NEXA 2QT6A 5IT2L 2FSEB 4HETA 7CGTA 1WA0X 5IEKA 2VXQH 4G8IA 3E6HB 4ZJ9A 1T5XA 4JKMA 4HS8H 4R97C 3UAFA 5AAWA 2MPAL 3O3UN 3HG0A 2G0KA 5HDQL 3SPGA 4ZMNA 4APXA 4Y4FD 1C08B 4E5XG 3QAZC 3WTUA 1BZ9B 4B9KC 5I1DB 3K2KA 4UQ9A 43CAB 2C4FU 4YBLB 4K7FA 4KDTC 1E4JA 2BVEA 3N1FC 1PZSA 2FSEA 4YVUA 1UZGA 4WW2F 4ONOA 5C08B 1BAFL 1ES0B 1W0WA 4NM4H 5FYJH 3H55A 4AXWA 1BZEA 1JHKL 3VXSB 3P69A 1S7SA 4OCYH 2VZVA 2Z3FA 2FJFB 5IREA 3LD8C 5I1AB 1LP9F 3T2PA 1G7LB 2GJZA 1I8UA 5D7KD 2EICA 2BZ7A 1OTSC 4NN6C 5C08A 1CG9B 1DZBA 2R69A 2WXIA 5CJ8A 1KXHA 1T0PB 4GUPB 4UAOB 5AG9A 2XZCL 2JH2A 4MA7H 5BRZA 3UP6A 1TXKA 4TLTA 3L3HA 4R7XA 1RQ5A 2WTPA 2VJXA 3KWUA 3MJGX 2GEQA 2DQUH 4LLMA 3HIZA 5E5RB 2BSTB 4PAZA 5CHNA 3ZTEA 1ZJAA 4F2MB 1C12B 4DP7X 4TSBH 4E41D 1GGCH 4YH6A 4G8IB 2X4UA 4KZCA 1MFEL 3KCPA 2D3VA 3HPJA 4BSWA 3CDYA 2YR3A 1F18A 4KH2A 2VH5L 2RJMA 4H0LC 1NLDH 4I13B 1JZ5A 3ZE2F 2VXUH 3TIEB 2VZ3A 3SB3A 4J3VA 3BWAA 1NMBL 4AQ1B 4KKLD 3QULB 4P57B 2BSTA 3CXFA 3ZZSA 4E42A 4GIOA 4M48H 5C0DB 2Z6FA 1AHWC 1L0XA 2J8UB 2QVTA 2V8MA 4ZBJA 3VRIB 5DQJA 5C6TL 3GB7A 5F88A 2P5EE 2ZCHH 1YC8A 3K91A 3WFEH 2YD7A 9CGTA 5B1CA 1CBVH 1AO7B 4XVTL 5I66B 2V2TB 1LM8V 2JFCA 5IQ7H 4JE0A 2A6JB 1QPKA 3OHMB 4WV1B 4MASA 5D7SL 3E1ZA 2GJZB 5EHFA 3CFCL 2EDOA 1OGTA 2IBGA 2J71A 5CUSL 3HNTH 3PP4H 2YK1H 4AEIL 5C2BH 4PJ7E 2YPLB 5JIDA 1J5DA 4OBRA 4WQOA 1DE4B 4A2FA 1XIWC 2D7PA 2YD2A 4AQ8C 3FU3A 5AZ2H 4F58L 4FQLH 1KDJA 1IX2A 1FP5A 3LRSA 3CSYB 3LNEA 3WFBH 3ZTNL 3AU0A 3O3BB 5CGBA 1H8OA 3UG5A 4N5EC 3L3IB 1N10A 1DVFB 1O7DE 3U82B 3NCJH 2FIRT 5ILTH 1HCVA 1M71A 4HUWB 1YMMA 3GIVA 1FAIL 1XSKA 3IJ7A 2GJPA 5TE7H 3GI9H 1ET7A 1QNIA 3RL2A 3TPKA 7PCYA 4KUCD 3C6LD 5C09D 5C7ZA 2PO6D 3I02B 1CXKA 1N7ML 3DX3A 2WSKA 5GRZA 4RX4D 3KJ4C 4H40A 4XMXA 2X2JA 4N2OA 4ZT1A 4RAUB 1XD1A 5HGBA 5T1DH 1OGAB 5FUZL 4HJJL 3RYMA 1QASA 1MJ8H 2QGBA 5KSUA 3IDIB 3UTOA 4WRLA 2F19H 2HRHA 3EF7A 1SPDA 3GIVB 3JXAA 4PB0L 5I75C 1TJXA 3P73A 3LHPL 4MJ5A 4H1LB 5HGHA 3GB7B 4IDJL 1WFOA 2BHUA 3Q2CA 4P2RE 2OZ4H 2VIRA 5DC4B 4ZD3L 1G7QB 4PJXE 3EHBC 4YHMH 5LB1A 1J9RA 4O2EA 1I85C 4Y8AA 3VGBA 1FBIH 4MXVE 3GXNA 3MUHL 3G5ZB 4H7VA 3PAVA 3JT0A 3IDIA 1SY6H 1W0VA 2EO9A 3AY2A 2MNUA 4RCAA 1NMCC 2PXYB 3OMZA 4G42B 4EBQL 3D48R 5IMLB 1SVCP 1UACH 4PP2B 4KRNA 3L3DB 2GBAA 4OB5H 1JDDA 3HC4L 5MEOA 2DMHA 5ISZB 1XBRA 1KELH 2F19L 1NKRA 3DK2A 4XOCA 4PJ8C 3C5ZD 4HCFA 2EEXA 4R7DA 1JFQL 4Y1AA 3NGBB 1PF3A 2NQDA 1YMMB 3ARRA 5JR1H 4NNPL 5L4MA 4GQRA 3UPCA 2IDCA 2F54D 4QXTB 4M8UA 3VFRB 1IQWL 4POUB 1XDTT 3SDDA 3QCTL 4IS6B 4JG5A 2D0FA 5JQ6H 4Z3TA 1RZFL 4PRBA 3FU5A 3IXTB 5EZLA 4F7MB 5K1VA 4KGJA 1U4EA 3N42B 4Y1AD 3DJ9A 3BVVA 4W9LC 4AOFA 1HAWA 4B9YA 4RIRB 4PN6A 2BHZA 3TBTB 3N42F 1PSKL 4KKCD 3CFJB 1R3JA 1G9MC 3VSVA 2W07B 1ZT1A 3CVBA 4NC1E 4Y5YB 1TMCB 3VDAA 4ZPTB 4FLHA 5E51A 2ROYA 3PQYB 3MNDA 3MRBA 4EQ2A 4XN9A 2IANB 1YG9A 3QUMH 4XB8A 3WV0A 2Y06H 3FK3A 5I5MA 3DYPA 1HHKA 1M1XA 4ZZFA 4EJ1C 4XNBA 3JWOL 3EZ8A 5DJCA 3FTGB 4WI9A 4NQCE 5DS2A 5MENE 2X70B 2P1YA 1I4FA 4N8CH 4TVPH 1J0IA 3QIWB 2OMWA 3U36A 2AJ3B 4TQEH 1FIGL 5EDXA 3MRPA 3A4EA 3ABKB 1DEDA 3TASA 2KQMA 4EN2A 1NGXB 3EXJA 1C9SA 1CVRA 4BDVA 2BVOB 4Y19A 4IRJC 4Z5RB 4YXKH 1EXHA 5E8DH 1AS6A 3IFPA 4LDCA 3RKPA 3WY4A 2ZSWA 3EYOB 1TEGA 3BWUC 4HF5H 2QKIB 3FSZA 4UQBA 4HIJA 4LCYB 3O45B 4XI5D 2CUHA 3C8KA 3ZMNA 1AZNA 3L2LA 4IIQA 4LSVL 4WI0A 4CC4A 1KYUA 1UXLA 3HG1E 4MJ6A 1N9PA 1J8HB 2A4CA 3H42H 3IE9A 2J8OA 2EVGA 5IR1B 2BS8A 1ZT1B 1MIMH 1M9SA 2YXFA 3X14A 3ULUL 3SBRA 1UWGL 3GBDA 3F5WA 4Y5XB 1AZVA 1FV1B 3I3DA 5DD0L 3VXQB 4I85A 3Q5YA 3B2MA 4Z7OB 3P0VL 1TIUA 3VI3F 2J2ZA 2ZG2A 3PP3H 5K93A 3C2AL 2P7TA 4OLWH 4BSJA 1IC5L 1IGFH 2N7BA 1MRDL 4HS6B 2EYSA 3ARQA 5DQ9A 3ZDZF 3LNHA 3WEMA 5LQBH 2RALA 2X0WA 1T2XA 5JHDA 2NUTA 4L8CB 4JE4B 5D8JL 1UH2A 5GZOC 4KI5D 5I8CB 5LUMA 4PTUA 1YMMD 4PJFF 3GINA 4YGVA 1UHVA 1I1FB 1NAMB 2XZAH 4X7TA 4N28A 3THML 3MMEA 5A3ID 3N85L 5JHLL 3I2CL 4O5LL 3K71B 1G4RA 1KXTB 3QHZH 3FQRA 4BD4A 1F56A 4NC1C 3A4DA 1SOXA 4YN3A 1CE1H 3ZQ9A 1O5DT 2C9PA 5IG7B 5F72S 3QNFA 2QVMA 4HZAA 1P4IH 5E2JA 4LGPB 4NGHL 3IBOA 2OZ4L 4PJCB 4I88A 4AIXA 5LBVA 1ZSDB 2KDYA 4BZ1L 5DEGB 1X7SA 3FFDB 1AGFA 1BREA 2BNUA 4JFTA 3TXAA 4HHWA 5HPMB 4YBQD 2FEDC 5CJBA 1LK2A 4LSSL 1OSZB 4LLYB 3QUYB 2DTSA 4BFBD 5L0QC 3LEXB 4I9WD 2P24B 1EJOL 2HRPL 4PRIA 3X14B 4M1DH 4HJTA 5IOPB 4WTWA 4NSKB 3VVVA 3FB7B 4GFTB 4JFYA 2NSQA 4JFWA 2OJZL 1P5UB 1WAAE 3WUZA 1X5MA 3Q43A 1U8CA 3G5YA 3CU1A 2NY0D 4DGIH 4YDJA 2UWEA 4AQ1C 1XIWB 3AM8A 1O7SA 3AG2B 3NCJL 3O9WA 4JG1H 4QXWA 3RPKA 2JKNA 3OMAB 1HJBC 3IJ9A 4AL8C 2WQVA 3KLAB 4P5MB 1OE3A 1I7RB 1FVEA 3IJHB 3CQFA 1OSEA 3VE0A 3HUJF 3OR7A 2P28B 1KGWA 4JQXC 3GMPB 4HKXA 2UVFA 2XPGA 3ERXA 3TJEH 3TNMA 3VSTA 3CZJA 3V6FA 4A2MA 1R5WB 3HCVA 15C8L 3BWZA 4JQVC 4PRIE 5KVDH 5GGSY 4Y4FA 2EQDA 4PGCA 4DFIA 4N0CC 4U1MB 4OM1H 1J7VR 2YZ8A 1WLHA 1SBSH 5A2AA 4YVNA 5ALBL 1TF4A 4ZUUB 2JKXA 4J27A 1TLMA 2G5BB 4P2OB 1J8HD 2X42A 5EIIA 2VLJB 4G8GB 3FDWA 3KBPA 4D9QD 2IMMA 1SBBA 3HCVB 1A9VA 2XWZA 4F7TB 1IU1A 4BSVA 2P24A 2KLRA 2NT1A 3WLBA 5J1TC 1D5BB 1EEYA 3ZDXF 3EGDA 3BH4A 2WM0A 3HFFA 1KGCE 5CCGE 2E6PA 3GSVB 3NCMA 3S98A 4BYHA 2OXHA 4JRYD 4WI6A 5C0ND 3BZEA 3PABB 3VXMA 4BA0A 3KR3L 2YAPA 3O6ML 2VLRE 2VDML 4X80L 1GIGL 2VN4A 5CWSB 4MCZA 4YUEL 1LTXA 5A2FA 3IDJB 3H9ZA 4P3CL 3U2SB 2GJ6A 4R97B 1KMGA 4LLMB 2VYRE 4JZJA 1U8NA 5C8JB 2BRRH 3N44B 1NCBH 4NO0B 4R8WL 5CJQL 1YMHA 2ZX8A 1QSEB 1NJ9A 4NM8L 2F18A 2R2HB 3S8FB 1WGOA 4QKTA 5D5MB 4NN5B 1LO3L 1N64L 2EYRB 3VA2C 4A6YH 1RZIA 5EOCH 1HCFX 3PRZA 5DGRA 5DTFB 1F3JB 3V0DA 5C92A 3MU3A 4X7FC 4L3CA 2BPBA 4PJ9D 5JIIA 3NCBB 1SDDB 1FVDA 4TQIA 3RWEB 5KVEH 3HMXL 1AMYA 3EH1A 2JB5H 3VAEA 2BC4B 3C60C 4AZUA 2WLMA 5IROC 3QDGD 4OIFA 1DEEB 2CCVA 4FFZH 1J5IA 3W57A 2GTZB 2X6UA 3OSVA 3Q3GA 3QYCA 4LLVA 4Z0XA 5D7JC 3Q2VA 1CU4L 2D4DA 4LLUA 2A6JA 2ZOTA 4LGSB 4OCSL 4WV1A 4BK5A 4DH2A 5E5MA 4FA8A 4MDJB 4U1NB 1UFUA 4QXTA 3TVMA 2FE0A 1JD9A 3WS3A 3WFDH 3OR6A 3VU1A 4PD4K 5AVWB 4P9ML 3AFLA 3NSFA 1ULVA 25C8L 5EU6E 4X0KB 1HVXA 3DX8A 1LK3H 4TL4A 4EQ3A 4P4KA 5G5DA 1IEBA 4PJIF 1TQCB 4F92B 3VXPB 2LAGB 4R26L 3D8MA 5TTRA 3TT3H 3L3OC 5DD6A 1V7MH 4LPXA 2Q7NA 2BNRB 2Q2LA 2X38A 1DLFL 3R4DA 3KGRA 1RJLA 3WENA 2YAMA 3NABH 4A2HA 3JT2A 2VQUA 4IOIA 4F80A 1IARB 1MH5A 4PCYA 3V4VA 1HXYB 3D34A 12E8H 2Z4QA 4JN1H 5FYKL 1NCCH 5DD5L 2FATL 3QZOA 3VA6A 4ZFFA 4ZOCA 2NY0C 5ALCL 1GW6A 2PF6A 4MNHA 3MC0A 5E4EC 1S9WA 2Y07H 4RGNB 2XQYA 4XNZC 1AQMA 1BQHB 3BX7C 2XYCA 1YY8A 3WN5A 2F53B 1XGRA 2Q2EB 4I4WB 2RACA 3WEAA 2A83B 3W0WA 5L4JA 2XFXA 2QR0A 5HYJD 1AXTL 4ICXA 2QFRA 5ANME 2FZ3A 4C4KT 5BOPA 3T0EE 3HZKA 2D2OA 5AZEH 2IDSA 3BAXA 4N1EA 4XMLL 2FEDD 2Z1KA 5CD3A 4R83A 4LE8A 2TSBA 3JQOB 4JRYE 3VFNA 1CGSL 4G8GD 3I74A 2HG0A 2NY3C 4PU2A 1W8EA 2EO7A 3QUMA 3TF4A 1RUML 4Q9QL 5HVGB 1A2YA 5DK0B 1C5DB 5EOTB 1KGCD 2K0RA 2YGOA 3EJCA 5J0BA 4KZEH 1B0GA 1GZPB 3FUHA 4JRXE 5DEZA 1YPZB 4H1LG 4PJIE 5BCAA 5KTEL 4GAGH 5FYLL 1MNNA 3EJSA 2P80D 4WWKB 1KEGL 1IC4L 1H8LA 3QUZC 3IPFA 1QUNB 3DSFH 4K71C 3GMNA 2VDMH 4FCAA 4X80H 1UFGA 3DLQR 1AY1L 3QJOA 2FCBA 3DXAE 3VXNB 2QTEA 5EF0A 1Z9SB 2DL9A 5FKPB 4N2AA 2KDGA 1GZPA 1FYTB 3T08A 4I18B 4PRBB 2C4FT 4TOYH 2AMUA 2EUWA 2CK2A 2IO5A 2XRAL 5D70H 3V4VH 3SE4A 2RQ8A 5HI3D 1IFGA 2H32A 2B16A 4HSAC 4W4OC 4XAKD 4XWOC 3RA7L 4HG4J 3MLPA 4ZMYA 3N43B 2K4WA 4WEBL 2A6KA 3HBPA 5DZJA 1UGNA 1FFNA 2I5YL 2YPVH 4OZHB 1B88A 3CTTA 3RU8H 2EEFA 2XWJB 1BVNT 3KXFB 1PNDA 1Z3GL 4IKIA 3STLB 4OLUL 2VITB 3WFCH 4B95C 4LKCA 3KYMB 1MY7A 2OR9H 1CDJA 4LRNL 4L4VD 4XCYB 4XCEA 4WSJA 2X28A 2BNRD 2CA3A 3ULVH 4XH2A 1ZHLB 3V4LA 2B5IC 2WQ8A 5HHPA 1FFNB 2X4NB 3KHQA 3VGDA 4LLDB 3G5VB 3HMWH 4W6WB 1UUNA 3AC0A 2X9WA 2ZSVB 1GYVA 4WIQA 4P5TB 2XN9E 2XQBL 3JVFC 4FL4B 4XNYH 1XGZA 5E9DB 4AL8H 1UYWH 3WFHB 2WXNA 2IPUK 4GKNB 1PNCA 3V0WH 4RWYL 2A6IA 5E2VH 1E5CA 4YDVA 3T3MF 1WT5C 4R5XA 4EXKA 5DVLA 1AHWA 4KKNA 4GSUA 4DO6A 2F0CA 1CLZH 1IC0A 2UY7B 1CGTA 3G6JF 1L9PA 1L7TL 5I8OH 1LL1A 1UC6A 2W9EH 2X9XA 4PJDA 2V7HB 3Q2NA 4B7IA 2ZD0A 3UAJC 4XMTA 4LNRB 4HK0A 4NWTL 3TT1L 1BM3L 4WWID 2CH8A 2Q7AA 1JK9A 1N70A 5FLVA 1GC1H 4HWZB 5DU7A 1ASOA 2XWJA 1ZDQA 1QFWM 3RGVA 1T2JA 4LSRH 3JUYA 2GEEA 3F00A 2VDPH 4JBSA 1T0MB 4J12A 2E86A 4HWEH 2MWCA 4PH8A 4GRWF 3HG3A 1CE1L 2UY7A 4CAGA 2QJDA 3Q8AA 3TZVC 3TFKD 3QIUC 4OZFH 1OP5K 5IF0B 2C5DC 5BRZE 2AJYL 2DS4A 3H9HB 2FO8A 1WZ1L 1ZSHA 4A7TA 3BGFB 1KB9J 3VWKB 5DRZA 3QEUB 1FC1A 5IV2A 1IMHC 4M5YH 2AEPL 3BMWA 3DJSA 3U7YL 2VC2H 1KXTA 1U8KB 1M1XB 4WFGD 1SEQH 2JJSC 4M6AA 2WGNB 2XJKA 1JWUA 1CXFA 2XKNA 4G6JL 4WCYL 2J73A 3UPRB 1K3IA 3RWHB 2KI6A 4HJGB 3TLRA 4QT5A 2BNQB 3GSUA 5EC2B 5HI5D 1M05B 1NEZB 2EDEA 3D69B 3OAWA 4NUGH 1FLRL 4KTGA 5DEFA 3HE7C 5EA0H 3PWVA 1Z5HA 2GAZA 2HX7A 1JK8B 1IAMA 5GGVH 3RWCB 1CFTA 2NXYC 1KGJA 4MKTA 3P9MB 4HK3J 3SBPA 2FJFA 1UXSB 5KVGL 1NC2D 5GSRB 2Y5QA 3KPSE 2MCAA 4H8WL 3W2DL 3ZDYB 5ID1A 3QUZD 1UG9A 1D5XA 4XZUA 5E9DE 4JFHE 3DNKA 1MVUA 3QPQD 3DOSB 1J05B 3RIAK 2DTMH 4AK1A 5FHBH 3NCFB 3HPLA 4KKRA 3OKDA 4DPCX 3QS3A 1QRNB 5IMOB 1A0QH 3I50L 3RDTA 2MOQA 4ODVL 1HJCA 1ROWA 4F9PA 2QVIA 3ZL2A 3QUKB 4LARH 4XC3H 4CKVX 4LBAA 1E0OB 4PJGF 3L9RB 2AQQA 3CG8A 4EZMA 4JM2A 1ADQA 2FH8A 2LQRA 5HTSA 2X3AA 4GRLD 3QFJB 4M4RB 2HT4D 2FHBA 5IVXA 4DVRH 4JZNB 5JLZB 1J05A 2YMTA 1L0YA 3I6KB 2X1OA 4NJ9H 3VFGH 4Z6AT 3GRBA 1OTSD 5GGVY 5B1JA 2B0SH 1HDMA 4D9LH 2WBJD 3V6FB 2QMJA 5DURD 1D7BA 2CXKA 4KTDH 3ORJA 1F90H 2OP4L 2Y6SD 4NQSB 5T5FL 2DF3A 4H0HB 5I76B 5JXEC 2YA1A 5ADPH 4OTXL 2D7NA 4RESB 5JHDB 2X5PA 5F9OH 2X4SA 1YEHL 3PWPD 1S78C 4AC4A 4FQ2L 1VDGA 4UT7L 4NPYA 1T0NB 3QDJA 3ALXA 2DQCH 3KPRD 4QF1B 3BKJH 4JPVL 4B9FA 5ANHA 2VL5B 4R4BA 5I15L 1LJMA 5FA4A 4ODHH 3U6XA 5DA0B 3B37A 1URIA 2EZ0D 1HSAB 3GXTA 5DZ9A 1FYTE 1GY2A 5AOZA 4C54A 4EKJA 1Z6JT 4D7BA 2AERT 1I8KB 3WIFB 1BPLB 5DMJB 5KW9H 1OGAA 1U30A 4YBQC 1NOLA 3VVWA 1D5BA 1EEYB 1VIWA 2XBTA 4GXFA 4CN1A 4IKJA 1NPNA 1WAPA 4DKAA 1BFOB 1IC7L 2QL1A 2IADB 4Q58C 2WXHA 2KS0A 1QRNA 4KK8D 2D7TH 1UASA 1PZAA 4CKQA 1IGTB 4I3SH 2RAMA 4S0HA 3MRNB 4OFPA 4ODBD 3PABA 1KNOA 5L6YL 3WKQA 4JQIA 3D4ZA 3CHSA 5JR1L 4GUCA 3UMNA 3O6KH 3V7AG 4NIYE 1EMTL 4YHYC 2VO8A 4YSRA 1T1ZB 2AQTA 4HHAA 1FNAA 4XMUA 4MJID 3V4PH 2HWZH 4FXTA 5AB2A 4PJ7B 1X5XA 1EZVX 5D7JD 5AOLA 2APTA 1QVOB 3U48A 1IGMH 4HG4K 3GUTA 5E1IA 3WJMB 2H2SC 4YHLH 1J9CT 4XHJD 3GMLB 2GSIA 3K6OA 1XIWD 3A5VA 3VD1A 3Q2LA 4MXVF 2Y1ZA 4YIQB 1L7IL 3RUGF 5IHHA 4O58L 4TLKA 1U4FA 2DQCL 3SY0A 2YPLA 3BT2L 2HJKB 2APBA 4OGXL 2R0KL 1CGXA 2PWDA 1F4XL 5F3FA 1YEJL 3BPLC 2CKBB 1MCNA 5E6RB 3TZVD 1AOZA 2DMBA 8FABB 1E4WH 2AK4A 3WNMA 3IB4A 4YDKL 2Y72A 5ERWA 2VDRH 1SN2A 5DZNA 4G6FB 4ELKB 1P1ZB 2WQWA 4V1DE 3B3BA 4AIZB 1QHQA 1TO5A 2XJLA 1CDHA 3DOIA 2XUWA 4AV4A 3X1EA 4X5QA 5HBBA 3PWPE 3ASNB 2VLJD 4XOEA 3BIAX 4OZFA 3WNOA 3QJFB 2Y3AA 3T0XA 2LU4A 3R19A 4F5CA 1O6VA 5D1QD 3V0EA 1MPAL 2F7IA 4E9SA 4ETQB 4IOSA 2Y25A 1KYFA 2F74A 4PB9H 1QLEH 4QD2E 1OHQA 5IESH 1MCPL 4NO2A 3BUYA 3QCVH 5SV3A 4PG9A 4XRCA 1UJ3C 3FTGA 4PVNA 3UBXI 5DO2D 2H45A 3UJJL 3WTVA 4G6KL 5AW9B 4XN8A 1DCEA 2JKLA 1YQVH 2BP8A 3OF6A 4KJPC 1DLHB 3V6ZB 3VH8B 1UKQA 4X6EB 2NYYD 3UTTB 5BZXA 1DBMH 4JVUA 1G5AA 4TV3A 1TVBB 2M26A 5DFVC 5FGRA 3BXNA 3M45A 4MB3A 3T3MB 4C56D 5E08L 4KX9A 1U3JA 1FFQA 2CO7A 5I1IL 4F7PA 2D31A 1AGEA 5BS0D 3FO0H 5EIIG 4HC1H 5KYNA 1EANA 4Y1TA 3RFRA 3GXFA 1CBVL 4K07A 3P4OA 1AQDB 3HRZC 5JIHA 1NAMH 4KI5E 4K94C 3JVGC 4MKMA 4UCFA 1NIFA 3U2IA 2BMKB 2ED6A 3FT2A 3A47A 3C6SA 4NQEE 2IANA 3W0WB 2Y5TA 1U8QB 4BEIA 2FX9L 2JELL 4BE5A 2JE8A 4JPKH 1KBGL 3IJYB 2WXJA 2FLMA 3NZSA 2EP6A 3T77A 4OKDA 5LAPA 1CGYA 1EFQA 3NEOA 4MJ6B 5LJYH 2ED8A 1YNKH 1OE1A 2NW2B 2WMPB 4JEGB 3SDCA 4B0MM 4N26A 3ULVC 2VLKA 1CLOH 5L2KA 2VABB 3IMVA 3LSOB 4PIBA 4WI2A 3CXHJ 2V9UA 4LCUA 2XLLA 2UY6B 1TG8A 2AV7B 2YQBA 3C6SB 3FQUA 1RU9L 4QWWD 1RZGA 5TE4H 2RD0A 3FF8A 3FHAA 4FFYA 4HOWA 1ED3B 4PW4A 4G72B 2PETA 1W9XA 2AJXH 2BLFA 4XBGB 3WTWA 4JQVA 1CK0H 3MOAL 5EUOF 1G4MA 3WEXB 3KLSA 4M7JL 2FBOJ 3EAKA 5EBGA 1UZ8B 1CLZL 1F42A 2N1KA 2UZYA 3H2WA 1YQ2A 3D3VE 1EXUB 4WWPA 3TCXA 3TO4C 3DX8B 4UTAL 3V5DA 3RPBA 1MFCL 1Z1WA 1HYSD 2O5ZL 4BXSV 1BBJB 3BH9A 3UABA 1NFDE 4PRAB 4G8GE 3U9PH 1RZKH 3CV5A 3QDMA 5KSVA 1J48A 1ZV5A 5TF1L 3RX8A 3COOA 1ND0A 2ADIB 1N5AA 2DWEB 5LO7A 1PU0A 2YC1A 2DWXA 4Q14A 3AZUA 2BMKA 5AYUH 2BOCA 1ZT7B 2AVFA 4HJSA 5J9PA 4P9HC 2CLZB 4TLUA 3BYTA 3HFML 4WWNA 3NRFA 1UURA 4JFDE 3D18A 5GRJL 3VD0A 3PHOA 4WU5A 3ATEA 4HX1B 2MRYA 3OQRA 5HVHB 2FK9A 4RZCB 4UM8A 4X8CA 5A2CA 5AL0A 1MEXH 9PCYA 3K2UH 2UX6A 4FFYL 4NC2B 4PRDB 4OLUH 1JXJA 4NENA 3ZDWA 1HXMA 1GGTA 3POHA 5C07D 2FJGB 3PWVB 2A9NH 4N2BA 4ZPVB 3CPLA 3TH3T 5IT2H 4IEFB 5D7LB 3C8KB 3MTXA 3PF2A 4FTDA 2BW4A 2R9HC 4Q2ZA 3AXLB 2DLHA 4KAQL 5FGBC 1E2VA 3X1NA 2EH8L 3D33A 2UWEB 3NK3A 3ECBB 3FQNA 3VFWA 5ID0A 1N26A 1GZHC 4XXWA 5GRXG 2WVSA 3RB5A 2O6FA 4F7KA 3TOPA 4L9LC 1MVUB 2BDNH 3SJVE 4PV1C 4PJ8A 5I5RA 3VXOB 2X87A 4FXKB 3LQAL 4L8DA 4R6UA 1G9HA 1A2YB 5EOTA 4FTVA 3KEHA 1X9UA 4Q2ZB 4ZAKA 4BUGA 3OG4B 4AZ8A 2CMRH 5EWIL 1AO7D 1LO4H 3EFOB 1Z5LA 3OGCA 1KJ2A 4O51B 3ZJAA 4QHLB 1M42A 1RERA 2H26B 4L9LA 2NZ9C 5I19L 1TVHA 5FA3A 3WUWG 1KULA 3SDXE 5F1NB 4Z3EA 1QYGH 3CXDL 5G4OA 1AH1A 4OZGA 2R69L 3L45A 2V9RA 1IC4H 4JKWA 3E7JA 2QDWA 3DX1A 4KDWA 1INEH 4NKMB 1HWWA 5D1XD 4F1ZA 2OXGB 4GQQA 3CZEA 3AU1A 4FEMA 1S6NA 5D4JA 2IG2H 1R47A 5AW2B 4GW4A 3FTYA 1JG9A 5EU4A 2FQGA 1EAPB 2E76C 2MCPH 4G8AC 3C09B 1DP0A 4DP1X 3MOBL 2BSCA 4JG0H 5CSZB 5A1AA 2QKSA 5JQIB 1H15A 4GSQA 2JJTC 3CVHH 1VERA 4WUKL 4U0QB 4H5SA 4WY7H 5AB9A 1PJWA 3IDYC 4H8WC 4P3DA 2JKJA 1W91A 3NIFB 3BVDB 1F58L 1FG2B 3SYOA 1XR9B 4V1DD 1LEIA 4W9GC 4PJXB 1QEXA 4W9EC 1G7LA 3VX0A 3P30H 1TZHB 1KN4L 1DBKL 2FIKB 1AYRA 3WHXB 4QRAA 4N90D 1ADWA 4UQAA 2IXQA 2DH2A 1TJGH 4RFEA 4IBLT 5BVPL 3NSYA 3D2UB 1S7TA 3T3PB 4A6YA 2LFGA 5HI3C 2LTQB 2VXVH 4Z95H 1CF1A 5BW7A 1IGCH 5DA4A 3H54A 4KDTA 1VEPA 1LWJA 4LU5L 3UACA 5ACZB 3C09C 1CPUA 3QRBA 3PDDA 2XPGB 1IAKB 3GI8L 3V0VB 2J72A 1S46A 4QTIL 3SJVB 4A66A 4YXHH 4AJYV 5BJTB 4MA8H 4NJAL 5AAWC 2CG9X 3OKDB 4RMWA 2COVD 2PR9A 4EUPG 5IEHB 3AUWB 5BMFL 1DQMH 3GSXB 3UGXA 1NGYB 4AVIA 3OAYH 4K23L 4H88L 4XMPL 3LKRB 3WUWA 4HXBH 2FBJL 2N3JA 4ZMZA 5HVWA 4FJYA 1DVZA 1ZWIA 3ARUA 5BV7C 4J2QA 3NFNA 3P77B 4S10A 3HC0B 1YVLA 3AITA 3QIUD 2AQNA 5KSAC 2HPOA 4Q89A 4H5SB 4B3VA 5AVQB 1YEGH 1M2VA 1RI8A 2I9LA 3AAZA 1RZIB 3ARGD 4MA3B 1TT6A 2RHEA 1THAA 5I66A 4M3KB 1IVLA 1RSFA 2WB7A 4OT1H 5F96L 2VNCA 1AD9A 1UA7A 3KPSA 1CDCA 1EERB 1XF5B 2BP5M 1S3KL 1OF2B 4JFEA 4WZ9A 1IIIA 1DQML 1NANH 4MXWH 3RURA 3W5MA 2ZKXA 2VL5A 1F8TH 4R4BB 4O02L 2ITDB 2Q3ZA 4PRHB 4ZSOA 5F3BA 5INCA 1TETL 2W0FB 4CILA 4QYOB 1G9MH 1NFDB 1XTMA 3APFA 4M62H 2JXMA 3GLDA 4MQXD 5I1AA 5KAQF 2X40A 1LD9A 4HFWB 3VQ2C 4IBVA 4M43H 1CT8A 5BXFA 1DQLL 1VFBA 3CK0H 1CTOA 1IAKA 1HZKA 2J88L 3GSRB 2QQLL 3VSUA 1BOYA 3B43A 5BJTA 2WLYA 3PPSA 1AO7A 1A6TB 4M5TA 1CQYA 2QHRH 1BQSA 3BAEL 4QRPB 2H8PB 3OKMA 5AEAA 3VDCA 4FQQA 4AH2B 4AQAA 4DK3A 1BYOA 3NJNA 5ICYB 1U2CA 3ELAT 1ZHKB 4XPTL 3UAEA 1FFPB 1OW0A 3TBYA 1VFBB 3L2MA 3LVEA 1WD9A 4PJ8D 4EOWH 3NFNB 4B53A 4H8VA 4TUOB 1OAQH 1C8QA 2HUHA 5FGBA 2GBTA 3HC3H 2Z8VC 5FHAL 4O9HH 5BO1L 2Z31B 3KLKA 2JELH 3OAZH 4G1EB 5B4MD 4NO3B 1I1AD 1TCRB 1Y0LA 3H3BC 5KAQG 1BZDA 1OW0C 3D2UD 4QRRD 3D0LB 4U6XA 1YEDB 5CF3A 4G5ZL 1OF2A 4KQ3L 5EO9B 4E0RA 1JGDB 2XIBA 5IWLA 2R56H 2G30A 3TIDA 1LDSA 5CJOH 1I9RH 3QORA 4X4MA 2X1WL 1O6SB 4ATTA 2WW8A 2NX5E 2XHNA 3L3DA 3GSQA 4HW6A 1JGVL 4XVUC 3UAJA 5BZDB 2OAAA 4YBLC 3EBAA 1NCDH 4TSCH 4D9RD 3KEDA 5KSUB 1KYOJ 5IVZB 4I0PB 2ZP0T 5F0MB 1BF8A 4XNXH 2BOBA 1XCQA 4CSZA 2YARA 3FZUD 3JWNC 4WO4A 1QSEE 3ZDZE 2CK0H 2V3FA 3D1MC 5GGSB 4CL7A 1NC4D 2YMXH 3F12B 3KPQA 1CD9B 2VSDA 1FC2D 2VGLM 4OZHA 5EBLB 1GYWA 3N04A 5AKSA 4R0LA 4LQ1A 5D55A 5M7QA 1COBA 4ETYA 3I75A 1K8IB 3ARTA 2GI0A 3BFOA 3IE4A 1NDMB 1YEFL 3WE6B 1QFWH 3BAIA 4KJYB 4HIIB 4EI5B 5BS0A 3UBXB 3L81A 4U1JB 3ZW3A 3VXRE 4A7VA 2A9NL 3P3RA 4FX5A 4WI8A 4C4KO 2XWRA 4C56A 1UATA 3TWCH 1JGIA 4XN2A 1ETJA 1QBML 1TR7A 5FM5M 2J8UF 3NPZB 4X99B 4Y89A 3T0VA 1Q1PA 3QXUA 3WO4B 1QVOA 2EZ0C 2LLLA 1O9VA 5HGGS 3GUTB 5GS1B 4IRZH 3FT1A 2TRHA 3MV9D 1B0GB 1JGEA 2CKBL 3FU6A 4I8DA 1O9ZA 4HV8B 4ATWA 1KCSL 7TAAA 1SMDA 3I2CH 4O5LH 1F97A 3WIIH 4Z78A 2X6CA 3G5ZA 3C5ZB 4DZ8B 4OM0L 2A0LC 2XTJB 4CVXA 5IVNA 3N0PB 3HLAB 4KXZH 3GUFA 4Y2NA 1QLEB 2BOBB 4TNFA 1BX2B 5ECGA 3NCCB 1NMAH 2XSKA 4FXKA 4X5XA 4G8EB 5CP7A 4QNPE 4CU7A 2EO1A 3AGVA 2E0PA 5CMAB 5L0QB 5C0IA 4PJIA 3SDDC 4W9ZA 3U1QA 1U91B 1E40A 4JFPA 4XMKH 1A1NA 4X4ME 3ZOAA 3IJEB 4TMPA 1JSYA 2WO2B 3K1DA 4ZO7A 1IGIH 3GJEA 4UINH 2OS7A 1MCBA 1TFPA 1K5NA 4KKZA 3BPOB 1F3RB 2IAMC 2BRQA 3W5NA 2OPCA 2CHWA 4PWJA 4XHJC 1RZJH 3MLWH 3EYUL 4GAYB 3WE6A 2G3XA 4RAHA 4P0DA 2OYPA 4F8OA 3WMPA 4GBXD 3D50A 3ARZA 3O4LA 5D1ZA 3V6OA 3B7TA 4GSRA 1QD0A 4QOKE 3SDDB 2UZYB 5TQ2H 4MAYA 5D7IA 5I23A 1DVTA 3DVGB 1U3NA 3T0AA 4DT2A 2PPCA 1TKWB 4LOVA 2WZAA 1OD9A 3WKPA 4JS7A 4X99A 4NQXB 3J27A 4D0BA 1ZAGA 1UM6H 2HXAA 4UF7C 5DQDL 2MOVA 1UA6L 1UT2A 4IJ3B 2J6EL 1XVSA 4KPHL 3JZYA 5D7KE 5EBMA 2WXLA 2Z7ZA 4XH2B 3F7YA 3V5KB 5HY9B 1MCHA 4DNLA 1BBDH 3OKKA 4W9DC 4MJIA 4YGVB 3X3FL 5I16B 3PQYA 4OFVA 5IJDC 4QYAA 3RGVB 5I1JH 4S1DD 3MMEB 1MCIA 4EN3C 2PPDA 3RWCA 3HI5L 4N8VB 1FPTL 1GYAA 4NXKA 4ONGH 2V5TA 3A67H 3BZFA 5FO2A 1ZCRA 3RIAF 3QXDA 3ULSA 5D72H 4PHZA 3CIAA 3QEHB 2ADFL 4PGBB 4NPKA 4ABWA 4WFFD 3D2TA 2D7QA 1B0RA 3NJGA 1KEML 3F7YB 3F65A 5E08H 3OAUL 4RNRB 1ZTXL 2P7TB 3ZKMC 2P8LA 3S3SA 1BECA 5EU6A 2ODIA 3AXHA 4MLSA 4I77H 1QWUA 2P43B 4CDGC 1NUNB 4AENA 3IGKA 3T65A 1V27A 3F7LA 1U2HA 1YQVL 1U8JB 3LNIA 1QSVA 4ZUSB 5FS5A 4P4KC 1BYNA 1CDYA 3UPRA 5A2LH 4JPIB 2CRYA 4MCMA 4K8RH 2I27N 4O2CA 1IZKA 1T0MA 2BVPA 1C08A 1J8HE 1OCWH 2J6WA 3BUIA 4NWUL 2D7MA 1VFOA 3RTQC 4FYSA 1A7OL 3S3JA 1Q38A 3LN5A 4YR6B 1K9TA 1HEZB 5B3JE 3GBMH 3NTCL 3LIZA 1LO0L 3WEXA 1QFHA 3V0IA 3HC0A 1X5AA 1RULL 5M94B 1JUFA 2KZBA 2FJSA 4NQDD 1E9QB 5IB2B 2IWFA 3UTPE 2J2ZB 2X1QA 3GRWL 1S7SB 3QJSB 1UVQB 1KELL 4JO1H 2VDRB 4C55A 1RLWA 2XC8A 2A7BA 5J3HC 5D1XE 3GMRB 2A1WL 1BBDL 5CSBA 2O5YH 4NUJB 5IB3B 1KY7A 3KPRA 2CGRH 2H6OA 4LF3B 2HLAA 1NINA 3GSWB 1Z32X 1HHHA 1H5BB 2APXA 4XXDA 5MEQA 4ONHB 3MRQB 3MJ9H 2PCYA 1TU2A 2EIKB 4UV4L 4A38A 1OIOA 5C2UB 4AGQA 4AENB 3BMVA 2DLIA 4WNSA 1XO8A 3S9DB 1IBZA 4XP9H 4OUUB 4TNVK 3VWKD 4KV5E 5IM7B 1AD0A 3TTYA 4NFDA 3O6LH 3WSQL 1PKOA 4GRLA 3P0YL 5KYXA 1HHHB 4AM0Q 4HPOL 4QHKI 4XP4H 4BFGA 2N01B 5KN5B 3LJ3A 4J3OD 4ZPVA 3GMLA 4OD3L 3RTLA 3GHEL 4K9EH 5IP4A 3K72A 2HPTA 5J11C 1E4KA 2NX5B 3EJUA 3CFBA 5DI8B 1GTFA 4LXFA 8PAZA 5B7EA 4KTEL 5KSAD 4E68A 1EDHA 1HAUA 1KCRL 1PG7H 3QJHB 2BNQD 4P5SA 5EEUA 1AD0B 4OFYD 4S1RH 1PX8A 4B7LA 1NWOA 4K2UL 1OAZH 5T3XH 1UJTA 4NO0A 3NEEA 4HWBH 1EEUA 1EO7A 4D0CA 1ZGLB 2F7PA 2NZ9D 3MQIA 4L1LA 2R2HA 3IKCB 2IFFH 2RA1A 3G6JE 3UJTL 4R4FL 5CIPB 4EIUA 2P8PB 4J8QA 3IDGB 5LNGA 2I07B 2EKJA 1F86A 3MGTB 2CGYA 5FYLD 1M1SA 3P4MB 1PZ5A 2ZKMX 2AJVH 1OY3B 5F1NA 1N5YL 2O6PA 3GJFH 2AABL 1TYRA 3BQUB 4EF3A 1JZ3A 1CL7H 1AJ7H 3BZEB 3ATDA 5TDPA 1IVTA 4IS6A 3UROR 3MRRA 4FTVE 4XO3A 2G9KA 5LXGH 3WIHL 2F5BL 4QPEA 2X4OB 1MWOA 4IGBA 4MXQD 4DVRL 4EZJA 1L9OA 2ATPA 2K4AA 3F7VA 1ZGLM 1BVKA 5AENA 3ZDYE 2BVUA 4WVRA 5E8PA 4L4TD 1G7HB 4OQTL 1XB3A 4H0GA 1A3RL 4JFED 2K9FB 3ZTJH 1NCIA 1IGYB 2BSSB 5C0EB 3SE8L 1MQ8A 1QBAA 4N8PA 1KJVA 3LN4B 1ACZA 3BP4B 4XODA 4DUXA 1U6AL 1D6EA 1HT6A 4DN3L 3MNZB 4P07A 4PJGA 4J39A 4KFMA 3G08A 4TQPA 2QQKL 1A6AB 1K8IA 2ENSA 1AGEB 4ZMLA 3QJUB 2GFBA 2K9UA 1ID2A 1VADA 5TPWH 3KPTA 5BXFB 1LWHA 3UJIL 2VM9A 2LLNA 3IDNA 3FB5A 2DJSA 5JW5B 1ETB1 3N41B 3T4AA 3GSRA 4JFDA 5KVFE 5J6GA 2AQSA 4OCWL 1HK6A 1DJHA 1W72B 4WEMB 1J0HA 3NUKA 2P42B 5HHXL 4BBWA 4WLCA 2C1OB 3CVDA 4FKEA 1Y1UA 3TYGH 3EADA 2GQHA 3VYNA 4OI9A 4B96A 4KZDH 3ILDA 1M7IB 1RCYA 2O30A 3O8XD 4LLQA 1C5BL 3NZUA 3U46A 4LVOC 3GT6A 4OKVB 5AUMB 4NOFA 2JIXB 3IETB 5F9DC 1JPTH 1PY4A 5D2LB 3EG9B 4M5ZL 5I1HL 3EZJB 4WSGA 1BLNB 3BKML 3CSGA 5J57B 2EYRA 1EBPA 2CAKA 1JVOA 2E6JA 3AQYA 2C1OA 2H9GA 1AC6A 4O9HL 4OJFH 2CNZA 2JMRA 4J3SA 3O11B 2QHLA 2Y07L 1AIFB 2NY6C 2UZPA 4U6XB 4WDIB 4XPBH 4PSPA 1U0QA 1O7VA 1KN2H 2ZG1A 5J6HA 4XO4A 3P77A 2NNFA 5ESAB 3SGKC 3MLUH 3ZL4L 1H6EA 1FSKC 5C0BD 5GS2H 2QVKA 3GTNA 3MTRA 5EU3A 3QI9D 4KJPD 4PJGB 3ZUCA 2GTZA 3GBNH 2AV1A 3X1BA 1HINH 3OPZL 2QELA 2P80A 3ZE2E 2ZXQA 1TJGL 4WK2B 3VGEA 4KKPA 5HHMD 1NCAH 1NWPA 2Q6WA 2VT0A 4Z76B 3K4DA 4PJBB 2WD0A 3B5GA 2XY1A 5FFOA 1H3VA 1FQ9C 3DOHA 2AQPA 4ODTL 3ZQXA 4M1CD 3F2LA 1LHZA 2B15A 2Y2WA 4FNQA 4I48A 1LK3L 4QHPA 5F7DA 3RUGA 4XVSH 5DHMC 4N2MA 2DQMA 1B6UA 5D7HA 4B5ZA 5F71A 1DCLA 1EFXA 1UUSA 4J8RA 3QYNA 5EBMB 5F9JB 4L3EE 1WCQA 4XN7A 1IKNA 2PW2B 4PJFE 3BE1L 2AK1L 4X7SH 1NDMA 1ZLVK 3IRPX 3VFMA 3HAEG 1JE6A 2ENJA 2WUBH 4ALAC 1BDYA 3EOAA 2WNGA 3BEWB 5JHBA 1KWGA 3OXSA 3QFDA 5FCSH 1SHWA 4AH2A 1L9RA 1TYJA 2CBPA 4I5BB 3ULVL 3PJLA 1MHPH 1I1YB 1VSCA 1HFUA 4KVCH 5B4MC 3RBSA 3UYRL 4MNHB 3KPLA 3LSOA 1JI2A 2DWEA 3ARFC 3WFCL 2ICCA 4KK5C 2OQJA 2AXGB 4HIJB 4I7ZC 5FYKD 5FFGA 1Z3GH 4HDIB 4PP2A 3RJOA 3O0RL 1HZLA 1AG0A 3WLWC 4KGLA 3DVNA 1ZHLA 4OW6A 3F83A 1BZ7A 4MQXC 3EDDA 4L9DA 1DQJA 4M7KH 3RX7A 4M8RA 1G43A 4JFUA 4AG4L 4YSTA 1M53A 1UGKA 1HYRC 4QXUL 1FA4A 3DTDA 4RWHA 3H9SE 5D6CA 5LGHL 2HX8A 4XC1L 2KPNA 2BRRL 5AW3B 2J4WH 4FCHA 1ZA6A 2C7UA 3FB8A 1JYVA 4FGMA 4A7UA 1N0XH 2XWDA 4XX5A 4F1SA 2A6KB 3CZKA 3GXUB 4F9LA 1BZ8A 3BKCH 2NUPA 3AREB 1NBQA 2WWOA 1AI1L 3LNFA 4JUSA 3S36X 3TBSB 5C0FB 2N1TE 3SBQA 1FL6A 2EDRA 3R06B 3ZZLA 4JFOB 5D6CB 1R3KB 2X12A 3G04B 1EAPA 3SJVD 3FTXA 2WWKO 4Z0BL 3L95A 3SKJL 4UM9B 2AXWA 1PEWA 4IRSB 1UWEH 1I7UA 1QI5A 3RILA 1WQVT 1GS8A 2DQHL 3IGAB 4HEME 3IJSA 3KL5A 3E6HA 4PGJA 3U7AA 3V7MA 4L29A 5I6KA 2V4LA 1ZVYA 2XWTB 4X8XA 5DJXA 4F3FA 1V7NH 5IWLC 2NYYC 4HIQA 1BCIA 2XVLA 1TKWA 3L4YA 1G7PA 1FG2A 5IJVA 2C34A 1JGLL 2VDKB 1V3JA 1BZOA 2EEAA 2HLAB 2JIXD 2AVGA 1AXSA 3H7BA 5GGUA 1J9TA 2R4SL 4NRYA 1A1MB 3HAEH 1XSIA 5HHMB 1EHLH 3UYPA 4MXQC 1SHMA 4K9JA 2YKLH 1G5GA 4LAQL 3AG3B 4LVNB 3S0PA 2V2WA 5BUGA 5FEBA 1LMKA 2G4EA 2HVJA 3GK8L 4FI8A 4I3RH 5GRWA 5E4EB 3MRCA 4OD3H 1RPKA 4IKLA 4NRXA 1FGVL 4GW4B 3N1PC 1AQ8A 2XDHA 2R1YB 4F2EA 4YQXH 1FHGA 3B9EA 5I82A 4OCRH 3LH2L 4U05A 1IM9B 1GPOH 2ICEC 2VR5A 5EUOE 1S7VB 3FS9A 4N2KA 4PJ9A 5KZCD 4F91B 3NAAL 5JNYB 1HWGB 1KPUA 1CI3M 2OSYA 2P5EB 3FRUB 5KYWB 5EU6B 3A6CH 1OT4A 3MA7A 3L3HB 5LBSA 2VDPB 4TQHA 5I1EL 1JNHB 1S9VA 2K6ZA 1ZLSL 3QIBD 2GTWB 5HGDA 2Y7QB 3CBKB 2YA2A 1WZMA 4FXGA 2UZXB 1OLZA 3BP7A 4BINA 3UL4A 3KH3A 1R5WA 5JNYA 1DL7H 3HR6A 5ABDE 4OIAA 2BVQA 2YSSA 2VERA 5J12B 4IBTA 3DHUA 4X4XB 1FORH 1ZVSB 3VXMD 4BIKA 4NKOA 3PIQA 1O75A 3K1KC 5DVMA 3NCYS 1PFOA 2GY5A 3VXUE 1YO4A 4HKZB 2H3NB 3FFOA 1MREL 3RZCB 1C5BH 2XBDA 4WW1A 4JFQB 2Y1AA 3RVTC 3IU3A 3T1WA 3BGFC 3IU4H 3O3EA 1GSMA 3BH8A 5HHXH 1M56B 1TYEB 5I5IA 5IK3A 4WO4C 1BZ9A 3QQ4B 3O6FC 1ZEAH 4OZIF 3L3JB 1WC7A 3WIAA 1WWCA 4HWBA 4JDTH 4G7QB 1I9JH 3QZMA 3RVVD 5H94A 2WZPA 1AR1B 4RFEB 1JVKA 1JXDA 4HWNA 4IOIB 2NNCA 2G2PA 3R7RA 1HILA 5AFAA 5I73B 3U0TA 1YNTA 4APQB 1MFCH 4KJWD 3BO8A 2ADJA 1R34A 1N0LB 1KTDB 2GC7C 3CN1A 4MRBA 1ID5I 2JCCB 5IHZB 5DJ8B 3LKOA 4DW2H 5DWUH 4JM2C 2XIDA 1T5WA 4JJ5A 3OZ9H 2AI0L 4ODSL 4HJEA 3Q44A 2TAAA 5IVXB 1PG7W 5C0AD 1T1XB 2WWMC 1U2YA 1CGUA 4OZ4A 4WJ5A 5C3LD 3UTPD 2HTLD 4G82A 2WBWB 3BVWA 3WN6A 3A24A 4AT6B 5BVJB 1KIRA 3ARED 1IEHA 4RGMC 5D2NB 5DO8A 5DVPA 2IDQA 3WD5H 1IB5A 4BQ9A 5K9OA 2D0GA 4GPVA 1KTDA 2VXSH 4ZI8A 4TVPD 4HF5L 5IFAH 3T65B 1OALA 4YAQA 1UB5A 4JO3L 3WUWB 1CLYL 3HS0B 4ZXBC 3FUJA 4HCGA 4ZUSA 1ZHBB 4HHAB 3T6VA 1T0NA 1D5XB 2ZKHL 3C87A 4L8BA 4UYPA 5C09B 4ACTA 3TN0B 1JZHA 4EDXA 5A7BA 4RFNC 3VFUA 2IIJA 3GHBH 4QTFA 5SWSA 4EI6B 3IGFA 5HHOA 1DYZA 4P9HL 3V9FA 2C9XA 2WBJB 2AXHA 3SPVA 3RKDD 2WYTA 3INUL 1C5CL 1W8OA 4QRQA 2BSED 2FO4B 5EORL 3K6DA 4NQDB 4M4RA 4ODUA 2HJKA 2QZ5A 1BFOA 4Q9CA 5IJBC 1YECL 3ZZQA 1JIBA 4RAVA 4RISL 1T89A 4Y9GA 1BLIA 4XHQA 3BISA 5DK2A 2VRAA 4OQTA 3GPEA 3H8NA 5CN2A 2PUQT 2O72A 1CGVA 3MNWA 3CHRA 1HH9B 1EJFA 3EJTA 1RY7B 1S2EA 2JXMB 4MZ2A 3E9UA 4CADA 5IHLB 1YPZF 4F7EA 3CDGA 3LS5H 3P02A 1NL0H 3M1OA 1S7WA 2F58H 3M7FB 5CBEB 3LN9A 2BOLA 3FN0L 4YOKA 5IQOA 4BSWB 5B8CA 1C1EH 2YD1A 4L4TE 2YGPA 3BVNA 4XMVA 4I48B 5E1AB 5H2BA 2R0WH 4AYDC 1UD6A 1EPFA 2X4PB 4TULL 4DQOH 5ES4B 3LN4A 5AG8A 5I6XB 3ILQC 4G9FD 4YAQB 3ZTCC 1F02I 4OI8A 5KJ7E 4KRMB 4NZJA 1IC1A 2NY6B 2L7EA 4PJ5D 3W11C 4GSXA 4NO2B 2ZYSA 3HI6H 4A2LA 4N4YB 3LVTA 4R9HA 4KK6D 1G1KA 4YO0A 4S0SD 3SGDI 4CC1A 4QCIA 4JO3H 2MNJB 4POZD 1CS6A 3DV6A 1OCRB 2CD0A 2MHAB 1I3UA 1F1GA 1G9NL 3D9AL 5A16B 2ID5A 3FB6A 1J0YA 3CFIC 2IDUA 3T2NL 4XPHL 2HKFL 1J5OH 3D39B 1UACL 3DTXB 4GKOA 2ZUQB 1BX2A 4GRWB 4V11A 3LPFA 2OULB 1DSYA 4BUHA 3SKJH 4FQHB 1JCVA 3GSOB 1R5VA 1WITA 5TDOA 4X7DC 1P0SE 4X6FA 3U1PA 4L1SA 2Z31C 3TBWA 3VXSD 4AYFB 4ZS6C 3VM5A 1AP2B 4NC0B 4L0ZA 3BSGA 1A1NB 1FCGA 1QKZL 4FG6D 3GS4A 4BRJA 2YUWA 2X1PA 5A16A 3KPNB 1E6JL 3H53A 4HIEA 5CEZH 1WISA 1C1EL 4NHCL 2IAMB 4FMVA 5EH1A 4E9YA 5C0CE 3OPUA 3S97C 4RBPH 4XNDA 3D5OF 3VD4A 2OTPA 1MCOL 2AF2A 5AOMA 3G6AA 1WWWX 3LS5L 3HLKA 5JDSB 2NRDA 4PI0A 2DD8H 4JRXA 4ELMA 4QXUH 3ARSA 3FUDA 4NZRH 1N68A 4PRHE 4UT6L 4WTQA 3DVGA 1KJMB 3B9DA 4TKWA 4AJ0A 3EJYC 4NUGL 2VWEE 2XA8H 3C5ZA 4WGKA 3U83A 3FU9A 1HZHH 4DZ8A 1XWVA 2F53D 4G7SB 3QO1B 4J3WA 2ZWSA 3QT2A 2WVVA 1OAKH 1U8PA 2PP8A 4LSPH 3KPSD 4H13C 3BUDA 1N3NA 1SEQL 4J4PC 1T03H 4R96A 4XCNA 2DWTA 1P9MC 4JKPH 4O2EB 4L23A 2MHAA 1MFAL 2E9WA 2C9QA 2PABA 4M5YL 4AUUA 1NBCA 5SWZD 5I1JL 4KK5D 4OUOA 1DL7L 1RPUA 3GKZA 5C7XH 5C9JB 5C0AE 2OW7A 5IMLA 3QDMB 1FCCA 2O61A 2NW2A 2XKNB 2YQ2A 4AEIH 3EOTH 1MOEA 1UM6L 3ARBC 3P0GB 4NRZA 3ZE2B 1P4LB 2EJ1A 4ZFQA 3U9UB 2NW3B 2C1PB 2ZE0A 3OKOB 5D4IA 5J13C 1WFNA 2Z91A 1QNZH 3O6FD 4PJGE 4PY7B 3RL1A 2BY2A 2QLVB 1J1XH 3J2PA 4X7EC 5EOCJ 4W9HC 1MSPA 2RGSA 1BM3H 4XNUH 1CICB 3OB0K 3EO0B 4WFEE 1BXAA 5JMRA 3TCLA 3VFOB 4OJAA 3OLGA 1FNEA 1CXLA 1NMBH 3M8OL 3SE3A 3PWUA 3M1CA 4XPAH 1QOKA 1C16A 2A6DB 3S2CA 2OCJA 2FWOA 2Q76B 1WFIA 4HBCL 5DJ0A 2AJUH 1F8TL 2YBRA 4TUJB 3QRFM 1HTYA 4L2LA 3VO0A 5FO9B 2C3XA 2EE2A 2QEJA 4XXWC 1WFJA 3L9RA 2CIIB 1MJJB 2R7EA 3GO1L 4TSBL 3ECUA 1B4JL 1S3KH 5CP3A 3UO8B 2NXYB 5HHNA 1XGYL 2ORBH 1ZEAL 5F7WC 3DJTA 3ZY7A 1OZTG 5C1MB 1X5IA 2XN9B 3MACH 4K5PA 1ZANL 4LVNC 2VDOL 4ZXBD 1NA8A 4MA7L 4QXGH 3NACH 5FYJD 1EO8L 2YBRB 4NQXA 2ZUVA 1UWEL 3UGEA 5FUCE 1QW9A 3H9HA 5GJSH 5IR1A 3CUPB 3SDAD 2R8SH 3RJDA 1VCAA 2VDQH 3KVQA 4JM2F 3RWIB 1ACCA 4WF7A 1SVBA 1H8SA 3M86A 3ETBJ 2HUEA 2WN3A 3D4CA 3BJLA 3FSOA 3KXFE 4N8VA 4WK0B 1VLXA 1F2XK 4J3OG 3ARDC 4PRAA 1TMQA 3QCUH 1JWUB 2NY5C 4YE0A 3RA7H 3IBEA 3G3LA 1ZANH 4IHOA 2DLGA 1E7VA 4U1SA 4XCCH 3CGTA 3RWHA 3PAUA 5I2IA 4LKCB 4P2YA 2EKSA 5AVXB 2DIBA 5TPWL 4KNUA 1UZ6F 1J1PL 4ISVA 5JA8B 3OB8A 3BEWA 5H35B 2M2DA 1TTBA 3M07A 3MN8A 3TL5A 4AV0A 1U6AH 3TO2B 4AVKA 3T3ME 5BVPH 4IK7A 2HKHL 4CBZA 3F85A 3LZNA 2R0LL 2IGFL 1PZDA 3NH7H 2N59A 4LCCB 3GJFA 4HP5A 3PWJA 3Q5TA 5E6ID 2EKSB 3TN0C 2YPKB 3E6FB 5D4HA 2AXGA 2O5XH 2FEJA 2GSMB 5E4AA 3ROLA 2Q86B 4ZDHA 4G2AA 1Q9KA 3S96B 3QHTC 4BJLA 3W11D 5H4ZA 1CXIA 2HJFB 4G7RB 1GHFH 5E2VL 3HE6D 4ADGA 1JZ6A 1E9OB 2K1MA 5F7YC 3RY6A 2NUTB 5ICUA 2HX9A 4RWYH 5HYJA 3BE1H 1AJ7L 1HKLH 3K4AA 5C0NC 3UTQB 4MMZC 5ACZA 4MGXA 1OCCB 4LQFH 5HJ3A 4K3DH 2B9AA 4P5TC 3I6KA 1R24A 3BYYA 1HKLL 3CFMA 4H20L 3MRDB 5AVZB 4EI6A 4UILH 5DC0A 5J1AA 2UXVA 3QXAA 2OSLA 2VQ4A 1L9QA 3HMWL 3QNZA 4RMVA 2PTTB 2B4CL 1OAYH 3KDMB 1FUNA 2KMWA 3UTSE 3VXRD 4Z1PA 2PP7A 2VDQB 1LEIB 2VZTA 3WMQA 4ORGB 43CAA 1OAZL 4KU1A 1NCAL 1HH6B 1DQVA 3OR7B 4U6VL 3VWKC 3GS7A 1AS7A 5D2NC 2PN5A 3IJSB 3ULUD 4DCQA 5L4IA 4BKTC 2OSLB 4GG6B 1DUYA 2XWTA 2I07A 2JVUA 4OFDA 1Y18A 4WEBH 4LMQI 3ZL4H 1XGQA 3ALPA 3TA3D 4CVWA 2OJEB 4TQ8A 4YLBA 2GJ6B 4PG9B 4XRCB 5LVEA 2ICWJ 1DQLH 3RL2B 5A40E 3AGWA 5I6OA 3W9EA 2WUCL 5D70L 1E2WA 3TT3L 4HZLA 2WTRB 1B4RA 4OFIA 1HILB 3VG0H 3MV7B 2JSFA 2AXFA 3GLEA 3C08H 5F7EH 1IGJB 1U95A 4QMEA 5IEHA 3MUZ1 3LTVA 2RTTA 2VR3A 4MJIE 1JS4A 1FRGH 2PP9A 4MMXB 3P54A 1F41A 5F1OB 3CX5K 4KKQA 4ZXBA 4B9ZA 4YJZL 1AY1H 3QDGA 3JWDL 3Q1SH 3HG4A 3IGUA 1I7ZA 4KVCL 5F7KC 4D7PA 4YSQA 4XO5A 3MRMA 4UAOC 4FFWC 4HZLB 5KANI 3MRLB 4YE4L 5DHVH 2WYZA 3E8UH 4MNQB 4XNAA 3WYRA 3UERA 5GZOA 3VDBA 3V6OE 1XH3A 4FI7A 2IH1A 4BQ6A 3Q05A 2X4TB 1XGYH 2DYPB 3H4FA 4PJDE 1J9SA 3FRPG 3KYAA 2Q7YA 3P4NA 1CLCA 4JMXA 3T4AB 3GBML 3G9VA 2JTDA 3NTCH 4Z7AA 3MRHB 4LOFA 4FHBD 4MB1A 3T6WA 3J07A 2WZ6A 4JHBA 4HOMA 2X4OA 5FYJL 5AW6B 3QH3B 3HZYB 2Q8AH 1YEEL 3GJFK 1XMEB 4QEGA 3MACL 2MCG1 2NY0B 3MA9L 1CT8B 3OJDB 3OKLA 1RJLB 1F6AA 1YUHB 4ZRGA 1RZKC 4D8PB 3NJHA 1R3HB 1BD2D 1CYXA 1FHNA 2MPVA 3P9WB 5LCVA 5CD3B 3KGTA 4KV5F 4ELMB 4GB9A 4DO4A 4E41B 4N22A 1GS6X 3EOBA 1UWXH 3ABGA 4BKSC 2EIBA 2ZT9C 2BHYA 1U8HB 4I1NB 3AADB 2EIMB 3GLAA 1MW0A 1QLFA 3S5YA 1I8KA 4LCIH 1B9KA 5JOEA 5IZ7A 1CE6B 5HHOE 2K70A 2ZWKA 2JV6A 4G7YL 3P30L 4P06A 5LAXB 3TP4A 4DAGL 2BP8B 5DJZA 1ZE3H 3S3DB 4HJ0C 4Z7OE 1ILUA 1NBYB 4BCYA 5INDB 2W81C 1KLUA 4V1DB 4PWFA 1PZUB 3JVGA 3EYQC 3LEYL 3ABMB 5E6IC 3EOAB 3BCDA 2AV1B 3H2PA 2X41A 1R3LA 1CDUA 1SDYA 5IHZA 3BKMH 4QRPD 3PQYD 1DVUA 4WU5B 4DZBA 2DQJH 3FO1B 3D0LA 2JKRM 5I1CH 1T03L 2B4CC 2E27H 2QV2A 1SJEB 3QZNA 1XXFC 4N2HA 2X6AA 4OLZH 3T8XB 3W3BA 1QFPA 5EZOH 1NBVL 4H4NA 4OZ4B 1N19A 2Q8BH 1ZV2A 1VKXB 1HN1A 3OM3B 1L9NA 5CFHA 1KCVL 1IFHL 1YN7B 2F9BT 4HIIA 4KC3B 4Y2DA 5MP6L 2B14A 4Z23A 5EEVA