2J21A

Human p53 core domain mutant m133l-v203a-n239y-n268d-r282w
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
193
structure length
188
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDWRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Structural Basis for Understanding Oncogenic P53 Mutations and Designing Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 43
structure length 188
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j21A00
2BIPA 2J21A 5G4NA 3WTTA 1EANA 4XR8C 3D05A 4IBZA 5KBDA 2BIOA 3VD1A 3D09A 2P52A 3WTVA 3WTSA 4IBWA 4AGPA 3WTWA 3IGLA 4AGLA 4MZRA 3WTUA 4IBSA 2J1YA 5LAPA 4L0ZA 2BIMA 1HU8A 5AOKA 2PCXA 4IJTA 3Q01A 5ECGA 1H9DA 3D07A 3D06A 3US0A 4AGQA 5AOJA 2XWCA 4G82A 4AGMA 3WU1A 3IGKA 2GEQA 2X0UA 5G4MA 2H1LM 3ZMEA 4AGOA 2RMNA 2BIQA 1CO1A 1LJMA 2J1WA 2J20A 4L18A 2WGXA 2BINA 4IBVA 4HJEA 4MZIA 3KMDA 2VUKA 1HJBC 1EAQA 2J1ZA 4G83A 4IBTA 1T4WA 3D08A 4LO9A 3US1A 3VD2A 2IOIA 5AB9A 4QO1B 2AHIA 2OCJA 1GZHC 3EXJA 2ADYA 1HJCA 5A7BA 1IO4C 5AOMA 2ATAA 3Q06A 1GZHA 2YBGA 5AOLA 5LGYA 2FEJA 2AC0A 3QYNA 5BUAA 2J1XA 4KVPA 3D0AA 3TS8A 1EAOA 4A63A 4AGNA 3QYMA 4GUQA 3WTYA 3Q05A 5G4OA 1E50A 5AOIA 1TUPA 2IOOA 2X0WA 3EXLA 2MEJB 1CMOA 4IBUA 4L0YA 3VD0A 4IBQA 4GUOA 2XWRA 4LOEA 1YCSA 3WTXA 1UOLA 2IOMA 3KZ8A 2X0VA 5ABAA 1KZYA 4IBYA 4LOFA 1TSRA 2J6WA
chains in the Genus database with same CATH superfamily
5LGJB 4UV4H 5JPMC 5G4NA 5DRNB 3KLLA 4AH2B 1A9EA 5DQDL 3VDAA 3BZEA 3WJMA 3DSFH 1RMFH 1SJMA 3TYGH 4A2EA 1PLCA 2XN9A 3GF8A 4S1RL 1ITBB 1OSYA 4LLDA 4U3SB 5CZVL 2P9RA 3PWVB 2ZOKB 3U4KA 1U33A 5K9OB 4PD4K 4X4YB 1GA2A 3IXTA 1KCVL 4L2LA 3MCLH 3OMAB 3S34L 1EBAA 3HAEB 3DX7A 4PYGA 3ZGIA 4DK5A 2A9CA 3HR5B 3F2LA 5FFGA 1WFOA 2OMXB 1DHKA 3F7YB 4O58H 1QOKA 1X5JA 3QIUB 1D7CA 4U31A 1WWWX 4KMTH 4MMZB 5AOKA 3DV4A 3VFMB 4QIRA 1GJWA 1W8OA 2JTYA 2VL5A 4ICWA 3BDYL 3ZSTA 2VLJD 2X89D 2WYIA 2OJZH 4NNPH 3QYCA 3U1PA 3UJTL 5G4MA 2CA3A 3FTVA 4ZTEA 4JFFD 5E4EC 3FFCD 4ZO6A 3M8OL 1KTLB 2YARA 3SKMA 3NZ8A 2P5PA 4MXVF 1OM9A 2FT7A 3P2TA 3TVMD 4GLRH 1X5HA 3SBQA 4YSCA 2JE8A 3SPGA 1EZSA 1KCUH 2X6AA 3ISYA 1JBJA 4W4OA 3DBXB 3HS0C 5KSBA 1IFHH 2HJLB 4ZMZA 2CXKA 3QQ9D 5L4JA 3Q8BA 4CVXB 3TA3A 3VGHA 1URZA 3ARVA 3FO0L 4JRXD 1BPLB 4TV3A 5HHPB 5J56B 4UQIM 4KK8D 4IJ3C 4ZK8A 1FAKT 1JPFA 4PGDA 1IO4C 1BM7A 2WO3B 4J3WA 3JTTB 4KBPA 1JI2A 2B1OA 3IU4H 3QEQE 2WBJA 2F08A 4MYWB 3DETD 4XN1A 2X4NB 1QRND 4WCYL 1CIDA 2WLIA 2X38A 4RWYL 4GMTL 2LT9A 1J0IA 5I1KH 1XMEB 3ISRA 4G7VL 2FECL 5KSAA 4NQCB 5J12C 1N7ML 2ZUUA 4KMLB 2P44B 3SQBA 1XF1A 1CFNA 4OM1H 5CD5C 3S5YA 2NXZD 1MXGA 3S5LA 4DETA 4JRYD 3VD7A 2RH0A 1MZZA 1JPST 2ZXEB 3FU9A 2H32A 2VO8A 1MHHA 4G9FE 1KTJA 5EN2B 4ZAKA 3GSOA 3I6KA 1UZ8B 1VKXA 4XNZB 5I6NA 4Q6YA 3UYRH 5C0JB 3EJYD 3FUKA 2D2OA 5IVXF 1W15A 4PBWD 4KRMB 2NW2B 1NPJA 4FJ6A 3VM7A 2DDQH 1JRHL 4BZ1L 4D0CB 3LXAA 1F90L 4LHQB 5C08B 1PZDA 3W38A 5GGVY 4OTXL 2W9LA 3BUTA 5JOPD 5GJTL 3MX0B 4UDUA 2MTAA 4L9DA 4CAGA 4TM9A 2XKNA 1Y1DA 2ZICA 4PJ7F 1BG9A 1U4FA 3TCLB 2IWFA 1KLFB 4FZEL 1FFPA 4IIQC 2EC9U 3AQZA 5BVJA 4BXSV 4WK4B 1SHSA 1ML0A 4YFEA 1U8HB 1QAWA 1UUSA 1CYXA 1GKOA 4R2GC 1PX4A 1LO2H 4G1EB 5MP6L 4E9XA 1J1OL 1YPZF 2VDPH 4LKCA 2CKBB 3VQ2C 4FQIL 1CICA 3EHBD 2H6PB 3KCWA 2X1WL 2C9VA 4ZX4A 4TNWF 4MBRA 3VG0L 3A6BH 2PABA 1VESA 4HIEB 1CO1A 3Q3GB 3V55A 5L7XH 3CFEB 1WISA 4LAQL 4E5XB 1R5IB 3WELA 5IG7B 5ANMA 2ISDA 4GAGH 4K9EH 3VI4B 1IC7L 2QSVA 2QV2A 4XODA 1JZ7A 1A4CA 2V0AA 4HC1A 1AFVL 4IGBB 5LBGA 4IMLB 4FQLL 1DBBL 4NXKA 4Z7VA 2ZCLH 1QPPA 2ZXCA 2J8OA 4OZ4B 4WHYG 3BEWA 3MNVA 3FT3A 2DLIA 3HZYA 4UQAA 3GJFA 2GHZA 3BH9A 4EZKA 1Y18A 1Q9LB 1MJ7L 2WWMD 1INEL 3OLGA 4XB7A 4XHQA 4X8JA 1UKSA 3K1DA 4LHJB 4UTBL 1FC2D 2W95A 3FULA 1CVSC 1F2XK 3LIZL 1KJ3L 1KJ2H 2AEIT 2C34A 1PSKL 3CC1A 5MEPA 1TJIL 4J3TA 1MCOH 3AVEA 3PNWB 3MJ8A 1HESA 1NANH 4O2FA 4Y5XB 5FKAA 2MPVA 4MAYD 1CGTA 2O5NA 2R0KL 3KDPB 4ZOEA 5HP5A 4GG6B 1CD8A 1UD5A 1UWEH 5DI8B 3Q05A 4JFQA 2F5BL 1BIIA 2WXIA 4WO4D 1TQCB 5FKPA 3ZYIA 5KVMC 5GGUB 1U8LB 3EDKA 5SWSB 2B15A 1C16B 5C07E 5IWLC 2NZ9D 2XQYK 2P8MA 3ETBJ 5GZOC 5AAMC 3BVVA 3V0VA 1KXHA 3AG3B 3JWNC 3OKDA 2E56A 1KJMA 1MNUL 3P0YL 1RJZA 2PTVA 5GGSA 4IOSA 4KTGA 1Q9KB 3QNYA 1KTBA 3H4HA 3ARED 5ISZB 1KIUA 4I0PA 3LIZA 2FIKB 1HXYB 1U4EA 3ETTA 4XWOC 3VDCA 2BSTB 4ZW5A 5BV7L 1SVZA 3CH1A 3D05A 4YDJB 1K3IA 5HJGA 4YX2L 2BWIA 2YUWA 4PRID 3UBXG 1IJ9A 1HC1A 4LHUA 5MHSE 3QDGA 3CSYA 4HV8A 4MD0B 1CGUA 4JVWA 5C09B 5B1AB 2BY3A 4L8SA 4CBZA 3WTUA 4TVUA 5L2KA 1MHEA 1V5JA 2P5WD 2AW2A 4QY8A 3KWWA 2BSED 5EF1A 4LRNH 3ARBB 5FGCB 3QQ4B 4WW2B 3D30A 3TBCA 3BGMA 4G7RB 4XBGB 4MTMA 4HUNB 3DX9A 1A7NH 1L9OA 1PEWA 5CU5A 3KPRE 5IMLA 2WLHA 1ASPA 3FQTA 3BN3B 1ODUA 2DQGH 4PD4J 2Z64C 4XN7A 5I0WA 1ZGLA 4QF1B 3U9PH 2NMSA 3L95A 5IQNA 3VWJD 2VYRE 1CB4A 1KGWA 9CGTA 1AE6L 4P46B 2CK0L 2CGZA 4PJHF 3ARGD 3T0AA 3K6FA 2E47A 4UIMA 3TA3C 4C8XA 1T5WA 5H2BB 4XC3L 4CGTA 1YQVL 5L8LB 4I18A 3O9WD 1QX1A 1IB5A 2EDFA 2F8VA 2Z93A 5I73C 2IMNA 5D71L 2VCOA 4U1KA 1C9SA 5AW2B 3VH8G 2WBJC 1W72B 4S1QL 4GP8B 5ALBH 3A3YB 1P7KA 4N2FA 4G80B 1UKQA 3CV5A 5DMIL 4L3CB 3O45B 5LBSH 3RWCB 5KSAC 1KJVA 1TEFA 1CE1L 1E4WH 4M8VA 3G5XA 3MMEA 3UPRB 4AQOA 3D0AA 3JWNE 4U49A 4X0KB 4QRTB 5IB4B 5E4OA 4TNWK 5F6HI 1G43A 2XTJD 3OLDA 4M6MH 3SSGA 4ZAKC 2V3EA 3FQ4A 5IBLC 2EIEA 3VFPA 1SQMA 5JMRA 5MI0B 4D0BB 2YQBA 2XN9E 1NIEA 2RR3A 2PXYA 2ZOUA 3TH2T 3IJHA 1V8HA 3BCDA 2HKHH 1THCA 3UIZA 5FYLE 3QORD 5DLML 4IM8A 4KXCA 2CDEA 3MLRH 2VZOA 4CVWA 2IADB 4Q9RH 1KPRB 2O5ZL 1MFVA 3FKUS 2CO7B 2WLMA 2V17L 1TNMA 1UD8A 3VXUD 2QGCA 3BGFB 3PWJA 3QNXA 3Q2VA 4FFVD 4P2QD 3D2TA 5DO8A 5C6TL 2FBRA 3IJ9A 5DRWA 5EIVA 2FR4A 1ZS2A 4HIHA 5I1EL 2AI0H 2OMWA 2BK8A 2RFXB 1YNLL 3VXSD 4HOZA 2F53D 3WFDL 2YO3A 1RPQA 4QHKJ 4XCEA 5ICZA 4PJIA 5K9KA 5A16A 4I3GA 5BO1L 5AG9A 3LB6C 1G6RH 2BOBB 5E8DH 4HVBA 3B9EA 2HTKD 2YAFA 5HYJB 4LPTA 4BXVA 3FH7A 4POZD 5SWQA 4ZZKA 1QO3A 2L0DA 3C6LA 35C8H 1IVLA 3FAXA 1CICC 3FRUB 1UGNA 5KSBE 3E9TA 4I88A 3KNBB 3M17A 3WFBH 4A67A 3D07A 5AW5B 5I5IA 2IANA 1U8CB 1UXLA 2WLLB 3BP7B 2HRHA 5CJXA 3KPPA 1QQDB 1N2RA 3BN9D 3F7KA 1T0NA 3UC0H 3FQWB 2ICWA 2MHAB 1FNAA 2J8UA 2Q9OA 3QC6X 1HL5A 3P0VH 1OCRB 5DS1A 4FYTA 5D70L 2D31B 3TM6A 3AGWA 1JF6A 1V7MH 3DURA 1B0RA 4MZIA 1U95B 2NW3B 3NCYS 2NY2D 2P8LA 3F58H 1BGXL 1XMWA 2WUCL 2PO6C 1ETZA 4OLZL 3MUHL 2ZYSA 1QLRB 4PG9B 4QJ5B 1ACYH 1XFPA 2VQUA 3LS5H 5IEKB 3WEXA 3EO1A 4KHXH 3GSUA 4GUPA 5JXAH 3EXJA 1FBIH 2GJ6A 4ZS6D 3NFSL 4KJYB 3FH5A 2EVIA 3HI6H 4HKBB 4PI0A 1I7RA 4JFSA 2WTRA 2V9QA 1C08B 5AOLA 3GIZH 4NUJB 3N1MC 3OKNB 1RV6X 3ZX1A 2Y06L 2K8QA 4M7JH 3SE4A 3RL2B 4BH8B 2QMKA 2IQ9H 1GYVA 1CF8L 1JWUB 2ETWA 1DJYA 1QSEB 1SM3H 4CMMB 3LRHA 1BMZA 1Z0MA 3MLUL 4IRSC 4PRHD 4WI2A 4A2LA 3FS9A 5C97A 4R5VA 3F65A 3QUZB 5C0FA 3IFNH 5FLUA 1VEPA 1YCSA 4AYMC 5IMMB 4I0PC 1DQLH 2V3DA 5EC2B 4NBZB 3HI1B 3PL6A 1AIFB 1MW3A 2Q5BA 3H9HB 4KXAA 1J0HA 1JNHA 4P23B 4UM9A 3QC5X 5BRPA 4YN3A 3VI4F 4ECNA 4AZ8B 5HGDB 5HD8D 3S6CA 1I9RH 2RBLA 1Y0LB 1A6ZA 3GNMH 1I3GL 3KBHE 4XAWL 1EZVX 1NCAH 1GPOL 1QACA 5FYKE 3TJHC 3V4PB 1FFRA 1Z2KA 4L37A 4L8SC 1XF2B 4EOWH 4P3DA 3FMGL 4WK0B 3TP4A 1G7JA 3H9SD 2VERN 3EJJX 3OGOE 4WU7B 5EZJA 5DJ6A 4F7PB 4NO3A 1OALA 3HG5A 3VFOA 4JBSA 1LO3H 4MXQC 1K8IA 3MXVH 4DT2A 2BY1A 2WXFA 1MAMH 3CZFA 3KPNA 5JW4M 4YDVB 1A5FH 4IEFA 5HHOB 3DVIA 5D72H 5JW5A 4IHOB 3VU2A 2NY3D 2ZX8A 3ES6B 3GI8L 3B9DA 4GG6F 2J72A 1C7TA 4KRPB 1Q0EA 4GBXD 5AVVB 43CAA 1QW8A 5BV7C 1N8OE 2FBJH 3ABLB 3ATEA 4IOIA 4TN9A 3IRCA 4Z7VE 2W60B 4FHBD 3GRWH 5FGBA 4FLHA 1AO7E 2XZCH 3H6JA 3O6MH 5SWZA 3GMPB 5E6SB 5I0XA 1ZHNA 1MLBB 1RUQL 4NQED 3KH4A 3MOBL 2KC0A 5E94B 3IMTA 3EYOB 3STLA 4H1LA 4I1RA 4ONHA 4Z7OB 2ZXDA 3IE9A 4OLYL 4I18C 4FQQB 3DIFB 4HIJA 4JO5A 1F4YH 2VDOB 2COQA 1UCBH 2AQPA 2O30A 1L5GB 2GJPA 4ELMB 1ZWIA 1M6UA 2IBBA 1IT9L 3CN2A 3FT4B 5J6GB 1GGCL 2YPLA 5IFAH 4NBXB 4TQ8A 2A4EA 1LMIA 1Z5YD 1MLCB 4FQ1H 4KX9A 3D39A 2B59A 2XRAH 4QRPB 2OMBA 3JXAA 3V0JA 4CNIA 1NDMB 2EUXA 2VDRH 1CDHA 1QBBA 2YN5A 2XVLA 5CP3A 4DP9X 2AABH 1NC4B 1YEDA 2CIIA 3O3UN 4Q2ZA 3ZQ9A 2R9HD 2WNGA 3OAUL 2FQFA 2CCWA 2DICA 1T03H 1EAOA 2OI9C 1P7HL 1RAMA 2GITB 4WW2F 3BZFA 3QG7H 2PXYC 1L0PA 5D6CB 5J9PB 3RFZB 1AXTH 2JCCB 3DX1A 1EEZA 1I1AA 3GO1H 3CBRA 4FAAB 1RJLA 3MBWA 4XNUH 1DDHA 1I82A 1M1XB 3QDGE 1RP9A 2QSTA 1H5BA 4PY7B 4GI9A 3L81A 4W9HC 3DTUB 3VRLE 1KV3A 1M7DB 4MMXB 2YQ3A 5L2KE 4ZTPH 4XNDA 5IHLB 2XLLA 3VXQB 1U91B 1MJUL 3GZQA 1DLFL 3KCPA 1CL7H 4ONOA 5I24A 3V2AR 2G75B 1IGJB 1R3HB 3GPSA 3KYMB 1EHLL 3MJ9L 3OR7B 4XR8C 4G71B 3W0WB 2QSCL 1JK9B 5I2IB 5T1MA 4AQ1B 4YQXH 1V7NL 3GSWB 4JO3H 3AWGA 3SYCA 4PJBA 4B7IA 4O02L 1UURA 5FHBL 5GXBB 4O9HH 2JF1A 3S97C 3ZKMD 3C6LC 5LGHL 3IDGA 4P5TA 4X4XA 1MIEL 3OB0H 1PJWA 1P53A 2ZP9A 4B6ZA 3U46B 1WE5A 3LOWA 4N6RA 1OAXH 4FA6A 2YPKB 4E9TA 1GSMA 1VRSA 1A7QL 4MA8L 1R3JA 32C2B 5AOJA 4N2NA 2D2CC 3GSQB 4L8DB 4LFHG 3HZVA 3BUDA 2OW6A 3RIKA 4DFIA 3MJ9A 3X3GL 5IROD 4KJWC 2WYZA 3FO9A 3CVIL 5ENWA 5FYKH 3BRDA 2YJLA 1A7RL 1JAEA 1FSKB 2SEBA 3O3BB 1F6AB 5DC9B 5KN5B 1MFDH 3L5IA 1CXHA 4P5MA 1NQBA 2C3VA 2X10A 5E2WL 2FHBA 3BFWA 3QARA 4OZFB 5HHNB 3T9WA 1A4JA 1J8KA 3IE4A 4Y7OC 3DO7A 4MJ6B 1R5WB 1DCEA 1PVHA 4HZ1A 2XG4B 3DTXB 3QDMA 3MJWA 3NUKA 5HHMD 5A2AA 2H2PC 3V4VH 1D5XA 5IHUH 2ODHA 3FUJA 5BZWA 2BVOB 2OYKA 3SOBL 3SE4C 3FQNB 4A37A 5IHWA 3BJLA 15C8H 4JKPH 1UOKA 3BZ4A 4QRSB 2AJYL 3RB5A 2Q86A 4GB9A 4UF7C 1SYSA 3TBVA 4AW7A 3X17A 4X5XA 4DSYA 1YNTA 3DOSB 1O9WA 5D5MA 3VXOA 2XZAH 3QIWA 1S7XB 2BNUB 3MFFA 3NRQA 4NIKB 2R7EA 2NNAA 5CIPA 4YBLC 4NCC1 4YHYB 1TTUA 4ZOAA 4Q52A 3A67L 2OCCB 3CVHL 5E95B 4PJIE 1RHHA 5L88H 4UT6A 4MCYB 2V9TA 3WKQA 3GB7A 5I1GL 4NYLA 4WJ5B 1JTTA 3D85B 2ZUQB 2ZWNA 1CR9L 2DPKA 4UQ3B 4QRRA 5I74C 4YLQT 3S3SA 3FBQA 3V5DB 1NC2A 2QLVB 3EG9A 2MSPA 1S9VB 2TAAA 1BVKB 4DZ8B 2IANE 3PHQA 2B1AL 5LO7A 1Z9PA 4EI6A 4F2EA 2ARJA 3ARFA 3ZDYB 4B0MM 2YD5A 4L4VB 4MNQB 2C9QA 2ITDB 3LEXA 2J8UE 3BWAB 2P26A 2ZUWA 4FQXC 2EP6A 4M7ZB 4OKVB 1JHKL 3BGAA 1JZEA 3CVHA 3O2DH 5HHQA 1NGQH 2DYPD 4OUUA 4XNYL 5E0FA 2P7TA 2V5SA 2DL2A 5FGBC 1H3UA 4IRZL 4S2SA 2PYED 3P4LA 3T0ED 2R2HB 1JXKA 5EU4B 2VGLM 1TIUA 5AWNH 3T3PE 1DQDH 4MJID 4EBQH 4J3OC 4ODHL 4OIBA 5HYIA 1J1XL 1IGYB 1OE3A 3JT2A 2APVA 2C7FA 1DVXA 4DESA 4HPHA 1V55B 4Y1AD 3RZCD 2FSDA 3DK0A 5F3FA 3FCTB 4RFEB 2GJ6E 1CS6A 3A47A 5DJ8A 2OZ4A 1KEML 5IW1B 3N1QC 2FX8H 1U92A 3QZWG 3S4SB 3NSCA 2I7SA 3VGAB 1BXVA 4JJHA 3TV3H 3MOQA 4XMXA 5INDA 5EG6C 1R3LB 5FYJD 1D5MB 4ZOCA 2P4AB 3C6SA 1JFHA 3GEWB 4AXWA 5KJRH 1IQDB 1NMAH 1VFUA 1L9MA 3VFVB 3T2QA 4JFUA 1ZVHA 2HRGA 3MLSL 5DJZB 3NACH 5AYUL 3EYVB 2IMMA 1ORQA 2AV7A 4GP4B 2K78A 2YA2A 1DJSA 4KKBC 2I27N 4ODSH 3EJSA 3V6ZB 3ARUA 5F0LB 2NY7H 2YBGA 1U3HC 1WZ1H 2FEJA 4LSDA 4NOFA 1I1AC 4NAJA 2CQVA 5D1ZC 1ZIBA 3GZPA 2WLKA 4YAQB 1JVOA 3RTQB 4PJ5D 5J1SC 4OZGA 5CLZA 1HCYA 3QW9A 4QHKI 4B9GA 4OD1L 1H5BC 1MRFH 2MOVA 4FP8L 4JDEA 5C9KA 2IBGA 2YZ1A 1MCQA 4GT0A 4WY7H 2DAVA 5ACZA 2DQFB 4LLAA 4NIYE 5DTFB 1N0XH 4AVJA 3CZEA 4U3HA 1CDYA 4FI8A 5BO0D 2Q3AA 3LD8B 4UV7H 5E1GA 2NLJA 3PREA 1TLKA 5F9JA 1HZKA 1RZFH 2CNZA 4D9LL 5IEHB 5T1LB 2CLRA 4HLZH 3MA9H 3T2NL 4I3SL 1KNOA 3UYOD 4YPJA 2OMVB 1OK0A 4KQ4H 5K1VA 2DEWX 4OGXL 4F15B 2A9ML 4A2MA 5C0BA 4A04A 2LU4A 2R4RH 3T4AA 2FGWL 4ONGH 3UTSB 4ELMF 3ZRCC 1MG3C 4JFPB 2YBRB 3CDYA 1J8HE 4JHVA 1DJWA 5DEGA 2AZAA 4L4TB 4F7MB 4KNSA 2N7SA 2LU3A 1Q8MA 4P5TC 4WFFE 3EYQC 1IM3A 2GUYA 5SWZE 1PQZB 3SE6A 3PGFH 5FO2A 4TVPE 5IJBC 3FYEB 4AYID 3FDWA 4I2XB 4UOW1 2A38A 3VFNB 2VLKA 2IGFH 5GIRA 3G6AB 3EF4A 5CMAA 3HS8A 4WUKH 1J87A 1ZCRA 4U0QB 1E3FA 4OIIH 3PS6A 4A7VA 2BRQA 2ZWLT 2YEZA 3QCUL 4DP6X 1MJ8L 4ZFFB 3HE6D 1T22A 2JCCF 1IC4L 2C9RA 5CZXD 4I5BA 4LF3A 1FGVL 4B7LA 1QSFB 2YPLE 4X6EA 3SCMB 4BUHA 4JS7A 3PV6A 5DFAA 4XH2A 2IJ0C 1SLWA 1S9WB 1EJOH 2F7PA 4R7NB 3D39E 2H0EA 3R18A 2NX5B 1FNGB 3JWDL 1S5HA 4TRPH 2F15A 4I8DA 5T3XH 5H94A 3KMDA 1UG9A 4XPTL 5DEFA 1XIWD 4PJGA 3ZTJH 4AY0A 1A1OB 4E0RB 2XA8H 1QA9A 5KVEL 3QPQC 1DSFL 1ES0B 3CH8A 1TVBB 1G7HB 2Y72A 4CDGC 2QR0A 1I53A 1OQXA 3QG6A 5HDOA 7TAAA 3DX3A 4R8WL 2GQHA 2OMYA 5GSVB 2W65A 4ABQA 3V0GA 1OP4A 1XCWA 3WD5H 1U2CA 2AEQH 2XQYG 5DEJA 1FO0B 3PDOB 4GH7B 3N41B 1EFXB 4LP4A 1BLNA 4Z0BH 3UJIL 3FQ1A 1B9KA 3PUUA 1OEZW 4LXFA 1M7IB 3QUMH 4TXVB 5CLTA 4Y4FA 4XNQB 5EBGA 1IARB 1JV5A 2Q76B 1MCEA 4XVUC 1U8NA 3K8KA 3LHPH 1E3ZA 3FCSB 4NHUA 4POUB 3BOVA 2P45B 3QJZA 3V0DA 2DQJH 4GAYB 3AG2B 3KVDD 4XVSH 3UDWA 4IBQA 1S2EA 4KXZI 4M61B 3HG1B 4PJBE 1G87A 4C4KT 1FG2A 5DU7A 3IS1X 1TXKA 1G1CA 2DI9A 4Z18A 4ODWB 2VKXA 1N0LA 3NJFA 1S9XA 3T65A 3ZR6A 1NCBL 4V1DD 4U1GC 4OM0H 3NAAH 1P5UC 2UX7A 3LH2H 1VAHA 4HWZA 1AI1L 3QQ3B 2ADIA 5BS0B 1KYDA 3EH4B 1LWRA 3S0PA 1JGVH 3NA9H 2DWYA 3FQ2A 2E3VA 3WKYA 5ETUA 3VAEA 3STBA 1IBGL 3EYSL 5TTRA 3I9AA 4ZW8A 3MTXA 4R6UA 1LD9A 3OXSA 2VLRE 4Y2OB 5B3SB 3M7FB 5KYYB 2VMFA 3CZSA 4OV5A 4MQ7A 4FABH 3SDAB 1M05A 3DXAA 5JHDA 2DLTA 1M71B 2YK1L 3TZVA 5AVSB 2XV6B 4JN2A 3EGXB 2CHWA 4R7DB 3WKNA 2ROXA 4XCNA 1PCXA 4ODTH 4TTGA 2B5IB 1SF5A 1H3PH 2QFRA 2QHRH 1QI4A 1MFBL 3EFDL 3QDME 4X7TA 3W56A 4AUUA 1IGCH 1YEIL 2JVUA 3HMWL 2JLPA 1P4BH 3GSNA 2G3XA 1HHHA 3DUSB 5LCVL 3FJTA 4UQ2B 5E00B 2PW1A 3E1ZA 3QRGH 5I76B 3CBJB 3MOAH 3TO4D 1WSST 4KK5D 4HT1L 5E1HB 4P2YA 3QR0A 2FLBT 3T0WA 5CNHA 1WGVA 4HUMB 3LH8A 3Q6FB 3KLHD 1J10A 3QHFH 4PRPA 3O6KH 3K72B 5D5ME 3V0WH 3N6YA 4Y89A 5IESH 3UZVA 4P8QA 4OFYD 1COBA 1OCZB 1E4XL 2X4TA 3UTTB 3VFTB 3ZDYF 5DK2A 3PFUA 1ND0A 1WC7A 3MBXL 1T2JA 2NUTB 3BKJL 3NIGB 3P54A 3PXJA 4FXLA 4Q9BA 5EBMA 4Q9QL 3SYAA 2YD4A 1JI1A 1DN0B 1OTTC 4PP2A 1OARH 2J1XA 4KVPA 5ELIA 4L3ED 3QYMA 3E6HB 3HN3A 2VDQB 1FE8H 2WQVA 1G1OA 2YS4A 4FKEA 4X8XA 3VNZA 4AIOA 2FB4L 2PTTB 2GVYA 2VE6B 1EO5A 5C0AB 3PPEA 4QRRE 1PEZA 2XWBB 4Q97A 1IKFH 4AYDC 1JDAA 4EUPA 3KL0A 3L2MA 5I5JA 1CD1A 1MSPA 1UKTA 2GIMA 1XBRA 2AJVL 3JV6A 3ROOB 2JIXD 4NO0A 2VLJA 2X89A 4FNLL 4U1NA 2X5PA 4IKKA 5AB0A 3T4AC 5JMOC 4RDQF 4BFIB 4JFFA 1LE5B 4NDMA 5EULV 3CZLA 1IZKA 1UACH 3H0TA 4GG8A 5HGBB 2KZKA 4HF5L 4NN7B 4WFEE 2NY4D 3TVMA 1AS7A 1PTZA 1QRKA 3UO1L 4HUXB 2CO6B 4DEPC 1OAZL 1FYTD 4AJVA 4HDIB 3D0VB 4K3EL 4LNRA 2WKGA 4Y9FA 5L4MA 3F12A 3PWLB 5GS0H 1JGDA 1I7TB 2VN7A 4KK9C 3VB9A 4WEEA 3MRFB 2AVFA 2BHUA 4JKLA 5GGRY 3C60D 3TNNA 4BSJA 4ZD3H 3PAUA 2BOLA 4DN4L 1Q72L 1T5KA 3MJ6A 3TF7C 3CVDA 4JRXA 1BZEA 4YFDB 3T0EB 5EBLB 5HVFB 3SJVD 1IAKA 1G7LB 5LQBL 4LVNB 3Q9QA 3QXAA 3RGVD 2VSCA 4XMPL 3RNKA 5A2IH 1Q90A 5I0DA 5L9DH 1E4JA 1B0GA 3B8YA 1KLGA 4RETB 5FV1L 1W0WB 2IWEA 4NM8H 3ZDZB 2UY7B 5JLZA 4RBPH 1M9SA 4HPYL 4Z78A 2WJ7A 5FDWA 3JYCA 1BVNT 5IUCA 4NZRL 1SJEA 3ZE0E 5HYEA 3F6LA 4I4WA 4XB8A 3L3GB 2VDMB 2Q7YB 5A1AA 1UB6A 2PN5A 2AJSL 3L3DB 3N1FC 2EDDA 3CXFA 3UFIA 2PF6A 1E4KA 1BQLH 4U1HA 4WTXA 2BFVL 4RGNB 2PCFA 1FUNA 1SYVA 4WIQA 4LLYB 4K3DL 4TUUA 5FYKU 2DY2A 1A65A 4W9GC 3B2UD 4ANWA 2BP8A 1FZMA 4DKFL 5DUPH 5DR5H 4AEEA 5E99H 3BZ5A 1WYJA 5F3HA 1ZHLA 1UJ3A 3O2WL 3U6RB 3LX9A 3C5ZB 4FQ2H 4R4ND 4Y4FC 3SKOB 1MAKA 2ICEA 4IU3A 3CDGB 3IS0X 4OSUL 3FQUB 4RMRA 2JKLA 3PJSB 1TCRB 5ESAB 3AQXA 2A9AA 4L1LA 4B96A 5TE7H 4LLWA 3P9WB 4RAVA 4FFTA 2LFGA 5JPNB 4GKZB 5EWIL 4P2RE 3ULUC 1ET5A 3QJVB 5C0BE 4A2DA 1ZSDA 3S37H 3HCVB 1TQWA 1E6OH 1VCAA 3TCXA 2OL3B 1MWAH 1XCQB 4MB4A 5DD6A 1QZ1A 3GLAA 2J44A 5MEQA 2ADFH 3HAEG 1A1MA 5D7SH 1YO4A 5E7BA 5BQ7B 2HFTA 5CFAA 3GBDA 2A77H 4XRCA 4Y19B 3S36H 4OD3H 4P57A 4KKCD 1WZLA 2DRUA 5JIKA 1OE1A 5J6SA 3MA7A 4JM0A 3VD1A 1SRDA 2IV8A 3OC8A 2ITFA 3B2VL 3WIFA 1JOIA 1UWGL 1I8IA 1G5GA 3B4NA 1UJTA 1HHJA 3BH8B 3X12A 3QJFB 4JFWA 3G6DH 1I1YB 3ZDXB 4ZSOA 1S7SA 2JCWA 4E9QA 2HJKA 5DHVH 1K8DA 3BP4A 3R7RA 3N41F 3BAKA 2UVFA 4JZNA 3TZVC 1CCZA 2JELH 3Q1SH 1AGBA 4K71B 2AAAA 3QDJE 4MD5B 5D7LD 1PLGH 4HBCH 4IMKA 3RX5A 1FVEB 1EERB 2HVKB 1NCDH 3PDGA 4LDLB 4PJGE 5IB3A 4N5ED 1N64L 3HFMH 1G5AA 3US0A 3STZA 4OLWL 4CW1B 4JFDE 3LZFH 4L1DA 1IEHA 1IU1A 3EH1A 2Y7LA 3E6FA 4QWWC 2K6WA 4QLRA 1U8OB 2H45A 1A3RL 5D8JH 3TBSA 1N5YL 2DBJA 3QFJD 3W9EA 3B5TA 4DP1X 1ACXA 4WO4A 4LK4A 2BVQA 1ZT4B 4M6AA 1X3DA 4XX5A 3L2LA 3ZE1F 2NQCA 2NY5L 4RA0C 4RFOL 4XVJL 5C3LD 5J7CC 2XVBA 3HBZA 2XXFA 5B3JF 2F1BA 3MROB 3FYIB 3CJJA 5CEXB 3VJ6A 3LQAL 4UTAA 1LDPL 2ZX9A 4FFZH 1F00I 2XWEA 1ID5I 3AREA 3KJ6H 2VR6A 1JMXA 4Q58C 4WI3A 1UASA 2OXGB 5CHNB 3F04A 1K4DA 4JPSA 4QRAA 3L6FA 5EF3A 1U58A 2DEXX 3K46A 4R97B 2PR4L 4YUEH 3ZVVA 4E42B 3ULUE 4PRIA 3WEOA 5CBEA 4Q6IA 2O5XL 3BSHA 5KSUB 2NR6A 2EDNA 4Z76B 3MRRA 1ECYA 4UNVA 1S7WA 3LKRB 4Q14A 5KVFH 4FLSA 5HGAA 1E50A 1XZ0A 2H2SC 2P5WA 5AOZA 4PJCB 4U6VH 5DZAA 1GGIL 4NO2A 3SDCB 1TUPA 2BSEA 3NN8B 2WXOA 2FQGA 5D7IB 1R5VA 1PU0A 2H8PB 4AIZA 5HPMA 4WWNA 1OT2A 1M6OB 4J3VA 3ROLA 4NNXA 4ZFOA 1LEGB 2H47C 4H8HA 2BIIA 3MRGB 5DJ0B 1D2OA 5J6HB 5KYUB 3EGDA 2CO2A 1HEZA 3JV5A 5EUKB 2Y07L 3TVMC 4FG0A 3SBWC 1ZVYA 5E9DB 4ZI8A 1WT5A 3O0RH 4A2HA 4GXUN 4X6DA 4L05A 3MNMA 2NQ3A 1TYRA 1GHFH 2A99A 4MDJA 4U7KA 4YBQC 4G6JH 3UMNA 4WV1A 3VWJA 5JHDE 4QHMB 4IBZA 1HH6B 4HUUA 2NSMA 3FF8A 5FB8A 3ARGA 1OOWA 3EO9L 2VITB 4PUBH 4BJLA 2J8HA 1OIOA 1RXLA 1ZGLM 1B4JL 1DQML 1X5MA 5CILL 3ZTNH 4YHLL 4M93B 5HDQH 1QNZL 3O9WA 1OTUC 1SGKA 2X7LB 3HC3H 4PR5A 3GT6A 3CXHK 4HWBL 1EDHA 3VI3E 1RZPA 3NIGF 3MC0A 1XF4B 2VABB 3EOAA 3IFLH 4YHZH 6FABH 4J39A 1CUOA 3DETC 4MAUH 4HJ0C 4WEUD 3OWRA 3OF6A 1LP9B 3WFEL 5EC1A 4NQSB 3DHJA 2PMZA 4U1SA 1C1EL 1X7QA 1XSKA 2D9CA 2K3TA 4PRPE 4TUOA 4OR1A 1YY8B 5E2UH 1CLOL 3WN5A 5DMKB 2V7HA 3IAQA 1ADQL 1ZHBA 2NXZC 2H0JA 4UU9A 4M8QB 4XC1L 2ZOKA 3EYFB 4HH9A 4LE8A 4ONFL 4I7ZC 4Y4KB 2A6KA 4OH2A 1HILA 3Q6GL 1NSNH 4NQXB 1AYRA 2WQWA 4IU2A 1TZIA 2WM0A 3P77B 5I6PA 2ERJC 2D03L 3NEXA 3QO0B 2XPYA 1S7QA 2NNFA 4PB9H 2CZNA 2X1XR 3GHPA 4CMHC 1UJ3C 5KVDE 1RLWA 3CVBA 2ZWSA 2I9TA 4HS6A 3MBED 2UY6A 2ICEC 4P2QA 1AQKL 5BMFL 4E9WA 4BSWB 4LVOC 1T04B 1JNNL 1IAIH 2FATH 3O2VL 2K4AA 4NQDB 5DVOA 1BZDA 3WXWL 3UO8B 5F7UA 4PMFA 2VLJE 2E6PA 3S5ZA 4U1JB 1P1ZA 4KOBA 2EH7H 2OMTA 3QXDB 2B0SL 4JFFE 3WLBA 3FFCE 3SDYL 2C1PA 2KS0A 1DE4B 3FB8B 4AEHL 1D5IH 3T6WA 4ABUA 4XMKL 4NLAA 4FI6A 4HQQH 4QXGH 5IT2L 5J1AB 2K7QA 1SVBA 2FZ3A 2BMKB 5ANHA 3ZDZF 5EU6D 4PBXA 3KPSD 4HMEA 5HJDA 3EHBC 2XFXB 2EAEA 3L9YA 2D7TH 3UZQA 5CSBA 5IQMA 1FDLL 4HCRL 1HNYA 3ILPA 3ZKSD 4Z3HA 1UB5A 2K9FB 1OAJA 4P9HC 2W38A 1BAFL 4JN1H 4JRXE 4O51A 1XCTA 1RK0B 4MASA 2EVJA 1FNSH 2NT1A 1SF3A 3MV11 4FADA 2OJEB 1HYRC 2JV6A 4O4YH 4WWPA 4HZLA 1B0WA 3SY6A 3SBPA 3BW9A 1UD3A 1QRNE 5I1CL 3SDDD 3HMXA 4ORGB 1F58H 1VHPA 2N1TE 3ZSSA 3PJNA 5DWUL 1FIGH 1TOXA 4YE4H 5DUBB 3S88L 1YMMD 1TJHH 2KERA 4WU5A 4AI7A 1LK3L 2AZUA 4IMKC 4WKZA 1AH1A 3TO2A 2FIRT 1OL0A 1Z9MA 2WK2A 4BFFA 3CN1A 2UV3A 2DLHA 4HCIA 4QXTB 1KTRL 1NGPL 4JRYE 5DVPA 4MNGB 3V6FB 2A5UA 2NY6B 3BP6B 3THMH 4P5KB 2Z7WA 2ZAGA 3K0WA 4JQXC 5E8OA 3LPGA 3E0GA 5KSVB 1KXVA 3GXTA 1D6VH 2LGNA 2FNBA 4WTWA 5GRYA 1KBVA 1B6UA 4P4RA 4A66A 3AU1A 4PS3A 1A1NB 1U8KA 4OCRL 3PP3H 4I89A 3DBSA 4LU5L 3FN3A 4WKXA 3ZT6A 1A6TB 4KROD 3CFUA 1N3NA 1NIAA 3BAWA 3GMRA 4M6OL 1KLFA 5D2NB 2Y7QB 2FCBA 5DRZB 5JOPE 4MCMA 4W6YB 2CJUL 1HDMA 1I3RB 4MJ5B 4BH7B 3AREC 1TKWA 2ZSVB 5DQ9B 4ZMTA 1H8OA 2CCLA 3K2KA 4WSJA 3RWIA 4C83B 2FJHA 4RMVA 3OZ9H 1JZ5A 1U8MB 3BISA 3GSNH 3HZKB 3J2PA 3VD2A 4PTUA 5DJAB 4DIXA 2IAMD 2JKNA 4Q6IC 1DBJL 3D51A 3TN0B 1HN1A 3DJZA 2NDGA 2NR6C 3QA3A 2H5UA 4N25A 3G08B 1G94A 2QVMA 2QQKL 1J1PL 1ICTA 1CT8A 4L5FH 1F4XH 3BFQG 5BXFA 2OX5A 1I9IL 2NY5C 3PLYA 4Z7IA 1PG7L 3G5YA 5H35B 4BBWA 2WVVB 1MW2A 1FL6A 3ARXA 3K6NA 3WY1A 4BGLA 3K71A 3ALPA 3LQAC 2HJFB 2FL5A 4GEIA 4NKDA 1I8AA 4DPRA 2MPAH 1DQJA 4YSEA 1QFWL 1FC1A 1TTBA 2J88H 3BPNB 4GBXA 3DYMA 4M4RB 4XBPA 5I75C 1RZJH 3OVUB 4JJ5B 4BZ2L 3B9VA 3BMVA 5DXWA 1N6VA 3D18B 4ZSOE 5KVDH 4DW2H 5EFIA 4LOFA 5FA3B 4EUPH 1DJHA 4GJTB 3AWFA 4K23H 2F8OA 3P3RA 2FX7L 4G6AD 1NCGA 4YSTA 3GMOB 5F7KC 5CEZL 5D1XD 3O9WC 2C9SA 2FD6L 4Z7UE 3ZJAA 5CCKL 4E9LA 2YD6A 4MWFB 4DERA 1DL7L 4D3CL 2UZIH 5E2TH 5IQ7L 2ED7A 4CSPA 4BFGA 4ODVH 1RJYA 3CK0L 2VR4A 2LTQC 3T3ME 1OQOA 5T3ZD 2GHWB 2A9NH 3MRPA 4ENZA 4J27A 4HHWA 1E6JL 3CUPA 4OJFH 1EFQA 4AJYV 1RKRA 4CVZA 4LSPH 3WN5C 4NBYB 3O81A 4G6FD 3BXNA 4QYAA 3VYOA 3QZPA 3UTQB 5TF0A 2C5DC 2E6QA 1QBMH 3L3IB 3IJ8A 4PJCF 4X8CA 3HVDA 4AGMA 3VA2C 4H26B 5D7IF 3QO1B 1FN4A 3QEQB 4DOHE 4P04A 1XF5A 4AZUA 3KYNB 3CXHJ 3QK0A 3BIBX 4XPGH 2Z35A 3P4OA 4HGWB 3UMTA 3CLEH 1F4WL 2UZPA 4PRIE 3QIUC 3NFPA 1TYJA 3DA0A 3QQXA 4MMZC 1CQYA 5DVKA 1RZ7H 4M1GL 6CGTA 3H42L 4X8GA 3CZUB 3L1OL 3UG4A 2F1AA 3CD4A 5JPMB 2BSCA 2Z0BA 3FFDA 5EPMA 5ID1A 2P5WE 3L5WA 4G9FB 1W72L 4CKVX 1R3IL 5DVMA 2IWKA 1OCCB 4CN4A 4UANA 1S7TA 3HN5A 1BLIA 3ESNA 1OHZA 2FLRT 4P3CH 2UUDK 3CFCH 4FNTA 4KX7A 1AKPA 2IFGA 3ABGA 5AD0B 2APTA 4HA1A 1RSFA 5EU3B 2XU9A 3AT9A 4J5VA 1UXSA 5F7DA 3U36B 3E2HC 2IPTL 1I4FA 3KEHA 2AXFA 3V9CA 1S8DB 2FTAA 4X6DE 1IX2A 3BKCH 3AQYA 2QTVA 2C9UA 1LP9F 1AHMA 2Z1PA 3BCFA 3DGGA 4UILL 3CFKB 3F00A 5BPPA 1HHKA 2VNCA 1LL1A 4HOXA 3Q5YA 5EU5A 4LQFH 5F7FA 4PJEA 4RMWA 2HTLD 3SIKA 4W4NA 1JDCA 4DF9A 3P4NB 3ARPA 4XHJD 3N85L 1LO5B 5EV7A 5GRZA 3H3KA 4H5SB 1UOVA 1TJGH 2XDHA 1AKJA 3AY2A 1OW0A 4JUTA 4PM1A 4FNUA 5DJYA 3LEYL 3HS0B 5EZLB 3RUGA 4IDJH 3DOIA 3O6LH 5L2JB 1F3RB 1MCFA 1XGTB 4ACPA 4B9PA 1KGYE 2DS4A 3NESA 3NH7H 5JHLH 2LAGB 2UYLB 5AVQB 4PREB 3B9KD 2WLNA 3VWKD 3WO3B 5G5DA 1ZE3C 3APMA 4K7PX 1NFIA 1WIOA 4ZS6C 4P2AA 4FMKA 3N55A 1KCBA 2XTJE 4KKRA 4KQ3L 2OM5A 2XIBA 3B3IA 1AJ7H 1KXVC 3V0EA 5C08D 1DBKL 3UBFA 4J1UA 1X5LA 5F7BA 1NCHA 1DQIA 3CFJA 4RQQA 1JGEA 1NFDA 2QPUA 3HB3B 4CKQA 1NINA 4JHWH 2E6JA 2O6CA 4QAWA 2XJLA 2D7NA 4TNGA 1OSEA 2Z92A 4P2QE 4BKLA 4KTEL 1MQKH 3CU1A 1NICA 5CUSH 2ZKMX 1NBVH 2ZOTA 5T1JA 3MYJB 4GAJL 1PX3A 2C7UA 4ZPVA 3SYPA 5D4QA 1RFDH 4TUKL 4Y88A 1CZ8H 1VFMA 4ZFZB 4DN3L 1L9PA 5HD8C 4PV9B 2VDLB 4XI5D 4PVMA 1N59B 3NCFB 4XVOA 5D1QA 4BCYA 2FJGB 3VDBA 4GXFA 3VFSB 3QR2A 3FN0H 4M7LL 3P9LA 2MCMA 2WXGA 4XXWC 3LKPB 3JVGA 1J05A 4Y4HD 5IKCB 5FM5O 2HRPH 1PX8A 2D31A 2Y6TE 4H2AA 1SEQL 3BT2L 4UTAH 2OQJA 4IIQB 3W82A 4FFYL 2AGJH 2Q1EA 4OCYH 4AYFB 1HIML 2NY3C 3VGFA 4H4NA 4HLEA 5LWYL 5L8KB 2EECA 4GBXC 4PWKA 4XP6L 2HFEB 4P49A 3SB3A 2BVEA 1T1WA 4U1IA 5C0EA 2VAAB 2R4SL 5EO0A 4AV0A 5AB1A 3TV8A 3D48R 1XGRA 1F11A 2N0KA 2FO1A 3MRNA 4XNXL 4LDEB 2QT6A 1PD0A 1ZV5A 3SQOL 1EZLA 1J5IA 1PD6A 3UGEA 1FVCA 1T3FB 2D3LA 1U41A 2I24N 1NDGA 2CRIA 3APFA 4H8WL 4Y1AA 2P24B 3V4PL 3FSZA 1OB1B 3RZCA 3LNFA 5LG6A 4EI5A 3KPLB 5A3ID 4WTZG 4ABWA 5CINH 5DQDH 2OXHA 1XQ4A 2ZX5A 5ALCH 3H3BC 4EMZA 1QTSA 4S1RH 3BT0A 1HI6B 1B9ZA 1FFOB 4PJ8D 5CZVH 4AK2A 1GXEA 4WF7A 3MGTA 1VJSA 1QWNA 1YN6A 4G5ZH 4G1MA 4Q0XH 1KCVH 3OMIB 2F19L 2ZIDA 3S34H 2JKRM 3VXTB 5ISZD 1WAPA 2X41A 4OZFG 2GCYA 1TETL 3AITA 4ZUTB 4BGDA 4PRHE 3SE9H 5HXMA 1KIQB 3MLXL 4GUCA 1P5VA 2WVTA 1F1DA 1ORSB 2FSEB 3U0TA 4CJ1A 1RERA 1OSPL 4PGCA 4H25B 3H4FA 1HKLH 4PWIA 4RGOL 3BDYH 5C09D 1MFCL 2XWJA 4ZXBA 5JOFB 3MVSA 2ZP0T 3B2PA 3PABB 3UJTH 3SQRA 5J5EA 4G8GD 3JUZA 3M8OH 4DAGL 4HIXL 4MXWL 5F21B 5B38G 3CMOL 4NWUH 5I8EA 2Q2EB 3BO8B 4GYBA 3CHXA 1DBAL 1A9EB 3HZ3A 2ZTBA 4ZBJA 3BZEB 1TDQA 3H9SE 4L23A 3WJMB 2E7DA 1Q0YL 1QFHA 2XN9B 4LLDB 3H9ZA 3QI9A 2QSQA 3ES6A 3GMQA 2ZUXA 5F1NA 3IDJA 1A8ZA 4X7SL 2VR8A 1A14H 4DZBA 3FO0H 3IXTB 5GGVH 5HBBA 3K6IA 5CR1A 3DX7B 1OP3H 1EGJA 4K15A 5AEAA 1BECA 2FH6A 1C8PA 3CFIC 1M7UA 4P46D 5HDLA 4IKIA 4NKIH 2DQCL 1B90A 3K80A 4MFHA 2NZIA 2X53A 3DV4B 1NL0L 4MX7A 2HT3D 3WNMA 3INOA 4YHPA 2VL5B 4G7VH 4UMGA 3GTTA 5DD0L 4WSKA 4WJG3 2YD0A 3A4AA 2IOOA 1SHWA 3ZO0A 1OGSA 4KH2A 3UGUA 1IKOP 1T21B 1ZJAA 3SKMB 3NZ8B 2XHNA 2DB8A 3U7WH 2OMUA 1MLCA 4N90D 4OT1L 1SFDA 1N6QL 1I8MA 3HE6A 3IAGC 2D9QB 4JG1L 4F7KA 3BIAX 1QHPA 2E7CA 1H15A 4KHTL 5KSBB 4IK6A 1L6XA 3C87A 1INDH 3ATAA 1T4KA 5IFHH 4GW1A 4ZNEA 2WINA 4P06A 1H6UA 1JRHH 1S78C 2JJVA 3TA3B 3WAKA 4BZ1H 3QS2A 4TULL 5MI0C 4QRFA 1F90H 1BZOA 3Q2WA 1FGNL 1GC1C 3BSZH 3OKYA 1E2WA 4UMSA 5I73B 1JPFB 4PGDB 5GJTH 2WBJB 4UOW0 5FO9A 4FXGA 1JK8B 1ZHKA 3L9EA 4RDQG 3S4SG 5CEZE 1CFSA 2WLIB 3MGAA 3L5XH 1YEGH 3FTXA 4I9XA 1E9QA 2E7MA 5GZND 3WE6A 4L8CA 4CUCA 1ZLSL 3RB7A 1CLZH 1KCRL 2O61A 1CFNB 3F7LA 4QCIA 3D2UD 3DV6A 3II2A 3S5LB 1S7VA 1R3HA 3IXAA 5MP6H 1J1OH 3LN9A 1E65A 2H32B 4ZAKB 1MHHB 4X98A 2PW2A 4FQIH 5FHAH 3GSOB 5GJSL 3W0WA 2BNRA 3I6KB 3OD3A 1KDIA 1VKXB 4AQ8A 2VM4A 3NIDE 3VG0H 4M5ZL 4HUKB 3U7YL 1OWRM 1PFOA 1KENL 4LAQH 1OM3L 1KGIA 2DWXA 2CGRL 3BAEH 3HE7D 3I2CL 4WFGD 5D1QC 1SOXA 1IC7H 1X5FA 1MEXH 1FL5A 1BD2A 1AFVH 4GI6A 1UA6H 4K2UL 4JKMA 1DBBH 3DSNA 1KPUA 2YPVL 2YPKA 2A1WH 3AC0A 4UDUB 1AAJA 4G8IA 4FYQA 3F6IA 4V1DA 2XKNB 3DPBA 4X7FC 2OLDA 3FN9A 3VNYA 1HZHL 1FFPB 1INEH 1MREL 4PJEE 4XN5A 3TFKD 5BVJB 4UTBH 3RKDC 3RVWD 3IPBA 4A6YL 4XO3A 5LGYA 2VN3A 4ANUA 1D6EA 3D52A 4IRJD 2AEPL 3CC5A 1HL4A 3NDYE 4OZFA 1RUML 5IM7A 2N01B 2FGZA 4LKCB 2F5BH 1CICB 4KV5E 3RUGE 2DV6A 5A2CA 1BQKA 4LIQE 2DQIH 4CC4A 4X5PA 3WENA 2IDSA 5JDJA 2ED8A 1KB5L 3HG3A 1LHZA 4JEGB 5CGBA 5ANMB 4APQD 1JZ4A 3R06A 5E51A 2X1QA 5K9QI 1MG2C 4MQTB 4NP9A 3HHSA 2E75C 3N91A 3P0YH 5E08L 3A6OA 5B38A 1QG3A 4Z7VB 3VRIA 2IPKB 3WOVA 4F5CA 4N6QA 1NLDL 3ULSB 4U2YA 1QSED 3BEWB 3MNVB 2F0CA 1GGUA 3FT3B 2AQ2A 3HZYB 3GJFB 4W9KC 5BV7H 1NUNB 2V8LA 3BH9B 4OF5A 4E68A 1Y18B 4YX2H 3TO4A 3ZL4L 1NFDE 3X1NA 4X8JB 4Y5YA 4MZRA 1NCIA 2P80A 5TGBA 2AJXL 2OS7A 3HTLX 4MAZA 4N4YB 5MEPB 4ALAC 2IBZY 3LKSA 1JTPA 1JJUA 3MJ8B 2NPLX 4O2FB 5FKAB 3HBGA 3T0VA 4F8QA 1KB5A 4OFYA 4TSAH 3Q43A 4JFQB 1BIIB 3UEQA 5FKPB 4XXCA 3P4MA 4ZXBC 5FPIA 5E5MA 2G60L 4GRLD 3WGVB 2W07A 2AQQA 2P8MB 5ABZA 2Z0UA 1EUUA 3OAZH 4WI0A 2EZ0D 4M1DH 3OKDB 3V0VB 4F58L 4L3EA 1A6PA 1TT6A 5IGXH 3DRTA 2CO4A 2XI9A 1KJMB 4WHCA 4PJ9A 1JPGA 1RJZB 5KZCB 5GGSB 1K4CB 2WXKA 5T5FH 1AG6A 3QNYB 5CKGA 4L4VA 1KIUB 3O8XA 3QI9C 4I0PB 2CK0H 3ULVL 4KRPC 1T7ZA 3CH1B 3FZUC 3VXRD 3W1ZA 1HOEA 3ZTEA 5IQOA 4CJ0A 1YQVH 4HUVA 4LHUB 3QDGB 3CSYB 5GRWA 2FVNA 4HV8B 3N40F 4ANVA 5D71H 1MWOA 4N8CH 1DFXA 2G5UA 4L8SB 5MEOA 5L2KB 4OCLC 1P6AB 1MHEB 3N2JA 4WI9A 1SNRA 3CIQA 4QY8B 3KWWB 1FYTA 3KYOA 3IMBA 3VFRA 4ZNCD 3X3FL 3BGMB 1HINH 4L29A 3DX9B 5IMLB 4Y1AE 3FQTB 3G9VA 2NYZA 4HETA 4WHYH 1ZGLB 1NBYA 2NT0A 3L5HA 4YXKH 4IYKA 1W6LA 3CPUA 1KYAA 3UBHA 2OP4L 3HE6C 1TEGA 3L95B 3RGVA 2WP3T 4QRPD 4F1SA 3TF4A 4ZW6A 1N67A 1RK1A 3EFFA 4LCUA 5EUOE 5FYJE 1NC4D 2NY0C 1M2VA 3WTXA 2ROYA 2O5ZH 2VWEC 4UIMB 3MR9A 1T5WB 3L4XA 1MFUA 1B88A 1I7UA 3OKOA 5GGQH 4UUJA 5JDSB 3MNWA 4I18B 4G9DA 2Z93B 3E8UL 1TQUA 3HRZA 4JFOA 4U1KB 3QUYA 5C6TH 5I1LA 2YEVB 2J1KA 4HJ1A 4FXGC 3MUGA 1YNLH 2AQRA 3OPZL 1P7KB 3FRPA 1BZ9A 2QEJA 2G5BA 3MCG1 3WFDH 4EQ3A 4PJ5E 1ZS8A 4NRZA 1KJVB 1NKGA 5DTFA 3CX2A 4YMPA 2BC4A 3BVWA 1CBJA 3G5XB 3MMEB 1A4BA 5DK3A 2YUXA 1B2WH 4XNBA 1J8RA 3QEHA 5LBVA 4ILDA 1TVDA 3WEBA 3LZPA 5BO1H 3VXMD 3GHEL 3W2DL 1NCTA 2YA1A 4TOYH 3GZKA 5D2LA 4PLNC 3MV9A 4FQJL 4JO1L 3VFPB 4WNJA 3A21A 1V05A 2PXYB 3HG0A 5FUOL 3IJHB 2JH2A 2GEQA 4NZTH 5AYTA 2CDEB 3LZQA 4BK8A 1R9FA 3CFMA 3ZMEA 1FZOB 2MH4A 1DQQA 4OIFA 5F7HA 4LCVA 1UA3A 1QR1A 3PWJB 1UENA 3QNXB 1WTLA 4U2ZA 2EDWA 1VPOH 5KSBF 4NJ9L 1DANT 2E0PA 2WWNA 3KYKL 4NPKA 2YFOA 5DRWB 2FR4B 4HIHB 1TPXC 1BGXH 1T7WA 2OMWB 3AWEA 4NCC2 2HPTA 2WUCH 3HG2A 5AUMA 4OLZH 1KB9K 5AB9A 1K6QL 4AEIH 1P7QD 2BDNH 2R2EA 3L08A 5GQBA 4DO5A 4XCEB 5ICZB 4PJIB 4Q8BA 5A16B 5K9KB 4K8RL 1FO0L 4XX1G 3W9DA 3QIBA 3KWTA 1RIHL 4TPRL 5K1JA 3DNKA 3NFSH 1UUNA 2AQNA 3HN8A 1NTDA 1T66D 3C08L 4J3UA 5SWQB 1QO3B 1WIPA 2AJ3A 3UAAA 5JW3L 4PV1C 3BKML 3C6LB 4ZDHA 4PLOB 2QLYA 4CC4C 1L7TH 3M17B 1YNKL 2Y06H 5T1DL 7FABL 2ZPKL 1O7VA 1SOQA 2IANB 4HSQA 4ZNEE 2VWEE 2VIRA 4DTGH 3KPPB 1CF8H 1N2RB 1T0NB 4BUGA 2ICWB 2VLMD 4K5OA 2J8UB 4N1HB 3FCBA 1NM9A 4JZOA 1IM9D 4X7CC 1IGFL 4I85A 4Y2DA 2ESVD 3BQUA 2KLRA 2VMJA 1TTRA 4U7MA 3HHMA 2D4DA 2QPEB 1B0RB 3DURB 4N0FA 1ZXQA 5J3HD 1Y6NR 1XEDA 2HN7A 4AYSA 4C56E 1CLVA 3MLZH 3LKNA 2P8LB 2F5AH 3KL3A 3KD4A 3T3PB 2NY1C 2ZQKA 4K73A 1ETZB 2IFFL 1MCDA 1WFJA 2WQSA 2IGTA 2G2PA 3IDMA 2HVBA 4DHLA 3BD4A 4XAWH 4Y5YC 3VRJA 3EO1B 3WEXB 3GSUB 4AWJC 1CI5A 4GUPB 5CS7A 4DKEL 4IIZA 1PZ5A 4P4KD 2GJ6B 5DJCA 3GRGA 1NGXA 2ZE0A 4I1PA 1RURL 5AAWA 5GHWL 2IDCA 4RISL 1I7RB 2MCG1 1B6DA 2WTRB 2BNRE 2DKUA 4PYHA 1YUKB 5LXGH 5EO9A 4XXCC 1JD9A 1IEAA 2X44D 1OB0A 3EOBA 3ZYJA 3FH8A 3OBAA 2J4WH 4AM0Q 2Y7SA 5F96L 5I15H 3TGXA 4AJWA 2Z31D 5CP7A 4N2GA 4YJZL 2WXNA 1BD2E 3GI8H 1Y7VA 2ZCHL 1E9PA 4Z7AA 4PJ9C 4JM4L 2WQRA 4DPCX 2P46B 5C0FB 5LDSA 2V8MA 1JXJA 1OE2A 2IH1A 4V1DE 3SDXA 4AL8C 3O8XC 3DGDA 1GZQA 4YBLB 1HCFX 4MJJA 4PW9A 4C56D 3PL6B 2VISA 1JNHB 2F54D 3CBKB 3AU0A 2X6UA 1EXGA 5IVOA 5IB2B 4Z1PA 1GOHA 4OLYH 3U30C 1A6ZB 2FT8A 5ICYA 3PFQA 1TZHB 3KR3L 3TPUA 3ZIYA 1C5DA 4Z7VF 4L37B 4A2GA 4B9KC 4P3DB 5DO2D 1LDSA 4ZW3A 1MRCL 4LSUL 1G7JB 3BPOC 5EZJB 5DJ6B 3V6BR 4NO3B 1IT9H 2R8SH 3Q8CA 3VFOB 3AXLA 1GGBL 1GGCH 1SXZA 1GW6A 2DQTH 5AALA 2MOQA 2VXSL 1K8IB 3X14A 5HVHC 2H6UA 1B4RA 3CZFB 3KPNB 1LO0L 2OKMA 2E86A 3GHBH 3MLTA 4IEFB 1MFEL 5JW5B 4XN8A 3EDDA 4LARH 5LHDA 4NUGH 2HX7A 4I3RH 5E5UB 1FFTB 2ENPA 2EYSA 4UQ2A 3ULVC 3UGXA 43CAB 3OAUH 2CK2A 4XMUA 1JF1A 3TIDA 3RGVC 1IV8A 1F3JA 4IOIB 4JPWL 4OQTL 4HGMA 4F5CE 2W5PA 2VM9A 5KBNC 4GO6B 4ZX3A 4QKXB 1NIBA 5SWZB 3C5SA 4OJDH 4PRBA 4X6BA 3RY6C 4FG6C 1ZHNB 4DUWA 1KV7A 1WV7T 3I6LD 1DYZA 4DQAA 2QVKA 2YGVA 5I8KL 3STLB 5J4MA 4BK5A 4H1LB 4MB5A 4ONHB 2BP3A 1HE7A 1SDAB 2Y4SA 5C7ZA 1O6VA 1M57B 4HIJB 3V4UL 2NSQA 3HRZC 1E42A 3QUYC 3AUWB 1X5IA 4H0LC 3SOTA 2XTLA 2YD9A 2JKIS 4YDIL 4Y0GA 1BYNA 2R56H 4M1CC 1GR7A 4P5RA 1MJUH 1LE9A 1ZWIB 5FF6A 1JCKA 1DN0A 1YHPA 4MJ2A 2HG5B 1Z3GH 3IBOA 2YPLB 3OX8B 2X87A 1EHLH 3ZLQC 3O4LD 3QS3A 5AZEL 1AZVA 3D39B 1J9QA 2B59B 3VRLF 4MQSB 3LD8C 4CNIB 1K2DA 4WLCA 4L3EE 1AYOA 3L7EA 4LLQA 1K72A 4O02H 5FHBH 2G5RA 2CIIB 5HJ3A 1JVKA 1YEDB 4Q2ZB 4IBSA 3U2SA 4R4NC 3QJQB 2FK9A 3BZFB 3ECWA 1MIEH 1GGTA 2GUOA 2LU7A 3NJXA 1EEZB 1I1AB 1NEPA 4YHML 2DH2A 2XKSA 3AABA 1RJLB 3MBWB 4L4TD 1A7QH 4MA8H 1DDHB 3VD5A 1OP3K 3FTGA 1H5BB 3FB5A 1RVFL 2O26U 2OA9A 1FFQA 2VDML 2FDBP 3CVIH 3MNZA 1IC5H 5CCGE 1A4KA 1A7RH 3B9AA 3DECA 3KCPB 3VMOA 1JZ8A 5FW6A 5EU6A 3BWUC 1FYTE 2FH8A 3CFDA 3KYAA 1IGML 4JUSA 3KPSA 5EOQL 4YXHH 1YJDC 5E2WH 3K74B 4XO5A 5FX3A 5KW9L 1Y6KR 5C0ND 3WV0A 5T1MB 3C8KA 4KKCC 3BD5A 3QIBC 3NJLA 4OIAA 3SCMD 5JHAA 4PJBB 2OTPA 4W70A 3SJVE 1CG9A 1QEXA 1XH1A 1AR2A 2HH0L 4K5LA 3V6OC 2YIHA 4JB9H 3IDGB 4P5TB 1A7PL 3RVUC 4X4XB 1G9NL 3VX0A 3GI9L 3SOBH 3IN2A 4R4FL 2OSYA 4N6RB 1JHTA 1OGAA 5DD1L 1JPTL 2AJYH 2NCEA 1E2VA 2X40A 1WK0A 4F80A 1R3JB 1KB9J 2YD2A 4KTDH 4PBDA 2IVFC 3KGUA 1BP3B 4HSCX 4Y2DC 1HCZA 1VGEL 3BQUC 3HZVB 2D3NA 3NVQA 2OL3L 5AW1B 3ZKQD 4D7BA 3IT8D 1T80A 2B39A 4BYHA 3FO9B 5ENWB 4FEMA 4K8RC 3KL5A 2KZ1B 2SEBB 4XP1L 3A67H 1GMEA 4P5MB 2C3VB 2ED6A 4NQUA 1VGKA 3P69A 2IC2A 3WL9A 2DWSA 1A4JB 3GJFK 2W0LA 3DO7B 5ITBH 2ICCA 3KE0A 1EMTL 1CDJA 5AAWC 4D9QD 5D2LE 3QDMB 3MV9E 2BZDA 2EYTA 3ENEA 2KI6A 4EF3A 3BLKA 1D5XB 3MGOA 3HG1D 1YEEL 5BZWB 1REIA 3L3OB 2JK5A 4ENED 3OHXA 3BZ4B 1MWAB 2Q86B 4Z0XA 4YZWA 1SYSB 3KHQA 3TTSA 4X5XB 3WXVH 4NP4L 1YNTB 2XG5A 1JHKH 3HPJA 5D5MB 5AZUA 3VXOB 5GGTL 2XKUA 2VB5A 3QIWB 4XCFL 2KT6A 2EUWA 3W11D 4IRZH 4OV5B 3MFFB 1H19A 4DGYH 2R7EB 2NNAB 4AK1A 3D06A 1MDAA 5JXED 1GGYA 2AJUL 2EXYD 3D25A 1J1XH 1EVUA 3QJHA 2J8UF 2M2DA 4WWKD 4Q9CA 1RHHB 3TEZA 3BLBA 5BOZG 3WKML 4Z7NE 3MNDA 1KEMH 3GB7B 4HJIA 3QXTA 3DIVA 2CRYA 4M7LT 4NWTL 4NYLB 3U1SL 1FA4A 1VIWA 3NFNB 5HHXL 5T3XD 3SDAD 4F8OA 4QRRB 2IG2L 3T3PF 3FHEA 1NC2B 3EG9B 1E67A 3EF7A 3GSXA 3K5SA 3P3UA 4NRYA 4QTHA 4U1GB 5K5YA 3T6QC 4IBTA 5I71C 4ES9A 1A3LH 3QCVL 4CSTA 2WZ0A 2KZBA 3PHQB 4KZ0A 5J57B 4EI6B 1J5OL 3IB4A 2XIIA 3KLKA 2ARJB 1ZXKA 5I1HL 3ARFB 2VMCA 4PJXA 3MLSH 5DFVC 5D7LE 3LEXB 3AJ7A 4M3HA 4QJ4B 3TIEA 5AYUH 2ENSA 2CIKA 1G6VK 3EJZC 1QP1A 1NGYA 3U9UA 5MEND 2ZUTA 3CVHB 1AXSA 5HHQB 1F86A 4OUUB 3H2QA 2ID5A 2HLFD 2P7TB 3B1UA 4H8UA 8CGTA 4S2SB 4UT9A 4Z95L 1WBZA 1RZKH 3QFJE 4OLUH 4BK5C 4OD1H 3WUWG 4GKLA 4KNQA 4FP8H 3WFCH 5DJ8B 3UTTD 2VXUH 3LQMA 4DGWC 1U92B 1AIZA 3MRHA 1XX9C 2VJXA 5BZZA 1P1VA 2Q8BL 2CKNA 1EWHA 5I1DA 4YHIA 1T1YA 4LCIL 5INDB 4M62L 3GSVA 1QFWM 4D9LH 2JI1A 1PYWA 1EZVY 3C6SB 3G9AB 3UCRA 1TQVA 5CXPA 5DHXB 1A6WL 4I3SH 4AXWB 2IALA 5C0AD 1XHHA 3MACH 1RZQA 2UWEE 3GBEA 4OGXH 1CD9B 3RVTC 3LKRA 1JYXA 2FWOA 4B9ZA 2LFEA 3ZE0B 4JAMA 5K69A 4HOMA 1ORQB 3QH3A 4YL4A 5HGHA 2AV7B 1DVFD 1UCTA 4M48H 5PCYA 1A8JH 3SDXE 3AY4A 2BSBA 4DWHA 2G9HA 3PNRB 3IPFA 1Q9OA 3LAFA 4KGJA 2YWZA 3BC9A 4OGAD 2GK0A 4MQXC 1WFMA 4NN7C 4OZGB 2C3GA 3R7QA 1DJXA 3Q01A 4JDEB 3GXMA 3X11A 1ZA3A 2CHXA 1RMFL 3QCUH 5FUCE 1ONQB 3TYGL 2WBWB 5ACZB 1IC4H 2O4EA 5CSGA 4KK6D 5TDNA 2JJSA 1FNFA 3EJUA 1SY6H 5HYQA 5KJ7E 3BKYL 3P3YA 4J3OF 4J4PD 2NLJB 4NHCL 2GBUA 1NKRA 4F8NA 5C71A 2WPGA 5F9JB 1KGUA 4J3BA 4F24A 2CLRB 3QWRD 5A2LH 1KNOB 4F33A 1SMOA 2D7OA 4DPAX 3JWDH 5FW7A 4JO4L 1HXKA 4MXVE 2EXWD 4WGKA 5C0BB 2OYPA 3T4AB 1XF4A 4XPTH 3NCJL 4QRUA 3G6JA 1G9MH 5KVEH 5DEGB 3DMMD 4GW4A 1IMHC 3M45A 1JZJA 3RPIA 4DEPB 5J11C 1IM3B 1JXDA 4R8WH 2F6AA 2YAHA 2YKLH 1QUNA 1J0ZA 2WCSA 3CZJA 3L3HA 2VLKB 4N8VG 5GIRB 2X6VA 5CMAB 2WOBA 2FWSA 4NNYA 3UJIH 3UTPD 1CFBA 3B9KA 3VWKA 4QOKD 3NCEB 1KCUL 2YEZB 1TFHA 1U8JA 4RGND 1A21A 1A6UH 3OJMB 4K5MA 1T22B 1IFHL 1X4YA 4PB0H 4I5BB 5HI4C 4LF3B 2CBOA 5EORL 4X6EB 3FQRA 4OW6A 3NT0A 3PV6B 3L4CA 4XH2B 2EACA 3AG1B 5T1KA 1D9KD 3C5ZC 4JANA 1RU9L 2EDQA 4LPUA 1DQVA 1R1CA 1NEZG 3B34A 1S5HB 2DLEA 1NUFA 2R2CA 4N1CA 1G9NC 5H94B 5DEFB 2R0LL 4PJGB 4XX1E 3QUXD 4IBYA 4WK2B 4M5YL 4KROC 1QA9B 4LEOA 5EA0H 4X6FA 1NCBH 1WZAA 3TBWA 1MUJA 4NS0A 4C58B 1CGXA 3ABZA 2EEDA 2QR0B 4PJDA 4B9YA 5TK4A 3QG6B 1I9JL 2I7OA 3W3BA 4I77H 5KBDA 3D8MA 2OMYB 1TEYA 3J8F7 5A2FA 1SJHA 2W65B 3OHXC 3OLEA 2JB5L 5GS0D 4NEHB 4PJBF 4XOCA 4AGLA 3LN4A 4HK0A 3WS6A 1BLNB 4RVBA 2C8NA 1VDGA 4WNQA 4JW3A 4G72B 2E7HA 5JNYA 2NRDA 4Y19D 3N44B 1N26A 5EU6E 5IJVA 4M9PA 1JV5B 3KPSE 3LDBC 1T5XA 2DDQL 3GBLA 1U8NB 4NHUB 3V7AG 3BWSA 3F8UB 2HMIC 4Y4HA 2P5EA 4EN3A 1WWCA 2YK1H 2RIKA 3BUBA 3L4YA 3NQIA 3TBYA 4HPOH 3TTYA 1L9NA 3L9RA 2F61A 3OKEA 4ZUVA 2VDNH 2NXYC 1B3JA 3MV01 3MLYL 1FG2B 4ZMXA 5EU7C 5DHEA 3WUWA 3EFDH 1KCSH 3IGAA 4YEEA 3WMQA 2FT6A 5B7FA 1N0LB 1S9XB 2AK4D 2EILB 3HMWH 5FYJU 3T65B 2J5WA 4L18A 4BA0A 2AEOA 5LCVH 2BINA 2QADC 4BD4A 7PCYA 4HWZB 1OGAE 1MDTA 4XPHH 3I74A 1HS6A 4RLDA 2Z6FA 1JS4A 3APNA 5EBWA 2WAHA 1YMME 4MD4A 1QFOA 1OK8A 2K6ZA 5CU9A 1II4E 1BZ8A 1PG7W 2XZQL 4UT7L 4KJPD 1MCJA 1JWMA 5DJ2A 1CWVA 3L4WA 4FFWC 4ZPTA 5ETUB 2R69L 1O9ZA 1HT6A 3MUY1 1Z32X 4FTVA 1FZKA 4RMSA 1T7XA 1N8ZA 1HH9A 2Y5TA 4NZDA 1EEYA 1LD9B 3OXSB 3GEFA 4NFDA 4PJ8A 3MBXH 4MQ7B 2CALA 3LQZA 3BKJH 1M05B 4GAGL 4K9EL 5E8NA 3N5AA 4XNAA 1NCCH 4UQ9A 3DXAB 5JHDB 3TZVB 1YNTF 2Z7ZA 4JVUA 4KJQD 3CPLA 4JN2B 5D5MF 3BVTA 2G2RA 5DRZA 2VAJA 3RDJA 4AJ0A 4XCNB 3S35X 2XOTA 3D4CA 5C8JA 2LVEA 4U33A 4X7TB 3ZIMA 4MVBC 1BJMA 4ZS7L 4AG4H 4R97C 4BCZA 3GSNB 4PCKA 3OAYK 3VI3B 4MNHA 2Y36L 1KN4H 4Y1SA 1NLBL 2AJVH 3IMSA 2PW1B 2WIIA 1L0XA 2X3BA 3IDIA 3US9A 5C3IA 5I1AA 1MCOL 4X5QA 3FUFA 4NQTA 4GNKB 2OBGA 3IF1A 4G6KL 4KI1A 3T6ZA 1IGTA 4PRPB 3SDCD 1MCBA 4WZ9A 1UWEL 1CJYA 5EZOH 4HF5H 5IY5B 3IDNA 3UZVB 4H2CA 3AY4C 2E8YA 4KXZH 1OAZH 1HHGA 5F9DC 4K3EH 2X4TB 1N5AA 1AY1H 1XXDC 4KWUA 2Y2YA 1G0XA 1A25A 5DK2B 1ND0B 1WC7B 2YC1A 4ZJ9A 5EBMB 2FJUB 4JPQA 5E9DD 4PP2B 4DN4H 1Q72H 2XQBL 3IDUA 2NZ1A 5FOBA 5FCUH 4EZJA 5K59E 3TEUA 2XACC 3SGJC 5EU7E 5LQBH 4N8VA 2BX5A 4KMQA 4R90L 2Y24A 4HKXA 2JJSC 1KYOK 2PCXA 1KJ2A 1XB8A 4N0YL 1D5BA 4EUPB 3GMMB 4PGEA 1CD1B 5TDPA 5IW3A 3UAJD 4KY1L 4B97A 1F1GA 4M93C 3JV6B 2Q87A 2VZVA 4YK4C 4R5TA 4HPYH 3OLIA 1NZRA 2VLJB 4PJXE 4NZUH 3OV6A 5IHHA 4U1NB 5F1IA 5GRUH 2DH3A 4NZRH 1X5XA 2BOCA 2HTLC 2ZXWB 3MRIA 3FFCB 4JFFB 4K9JA 4NDMB 1I1CA 3H0TB 3IWUA 1X44A 4GG8B 1HNFA 1NEZA 8PAZA 4G42A 4LRNL 2VUKA 3TVMB 5A6MA 1EAQA 1HYSC 5JORB 1UWYA 3LKQA 4QHNA 1A7NL 5ERWA 2L7EA 4LNRB 3F12B 1JGDB 2SODB 1INQA 2A6DA 4NI6A 1XD1A 1SOKA 1JSYA 2DTML 3L3IA 4Y4KD 3TNNB 3ZE0F 5CCJA 4DKFH 1BF8A 4AKPA 3K8LA 5HI5D 3U9PL 3WG7B 1WJ3A 3B9KC 3VWKC 4P0DA 2EIJB 3QEQA 4JRXB 4FXTA 5F0MB 3O2WH 2YD8A 3FUHA 1IAKB 1NCUA 1ZEAL 2ATAA 1UADC 3QXAB 2PPEA 1E43A 3RNKB 5D7KD 4H0HB 4TLTA 4WO0A 3VXPA 4OSUH 1B0GB 1QLEH 1MW1A 1KLGB 3GS7A 3L54A 3GUTA 4XXDA 4KU1A 2OK0L 4OZGF 2X2UA 3BFOA 5JLZB 2XPZA 4G59C 3MFGB 4G2AA 4KUZL 1BAWA 4Z78B 5FDWB 2V2XA 3ZE2E 4IBUA 4R4BA 2FEEI 5GZNA 4PSRA 5I26A 1CTMA 2GBAA 1SJEB 3ZMRA 3NBNA 1WUNT 4NQDD 5KANG 4I4WB 3D2UA 2NXZB 1HAUA 2JB6A 4BDVA 4ZUSA 3FU8A 1UB6B 1XBDA 3CVCA 1JV2A 1E4WL 1KZYA 1WD9A 4U1HB 2YA0A 2OTUA 2PCFB 1SYVB 2BCKA 5I6OA 1XB6A 3RWDA 4IOFC 1GRWA 2ZX7A 3FHQA 2ERJB 3RAJL 4AQAA 1H6FA 3RL1A 3DUHA 4M6ML 1FZMB 3CN4A 3HE7A 4XPFH 5F3HB 4CMHB 1ZHLB 1RUAL 1UJ3B 3CWGA 3F64A 3P73A 4HKJA 4D9RD 5C70A 1Q0XH 1F6LL 4E36A 1WEJL 2ICEB 3LZNA 3MLRL 4IU3B 4LSVL 4WEBH 3TOPA 2ORBH 4G70B 3WHXA 3FT2A 3OXRA 3LRGA 2GIYA 1VEOA 4LLWB 3S3CB 2H7WA 1Q1JL 4RAVB 4EN3C 2H26A 1PKQA 3AXHA 1EHXA 1ZSDB 3ESOA 2AERT 3ZKND 5LBSA 3G6JE 3JT0A 1N64H 4AGQA 1I1FA 2AI0L 1TYEB 2E9BA 4IDLA 2Z1KA 5DD6B 4YNYA 3CX5K 5MEQB 4WFHD 3MRKA 4IRJA 1WFIA 5F88A 1FLRH 1A1MB 2JJWA 3S3JA 5DHDA 1MFMA 5CN2A 4R26L 3EHBB 3VSTA 1T20A 2HFFA 1PY0A 4LSRH 4XRCB 5E8DL 2NY6C 2G4GA 5IB5A 3QXUA 4RFOH 2VDLL 3JUYA 5FOJA 3MA7B 35C8L 4APQA 5IMKA 3TURA 2DD8L 3SO3B 5SX5K 3WIFB 1DSWA 1GYUA 3JWOH 1I8IB 4HHAA 4OFVA 4ZMAT 1GL4B 3LQAH 3X12B 3GMLA 4PJ8C 4ZSOB 1S7SB 3UC0L 2HJKB 3LPPA 1YAIA 2H3NA 1I9EA 4H8QA 1IC1A 1K8DB 3BP4B 4G8FA 1FWXA 2CXGA 4JZNB 4Z77A 1J11A 3TT3L 1AGBB 1F8TL 2PR4H 2E9JA 5H37H 1U93A 2O5XH 5BUGA 3PQYD 4Q74A 3KXFA 5LXVA 4A6YA 3N44F 4X99A 1ZMYA 5IB3B 4LP8A 5HDRA 2JJUA 3F58L 2AXGA 5H4YA 4PLJC 3FW6A 3STZB 4N0RA 1T1ZA 1G6RA 4HJGA 1BMGA 5C07A 3E6FB 4PJDE 1YYLH 1GGIH 2VXTH 2G3MA 5AKTA 2EDXA 1ACYL 3TBSB 3W9EB 2G2NA 3T3MB 4PV8A 4CSSA 3ULUF 4WO4B 2ZYHA 1FBIL 2BVQB 4PTTA 2XBZA 1R17A 4GRLA 3NPZB 1EIBA 1KGCD 3ELQA 5T3ZH 4K4KA 3GIZL 5LNEA 2Y07H 2ZXGA 4K9EC 3DJTA 4GQ9H 1WWAX 1BVOA 4OGQC 4M7JL 3VJ6B 4UCFA 4MDIA 1YEFH 1EANA 3S5LG 4ATWA 1CQKA 1VFAA 4DOHB 2BXZA 3AREB 1FNEA 5J8OA 3VW3L 2AEWA 1K4DB 2WHVA 5SV4A 3L6FB 1V3KA 4KKAC 1U58B 3VXRA 2DQUH 3F5WA 1GS8A 2VAAA 3Q1EA 1B4JH 1DQMH 1WQVT 3FUMA 4KTYA 3HAEH 2EIZA 4PRIB 4Q6IB 2YAEA 4YSDA 1DQKA 3C75A 4YHLH 1QNZH 1A6VL 3MRRB 4GT7A 2Z8SA 2IIJA 2B2XH 1S7WB 4OZIA 4HWBH 3EBIA 3LMJL 4OF8A 5HGAB 1BOGA 2XZZA 3UG3A 2G3ZA 1XZ0B 2P5WB 1SN5A 3KPRA 4KO7A 2VZ3A 4NO2B 4E9YA 2UXTA 4GRWB 2XA3A 3GNML 1R5VB 1Z9NA 3D5OF 4AIZB 2LHAA 4EOWL 5HPMB 2FECI 3ROLB 4NNXB 1C1EH 2XT1B 3K7UA 4GIPD 4ZFOB 1WIUA 2CJTA 3EGDB 2E46A 4MA3A 1ADQH 4XC1H 5JQ6L 1HEZB 4Y8DC 4FTVE 4YHNA 3O6FA 3MXVL 4JZJA 2A4CA 1MAML 3Q2LA 3TJEL 4X6DB 4YXLH 3B6SA 1IL1A 2V5TA 4AYEC 4C59B 1A5FL 3VXTA 1KYOJ 1QFUL 2MKWA 4MDJB 2QHLA 5D72L 4WV1B 1QWUA 3VWJB 5FYLL 3RWEA 1AACA 2WXPA 4HUUB 5FB8B 2XPGA 3ARGB 3MRBA 1Q94A 3C6EA 2M8XA 4YL9A 1HSAA 1JRHI 2Y25A 4XPAH 3VACA 3GRWL 4LLMA 4NZ8A 5IOPA 3O9WB 2XZCL 1PD1A 4PR5B 1CC3A 3NA4A 5CGYD 1E4HA 3EOAB 2QDVA 4JDZA 1AR1C 4KKQA 4KI5D 2VSKB 2WQ8A 4L1TA 1F4YL 2ZKWA 5DC2A 5EC1B 1WZMA 4JM2A 2B0SH 4U1SB 4G8GE 5GZNC 3SDYH 1XVSA 2C3WA 3H9YA 1X7QB 2X4OA 4NUQA 4HS8L 4TUOB 3F85A 3WN5B 1HVXA 5FGRA 4AEHH 2V7HB 5FGCE 2I32A 3VXMA 1ZHBB 4A68A 4UU9B 1AOHA 2BRRL 4HH9B 5IFAL 2A6KB 4FQ1L 1HILB 5E6UB 1A2YA 2HVJA 4ADIA 4IU2B 1TZIB 3EIFA 4HCRH 3GRWA 1BVLA 2WIMA 5CR8A 2CLVA 5K9JL 2AABL 4XVTL 1S7QB 3ESMA 3ULAB 3LXCA 1G7QA 2WNWA 4XPBL 2VRKA 3HE7C 4YSAA 3V10A 2OPCA 3TWCL 5D7EA 1ZDSA 1LQBC 2I9TB 2PUQT 2XNAA 4HS6B 4M03A 5KJ4A 2UY6B 3CFQA 3RA7L 4P2QB 2XC8A 3BD3A 3WNLA 4G6ML 4Z3EA 5FR3A 4MB3A 4BSVA 3BRGC 1T21A 2GTWA 3S88H 4MRCA 3T5WA 1N12A 4JREB 1P1ZB 1LK3H 3QQNA 5D6DA 1S9YA 2OMTB 5AVXB 3WLBB 5E56A 5JR1L 2CDGA 2C1PB 3RBSA 2L04A 3ALXA 1CL7L 3I9PA 1NGPH 4U3XA 4LHUG 4EIUA 4FNSA 3E2HB 4N90E 2FZ3B 2CKBH 4LSSH 4HHGA 2FHFA 3IN0A 4JJOA 4XZUA 3RPBA 5DURB 3O3EA 3F7VA 5K33A 5FC9A 3UZQB 3C2AL 3SN6N 4JO3L 2C1OA 2VM3A 3ILPB 4OCRH 1UD6A 5EZIH 5KTEH 1ZT1A 2QV4A 3JV0A 4XNMA 1JIBA 1UB5B 4LU5H 3WYRA 2WCGA 1H0DA 4O51B 4APQC 1XCTB 1JK8A 2A6JA 3C09C 4OI8A 3T6XA 1IM9A 3ZZQA 3X2QB 4M6OH 2LV4A 2ESVA 1OAXL 2DQDH 4HZLB 2MNUA 1YECH 3EH3B 3HB3C 2R59A 3BW9B 4V11A 4FMFA 1LEKA 3U83A 4PN6A 4KZEH 4YGVA 5CD5D 3X13A 3PPSA 3VD4A 3RLSA 3V7AE 1WICA 4WU5B 1HEJC 1DBJH 3GXNA 4WKZB 1KBBA 3UXFA 3TO2B 4RMBA 3F6JA 4M3JA 1S5IL 5FYKL 4A7SA 7CGTA 2ODIA 2K4WA 3GS0A 4P4KA 4UAHA 1T0OA 5F89A 3EOTH 4ACTA 1X7SA 2MNWA 1XTLA 4XMLL 1I9IH 4JMXA 3ZRSA 3FT0A 1PG7H 5E8OB 3B7SA 2OSXA 3PAYA 3QE5A 1Q1PA 2BP5M 4P4RB 3U0PB 3AU1B 3MV8A 4GRLC 1U8KB 2JXMA 2PYFA 3V79C 2OV0A 3C12A 3DUUA 3FQXA 3J27A 1JYVA 4PRDA 4PVLA 2Z31A 2N3JA 5IR1A 2ADGA 2WXMA 3BX7C 3QISA 4XN4A 3V4VL 4I48A 5DT1L 4CN6A 4HC1L 2VR9A 5DD5L 1N3NB 3GMRB 3I3EA 4YIQA 2V33A 4BZ2H 1HDMB 4JHUA 1JYNA 4JLRA 1TKWB 1JG9A 1O6SA 2IH3A 1ZT7A 3RWIB 1X4XA 2FJHB 1OZUA 4HLZG 4C56A 1K3ZA 1PKQE 4R2GD 1E8YA 2F54A 2APFA 4PTUB 3T04D 3T0BA 2FX7H 1N6UA 3M7OA 5DZ9A 3RU8H 5B7EA 1WCBA 1N18A 2FD6H 3DO4A 3QA3B 4OCWL 1DL7H 4D3CH 4XE5B 1PZCA 1U3JA 2H1PH 1CT8B 1L9QA 2ITCA 4WVRA 3CSTA 4G5AA 5BXFB 2OX5B 3IBEA 4L3AA 1YC7A 2ZF9A 3CK0H 5IK3A 2ICES 4C4KO 4ELDA 2PWHA 3V4VA 1N4XL 3G5YB 1SDDA 1AC0A 1FL6B 3O4OB 5JZ7C 1B4TA 2RALA 4RESB 3K71B 4HW6A 1I7ZA 2IPKA 2FL5B 1L4IA 3I02A 4NKDB 2F8XC 2NY3B 1ZIAA 3ULSA 1DUYA 3LNIA 1AO7A 1DQJB 3O6FC 4JZJC 4GBXB 4K07A 3HNTH 4WHTA 4U4BA 3Q8FA 4XBPB 4UBDD 3T3MF 1JZIA 2