2J21A

Human p53 core domain mutant m133l-v203a-n239y-n268d-r282w
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
193
structure length
188
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDWRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Understanding Oncogenic P53 Mutations and Designing Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords CELLULAR TUMOR ANTIGEN P53
total genus 43
structure length 188
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j21A00
4IJTA 3WTYA 5LGYA 1UOLA 3WTTA 1YCSA 3VD0A 2XWCA 4A63A 3WU1A 2J21A 1HU8A 2PCXA 3D08A 5AOLA 2IOIA 5AOMA 1T4WA 2YBGA 4IBTA 2XWRA 5G4OA 3WTVA 5AB9A 2J6WA 5A7BA 4HJEA 3WTUA 1IO4C 3D09A 4LOEA 4L0YA 1EAQA 2WGXA 2X0VA 2J20A 3D0AA 5AOKA 3EXJA 4MZIA 2MEJB 3D07A 3IGKA 1GZHA 1EAOA 3IGLA 4IBUA 3WTWA 2J1XA 4KVPA 1TUPA 5G4MA 2J1ZA 4LO9A 1GZHC 2BIPA 1HJCA 2H1LM 2RMNA 3ZMEA 5AOIA 1EANA 5BUAA 3EXLA 4LOFA 3KZ8A 2ADYA 1CO1A 1CMOA 3WTSA 2X0WA 5KBDA 4GUOA 5ECGA 2BIQA 2FEJA 2AHIA 3D06A 5ABAA 4IBYA 4IBSA 2J1YA 1HJBC 3KMDA 2ATAA 3QYMA 1LJMA 2BINA 2VUKA 4G82A 2IOMA 3US0A 2J1WA 4IBQA 4AGQA 4MZRA 3QYNA 3D05A 3VD1A 4GUQA 5AOJA 2IOOA 1KZYA 2OCJA 3Q06A 5LAPA 3Q05A 2AC0A 4XR8C 2BIMA 4L0ZA 3VD2A 4QO1B 4AGLA 3US1A 1H9DA 4IBZA 2X0UA 3WTXA 4AGPA 3Q01A 4IBVA 1E50A 5G4NA 3TS8A 2GEQA 4G83A 4AGMA 2P52A 4AGOA 4AGNA 4L18A 4IBWA 1TSRA 2BIOA
chains in the Genus database with same CATH superfamily
4XB7A 3CN2A 4Z0XB 3CG8A 4MS6A 2GY5A 2YBRB 1WIUA 3VRLF 4LCUB 1V5JA 2P7TA 1IM9A 4CVXA 1MCPL 1PZCA 2BHFA 3WMPA 4TQ8A 2CR0A 1EQWA 1UUNA 1KYFA 2BOCA 4WUUA 4ZNEA 1BGXL 4YHLL 5D5MB 2ADIA 3IDIA 2OTWA 2EZ0D 3DV4B 4YHZH 5BRQA 4E42A 1KDJA 2F74A 3U9WA 1HHJA 4JAMB 3WO4C 1AD0A 7TAAA 3KVQA 3ESOA 4WY7H 1QFWM 4L23A 4PB9H 4XCYB 4XGZA 4LNRA 5FO9A 3VXPB 3AY4A 4B9GA 2DQUH 5A6IA 1W72B 1Z0NA 1DQQA 1DVXA 4BH7B 1FE8H 2GQHA 1CS6A 1MVUB 3DPBA 4PGBB 1M2VA 4K7FB 5FYKD 1FF5A 5AYQA 3L7EA 4A66A 2CLVB 4UOZA 4LLMA 1KYUA 4P2RD 1OF0A 2WSDA 5DGQA 5IQMA 3K5RA 1FZOA 5CSGA 1R47A 3GO1H 4I18C 3CBRA 1T89A 1HH9B 4OZFG 1C5CH 4JGMA 1MCPH 4LO9A 3MFGB 4YDLC 4QHNA 3V9CA 3O2WH 1MWOA 5AFAA 5KSAC 4K8RH 5JHDA 2HXAA 1Q8MA 2OV0A 2Q7YA 1KENL 3GDCA 4NQXA 4AMXA 4LVNC 5TF1L 3VG0L 1J8RA 2G60L 4FHJA 1N5YL 2AI0H 1VF5C 1NC4D 4JHVA 4MD0B 2WMPB 2VLKE 2MKWA 3DMMB 5KJ7E 5DHXB 3L3HB 3QC5X 3K4DA 3BWAA 4H8HA 4RIRA 3VNZA 1S9VA 3TYGH 5HBBA 1QW9A 2R2BA 2ZUSA 2FEJA 1URIA 4LDOB 4W6WB 5DD0H 1F4WH 4PJFA 3CSBA 4JY5H 2YD5A 3ARVA 3VO0A 3ARZA 5I6XC 2VR3A 1BVLA 3C08H 4FXKC 3V7AE 1CXLA 1U3HB 2IDQA 1LL1A 1QWHA 1YECH 2EKSA 5C07D 5EIIA 3EYQD 1N59A 4AQ1A 1JK9B 2ZG2A 4MDIA 2XKUA 1MREH 1X6NA 2YRZA 3NN8A 3GSNL 1KJ2A 3IDGA 1T4KA 3TV3H 1PZ5A 3STLA 5GRYA 1HH6B 4Y5VB 2GB2A 5E4IA 4Y16C 3DTUB 2PWHA 5F6IC 3DVGB 4NSKA 2EO9A 4XR8C 4D0CA 4YHIA 1CCZA 4NM4H 3W9EA 3Q0HA 4PJXB 5C0AD 1AP2A 1ZJAA 2NSQA 4ELMB 2HN7B 1MNUH 3EFOB 3C6SA 4XZ4A 4BFOA 2O6PA 3KWWA 5HDQH 4Z7NE 3DHPA 1ID5I 1KC5L 2E9BA 2Z8VC 2WTRA 3ZLQC 4BK8A 4CBPA 2DQGH 5BW7C 1ETZB 2FX9H 4S1DD 2X4OA 2VISA 3PAZA 3IDUA 4FA7B 3FO1A 1X7QA 4BKLB 2WLIB 1XGQB 3Q13A 1CR9L 1CFVH 5D2NB 1FCCA 3LX9A 1AO7A 4ZRGA 2OMTA 5IMKB 4NQEE 1JDAA 4ELMF 1OGAA 1RU9L 1XSOA 1ZLSL 2G5BA 2A1WL 2G4GA 3QGVA 1G0XA 4ZFFB 2BWQA 2YBGA 5EV7A 5DJYB 1UVQB 2Z31B 3OQ3B 4DKAA 1BBDH 4M7LT 2OBGA 5ANME 3OGCB 4QRTB 3MLSL 4NBZB 1B90A 1D3CA 1JK9A 1S3RA 4MDIB 2UZXB 2BFVH 3WKPA 2W0FA 4HH9A 5DRNA 3TBVB 5AD0B 2ZXQA 3K2KA 1DQJA 2G5RA 3S5LA 4P23B 2X0VA 4J3OH 3NMEA 4E41B 3ABLB 3BP4B 2B3RA 2WZAA 3GDBA 3HNSH 5D4HA 5LGHL 4Q9BA 3RAJL 2ICEC 2XQYG 1GY1A 3CSYA 3X3GL 4C4UA 3VI3F 3C5SB 1PAZA 1MEXL 2NCMA 3US9A 5FEBA 5HGHA 4X0KB 4MVBD 5DJDA 3IKCA 1D5RA 1MFCL 2KYIA 3RE0A 3SGEH 5IW1A 1HYRC 3BSZA 2VLLA 4MXVF 4NX0A 2F1BA 3AXLA 4U2YA 4XXCC 4UTBA 2YMOA 1A7OL 2RMNA 3LB6D 3OLIA 4KY1L 3TJHD 5HYQB 4OJYA 1VCBC 1JZJA 1KELL 1MLBB 4OLZL 2P24A 3VXSD 2ICWB 1ZTXE 4P4KA 3BT0A 3UO1H 2R8SL 5EEYA 1IVTA 2HT2D 3DX9B 1DE4A 2Z3FA 1TTGA 1FFOA 4DGVH 4FLHA 3L4ZA 4NS0A 4NFBA 5IJBC 4R7LA 5DD6B 3RJOA 3QK0A 3QG7L 3VG9B 4M93C 4D0BB 3PJNA 2C3VA 2O5XH 4FULA 3LAFA 1U92A 1AVAA 3GS4A 1A1NB 2BERA 5F1IA 1RZJH 3QIUA 2EYTA 5ALCH 4AY0A 1RP8A 5LG6A 3ISRA 4YSDA 4FS0A 2E4FA 3MXWL 4KPHH 4MNGB 4NQEA 1ETZA 7CGTA 2EIZA 1WHOA 2QQKH 3QZWG 5AKVA 3ARGC 3OR6A 5HJBA 4AQ8A 1B9ZA 2Q86A 5DTFA 4FNPA 1T3FB 3N3EA 3C5JB 4KKCD 4KQ3H 1DCEA 3RU8H 1ZT1A 2GHZA 4ZFQA 1YDPB 2Z8WC 4F5CA 4IRJC 3ZL4L 4F91B 4JFPA 2MOQA 4XNDA 4G83A 4HA1A 4KJYB 4M1DL 4L18A 1WFTA 4EUPH 4IJTA 4DPRA 3HZYB 3D4CA 4Z95L 4GFTB 1OSPH 2PPCA 4L9LA 5GGTL 2BY1A 2EXWD 5B22A 3IGFA 4BFKA 4ORGA 4P4KC 4DEPC 4AMKH 3WJLA 3JVGA 1A6VH 4KI5F 4QRPA 1Y07A 3NIDF 3OVUB 2WLLB 5E4EC 2DEWX 1L5GB 5M94B 3NK3A 5GISH 5I1GL 4C4KT 1E40A 3OX8B 4ZAKC 1WT5C 2WXPA 1UM6H 3H42L 5DC2A 1TYRA 4PTUB 4NN7B 3HHRB 4IJ3B 3ZYJA 2DLGA 3N1QC 4UZGA 1RZIA 4WO0A 1I7ZA 3QEHB 2IBZX 2X2YA 3OM3B 4XPBL 2XG4B 4C47A 1IJNA 1PZ3A 4KY2A 4L4JA 4U3CA 5GSVB 1UWEL 2NLJB 1IKFL 1CZ8H 4XCCL 2D9CA 4FTVB 4WI5A 3LMJH 5AW7B 4BYHA 3EJZD 4ZI8A 4G9FE 1S7RA 4WU5A 3ZTJH 1FPTH 3VB8A 1YYML 4TSAH 4F7CB 5B21A 5LQBH 5E0QA 3EAKA 1NL0H 3EFFA 1U8KA 5C0JB 1TG8A 1K4DB 4DF9A 1O9WA 2DAVA 3J2PA 3SKJL 3EG9B 5TDPB 2X53A 4OI7A 5E9DA 2EVJA 1SJXA 2JB6A 3OPUA 3FXIC 1YY9D 4N8VG 3GRGA 5DQDH 5T3XH 4XOAA 2A6DA 1LNUA 1QZNA 5D5ME 1PLAA 1WVZA 3PL6C 5FA4B 1X5MA 5DXWA 5ABAA 4F93B 2YUZA 4KMTH 1DJXA 1IZKA 3CFIC 3BVXA 1RFDL 5E08L 3GIZH 4FZ8H 2HKAA 1R5IA 5E70A 2BO0A 5HHNA 1AZRA 3ZHFA 3ZT6A 1H3PL 4XCCH 4R4ND 2H6PB 1CLOL 3F58L 4G6MH 1MCWW 1CDHA 4KTDL 5DEZA 1N8ZB 3CU1A 2WY3B 4PRIE 1O75A 1OAZL 3ZJAA 2GFBA 5KZCD 1GGCL 1IIIA 8FABA 5C0RH 3BE1H 5IROA 2EDMA 5JOEA 4EXPX 2JB5L 3O3EB 2OSLA 2H2PC 3QZPA 4RNRB 1IL1B 2AXFA 3EO9H 4PGEB 5C0ND 1EO7A 5IOPA 5HHMB 3WKQA 5L2KB 3L3OB 4PH8A 4X9HA 4O58L 1P4IH 3QG7H 3C9NB 4B0MB 3MCLL 2LE9A 4N87A 4I48B 2QL1A 2YQGA 4HX1A 1DBJL 3MLTA 4EQ2A 4F7CA 1A3QA 5CLWA 4ODWA 3QG6A 1Z9OA 1IC5L 1QD0A 3LSOA 1ZLUK 2NYYD 2Y1YA 4ZUVB 2Y1ZA 1ZS8A 3C6LA 3V9EA 3FSZA 2DH3A 3PWNB 4U1LA 4F9PA 2FZ3B 4TUOB 4W4OA 2JCCF 1PSKH 4YSTA 4A2EA 1OSZB 3V0DA 5I24A 2NY6C 5EN2B 3MCYA 1HHKA 4RRPG 1VZIA 2DEXX 4QHMA 4UUJB 4U1NB 5D5MA 3GKZA 4JG0H 2P9RA 1PIGA 4KO9A 3EDEA 4JHAL 1FN4B 3RAJH 4ES8A 1RAMA 2QJDA 3FRPA 1BXAA 3K46A 5JIDA 5AW4B 2BVQA 3WE6B 4WK0B 3O9WB 3BAIA 3SQBB 4XMTA 5TQ0H 2V17H 4PI0A 3B3IA 3S3PA 4HMEA 4NZTH 4YGVB 1PZUB 4H26B 1P2CA 4ODSH 1Q94A 1C9SA 3UC0H 1YEJH 3DX6A 5BV7C 2DJMA 2VTFA 2BNRE 5DJCA 5IM7A 2QGCA 3ASNB 1UCBL 3VDCA 3O8XA 1A7RH 1UWXH 3ALXA 2X41A 1H9VA 1CTOA 4G80B 3L9YA 4PGDB 1MJJA 1G9NC 2O93L 3EXLA 1UYWL 2CDFA 4OQTL 4TKWA 1LP9B 1EA9C 1TTCA 4BRVA 1B4LA 2FUTA 5HDWA 1KT2A 1P7KB 3WFDL 5EOTB 1SJVA 5DTFB 2GCYB 4QYOB 3BYYA 4AYGA 4JJ5B 1FAKT 5IBTH 2CHNA 4YIQB 3PQYE 3LZFL 4FABH 2WNGA 2R9HD 5CIPH 4KX9A 2IANE 3T3MF 1HZHL 5J1SC 4O02L 3UCQA 1A65A 3BJLA 5DYFA 4ZOBA 5D6DC 3BIKB 1E8ZA 2YEZB 1RHHA 3GFUA 1ZTXL 1RZ7H 3HI1A 3LNIA 3VD7A 4R9HA 5CJ5A 3LIZH 1A21A 3ME0B 3QNYA 4PLJD 4PREA 2CDEA 4JM4L 3VWJC 1CD1A 1JHTB 2X4QB 3ILQD 1I8MB 3CCHB 3QO1B 1VGEH 4R0LB 2OTUA 2FGWH 2H6OA 3NIGF 4NOFA 4LDCA 4AGLA 1U41A 43C9A 1NCGA 1BOGB 2X0UA 5KVGE 1B4JL 2B08A 1L9RA 4LPXA 3SKNB 5ADPL 3QEHA 1KJMB 1MFEL 3BJ91 1RJLA 3PABA 4OF0A 3NCCB 1CFSB 1VIWA 4N2MA 1LQSR 1THAA 4UILH 3ZZSA 2MPAL 4G71B 3TWCH 4YAQA 5MENA 1FC1A 1YEHL 2PUQT 1R5VA 1FDLL 1L4IA 5ITFB 2OCCB 4P2CG 2VIRB 4XRCA 4HIXL 3RY4A 3AM8A 3CZFA 3PDOB 5IHUL 2E86A 1T5XB 5D7LA 2V3DA 1ZHKA 2ZX6A 3MRKB 1T1YA 2MFNA 4YHKL 5EOCL 2FX9L 4KNTA 3APFA 1IEBB 4EQ3A 3GIVB 5DJZA 1CU4L 4LLYA 5F9WC 5K69A 1TZAA 3FN3A 3RDTD 2DBJA 2XVLA 3U1QA 5C3IA 4GKZA 4MCZA 1LO2H 3QHFH 5EOQH 5GZOC 1ZLUH 4NKQB 5KYWB 3TIEB 1KYOJ 4YEFA 1BZ7B 3PNRB 1F1AA 2ZQKA 4NQSB 5JW4R 4HUMB 3D4GA 5I6NA 4A7SA 3MMEA 1ZWIB 4RFOH 4LSRH 2ID5A 3KPRE 1MFAH 2NYZA 3LRHA 1V54B 5E4OA 4AT6B 2KQNA 3VWJA 3EOAB 2CBTA 2XTJB 2AK1L 3DXAD 2EO1A 2X5PA 1IKNC 4HYTB 4LSQL 5C0BA 3QQ9C 4XCNB 2H1XA 1FYTA 3JTTA 2QV2A 3GI8L 4HJ0C 4LEBA 5CJOH 5FXCH 4JY6A 3SPJA 5IT2H 3QJSB 3QRGL 5FWQA 1KGYE 3HC4H 4LOFA 3SBWA 2HCZX 1M71A 2ADJA 2DV6A 5LAXA 3ZDYB 2EDWA 3MGOB 1Q0YL 4BH8B 4A7UA 3O11B 4PJGF 4B9FA 4DN3L 5C6WH 4WF7A 1JDDA 4NHUA 3SDCA 2OW6A 3CN0A 5E2WL 5D6CB 1YUHB 2BWDA 3GIVA 3Q43A 2DN7A 5DJAA 5DJZB 1JNNL 5DURD 5L2KD 2EDRA 5F7DA 1FLRL 2DM3A 4ZMXA 1BBJB 3S8WA 5A2AA 5E2JA 4Y4HC 3U6XS 3MU3A 4BH8A 2F08A 3TN0D 3WUWA 4GXVL 3DWTA 3UGEA 2NR6D 3VTMA 1YMMD 4X6CB 2BNUA 4PJ7E 4ELMA 4GT0A 1KACB 1BZQK 1MHEB 2A6IB 4H8QA 4W6YB 4PJ5A 3EO0B 4NZUH 5E6YA 2HRPH 4W9CC 5DD5L 3I9GL 1OW0A 4YPJA 1TQBB 4HXAH 4QLRA 2Q9OA 3MLRL 5F7MC 4LLDB 3WFHA 5FB8B 4KRPC 4H8PA 4KTEH 5E9DE 2Z9TA 3C60D 1ND0B 1EAPB 2Y07L 3FAWA 3WNJA 3EJTA 5JQ6L 2CNYA 4DUWA 3MGTA 2AABL 4LSSH 4Z7OB 4LVNB 5GS0D 1UQSB 3PUCA 1M7DA 2RB8A 4F92B 1KEGH 1XGUB 3KH3A 5T1KD 4CN6A 3LRMA 5KYWA 1CDYA 2DPKA 4BK4A 1IBGH 4A7GA 4FA8A 1K85A 3BRFA 1COBA 4LVOB 1OGPA 2Y1VA 3MLYH 4J2QA 3T6WA 4YC2B 1SLXA 2QADB 4IHOA 5CJ8A 4AYBA 4KROD 4IKJA 3DOHA 4QRSA 5HJ3A 1A6AB 4YL9A 3SDAA 2N3JA 4FLSA 1I31A 5B4MC 3G6DL 5DK0B 3KJ4C 2IADA 1FL6B 1GSKA 3LNGA 4KX8A 3TNNB 2CUHA 4P4RA 3QRGH 1ZLWK 1N6QL 1JN6B 2CRIA 2R15A 2WMPA 3KL5A 2XFXB 5F0LB 1EZVY 4HWZA 3RHWK 5CFAA 4HMCA 5I16B 2OR7A 1X5IA 3E7JA 1XR9B 2GC4C 4FG6D 4M61A 4I4WA 4XPTL 2WWMC 1YZZA 3BDYH 2WB7A 1OW0C 2VL5B 4JQIL 3W37A 5LXVA 1U8OB 2JXMB 1CD1B 4O02H 1YMMB 2NSMA 3A21A 4UQ3A 3VJ6B 1ASPA 3B9KD 4FQQA 2OYKA 1TYEB 4Z0BH 4ZAKB 1P84K 4FQ1L 4BK5C 4QTIH 3AXIA 3OJVC 2W80C 4XNMA 5C09D 4AKPA 5C09B 5DS1A 3MRGB 5MI0C 3GD1C 3G04A 1C08A 4WEBH 4DIXA 2X1OA 1FZKA 3EJQA 4Z7WE 2V8LA 1TQBC 1NGXA 4K94C 1ZGLB 2A9DA 1SDDA 3LIZA 1MFBH 1NFDF 3BVNA 3HUJF 3Q9QA 1V8HA 4PS8A 2OLDA 4QRAA 2YIHA 4G5AA 15C8L 1Z66A 2WWNA 3FB7B 3BSHA 3N2JA 5B8CC 1ORQB 2FBOJ 4KX7A 2Z91A 1PLBA 1IAIH 4X99A 2DI7A 3ABKB 1OARL 3BVNB 3VXNB 3SY6A 1F4YH 2HG5A 3BEWB 3MBED 2JCCE 1JFHA 1ZTMA 2E9JA 2BNQA 3HAEB 2K6ZA 3KYMA 3QB7C 1FO0B 3A4AA 4PJCF 1AS8A 3FT1A 2OS7A 2XI9A 1MI5A 5ES4B 4QRRE 3ARDC 1MCHA 1NPUA 3TEYA 4V2BA 3LJ3A 1KCSH 3QIBC 2G5BB 2GT9B 3EHBB 1K5NB 1IM3B 4ODHL 4N0CD 1RZKL 2B77A 1YMMA 2ZNXA 3WELA 5BRZD 1W0WB 5FS5A 2ZUVA 1GPOL 3LZOA 4PJEE 3L1FA 4U6XB 3B2MA 3DUSA 3VDAA 4HK3J 3UZQB 1IILE 4O9HH 3QJZA 5D1QC 3LKRA 1FZMA 2Y6SC 4M93B 5A2IH 1CT8A 4GEIA 3FMGL 1I3VA 1KB5B 1FN4A 1GAFL 5K9QI 4I3GA 2ZUUA 1HQRA 5DEJA 1UJ3B 3NYKA 1AOZA 3M1BA 4NI3A 2FYVA 3HJ0A 1KY7A 3FZUC 4N6RB 4DZBB 4JKLA 1LE9A 5AYTA 4NC2B 5H37G 2R2HB 1FYTD 4NDMB 4PJ9B 4YHNA 2VM9A 5DMKA 3DHUA 3CZNA 3U0WH 1UJ3A 3WTUA 4FYTA 2NNXA 4HXBL 5KVEH 2WP3O 5DYOA 2VXSL 1ANUA 4J7RA 4AJ0A 5F1SA 2P5WB 5DHYB 3D9AH 35C8L 3EHBC 2Z6FA 3QZLA 3IXTA 5AOKA 4MWFB 3SE8H 3CE1A 5D9SB 2I9LB 4U3HA 2JE8A 5I1IL 4I1PA 3HVDA 4L2LA 4LOUD 1ET8A 2IXQA 1SDDB 1P5UA 1GOHA 5CIPA 3IFNH 3ARFA 4OB5L 1HWWA 4FZ8L 1GZHC 4LP4A 4TPRL 4NZ8A 1OAKL 3PPEA 4Y7OC 4ZTEA 5D72L 4G59C 5T5FL 1RPUA 1QRNE 5JLZA 4NQED 3V6BR 5MEPA 2H0EA 4JUTA 4U1MB 1HHIA 4E9RA 3T0AA 2BSTB 2W92A 6TAAA 3LZLA 3FT9A 4FI7A 1OALA 5D1XD 3MRRB 4OF6A 3BGMA 2EIZB 1KN2L 4PBDA 2ARJA 1O7DE 4QRPD 3TNMA 4P5SA 3S37L 1OT1A 1EERB 2A6JB 4E5XG 5DZPA 4J1UB 2XX1A 1UZ8A 3VGBA 4LKXA 2IOMA 3R0MA 4ANVA 4ODUB 1ZS2A 1N8OE 1BV8A 2GAZB 2WBJC 3UPRA 3DXAA 4KO5A 5I1DB 5ESAA 2XBTA 5DD1L 2AZAA 2I32A 5D2LB 2EE6A 5IREA 2IQAA 2IAMD 3L16A 3PP4L 3DETC 1UGNA 3WS6A 4UQDA 5IB2B 4AIZA 5AKTA 3JWDC 3BYTA 5I19H 1IM3D 5AW0B 1BIHA 5D2LE 3ULAB 1FFPB 2ENJA 4AZ8A 4NKMB 4JDEA 2MNUA 1BVKA 4XP6L 2F54E 3QUZA 1I3RA 3L9RA 1TTRA 1DCLA 3NZHH 5JOFA 4NT6A 1S9YB 2G2NA 4HCIA 4KJYA 4L1DA 2GKIA 5CLZA 3UYPB 4ODXB 4P5TC 3LDBB 2VLKD 4R8WH 4H0HB 3JV0A 4AK2A 4OJFL 1EBPA 4XHJD 1PG7W 1QRNA 4ZAKA 3ZKXB 5T3ZH 2EIJB 2ROXA 1G7LB 4N2DA 4ORGB 3MRBB 2DMGA 3QUYB 4WW2A 5J9PA 2L7QA 2QBWA 2YRPA 3B9DA 5KSBB 3DOSB 4Z9KB 2D4DA 3QI9B 4ZMVA 2X40A 1VLXA 5CGYC 7FABH 3KW8A 1NL0L 1MH5A 3UBXI 5SWQA 1AXTH 4Z76B 4FQXB 4TM9A 1YNLH 5I8CB 3ELQA 4JCMA 5JHLL 4MTMA 3DRQA 2WSPA 4L3ED 5FO7B 4ZUWA 2QSQA 3BVDB 4A7QA 4IOSD 4NNYB 4Z78B 2QVIA 3B1UA 2WYHA 4UQBA 4U7SA 4Z7OE 4EKJA 3EYOB 3HG1B 2APBA 2ALAA 4MAYC 1RZJL 2PW1A 4L3EA 2D03H 2WXIA 2BP5M 4GXVH 1D5BB 2X4UA 5B1KA 3RZCA 5F3HB 4MQ7B 5FO8A 1JGEA 4YFEA 2X4PA 1R3HA 2ITCA 2FCBA 1NINA 3IETA 3QUZC 4U6YA 3LRSB 5DD1H 3UEZA 3VQMA 5CM1A 4NHUB 1TQWA 1EGJH 4HWUA 4P3WA 2BY3A 1NFIA 3LKNB 2HYMA 3HE6D 4Q97A 4ZDHB 2H2SD 4WV1C 1CN4A 3N42F 3FO0H 1KCVL 2JKRM 1DVFB 9PCYA 1S5IH 1TMCB 4NPYA 3LXCA 1JGUL 5C3LD 4LKCA 1L9QA 2ZUQB 3CH8A 1BVNP 4CVWA 2V9UA 2IH9A 3FFCD 4QRFA 5L8JB 5JDSB 1LEGB 5ID0B 4X8XA 4HQQL 4YQXL 2XBZA 4FQ1H 4XXWC 1JPFA 2F53B 4FZEL 1ROWA 2BNRD 2W95A 4JY4A 2FJFA 1GGIL 1JD9A 1NAMB 3G6JE 4JGNA 3AC0A 1AO7E 4XVTL 3MV7D 4WHCA 1J5OH 4PJDE 2BVTA 1YRKA 4R4BA 4OH2A 4YEEA 2F53E 3ECBB 4AGPA 4YHPB 3I6KA 3Q8BA 4TTDC 4DP5X 3U7YH 1AHWC 2HJFB 4W4OC 1M7XA 1XT5A 2DM7A 2XRAH 3ARRA 5E56A 5IB1B 2GEQA 1ZLSH 2Y06L 3QHZL 4R96B 3A67H 1GKEA 3UYOD 3QBTB 3MROA 1QTSA 3D9AL 2AEWA 3KHQA 4RGNE 2HUEA 1PKOA 3HPLB 1YCSA 4I3RL 2YR3A 2CR3A 2BP0A 4L8DA 3BVWA 2HJFA 4G6AC 3N1FC 3ZHNA 2AKRA 4A1RA 4ICWA 1WP6A 2O30A 4B60A 3H42H 2H2SC 1GC1H 4PVLA 5DUBB 1E3ZA 2WQWA 3PXJA 3O6FC 1UG9A 3O2DL 2R7EB 4JGUA 4JB9H 4YAQB 4NC1C 3C2AH 3KGTA 1M3JA 1QFUH 3PGCB 5AW6B 1XR8B 4GIOA 3X1EA 2DJ4A 3SE6A 4QHLA 4A39A 2E76C 4QXWA 5D1ZD 3MNVA 5IIEA 1BAFH 1EZVX 2AEIT 2OR8A 4NQQA 3SDDA 4Z3HA 4PIBA 1JZ2A 3U2SB 1TQTA 4XO5A 3NABL 3UDWC 4PW3A 3N1PC 3GTVA 5MEOA 3IAGC 1IEBA 3D2UD 3P4OA 3FO2A 2X28A 1UM5H 4JHUA 4JQIH 4XXWA 2I60H 5EIQA 4R0LC 3T3MB 1N2RA 1LO5B 1E4JA 4HUUA 5FV1L 2A4ZA 2J4WL 3Q2WA 3WEOA 4W6XB 1PAMA 4YBLB 3GJFA 4W68A 3NIFF 4HKBB 4FFVD 5DT1H 3UAJD 1A1OA 3RWIB 3DMMC 5JIPA 4JZNA 4MYPA 1RHHB 1CFTB 5ABZA 1J48A 4PJXE 1G9NL 4N2CA 4HC1H 5CGYD 2FX7L 2IF7A 5IEHA 3SQRA 3ARPA 4LSVL 3FHAA 3IRCA 4OF5A 3OV6A 1SLVA 1T83C 4B9ZA 4PGEA 3AWFA 1II4E 3QRLA 5D7LD 1I82A 4MJ5B 3FUFA 4XHJC 1SJHA 3VW3L 3BN9D 3FS9A 3LKPB 4DKFL 4PJHB 2L8AA 3GM0A 3GBLA 4M3KB 2YAOA 4PCSA 4UZSA 3A23A 3VX0A 2QADD 1VGKB 1S7SA 2CDGB 4XVTH 1MHPL 2KMWA 2X2UA 4RSYA 5FYKE 3KNBA 3SCMB 2B20A 3K72B 1O7VA 3L3HA 5IGXH 1VACB 5B38A 1DBML 5D71L 1S9YA 3VFTA 3QC6X 1BP3B 4OZGF 4MZ3A 4WWKA 1HHHA 3SDYL 4M1CC 1B6DA 5GGVH 2AEPH 1RUKL 1P4LA 5FGBA 5KSBA 43CAB 2GSIB 2A73B 2DQUL 1IQWH 5FGCB 2IAMC 3PXLA 3QZOA 1XGPA 5EN3A 5SWZD 1NICA 1HFUA 2AXGA 4APQC 4HWEL 4N5ED 4Y5YB 1HEJC 2YAQA 1WCBB 2FWLB 4Z3EA 1VSCA 2WBJD 4MQXD 3L81A 2MNJB 4HCFA 2Q3XA 2UY6A 4NRZA 4X7SH 5D55A 3ULVL 4RA3A 5TGBB 1H8OA 1B0GB 1SQMA 4H20L 5LGHH 2Y7QA 2VSDA 3B4NA 3UJTL 5L2JB 1AQ8A 1AZNA 4HPHA 4N25A 4J3TA 3CLWA 2HLAB 4KRPB 3K2MC 1WCBA 1FH5H 4Z7IA 5LGJB 1Z9PA 5EHFA 4NAJA 2EC9T 1MLCA 4HOMA 1NCBH 1M7UA 4QEGA 5KN5B 1NCHA 5D96C 4HISA 2ODHA 3D08A 1MZZA 1PD1A 2ZUWA 3IJ7A 3KEDA 2XQBL 2XWBA 2ED7A 2UZIL 1D7DA 2QGEA 5D7IB 5C0FA 4JAMA 2L7JA 2BSEA 1QI5A 2CKNA 4XX5A 2BZDA 3TWCL 3JVFC 1AFVL 1GIGL 2A83B 3D25B 1KIRB 4XCEB 1HN1A 4JFTA 1CTNA 1KPUA 2WP3T 2A99A 43CAA 4LOUC 3WOVA 2ADFH 3MREA 1CGYA 4IRSA 3UBXG 1OSZA 3KPMB 3MAWA 1IE5A 2HTLD 2XWDA 1GS8A 5E03A 1ED3B 1TTFA 2ZSWA 2XN2A 4LCYA 1A3RH 4M6OH 2XQYK 1H3PH 3QUXB 1A8ZA 4XPGL 4XN1A 4B5EA 4AKQA 1KCUH 4FYQA 4EDXB 4CU7A 1MCKA 2VKXA 3GT6A 1CF8L 5CGBA 3ZMEA 4MCNA 2IMMA 4JL1A 5F7YC 3FZUD 4KXAA 3GLZA 3T65A 4XH2B 3V4VH 3P9MA 1U8OA 1B0WA 4HV8B 4Y2DA 5HVWA 1KTCA 3IFLL 4Y4HA 3BH9B 5A16B 1S4IA 4ONHB 2JSFA 4KHTL 4OLEA 3DURA 5JUEL 1ZVHA 1MFUA 5D1QD 1O9ZA 1RUMH 1U8HB 3ERXA 4K3HA 2OSXA 5FUCC 2H6PA 4K7PY 4CU6A 5BXFA 4Q6KA 3STBA 4D8OA 4NOBA 3QJHB 2QPFA 3ORJA 4K8RC 3VXTB 4HZ1A 2B1HL 1IM3A 1SLUA 4UILL 1EHAA 5EUOA 1UKSA 5H2BB 1HHGB 1DSFH 4LP8A 4MJIA 5T1LD 2AXFB 5L2JA 3TJEL 4MDJA 2LTQB 5E6IC 3EJUA 1AGEA 1HXYA 2ZOOA 5GRJL 3PXHA 4MB1A 1TZ8A 5TE4L 1HDMB 1ES0B 1PY0A 1U58A 5EBLB 2AF2A 5I26A 1RZPA 2UX6A 5KSBE 4DJMA 2CJUL 3NFPA 5BJTB 5K5YA 2GHWB 1JZ3A 3D33A 3KDMB 3LXBA 4ALAL 3I2CL 2VQ1B 2FJSA 5CKAA 3F5WB 4XWGL 3WXWH 3M1OA 2VZUA 1KJ3H 1T7XA 1CXKA 3S5YA 3KPSE 2V0AA 3WNIA 3EYFB 1FNFA 1CDJA 2R29A 2WLLA 5DDHA 5JMOC 3ELAT 4N90D 1W16A 5I6XB 5DJXA 3NBNA 5E4EB 4AUUA 3EJCA 4E41A 4ILDA 4AJVA 4WHTB 1YC8A 5LBSL 2NX5E 1CLZH 2WWOA 2J21A 2EUZA 4EJ1C 5I1IH 2WO2B 1DQMH 3G5VB 1UD3A 3VTTA 3WL9A 3K6OA 1T66C 3NJNA 3TH4T 2JXMA 3TFBA 4PV8B 3V4VB 3UBFA 3HRZC 4B3VA 4GO6B 4CSPA 4LQ1A 4XVJL 3I6KB 3B9KC 5C0BD 1WAPA 2EDQA 4BCZA 4J8RA 2HMID 4P49A 2OK0H 2VDQH 1TCRA 5F7EL 5IMMB 2O5YH 4CADB 2V3EA 2DQDH 5B7EA 2A2QT 3ARDB 5E6ZA 1MCSA 3RHWF 4EI5B 4FKEA 5JW3H 5C9KA 1DUYA 1INDL 2WXJA 1S5HB 2VR8A 2PP9A 5H4ZA 4PCKA 3WTWA 3FCSA 3FSWA 3LN4B 5C6TH 1U8QA 1BAWA 3F7LA 4OGZA 2IH1B 1LNUB 4PG2C 1BCIA 2KHAA 5F6HI 2W88A 1MY7A 3QIUB 5ALCL 5CINH 2NY0D 4AXWB 2WQXA 1CGSL 4K3DH 4N2HA 4IQHA 1LTXA 3FT3A 2IGFL 3CVHL 4XTRC 4FZEH 4JMXA 5CILL 4M5SA 3BWSA 2AJVH 2FT7A 3BPNC 3HNTL 2R1YB 1I8UA 4MNQD 4XAKD 5I28A 4HIEA 4KDTA 1ZLEA 4A6YB 1NCDH 1RLWA 1NCWL 3K0WA 2QQLH 4QAMB 3QNXB 2BSBA 1FV1B 2I25N 1MUJA 4HUXB 4JFQB 2WLMA 5L4FA 2OSWA 2KH2B 2IQ9H 5AVSB 5BZXA 5HYSA 2B1AL 1CE6A 3N43B 4JFZH 3DIVA 1OHZA 3GGWA 3NCJH 5DHVH 3JSSA 4WUKL 4TLSA 1ORSA 1VB9A 3OAYK 2ARJQ 1I1AD 1U8PB 5DSCA 4KRPD 4B9PA 4UT6A 3O0RH 3VD9A 2DQJL 1ERNA 5JPNB 4UMGA 4PAZA 1G1OA 2JQZA 1QUPA 4MD0A 4JFHE 4L0ZA 2R2EB 4HIHA 4TNWK 1I1AC 4QRPB 3IB4A 2BZ7A 2ZNWA 4P2QA 3UTSD 5IVXE 5KS9F 5MP6H 4ZUUA 3BLPX 3VFMB 5IF0B 4BIKA 1L9MA 2HFGH 2OMWA 2GTWB 2ZAIA 2VIRA 4HWZB 4JQIA 4N26A 1DQML 3DVIA 4I1RA 1BFVH 3FU7B 3BPOB 2AW2A 1DJZA 3UC0L 4F8QA 2WCSA 4Y2OB 1KN4L 3B6SB 1IAIM 3RUGB 4QY8A 5EU4B 2X6UA 1IX2A 2R1YA 4X4ZA 2F5AL 5EULV 3O6KH 4WVRA 3T9WA 3RX9A 1UD4A 2H0JA 3KL3A 5GPRA 5LN4A 1J0YA 3QUMA 5E9NA 3WU1A 2R7EA 3WEBA 2Z8SA 4QXUL 1X44A 3NTCL 3QNXA 3VWKC 2JELL 4NKOA 4TLTA 4FNTA 1SEBB 4MD4A 2RQEA 5MI0B 4CSTA 4PJIF 4W9GC 5IIEB 4K73A 4UDUB 1DJYA 4M43H 5TDOA 1AH1A 3KWWB 3B7RL 5LGKA 1BQRA 3ZDYF 1FNEB 4NKOB 4QHMB 4UUJA 4AT6A 1YYMH 1CK0H 4W4NA 4WI7A 4YH6A 1G6RL 1MW1A 1UQSA 3QQ9D 4AYFA 1GY2A 3M86A 2FH8A 1TETH 1OP4A 2HSIA 5E1IA 3B8SA 2B14A 4HS6B 1X5KA 4N0UA 1KLGA 3BMWA 4PVBA 2MCAA 4OFQA 1J8HD 1VEOA 1JG9A 1IKOP 1T2JA 5DO2C 3BZFB 2HMIC 2FHCA 2ZF8A 4LKXB 4XP4H 4U49A 2ZUYA 5AAMA 1KYOK 4KV5E 4QTHA 4NB7A 4GW4A 3AUVA 4PLNC 2A6JA 3BISA 1XH2A 5HHOD 3RZCD 1YY8B 1PD0A 1CDCA 2HPOA 4URKA 2ZXCA 1ASQA 1A7QL 3ATDA 4PJIA 5IJVA 1GGCH 1T66D 3PNWB 3J8F7 4L8BB 2XA3A 1A47A 4KTDH 5HGGS 1T0MA 2ZYHA 3P54A 4HZLA 4Y2LA 1PG7X 1OT2A 1XCQB 2QSVA 5EIVA 4PBWD 2VDRB 3C5SA 5GZOA 4XBPA 2IV9A 3VFGL 1XIWA 4RWYL 1KMGA 5I73B 1JHLH 3GHEL 3CPLB 2CGYA 4XO3A 3WCYA 3LRKA 3QNZB 1KG0B 1CL7L 1WZLA 4WKZB 1Q9LB 4BZ1H 4LNRB 5FHAH 3VXPA 4E9YA 3LEVH 2AK4A 3HR5B 4XVSH 1CFBA 2AJYH 4ZOAA 3EDDA 5AOJA 2OMYB 1PEZA 4U7KA 3VH8B 5I6OA 3SODB 2UWEB 3IE4A 4OJFH 4RGOL 2GUOB 1JHLL 3GHEH 4F9LA 2SODB 3DKHA 2CG9X 3CZKA 3ILQC 3J7HA 5DJ0A 3UP6A 1WZAA 5I1AB 5E6ID 5DVOA 4YHNB 1JWMA 1NDGA 3IMSA 4CC4A 3MRHB 3PJSB 5KWYC 2C9UA 5IVZA 4RMBA 4P9HL 4EOWH 5L7XH 1JS4A 4IS6A 4K8RD 1VFUA 1WCQA 3I6LE 2J3SA 4DGUA 4EUPG 5B3SB 5ICYB 3B2DC 3S34L 5T5FA 2GK0A 3AU1A 4F58H 2WCGA 4HU8A 3BPCA 5FKAA 4W9ZA 1AD9A 1GJIA 4MRCA 2XFGB 1BYPA 4HKXB 5CFHA 3C5XA 1XFPA 4X8GA 1HHKB 2JB5H 3BN3B 1T1WB 3F3HA 5HHMD 4Y19E 1AKJB 3PFQA 5HGDB 1NMBL 2Z34A 1UEMA 3G6AA 3S35X 5JW4Q 4KAQH 4U1SB 4JFDA 5EBMA 1MHCB 4TUJA 4XC1H 4XRCB 3MKKA 4UZUA 1U3NA 3EOBB 3II3A 4Y19B 2QSCL 1G7LA 1J10A 4LSTH 1G1CA 3RWFA 1ZRUA 4ZD3H 1ZSHA 1DBBH 2LQRA 3L3IB 4PLKD 1MFCH 5LO7A 5FOBB 4FTDA 3AREB 4PS4H 4L9LB 2P8LA 4WHDA 1TQCB 2CLRA 4QTIL 3V10A 5DJXB 5DQDL 3CUPB 3GSQB 3L2MA 3MKGA 4YDVB 1ZIAA 1W72A 3FNKA 5FHAL 3KDPB 4L1SA 3WO3B 3D7PA 3OWEA 3D0VB 5E4AA 2ITDA 1MCLA 5I17A 3K1KC 1MHPH 1ZIBA 1DLHB 3DO7B 3MJ8A 3HN3A 3R7RA 1A7NH 3FYEB 4OBRA 1OGAE 1NGPL 2CJSA 4A2FA 2FD6L 4N2FA 5F9JB 1IFRA 2TAAA 1NBYA 2B3IA 4KXCA 1IM9B 4CVXB 2R1XB 3BT2L 1WEJL 2OMYA 2EEXA 2EDFA 3JWNH 3O6FB 3DJRA 4GYBA 2G3ZA 1KF9B 3D8MA 3ILPA 3LQZA 3CFNA 3WY1A 3SJVE 3UTZA 4E9SA 1HCVA 3ESMA 3EJSA 4RZCB 3OQRA 1MCJA 3PFUA 1QX1A 2QELA 4NO0A 2R0ZL 2VQUA 3QPXL 4JFFA 4H0LC 5TE7L 3O3BA 2BRRH 1EFXB 3WY2A 1KGXA 3WJMB 4AM0Q 2XWTB 3H9SA 4MQXC 3LH2H 3EBHA 3SO5A 3PF2A 4N1CA 5AZEL 4APQD 4ZS7H 3MFFA 3UDWA 1IJ9A 3MN8A 2HG0A 3CQPA 3OKLB 2YPVA 1BQKA 4MLSA 2BSTA 4HKJB 2W94A 1EO8H 5IQ7H 4RDQG 4UV7L 4A55A 4LU5H 4XOEA 1U2HA 1ET7A 4Z7WB 4I18A 3MNVB 4P9MH 4PJCE 5IW1B 3KS0H 5DHMC 5HHXH 2VITB 4J3SA 4MA7L 5LBSH 1XR8A 3V6FA 1NFDE 3HBZA 4WCYL 1SHXA 3OAUL 2VSMB 3F65A 4JQXA 4RGNB 1JNHB 2Q10A 5D7IA 4XC1L 2QADC 3MJGX 3UTOA 5HHNB 3KWUA 1IC7L 1S7XB 3NK4A 5F96L 3ZE0B 3FO2B 2KBGA 3ZGHA 5DHVA 3HPLA 4UINL 4QYAA 5MEND 5HDBB 2HFFA 3MLXL 2QSTA 3C5ZA 4HBQA 3V6ZB 1YY9C 3L3OA 1ZHBB 3AY4C 2VXQL 1B9KA 3O3EA 3ZE0E 2HFGL 2FSEB 2G9HB 2YXFA 5G4OA 2BSRB 2EDDA 4LIQE 4AC4A 5E00B 1CJYA 5HVHB 2DWDA 5IJVB 3KCWA 4LSPH 4R5TA 3W38A 3DMMD 1QPPA 4WW2F 4FFVC 1CVSC 1Q0YH 3LSOB 4PJAA 2A6KB 2OCFD 4PJEB 4TVPE 1AGCB 1T89C 4U0RC 4UQIM 4X5QA 5ELIA 2Y2YA 5AZ2L 3QEUB 1PX3A 2BP8B 2BMKB 2G0LA 3MUHL 5I18H 3RIKA 1YUHA 2KZWA 5DJAB 2ZUTA 4ELME 2OAAA 4PJ8D 4KRMB 1TZGL 4CDGC 2PYFA 4QRQA 5I30H 4M9PA 2AV7A 3LHPL 2M1KA 4F33A 3RFRA 5IHBA 5EMYA 3AQDA 3IU3B 5J6GB 3I9GH 4JFUA 2MSPA 3NCYP 3L1OL 1OCWL 4KKNA 5BVJB 1I9JH 3H7LA 5KSAB 1YEEH 5F7LB 4LSRL 2VLLB 4Y0GA 4OZ4A 3RURA 4XN7A 4DOHE 4RAHA 4LE8A 3DSFH 3C5ZD 4G6AD 2PYEB 2EXWC 2EH8L 4L8CA 1S78D 2D7NA 5HP5A 2XVKA 3EDKA 1IAKA 4KUCF 3SO3B 1VPOL 2APSA 4MZ2A 2QQQA 3ZVVA 1U33A 4RBPK 3T3PB 5CEXA 4EOWL 1ETA1 3QDGD 2LU5A 2DLFH 5DRXB 4GW4B 4TTDD 1MRDL 3LD8B 5D7JA 5CS7A 3RVXC 4WDIA 3NJGA 1HSBB 2LOEA 1T22A 2FECI 3QUKA 1OE3A 4GG6A 1TPXC 4WWKD 5JIKA 1VESA 2WVUA 2OMTB 3PQYD 1XL4A 5D2NC 4IBZA 5F7FA 4N2OA 2WXQA 3SDXF 1Q1JH 4PRBB 3CN1A 4HFWB 4MFHA 4JRYA 4Y2OA 3CHXA 3UPAA 1WQVT 3ULVE 1E5BA 2HUHA 4XPFH 5E8NA 1U8IB 1PKQB 3TCXA 4TLKA 3RFZC 3EH2A 5TGBA 4JZJA 1FPTL 4L9DA 1ZD6A 1IC1A 3NDZE 3RB5A 3D3VB 4LCVA 4LARL 2ZG1A 2WIIB 4DTGH 1UM4H 4WY7L 1LILA 3TEUA 3W3BA 1U92B 3BD5A 5T1KA 1YNKL 1AQMA 3O4LA 4PJ8B 4XPFL 4TTGA 2XXFA 3MV11 1BEYH 3UYRL 1O6VA 3CFQA 3Q8AA 3QFJB 4KXZI 3UEQA 2DH2A 3P2BA 2VLRB 4JLRA 3QNFA 4L8SB 3FUKA 5LAXB 3C60A 3JV5A 3TJHC 3W81A 3BZ5A 2EECA 2P28B 3L3DB 1F6LL 1AQHA 1NC4B 1MLBA 3GRWL 1Y18A 3D39B 3QS2A 4O02B 5E6UB 1Q0XH 3ABZA 3KBHE 1RKRA 3NRFA 5E51A 4WENB 1S6NA 1E4KC 5F2FA 1QSFA 2OMBA 1I7RB 3P73A 3O41A 2HH0L 3OKMB 2R0ZH 3SHSA 2W38A 5CZKA 1U42A 4Q9QH 1R75A 4MNQE 1O9VA 2CK0L 3TEXA 2DL2A 1BG9A 1QA9B 1U8LB 3GZOA 1AMYA 1NCAH 1ZT7A 4LCWE 2A6IA 4ANWA 3P11L 5T1LA 1IGJB 2D0FA 3RWGA 5B39A 4Z3FA 2I07A 2WUCL 4J8QA 4KO7A 4P5TA 5MEQA 1T0NB 4QLWA 4O2EB 1W8OA 5BCAA 3T2NH 1H19A 5TPWH 4GG8A 4BZ2H 1HL5A 3QR2A 3DXAB 1FIEA 4P5TD 4WRLA 3Q48A 4J6RL 2Z7ZA 5E9AA 3OKYA 1PPIA 3C12A 1UKTA 2F5AH 4L4VB 4OIIL 5BRZA 1Z1WA 4UM9A 3B2XA 4LEEA 2WYTA 4OUUB 4NJ9H 1WH0A 4O4YL 4P9ML 1BFVL 3K6DA 1SMAA 2VDNL 1NDMB 3MTXA 4PWIA 2YN5A 3QUXC 5D96B 3RQ3A 2Y69B 4JDEB 3EDFA 5ICXB 4YX2H 2H26B 3AQZA 4X80L 2HT4D 3V52H 1XL6A 3AACA 4Y16B 3ECQA 4Y16D 2JJUA 3D1MC 4FG2A 2FJUB 3BUTA 2C9QA 3OKEB 1OSYA 5IMOB 5T1DL 3RGVB 1HDMA 4BZ2A 1L7TH 3RPIB 2XA8L 4G9FA 3G6JF 1J11A 1DJWA 1MG3C 1NUDA 2VXQH 2YUVA 4N0RA 4JDZB 3TBBA 4NUQA 4J8RB 3RI5K 3UFIA 5EC1B 3DJZA 5I73C 1MY5A 2CO6A 3T0EA 1L3WA 2K78A 2E9IA 1D5MB 3ZKXC 2EICA 2GCYA 1SYVB 4OCSL 4YXLL 1LE5A 2FQGA 1TCRB 1OAQH 5KG9A 2R4RL 2F54D 2FZ3A 4TUOA 3QT2A 3B9KA 1FRGH 5DZOA 4ADJA 5AB2A 5D4IA 1IGMH 3P9MB 5KEZA 5ECJE 4CA4A 4RFNB 3WFCL 3OLGA 1S7VB 3TA3B 5D1ZI 1K3ZA 1HZHH 5MEPB 4FMVA 1W0VB 3MOBH 3Q44A 5C6TL 2E7MA 2X4SB 4YHML 2ICWI 3UADA 4ZXBA 5IBTL 1NANH 4R2GD 5KVFL 2QPSA 2WUCH 3OXSA 5TE6L 3O3DA 1OARH 2MTAA 1MWAB 4IOSA 4R0LA 2W81C 4ZD3L 1LMIA 1B88A 1P0SE 1NGZA 3GM8A 1PZ5B 2A77H 4TQHA 2AVGA 1R5IB 4R7XA 1S9KC 1NBYB 1OLLA 4JRXD 3DMMA 3G7TA 4FQHB 5K1JA 1MI5B 2R29L 4W70A 3SYAA 4AIOA 3FB8A 2EZ0C 4QCIA 4MMXC 3O6FA 4DO5A 2X6AA 1H0DB 4R84A 3R06B 4AKOA 4GLRH 2IQAB 4UM8A 5DC0A 2EDLA 1JIBA 2PW1B 3QAZB 5F0MB 3SDAD 4QR7A 2ED8A 4NM4L 2YKLL 2UXGA 3L5HA 4OFPA 2RFXB 5B38B 1X7TA 2ENPA 1LJMA 3LPOA 2IANB 3MLTB 4ZFZA 4K5OA 4UOQA 2XXMB 2F1EA 3ECWA 1TQSA 3U25A 1QATA 4HS3B 3REVB 4GIAA 3LHAA 2ENSA 4U1LB 2D2CC 4LARH 4JFYB 4N0CC 3WTYA 4HWBH 5JXEA 4P57B 5FV2A 3QIBD 3D3VD 2IPTH 2WYIA 4OCSH 1SVBA 4NWUH 3T65B 4RA0C 4PJGB 3T8MA 3NABH 4AYEC 1L0YA 1NMCC 3MBEC 1MJJB 4PCTA 1LK3H 3PDGA 4GKSA 3H7BA 4FE9A 1J1XL 4X4KA 3QULA 4RFNC 4XE5B 4AGOA 2DQDL 5IBUG 4CAGA 4IOIA 4KAQL 5E1GA 3H0TB 2H9GA 2WQRA 2K7QA 4B9YA 5SWSE 2CNZA 5K9QG 5BW7A 5JHBA 2V9RA 1AACA 3TWYA 4N85A 1OY3B 5EU5A 4GKSB 3E9UA 3EF7A 4YX2L 1HSAB 5BS0B 2VXTH 3E8UH 4FQLH 3BVTA 4JFSA 4BV1A 3DUHA 2JIXB 3SSGA 1AE6H 2YAPA 1MRFH 5I19L 1UCBH 1WA1X 1K8IB 1DANT 5HY9B 4JFOB 4YSRA 4DSYA 2BSSA 2WQSA 1TJIL 1SEBA 4YZFE 2DD8H 4ZFGL 1BM7A 1JGDB 3WIFA 1N68A 5IB3B 5F70A 5INCB 3CFJA 1R24A 1TVDA 2COVD 3QJRB 3R18A 3VMOA 2VN7A 1JRHI 1KCRL 3QG6B 2C7FA 1YEGL 3L54A 2IEPA 2Q6WB 2A9NH 2WWMD 4AEHL 2VZ1A 3IFOB 4R2GC 5AB1A 4HFUL 2LABA 3ULUF 1WLHA 4AQEA 5DHEA 3OPZH 4NM8L 1E9PA 4U1HA 4FGMA 4OFIA 3WJJA 1RVFH 4MJ5A 5HDRA 4KK8D 1KIUB 1T04B 3QISA 5HGAB 3FU5A 1VEMA 2I85A 5ABDE 3REWB 5KYUB 2PKDA 1OB0A 5FF6A 2X44D 2DQIH 3IMUA 1S5IL 4U1JB 2O61B 3U0PA 3MRDB 5B4MD 3WIIL 1P9MC 4AENA 4HJJH 5LNDA 4OM1L 3IMRA 2X2HA 2FJFB 3C75A 2XZAL 4AYDC 4DCQB 1MN4A 4PJIB 5IFHH 3NIFB 4DAGH 1JZEA 1MHHB 5DURB 3QUML 3QJOA 4TRPL 4AVJA 1Z3GH 2BY2A 3APCA 4ZW5A 3MRHA 2XPGA 3MJ7B 4MA1C 5CJOL 3R1GH 5D1ZB 1EWHA 1RL1A 5D7LE 1ITCA 4RAVB 1A7BA 1QKZH 2LLGA 5LNGA 1RZQA 4BJLA 2WZPA 4Z7QE 3EFFB 2W5PA 4IRSC 4MAYB 5F1NB 4HWEH 4QF1A 5GSRA 4DTGL 1K3IA 1KY6A 2YA0A 2AK4B 4WGKA 1QLRA 2AK4D 2HT4C 2JLLA 3RWCB 5FYJD 4DO6A 4D3CH 3US1A 4R4BB 4E0RA 2C4FT 2OI9C 3MI6A 3GZKA 3UBGA 2NMSA 1UM5L 2XNAA 1QBLL 2WBXA 2Z4QA 1TFPA 2ADFL 4OZGB 3SO3C 4DNLA 3TN0C 1SFDA 2X6BA 4JG9A 1SF3A 3SKUD 3MODL 5FO7A 4Y4HD 2V5TA 4F7KA 3D85D 3DSNA 4KQ4H 1TZIA 4QIRA 4BSWB 5GJTH 4R2GB 4Y5YA 4X5RA 2WINA 2HWZL 3HBPA 4XPTH 4FCAA 4NCDA 3WFEL 3BVUA 3QEGL 3JT2A 1AO7D 5BO0D 3MNZA 1FGNL 4FCHA 2JWYA 3IKKA 3QXDB 3HFFA 2B0SL 5C0GA 3IN0A 1FYTB 3JTTB 4X9GA 1F86A 4JO3H 3A6OA 4LAJH 5KSBF 4XMUA 2WW8A 1LEIA 1ETJA 3ILEA 1WT5A 3VXNA 4WAFA 1G5GA 1HEZB 2E4TA 1TXKA 4LSDA 3PU7A 2C8NA 5B7MA 1VCAA 3IJSB 2P8PA 3P0GB 3AGWA 5CHNB 2PP8A 3S4SG 5E2TH 2Q8AH 1LEIB 3IXAA 3QA3A 2BW5A 4X4YB 3QUYD 3FFDB 5BNXD 3KPOA 4UNUA 5JW5A 4Z6AT 2IQ9L 1D5IH 1RUML 12E8H 2CGZA 4L48A 1R3JA 2FQEA 2XPGB 3MJ7A 5L2KE 5GZOD 4G5ZL 1RUKH 3OJ2C 4EE2A 1T0NA 3FRPG 1YPZA 3GHBL 3HAEG 4WWOA 3VSUA 3VXUB 3G6JB 3SDYH 3GSNH 4K07A 4UNVA 4M48H 3QORA 4EO5A 3VJ6A 1B6UA 5J3HC 4I77L 2YZ1A 3X1FA 1I4FA 1MZYA 4A2MA 1D7FA 1OOWA 3SJVB 4H8WH 5INDB 3MUZ1 4XBGA 3QYMA 4EUPA 1IC4H 1LO3H 4HAFA 5E2TL 2EE0A 4PJEF 1Z0MA 2G2RA 2IH3B 5TPWL 1Y7VA 3WEMA 1DBAL 4DGYH 3HS0C 1BGXH 5EU3A 4MQ7A 4Y4HB 4EF3A 1KGUA 2X3CA 2UYLB 5JPNA 2A4CA 2WTRB 4HFWA 3KBFA 3N9GH 4FQCL 3ZSSA 2IBZY 3Q3GA 3QO0B 4F7MA 4JO3L 2OZNA 1JNNH 1KT2B 2JIXA 1TNMA 2G4EA 1SOSA 2V7HA 1N0LB 5IB3A 2LU3A 2J7LA 1GOFA 1AG6A 4PLJC 5JDJA 4X6FA 2QVKA 2E6JA 1R3JB 2W1NA 1T2XA 1CD8A 1NCBL 2VN4A 3QHTC 4JHAH 5HPOA 1ZY9A 5DRNB 1JSYA 1AZZC 1H3VA 1LGVA 5JIQA 1FSKC 4LEXL 3ETSA 2A9ML 4GP5B 1DBBL 1S78C 3NEEA 5CEZH 4OKDA 4OZIA 5IHHA 3C5ZC 4DGWC 3WI9A 4OV6F 5D1QE 1JNHA 1U3YA 4N8VA 2GITB 4AEHH 1AQKL 3GS7A 2A74A 4JZOA 4I0KA 1NEZG 2IO5A 3VCLA 3BDYL 1WAEA 2FL5B 4MCYA 4RFOL 4HC1A 2VDML 3EO0A 4HDIB 1XO8A 3PHOA 4UANA 4QRQB 3WTVA 3BWAB 25C8H 3MRIA 3U0TA 4ADGA 3LZRA 3EZ8A 2R0LH 2NY5L 3BSZH 1WAAF 4JPIA 4P5MA 4J3UA 3L4CA 1DVYA 4PJ8C 3WN5C 4MB5A 5KVFE 1CU4H 2XG5B 1USQA 3WUWB 2ZOTA 4MD5A 4YNYB 1JV5A 4MBRA 1DBMH 5D71H 2VXTL 1JDCA 3E8UL 3KPLA 3CC5B 1BZ9A 4NQVA 4XXCA 3W9DB 3PHQB 3R8BB 4U1KB 4EIGB 5D7SL 2ICES 2PW2A 4E2OA 2VOTA 3HW7A 3QEUA 1KCBA 2X4QA 2RA1A 1N70A 2LR4A 5DUML 3B9VA 2W60B 4OF8A 2QVFB 4HF5L 5DJ8A 1NSNH 1Q9KB 2A4EA 2JLPA 4KMLB 3WMQA 1C5CL 1RK1A 1K6QL 2GSIA 3DVGA 4NSKB 2X4RB 4R7DA 3SDCD 4R26L 1RIHL 2HRHA 5GSRB 1J5IA 4NRXB 1HAUA 4OJAA 1DR9A 1M1XA 2FJGA 1CFQA 2ZWZA 3RZWA 4BZ1L 1XB8A 5E9DD 1PY9A 3IDYC 3BAJA 5DU7A 5C71A 1FO0H 4ZMAT 2NY6D 3CPLA 4FTVD 4NM8H 5JHAA 4TSAL 1I1FB 4NKDA 1LDPH 2WJ7A 3MRRA 4X6DA 4PGCA 5IK3A 1ID2A 1KCUL 4GLRI 4RMUA 2I24N 4PJFF 4RFEA 2CWRA 2XLLA 5JIMA 1AC0A 4GG6E 1CYWA 3LZPA 1OCWH 4WFFD 5FF6B 3FB6B 5HGBB 3W0WE 4YNYA 4GKZB 4L3FA 4MCZB 1AANA 2EIMB 3ZDZB 5BPPA 2H2PD 5F6HJ 1Z9MA 1BD2D 2W91A 4WWNA 2LW3A 5IR1B 1AE6L 1AZBA 3FJTA 1QHOA 5EOCH 4MA3A 2OMNA 2VDQL 5C92A 3GJFK 2XETA 4HXBH 5KVEL 1TZHA 2DY2A 3DX0A 2ZKYA 1R5VB 3E80A 4RX4D 1AXTL 4XAKE 1ZXKA 4I5BA 1NBVL 1TDQA 1WA2X 4AZ8B 3W0WA 4Y1TA 2F74B 1DQTA 5JNYA 3GC3A 4GI9A 3V4UL 2BH0A 3U9UB 2NUPA 1EHKB 3CZEA 4GQ9H 3LY6A 3ULUE 1OK8A 4OGYL 4LSVH 4NQUA 1CF1A 2EEDA 4ZUSB 2SEBA 5A2LH 4AH2B 4OCXL 4GXUM 2A9NL 4XNZB 1F3JA 5EZOL 3UAAA 4N2BA 1E65A 5C09A 3LN9A 5ESAB 4JKNA 3BI9X 32C2B 3FU3A 3T4YB 5HXMA 1ECZA 4L0YA 4AI7A 3HCVB 3K5SA 3D0AA 2AXHA 1GZQB 4LOVA 2WKGA 1DBKL 4GW1A 3PWVB 4PJDA 3EXJA 5I17B 3UTPD 2X9WA 5BXFB 2OPCA 1V7MH 3MXWH 4IIQA 1S7WB 2H8PB 1XWVA 3RFZB 2HJKB 1NBZB 1UXWB 2FNWA 4FXTA 3LXAA 3NRQA 4ZYKA 4DK5A 3OZ9L 5C08E 3GBEA 3DJSA 2C9PA 3MRMB 5D5MF 3U0WL 4TUUA 5KYYA 2HG5B 2LAGB 3BEWA 3GSUA 1EZSA 3WFHB 5FB8A 3U4EB 1HCFX 4UTAH 4Q9RH 4WU7A 5H94A 1UUSA 1ZT7B 3FUDA 1H15B 2YD8A 3H54A 3Q3GB 4F7MB 4PMEA 3W0WD 1M3IA 2P46B 3CDGB 5F7EH 1C8QA 3S48A 1J1XH 2VMCA 4GSRA 4AM0B 1XTMA 1JV2A 3QFGA 1RUAH 4IGBC 2F54A 4YO0B 3B5TA 1BXUA 3MNDA 5CLTA 3QDJD 4R3SA 1B3IA 2O5NA 4LZKA 1QUNA 1C5DB 4PS3A 1J87A 1E7UA 1XH1A 3HIZA 3MREB 1V7ML 4MNQA 4WGWB 5IT2L 4OZIB 2XRAL 3RGVA 1FAIL 1OB1B 3QS3A 2B7DT 4IBQA 4L3AA 4X0KA 3A4EA 5DJDB 3T4YA 4M6MH 2E59A 3VXUE 1U2CA 4OSUH 1P7QA 4PRPE 4U6HB 4IRJD 3FRUB 2DYRB 5JW4N 4Y9CA 5HI4D 4JDZA 2JELH 4CRPA 2NX5B 4F3FB 2NX5D 1RFDH 2DQFA 2VDNB 1MAJA 2WN2A 5F7AA 5C9JB 2AC0A 3LXUX 5KSUB 3M1BB 5F21B 1ZOXA 2DRUA 3IJEB 3KD4A 5FYLH 3ARGD 4AXWA 2HTKD 2Q76A 4U1NA 2XY2A 4OGYH 3OB0K 2D31B 3X17A 3PDDA 4G7QB 1PJWA 3HZ3A 2J5LC 4YXLH 1TJHL 2DIBA 4GBXB 2BHUA 1S7VA 3TA3A 3MVSA 2PNDA 3FU7A 3GB7A 4N4YB 4TS6A 1QI3A 4LSTL 5EEXA 4YSOA 4MD5B 2VLJE 1HXMB 5IJDC 4F7PA 1HNFA 3ESVF 3WGUB 4Z76A 3D0LA 4HWBA 1WC7B 3GPEA 3NDYE 4UV4L 3QUHA 4P4KB 4IDLA 4QHKI 4MXQC 1EBAA 3QDJE 4NENA 5C09E 2ESVA 5BRPA 3Q5TA 4XPBH 1GOGA 1NGWA 3MCLH 4L1BA 5AEAA 1R3IL 4YZWA 1PFOA 3N0PB 3ILDA 3BGAA 3NGBC 4K3JH 3U7YL 3RZCC 1ORSB 3ZPDA 2CIKB 3F7KA 2IALB 1F8TL 5C0EA 1NCJA 3LB6C 4Z0BL 3F62A 1UOVA 5HHME 3QUMH 1CE1H 1G9MC 2WBKA 5D8JH 1YMME 3QUYC 4MVBC 3RJDA 3LOWA 2P8PB 4AUJA 1YEIH 2OXGB 5ANMA 4LFHD 3EUDA 5L8KB 1RXLA 2V3FA 2DMBA 4RAUA 1YSOA 1PDKA 3I6LD 1M7IA 1LDPL 1TVBB 4OSUL 4XHQA 3QIWC 2M8XA 2WC7A 4G42B 4FQXC 1ESOA 1RURH 3HFMH 1EEQA 2MCPL 3ZRSA 1FO0L 3C08L 2FX8L 3AT8A 4BBWA 3PP3K 2I26N 1PZBA 1WBYA 1R5WA 3NA9L 2ZXGA 1LMKA 4MHHG 4UAOB 4BZ2L 2F8OA 3ARSA 5IB2A 3LEVL 1PQZB 1MF2L 1YY8A 4OFVA 2BNRB 4UT6H 5ESQB 4ZMZA 3S3CB 1VFAB 1TTUA 3ZE0F 5IHLB 3BDXA 4APXA 1CFTA 4DK3A 2Y4SA 1ETB1 3L3OC 4PREB 3BZEB 4FJ6A 4LCIL 4BGLA 5D72H 4HEME 4DETA 4NO2A 1KENH 4PRHB 5F88B 2ZP0T 1K9TA 3LMJL 1FH2A 3HA0A 2G30A 2EJ1A 4HU2A 4S1DC 2H1PL 3V52L 3CLEH 4GSQA 5EU4A 1BXXA 3UTQB 4BGDA 3P4OB 1YG9A 4Z78A 1IGYA 2M83A 2R2BB 1MAMH 2X4TA 5GRZA 1SPDA 3NA9H 3NJJA 3MRNA 2ZCKH 4MKTA 1I85A 1AY1H 1EAJA 2R4SL 4OF7A 5EZLB 4RMTA 4HJIA 1AGFB 1H5BC 2IWEA 3GI9L 7FABL 1REIA 4QOKB 1I8IA 2KT6A 2BSSB 3I6GA 3VI4B 3EYQC 3TS8A 3B43A 4M5TA 3ARTA 4NQTA 1K8IA 5HY9A 4IRJA 3MX0B 1A6TB 4LLUB 5EO9A 4TSBH 4IIQB 3IMWA 3AG3B 3CSFA 4WFFE 1CE6B 1DVZA 2QR0B 4XB3A 2FAUA 2DI9A 3V0HA 3CFJB 5FYLD 4BM7A 4EN3B 4FKKA 5FHBH 1G1YA 1AQDA 4DP0X 3O6LH 1ZT1B 4QXTA 5ALBH 3HMWH 3AGVA 3C60B 1IKFH 3FF7A 4XTRD 1NSNL 4XPHH 1SVZA 2Y7LA 1XCWA 4HIXH 1BQHG 4PJAE 1KCSL 1Q72H 4BKLA 1A2YB 1CI5A 2GVYA 2NY0C 1OEZW 3B7YA 5I8OL 3MRDA 4ZW7A 4KK8C 1BM3L 2R1WA 3MBEB 3VRLE 5MENE 3JV4B 3T77B 4CC1A 3BT2H 5IF0A 3NACL 1UZ8B 2CRMA 2VERN 4NN6B 3RVTC 3IFLH 4I89A 4QDGA 2N0MA 4PJ7F 4YLBA 3CVBA 1CFNB 4DW2H 2IVFC 5F3BA 2D7OA 3V4VL 3ILPB 3P40A 2VDPL 4DQOL 2NW2A 2J8UA 1ZVNA 3BW9B 2ZWYA 4NI6A 1H5BA 3LKQB 1FZJB 4F3FA 1NQBA 4M7ZC 1OAJA 7PAZA 5JHDE 4LEOB 4NZUL 3MNWB 3TGXA 2XWEA 1D6VL 2WB1A 2FJHA 5EIIB 1CLYH 2EINB 4HAKA 3C8HA 1MVFA 4JKPL 2BVUA 5C7XH 5DI8B 1IV8A 4LU5L 2VZOA 5AVUB 5C9JA 2UY7B 1JGUH 2E7LC 1MW0A 2Q8BH 3UMTA 5KVDH 1QNZH 1K72A 3PS6A 4NUGL 4EIBA 3E1F1 3SYCA 3KMDA 4N68A 5IK3B 1R3KA 4QRUA 4XP9L 5FUCE 3VXME 3LRLA 4JN2B 3US0A 2HAZA 1QSVA 1AR2A 5AVRB 5BZDA 4HJSA 1KGIA 3SQBA 1OKEA 2JJVA 1X9UA 2WWKO 3SPVA 1JRHL 3FQXA 4F58L 4I2XA 5T3ZD 4HLJA 4NNXA 1H15A 3BP7A 4X2UA 4RQQA 3JWNC 1M9WA 1P7KA 2IGTA 3T4AA 3BH4A 1BWWA 4XAWH 2VDKH 5E8OA 3K8KA 3CZSA 4NERA 4QT5A 5JHLH 2ZOLB 3GEWB 2C9SA 4UINH 3TTYA 3RRQA 2RFXA 3WNNA 2DWDB 3BKYH 3CQFA 4Y5YC 4HV8A 1UB5B 5GZNA 2DLTA 1UKQA 3OPZL 4OLWL 3JV4A 5JPMC 3SDAC 3II2A 4PRIA 3QORC 1U8HA 3BQUA 3OKOA 4YQXH 5AZUA 3D87B 1PFCA 5DHVB 1HU8A 3DUSB 3C8KA 2WV3A 3WKNA 1JI1A 3QXVA 1OCCB 2GUOA 4RDBA 1F3JB 2XWRA 2UUDH 4E5XB 4OGAD 3V6OE 2ZOUA 4Q14A 2GBAA 3VXMA 1E4WH 3E1ZA 4HJTA 12E8L 5CXPA 4X42A 2H45A 1BQUA 3NZHL 3PWUB 1YNTF 3GSRA 4ATWA 3K6FA 1G0YR 5GGRA 4NNXB 4YHZL 2P26A 1RP9A 4DGIL 2J5WA 4PN6A 1MFMA 4YHLH 2NXYD 5CGMA 1LK2B 3QHZH 4L0PB 3MLXH 1NGXB 3KPTA 4TRPH 3MOQA 2ED9A 3O8XC 4U1SA 1ZT4A 4LDLB 3CTTA 1QSZA 4PYGA 3FTSA 5EG6C 3NJIA 3PHAA 3ARYA 1I3GH 1WISA 1EX0A 4WU7B 3AMLA 5H94B 2FB4L 1AGFA 2V8MA 4C8XA 4YE4H 3TIDB 3OKLA 4CNIA 1GHFL 3RVVC 3HR6A 5HI5D 2BM3A 2NNAA 4FQJL 6FABH 4GUOA 2YUXA 1UGKA 2VLKB 3KYMB 3DX7B 3JWDH 5F6IB 3FB6A 4GXUN 3FW6A 4UV7H 5EWIH 2Y7QB 2FO4B 2XJLA 1I9IH 1J1OH 3HLAB 4Q52A 1DFBH 3Q9PA 1XV8A 1W15A 1PNDA 2X2IA 1W0WA 6CGTA 1A9EA 1QBLH 1ITBB 2JB6B 3UACA 3MRJB 1MJ8L 3UAJA 1A1OB 2J1WA 2Y36H 3NTCH 4YLCA 4BDVA 5I71C 1GYUA 3EKCA 4N5EC 3IGAB 3A24A 4G43B 5CO1A 1KXTA 1I3UA 2OCJA 1R3LB 3G5YB 1RJZB 1CVRA 3QUGA 4J12A 5AAPA 4IMLB 1A6AA 4ZFGH 3GK8H 2BNRA 5ESQA 3GMRB 5F8RC 4A68A 5BQ7A 2AMUA 4JY5L 4JPWH 2FRGP 4I3RH 1BMGA 3DROA 4CGUB 4EAEA 5JZ7D 1J9CT 1NFDB 4P4RB 3T0EE 1D6EA 3VACA 4M1CD 2F6AA 2FH6A 3QUXD 4F2MB 2WVVB 4FI8A 3ZHDA 3BSGA 4XXDB 1A6UL 1F0LA 2B0SH 4D94A 2H0PA 1UTDA 1VGKA 4KUZL 3BSZL 1CLOH 4UTBL 4FG4A 1N26A 5D1QA 5GXBB 1HX0A 2UZPA 4NZTL 4HULB 3EOTL 1PZAA 1O6SB 3MJ6A 5I8OH 1NOLA 4W9IC 4OZHF 4A6YH 4PBVC 2WQVA 3NVQA 4QMEA 2XU9A 4J3OD 1IMHC 5KVFH 3WIIH 4LHQB 3U7WH 5EZLA 4QRPE 2XIBA 5C0DA 4NHCL 1OE1A 4XB8A 4KC3B 2Y6TE 1ZK5A 4ZT1A 1RK0B 2AABH 3AT9A 4CUCA 2Q2EB 3BOVA 4FMKA 2UVFA 3OKKA 1E8WA 1FORH 1EAPA 1QEWA 4ZMLA 1DZBA 2OMXA 1KN2H 3OAZH 5L88L 3HNTH 3UAJC 1F4XH 3IGUA 2J8HA 3LPPA 3QZWB 3VFPB 4K5LA 3HBGA 4QRUB 1OD9A 1F2XK 3VG9C 2NTSP 1I9JL 2EH7H 2HKFL 5DQ9B 2FR4B 2O4EA 2EDTA 3FQTA 3RWJB 1I7RA 4YDNA 2Q87A 1J8HB 4LMQE 1XVSA 4WFHD 4P2OA 3U30C 1RY7B 3CFEB 5IVNA 2IMNA 3F83A 4TVSa 1NDGB 1ILUA 1FV1A 4JFVA 4N90E 5FGCE 5LXGL 2O5ZL 3X14A 1UT2A 5C0BE 3UZVB 2UZXA 2F8XC 1F58L 4LFHG 1L7TL 3L08A 5C0CE 2ISDA 3ARXA 5EFIB 3O6FD 4POUB 2DQHH 1OP5K 1JUFB 5B3JE 3HC3L 5GGTA 5GRUH 5GQBA 3MGAA 1RJYA 5CR1A 1VZHA 3CSYB 1JGEB 3Q8EA 4RAVA 2IPKB 3WDJA 2G60H 1N5YH 3C6LD 3HG1D 4GKNA 3SGDI 4PR5B 4M61B 1VJSA 4WEBL 3DO3A 3D51A 1E4XI 4I87A 3TBSB 4EZJA 1I7ZB 1P69B 1X3DA 3UG4A 1MCOL 1ECYA 4GAGH 3OHXC 1NEZA 2ATKB 4YDJA 5HYJB 1CLZL 4KY1H 1CD0A 2NY5C 4OLWH 2K8MA 1RUQH 1FL5A 2BS8A 4GPVA 4RIRB 4KKZA 4HUVA 2O6DA 1WBXA 4HGMA 4P59H 4WWKC 1IGML 2J56A 1NCWH 3RG1C 3TTSA 4HP5A 5GS2H 1EDYA 1QRNB 4GSXA 3RVXD 1NEZB 2ATKA 5HYJA 2ORBL 4NO3A 1DO6A 3TJPA 1X5FA 4EDWH 3MV9B 1NCTA 3VXRB 3D0LB 4NXKA 5AW3B 3BPLC 5B1CA 4L4VD 4QTHB 3DOSA 1LO2L 4QJ3B 4TQEL 1NAMA 4IYKA 2R4RH 3MRBA 1NEPA 2QTVA 1NGWB 1NCCH 4W9JC 1WWCA 3UAFA 1ZGLP 3IBEA 1NTDA 3IDMB 4FG0A 1JRHH 1ZAGA 1F8TH 1XAKA 4NQDB 4FN0A 1SOQA 4G6FD 4IGBB 1ZEAH 4KKLC 4TULL 1G1KA 2HH0H 3RBGA 4JPKH 4N28A 3MV7B 4K5MA 3I85A 5FYKH 1FCGA 2IPKA 2X70B 1UC6A 2B2XH 3F6JA 4PJFB 3C5JA 5KS9E 5I8EB 1HI6A 4YMPA 2NY7L 5T5NF 1XXFC 3OHXB 2PPAA 1P4BL 4U2ZA 1GAFH 3KL0A 5EO0B 4G1MA 5I1LB 3FQNB 2D0GA 4B27A 4LOEA 2FECL 3S3DB 4R97C 3G5XB 4NFDA 5C1MB 1UWXK 4WW1B 2MQ0A 3VFMA 2AEOA 4QNPF 2Y3AA 5FUOL 1WEJH 5IW6B 2C7UA 2F54B 2YLHA 3K6IA 1DVFA 1YJDC 4BDVB 1ZS8B 3C6LB 5C0AE 4M7LL 1PCXA 3OR7A 3QFJD 3MRJA 2WXLA 2WLKA 3L7EB 2QPUA 5E5RB 2B5IB 5I5JA 3AS0A 3V0WH 3GGWB 2UWEF 2APTA 1P7QD 3FTWA 2PCPB 2R2EA 3TU6A 1BBDL 4OV5B 4WV1A 4M6ML 5EUKA 1IRAY 3QQDA 5DZJA 2Z0BA 4GKLA 1PD6A 3OKNA 4M8RA 2PTVA 4Y89A 4JKWA 4N0UE 1HOCB 3CFTA 5GRJH 3TONA 2JJWA 3TYGL 2VM4A 1XGZA 1B3JA 4HUCA 3TVMC 2XHNA 3APNA 3LEXB 1UZ6F 4R5XA 4N8PA 3UIYA 3QXAA 4Q9RL 3RWDB 5DJCB 2O5ZH 1NC2B 5DHDA 4LL9A 1MJ7H 3GLAA 1VA9A 2HZHA 2YD4A 4OUOA 1E6OH 3BAEL 4HBCL 3OSVA 1JOIA 1PL3A 2AJZA 3MHZA 3QUYA 5J9PB 4U6HA 1E9QA 3DETD 3S2AA 3VFOA 3V0GA 2BMKA 4LQFH 3ARUA 1ZA3B 1IBHA 2NPLX 2BC4B 4X6BA 5EO1B 3MJ8B 1I7TA 2MHAB 2XV3A 5K9JL 4TNVK 1OAYL 4CADA 1XZ0A 3QIBA 1MNNA 1U8NB 4BK5A 3BPOC 3ZU8A 4F57L 3ATAA 3GMQA 3OC8A 4FX5A 2Z1KA 4JQVC 1GZPA 4XGZB 5FO9B 3QH3A 1KTJA 2ZSVA 4LCWD 4LPYA 4BFRA 1YHPA 3QXWA 5IJCC 2CJ3A 4B7IA 5J1TC 1XZ0B 1XIWD 3QIBB 1A9VA 2XN9A 1UWGL 2Q6WA 1OANA 4HH8A 4UDTB 3G5VA 1Z5LA 3E9TA 5KTEL 3ETBF 1EJFA 1J86A 1GZPB 4EBQL 1JI2A 5D1XC 3WV0A 5IOPB 3I2CH 3PWPB 1ZMYA 1XB6A 3ZL4H 5BQ7B 2Y2TA 3HS0A 3WE1A 5AW8B 3I50L 3V5HB 5A43C 2K6YA 1J8KA 4JFYA 2V7NA 1UD8A 3NSCA 3QXAB 3HUJB 3C9NA 4S11A 5D7KD 1A6WL 1BQHA 1H8LA 2IDCA 4HIJB 1IBGL 2D3LA 4ODUA 1DP0A 5EZJA 1CICA 4JDTL 1I1YB 2NYKA 4KBPA 3WNLA 1C5DA 3ARFB 3F8UB 4KVCH 4K7PX 4HKJA 5FYJE 3NP4A 3T0EB 4F2ME 2DQ6A 1P84J 3A6CL 3IGLA 1KG0A 3KWVA 3T0WA 4PLKC 2EDEA 2EUVA 3DHMA 1LE9B 2CO1A 2GJ6A 1HKFA 1U3HD 5IWLC 1G7MA 4MXWL 4W9HC 2VLRD 1IAOA 1WE5A 3IS0X 4J6RH 3WJMA 4DP8X 5AALA 2XN9B 2XQYA 4BCYA 3HE6A 5AVQB 1RZFL 1S9XB 2BDNL 3RL2B 4Z77A 2MKLC 3CC1A 2X4TB 5JW4M 1IQWL 3CHSA 4ZZKA 2Y6SD 4AJYV 1A3RL 4GRLC 4UAHA 3ZRFC 2J1YA 1TZGH 5FW8A 5I30L 4GRMA 2RCSL 1U8KB 4OLYH 3IJYB 5IVZB 5C0JA 4OZIF 3TZVA 3ZYZA 1UOKA 3S35H 1B2WL 2BNQE 4JREC 1IBZA 4KITB 1MEXH 1UA6L 1YQVH 1P7BA 3RY6C 2OMVA 2XV6B 4Y1SA 5J0BA 3AU1B 2C3VB 4UV4H 3IVKA 1B0GA 1KZYA 4NUJB 4AITA 1E8XA 3KYNB 1IBYA 3U4BL 2IJ0C 3ARDD 1I7UA 1UD6A 3GQFA 3MUY1 2UZIH 3L95B 5BZDB 2VE6B 3PQYB 2XZQH 4PVNA 3HPJB 3LS5H 4AQAA 2RHEA 2CAKA 3Q6GH 2P5EE 5KVEE 3MOBL 5IQNA 1S7RB 3FT0A 4WU5B 5MHSD 1FO0A 2E56A 3UGUA 5J5EA 4HEPG 3HLKA 2KDYA 2V17L 1KLGB 4JZOB 3QAQA 2GSGB 5HDLA 4PRPD 4RAUB 6PAZA 3DVFA 1DJHA 2N7AA 4P23D 2L7UA 2VMEA 1RK7A 5DC4B 3WDIA 4R7NA 4HXAL 2E5EA 4GRLB 3L4UA 3S5LB 3VFVB 2ZOLA 1DSYA 5IQOA 4HD5A 4GQPH 3FOMA 4O2CB 4JPIB 5K39B 3UX9B 3LN5A 5TK4A 2OMUB 4L2YA 2QMJA 3VXRE 1OAXH 3IF1B 2A9CA 5EU7E 1MQKH 4TVPD 2VGLM 4KNUA 1FZJA 1INEH 5JYMA 1UB5A 4FFTA 5LHDA 3FDWA 4ZTOH 5T1KB 3LV3B 3N5AA 1ZXQA 4D0DB 5DO2D 1KB3A 4N8VB 1QRKA 2X4NB 4EKXA 1CYGA 1TR7A 3IM1A 3E2HB 5MERA 3GSXB 4BEIA 1ACZA 3RIAF 1U30A 3FT4A 3SYOA 5PCYA 4NAMA 1C8PA 2HJLA 3CH1A 3D4ZA 5LVEA 3QPXH 1CL7I 1T1ZB 4RZCA 2GJZB 4AG4L 4X4XA 2OYPA 5TD4A 1JPSH 5BRZE 1MRCL 3T1FA 1D9KB 3BQVA 1M1XB 2FJGB 1LVEA 4DKFH 1BX2B 2FIKA 1ZCRA 1FH5L 3IRPX 4DKEH 1MDAA 2P5EA 5C07B 2O6FA 5I1AA 5E7FA 1AC6A 4G8GE 4QI3A 2A1WH 2NSXA 4KROC 2LFEA 3SDDB 1JUFA 3MV7E 4ODSL 2AVFA 5D7JB 3VWKD 4BA8A 3FUJA 4KI1A 1S8DA 4PTTA 4AMWA 1G84A 4NLHA 5TF1H 1MFAL 2Z64C 4C57C 4YR6A 2CPUA 4C56E 2GTQA 5C0AB 1HK6A 2QLVB 3U4BH 5GGUB 5CCKL 3QRFM 3BP4A 3NJFA 3OZKA 3ALWA 1I53A 4C56B 3ARGA 2E27L 3A4FA 4PJBE 1PJ9A 4UYQA 3VQ1C 5G2NA 1EO8L 4TXVB 1R1CA 4FI6A 1DN0A 3C60C 5FKPA 2Y7SA 1EXGA 3L5WB 5CP7B 1AGDA 2NQ3A 5IGXL 3ZMNA 5KANI 3F2LA 5EOCJ 4V1DE 4Q2ZB 2DQMA 3MV9A 5ADOH 1H3UA 4ALAC 4QO1B 5M95B 5EUOF 3BKYL 3F6IA 1QVOA 5TDNA 3KLSA 3LH2L 4JG1L 4LKCB 4MB3A 5D1XE 4BFEA 1HKLH 3NJKA 3N0AA 5G4NA 3U9PH 4Y1AD 5DSCB 4FFYA 2KLTA 4TULH 3FCBA 2Q2LA 2WVSA 3FN0H 3KPRD 2ESVD 4P06A 5TQ2H 1NZRA 1BM3H 2WQAA 1EDHA 1ULVA 4JBSA 3OZLA 1IM9D 2JF1A 5KW9L 2WVVA 4G9FB 2CE6A 3WLWD 3WS3B 1R9FA 4KXDA 3RPBA 1C16A 4KGJA 1OV8A 1WG3A 2HRLA 1YJDH 5F7WC 4CMMA 4JM4H 3HRZA 5HPMB 1DSFL 4KVCL 1TEGA 2MQCA 3LIZL 4WCYH 1CFSA 1CIDA 4G8AC 2BS9A 1DQDL 5HDQL 2Q86B 3T1FB 3SKNA 3J27A 3KPPB 1H8SA 3RWJA 1S3KL 4J3OF 3ZT5A 2F0CA 5HPMA 3S88H 4YPGB 4HJ0D 5JNYB 3Q8CA 1G7JA 4OCYH 1EAQA 5E6SB 3RKDD 1EVUA 5IESH 3N6YA 5F7UA 2EILB 2Y24A 2TSBA 2FHBA 2Q8BL 1G7QA 3RDJA 3FTGA 2R83A 1NJ9A 4JN1L 3QQ3B 4PG2A 4HCRA 1KV7A 4G1EA 5EUOB 5FK9A 3P0VH 4F2EA 1A9EB 3RX7A 5CBAB 5GRUL 2R4SH 5CN1A 1RHFA 1QAWA 4FQXA 5F0PB 3U82B 4POZD 3ZTNH 4F20A 3KZ8A 1DVQA 1AP2B 1UWEH 1IUZA 1ES0A 5EBLA 3BZ4B 3WTSA 3OKDA 1V55B 3SOBH 5I82A 1HSBA 4N8CH 4ZSOE 4YBLC 3CZFB 4PM1A 4A2LA 1NBZA 3MRPA 3MA7A 3QJFA 4LGSB 4U0RB 1N5AA 1NIDA 1KBVA 2MRYA 1LP9A 1SM3L 3VI4F 1HJBC 5I1EL 4BRJA 2ATAA 3U2IA 3ZDXE 1U3HA 3MO1A 4PRNA 1FFPA 3DJTA 2WNWA 3IETB 4P99A 4R7NB 1E5UI 1NFDA 4F15C 3MUGA 4DZ8B 2VN3A 2ZSWB 3JZ7A 3UTTA 3V8CA 4ZMTA 4BUQA 1QR4A 4OLZH 1V05A 4JCWA 4G6JH 3T1WA 4X98B 4F33B 4QJ4B 2A9AA 1AJ7H 3H85A 4OAWB 3LHPH 2A9MH 4ZFOB 3VNYA 3CGTA 3QFJA 1P5VB 1P6FA 2ITFA 4M43L 3TO4B 5I74C 1K4DA 2E7CA 4NQCA 3VWJB 4PUBH 3VWJD 5CKGA 4P2RA 3HE7B 3GMRA 3OAWA 4PB9L 4LLQB 4X5LA 3BO8B 2SEBB 3JT0A 1T83A 1PMYA 1JWSB 4WSJA 4AYMC 2OMXB 4K5NA 3FO1B 2JKWA 4CDHA 2GJZA 3AFLA 3VXMD 1P4IL 5FIEA 1UH3A 1WRFA 3DGDA 4UM9D 2R9HC 1KJMA 4XP6H 4MMZB 1HEHC 1KDIA 2VO8A 2HFFB 4DKDC 2HN7A 2WNXA 3FFOA 1E28B 2K70A 1DDHA 3ZDZF 1EJOL 1TSHA 1LP9E 1U8JA 3SD2A 1WZ1H 1WAAA 3V5HA 3LZNA 3EGSA 1CR9H 1J9QA 1T5XA 3FFCE 3RDTB 3QJQB 5L7XL 2YMXL 2GG1A 3LVTA 2DQJH 5HHVH 1NOFA 2ZICA 3BXNB 3ULVD 1K5NA 2E0PA 2QVTA 2AQTA 4ISVB 4I77H 4JHZA