2J21A

Human p53 core domain mutant m133l-v203a-n239y-n268d-r282w
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
193
structure length
188
Chain Sequence
SVPSQKTYQGSYGFRLGFLHSVTCTYSPALNKLFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCYSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDWRTEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords CELLULAR TUMOR ANTIGEN P53
publication title Structural Basis for Understanding Oncogenic P53 Mutations and Designing Rescue Drugs.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 188
sequence length 193
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j21A00
5AOKA 3VD2A 4IBVA 3Q01A 2J20A 2IOIA 2AHIA 3ZMEA 1GZHA 4LO9A 2BIMA 2BIPA 2J1WA 4KVPA 3WTUA 3QYMA 4IBZA 4IBWA 4L0YA 2OCJA 1YCSA 5BUAA 1HJBC 5A7BA 1GZHC 3D0AA 3KZ8A 4IBQA 4XR8C 3VD1A 4IBYA 4AGMA 1H9DA 3US1A 1EAQA 5G4MA 2BINA 5ABAA 5AOMA 2J1YA 2H1LM 4LOEA 3KMDA 1EANA 2WGXA 4AGOA 3WTXA 3WTTA 1T4WA 2P52A 3EXLA 2AC0A 1UOLA 3WTVA 4IBUA 3EXJA 5AOLA 1CMOA 3WU1A 4MZRA 2YBGA 3D07A 2FEJA 4IBSA 5AOJA 3TS8A 2X0VA 4IBTA 5AB9A 4AGPA 3US0A 1EAOA 4G82A 4AGLA 2J1ZA 1KZYA 3D05A 4AGNA 4AGQA 5ECGA 1TUPA 3WTSA 5G4NA 2BIOA 4IJTA 3IGKA 2ATAA 5G4OA 2MEJB 4QO1B 3VD0A 4G83A 2RMNA 5LGYA 5AOIA 2J6WA 2X0UA 2IOMA 2J21A 1HJCA 4HJEA 3Q05A 4GUQA 1CO1A 2IOOA 4L18A 1IO4C 4LOFA 2GEQA 2X0WA 1TSRA 2PCXA 3QYNA 3D06A 1LJMA 3IGLA 2VUKA 5KBDA 1E50A 2BIQA 3D08A 4GUOA 2XWCA 2J1XA 3WTYA 2XWRA 3WTWA 4L0ZA 1HU8A 3Q06A 3D09A 4MZIA 4A63A 2ADYA 5LAPA
chains in the Genus database with same CATH superfamily
4Q4EA 3BMVA 2WCPA 5K9OB 4NQSA 1DQJB 1FN4A 3KPMB 3OAZH 3MA7B 1SVZA 2ZKXA 4YSOA 1UCBH 4MJ6B 4QNPE 1MQ8A 4ONOA 1NEZB 3PQYA 4WTXA 4E36A 1IBGL 4FFVD 5DJYB 4JKWA 4NN5B 2WBJB 4CMHB 3MR9A 1I9JL 2C9AA 3U2JA 1IBBA 2B5IB 3L3KB 3V52L 5IFAL 3VD1A 1AHKA 5D2NC 2GFBB 3WFCL 5AL8A 1OIOA 4ELKA 4B9GA 3KD4A 2JJTC 4YL9A 1ZLVH 1U4FA 1RZJL 5CP3A 3ISRA 2CBOA 5SV4A 1TZIA 1IAII 5CEXB 3HZVA 3HPLA 1OARH 3RTQD 1OGPA 5F7DA 3G5VB 2H6OA 4ZW5A 3THMH 3AWEA 5BVJB 5I16B 4PJDE 1YYMH 4Q8BA 5F7LB 3EJRA 5JIPA 2B16A 4FYRA 4HS3B 3DHUA 3IXTA 4KDWA 3HG5A 1OCRB 4LOUD 2YZ8A 3OKNB 4Q6YA 1RZGA 5AUMB 3GJFB 4DK5A 4RMSA 3AACA 2C3WA 3TS8A 1DUZB 1EHKB 1FH5H 4YXHL 3F6JA 1A14H 3ZDZF 1UYWH 2YXFA 1V3MA 1BM3L 1X3DA 3A22A 3CFCH 3GSVA 3PQYE 4LGPB 5L2KA 2J1ZA 3OX8B 1CTOA 3BMWA 1CFVH 5ES4B 1D9KC 4G2AA 3D69B 4P2OB 4GQPH 5CLZA 3WG7B 3UO8B 3EOAA 3LIUA 2QADC 3BKYH 4YX2H 1MEXH 1OSYA 5DURB 1DDHA 1YUKB 4JS7A 3HG1B 4HUKB 4L1LA 1OP5K 4DESA 1JWSA 2WBJD 3LS4L 5D4IA 3PV7A 3KJ4B 2EABA 3L1GA 1YMHB 1NBZB 2HT2D 4NP4H 3GXUB 1G6RH 3Q48A 5HYQB 3VFNA 2NQCA 2XHNA 1A1MA 2Q20A 3RWGB 4E41D 3HE7D 4N8CL 1KCBA 2A0LD 5HVGB 5DMGC 3L3OB 2QR0B 4KGLA 1HC1A 4Y19B 4FLHA 1H3PL 3MGTB 5KBKA 4ZFFB 3MLUL 4CVXB 4KKZA 3MJ7B 2YEQA 4Y9BA 2VDPH 1A3RL 1I8MA 1QQDA 2JK5A 1FDLH 3IAPA 1NEPA 1URZA 3WNMA 4FNLH 1MFCH 1QKZL 2ZF9A 3PP4L 4HLEA 1P5UA 4GI8A 5I73C 3TFKD 1U58B 4NNYB 3MFGB 4X5QA 3KEHA 3GZOA 1MXGA 4R0LB 5L2KE 2BC4A 4CU8A 3OV6A 5CMAA 2MCAA 1MCPL 2MKLC 3U79A 5JW5B 3KLQA 5T3ZD 3WD5H 5K59E 4JG9A 3I6GA 5FYLL 1YNKH 4RMWA 4M8QA 5EWIL 32C2A 4PJFB 3BQUD 1BJMA 1YEIH 4P23A 2Y7QB 2CPCA 3QQXA 5JW4Q 5E1GA 5I5JA 2VCOA 5H4YA 4YXLH 3TBWA 3W2DL 2CR0A 3HG1D 1LDPH 1ETJA 3DX6B 2OTUA 3GMPA 2XVBA 5DU7A 2BNRB 2ITFA 3BAEL 5BNXD 5AD0A 2AXGA 1YNLH 4JDVA 3S0PA 2XXFA 2AKRB 4A39A 1MW1A 1MVFA 1AJ7H 3FF8A 1Q0XH 1MCDA 4ERSH 3SPGA 2O1AA 4L8DB 1GR7A 4F91B 2ZXQA 3V5DA 5E6IA 5AWNH 2YOCA 5ID0A 5A40E 2OJ1A 2VC2B 4Y19D 4KHXL 1AYOA 1CD1A 5EFIA 3OJ2C 2LHAA 2QKIA 3ZZLA 2BRQA 1DN2A 3WU1A 5BVPL 1E27B 1J1XH 1JF5A 1H6FA 3ZT7A 1DZBA 2G5BB 1ACCA 5T5FL 1BAWA 4PJGF 4ZI8A 2ERJC 3IDMB 3GTVA 4D0DA 1NGYA 2V9UA 2CDGA 4HIPA 2VO8A 3FOLB 3QO1A 1KZYA 5IVXB 3N1QC 1HAUA 4ECNA 4JANB 2PKDA 5AW6B 4PB0H 1QAWA 5GZND 3O6ML 4RX4D 5GGVH 1KIQB 3G04B 4JKPL 1FORH 4JHVA 1CYGA 3HBPA 1VERA 2NW3B 4IQHA 4LCVA 3Q3GA 4JO4H 4NKOB 5LXVA 4UYPA 4DPRA 3BT2H 2P5WA 2KHAA 4NC1E 4WW1B 5AYQA 1BIHA 1EERB 2EDOA 2WXMA 3MODL 5H37G 4YFDB 3RDJA 5K9OA 4WI3A 1DQJA 1RIVH 5MI0B 5CFAA 3MA7A 4PRHD 4TQIA 1CI5A 1WFMA 1A1OA 4UQEA 3SCMD 3QEQB 4K7PL 4G7VL 2BNRD 1NEZA 1T89A 4GW4B 5CGBA 2EVFA 5DJYA 4KTGA 3DUUB 3TV3H 1E7VA 1URLA 4G6JL 2NZ9D 5CSZB 4IDJH 1NM9A 1W0VA 4TM9A 3L3KA 4HUMB 4P07A 4WWNA 4YSTA 2GFBA 4DGYL 1DBKH 4UDUA 2I24N 4G8AC 4Z7QF 1KFAH 2FJUB 5CINH 4QNPF 1EMTL 5F21B 1CICA 4R7DB 4HAFA 1QVOA 4APXA 1TDQA 4TQEL 4G5ZH 3G5VA 2EDTA 3PGFH 4U1SB 5BVJA 5I16A 2ZUSA 5IT2H 4DERA 1RMFH 3GMOB 5DLMH 4Z0BH 3S96B 2CU9A 3G08B 4EKJA 4P49A 3L3JA 3F5WB 3G5WA 4XP9H 2P5WE 5IJCC 4TTGA 2IXQB 3ZOAA 2QPUA 1NCDL 2Y7OA 2FSDA 3OKNA 1G9MH 3HUJF 3GJFA 5AUMA 1TTUA 5K39B 1B0WA 2GSMB 1DUZA 2BSRB 2VAAA 3GSUB 3HNSH 4AVIA 3H0TB 1QSVA 1MLCB 5JA9A 4XVSL 4P2OA 3D69A 2E7LC 4DSYA 3MCG1 3FTGA 4X7FC 1I3UA 1F4XL 3TGXA 4U1JB 3HRZA 1ZA3B 1BZ7B 4MMZC 1UZ6E 1GPOL 3GRWH 5T1DH 4GXVL 4F8TA 1DHKA 4ONFH 4YUEH 5I0XA 5IV2B 2L7QA 3FULA 4K71C 2X4UB 5ID1A 5JHLH 3ZKSD 5HYQA 1CLYL 3DX8A 2PWGA 4WJKB 4U4BA 3SDCB 1UA6L 1RL1A 3T5WA 3RWGA 1XBRA 2YXMA 4JO3H 1MQKL 1A6ZB 3L3OA 2QR0A 3EH5B 1DL7H 1SLVA 3PL6B 1IB5A 3EYUL 3QORC 1QBLH 4KX7A 1UENA 3MGTA 4WRLA 1TYJA 3KH4A 2XN2A 4TQPA 1N64L 4CVXA 3MJ7A 4X7CC 3BKMH 1XX9C 4I0PD 3QNFA 1UD6A 3QXDB 4K7PX 5IESL 1GCFA 1H3XA 1B4JH 2R0LL 1HYSD 2J4WL 1R5WB 4WWPA 2Z7UA 4NNYA 4N2BA 4HXAL 3LB6C 4M43L 2J21A 5CCKL 1FGNH 1OPOA 3BE1L 3LRLA 2VH5L 3MLPA 4LARL 7CGTA 2YAQA 5JW5A 4FJZA 4YE4H 1SXNA 5EO9B 1F42A 4ZBJA 2O5XH 4DKEL 4TSAL 4DW2L 3NJLA 3UIZA 1J9SA 2IF7A 4PJFA 4YLCA 2Y7QA 4H25B 3NP3A 3VQ2C 1MH5B 5D1XB 2AEIT 1NIAA 3FCBA 3D08A 1YY8A 3D4GA 4FQJL 4PJIA 2CBMA 4L23A 2MSPA 3WTWA 5DZNA 4PV9B 5F7YC 2AKRA 5K59F 3FAXA 4F2MB 2VR9A 4PJAB 5E94B 2MQ3A 2Z6FA 4A2MA 3AS1A 3LMJL 4L8DA 3SE8H 3VRLE 3FCGA 4G8FA 4OUOA 3AREB 1MZYA 5ESAA 3BDBA 1OAKL 4HKZB 2CHZA 1KGXA 1GAFL 4RFNB 3D85B 4NBZB 1MLBA 4ZW7A 3D87B 4Z3TA 4N2NA 3VFWB 1JWUB 1S7WB 2FL5A 2NY6C 1E27A 3N6YA 3HLKA 2G5BA 4PCKA 1LEGB 4IBYA 4KKQA 4FG0A 4M93B 1WWAX 4PYGA 1CDIA 4DVBB 4R4FL 5CN3A 5C3TA 1XL4A 4NC2B 1HYSC 2L8AA 4OGAD 4J3OF 5IVXA 3B3IB 3OR6B 4PJFE 2DMKA 5F9OL 5F0PB 3RY5A 1P5UC 1BAGA 1CXFA 5KJ4A 1VACB 2C9SA 3I6LE 3G04A 3A21A 2G3XA 1W6LA 4NKOA 5GJTL 3EFFA 4AQOA 1CGVA 5DYOB 5D1XD 4KXCA 4QTIL 1TF4A 5AW8B 1RFDL 3L1EA 1Z9NA 5TFSH 1E6JH 3ZL2A 1J1PH 4R7LA 1TJIH 1N70A 1WFIA 3QEQA 5IQ9B 4Q9RL 3VX1A 1RUPL 5F7MC 4WHTB 3V9CA 3MXWH 3ZXAC 5L8JB 4MA1B 3DUUA 3LNDA 1GY1A 1L0YA 4WU5B 3UTSB 2F8XC 2XZQL 3D2UA 1OGAA 1WUZA 2YD4A 1PS3A 4NN7B 1BM7A 5CSZA 3AU0A 1NINA 2HJLA 3L7FA 4N0CC 4N3TA 1FNEB 2V8MA 4HPOL 4JUSA 4TTDC 3ARED 1IBZA 3VXNB 5EU7C 1IAKB 4NC1C 1AH1A 1R5IB 3F05A 1SHWA 3D85D 1HL5A 4A7QA 3Q2CA 4R7DA 4BFNA 1WD9A 3GI8H 5IHHA 3SB3A 1SBBA 4HS8L 2X4RA 1JV2B 4PP1C 5IVXE 3F12B 2O6FA 5INDB 2DN7A 5DC4B 3U2IA 5AVTB 1HZLA 2QKIC 3HOGA 3L45A 4J23A 4PSPA 4XNUH 5J5EA 1S9XB 4NI3A 4ZMOA 3G08A 3D06A 3HC3H 1JGDB 4IU2B 3CXDH 3A4EA 4ZW8A 1ZTXL 5K39A 4DTGH 2BSRA 2E59A 1WCBB 2B9AA 2J1XA 3GSUA 3QEQE 1BAFL 1MVYA 5GJSL 3H0TA 4JY4B 4C8XA 1MLCA 1BQ5A 1HCZA 3LH2L 4NM8L 4CADB 4BINA 2B2XL 3H9HB 1OGAE 3LZLA 4KTYA 2IMNA 5KSAC 3BAJA 4U1JA 1GJUA 1AY1L 1MCQA 3QEGH 3T4AB 1LO4H 4AVKA 1IGCH 1BZ7A 1ZA3A 1JRHH 2GG1A 3AADB 3UTSD 3IMRA 5LQBH 5IV2A 5DMYA 5I1GH 4ZD3H 2X4UA 1TQCB 5IHZB 2CHNA 5B38G 4WEEA 3SDCA 3IWUA 5BS0B 1T89C 1YCSA 1AD9A 2VRKA 1AP2B 1AS8A 5SWSB 3V6ZB 5FYLD 1T7XA 2CO6B 4NN5C 1A6ZA 4YDIH 1S8DB 3H42L 5IHBA 3PL6A 5CCJA 1YVLA 2BFVH 1KOAA 1UZ6F 3P73B 4M6ML 4NDMB 5GRVL 4DCQB 2WXHA 5CJXA 2IDTA 4DAGH 3W81A 3M1OA 1E42A 4YFLI 1R24A 5BUPA 1C8PA 4R4BA 1CICC 1R5WA 3MX0B 1BVNP 4ABUA 1DSYA 4MA3B 4XOAA 5JPNC 4EUPA 1E4JA 4HT1L 4XC1H 5EU6D 5FCUL 3EYQD 4NQUA 3IYLW 1EO7A 2FGZA 4W9JC 1D5ZB 5C6TL 5EO9A 2VDRH 1KEMH 4CVZB 4TOYH 2E6JA 4QKTA 1RKRA 2WXKA 2D7NA 3I74A 4XMTA 1ITBB 5CBEB 1T7YA 4BKTC 4H25A 4KUCD 3EJJX 4CSPA 1MH5A 3ZT5A 3V4UL 5IHWA 3S8WA 3ZL4H 2IDSA 2W65B 3CN4A 2IGTA 3DTUB 2CNYA 4JM4L 5CSGA 2ZYSA 4ZYKA 4DETA 2HT4C 4P2OC 1GCYA 3HBQA 1MRFH 5B4MC 3I9GH 3RPKA 1QWNA 3EGXA 2YWZA 4F2MA 4PJAA 6TAAA 5LGJB 3X3GL 3RFZC 3VG9B 3HRZC 3O11A 3VSVA 5BS0D 1YECL 4JPKH 1NEUA 3AXHA 3U0PB 4XO4A 5JA8B 4WK4B 1E4XH 3KJ4C 4W9KC 3F7YB 1OTSC 2VZUA 4GI9A 1MWAA 1IQDB 2PTUA 4Y8AA 2GEQA 4ODUA 3UJJH 5L4JA 1JWUA 5K9KB 1A7BA 4JDZB 3ECUA 3GB7B 5LBSL 3ROLB 1GGTA 1NPUA 4PGCB 2KMWA 1RULL 2D7TH 2OR9H 3L1OH 2YGVA 3VU2A 1LEGA 1CLOL 1Z6JT 2P45B 3F6LA 1JVOA 4NBXB 2DQTH 4TVSa 4DVBA 1JVKA 5CGTA 4LHUB 4HG4K 2D0HA 4UB0L 3C75A 1ZHLB 2IDFA 3B3IA 3OR6A 1OB1B 2AQ1A 4FNQA 4GKNB 4GG8B 3NCBB 3LHPL 4PMFA 1VACA 4JHWL 2HYMA 2Y36H 3PGCB 3DK2A 4QHNB 3FRUB 2AFNA 4Z7NB 4OLZH 4XXDB 1V05A 3L8QA 3IGUA 1L6PA 5DYOA 4ZPVB 2APBA 4OFYA 2CLZB 1BREA 4F2ME 1BG9A 3E2HB 1GVIA 4PJAE 2Z1PA 3FZUD 3WIHH 5JYMA 1HINH 4KZDH 3TEXA 3O3DB 2PPFA 4EIUA 1EJ6A 3RIFF 1S6NA 4WHTA 1A7PH 2JB6A 4JFDD 1SY6L 1S5IH 3MRKB 3FFCA 4WU5A 3QCTH 4JZNB 3SDYL 3NMEA 4K73A 1B0IA 3X12B 1A9VA 3BQVA 1BFVH 3EJYD 4PJHB 4PRPB 1IJNA 2JKJA 2VERA 2XV0A 1IAKA 5I8CB 2C7FA 1GKEA 9CGTA 5SV3A 4EXKA 1VFAB 4QWWC 3QJUB 5L88L 1G7HB 3P4NB 3FYEB 1FL3A 3K4DA 1XB6A 2QHRL 2OJEB 4KZEH 1MFUA 3IRPX 4R6UA 2VDOH 1YN7A 3FO0H 2PR4H 2FGWH 3O0RH 2WNKA 1FSKB 2R0KH 4XVJL 2DMBA 5INDA 2VLKD 4FNRA 3EJZC 1DJYA 2BNQA 3OKYA 5FOBB 1NCBL 5EC2A 4N6QA 3EOTL 2YSSB 1S9XA 2Z91B 1F6FB 4F27A 3U7AA 2LFEA 2WINB 3MI6A 2X0VA 4FQCL 4DUWA 1JGDA 5I76B 2YK1H 4IU2A 1F6AB 2G60H 4DUVA 3C8DA 1JVLA 2OJZH 1WCBA 2FECL 4XP6L 3D7PA 2A1WL 3HJ0A 1AZZC 4NRZB 2X4SB 4BIKA 3P4MB 2DM4A 3FFCE 4CADA 3PJSB 3W9EB 4PUBL 2OZNA 5T5FA 2BXZA 25C8H 3T4AA 3IDXH 3ARFC 1BBDH 4J3OH 1U8IA 1QBML 3LQZA 4ZTEA 1ZPLA 5FYLE 3DETD 1F97A 1L5GB 1PG7W 4WF7A 1TJGL 4K2UH 4PRID 5IHZA 2Z93B 3BWAB 2VB5A 1OLLA 2Z7WA 4PRPD 5GGTA 5HJBA 4AW7A 3QQDA 2VZVA 5SWSA 1H0DA 1MDAA 3WIAA 2CO6A 2AJ3A 2WLMA 3EO9H 3FT4A 4K5OA 5A43C 1S8DA 1T0MB 2BNQE 1P69B 2VSDA 3E7JA 3P73A 4WHYH 2XWRA 1CZ8L 3P2BA 4NDMA 2QQLH 4DCQA 3CMGA 4HV8B 3FB7A 1B4RA 4AEEA 4GMTH 1IAOB 4E9TA 5I1JL 4J4PC 3G9VA 2ZYRA 2EINB 3K3QA 2F7PA 2FYYA 2HT3C 2K3TA 3P2TA 1PCXA 5EB9A 5DMJB 4JJOA 4RFEB 3V6FB 5HI5C 1NQBA 5E5LA 2QZQA 1F90H 2G2PA 2BIPA 3ECBB 1MG3C 3NG5A 4NXKA 3TJEL 5ADOL 1M53A 5CEZD 4X83A 3KBFA 2FR4B 3QHZH 3QA3A 5A7BA 4QHUB 2HG0A 2EUVA 2PN5A 3WSQL 3L5XL 5EEVA 5H4ZA 2KZKA 3QDAA 1I82A 1M71A 2XDHA 3WFEH 5D93B 5EZLB 1G94A 5SWSE 3CX2A 4A7GA 2Y5TA 1L7TL 2ATKB 4KDTA 2VXSL 5I2IB 4OZ4B 15C8H 1A7QL 2HAZA 1MCOL 3V0HA 3NN8A 5LGJA 1SYVB 3RL1B 4XPBL 4HDIB 1IZJA 2YD0A 3IDNB 4POZC 3RJQB 4XTRC 5MEOB 3U0PA 4FG2A 3P02A 2RBLA 3F7YA 4OI7A 3B6SB 5AEAA 4PD4K 5D96B 1Q90A 4JFXB 5F7EH 3SDCC 2OSLB 2DBLH 3WI9A 5K9KA 4JDZA 2F7RA 4HCGA 3GB7A 3ROLA 2ZF8A 1Q8MA 4PGCA 3BVUA 5AVWB 5KVFL 2VW6A 4KY2A 5I26A 4DKFH 5I30H 4BSWB 4PW4A 5KBPA 3HIZA 2FK9A 3WUWB 4DP9X 4LDOB 3BC9A 1DVFA 3CFBB 3FT3B 1U3JA 1PAMA 4LHUA 1GKOA 4G70B 5CJXC 1ZHLA 4JN1L 1PZ2A 5I1IL 2YGNA 3NA9L 2X2JA 1IBHA 2RMNA 4GG8A 4GKNA 4OLXH 1XSJA 1HNFA 3P4OB 1T1XB 3PGCA 1EX0A 3FRUA 2DD8H 2QVFB 4KXZH 2BOLA 4XXDA 1RSFA 1NWOA 3WN5B 4JLRB 4AKQA 4L1SA 4ZPVA 2AP2A 2XWZA 1WP6A 2P8MA 3BFQG 3TT1L 2DMHA 1G7MB 3EH4B 3VQLA 3EOBB 2Q1EA 2ZXDA 3C5JA 5TE6L 4NN6B 4X5RA 3O3DA 4OIIH 1PLGH 2RJMA 1CL7H 4KDVA 4PLKD 2EE2A 3T4YB 5HHXH 4YHKH 5D1ZI 1NOLA 3CFKB 1UWFA 4YDJA 4CSZA 4Y5VC 4JZNA 4F2FA 4GOSA 2I07B 4JRYA 3HJEA 3X12A 3MOAH 5A6MA 3NCYP 4GYBA 4PJHA 2YQGA 4UM9B 5LHDA 5CM1A 2IG2H 2IAMB 5I8CA 1B0GA 1QI3A 3F8UB 4NM4L 5LAPA 3ZUNC 1UWGL 4X5XB 3U36B 1AIFB 5T3ZH 4ATTA 1G7HA 1MJ8L 1UXSB 5DT1H 4FNSA 2HLEB 1PX4A 2OJEA 1QFWL 1A4AA 3PHAA 3UGXA 5AW7B 1XR8A 4ONGH 4WUKH 3LEVH 4QR7A 1IGJB 3GF8A 3Q1SH 2G3NA 2M2DA 2WCGA 5EU4A 5IQ7L 1CFNA 4XAWL 5C6PB 2YSSA 5TDPA 3I6SA 1WICA 1P1VA 3DTDA 3MTRA 3K6OA 1N3NB 3X1GA 3WY3A 2DTSA 5DVOA 1L7IL 4HQQL 1O5DT 4UV4L 1A6TB 1F6AA 2R29H 4YQXH 4WI0B 2M26A 2A38A 1JWMB 2WTOA 5DQ9A 5HHOD 2YC1B 2ORBH 4J3XA 4NUJB 1I9IH 4MDJB 4L2YA 4NRZA 2X4SA 3H7BB 3P4MA 5CJOH 4Y5XB 5T5NF 2QTVA 2ZWSA 3PJSA 2YMXH 4QAWA 4JRYE 3W9EA 2DQMA 2WIIA 1FVEB 4MNQB 1EJOH 2GHWB 4PJHE 2RCSL 4PRPE 4I88A 1MIEL 4JB9H 4XVUC 3ZVVA 3IFLH 4KGJA 4WI6A 1EO8H 4GRLA 4KAQL 2VXQL 1GGBL 5LAXB 1TTCA 3J07A 4M1DH 1L5GA 3ZTCC 2F9BT 1IGMH 4WV1B 1G0YR 2FSEB 3LVTA 4QRRD 1NCJA 5PCYA 4LRNH 4WO0A 3B2UC 4APQB 2MPVA 3ZHLA 1BZ8A 4OLUH 4U1MB 4JFSA 3V55A 4F1SA 4OF5A 4BHUA 5J7CC 1VIWA 3UAJA 4BYHA 2X2YA 4O4YL 4HC1H 4JHAL 2OMXB 1O6SB 4L4VB 4BUQA 1MF2H 1D9KD 3QW9A 1J9QA 4EO5A 5SWQB 1ACZA 4N0YH 5AAPA 3GUFA 1NTDA 4HV8A 4F33B 3LZRA 1XO8A 4Z18A 2EQDA 3AUWB 1IAOA 3GC3A 3CG8A 3NJXA 3O8XD 5DGQA 4DF9A 4YSSA 1A2YB 4OBRA 4XGZA 4O9HL 2ZG2A 4OZGB 4MXVF 4RFEA 3S98A 3CXFA 1IO4C 4HHAB 2WZ0A 2I5YH 3FTWA 5T1KD 3ECBA 3MLXH 4NO3B 4TUOA 3FT2B 2HLAB 4AEFA 3CZSA 1LD9B 3T09A 2A3TA 1QI5A 4PSRA 4HHWA 1XH0A 1J1OH 5DMGD 2FR4A 1QW9A 1KB5H 4QHUA 4ICXA 4EDWH 1E7UA 2IADB 4I77H 5C6WH 5K5YA 4KQ3L 5L6YH 5FECB 4FZEL 3HS9A 4MNQD 1BD2B 3AG2B 4HFUL 4PCYA 3R4DA 4V1DB 3BKCL 4K9EL 3JZYA 1K6QH 3N85H 5ISZD 4QLWA 2X9XA 2ATKA 2BY2A 4KUCF 5B8CC 1IT9H 4OZ4A 4U1KA 3EIFA 1XWVA 2XY2A 2GJRA 1M4KA 1SYVA 4RDQF 3RL1A 3QG7L 4HDIA 3IDNA 3MBWA 2ICWJ 4PR5A 5MEOA 4F7KA 2CIKA 3T77B 2Y1AA 5E99H 2Z35B 5AZEL 2IEPA 4JFYB 5CU9A 3A24A 3KVDD 1CLZH 1TQCC 3LRHA 3PF2A 4JFXA 4L4VD 2ED9A 4OI8A 1T20B 2OSLA 3OXSB 4HIJA 5ACZB 4B9YA 5C0CD 2A6JB 1D5RA 4AGMA 4Z8FH 4KFMA 3BESR 1EAQA 4C56B 1UH4A 3IK2A 4QPEA 4BSWA 3QPQC 3CFBA 3CVBA 3BIKB 2FQEA 4JFPA 4Y1AB 4NS0A 3QNXB 2PW1B 4KV5F 5A16B 2E9IA 5KVDL 1OAXH 4ZQTA 3IE4A 1YMMD 2XQYA 3GFUA 1AQ8A 2HUEA 4KJPD 4RAVB 3P4OA 1T1XA 2K6ZA 5JHMA 2WN2A 3WTVA 1AG0A 4NZ8A 3Q9QA 4XE0A 3R4RA 1C1EL 2R2BB 3WN5A 4JLRA 1DO6A 5JOFA 4L5FL 2CKBH 4RGOL 1BD2D 1G7MA 3DMMB 1OAQH 4V1DD 1IRAY 3EOBA 2R4RL 4R7VA 4EVNB 5AW1B 1LO3L 1JSYA 1ZTXE 3T4YA 2I7SA 4YL4A 2A4CA 1A7OL 3CFKA 2UWEB 3HS8A 1HQ4B 1KCVL 3JWNE 4NZJA 1E6OL 1I75A 4TXVB 5FGRA 4UM9A 4HD5A 2IAMA 1E5UI 5FUCE 3KHQA 2OPCA 2PYED 5IR1B 3APMA 1KTDB 4X5XA 3U36A 1AIFA 3AGWA 1AHWC 1QHQA 1UXSA 3MOBL 3MXVH 4GS7C 4IK6A 3PAYA 2X09A 3H53A 1I3RB 4KK5C 4V2BA 4AC4A 3RUGA 4DEWA 3UJTH 3G5YB 1FV1B 2VSKB 3TFBA 4XPHL 1IGJA 1IFHL 3VX0A 5DUPH 3VTMA 5IJVA 1LO2L 4NFDA 3SEPA 4OZFB 5ANMA 3ILQC 2CK2A 2BVQB 3CHOA 2VWEE 2VMCA 3IMWA 4FG4A 3O6FA 3OC8A 1N3NA 4HKXA 2E4TA 3AQDA 3ZZSA 2Y2TA 2A74B 2HX7A 3CH1B 5D8JH 3BRDA 3GXMA 1DVFC 2OYPA 1RU9H 4K0OA 4WI0A 3RGVA 1JWMA 3C9NB 3ZKNC 1SMOA 2ADYA 2VDKL 2YBRB 3MA9H 5HI3C 2A9DA 4MDJA 5FLVA 2NOYA 3BPNB 3H7BA 3IPFA 3FRPG 5IJKA 3QR2A 5I0VA 4Y5XA 5TH2A 1FC1A 2ZXCA 4K7PY 5E9DB 4Z7NF 4UAOC 4XPFL 1FVEA 4N85A 3DI2B 3K2UL 2DKUA 5E5MA 2J1WA 4OIFA 4R4ND 4GBXD 4URTB 5CZRA 3NIDF 4R8WL 1I9JH 5LAXA 1F4HA 2KDGA 1MW2A 3L4VA 1AXTL 1XD0A 4WV1A 1FHGA 1XH2A 5FFLA 3V52H 5AVXB 5IFAH 4RBPK 3WFCH 3C87A 4C4KT 4ADGA 2XIIA 3E9TA 3NA4A 4J3TA 4APQA 3RUGE 4U1MA 3QULB 3L4TA 3FB5B 4PY7B 4R97B 5IHUL 1RZJH 2XWTA 4XCEB 2YLKA 4J3OG 5I66B 1CYXA 4IRJB 3N40F 4PJHF 2OMXA 1SOXA 1O6SA 5ALCL 3O4LB 2P4AB 4OF7A 2N59A 2I9TB 1Z7JA 5SWQA 3RVUD 4X4YB 4Z7AA 3L9EA 4A1RA 1GJWA 1D6VH 5FGBC 1SY6A 1MCKA 4I2XB 2J44A 2LT9A 4IU3B 4OZGA 2WJ7A 1FSKC 4WHYG 4HHAA 2QSVA 1LM8V 3CBRA 2X6MA 3E9UA 2HLAA 4YGVB 4KKLC 1IBFA 3BPOC 2IC2A 3CIQA 3IU3A 4HD9A 4MNQE 3TWYA 4WWID 4QHKJ 5E5RB 1BM3H 2EEBA 3PYCA 1JTOA 2IADA 1Y6NR 4OLVH 1YZZA 3SDDA 3K80A 4ODTH 2D3VA 3QHFL 1T4KB 5F44A 4EZMA 4JQXA 3LS4H 4K8RC 4J3WA 4F15C 5D7KE 5HGGS 1AMXA 4YBLB 2AAVA 1GC1L 1U95B 4P4KD 1HH6B 1V10A 4GP5B 3PV6A 1KJVA 4N8CH 1TLKA 4ZW6A 3BWZA 5IHLB 4GRLC 3T77A 3VFPA 3Q13A 4IOSA 4WEBH 1Z5HA 2AQQA 4IRJD 4JPQA 3RVTD 4JFYA 2NNAB 2UXTA 1H3PH 3MJ9A 4P46B 3CN1A 3DURB 3O4LD 3T2NL 2HRPH 1T20A 5IUCA 1A3RH 3BSHA 3OXSA 1Z3GL 5ACZA 4OZGE 4PJ8B 2CA3A 3VWJB 1BMGA 4Y4HA 4C56A 1QKZH 2Z65C 3ORJA 2HCZX 3PP4H 1GGYA 1FYTD 1U2HA 4DN3L 4TVPL 5HHMD 5C0BA 1AZCA 3BLBA 3TBYA 1NUFA 1QMUA 3NRQA 3BIKA 4Y1AA 2EEAA 1N5AB 5A16A 3VD2A 4QMEA 1KT2B 3X1NA 2Y7MA 3SPJA 1BD2E 2E27H 1UM5L 2FO1A 1RUAL 5FYLH 2BHFA 5EWIH 1DJWA 3ETSA 3AGVA 2ZXBA 1ROWA 4OCLC 2K45A 5GRZA 1B2WL 3DMMA 3LH9A 2F19H 4XI5D 5TDNB 3V0DA 4KVCH 1Q9LB 5DCCA 1UFUA 3BAEH 4GT7A 4XBPB 3B2XA 5ERWB 2QKSA 1MG2C 4HXBL 1PLAA 2R51A 4M1CD 2UWEA 5B1JA 4JFZL 3KWUA 1HQ4A 5EIIB 2JI1A 1HWHB 1NSNH 2UY7B 2MOVA 3IDYB 2V2XA 3REWB 3VE0B 2AGJL 4ADJA 4X7DC 2ENJA 4C56E 5IR1A 4KHXH 4NWUH 2VSCA 4TLUA 3LKRB 4XN8A 5C0BE 5I9QB 4HIHB 3DHMA 4BK8A 4D2NA 4EOWH 1I3RA 4L1DA 2P8PB 4Y1AE 2VJ0A 3VWJD 2AJZB 1OY3B 1TITA 3L54A 1FV1A 3ZJAA 5E2WL 1VCAA 2F58H 5D96C 3FO1B 3JWNC 4P5MB 3QDGB 2LLLA 4PVNA 4OZFA 1HSBA 2XX1A 3FUKA 5F9AC 4UTAL 4LMQE 1NFDA 4N1HB 3MZGB 5HDBF 4DGIL 5TPWL 2DQCL 1JCVA 3PP3K 4N2EA 4QIRA 2NYKA 1T22A 5HI4D 3PJLA 3O6MH 2IPKB 2X70A 4NIYE 4N0CD 1DSFL 4ZODA 4KROB 4TTDD 2Y06H 1T66D 2XN9B 1U93B 3C9NA 2DRUA 5DSCB 2VR8A 1PU0A 2CR3A 2YBRA 3SJVD 2LU4A 5AVRB 3MODH 2R9HD 3CJJA 2UWEE 3OJDB 5JHDB 5J89A 4PGZA 5E9DA 4KO5A 4K7PH 4G7VH 1BFOB 1YEGH 3PUUA 3VXSA 3PREA 1OEZW 1K72A 2WK2A 4ZW3A 5CKAA 5GS0L 1FPTH 1Q9KB 3LX9A 4ZDHB 3X13A 2WXIA 1ZLSH 1KFGA 3SE9L 2NQ3A 1DVUA 3FQ4A 4KJQD 1IAIL 4FQPA 4XNQB 4FA7B 1ZT7B 2H6PB 4HOMA 4PY7A 2CLRB 3CFUA 4XCEA 5D55A 1EMTH 5EBMB 4DP1X 3C60B 1XFPA 4TQEH 1BZQK 2ALAA 2BW5A 3RPBA 1NFDE 2I9TA 2IAMC 2F7QA 3L7EA 4X4YA 1NMCB 5A2JH 2NTSP 3Q01A 4L1TA 3VI3B 1ZSDB 5JHBA 5KSAD 2V3FA 5FYKL 4M3HA 1NCAH 4LEOB 2ZUVA 2XVLA 3BZFA 4JPWL 4HMDA 4DP8X 5E4EB 4I2XA 3T6WA 4R7NB 3C08L 4MNHA 3EUUA 4IU3A 2H0EA 4KKAD 3VGAB 1T03L 2PTTB 4H8QA 3N0AA 3E6HB 4G80B 4KROD 5CJ8A 4YGVA 1U8HB 4ZTPL 5CJQL 5E9DE 5BW7A 5E8DL 1KCUL 2HN7B 3VXSE 3KLHD 4RMUA 3HEIB 3LN5B 3O6FC 1JRHI 4IRZA 4LPUA 3FU6A 4Z3JA 4G6FB 2W0FB 2WVTA 3QR0A 4XNYH 1F4XH 5DS1A 1J18A 3RGVC 1T0NB 1T4KA 1GPOH 5IBTH 1Q1JH 5DHVH 1OE2A 3HG4A 4HUWB 4Y5XC 3HS0A 4HEMA 1U95A 2B14A 5GGSA 2AC0A 1HH6A 2LU3A 2Z31B 3SZ6A 1MQKH 2L7JA 4FKEA 2VDKB 1OCWL 3D07A 2NNAA 4Z5RB 2FLRT 3QT2A 4P46A 4QJ3B 3HZ3A 4I2XE 4FFWD 2M8XA 5SWZA 3SGEH 4GRMA 1MNUL 4JREC 3GM0A 4PJ8A 3QO0B 4EBQL 3ULSB 5D7LD 2R0LH 5JR1L 1NGZB 4HMEA 5E2VH 1AANA 1PLBA 2VXQA 3FFOA 4RA0C 4UT6L 1V55B 2P48B 4ENZA 4P5KB 5C0EB 4M4RA 2AZAA 4HXAH 4WO4B 1DJXA 5DHXB 2HT4D 4M43H 4UI2A 3FAWA 3BE1H 1YEHL 5CCKH 2VH5H 4WY7L 4LARH 1N5AA 2BK8A 4AV0A 1J5OH 4PWIA 1PZ5B 3GSOB 4AW4A 2CO1A 1KT2A 1JF1B 4YLBA 3V0VA 3WO3B 4NZRH 5IQLA 4TSAH 2BZDA 1UOKA 3LAFA 4G6FD 5KN5A 5MP6L 3N50A 4HEME 3FCTB 3U4KA 2GQHA 2H32H 2NX5B 5IBUG 1Q9LA 3RX9A 1I4FB 1OWWA 5ERWA 2ADJB 4A2GA 2EDDA 1E4XI 3SDDC 1QG3A 2XNAB 5DR5L 3OF6D 4YBQD 5PAZA 5EIIA 2DQDL 3UERA 5SWZE 3RVWD 4YSEA 2UY7A 4Y4FA 4JQXC 3W9DB 5J13B 3NGBC 1BSIA 2DWEA 3IBEA 1HZKA 1DVQA 4FXGB 4DGUA 5CEZH 3FH5A 4FXKA 3ARGB 4Z0XB 5F89B 1L0PA 3LKRA 3GJEB 4HIHA 4NENB 1HHKA 3PFUA 4E5XG 3BPLB 1ZT1B 2P8PA 1R3HB 1AGEB 1LEKA 4QRTA 1UADC 2AJZA 5DD5L 4MLSA 1G9HA 2ZT9C 1CR9H 1EFQA 2OQJA 2D2OA 3FO1A 4AYEC 3T04D 3QDGA 4R4FH 3ZPDA 4ALAL 2WD0A 5B1AB 1SLWA 3KYOB 4OJCA 3S6CA 2J43A 4N0UB 1CDCA 2E86A 2VL5A 4XCYA 1E90A 4Y4HC 2Y7SA 3GPEA 1FVDB 3ZQ9A 2W1NA 4AYDC 5F9OH 4DPAX 2IPKA 2O6EA 2VJ8A 1NH6A 4L37B 4LP5A 2BIIA 4K9JA 1B9KA 2XN9A 4PJBB 1U93A 5L2JB 5GJTH 2H1PL 1YC8A 1KMGA 1SXBA 1A4CA 3ECWA 4WWKC 4QTIH 2BWIA 4F7CB 5JHDA 1TTBA 1RFDH 2WLIB 2C3GA 4Q9RH 1BFOA 1RUPH 1TJHL 5FHAL 3P2DA 3NACL 3Q2NA 2W88A 4YOKA 2JTYA 3KPPB 1U36A 3LOWA 3T2PA 1SJEB 4U1IB 2ZPKH 2QGEA 2DQHL 5EZJB 3RU8L 1FRGH 2DL9A 3MMEB 4M8VA 4XNQA 3WJLA 2H6PA 3PG2A 5E2UL 3ARGD 2ZOLB 3O6KH 5B1JC 4GSXA 4IMKC 5EBMA 1KBVA 3MJ6A 3QDGE 5FM4A 3C60A 3DVGB 4WU7B 1UXWA 5GS2D 3DJZA 4TUJB 5DA4A 5TD4A 4LLMB 2APTA 3VTTA 5FFOA 1SDYA 3IMTA 3VI3A 2HVKB 1ZSDA 1F00I 4LEOA 1SM3L 3ARFD 1DUYB 3GUTB 2XN9E 4Z7UA 4R7NA 5HY9B 5AQ0A 2CCLA 4L1BA 1TXKA 3HAEH 1DFXA 1INQB 4CBZA 5E1HB 1UT2A 4RLDA 5L4IA 2PTTA 1M56B 2RQ8A 3E6HA 4G80A 4JL1A 4N26A 5JHDE 2R83A 2O61B 2EKSB 1HIMH 3C8KB 4GNKB 1KJ2H 4J28A 3CPLB 3LN5A 3R0MA 3B43A 1VZHA 1AO7B 3LH2H 2L7UA 2K7QA 1P6WA 4PWGA 2B2XH 4Y9CA 3V0WL 5KYNA 4HJGB 4TVPD 5KVDE 2C3VB 4HETA 3BO8B 3C5XA 5KVMC 1T0NA 2AJVH 1AHMA 3BSGA 3KPNB 3WY2A 3G6JB 5I74B 4OQTA 4HUWA 3NK4A 3GSQA 4J4PD 4M3JA 4PTUA 2DLFH 1A6VH 4J8QA 2Z31A 3WKMH 5JXEA 4KNSA 4S11A 5J0BA 2XXMB 2BSBA 4X8JB 3VI3E 3BXNB 4LCCA 2AITA 4Z5RA 3FJTA 4XVTL 4FA8A 3O4OC 1PFOA 2YAMA 3ML9A 3FUEA 3P69A 4ODSL 3F7QA 2YRPA 3QO0A 4A7TA 2FE0A 1Z9LA 3EYVB 3QUYB 1Y7VA 2C1OB 5JIMA 2BSCA 5CD5C 4P5KA 1F3DJ 2R1YB 5CGYD 5T5NG 4FCHA 4WO4A 2HLFD 2F74A 3DJ9A 3IFOB 2AF2A 1I53A 5K1NA 3NABL 2WP3T 4Z3IA 2OXGB 3GSOA 2KPWA 1JF1A 4H8HA 1NGWB 4OLWH 4POZD 4UMGA 5C6TH 3WV0A 2AK4A 1A4BA 4IIQC 3KH3A 1KYOK 3CZGA 5FYJE 2WWOA 4AC2A 2VQUA 3RPIB 3EBAA 4PV8A 1JZIA 1KLUA 3NH7H 4X42A 3R06B 2GIMA 3JVGA 1Y18B 2B15A 2X4TB 3FN0L 2AQ2A 2MQGA 3K0WA 2NX5A 4XZ4A 5BW7C 1EAOA 2D0GA 5JOPE 4AKOA 3WNNA 2OA9A 1M3IA 3ILPA 3OZLA 3WXVL 3PHOB 1XIWC 2ADJA 2D73A 3FCUB 4LVNB 4J2QA 4OCWL 4DZBB 2R23A 2DJMA 2XNAA 2XWDA 1YECH 2V6HA 1C5CL 5TQ2L 3W9DA 5TE7L 5IG7B 3DVNA 5JXAL 4PRNB 1E28B 2ZX5A 4FXGA 1I8LA 4YBLC 3HS0C 3F85A 1EZUA 1NCHA 5F89A 4Z0XA 2Z92B 4L9DA 3GJEA 3L5HA 4NENA 5GSVB 1C9SA 2VQ1B 1V3JA 1ZT1A 2ICEB 2PCXA 3PHSA 5LBSH 1AGEA 4KZCA 3ZRSA 4XCFL 1JHKL 4OJFH 1RULH 1GZQB 1INEL 3QUYD 3DARA 2YUXA 1OAZL 1IM9A 3HR6A 1CLOH 1GS8A 1T5XA 5H8DA 4NHCL 4AZUA 5IJBC 4P46C 1Y6KR 4ZUTA 4JGUA 4Y2DB 4ZX6A 4CJ1A 2AK4E 3UG4A 1WEJL 5SX5K 4N0UA 4KXZI 5KUMA 3LHPH 3MJ8B 1T2QH 3QZPA 4A63A 3T0EB 5B39G 4JHWH 5L2JA 2NX5E 4PJBA 3RWJA 4L8BB 4U3SA 3VFVB 5KVGE 4RDQG 1QUNB 1CL7I 5J1TC 1OGTB 4ODXB 5IGXH 3S36L 5DEGB 1I7UA 4N6RA 1MRDH 1EJFA 2WLIA 3POCA 2AAAA 3X1FA 2XTJC 5IZ7A 4PJ5D 4B3VA 3QIWC 4YFEA 5C0DA 4QRSB 2OCJA 1MFNA 2XTSA 3AWFA 4CILA 3LZFH 3W0WA 2BNUB 3QK0A 1OAYL 1V5JA 3KPPA 4J3BA 3SDYH 1I85C 4AOFA 1W72H 3C6SB 4J1UB 4I13B 4U1IA 5K69A 2KC0A 3ILDA 2Q10A 3CFQA 1CFQB 3MMEA 2B4CH 3HFML 4JDTL 4QRUB 5EF3A 3VMPA 2QGDA 4PW3A 2ZOLA 5L88H 3JTTA 7PCYA 1PG7L 3H8NA 5DS2A 4BFJA 4P5TC 5E1AA 3DVGA 4WU7A 4Y4FC 1KCLA 3IDYC 3VVWA 1X5YA 1BXVA 1UFGA 4N0UE 4WHCA 3N43B 4XVJH 5L0QB 1MFDH 3TL5A 3B7SA 4TNVF 4FXKC 2HVKA 4X6CF 4AI7A 2COQA 3CSGA 4JFWA 2YN5A 3SHSA 4QRAA 4Y2DD 2XA8H 1DUYA 3EOTH 5JIKA 1A3ZA 1YYLH 4PJBE 1FZJA 2RALA 2W92A 1WBXB 5HY9A 1S9YB 4FQCH 1INQA 1Y6MR 1G7JB 4IHOB 2Z8VC 3T0ED 2EKSA 2X53A 3C8KA 3DX0A 2Y2WA 2ZUUA 4OR1A 1MCSA 4TVPE 2A1WH 4Y88A 1UASA 3VH8G 2R2EB 3CPLA 1FZMA 4G6KL 3W0WE 4KMQA 2ZP0T 3WTSA 1AO7A 1PNDA 5D70L 3QPXH 4C4BA 5TK4A 4BSVB 2CMRL 4CC1A 1MFAL 4D9LH 1SRDA 1NKRA 3HI5L 2C3VA 3SKNA 3BO8A 3VGBA 5DJAB 2DEWX 4LLUB 1MRCH 3G6JA 4FKKA 4HWBL 4L29B 4OUUB 4WI7A 3PAUA 1TJGH 4NJAH 3MQIA 1E9PB 5DUBB 3ROOB 1SXCA 1EHNA 5C2BH 1TTFA 4FOMA 4NPYA 2GABA 5CGMA 2JQAA 3OMNB 5CP7B 2W0KA 4NAJA 4X8JA 2YGPA 4U33A 3BXNA 2EXYC 3POHA 4I3GA 4PJEB 1IIIA 1RUKL 3OKDB 5E24E 3S36X 5IB5B 4OSUH 3OB8A 1JIBA 5IMOB 4UT9A 4AIOA 3DTXB 5KYWA 4AITA 3DIFB 4N2MA 4L2LA 5I1JH 3NIFE 4UTBA 1T7WA 2HKAA 2R1YA 2VNCA 1GGCH 5J6SA 3IFOA 3VI3F 3EYOA 3T08A 3FTZA 4JKNA 2ISDA 1AO7E 3AUVA 4KJWC 4Y1TA 3FQRB 3TJEH 2VZSA 5F9JA 1HQRB 3QXWA 1NGWA 1TYEB 4MQ7B 4GSRA 2CJ3A 4CKVX 2X3AA 1F02I 3HBZA 4JMXA 2FB4L 1VA9A 1KIPB 3G6JE 5IMMB 3VGAC 2VN3A 2FBJL 3RPIA 4J6RH 2COVD 5ILTL 5C70A 3EAKA 3B7TA 3QFJB 3SKMA 4L4TB 3R06A 2JJUA 1Y18A 2IBZX 5CJBA 3Q2LA 3I9AA 3DOSB 1L7TH 2BSEA 3PHOA 4Q6KA 3DRQB 3HFFA 1JDCA 2JSFA 2E0PA 2YN3A 4FERA 1YPZF 4FQXA 1G9NL 4Q6IB 4DZBA 2EILB 3I50L 5HYSB 5I75C 2WO3B 4XMLL 3RG1C 1JXFA 1F86A 2BVEA 4WJ5B 3U1PA 5IG7A 3LEYL 3L48A 4X8GA 4Q9QL 3TP4A 1WTLA 1YEKH 4NZTL 4NO5B 2V4LA 2Z92A 2WO2B 5DD3L 2VTFA 1B6DA 1JZHA 2Z31C 2YBGA 2VQ1A 1PTZA 2ICEA 2YRZA 4LESA 5JXEC 2IQ9L 1L0XA 4GP8B 5KVFH 2IPTL 2AS5M 2R15A 5H2BB 2AI0L 3VSQA 1GZQA 1HNGA 1GYCA 1GIGL 4LCCC 1X44A 2N0KA 4JG1H 5EU3A 4G7RB 3PABB 3MLRH 1WAAA 4Z3EA 4JN1H 1CDHA 4BDVB 4E68A 5I1IH 1SXZA 1EHXA 5FK9B 1G7PA 5HJGA 2E76C 5ICYB 1U3HA 2K6WA 3T0EA 4XHJD 1CURA 3UO1L 5IBLD 1NICA 5FYKE 4WO4C 5F7KC 5BOZG 2ZAIA 4L8BA 3PGDB 4UQ2A 1QUNA 2HMID 1OGTA 3ZL1A 1MNNA 1H5BB 4KY1L 1UWEL 1ND0B 1NIFA 1BFSA 3HVNA 3QFJD 5DEGA 3TIEB 3TT1H 3I9IA 2J56A 1ZLWH 1KDIA 2GJ6D 1AGFB 5DWPA 4LL4A 3FHAA 3RIAK 2BNUA 4URKA 2WLZA 5J1AB 1EV2E 4WI9A 3V4PL 3U9WA 1SDDB 3C6SA 3JVGC 4J1UA 4V11A 1XCTA 4PEEA 1PMYA 3TVMA 4GUOA 3RGHA 2I7OA 1MW0A 4JFHD 4NM4H 4MDRA 3JWDL 4H0GA 1T6WA 2HTKC 1RZIB 2J7LA 3HW7A 4MS8D 4AK1A 3MRRB 1IARB 5HI3D 5IFJB 1AXSB 2JJWA 3IJHB 4WK0B 4F7MB 4NNPL 1QFWH 1AZNA 1GW6A 1WAAE 2J8UF 4NFCA 4NQVB 2O5YH 1BMWA 1I8LC 2PCFB 3JWOC 2F6AA 5BRZB 5EOQL 5IQ7H 1HX0A 3WTUA 5D71L 4HCRA 3T0EE 2ZUQC 4LSPH 5AVVB 4ELMA 2WV3A 1S9YA 1TNNA 5CEYA 2Q3XA 3CHQA 4QLRA 1L7IH 1TT6A 1G7JA 4HQQH 4DFIA 4UV4H 1MPAL 3VGFA 4H8WL 1BQHA 4J3UA 5F3FA 2VLLB 1MAKA 2QTEA 1FBIH 1KN2L 2A73A 2MRYA 2V5MA 1GS6X 3D12B 2LQRA 1ZVYA 1LO0H 4BSVA 2Q7NA 2UY6B 2F68X 3NSCA 3HAEG 1UB5B 4QTFA 1GGUA 4TRPL 1KCSL 3WXWL 2ENQA 3B2VL 5FCSH 5DJAA 2RCSH 1OPGL 2CSPA 3DDFA 4TNWK 4BGDA 3PAZA 1PD0A 2VMFA 4KAQH 1BF8A 1GGBH 4S1DC 1M6OA 3CU7A 4OUUA 4EN3B 1GMEA 2VR4A 1EDQA 1SOQA 1TG8A 4XPTL 1UOWA 1MCRA 2JWYA 1E9PA 5DUBA 2XZAH 2RD0A 3PXJA 1UA3A 5CP7A 1PZDA 1S4IA 1MY5A 1SDAB 2KS0A 1KACB 1XGTB 4XC3H 5EN2A 4UUJB 4O4YH 2VUOA 1H6EA 1MFVA 4JHAH 4X2UA 4G8EB 3U30C 3OKDA 3DYOA 3RDTB 3WUWG 2HTLC 2NNXA 4MX7B 4PRAB 4O02L 4ELME 3IVKA 4AMKH 3RX8A 5IMOA 2R0WL 3UADA 4AL8C 1KGCD 3KXFA 3NCFB 5E4IA 3DIFA 3ARZA 1D6EB 2IFGA 3QP3A 2J73A 4ZSOB 1DQML 1O7SA 5LGYA 1E9QB 4LAQH 1SEQH 3W39A 1VPOL 3ULUL 4M02A 1CDJA 4D3CL 3U9PH 3FQRA 3GIVA 1BEYL 4TSBH 1TSRA 2B77A 4MCMA 4XP4L 5CR8A 3QQ3B 4F20A 3HB3B 3DGGB 5FO2A 1KIPA 1N2RA 4KQ3H 5IMMA 3GXDA 2CBTA 4OJDH 1PZAA 4YN3A 3FSOA 3UTOA 4HFUH 1QSEB 4L4TA 1NLDH 5EUOA 4K9EH 3U0TA 1KG0B 1OSZB 1JYWA 3DOSA 5JIDA 4HOXA 1BLNA 3IMBA 1K4DB 1OB0A 3DRQA 4LGRB 5LLIC 1NANH 4Q6IA 4MGXA 4OCRL 5AOKA 5TQ0H 3MRHB 2WTRB 5F7BA 3G6JF 3D1MC 4FFYL 3S3CB 4EI6B 1HHIB 1DN0B 4WJ5A 1J5HA 1EEQA 3KXFE 1FAIL 2MCG1 3W82A 1F18A 1CIDA 1CIUA 3N41B 3E6FB 4KRPC 4DEPC 3L4UA 1OM3H 3O6LL 3INUL 4NO5A 3MVSA 2RACA 4P2QB 3AB0B 2BMKB 1MI5D 5I23A 2EDXA 1PZUB 2XIDA 3DO4A 3HE6A 4HWZB 1UD5A 1L9OA 5HVWA 1G7LB 1WT5A 2DQUH 4WTWA 1LTXA 5KYUA 1R3LA 2O4EA 35C8L 2EVJA 1S7UA 4JZJA 1CF8L 2X89A 3PABA 3L5JA 3GMQB 1S3RA 2VISB 5FXCH 2YPVL 5FK9A 2YPKB 2NY2C 1N59B 2HVJA 3PHQB 5ICYA 1T5KA 2JKRM 4PAZA 3QFJE 2P5PA 4L4TE 1YNTB 5EUOE 3HB3D 4LCYA 2Y1VA 3KWWB 3SPVB 1CD0A 3PGDA 1C1EH 1XQ4A 1NOAA 3FO9A 3FCSB 4L5FH 4RGOH 1ND0A 2H0PA 1ZVSB 3TIEA 5DMIL 1LO3H 2JKIS 1AGFA 4MVBC 3ZQXA 1O75A 2V33A 7FABH 5KJ7E 1SN5A 1BZ9B 1JZ2A 2XN1A 4JFHE 2JLLA 5J1AA 1HCVA 1KTCA 4JFFB 4Q56A 1DBJL 1SDDA 2EIKB 4ZK8A 3TNMA 5G55A 5EEWA 2J71A 4X9IA 1E6OH 2KH2B 4OJAA 3LIZL 5IVZB 3WE6B 5F1SA 5AALA 3CHPA 5CSBA 4YDKL 1B3JA 3AXIA 3MOBH 4FQXC 4N2GA 1G6VK 1RZIA 3CHSA 2YA1A 5F7AA 3RWDB 3MRRA 1T80A 5F8QC 4NQED 5IFJA 1AXSA 5ENWB 3IJHA 1ZLUH 3DSFH 3BSZA 1EFXB 4JFEA 3ILEA 4OD1L 2IOOA 1Q1PA 2JCWA 2PCFA 3T8VA 4PBVC 1IFHH 3VXTB 5BRZA 1S46A 1LO2H 1F41A 1S3KH 3KVQA 4NCDA 4AV4A 3IFPB 3BD5A 3L4XA 3RJOA 1NCOA 2WANA 2ICEC 4LLYB 4UTCA 5AYUL 1Z9MA 2NY0B 2F53B 2DWYA 4PG2A 2RH0A 5C0RL 4FA6A 4Y9GA 3TO4A 1MFEL 2MOQA 2UZPA 2VDKH 3UGUA 3SYPA 4GW5B 4MZIA 4X9GA 3ZYZA 3K6SB 2EZ0C 5BO1L 2EECA 1KYAA 3B9VA 1NAMH 4H44C 2UY6A 4F80A 1NBYA 1U3HC 1UB5A 4XPFH 3IS0X 3WGVB 4C4UA 5IM7B 3CZUB 3BT0A 3KDMA 4HKBB 4H20L 4JFFD 1MCNA 4EN3A 1ZK9A 3BAYA 3L3IB 3THML 2B1OA 1P84J 3S4SB 5EEUA 4HJ0D 1PQZB 4B97A 4IDLA 1KEGH 3D0AA 3HC2A 1LXMA 4JFEE 3G6AB 1JMZA 1RZ7H 1XAUA 2PP7A 5IHUH 3PDGA 4BKLB 2QVTA 5FO7A 5BRZE 3BGFB 1TEYA 4UUJA 3TVMC 4G8EA 3RDTA 4S0HA 4PRAA 1EFXD 3OKMB 3FXIC 1J0YA 3OKLB 4FABH 4F9LA 1FH5L 4R2GC 2QVIA 3C12A 4QHLB 3AZUA 3ARXA 2EC9U 3CFCL 3FSZA 4TUUA 3VRIB 2AERT 2O72A 4Y2OA 1RJZA 4HF5L 1E9QA 3V4PB 1VENA 4IKJA 1O7DE 1BQRA 1DJZA 3BKYL 2F53D 3ESNA 5DJ0B 2FX9H 1MEXL 3AW5A 1P53A 1U8JB 1JDDA 1CK0L 1CE6B 3T8XA 1E3ZA 2JI3A 3QUXB 2RQEA 2W95A 4U1GB 2OMZB 1IM3B 1G6RL 2LGNA 1VEOA 5IQNA 3DGGA 2ZD0A 3I75B 4NOBA 1QLEB 2R8SH 1M2VB 1WLHA 2ARJQ 1FA4A 2MTAA 3AAZA 5GS2H 1QSEA 3QHFH 3HHRB 4J39A 4JFUA 1KG0A 2VDNL 4FFTA 3RZCC 1VKXA 3WFHA 2VDPL 2AQNA 2VYRE 3L3DB 1FDLL 4FNLL 3EFOA 2JJSA 2RFXB 3MRHA 1A9EB 3N1FC 1YQ2A 4EI6A 1HHIA 3SGEI 3MBED 1E5BA 3M17A 3GLAA 2DMCA 5TF1L 3E6FA 1BF2A 4PJXB 2HJFB 4K3EL 4P2QA 4OZFG 2WBKA 1Z3GH 3KL0A 4HWZA 4PJEF 1YNKL 1V7NH 5EEYA 1G7LA 4ZJ9A 2B20A 1RIUH 3DXAB 4N8VB 3GBMH 2PP8A 5IB3B 4K7FB 2BSDA 4PS3A 2RIKA 3PCYA 5F1IA 1WGOA 2VISA 3D52A 1MWOA 1N59A 2FLBT 1VESA 2BSTB 3PHQA 4UIKL 1YNLL 1QSEE 2GEEA 3HZMB 5CILL 1YNTA 1RUAH 2AJXH 3FQTB 4ZMZA 1BQSA 4ZTOL 1T1YB 4YHIB 1Q0XL 3KWWA 3X3FH 4O02B 2QBWA 4OBSA 5HDWA 3FCSA 5AWNL 3CK0L 1B2WH 1HDMA 1ZVSA 4Q97A 3LKNA 3FQWB 5HJ3B 4LAJH 4LVOB 1HCFX 1GZHC 2BHZA 5J11C 1MCIA 3C2SA 4P3DB 1XL6A 1FFOB 4TMPA 5I0WA 1J1XL 3OGOE 2NY4B 1YRKA 3VXUA 4P2QE 4QCIB 4PJ7A 4UQ9A 4DOHB 2AGJH 5IVZA 4PS7A 3HZYB 3D9AL 4S0SD 3GJFK 2WIMA 4KK9C 3LNHA 3AXLB 5EG6C 1U8KB 4Q6IC 4AG4H 1HNYA 3RWDA 4PB0L 4JM2D 3UTTB 1ES0A 1S7VB 3O2WH 5GGVL 2VQ4A 4A7UA 4MJID 2UXFA 4F24A 3O2VH 4WWKD 1YY9C 2E7DA 1BWMA 3S3JA 4JO4L 3DXAD 3P9WB 3BT2L 1Y0LB 3GLDA 4MKMA 1G4MA 4UTAH 3IFPA 1RIVL 2NY1D 4IRSB 4JHBA 4LLYA 2EIMB 4R3SB 3NQIA 3TBSA 4DGIH 2DQCH 3QDMB 3HE6C 2HFTA 3ATEA 1WT5C 2Y5QA 4U6TA 1JXJA 3TV3L 1BQKA 2E6QA 4JZJC 4ZFGH 4W70A 3QFDA 4IDJL 4MD4A 2O6CA 1OO2A 3FPYA 1EZLA 4GW5A 3ZKQD 1I1RA 3H3KA 2CO3A 1DBKL 2XPGB 3MNWB 4QKXB 2G3ZA 3ZHDA 2W94A 1JZ8A 3EHBD 4KI5C 1KFAL 4PJCF 3VXUE 4BK5A 5CINL 1YUHB 4U49A 1EDHA 2YS4A 1S7RB 4PJ7E 4YNYB 4ZX3A 5IM7A 2PO6B 5A2CA 5GZOA 1IFRA 3CUPB 5GS0H 4G5ZL 1OF0A 3ULUD 4ZOBA 5D6CB 4HKBA 4PWJA 1WD8A 4TN9A 5CF3A 3L3IA 5TJWK 5IT2L 4ETYA 1P4LB 5E95B 1PQZA 2VUKA 3QNYB 4XB8A 4EZJA 1GJIA 5DLML 3Q43A 4Z0BL 5I6XC 4N90D 3B9AA 4GRWB 3UX9B 5HBBA 4XP9L 1UWYA 2P7TB 5D1ZB 3U7WH 4BJLA 1AR1D 1IMHC 3RTLA 2IO5A 3OKMA 1BGXL 4TNEA 3OKLA 2D7OA 2EDMA 3O3EA 1DVSA 2Q5BA 3CVHL 3UYRH 1P0SE 1PZ3A 3CDZA 4HIXH 3VRIA 4M4PA 1JP5A 3V6BR 3V4PA 2CRYA 2AJUH 1RZKL 1MWAH 1J48A 1UD4A 1I8KB 3OB0K 3MV7B 3QDMD 4EPSA 5DJ0A 1KJ3H 1U8JA 4YC2B 1T03H 1CE6A 5C9JB 4ZOAA 3E8VA 3QUXA 5T1DL 5H37A 4ZTPH 4JG0L 4MD5A 1Z2KA 1AS6A 5E8DH 1KCUH 1Q0EA 2ENSA 1IM3A 4IBQA 4WWOA 3REVB 5JHLL 4L3CB 4YE0A 3IPBA 4EIZC 1WFOA 1PY4A 2QT6A 5JDJA 2ZCKL 3I75A 5G4MA 1QA9A 1TKWB 1M2VA 2XICA 2H41A 5CIPB 2VM3A 1HXYB 3VCLB 1XB3A 3TO4C 1GW0A 1O7DC 2JJVA 2QZ5A 3L95B 3U2SA 3LXAA 2PO6D 5DK2B 4LSSL 1KELH 4JJHA 3BKML 5MENB 3L3DA 1KPRB 5GRJH 3QCUL 1PDKB 5GS1B 3O9WD 4FFZL 1B4JL 3MDJA 4KRLB 2RFXA 1A9EA 4LEXL 3V0EA 2FHFA 1OCWH 3ARYA 3VD5A 1JGUL 1UD3A 3EW3B 1CTNA 2APFA 2OSYA 4UMSA 2BH0A 5E2TH 3MLZL 1XH3B 1JJUA 2AV1A 2DQ6A 2HJFA 1HHHA 1KBWA 1MNUH 1QYGH 1IKOP 5EHFA 5FO9B 3B7RL 2O5XL 5ECJE 3JV6B 4EBQH 2KYIA 4I3SH 1TQBB 2CDEB 3MYZA 3NRPA 4UT6H 1RZQA 5AAMA 3WY4A 2CO7B 2Y25A 3RDTC 4ZZFA 3QGVA 5IB3A 4K7FA 1SVBA 4F9LC 1YEHH 4WY7H 4LEBA 2FT6A 1MCFA 2VE6B 3QARA 4FG6C 1GOFA 2QPSA 2WKOF 2XWBB 3HZMA 3FQTA 5IFHL 1T1YA 2LTQB 3HHSA 4O02A 3G9AB 3PWPB 4KKNA 2YHGA 4WKZB 5MP6H 4J27A 3B7YA 1QBAA 3FQWA 5HJ3A 1O9WA 1I3GH 3ESUF 1AFVL 5B38B 4P3DA 2FDBP 2LV4A 5MEND 5C2UB 2KZWA 1FFOA 3BGAA 4M1GH 2ICWI 4HPHA 4Z7VF 3QDJA 1IC1A 3QH3B 4W9GC 5DHYB 2DQDH 1AYRA 4BZ2A 2R39A 2DJSA 2CGZA 1G6RB 3OKKB 5IQOA 3WAKA 2EH8H 4D9RE 1IL1B 2SODB 2B3RA 1U8KA 1JERA 5C0AB 3DXAE 4KRMB 3TA3A 2AHIA 3VXMB 2IH1A 4MJ2A 3UTTA 2ATPB 4C59B 1S7VA 3UTPD 3MGOA 2WTPA 3R1GL 5DD5H 3RHWF 1A6AA 4OF8A 5GGTH 4GB9A 1YEJL 2VDNB 4KO9A 1NBVL 2XTJD 4NKMA 2BVOA 1Y0LA 2VDPB 3CSPA 3SKJH 5B7EA 5TTRA 3TASA 4ALAH 3AB0C 4IRSA 2ZOWA 3PDOB 4O2FB 1H9DA 4R3SA 1E6JL 1J1PL 4J3SA 2CJSA 2WZAA 4LSVL 1ZGLB 2EXWD 1IC7H 4UQAA 5F9WC 1P2CB 3SDXF 2TRHA 2VKWA 1UTDA 2W9EH 1JZ3A 1ZXKA 1JNNH 3GXPA 3PWPD 2YKLH 3BOVA 3NSDA 5EZOH 1SN2A 2XPGA 3MNWA 4P5TD 1NLBH 3KLLA 3UBHA 2G30A 4GPVA 5HGHB 1QHOA 2LABA 3PXLA 1YUHA 2QJDA 5C7XH 1TMCB 1S7RA 1TJHH 3K1KC 4YNYA 5FHAH 3D48R 3BH8B 3NACH 2PO6A 5JHAA 3GI8L 3PE9A 3ZRCC 4TQHA 1XSKA 4ZNCD 5D6CA 2BOBB 3PNWA 1L3NA 2MNJB 2AQ3A 2YPVA 4H5SA 2DQHH 3N42F 4WTZG 3UTTE 2FH8A 3QNYA 2H1XA 3M8OL 1VZIA 5E2UH 4DKTA 3WIFB 2K78A 2F2HA 3HC3L 1H3UA 3APFA 4RAHA 3SY6A 4K3HA 4AGNA 3VXMD 2DKMA 2P7TA 1KB9J 2XSKA 5D1ZA 3CXDL 3S34H 1A47A 3LQAC 4AXWB 4LCIH 4BA8A 2B1AL 2DYPB 4BFBD 1J05B 3GO1L 3V4LA 3FU7A 3QDME 2DQGH 1G9EA 2VR3A 2A6KB 2CRMA 1X5ZA 3ALWA 1BG1A 3PWUB 5LWYL 3NJIA 3NYKA 4ODWA 1BYPA 3MV7A 2WWMC 3QEGL 5HPMB 5DTFB 4K3DH 1ORQA 1JRHL 1KF9B 3CDCA 3ET9F 5C9JA 2NYYC 1SPDA 5D2LB 4JM0A 4D0CB 4WCYL 1D5MA 4L3CA 3JYBA 4PFEA 1MCJA 5JQHC 4JY5L 4LCWB 4MQTB 4UM8B 1WTGT 3V0WH 4MQXD 43C9A 1TKWA 1U8NB 5CIPA 4RRPA 4YDIL 3VCLA 2EDRA 4WFFE 5D4QA 1TTRA 4ENED 4R84A 5DK2A 1XH1A 1OGSA 3GK8H 1AKJB 4GRWE 1KPRA 2OM5A 5F9DC 1PDKA 3ARDB 5GS1A 2XETA 1N8ZA 3ULVE 3LN4B 43CAB 3BRGC 4YDZA 1QR1B 1OP3H 1CG9B 1BYNA 4H8VA 3S2CA 4YHLL 4FQ2H 4F57H 4XC1L 3ESPA 2DBJA 4NOFA 3MYJA 2KKQA 5I15L 4UOQA 5INCA 2VQTA 4EIGB 4Z1PA 1XH3A 3MLSH 3TO2A 2DYPD 1XF4B 4UZUA 5D6DA 1WZLA 3ZMNA 5KZCB 4HBQA 2VDRL 3MV7E 1KEML 5FO9A 2H26A 5IVNA 3JV6A 4NKDB 4OVVA 3KLSA 4B9ZA 3BGFC 3BDYH 4QRPD 2K70A 1BX2B 5E0QA 3U4AA 4XNXL 4YSRA 3UZQB 1CXLA 1S5HB 3UIYA 2VDMH 3QVAA 4P3WA 4S1QL 1KXVC 3NABH 1PW3A 5CZXC 5I19H 1JYVA 2J5LB 2VE6A 5D4JA 3FU0A 3CAFA 4ZMAT 3GGWB 1A8ZA 3BVVA 1MRFL 1RD6A 3ZYIA 5EZIL 5CZKA 3I3EA 5D7SH 4LCWD 1S2EA 5FW6A 2UVEA 4WKZA 2Q6WA 1UM4L 2WB7A 5MENE 1D7FA 5T3XD 3FHEA 3WLBA 2P80A 2H8PA 2QELA 4J6IA 4TF4A 4D8OA 3M45A 5B38A 1I1FB 4W9EC 2AEPH 2D3LA 1CS6A 3UJJL 3NPSB 1S78C 1N10A 3ARDD 5CS7A 1NL0H 2VLRB 5CZVH 2KLTA 1MXDA 2OX5B 3QH3A 3L1OL 2OR9L 5DHYA 5G4NA 4ZX4A 3QIBB 4IJTA 5BOJA 3V5KB 4YAQA 2DQTL 4KNTA 5TQ2H 2ZWLT 3MCYA 4XZUB 5JXAH 1G6RA 3OKKA 3EGSA 1JNHB 3QWQB 4W9IC 1IL1A 3BN9C 3SY0A 2G4GA 5C0AA 4RESB 1W8EA 4AQZA 4C83B 3BLPX 1BMZA 4FTVD 4EI0A 2N0MA 2GY7B 4YMPA 3VO0A 5BJTB 2Y36L 4NZDA 1JHKH 1JXKA 1INEH 3HKFA 4ZUWA 4PJXF 3UCQA 1OT4A 4NHCH 4X9YA 4JM2F 4FADA 4UQBA 4Y2NA 4ZMVA 1NC2A 3VFGL 1WEJH 3PDOA 4O2FA 3WIHL 4KZDL 1HINL 1ZGLA 1AGCB 1CGSH 4WGKA 1P2CA 1IKNA 4PP2B 3L3GB 1E30A 1A7PL 1EGJA 3Q06A 5AAMC 3MV8B 3MRGB 4FI8A 2RA1A 1RK7A 2M83A 3BWUF 4XODA 3CIAA 2I9LA 1XGUB 1BFVL 3SE3C 1OP4A 3ZDXB 2BO0A 2DM3A 4L8SB 3S36H 4B50A 1A9BA 3DVIA 2V9TA 1ZCRA 5HDOA 1NIBA 2PXYA 3JV0A 4DZ8B 2FEDC 3QZOA 2YD6A 3LNFA 3QISA 4HGMA 4OU3A 3SYAA 4BWTA 4MJJA 2VDOL 1OAYH 3FO0L 4GXFA 2BOBA 2CK0L 3O0RL 2GIXA 4OZHF 5HDLA 3RBGA 2R0KL 5F6HJ 5C0AE 3TN0B 3WMPA 3DX3A 4LVOC 2LR4A 2P43B 1IEHA 4F2EA 3AMLA 1R4XA 5HSFA 4Y89A 1QFWI 5K1VA 3ULUF 1EBPA 3WIFA 1VRSA 3KE0A 1PG7H 3BVWA 1N4XL 4FHBD 2NY4C 2OSWA 5ADPL 3AG4B 3QZNA 5LDUA 4KKCD 1FYHB 2XFGB 1UGKA 3NUKA 2NRDA 2QV2A 2X1XR 1M05B 4HPYL 4EZKA 4AUUA 3RWFB 3TA3C 3PWUA 3OXRB 4H88H 2ALWA 4HZLA 4W4NA 4R90L 3M88A 3NAAL 3GQFA 4S1DD 3UEQA 3IJ7A 1N0XH 2YD2A 1KBGL 25C8L 5HPMA 1BBDL 3M1CA 3RKDD 3MV8D 3KBPA 3DO3A 3QJXA 3RNKA 5D2LA 3FSVA 4IRSC 2NLJA 1IAIM 4K2UL 1X4XA 3Q5TA 4IBTA 5AW3B 4D0CA 4ETQA 2EE6A 1IGYB 1SJMA 2G0LA 4G6KH 3WLWC 1UVQB 5D70H 4UM8A 2FJHA 3T0WA 2EACA 1SQMA 1SNRA 1MFAH 3EO9L 4N20A 1U8NA 2XWXA 3HI5H 1JS4A 5JTWA 4QRQB 3AVEA 2Y0SA 4WW2A 2NY3C 2H4EA 3X14B 1ZK5A 2PETA 4HWBH 5ITFB 2QQLL 1QFPA 2ADFL 4HH8A 1YDPB 1AKJA 5L7XH 4O58L 1NAKL 4YHMH 1A4KB 3HMXL 1I1AA 4GMTL 3LN4A 4NHUB 3LTVA 3SODB 5I1AA 3M46A 1HOCB 1QR1A 1CG9A 1XDTT 2OSXA 3ARVA 5LG6A 1CC3A 4LIQH 1CVSC 2NUPA 2WUCL 4IGBD 1AIZA 2OW7A 1QR4A 3OAUL 1XF4A 2VR5A 2QV4A 2KLSA 1Z9OA 4XBEL 2MMXA 2BVYA 2X7LB 4UAHA 5FIEA 1RJYB 3QHZL 4NQXB 1QSFB 3FONA 2IBBA 4HSCX 5D1ZC 4ZO7A 1PFCA 3F04A 5JQ6H 1LE9B 3ULVC 5D2LE 2YARA 1BX2A 3UZQA 1S5HA 2CJUL 4XT1C 3HZKB 1W9XA 1AMYA 2BCKA 1V7MH 4UILH 3ELQA 1MCLA 3NQKA 4W9CC 2B8OT 3GGWA 4XNMB 3W11D 15C8L 1G4RA 3MC0A 2X4OB 1P7QB 3CLWA 3MRPA 2FB4H 2OP4L 2R2CA 4JUTA 4AENA 5A2LH 2GT9A 4KRPD 3MFFA 4BBWA 2DY2A 4F8PA 4A6YL 1NANI 1XGRA 3TF4A 5E7FA 1NC4B 1I1FA 2HFGH 4PJGB 5F7EL 2DBLL 1JD9A 4POYA 4OF3A 5J9PB 1G9NH 3I50H 2VLRA 1D7CA 2JCCF 4XMLH 5I30L 3GRWA 2V7NB 3QIBA 4ANXA 3CXHK 3V5KA 3FPXA 3U4EB 2NY2D 4W6WB 4XZUA 5JHLA 3LEYH 4N1CA 1JNHA 4I1PA 3S8GB 4XP1L 3TWCH 3D3VB 3GMRB 2YR3A 5GS1C 3NCJH 4NRXA 2BWQA 2QPFA 5DD3H 2WSDA 3MRFB 4C83A 2IQ9H 4G7YH 4OLXL 3QQ9C 1MN4A 3NSJA 1IQWH 2EC8A 1QSFD 2IPTH 4ANUA 4E9WA 4KZ0A 1GIGH 2IWEA 4N24A 4WFHD 2Y6SD 2BP8B 3OG6B 4ZPTA 3LPPA 4U1NA 1OAJA 4XAKE 3LSOA 2YGQA 2FATH 1DQIA 4RNRB 1H3GA 3A6BL 4QF1A 4U7KA 4AEIH 3D4YA 4OIIL 1PLGL 1AGCA 1CL7L 1IEAB 3QUGA 1J0JA 2GVYA 2OZ4H 3QI9A 1PX3A 4PP2A 3L3GA 1UOVA 4O2EB 3S5LB 3T1FB 5LJYH 3MRGA 3UO1H 1P7QD 1N7MH 4QO1B 1N18A 4MAYB 1MSPA 4OZIB 4UOJA 3MOAL 2WXNA 4IKLA 3MLYH 5E4AA 1XGZA 3LN9A 4L8SA 5DS8B 1WA1X 2VDRB 1JPGB 5C08D 3GKWL 2VLRE 3FQNB 4LLAA 4LOFA 5T3ZL 5DT1L 2LTQC 3VQMA 4LT7A 1I1YB 4A67A 3KBHE 3C09C 4AYFA 1F11B 1HL4A 3LQMA 4LKXB 1SJXA 3UJIL 1UACH 3RI5K 3TN0A 5E56A 3V5HB 2X42A 2VDQL 4H26B 5I71B 2GSGB 3HUJB 5D1QB 2DPKA 3I02B 5DO2C 3ZE2F 1PEZA 4WFGE 4JFVA 2DM2A 2N7BA 1P7BA 1EEYB 1GOGA 2R29L 2ICES 5HVHB 3O2DL 4QJ4B 2ORBL 4MTMA 1I9IL 3RWFA 2V7HB 1NMBH 5D71H 2VERN 2FQFA 3GBNH 3OXRA 4N5EC 3IKCB 4P9ML 2Q2LA 2YMXL 5BXFB 2EIEA 2F5AH 4KUZL 2PWFA 4NRYB 2KPNA 1EJOL 3B9KB 2V8LA 4PCTA 2YQ2A 3AG1B 4M3KB 4B0MB 4H8WH 2ZXWB 5E8PB 1IGML 5JIIA 4P2RB 3KS0H 3KYAA 5DVLA 4HULB 4PW9A 2GUOA 2XX0A 4BK4A 1UVQA 5EOTB 1A25A 1FO0L 1IKNC 4NO0B 4OLUL 2JMRA 3RVXD 2P5ED 2XRAH 1KCSH 3A23A 4P4RB 2IVFC 3T3MF 4D9QE 5HYSG 4R2GD 1OPGH 3AU1B 1A7NL 4LPXA 4HC1L 2EDQA 2F1EA 1DBML 5EOCJ 3X14A 2FWOA 5DC2A 1TJXA 1TPXB 5ITFA 3LKOB 1QSZA 3JT0A 1YDPA 3RA7L 4N0YL 2PXYC 5I1HH 4GJTB 1WWCA 5AFAA 1TCRB 1A4KA 2OR7A 3QXTA 5CN2A 4LQFH 2PWHA 2FD6L 4NHUA 3MOQA 2OMYB 1EIBA 2YMTA 2WXJA 4FYSA 3CFTA 2NNFA 2XQYK 5IF0A 3P30H 5EO0A 1K85A 2IJ0C 2I5YL 1QABA 4NO2B 2P1YA 3ZTJH 4EJ1C 5BOPA 3C5ZA 4JQIA 3TF7C 1OP5H 5GRVK 2X7LA 3GZKA 1J1OL 1RK1B 4LSQH 1DQQB 2FJSA 4LLWA 1KB5L 4HP5A 4NJ9H 2ZOTA 1HT6A 3L08A 5D9SB 3RIKA 4EDWL 1DQMH 4PI0A 2GC4C 2VDOB 1JHTB 4I77L 8FABB 1LE9A 3AT0A 3RZCD 4H40A 1FE8H 3A3YB 3OVUB 1SJHA 1X4ZA 4RCAA 4B5ZA 5DQJB 3VWKB 2IOMA 3HZKA 3ULUH 1ZOXA 1QWHA 3D33A 3SO3C 1WHOA 2V5RA 3N85L 4LOVA 4ZAKA 4EAEA 3FRPB 4XP4H 2KI6A 4XNMA 1T1WB 2AQRA 3HN3A 2K3HA 5ELIA 3HPJA 3SE4A 2X4OA 5AG8A 2NXYB 5F0JB 4OTXH 3AS2A 5C0FB 1MCCA 4NERA 1AQHA 4KNQA 1NC4A 4PJGA 4FHJA 3OKOB 4U6YB 5LG1A 4KMTH 3WS3B 2KBGA 2ZYIA 1KCWA 5IQMA 1BXAA 1SXSA 3ETBJ 3JUYA 4WW2C 2V7NA 4FFYH 2A6DB 3BAXA 4HJUA 4M5ZH 4RA3A 5GISH 4UOZA 5LDSA 4WNJA 5KVEH 4JPSA 1FAIH 5BCAA 1QSFE 1K2DB 1SF5A 3D3VA 3GMRA 4KBPA 3H9ZA 5E51A 3O6LH 3INUH 1X9QA 4EI5C 1I1AC 1OAXL 4IBZA 3MNVB 3MRFA 2GIYA 5T8IA 3S37H 4N8UA 1QO3B 3QJZA 4F7PB 5B1BB 2EEDA 2IH9A 4A38A 2WKLA 1AR1B 4YK4C 1U3NA 5FW8A 3BZ4B 4QXGL 1CB4A 1L9RA 2CKBL 3VWKD 1ZDQA 4GAJL 4PGJA 3BCDA 4RNRA 4IK7A 3UAFA 3RWHB 2UZIH 3KPOB 3BUYB 4I4WB 1BHGA 4ZS6D 1O0VA 5DGRA 1IEAA 1ZXQA 1NCTA 3MV9B 3GBDA 3T1FA 4QO1A 3U6RB 2NXYD 2YD8A 4MAYA 1T4WA 4WIQA 1C5DB 4IS6B 4KK9D 4PJGE 5ESQB 2ITCB 5HHVL 4J3VA 4P9HH 5IROC 3T0DA 1NKGA 3W5MA 1EHLH 1YEEL 3K6IA 5DMIH 3ZZQA 3FQNA 3I84A 3QWRA 4OD2B 3OHXB 5JW3L 2DWXA 3S5YA 1XV8A 2IH3B 3BIBX 1G7QB 1G9MC 1F11A 4LKXA 4U7MA 5ESVB 2R4SL 5C07A 3VFSA 3RTQB 5AOJA 1X5MA 3D3VE 3UJTL 1ROCA 1FG2B 1KSRA 2B1HH 3ME0A 4E9VA 4B7IA 3II3A 3FC8A 4LZKA 4XO9A 3V5HA 4XX5A 3LXBA 2C3HA 2V2WB 3LIZH 4OLEA 4M8RA 3HUJA 1K3IA 3NPSC 4OJYA 4Y16B 5D1QA 4CSTA 3QR1A 1UB6A 2V37A 3DSNB 3FS9A 4M7ZB 4BCZA 4LL1A 4Z77B 4A6YB 1RERA 3QIBC 5D8JL 4HHGA 4X6DF 4PG9B 1H3TA 1RU9L 1TZHA 3RB5A 4LGSB 2XY1A 1K8DB 1UJ3C 3Q05A 3BD4A 3MA9L 3FTVA 4ZOCA 2V7HA 1XVSA 1LO5A 1KXQA 3A47A 3OGCB 3IKCA 4Z7QE 5BXFA 4OZIE 5AYUH 4NRYA 3B9KA 4RMTA 5FLUA 3MV9D 4M5YH 1SN0A 2VW4A 1PAZA 3KL3A 2GITB 4KFZC 4N2DA 3VXQA 5C0RH 2X4NB 1MFEH 2QVMA 2XPZA 4P2RA 4ICWA 4NT6B 4UYQA 5DD6A 5C0GB 5KAQF 1PNCA 5C07E 1U91B 5BO1H 5FGSA 5EOTA 4D94A 1KLFA 3QI9C 3HE7B 1UD8A 2W0LA 2BPBA 4NO0A 3FTSA 2ADIB 3LRSB 4E41B 4WVRA 5F1KC 4P4RA 3RVVD 3INOA 2R1WB 3HLAA 2EJ1A 3AU1A 4LPYA 3ZDXF 1KLGA 3UZVA 4H1LB 1P6FA 3HUJE 5D1QE 4Y7MA 3WIHA 4H20H 3LKOA 5IOPB 4JY6B 1DDTA 1BWWA 3SPHA 1TCRA 1D6VL 3EFDL 4F37K 5DK0A 2WYIA 4YIQA 2ZKWA 4Y16D 2OMYA 3H1ZA 3CFDB 4MS6A 5BV7C 1QZ1A 3FQ2A 3IM1A 1KPVA 1T6VN 5EU5B 1TZGH 4RIRB 4A68A 1KXQE 3N1GC 5E7BA 1S9KC 2BSSA 1RK1A 3OLGA 2VRQA 3NCXA 1G5GA 4XMPL 3QG6B 1FGVH 5D9SA 1F4YH 1KENH 3CNKA 3IMSA 4OLVL 3BQUB 4HF5H 5JDSB 3GSNL 2NY5C 4YHYB 1UA7A 4P2RE 3EO1B 1U8QB 2A5UA 4M61B 4ODTL 4R5VA 4YGAB 5DQJA 4XO3A 2ODIA 3CVIH 4XOBA 1CK0H 4Z3FA 4HWEL 5HYFA 5EULV 3QIUC 5CKGA 4HOZA 3FRPA 3VG0H 1JZEA 4ZXBC 1T1WA 1BOGB 4OGYH 4LKCB 3U83A 4ZFOL 1X5FA 4X9FA 3ZTEA 1NCGA 3BFOA 1FAKT 4JJ5B 3NSYA 1LQBC 5C0FA 1S9VB 3EADA 4X0NA 4WUUA 4WEBL 2AVGA 4ORGB 3WGUB 3ZDYF 4EZLA 1MDTA 4FJ6A 3BZEB 3QRGL 2VDNH 2FHBA 1R47A 2HRPL 3B2DC 4GSDH 4WFEE 4U6YA 4RDBA 2J6EH 2HJKB 1HKLL 1JV5B 3HC4H 2Z8SA 3WBDA 1P5VA 5HD8D 2CM5A 1QW8A 4MA8L 1T0PB 4PYHA 2A6DA 5D5MF 5K33A 3K71A 1HVXA 3C5SB 5TF1H 1YLBB 4TLKA 3VXOB 1K2DA 5BO0D 1FIGH 4E0RA 4K3EH 3F7LA 2EDLA 2EUXA 4LVHB 4K94C 3MNVA 5T1LB 3B9DA 2HB0A 1QO3A 4F7PA 1NCNA 2E27L 3GHEL 4P3CH 1R19A 1YYCA 1ZHKB 3BZ4A 3C5ZC 5J6HB 1EHAA 4KK6C 1B90A 2F19L 1LHZA 2XG5B 4PRHB 1TR7A 3RWHA 3BUYA 2VIRA 3Q6FB 4I4WA 3KYMB 2X1QA 3NIGF 4KVCL 3SCMB 5ACLA 2AEQL 1QOKA 4L9LC 1IC4H 2WN3A 1RURL 4UIKH 2KLRA 4NFBA 4WUUE 3UDWA 2C9PA 5CILH 4ZTOH 3NDYE 1TVHB 2FHCA 3U6RA 4JPVL 2R69L 1C5DA 3OLIA 4IS6A 5ESQA 1CFMA 5C7ZA 4DP0X 1N26A 1YJDL 1NSNL 1RUQL 5B22A 3CK0H 4ZAKC 3F62A 1KB5B 4LF3B 3DX7B 3S4SG 4QOKD 3RL2B 4NWUL 5HHPB 2ZWKA 2Q87A 3SE4C 2OS7A 3MUY1 4OD2A 4G9FD 4XH2A 1XF2A 4EOWL 3IGAB 1BIIB 2IH3A 1G7QA 4ZUVB 1KGJA 3BP4A 3DIVA 3RTQA 1AC6A 3KR3H 1U8LB 3WHXB 2Z64C 1FG2A 2F58L 5KJRL