5B1CA

Crystal structure of den4 ed3 mutant with l387i
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
101
Chain Sequence
SGMSYTMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKVVGRIISSTPLAENTNSVTNIELEPPFGDSYIVIGVGNSALTIHWFRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Envelope protein E
publication title Modeling and experimental assessment of a buried Leu-Ile mutation in dengue envelope domain III
pubmed doi rcsb
source organism Dengue virus 4 dominica/814669/1981
total genus 14
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5b1cA00
1Z3RA 3N43F 2V33A 3UZVA 4L5FE 5KVEE 4AL8C 5IREA 1URZA 1Z66A 5B1CA 3C5XA 4ALAC 2R29A 2JQMA 5IZ7A 3UYPB 3WE1A 2ALAA 3J27A 3UAJA 1OANA 4GSXA 3N40F 5KVDE 5LBVA 4UTCA 3N41F 4BZ1A 2JSFA 4UT6A 3P54A 4BZ2A 4UTBA 2HG0A 2R69A 3J2PA 2H0PA 4UTAA 4X42A 3MUUA 4FG0A 3N44F 5LBSA 4AM0Q 1ZTXE 5KVGE 3C6EA 1RERA 5AAWC 5AAMC 1TG8A 1OK8A 2I69A 5KVFE 5H37A 3VTTA 1OKEA 5GZOA 2P5PA 3UZQB 4FFYA 1PJWA 4GT0A 2JV6A 4FFZA 3UZEC 3N42F 5JHLA 4UT9A 5JHMA 1SVBA 1UZGA 2GG1A 3G7TA 1S6NA 5LCVA 5GZNA 3IRCA
chains in the Genus database with same CATH superfamily
1K3ZA 4P3CL 5C86A 2J1KA 2WQUA 1G7LA 4GRLB 4WHYG 1LO2L 5KBDA 4FL4B 1NZRA 3CMOL 3B9EA 3FSWA 5HI4D 2UZIL 2LAAA 3NACH 2YEVB 3QORC 1KYAA 3OMAB 4U0RC 3BLPX 5L0QC 3ZHNA 4FKKA 2R0LH 5DFWH 3GO1H 4Z7VE 2BZCA 2X70A 4RA0C 5JIQA 4UUJA 4X9YA 3ZIMA 4JZJA 5B1JA 1URZA 4A63A 5L6YL 1JZ5A 2C3HA 3FCSA 4UOW0 1M7XA 5FEBA 4F8NA 4HLZG 3CPLA 1P7KA 5F7LB 2NSMA 5BV7L 1PZUB 2LLNA 1ZVSA 3PQYB 4RAVA 5DRWB 4ZX6A 1UCBH 3V4LA 3CVIH 3GHBH 4WTQA 1YNTA 1MUJA 1YQVH 3L9EA 2FBJH 4OFYD 2BMKB 3T0DA 1D2OA 2Z64C 3K4AA 3UCRA 3NJJA 5ESVB 5HJDA 5J9PA 2VMJA 1SXZA 3NIFE 1X5LA 1YYMH 3L17A 1PG7X 3P40A 1TNNA 4O4YH 5LQBH 5IR1B 2F9BT 1BQHB 2D7QA 4NWTL 2HG0A 2WCGA 3NVQA 5D1ZB 4UOZA 3T3MF 5HI4C 6TAAA 3AW5A 5LGHL 3VTAA 4G72B 2BNQB 2ZG3A 5JHDB 1A9VA 5C0ND 4NRYB 2YMXL 2ZXCA 4RQQB 1UM5H 3HFFA 5JW3H 3QUZD 4N2EA 4N2BA 3LKPA 2CGRL 4JVWA 3BGFB 1N3NA 1NWOA 3L5IA 3E6HB 4X5WA 3SDCD 1FN4A 2JJVA 3JWOL 1ITBB 2R9HD 4PJDF 5DD1L 2OSWA 1ZHKA 1D5MB 2DQTL 2ZSWB 1I4FA 1WBYA 3I6KA 4MNGA 1LK3L 4A1RA 5FWQA 2R4RL 1RCYA 2AQ1A 2IJ0C 3QFJA 4TQEL 5B8CA 1QLEB 4JB9L 3AXIA 1NFDE 4P2RB 1I1FA 2FHBA 4UT7L 3SKJH 5D4IA 2DI8A 4LKXB 1IT9L 3C8DA 5FYKE 5CBEB 1OGTB 4JO2L 3TNNA 3RNQB 2CQVA 4JFXB 1XZ0B 2BVPA 4ABQA 3RZCA 4AUUA 2XJLA 4HKBA 4ECNA 2NR6A 3DDFA 1B88A 1IM3B 3GLDA 1RZ7H 1E4XI 1VEMA 5JXAL 3EDDA 4WW1A 5C0AD 4Y1AA 1MXDA 2HRPH 4CSZA 3WO4C 2O6EA 1LTXA 2DWDA 1AE6H 4XVSH 5C0NC 1L0QA 5KS9F 4AIEA 3S3BB 4WY7L 1N7ML 3QUZC 3KBPA 4PTTA 2VDRB 3Q9QA 4HHWA 4B7IA 3SDCC 5ABAA 3U1QA 4L4TD 2R9HC 4U1SB 4YSOA 2H1LM 2BOBB 2XZCL 1EHXA 4JO3H 1PX8A 1RZJL 4LGPB 4QR7A 3RL2B 3VFRA 4AIXA 1MCIA 2AK4E 5EIIB 3KVPA 5HHNB 2CK0L 4UB0L 1PLBA 3IDXH 1JF5A 1AD0B 3SOTA 3S36H 2FGZA 2CHZA 3WJLC 4D9QE 3E38A 4U1KA 1UA6H 4DFIA 4TVPH 3NIDB 4XI5D 3SQRA 2VDKB 1RUML 1HINL 2H4EA 4CMMA 1R24B 3GHEH 3ESVF 3D3VB 4XNUH 2VXUL 2IGTA 4MVBD 5KSVA 4WWKA 3VWJD 3EYUH 4RMVA 2B59A 4R96A 1WGOA 3AC0A 4O02A 1TJXA 3VXRD 4CN1A 2Y1VA 3EYVA 1VIWA 5GGUB 3C9NA 2XY1A 3LH9A 1QEWB 1Z5LA 2CO6B 4L5FH 1I75A 3B9VA 1H3GA 4YDJB 3MLUH 3NJGA 3CSYA 5GGQL 3WMPA 4LBEB 2VDKH 3OB0H 3WFEH 3ZHKA 5DS8B 4OJFL 2YK1L 5E08L 2YPLA 4FDWA 1FRGL 5DD0H 2E27H 2OMXA 4LDEB 3S37X 2WXJA 4PWHA 1K8IA 2Z4TA 2VDQB 3G6DL 3VFPA 1QBAA 2W65B 2NUPA 5K9OA 5FCUH 5I66A 3DBXA 3I9GL 3V9FA 3OD3A 5D71L 1A7RH 5LGJA 3UTSE 2Q1EA 1SUJA 3VWKA 4XI5C 4NRXB 1J9CT 3KJ6H 3FB6A 4FYRA 4XNZB 2XQBH 5JHLH 4HIHB 1IJNA 4FERA 2VDQH 3FRPB 4MVBC 5FPIA 1X5HA 3VWJC 3AGWA 4ZX5A 3VCLB 1CCZA 1TUPA 4KTGA 2WPGA 3S3JA 1QR1B 3DGDA 1BIIA 1B4LA 2D03L 2Y06L 2X2JA 3ORJA 4M6NL 1D7CA 4N8VB 4D3CL 1IFHL 5CLXA 3PYCA 1ID5I 4X4YA 4UOQA 2WUCH 5ELIA 1ZGLB 1A7OH 2WB7A 3P9LA 2AQQA 2ZNXA 4NDMB 4H13C 5FYJD 1VZIA 4ZQTA 2JKNA 1BZ7B 1BX2B 2WP3O 1PKQB 5F6IB 3GNMH 1FVDA 3D0LA 5AOKA 2K1MA 1TQBB 4WJKB 3BHBA 1BVNP 4X6DB 2ZUYA 4RFOL 3ZKXC 4DCQB 4BKSC 3MBXH 1KXVC 2QPEB 4HHAB 5EN3A 2ZF9A 3WTVA 5T3XL 3HI6L 5JPMB 1R5IB 3FO0L 3IU3B 5GZNA 3NFPB 3IDIB 5G2NA 4YDIH 2UZXA 5ITBL 4J3UA 4XN9A 4MCYB 2EYRB 2HFEB 1KB5B 3IWVA 3WL9A 4OUUB 1JBJA 1VDGA 4NIYE 4UBDD 2J4WL 3SKOA 5EOCL 3ZSSA 2DQDL 1BVOA 3AFLA 1BLNB 4OZHE 4HMEA 4XWOD 3B7RL 3IJ8A 3RDTB 1U3HD 4MDIA 4H88H 1N6QH 1KB5H 1BZDA 4HLJA 2IQAA 4A2MA 2CHXA 2EILB 4HDIB 3ETTA 5FW6A 2MCAA 4M6AA 1QLEL 3F85A 4WGKA 1TTFA 5D4HA 2VR4A 4XP6L 3FOLB 3ZZQA 5AW4B 1IGMH 2H9GA 4C47A 3K1KC 5IB2A 1B9ZA 1DJWA 5IV2A 4E5XA 4G70B 4UDTA 2ZUUA 1Q72H 1KXQE 4GRWF 1KV7A 5DJDA 3ZKSD 3L8QA 5HDRA 3ILQD 1CLCA 4G6FD 3TIDA 1O7DE 2KERA 3TO4D 3L3DB 1TZ8A 4TSCL 4OIAA 4WO4D 1KBPA 2PYEE 5FS5A 5IW6B 5LHDA 4WHTB 4AL8L 5CIPA 3FH5A 4Y2NA 4NHUA 5J6GA 1UUNA 3SIKA 2Y3AA 4TKWA 1KIRA 4QO1B 2XHNA 3LX9A 4APQA 3T0EE 3V5HB 4UBDC 2VDRL 3WSQH 2CJUL 1GW6A 4DUVA 4XWOC 1CE1L 7PAZA 1S8DB 1U3HC 1U42A 5D1XA 1DVSA 4LVOB 3FU0A 2IXQA 4NT6B 2ZYSA 1ZOXA 1YEEH 5HY9B 3QQDA 1QI4A 3IPEA 5CD5D 1Q9LB 2WLHA 4PJFE 1TSHA 3QBTB 4RBPH 3STZB 4QRQB 2JLPA 2AGJL 2Z91B 4DZBB 2WSDA 3AABA 3D5OF 2Z4QB 4OZGA 1TEYA 1UGKA 3ILQC 4A39A 2VNCA 3L81A 1ZY9A 3HNVL 3I6LE 4WO4C 4MAZA 4PCYA 5B1BB 3TO4C 4KVCH 5FF6B 4AEFA 3RZWA 3A4FA 1KJVB 5TE7H 3O9WB 4F91B 2OMWB 4ABWA 3HPLA 2V17L 5GRUH 1JF1B 4LPTA 4AEIL 2F5BL 2R8SH 3S4SG 4Z0BH 4AKQA 5DMKB 5JIMA 3LN5A 1H8OA 2D0GA 2R69L 4KFMA 2WTPA 5IJKA 5FYKD 3BFWA 2JKTM 1MQ8A 2OLDA 4EAEA 1KMGA 3S2CA 1U93A 3RTLA 5LNDA 5IWLA 1R6VA 3HE7B 2YPVL 5DZJA 1TCMA 2A6DB 5CD5C 3KWTA 1OAZH 4PV1C 4PTUA 4ZOAA 1PX4A 4EOWL 2WKOF 4AGPA 3MRNB 1I8MB 3HOGA 3EUDA 2BSSA 3LEYH 5D55A 2I9LA 1NCIA 1OW0C 3Q1SL 1A2YA 3QZWG 4B0MB 2EVGA 4WI3A 1G5GA 1QLRB 5K39A 2WV3A 2H0JA 1WP6A 4LVHC 3V0JA 3PQYE 2CKBH 3ZE0F 2G2NA 4YXKH 3TPKA 4OCYL 4NPYA 1E7UA 3VJ6A 2I24N 3GSQA 3DTXA 2WKLA 2CWRA 2PPFA 5IOPA 4PWFA 1HH6A 1BM7A 3QNZA 4M9PA 4Y16D 4N90E 3MROA 3MUGB 2AK4D 5SX5H 2E7MA 5KJ7E 1ZAGA 2OXHA 4RNRA 4CSPA 2WBJA 5GS1C 3VUAA 3D0AA 2IH3B 2XTJB 4D9QD 1H3PL 1CGXA 1VJSA 3DX6A 1GYVA 4FZ8L 5C70A 3ZT7A 1YNKH 5JHDE 3BP7A 5E9DB 4L3AA 2OMTB 2WZ6A 3D05A 1LEGA 3MLSH 1N6UA 3H7BB 1VGKB 2PWHA 3B4NA 1OF0A 5DXWA 3DX8B 1XTLA 3BDBA 1INEL 2J57A 2IPTH 1FBIH 3LVEA 1DUZB 2P1YA 3O0LA 3Q7JA 3W39A 3ZL4H 4JPKL 4A2GA 1PLAA 3QQNA 5DFVD 1DN2A 1QSEB 4J3VA 5GHWH 1CU4H 3KPOA 3HZVB 3GGWA 3LEVH 3D9AL 1KGUA 1A9EB 1FL3B 4CRPA 3GSVA 1D6EB 4P2RE 3V79C 3DOHA 4Y16C 2VR6A 4LLQB 2X3AA 2MIZA 2P47B 3U0TA 3BZDA 2BS71 5E4IA 2GEEA 5DHMC 2EC9U 3KM1A 1P4BL 1D7DA 2LU5A 5JUEH 1H6UA 4WQOA 3GT6A 4HWUA 1YJDL 5CINH 3HZKB 1KGCE 1YRKA 3HE6D 5C2BH 1J5OL 3DTUB 3IDYB 4N24A 1RV6X 3OM3B 4ZYKA 2C9RA 5F89A 4FFVD 3UTSD 1OTTD 4FFZA 1I1YB 5BRZA 1ZSDB 2GTZA 5FB8B 1UEMA 5F9WC 3QI9A 4X0KB 3REWA 3S6CA 2NNXA 3S9DB 1WFMA 2C5DC 2AXGA 1RUAH 3ABKB 4PRPB 1T1YA 2ZNWA 4CVZB 5E99H 2NY1B 4FCAA 4ZS7H 3L1OH 2FX8H 5DFVC 2XG5B 3KYNB 1NL0H 1YAIA 4KX7A 4OGAD 3RVWD 3S34L 3WIIL 4YDKH 2BSRB 1NEZB 1YMHA 3HLKA 1PD0A 1YEEL 1JPTL 2G75B 4JMNA 1Z0NA 3WFDL 4YE0A 2QPSA 3ZE2F 3F58H 3BKJH 1PZ3A 5E7FA 2DLIA 2J8UA 4WNQB 2R2EA 4A7GA 4CU8A 2V33A 3MZGB 4YQXH 1CIUA 1ECYA 3CZSA 4L5FE 2EDYA 5DJZB 3AXHA 2VXSL 5AZEL 3NIDE 4XMUA 3ECBA 4NSKB 3CFUA 1FAKT 2V7HA 2FX9L 3MRIB 1E4WL 1S9YB 1NCDL 4J6RH 4JFDB 4N28A 4QAMB 3VGAC 3PWJA 4AH2A 3D3VE 3HE6C 3P4OB 1MI5A 2DEYX 2DH2A 3FKUS 4FFVC 4GKZA 4WFGE 4LEXH 1OTTC 5EO1A 1T03H 3QJFA 1O9VA 1R0AL 1TU2B 4IK7A 1DSWA 3TYFA 5D7HA 3E8UH 3FRUB 4F20A 4JO4H 4UAHA 2GW5A 3IFLL 4GQZA 4J8RB 2CO4A 4MSWB 1KUMA 4OGAC 5I8OL 1YN6B 3RVWC 4QGYA 4AIOA 3CVHB 1CLOH 4O51A 5K1JA 3S35H 4PYGA 5BVPH 1PZCA 3H3PL 5FKPA 3VD0A 2DQEL 1IAOA 3UC0L 1CFNB 2MOQA 1QUNB 2BCMA 4ILDA 4WI8A 2JNZA 1DJGA 1ZLUK 3GBLA 3TWCL 3MXWH 3SKNA 3HB3B 5I75C 1KCRL 3P73A 3ZUNC 3X11B 5E8NA 1JZ4A 2O6PA 4C83A 4ETQA 4FC3E 2WJ5A 4Q9BA 2PYED 1A9BA 2XPGA 3SCMD 5A2KH 4F57H 4BHUA 2ITCB 1G0DA 1Y0LB 2B1OA 2OV0A 1RJLA 1EEZA 3U2JA 3T0ED 1PEWA 2Z6FA 3GXTA 1M6OA 1U2CA 1INDH 4X0NA 2XWDA 3VTTA 3GPEA 4PHZA 1PKQE 4RX4A 5FUOL 1BG9A 1T1WB 1U8KB 3VQLA 4D0BA 3BYYA 4A6YL 1XGRA 3JWDH 3IEAA 1NFIB 5AYUL 3VGFA 3WEBA 1NUFA 4X6DE 4BWTA 3CHXA 4YSDA 1IAII 3FN0L 3D4CA 4PLKD 1J9QA 4C56B 3P9MA 3T1WA 5KW9L 5MEPB 2O5XH 3BDYH 3NFSL 4K7PY 5KUMA 3C6LB 4P5KA 1RD6A 3QHFL 1XDTT 5JORB 4ZUUA 3OQRA 4KV5E 2QSVA 3FB7A 4XRCB 4WHCA 1PYWB 5D5MA 1MAML 4XMPH 2QQKL 1XCQA 3BOVA 5HD8D 1C5DA 1O7DC 3ALWA 3I6LD 1U2YA 1YEFL 4FNQA 4MAYD 1MWOA 5HDQL 1JPGA 3SCMC 1RZIB 5T1LB 2N56A 4R26H 1BIHA 4G1MA 4GXUN 3X3FL 1CFMA 4OLUH 1GTFA 3MODH 3PABA 4OH2A 3T0EC 1A1OA 4X6CB 4KKPA 2RACA 5ADOH 3L4XA 2LV4A 4PJCF 2GBVA 4UU9A 1XGPA 5D2NA 2BIOA 4POZD 1B2YA 4GRLD 1LP9A 4LSTH 1FL6A 1GY2A 1SDDB 5C0JB 4K7FB 4ORGA 1B3JA 1DBKL 3NSCA 1M1XB 1ZE3H 4J3XA 5F88B 1JGUL 3CSBA 4BZYA 1NPNA 4HP5A 3GZOA 1NLDL 4PLKC 2XKNA 1WGVA 3JTTB 3WS3A 1ASOA 4IM8A 2WOYA 1FPTH 3E9TA 2QDWA 3G6JE 3HZMB 1SXCA 3X12B 3MA7B 3QUMB 4KDVA 4JKNA 4MDRA 4GW5B 3GKWH 1G0XA 4WWOA 2OL3A 3PQYD 4DGVH 5HD8C 2NQDA 4NCC1 3T4YB 1B9KA 3KWVA 4MAYC 1WA0X 5A6IA 4GB9A 3LHPL 4NUMA 4LESA 2MOVA 3T71A 1BGXL 2E75C 4HOXA 2PWDA 2X42A 1ZLVH 4HJUA 4N90D 2OTUA 2PCFB 4HCRH 3KCPB 2W07B 2E9BA 4TUOB 3IJHB 4POZC 2QGCA 1U95A 3X2QB 4FL4C 4UWQB 3IRZA 3F7LA 1SPDA 4HH9A 4PU2A 1SY6A 5KAQF 4JL2A 2TRHA 5JHDD 2P48B 4N6RB 3WNPA 1I8LA 1LMKA 3UBHA 2A83B 1XF5B 2J8OA 2Z7YA 3NMEA 4KRLB 4FA7B 1JK8B 1QBBA 2NMSA 4E9TA 1MFEL 3HCVB 4EI6B 2ZP9A 4ZO7A 1MFUA 5DVLA 2F1EA 3QQ3B 4GMSL 2YXFA 1NH6A 5F7MC 4YBLB 5I30L 4D2NA 1KCUL 1RIUH 3Q2WA 1HHJA 3BPCA 5TH2A 5CMAB 1UXMA 3AY4A 4P2RD 2H7WA 5C0IB 4WSKA 3TEUA 3LDBC 2P46B 4FTVE 4RVBA 2AQTA 4JHBA 1CI5A 3CVHL 3U2SA 3PREA 3BQUA 1Y18B 4LF3A 1BAGA 1IM3D 2IANB 3BSGA 3EJQA 1KGCD 1AANA 1X6LA 1JK9A 4Z3JA 2HT3D 5JTWA 5I73B 5KVFH 2BHYA 2RJMA 5DK2A 3QZNA 4UQ3B 4PRDB 1A7PH 2QHRL 3DYMA 3BAYA 1T4KB 1KPVA 1WD9A 3DX3A 2GCYB 1ZHLB 4BFBD 1IRAY 2O5ZL 4FG4A 1CB4A 5TGBB 3BGFC 4HKZA 5EUKB 4ODHL 2GJZA 2ATPA 4MMYA 5AVUB 2JE8A 4P5TB 1JPSH 4LE8A 4TVPD 2Z1KA 2VM4A 3B6SB 3WTYA 1G9ML 4JY4B 3I84A 2CD0A 1FNSL 2EE3A 3VD7A 2AITA 3RRQA 1PW3A 2EO1A 4M8VA 1T0OA 4JKWA 5IQOA 1NGQH 2NLJA 4AGMA 4P4KA 1RSFA 4BZ1H 4AUYA 2XTJE 2AQSA 2GUOA 2H32B 4K71B 4PGDA 3V5DA 5D2LF 4BZ2H 1CBVH 4U4BA 4EI5A 5E9DE 4G6MH 2XN9A 3A4EA 1AJ7H 1QWUA 4GO8A 3FU6A 1J9RA 3O3AA 3D3VD 1GHFL 2HT3C 2WQWA 2EE9A 4KDWA 1P4LB 3I6GA 1RFDL 5LG1A 4HIEA 2YQ2A 4F58L 5LBSH 2IAAC 2XOTA 4WFGD 1ACYL 2WINB 5FWRA 1DFXA 1MFBL 2ZP0T 3FK3A 3TP4A 4Z78A 4NUJB 1Q9KA 3IE9A 1U92B 2H32H 1P2CB 1QSEE 4JQXA 3GEFA 2XSKA 5E6SB 4UTBA 1II4E 2C3VB 2CXKA 3L95B 1GSMA 1K5NB 2ARJB 3RWJB 2RALA 3VA6A 1A6ZB 3EGDB 4AQ8C 4KDTC 5HPOA 3UX9B 1JPEA 2XZQL 3X1BA 2HYMA 1JZ6A 1FFRA 2IDCA 1MFCH 4Q9RH 3GMNB 1CXLA 4FFYH 4UIKH 3WYRA 5CEZL 4ZUSA 4IBYA 4S1SH 3O6FA 2F18A 4FADA 3WY4A 1IC7L 2P5WA 1AO7B 4O2EA 5DK0B 3QXDA 1XEUA 1ZA6B 3IDNA 3G6AB 4L48A 4N1EA 3SQBB 2EDNA 3R0MA 4H8WL 1EV2E 3D39A 1T80A 1NC4A 1KLFB 5CUSL 1ED3B 1XH0A 3S3SA 5DJYA 2UWEA 5TDPB 3EXJA 2OKMA 4WI7A 2F53A 5DD5L 3NEEA 2CO7A 5I18H 1VGEH 3C8KB 1EAPB 1C12A 1M2VA 5AD0B 4IOIA 1TCRB 5GPRA 1TKWA 4FXGA 3BWZA 1LEKB 3QUML 1F1DA 2GJJA 3Q01A 3WXWH 1JV5B 3I2CL 1F11B 2DQUL 3HRZB 5I76B 1N0LB 1A7BA 1ET8A 4MWFA 2V2WA 2WLIB 3GM8A 4OZFG 2E9GA 1E9QA 3C5SA 4CJ1A 3MYJB 3IETB 1BM3L 1B90A 4PGZA 1H8NA 1ZJAA 4L8DB 4JFDE 4NLHA 5F44A 3T4AB 2BSDA 1PNCA 1Q94A 5E1AA 4DKAA 3BO8A 1VPOH 1EEYB 4G8FA 1CD1A 4CBZA 1C7TA 3U4KA 5CXPA 2N7AA 1ZS8B 5LNGA 1ZJBA 3BZFB 3US1A 4XBEL 3SGKC 3T3PF 3OHXA 3RI5K 3AAZA 2YD2A 1FF5A 5ADPH 3SE9H 1VA9A 2WO2B 2HVKA 4WTWA 4K5OA 1YEJL 1MJUL 1QTYT 4JFZL 3MCG1 2LU7A 3DHPA 5DQJB 1EANA 3VGEA 4FZEL 4B9CA 3T5WA 3TJEH 1R17A 3LQAL 5FM5O 2AXFB 1OSPL 3ARGA 3ROLA 2QQNL 5C0RH 2BOLA 3KLAB 2AZUA 1CLZH 5DJ0A 3A6CL 4KY2A 3FOMB 5F6IC 4AK1A 4AEEA 3HR5B 1TQBC 3QIBB 4DF9A 4NNYB 4A7VA 2VXQH 3DA0A 4PJ7F 5JPMC 2AEQH 1UD2A 3B9KA 3FT3B 1ORQB 2BX5A 3PDOB 4JZNB 5BJTA 5AAWA 5J1TC 4MFHA 5IB1A 1ZDQA 4NM4L 4BH8B 4MKMA 4D9RE 3ZL2A 1IGJA 2ENQA 2IWGA 1IGCL 3MOBH 1RQ5A 3PGDB 1TLMA 2IOMA 3GSNL 3SKUD 4F24A 4I18B 2QVFB 3II1A 3ASWA 4OCLC 5JNYB 3FYEB 2X38A 2MH4A 4WKZA 1ZT7A 4FQLH 1JL8A 4N0UB 4M61B 1XF2A 3OJDB 1LNUB 1EBAA 3TA3A 3EDJA 3FYIB 5DYFA 3GXFA 4FQ2L 1WFOA 4Y9BA 4XPBH 4LK4A 3U9PH 4B53A 4HIIA 5E8PB 2ATKB 5D8JH 4HMDA 1HOCB 4AMKL 4C56E 5GZOA 4H40A 4K3EH 1QNZL 1GJWA 5LWYH 4LLAA 2XWTB 4HUWB 2FATL 4OZIA 4Y1TA 2IH1A 1E9OB 4KPHL 1HXMA 2ZONA 1NCUA 4QHUA 1E8XA 4JRLA 2WXKA 5IW1B 5IK3A 5DD3L 5GSVA 5T33L 3VDBA 1CLVA 1ZTMA 3DUSA 2C4XA 2VLME 2UZPA 2DQHH 1U8QB 3FB8A 2YD1A 3CXHK 5C0BA 2XXMB 4OQTH 1E42A 4W6WB 4UTAL 4KWUA 2IGLA 2OJZL 4DGIH 3P1VA 4JRXB 2BIHA 3IN2A 4LIQH 4EDWL 2Q7YA 3SDXB 3BAKA 3ASOB 4FTVD 5ESAB 4ZTOH 3KPSB 5F7DA 1H9DA 4LVOC 4PJBF 4ODUB 1JFHA 1I3RB 4LOVA 3CWGA 3HE7D 4R7XA 2ZXWB 2ZPKL 3I3EA 3DX7B 4MCZB 5EV7A 4Y2OB 4Y7MA 4FLOA 2P80A 4AYFB 2E59A 3IGLA 3ULSA 3OJVC 4OFPA 4GG6B 2YGOA 1IKNA 3HS8A 4HX1B 1HZLA 1LILA 4OW6A 4XGZA 3DX9B 3KYMB 4NHCH 5E1IA 1EA9C 2BZ7A 3DURB 1RK1A 1GOHA 4YDVA 3UO1H 5CILH 3GZPA 1JPST 2BOCB 2WLMA 6PAZA 1ANUA 2CDEA 1PIGA 2X4RB 2Z1PA 4LASL 2CDFA 3KLLA 4UANA 5FM5M 3RWEB 3W9DB 3X13B 2WWKT 4YHKL 5AWNL 3D2UA 2D3LA 3PIQB 2R39A 4L8SA 1JHLH 1UB5B 3DX4A 3RY6A 5CLWA 3DMMD 4N8UA 4UQBA 4D0CA 1LJMA 4PV8B 2XV3A 1EFQA 1MCOH 2ZYRA 2XTJD 5CP3H 3HJ0A 4NO0B 4J3WA 3HE7C 4XB8A 5E9DD 4PJIF 4Q9CA 4JS7A 1HQ4B 3FQUA 5F3BB 2XZAL 1T2XA 3EDEA 1NGXB 4WWID 4CN4A 1P0SE 2CCLA 4OJEH 2VQ1A 2V2TB 4FTDA 2Z92B 3P3RA 2BC4B 2QMKA 5LN4A 3AU1A 3CX5K 4Z3TA 4N2LA 2ICWI 2JB5H 3UTTE 5KVDH 4TNGA 1CZ8L 1QSED 4LHUB 3T6QC 3GTVA 5EBMB 4LSPH 1U91B 1HZHL 3UG5A 5LG6A 1SXSA 2FB4L 3MLTA 4YMPA 5FGSA 2EDTA 3CFMA 1MQKH 4UINL 3GSXB 3MRCB 5I9QB 5KVFE 3BPLC 2NX5A 2ZYHA 3WLBA 1KEGH 1ZCRA 5GIRB 1XIWA 1RMFH 3BRGC 2YA1A 5CZKA 5KJRL 2DTMH 3P02A 3O2WL 4P46A 3TX4A 3BT2H 4E41B 3WTWA 2AEQL 3DMMC 5JHMA 4NNXA 2IANE 3VG0L 3NA9L 1QI3A 2QL1A 1JZ7A 3RWIB 1S4IA 2BSED 1KXTA 3G04B 1FDLH 5J89A 2FVNA 1CXIA 3BH9B 3AWGA 3PWNB 5I9QC 3PXLA 2NTFA 4Q2ZA 4P07A 1S6NA 2J6WA 2WK2A 1L0PA 2NOYA 1UFUA 5CGYD 4LSRL 5TDNA 4PR5B 2WXRA 5D7IF 4DVBA 1ZD6A 4K7PL 3VXPB 1CS6A 4KHXL 5LAXA 5CJOH 3U30B 5I16B 2NY1D 3RURA 1MEXH 2ESVB 4R9HA 1CFVH 4Q74A 4XC3L 5D7KE 1D5ZB 2I7SA 3WNMA 3ZR5A 4HHGA 1X4YA 1NMCC 3QJRB 1AFVH 3QP3A 4GIOA 1RY7B 4WK2B 1JZIA 3G9VA 4GW4B 4DFHA 3H9ZA 4QAWA 5IQNA 5HTSA 2HKHL 4CC4C 5E2VH 2PPDA 4JFDD 4CC0A 3CFDB 1EX0A 3IXAA 4MA1B 3OR7A 2XACC 4IBWA 4MNQA 1K2DB 4H20H 1BBJA 3F6JA 4JLRA 3ZZ1A 2IMMA 5FW7A 1S9KC 3C5ZA 4P3DB 2E47A 3BW9B 1KC5H 3GTNA 1JPFA 4LPCA 1BYPA 3DOSB 5T3ZH 5TK4A 3ELAT 4MHHI 5CGYC 4RSYA 1NBVL 2YARA 4TN9A 2BDNL 1CT8B 2OYMA 3BD3A 5FW8A 4JM0A 2FR4A 2NY1C 5IM7B 3MNZA 3C2AH 2CHWA 3NQIA 2QT6A 3EJYD 5F7UA 3FQXB 3Q6FA 4PRBA 2VLLB 4KZEH 3VFWB 4F15B 1R3KA 5EF3A 1JSYA 4G11A 1MAJA 4MKTA 3VXUE 4TTDD 1EHNA 3L4UA 4Y4FA 3V4VL 1AO7E 4LLYB 5EEYA 2COVD 3MV8B 1ZGLM 2X1OA 3FU5A 1WWAX 3LN4A 1SDAB 1XXFC 1GGCL 3AT8A 1OP5K 3FT0A 2A6IA 3NJVA 3ESPA 5AKTA 1AZCA 2E7LA 3HB3D 2HH0L 5I1EH 2GB2A 1PU0A 2NY0B 3S48A 1AKPA 1I9IL 4A2FA 1ETZB 4R7NA 2NY3B 3QG7H 4M56A 4XHJD 4Q6IA 4M1DL 5GJTH 4D9RD 1R3LB 2NSXA 1XEDA 2J6EL 2LAGB 3LVTA 3J7HA 1IC4L 3ZDYB 3L3KA 3GB7B 3WN5A 1ZXQA 4Z1PA 1JGEB 2R4SL 2XN0A 3KPMB 5DJCA 3EJYC 4ZFFB 2A5UA 2YEZB 1JUFA 2WKGA 5JPNA 3P30H 2R0KH 1TTRA 4I3SH 5I1LB 5CEYB 1C08B 4GJTB 3QHZL 4TTDC 4U1IB 2VOTA 2DLFL 4AKOA 4DN4H 1LK2A 1FFNB 3NYKA 4DAGH 4RWYH 4Y5YA 4MXVE 2P43B 4C56D 2JCCF 4NXKA 1KF9B 1WZLA 1QSFE 5FYLH 4GG8B 2VDOB 3C6LD 4LRNL 3MRQA 3HB3C 1NQBA 3HZYA 4H25B 5A2FA 3QCTL 1CTNA 1GZQA 2ICWJ 5DA0B 1HSBB 1FIEA 4XHJC 5HVFB 3RGVB 1H3WM 1MREH 1GIGH 1FFPA 2VN7A 3GIVA 4XVJL 4YEEA 3JWDC 2VLMD 3RX7A 5T1LD 4Y8AA 4OBRA 5CR8A 2GC4C 2A74A 4H1LA 1TEGA 3ARDB 5F7YC 3NN8A 1MPAH 4XNYL 4ERSL 2VL5B 4RETB 2ZWZA 2P8LB 3B5GA 3LXBA 5MENB 3ZMNA 5C09B 5DJXB 4X7DC 5DO2D 1G5AA 4F7PB 4DVRH 5EUOB 4G6JH 2YSSB 2X4OB 5HGAB 5LN8A 4JQIH 1GPOL 3BUBA 3ZZLA 3OKOB 4PJHA 4PBXA 4PREA 4W9JC 6FABH 3Q43A 1XTMA 4JPWL 5L7XH 1NSNH 2P44B 4KO6A 1A4KB 1C1EL 1HXYA 5M7QA 2X5PA 2ZUQB 3C6LC 5KYXB 1AXTH 4YX2H 1EGJH 3QYNA 5CEXB 3BEVA 3QUYA 4Z7WA 2D7TL 3OKYA 5CS7A 4O2CB 2OP4H 1MH5B 2CK2A 3V6BR 2C4FT 3PWUB 1BFVH 4N26A 4D0DA 5DVPA 1WO2A 2PPCA 3ZGIA 4QOKB 4N0UE 5LBGA 3U46A 2HT4D 3N44F 1QFWH 3PS6A 2VE6B 4YJZL 4JHWH 2NW2A 4OLVL 1KIPB 1BD2E 2DI7A 5KANI 2PXYA 4M8RA 5F7EL 2WNXA 1GL4B 3LY6A 5DO2C 3HN8A 4Y0GA 3DTDA 4NGHL 4HGMA 4JQVA 1QFOA 2Y1YA 5DK3A 5B1KA 2JI2A 4F8OA 4P2QB 1M7IB 1RULH 1KN2H 5IMMA 4LIQE 4GSDH 3Q44A 4L3EB 4PJ9A 5I1DA 1AQKH 3HMXH 2VDLL 3T77A 5TE6H 3RUGA 1RZGB 1DQLL 1KLUA 4X8CA 3UTTD 3ZRFC 5D1QB 2YSTA 5TE4H 1CL7H 1JD9A 3UEZA 4L1SA 1Z2KA 4B0MM 1I3GH 1IBGL 1Z3GH 3IJ7A 4JRXE 3UXFA 3NCCB 4KO7A 2OX5B 4WTXA 3HHSA 1HHGA 1S7UB 1WBZB 1XGTA 3QORA 3SDXE 1QLFA 2UXGA 1ZHBA 2HT4C 3FSVA 4HUXB 3RU8H 4TNWK 3BP4A 2XXGA 2BSTB 3OZLA 4XCYB 1AGBA 2RFXA 2JIXB 4FMFA 4M03A 4FJZA 4NJ9H 3T0BA 3UZVA 4GG6E 2N0MA 5HHVH 4JNXA 4MJIA 3BVVA 2CLVA 3OGOE 4EBQH 2GQHA 5GGRY 5GISL 4LPYA 1CURA 4NZ8A 3MRRB 1MCLA 1FGNH 1IQDA 2ZUTA 3OMIB 4LSDA 4P2OB 3NJXA 2UZYA 1B2WL 4GFXA 1XD0A 4HIJB 5DQDL 3MI6A 4P4RB 4PY7B 3OG4B 2AV7A 4XMWA 3T3MB 3IMSA 1HFUA 5IFJB 1ONQB 2XBDA 5D7KD 2FJUB 1N8ZB 4YBLC 1WAAE 3MOQA 1UKTA 4U6HB 1IFGA 1F00I 1UZ8B 1O5DT 2V5YA 1UXWA 2VC2B 2FEJA 2KPWA 5HGGS 2IGFH 5KVDE 1MCBA 1WLHA 3IFOA 2YN3A 1BFOA 3ZGHA 1E6JL 1W72A 4PJDB 4XAKE 3BWUC 4X5XB 5DZLA 1BWWA 3HUJA 3PHSA 1KPRB 2L04A 2XQ0A 1YNLL 4YHOH 2ZKHL 1OAUL 4PVLA 1OCZB 2NZIA 4XNBA 5DUPH 5I73C 1BYNA 3CZFB 4YHNB 1NCAH 2VC2H 2VDOL 1R75A 5ITFA 1KTRL 4ZW7A 3H4FA 3QC5X 1H3TA 3HKFA 4JZOA 3V0VA 1CFTB 2HLAB 3KNBB 1BVKA 2ZX5A 4OFYA 5J12C 4RESB 3TBTA 4HCFA 1NJ9B 3FT4A 5L4JA 2H26A 3OLDA 1ZV5A 1A14L 3FUNA 2ICEB 1QFPA 3K2UH 4YXLL 4Q0XL 4TTGA 4FQQA 1I3VA 1JI2A 1RIVL 5KS9B 4E41E 2NY6D 2BVYA 2HVJB 3VXUD 1W0WB 1FIGH 2RCSL 5ABZA 1UYWH 1DBAH 3BUYB 1AO7D 2OPCA 2HJLB 3ERXA 5DRXA 4IU3B 5EN2A 4K71C 1BFTA 4QTFA 3DVGA 3BSZA 5F1NA 3K91A 4UOW1 3QUZA 2C34A 1HQRA 5PAZA 5G4NA 2DBLH 3A3YB 2Q8BL 1DQQB 2DQGH 2RTTA 2IF7A 4IRZH 3SDCA 2PCPB 3QFDB 4X7SH 4QT5A 1HHKA 2ZOLB 4PRAB 4IU2B 4GOSA 1WDAA 2CJTA 3WUWB 1AG0A 1U8PB 2ESVE 3DX1A 4EZMA 3U6RA 1VSCA 1JWMB 1RZ8B 3MFFB 5E0FA 4PV9B 4KQ3L 2G9HB 3WJLA 1E5AA 2W0KA 4C59B 4KUCD 1V3JA 3SY6A 5T3ZE 1NCGA 1SYSB 2NY6C 3OLGA 1SXAA 1Z0MA 2EDXA 3APCA 5C0AA 4BJLA 1P53A 4NIKB 1NMAL 3QAQA 4JKPL 5ILTH 4PHXA 4Z7UA 3D18A 1QSFD 5BQDA 3KLQA 1CVSC 4BFGA 1UQSB 5BVJB 2JWYA 5A7EA 3WE6B 1TDQA 1P6WA 2YBGA 1BAFL 4XNMB 1USZA 3HC4H 2BP8B 4L4TA 3QS3A 1AGFA 2BRRL 4HGWB 4PS4L 4LEEA 4U3CA 1UXSB 4X80H 5D7LB 3DARA 2PO6B 5FAAA 3SZKC 1MIMH 3EG9A 4L37A 1RUKH 2F5AH 3W5NA 4IKLA 5DR5L 2CHDA 3HRZC 3ARFB 2EDFA 3P4LA 4NCC2 2OCFD 5DGRA 1E2ZA 2EEAA 2FYYA 1IAKA 4TV3A 5HGDA 1A6TA 2DQ6A 5AB9A 5GSRB 1OM9A 1J11A 4GW1A 2VJXA 3J2PA 1INQA 3VXOB 3QIBD 4GKOA 3ES6B 3VWJA 4RGOH 3DO3A 5E5LA 4I5BB 5IJVA 4B9FA 1KIQA 5HYQB 1IILE 1TQCB 2HKFH 1VACB 2X6CA 4YSPA 4HOMA 2YQ3A 4RFEB 1RZKL 4K8RL 5IQMA 5DUJA 3CBKB 4U3HA 4HUCA 1LWJA 3I9PA 3GZQA 1JNLH 1X5AA 2YD5A 3VFSA 3IAPA 4GXUM 1SBSL 1WSST 3UYPA 3ZDYE 5HYEA 1AGDB 4MHHG 5FYLE 3TBYB 2QJDA 3TLRA 4K3DL 4N9OB 3JT0A 1IQWL 3NAAL 3DO4A 5DUMH 3RBGA 2F74A 3EDFA 4MXWH 4M62H 5BZZA 3DIFB 1WISA 2AV1B 2TAAA 4IGBC 4PB9H 4WENB 1KXVA 2Q76A 2G60L 3ASNB 5CSGA 5D1ZI 2NY4B 1BD2D 1JZGA 4ODXB 2GYSA 4S2SB 4F37F 2EVHA 1GOGA 1ZSHA 1PBYA 1EAQA 3L13A 1ZEAL 1DYZA 4C55A 2ZCKH 2AJ3B 3QJXA 5D70L 4JRYB 2MPVA 3QIBC 1NOFA 1IGFL 3AS0A 3T65B 1P1ZA 1FH5L 2EINB 3MLVL 2GPZA 5GQBA 5DJ6B 1U8IB 3AUWB 4H26B 4HWBA 2EXTA 2QPFA 3FS9A 3PFQA 4JANB 3WD5H 4MCMA 4NZTL 4BFOA 2UV3A 1VF5C 5F3FA 4QYAA 3L4TA 1N12A 3L3IA 4PG9B 3CVDA 4BK5C 3MSPA 3ARRA 1JVKA 4I18C 5L2JB 2EH8L 3TNMA 4WSGA 5MENE 3K0WA 3EOAB 4GRWB 3L1EA 3DV4A 4JRXD 5C09E 1FZJA 3T04D 5IB5A 4URTB 2EKJA 2KUTA 2OR8A 3TFBA 2AK1H 3MJ7A 5EUOE 3QT2A 3VX1A 4GI9A 3F84A 1BEYH 3F3HA 3KGRA 2WZPD 5FOBA 1U21A 1OLZA 5JW5A 4HT1L 2X0VA 3ML9A 3QZLA 4YK4C 5KG9A 1B0GB 5B3NA 3ENEA 1LO5A 4Z95L 1NCBL 1JYXA 5DCCA 5BXFB 1W9XA 2CIIA 3V4UH 4GRWH 2YFOA 4ELKB 1Y1UA 1FC1A 1RSYA 3ZRSA 1FV1A 1I9JH 1JCVA 3MXVH 3TBWB 4RAUB 5EZLA 4ELMF 3EBHA 4Z3GA 3NEOA 2ADFL 3BISA 1R47A 1T1XB 1SF3A 2O30A 4QWWD 2VDPL 4J3TA 1R5VA 5EOQL 3Q8CA 4W68A 3KPQB 2OZ4H 5AVRB 1U3HA 1I8UA 4QOKE 3EH3B 1TZGH 2I85A 2X9YA 4IJTA 3NIFF 4NC2B 4ONGL 1MJ8H 3OSVA 3QXAB 3CZNA 2XQYK 1E8YA 3OC8A 3RPIB 5KVGL 4HWZA 3R8QA 2XYBA 3QPXL 3P0VH 5J1AA 3DPBB 4M7JH 5AW8B 25C8L 3VRIA 4GBXB 3HAEA 4ZXBC 2QGDA 4NO0D 4Z7VA 4XAKD 4P2QE 3MJ9A 5IMKB 3RIKA 1RZFL 2BFVH 3TO4A 1RKRA 4IKKA 4WO4A 4HZLA 1T0MB 4L3EE 5DMIL 5AVTB 3NJFA 4JM2A 4HJ0D 1MCHA 2NY5H 3GS4A 2GI7A 4ODWB 4G6AD 5GGRB 2X7LA 1E28A 4FF9A 1OTSD 3DUUA 4OF6A 5D1QE 4LHUD 1AH1A 5F6HI 1DFBL 1KACB 1YZZA 3FONA 4QWWC 3SQOL 4AYEC 4JY6A 3LZFH 4W9DC 3GLEA 2NT1A 4TSBL 3AS3A 43CAA 4HS6A 1UATA 3NSJA 1KCWA 2ORBL 3NJKA 4OLXH 4M4PA 3SDYH 4E41D 3OSKA 1HKFA 2E7DA 2QKIB 5GGSY 5HDBB 2GY5A 5IHWA 1YEHH 1OE2A 2WUBH 3OVUB 5EBGA 2KL6A 2BK8A 3A0OA 3ZE0B 5KANG 1ZA3A 4BGDA 4KQ0A 4ZODA 4ALAH 1OW0A 5AZ2H 4RMTA 4KNUA 5L88H 5I28A 4I4WA 1XT5A 3A24A 3NCFB 2AVGA 4KJYA 2OXGB 1PDKB 4BFIA 4DO5A 2QV4A 4ZO8A 2HX8A 2OMVA 1KBKA 4XR8C 3VFMB 4HJ0C 3UABA 1FCCA 2GSIB 3OMZA 2EIDA 1GZHC 2NQ3A 3FJTA 2IQ9L 1TFHA 2J1WA 4G6AC 1TMQA 4BKTC 2IAMB 5E4EB 2ESVD 1OTSC 3T3ME 4AXWA 5IESL 1KTKE 1AZZC 3UTQB 1NDGA 2DM3A 1VRSA 1NFDA 1XF4A 4X99A 4F7MB 1KFAH 2WMPB 1I7TA 4MGXA 1AZNA 2GJ6A 4AC2A 5GS1A 3HHMA 5BNXD 1VFAA 2R7EB 2AEIT 2VWEE 1OAQL 3EADA 2W9EL 3GBML 4GRMB 1KCKA 1FO0A 4IBLT 4Z7NF 3ET9F 4KY1H 4AWJC 1P84J 5T3ZD 4PJDE 1OCOB 1QQDB 3MLRL 3WD5L 4PLJD 1BG1A 1A0QL 5TPWH 4OTXL 1OANA 1RIHH 2WTRA 2JKJA 1KJ2L 2ZWYA 4TS6A 5EOCJ 1NLBL 4GQPH 3O2VH 4AQ1B 3ZR6A 4JO1H 4OFDA 1TTAA 1C5CH 4JN1L 3RL1B 1D5RA 5EEZA 3KBFA 2D31A 1QA9B 3P69A 3O4OB 5EU6B 1AY1L 5HHOB 4Y16A 3U30C 1ZV2A 3TCLB 3JWNH 1KCSH 3MCLH 3VXQB 1I8KB 1J1OH 2AK4A 5IGXL 1Q38A 4JK0D 3PPEA 1P9MC 4N20A 1CGTA 2OI9C 2A9NL 2ZJSH 1M9WA 1ZLEA 2WCPA 5FA3B 4EIGB 5KS9E 4YSEA 4AENB 1D5BA 1L0XA 3OJMB 4TNFA 3INUL 1DL7H 3B43A 4ZK8A 3TA4D 3NCMA 1MVYA 1P7QB 3HG2A 5DUBA 1GAFH 5EEXA 3TVMB 1UFGA 4PLJC 4QRBA 1WH0A 4MA1C 1MWAA 3GMRB 2NY0D 4NRZB 4IKJA 4OGZA 3ARBB 5FK9A 3FTZA 3SY0B 2CM5A 3TF4A 2NY3D 4QXTA 2CCWA 2DQCH 3H6JA 3X3GH 2ZXEB 1LGVA 1TVHA 1XF3B 2DI9A 3DSFH 4LCCB 2NSQA 1T5XB 1GCYA 1CK0L 1E90A 3U7YL 3GRWH 3Q2LA 1Q1JH 1WTLA 1IEBB 5E1QA 5I1KH 1T3FB 5DT1L 2FNWA 2AVFA 3HFML 3LCYA 5FYLD 1L7TH 1G7QA 4JHVA 2B1AH 2PTTA 1MCWW 4F15C 3FTUA 3NJLA 3HIZA 4O5LH 3HE6A 3RG1C 4HUMB 4Y2DD 5AW9B 1JTTA 3FXIC 4ODSL 4EZLA 2FL5A 2VITA 3UTSA 5BO1L 1OE1A 3KDMB 3BH8A 2K6YA 4RIRB 3WV0A 4MBRA 2AEWA 1JZFA 5K59F 2NY0C 2YOAA 2H3NB 5F7BA 1CICB 1LMIA 3GMQB 3H85A 5EU4A 1X6NA 2NY3C 5HYIA 3WNIA 4R7LA 1MCCA 3RGVD 5E2TL 5K1VA 2J2ZA 5SX4I 5D7LE 5F6HJ 1GGBH 5LO7A 4EUPG 4MJ6B 4QRPB 5ESQB 3S98A 1VADB 2BIPA 2H8PA 3ARDD 1J9TA 1OGSA 3OB8A 5MEND 5HHPB 3V10A 5C09D 3VI4F 1PFCA 4R7VA 4W9FC 4KJPD 2I07A 1IBFA 3KEDA 5I8KH 1JXFA 4WW2F 1E4XH 4Y2DC 3UBXG 1B6UA 2CIKA 3VVWA 1YEGL 1BF8A 4P59L 4ZTEA 1VENA 2B5IB 5CWSA 1I1AA 3IJYA 1YEIH 3VD9A 2OMYA 3U7WL 4QYOB 3LEXB 2IALA 4PJGF 5I0WA 1WIPA 3GJEB 2K0RA 3GSRA 3E1F1 1DBML 5JYLA 2PUQT 1C8QA 1ZTXL 1IARB 4Q97A 3TEYA 4U7SA 1O0VA 3T0AA 1WT5C 2QGEA 2ZCLL 5GGTH 4ZX3A 5B21A 4N2FA 2D3NA 3F12A 3RGVC 4HPYL 4XP4H 2JTYA 2W94A 4OZHA 3RX8A 3OF6D 4B9YA 3PWLB 3KEHA 5I1HH 5IF0A 5CJXC 4QOKD 4JN2B 3EO0B 1PZ2A 1KTLA 3ARDC 2YKLH 5IB3B 4QXVA 1M71B 4NQVA 2AAVA 2XWEA 3IKCA 2UUDK 4KJPC 5H35B 1TJIL 3LIZA 4G8IA 4DGYL 3QEQB 1UWGH 4NZUH 1T5KA 1KXQA 3QPQD 3QRGL 5J1SC 3APFA 4P2QD 1F3JB 2CH8A 5I1AA 5FHBL 3EJSA 4AZ8A 3SGJC 1J1PH 2PYEA 1EHLL 3QUGA 4ZUVB 4L3ED 3EFDH 3SCMA 2X3BA 4UT6L 4B6ZA 3QUHA 4V1DB 1T22B 1ID2A 4Q7DA 4PJCB 2ZUQC 1NGZA 4O58H 3EYQD 3T8XB 5EBLB 3TU6A 3NG5A 1G6RA 2C9PA 3T0EA 4EN2A 9PCYA 3PWVA 1XMWA 3FCBA 2RD0A 3HC0A 2ARJQ 4TUJB 5D1QD 5BMFL 5F93C 1GH7A 4PB0H 5LCVA 3N0PB 5B39A 1CFQA 1S7SB 3IDJA 4X7EC 4GRWE 3WKYA 3BFOA 1A8ZA 3IXTA 1QMUA 1TVBB 2YXVA 3BVDB 3H6AA 3UBXA 2C1PB 4K9EH 4KKCD 4AY0A 4DKFH 4XP9H 5DDHB 2V5MA 3JT2A 4Y19B 3MJ8B 1K4DB 4LO9A 1N59A 3WJJC 3WEOA 2E5EA 5C0DA 2BVQB 4JPVH 4PJFA 1BQHG 2JIXD 5TF1L 1OCWL 5FUCE 3TO2B 4A7UA 3QPQC 3CK0L 1TTBA 3GDBA 1MFDH 3MRLB 1XH3A 4N0YL 4G43B 4XPHH 4JG1H 4MAYA 3TBSB 3U25A 4BA0A 4OR1A 1VFMA 3A5VA 6CGTA 3UJJH 2J73A 2V0AA 4P2OD 2OMUB 3EYQC 5A16B 3WFHA 3WO3B 1ACXA 1F0LA 5FA4A 3UTZA 2X4SB 4XO3A 5K1NA 4YGVA 1I31A 1TZIA 2J21A 5D1QC 4JFHE 3V52L 1C7SA 4X83A 2YFNA 1HIMH 2EIJB 1BBDL 2WZ0A 4ZOBA 1JNHB 2XTLA 2O5YH 4G2AA 3VFUB 1I3UA 1FJ1B 2H47C 4KKCC 2PMZA 1JGLH 3KR3L 2GBUA 3JQOB 3QCUH 3QIUA 5GGSB 2KPNA 2ADIA 1N5AB 3HNTH 5CLTA 4RA3A 4JDTL 5T5FL 1RZKC 4O2FB 3LPGA 4IBSA 1U9KA 2A1WL 3KPNB 5IBTL 5C9JA 4A04A 3IBOA 3GZKA 4FNPA 1EQWA 2G4GA 2EIZB 2XX0A 1MHHB 3PQYA 2PLTA 4M6ML 4JCLA 2FGWL 5DRWA 4NN6B 3C6EA 2Y7OA 4ODTH 4Y5VB 1LXMA 3JBG7 2ZUXA 3N1PC 1NGWB 2BMKA 1G9NH 1X5KA 4P2OC 3S3PA 3AMLA 4TRPH 4M43L 4N2CA 5ESVA 4HCIA 1QUPA 1A66A 2RH0A 4FJ6A 4V11A 2F8XC 3II2A 1FL5B 2Z35B 2XG4B 3PNWA 4HEME 5JHAA 1BW8A 4FEMA 5EIIG 4XN5A 1E0OB 2B4CH 5IR1A 4W9KC 3V6ZB 3MA9L 3I6SA 4K5LA 3ZE0E 2VWEC 5DHDA 5JHDA 2J43A 4EPSA 4OM0H 4NRYA 2G2PA 4RQQA 3NBNA 3ESOA 5L8KB 2JKWA 3JTSB 1RHFA 4RRPA 3WEXB 1YDPA 1QBML 2IFFL 3ISRA 3FQNB 3I9AA 1X5YA 3QK0A 4J39A 1N4XH 5MEOB 1JNNL 3UPAA 4G7VH 1TO5A 5D72H 4Z3FA 2DV6A 1HILB 2WVUA 1D5MA 3CV5A 4HCGA 4LNRB 3UO8B 4OCXH 1NMBL 4P3WA 3OQ3B 5IEHB 2EVJA 1Z9NA 4K7PX 4TUUA 4AE1A 3I50L 3B3IB 1P4UA 35C8L 5D2LB 4HC1H 5L2KA 3RIAK 4P2RA 4QRUB 1MSPA 5D9SA 3K74B 1TETH 5CBEA 2GBTA 1OGTA 3RNQA 4JFXA 1XZ0A 2ICEC 5KJ4A 2GITB 5CSZB 3RA7L 3NIDF 3FAWA 1IM3A 1BZOA 2DAVA 1G4RA 3ABLB 4MZ3A 4FG6D 4UV4H 1T7WA 2JKRM 3NUKA 1QPKA 3CG8A 1I9RL 3JWNE 4GXVH 2WVTA 5J13B 4X8XA 4N68A 2Q9OA 3BCFA 3WCYA 2CJ3A 1E27B 2OSLA 3EOTH 4KNSA 1ZT4B 4U1MA 1NAKL 4N5UA 5C0FB 4BK4A 3LRSB 4X7CC 1HYRC 2DWXA 8CGTA 3RVUD 4KOBA 2M83A 1J12A 2YAOA 3SPHA 3FRPG 3O45B 3O3EA 4U1SA 4AQ8A 4KDTA 2M26A 5EU6E 5I15L 4L8CB 3Q13A 2B1HL 2B9BA 2BOBA 3GRBA 3MBWB 3D51A 5D7LD 3RL2A 5BOPA 4FOMA 2PO6D 5EIIA 4N8VG 2FWLB 3S3DB 3DVNB 5HHNA 2A9MH 3O3DB 1U3YA 3QZMA 4NAMA 1DQML 2NZ1A 4OD1L 1O9WA 3OKLA 2WLZA 3ARFD 3LKSB 3NCJL 1RHHB 4KROD 3SE8L 4S1QH 4HSAC 2H0FA 4J7RA 2AJXH 5H37H 2WYHA 1OPGH 3VXTB 1R24A 4YE4L 4ZUTA 1FNHA 1S5HA 4FG6C 3EYSH 1LO3H 3KS0J 3SD2A 1H6EA 5MP6H 5H2BA 1K6QL 4M93C 2AJYL 3QZOA 3TZVB 4MXQD 4CVWA 1XH2A 3RX9A 1JHKL 4N2OA 5GRJL 5GGUA 2A77H 3UMTA 4KJWD 1QEWA 4J3SA 4ZFGL 3WTTA 3AB0B 4LXFA 1FORL 1S5IL 4YDJA 1T0NB 4AGQA 2APXA 3SKMB 3GUTB 4B5ZA 1KBGL 3RVUC 5KZCB 4QMEA 2Q86A 5DS8A 2R29L 2X6MA 4XCCH 3RWCA 3UL4A 5CZRA 2W8CA 5T1DL 1PG7H 3FHAA 1A5FH 5T5NF 4AC4A 43C9B 4FD0A 2PO6C 5JHLA 2XV0A 1WZKA 3LZNA 4GLRI 1U2HA 2YUVA 3TH2T 1XB8A 3KL3A 2PYFB 1UOVA 4WNSA 4PVNA 3ARFC 4BQCA 4ODBD 5CZVH 2O61B 4FQ1H 4KROC 2NY4D 2LT9A 2EUVA 1HI6B 5BO0D 4ZZKA 1KB3A 3T3PB 2FNBA 4NRXA 1OAXH 4LCYB 2RIKA 3ALXA 1CXFA 4JFOB 5C7XL 3VQMA 3FRPA 2GT9B 3FSAA 3SGKA 2G3MA 3VCLA 4G5ZL 4MXQC 3LS4L 1QR1A 3NOIA 3L4ZA 1LDSA 3V0GA 1TQCC 2HTLD 4L4VB 3TYGH 1SHSA 4Z76B 4N8VA 4KJWC 4LQ1A 3GD1C 4QRPE 3SZ6A 1S9XA 4W4OC 4OZFH 2YAMA 1WZMA 4S1RH 4NO3A 1ZGLA 4YHIA 4AM0B 5GRVK 1F90H 1WS8A 3B2UD 3VGDA 4NDMA 1YPZF 5HPMB 5EU3B 1BZ7A 1BX2A 1MRFL 1PKQA 2VXVL 1L9NA 4I3GA 3ZYIA 4X6DA 2XVKA 1U8HB 3W5MA 1IB5A 3HG3A 3FO1B 4MA8H 3UJIL 3MR9A 4F8LA 4HHAA 4LQFH 5JPMA 2NY4C 1CG9B 2OYPA 1TVDA 3OKMB 4U2YA 1HHHB 3NFPA 5D7EA 3IDIA 4OGXL 2HFGH 5ICZB 5GJSL 1EIBA 2A73B 2EYRA 2FCBA 1KB5A 2HFEA 4JDZB 4IBUA 1ZV9A 4OUUA 1QSZA 2C4FU 2QSCH 1G7JB 4GQ9H 1O7SA 3D09A 4U6YB 1KTJA 1Q9WA 1CGSL 1AR1B 2ZAHA 3EH2A 5KYWA 2NYZA 2HTLC 4CGUB 2VSKB 3CAFA 3K6DA 4LP4A 1D6VH 4NNPL 4UQIM 1S7XB 1BLNA 4UYQA 2O1AA 2Q6WB 2H0PA 3F2LA 4UZGA 4I3RL 4PW4A 3AACA 3B5TA 3B2UC 4JFHD 4WAFA 3V0WL 1EHAA 1NDTA 4DQAA 4GS7B 3MRPA 4H2AA 3VI3B 5E7BA 4YSSA 2H3KA 3UTOA 3MUY1 3ILDA 4PCKA 1AYRA 3QEQE 5I1CH 2EDRA 3CE1A 5TQ0H 1MXGA 4QXUH 5E6UB 2V9QA 4PGCB 4X6EB 3BZ4B 1JV2A 1LL1A 3L3DA 5IW6A 3FFDB 1Y6NR 4FQIH 4WHTA 3G6JA 4V1DE 3FMGH 4PJCE 4L9LC 5FUCC 1MDAA 3BP6B 4QO1A 3O11B 2D8KA 1A6VL 1PLGH 3S37H 5JOPE 3V5HA 4DETA 1JNJA 1NBYB 3AG3B 4LP8A 4OU3A 1DLHB 4Q14A 4PJBB 4GSRA 5IFHH 1X3DA 4ATTA 1NIEA 4X8GA 5KSAA 1F8TH 2K9FB 4BH7B 5C1MB 1UT2A 1F56A 1FYTE 1UEYA 3PP4H 2QDVA 4NWUH 4Y19E 2D73A 5HY9A 5KVEL 4XXCC 1MCFA 1Q9LA 2NY5C 3BN9D 4IK6A 4KTDH 3FPYA 5B38B 4PSPA 3D69A 3RGBA 3STZA 3NJNA 3QC6X 2Z91A 4DZBA 1IKFH 1H3XA 3NGBB 4P23B 4ATWA 1Z32X 2WXLA 2Z4QA 4DNLA 5HGBB 1HTYA 4IRJB 4NLAA 3TS8A 3FT1A 4OD2B 2CMRL 4MX7B 1KJVA 1CD8A 5BPPA 2OMWA 4KZDL 3LRMA 4FYSA 2IAMD 4NO5B 5IY5B 3GIZH 5DMKA 3AG1B 3F04A 3H9SB 3PP3K 3SDAB 1F6LL 4K2UH 1E5CA 1GGTA 2ZCHL 2R23B 2HWZH 2DWEB 1QI5A 3OKEB 2UXFA 4PJIB 4ALAC 2XRAH 2CJSA 2WO4A 4DK5A 1JXKA 4FTVA 2AJUL 1G7PB 4DKEH 1Y6KR 1U8OB 2CKBA 4TNEA 1V7ML 3HE7A 3BXNB 3IDUA 4ZMPA 4IEFA 3C60B 3BN9C 1NBCA 2QKIC 4G7YL 1NCHA 5CD3B 4CL7A 3AVEA 2P45B 1EJFA 2DRUA 5SV4A 3UPRB 1J86A 2CBMA 3D48R 4ONHB 5L9DL 4N85A 3FDWA 2FT7A 3RAJL 1KCVH 2PR4L 1JFQH 2B2XL 4OCSH 1A6UH 2RBLA 4OKVB 1BYOA 2BCKA 1BDYA 3FU3A 4YHPB 3IFPB 1PD1A 4G8GB 3SPGA 4HIXL 3H2PA 1DSFH 1FVCA 5EU6D 2R2HB 3F65A 1D2PA 4C58B 1HXKA 3MUGA 2EKSA 2IAMC 2GAZA 3FZUD 5E4EC 2FEEI 2CO1A 2FD6H 2VXTH 1N64H 1LO4H 3DMMA 4PJXB 1NEZG 3QG6B 1F58H 4G9FB 1NANI 1U33A 4X6FB 2IH3A 1AZVA 4TL4A 3WTSA 4WI0A 3W0WB 1ZVNA 2LOEA 3H0TA 2XIIA 1OIOA 5D7IB 5E9DA 1P7QD 3K80A 1Q9OB 4GMTH 2OMTA 4UQ2A 4YOKA 3ZKMD 2V8MA 5HJ3A 4ONFH 3VRLF 3TVMD 3FC8A 3H7BA 4LSSH 1VGKA 1I7RB 1SJHB 4C4KO 1QBLL 2I5YL 4K55A 5B7FA 3JWNC 2VZ1A 4N2DA 4AYSA 4FKHA 1FFOB 1DUZA 2GABA 4AV0A 4HQQL 3QDHA 1ZPUA 3PL6B 4OCWL 3RWFB 4AIZB 1QSEA 2QVKA 2L4OA 3L3OC 5GRVL 1NAMB 3D08A 5ERWA 4W9LC 2EDOA 2LLGA 1A9EA 1FL3A 3NA4A 3QYCA 5D2LE 3WHXB 2WXPA 1GC1L 1D6EA 1FHNA 2DQIL 3QWNA 2XU9A 4B27A 1PX3A 4JDEB 5CCKH 1IM9B 2ZAGA 4CC4A 9CGTA 3QJZA 4LMQI 1PG7W 3TPUB 1O7VA 5KYYB 5B3SB 4OI9A 1BQRA 3DRQB 1NAMH 4MD4A 2AJSH 1CTOA 3AS2A 1BPVA 3CC5B 3V95A 4MLSA 2NUTB 1MCSA 4QRSB 2BSEA 4RSVA 1I1YA 5F7WC 4AX3A 4R6UA 4XVTH 4PJEF 1G1CA 4X0KA 1F4YL 1HSAA 1F42A 4Y4KB 4P06A 2X4NA 1UWEL 5EFIB 1K8DB 5FV1L 3SDDB 3TVMC 5J7CC 5K9QI 3FNKA 4RMQA 3TT1L 3UMNA 1CICD 3OPZL 4H8HA 3N9GL 3RPBA 4JHAH 2I60L 3T2QA 3PJNA 2XG5A 3K5RA 2CLRB 1MCWM 2BSRA 3PAZA 1JE6A 1NEZA 4LCCC 4QRPD 1KELH 5KSUB 4E9QA 2G75A 1VZHA 1URIA 5DVMA 4I0KA 2KDYA 4M7LH 2LR4A 1F2QA 1W0VA 5GRXG 4P49A 2MWCA 5DJZA 1WJ3A 3DX0A 3EO9H 1U8MB 4JFDA 4EQ3A 1KSRA 1N5YL 3MMEB 2XUWA 3QH3B 3AG2B 1ES0B 3P4OA 1PAZA 1DSYA 2UY7A 3AMKA 3BLBA 3U1SH 2MRYA 2OW7A 1QHOA 4G7QB 1E3FA 3DJTA 4JGUA 5JW4R 5I8EB 1TU2A 4HFUL 5FIEA 3NP4A 3WJMB 2JJSC 4PRIB 2C1OB 3FRUA 4I87A 1IE5A 2QVIA 1Q4NX 2ZSVB 5FECB 3MRJA 4PGBB 3MLXL 4KZ0A 4NZDA 2HWZL 2P24B 2WGNB 4E9RA 2FJGA 1PMYA 5DWUH 2N1TE 4WU7B 1NUNB 3ZJAA 4R5XA 2BVOB 3JUYA 4MSWA 1GA2A 4NZRH 1YN6A 4NKIL 2YAFA 3TN0A 3AY2A 3L4WA 5D7JB 2JCCB 4PGEA 1IAIL 4FNLL 4TPRL 1KN4H 1YUHA 4MZIA 1CFNA 1FNGB 2WZ5A 1QUNA 2CR6A 4JX0A 5AUMB 3T3PE 1A3RH 4NKDB 5EZOH 4M48H 3VFGL 3LSOA 4KVNH 4GY4A 3QEQD 4NO2B 1WPCA 4N9GA 3X11A 4XN1A 4F9LC 2B5IC 2PNDA 3T6WA 4Z8FH 3B7YA 1NINA 3DX2A 4ELDA 3P2TA 1G7LB 5CGMA 3M45A 3ZTNL 4JVPA 4V1DD 3OZ9L 1Y0LA 3U48A 5CKAA 1I7ZB 5AVXB 3SJVE 1JHTB 5JOPD 3EUUA 3WGVB 1MCJA 4MCNA 3P4NB 4X6CF 4OM1L 2VR3A 2XBZA 1SJMA 3H9HA 3LNHA 1AZRA 4U1LB 1JWSB 4EN3D 4ZDHB 4PJ7E 1BREA 1FYTD 1OTUD 1NFIA 2OCJA 1MFAL 1HH9B 4GMTL 4I7ZC 1NCWH 4HS3B 4YWGH 1ZKAA 4HS8H 4Y19D 1EAJA 1ASPA 5DC9B 4C56A 4RAVB 4Z77B 5MEPA 4JG0H 4FQJH 2F8IA 2QR0B 3C6LA 3K8MA 5EZPA 3OAUH 5AVZB 3AG4B 5E8DL 5JORA 3PNRB 4XRCA 1OM3L 1PYWA 3NIGF 2QSTA 5TDOB 3GXNA 2MSPA 4NQSB 1KEML 4OVVA 3PGFH 3N44B 4XNDA 4F92B 3QJUB 1RZIA 5HI5D 5T1LA 5EWIH 4NKMB 2C9SA 1OGPA 3P0YL 4K9EC 5I0VA 3K46A 3PJSA 4MAUL 5BCAA 1EJOL 3EXLA 3AZUA 4R4FH 4EN3C 1SDDA 1LD9A 2MFNA 3VI3E 3LKOA 2W80C 4K7FA 5C0JA 3O2DL 1OTUC 1M1XA 4S0TD 1FN4B 2D2CC 5F88A 1AKJB 1FZMB 1I4FB 1QATA 1WBYB 3I6KB 1GOFA 3U83A 3JTTA 2AJVH 3LV3B 3O6ML 3VM5A 1XGYH 5TFSL 2FUQA 5B8CB 1IC5L 2B77A 1AD9B 2G2RB 3MA7A 3MN8A 4HCRA 5FCSH 4F9PC 4GW5A 3TNNB 3SHSA 3B2PA 3RZCB 4LP5A 2WXOA 2WZAA 1E3ZA 3T4YA 4OI8A 2HRLA 4HPOH 1E5BA 4HJSA 4IYKA 4HIPA 5B7EA 4PJBE 2AXHA 5HI5C 2A4CA 1X9RA 4Y1AB 3MGTB 4W6XB 1RJYB 2AEOA 2DWDB 2HG5A 2PCFA 2VW6A 3WIHL 3PGCA 2W07A 1LDPH 2VERA 2D4DA 3FSZA 3GUFA 4LL1A 4TUOA 3IJHA 1UZGA 3RNKA 4A2LA 1HE7A 4PTTB 2L7JA 2DD8H 1H8LA 1TTCA 2XA8H 4UQDA 2EDWA 4XOAA 2ZKMX 1NPUA 4DW2L 4X2UA 3CXHJ 2F6AA 4N6RA 4BFFA 1RVFL 2FQFA 2J20A 5TJWK 5DLML 1CFBA 1IAMA 2A83A 1XF5A 4LSVL 2Z8SA 4E9WA 1G9NC 5ALCL 4EJ1C 4I77H 1JK8A 1WC7A 2JQAA 2NY7H 2E6PA 3A21A 5D7SL 5F71A 3HCVA 4EI6A 3FQTB 2O5NA 3UTTA 4K3JH 3AJ7A 4U1KB 4XMTA 1HK6A 4AW7A 5DI8A 2B4CC 3C08L 4NN6C 4NOFA 2L7UA 1DVUA 2KMWA 3H9SE 4CMMB 2OZNA 4Y5VC 2XC8A 5KBLA 5IREA 5CMAA 5EBWA 2GIXA 2KT6A 1N9PA 2EZ0D 5C0IA 2VLJB 4PJIE 5FOJA 4K5MA 2XJKA 1TJGL 3HN3A 4R96B 5IUCA 1OB1B 3GXPA 3HS9A 4O02B 1P5UB 1SN5A 2JVUA 5L4FA 4XPGL 3NJMA 2IBZY 3K8LA 1NKRA 1C5BL 1Z5LB 1D7FA 1UH3A 5E4AA 4Q89A 3SBWC 3LZRA 3GWJA 4Z8FL 2FJHB 4Z7AA 5LXGH 3S88L 4KGLA 1D5IL 3VFOA 2NXZB 2E9WA 4BFKA 4UQ3A 2QQLL 5IFAL 2YPLB 1JJUA 2OMXB 4XB3A 1CGYA 1Y1DA 2PWGA 4FNSA 1ZHLA 2IOIA 2EXYD 1AI1L 4BZ1A 4M1CD 2NUPB 5EUKA 4G8GE 1EZLA 1EZVY 3CFKA 3U2IA 4BFEA 2NRDA 2WNWA 3KWUA 4BZ2A 2XY2A 4Y2LA 3B6SA 4M6OH 2CRIA 4JY4A 4NQTA 1DE4B 3JYBA 5IQ7L 3AT0A 4N1CA 2ZTBA 4JFPA 3VWKB 3ULUL 5AEAA 5E0QA 3NSDA 4R8WH 3FB6B 4ZT1A 4OD3L 4PJXE 4FG0A 5LBSA 5E5MB 5IB4B 2EZ0C 5JXED 4G9FE 2F68X 1RAMA 2DYPB 3W0WE 2H32A 2SODB 3CLFH 4ANUA 3CX5J 4GINA 5ICYB 5D7IE 5IVXF 4IKIA 5KOVC 1QFUL 1HNGA 3BUQA 3REVB 4OJAA 3SBQA 2ILLA 3P9LB 3TZVD 1BXXA 3CN0A 3M8OH 2VZSA 2F0CA 2J55A 3N1FC 4FFYA 1THCA 2LW3A 5ACZB 4X9FA 4OAWB 3KJ4C 5FGBC 1S9VB 2HUEA 1FVDB 1SFDA 2EXYC 4M1CC 5KZCD 1K5NA 2ARJA 2G3ZA 3RWJA 1A6ZA 1MLBB 3KHOA 3KYOA 1FWXA 4KMTL 3FF7A 5DHEA 4HYTB 4B9PA 5JOFB 3LD8B 5AVQB 5DMJB 3GMNA 2QTEA 5EA0L 4BGLA 4N86A 4M5ZL 1QW8A 1MW1A 3VXUA 4HUVA 2VDML 5INDA 5JXEC 1AO7A 4YDMA 5DWPA 5IVNA 3IPFA 3SGDI 4OF7A 3GBDA 2BS8A 1ZA6A 2ICWB 5GXBB 3G6AA 2WAHA 3SQBA 3ZSTA 1EDYA 5EORH 2E0PA 2K7QA 1R3IH 1B3IA 1LE9B 1KLFA 1ED3A 1J9SA 3AADB 5FGRA 5TDPA 1HL8A 4YDNA 4XPAH 1DLFL 1MJJB 1V7NH 4XPFL 3TZVC 3C8KA 2VYRE 1EAPA 1MJ7L 2C9AA 1U4EA 1TCRA 3CVCA 2E9IA 2JELL 4LOUD 2O6CA 3AITA 3AB0C 4NP4H 1LEKA 4WUKH 3O41B 3HA0A 2X44D 1JV5A 3SJVD 3HRZA 4NUGH 5I76A 1WA1X 1N0LA 2P8MB 1XSOA 4N8CH 4TLTA 4E5XB 4YFEA 2EUZA 1O6TA 4FP8L 2YAEA 4U6XB 3MYJA 3IETA 4DP9X 4I48A 1G0YR 2DQJH 3G5XB 1EHKB 3DBSA 1GTNA 3NABH 5KTEL 4L8DA 3UROR 1MZZA 3CH1B 5IBUG 3QDGB 2X2YA 3GBNH 3HS0B 4NM8L 3RI5F 4KO9A 1EEYA 3GJFB 4JCMA 3FFCB 4LSQH 4TSAL 4APQB 2GUYA 2H6UA 1QSFA 4KQ4H 1R33A 2WANA 4NYLB 2ITDB 4PRIE 3AXLB 1AXSB 3BZFA 5DHYB 2W81C 2DIBA 1WYJA 2SEBB 1AR1D 4BRVA 3CFCL 3D4GA 2ODIA 3PDDA 2NCEA 3GJFH 2ENYA 3NJHA 5K9QG 4LOUC 1C8PA 3M1BA 1T21A 4UIMB 2EE6A 4WFHE 4O9HH 5DQJA 4V33A 2VXQA 2JCCE 1E40A 5DO8A 4IGBA 2AXFA 3IMTA 4HWNA 5FYJH 4OT1L 3KLAA 3U4BL 2P49B 4OZGB 2Y5TB 1GS8A 4MQTB 5DTFA 1UKSA 5EOTB 3QIBA 4JEGB 4KC3B 4O02L 2XN2A 1T83A 3OAYK 3WTUA 1ADQH 2Q7AA 4NNYA 2E6JA 2XNAB 3LB6D 2XIBA 5DD6B 1DJIA 2LU3A 5I1IL 1XCXA 4JFVA 1NCOA 4F27A 2FO1A 5J11B 1ORQA 3PDOA 2Y5QA 3SN6N 4QTIL 4M6OL 3P77B 4BH8A 1FLRL 5ALBH 3K6NA 4MJJA 1BVZA 2X9WA 4BK5A 1LO0H 3PGDA 4ZD3L 4G3YH 4K5NA 3BFQG 5IBLD 1GC1C 4I18A 3RKDD 2X4UA 3R1GH 5A2CA 12E8H 4FX5A 5JNYA 3E1ZA 3QR2A 2BY1A 2FO8A 1X7QB 4AVJA 4N0UA 2V37A 4M61A 4XPTH 4ZTPH 3OJDA 1LNUA 3BAJA 4HW6A 2V4LA 3DETD 2C9QA 2I9LB 1BD2A 3MYZA 4OLWH 1H6FA 5K39B 3BX7C 5E8PA 5IT2H 1SZNA 2ATKA 1HOCA 3HRPA 4GS7C 3SGEI 2V2XB 2G3NA 3DTXB 3QAZB 4OQTA 2XWTA 4KI5F 4ELMB 1HH6B 3TV3H 1NCJA 2B39A 3LB6C 4HXBL 4P23D 2BNRB 4XC1H 3V5KB 4L29B 1C16A 5H94B 2CRYA 5ANMB 4IRJD 5FM4A 2OXHB 5C0GA 1A4AA 4LB8A 1U8QA 1UENA 5DF0A 3QISA 3KLDA 1KWKA 3VW3H 2WP3T 1R1CA 2G5BA 4WFFE 2PW2A 5IBLC 3RKDC 3ZO0A 1E4JA 3H9SD 3SDAD 4JRXA 1LEGB 1SYVA 1XAUA 3L4CA 2R56H 1GVIA 1OCCB 2MHAA 3SDXA 3VFVB 3FH8A 3GMMB 2NZ9D 5JIIA 4OCRL 2WZPA 4BELD 2H1XA 3DETC 1OARL 2B3RA 4ODUA 3B2MA 3HMWL 4D94A 1ROCA 4ZXBA 1JZDC 4ZO6A 4B97A 3EFFA 2ZX9A 4MD5B 1HKLH 4XP5L 2WQAA 3DX7A 3KGSA 4MCZA 5D4QA 5I1JH 3GGWB 3OKNB 3MLYH 5AVSB 4AYFA 1NGPH 3C60D 3HG4A 1XMEB 3I75B 3VXNA 4GG6A 2F7RA 3MRHA 1B0WA 2GIMA 2PPEA 3ATFA 3FU7B 2KZKA 1T7YA 1T5WA 4P23C 5AL0A 3KYMA 1F4XL 4I0PB 5EO0B 3DURA 1KJ3L 1QAWA 1LLAA 1CDJA 4IRJC 4NKOB 3RWDA 4YFDB 15C8L 4G8GD 4UT9H 4DTGH 5CP3A 3HW7A 2FX7H 3QRFM 3UJTL 3V4PH 1HYSD 4UQAA 2X4RA 3RWEA 1RI8A 1MRDH 3X13A 2WGXA 2Y0SA 5E9AA 5BRZB 2CALA 4W1TA 1WAAA 3AS1A 1UB5A 2Y72A 3QI9B 4NCDA 4M1GH 2FWUA 3EOBA 3SDAC 3T09A 4PV8A 4G9FD 1N0XL 2AXGB 1RJZB 3FO9B 2NZ9C 3GI8H 3W0WD 1T1YB 2WY3B 3CDFA 4K94L 3MACH 1PZAA 4EI0A 4ZMTA 3CDGA 2HAZA 3IS1X 1JDCA 4Y8DC 3VGBA 4LLMA 3L2MA 1KGYE 2YIHA 5CJQH 1HQ4A 1RU9L 3MLWL 1Q0XH 4KMLB 3L1FA 2FUTA 1YMHB 2JKLA 3C60C 1RP8A 1NGXA 4Z6AT 2Z92A 3V0EA 2BC4A 1GZHA 3UOAB 2ZXDA 1M53A 2NXYB 2D2OA 3PL6D 2X89A 2CBOA 3C6SB 4LHUA 5EBMA 4QXGH 3L48A 1U91A 3NH7L 3G5YA 3PV6B 4RISL 3RWGA 3CLEL 2V7HB 4L2YA 3ATBA 4AH2B 1CF8H 3GSXA 1QYGH 2V9RA 3MRCA 3PWJB 4P9MH 4JFUA 5MERA 1FNLA 2LTQC 2VLJE 5GIRA 1IM9D 1QFHA 1HYSC 1JGVL 5ES4B 4GKZB 1LWHA 3CSGA 4R90L 4WIQA 1H15B 5JW4N 4E41A 4U6VH 3TYFB 5IG7B 4GAYB 2FYVA 1OP4A 4CMHC 1MNUH 1YEKL 4B3VA 4P9HH 4NAQA 3MCKB 1PZSA 2ICES 3QUXA 2EEXA 3ILPA 3B8SA 4JPQA 3G04A 2Q8AH 2YPLE 4U31A 1AGCB 3GMPA 4F1ZA 5AG8A 1OGAB 4U2ZA 2E76C 2GHZA 5CP7B 4YHZH 4YHLH 4Y4KD 4YUEL 2IO5A 3KAAA 3SDDD 2D3JA 4PR5A 3CHOA 1T0PB 3VXPA 5DSCB 4GSXA 4JPSA 4ZMNA 2ESVA 3PL6C 4UMSA 2FIKB 1P9MA 3SO5A 1D5ZA 4P3CH 5AW7B 2L7EA 3OWRA 2N7SA 1DDHA 1LO2H 3CMOH 1KBVA 3DRTA 4NQQA 2J1YA 3P73B 2UZIH 1EUTA 2CSPA 1IL1B 4GW4A 4ADIA 4OFQA 2E7BA 2XPGB 1WK0A 1UACL 1EO8L 3L9BA 1IGIL 1ZIBA 4R0LB 3VO0A 4JFEE 5L6YH 1RJLB 2DQFB 4M7ZC 3P3UA 1HWGB 4MA7L 1P7HL 2CBTA 3U9UB 3O6KL 3SB3A 3C75A 3C5JB 5BV7H 5DZ9A 5AL8A 4KTEL 2AABL 4FI7A 3VYOA 3BW9A 4Y4KC 4WV1B 4PRID 3SDDC 4F80A 1XGRB 1CT8A 3VNZA 3NCXA 5IM7A 3ZDYF 4LT7A 3HG1E 4HU2A 3P9MB 3L54A 3FQXA 2YD3A 4GT0A 5HSFA 5CCJA 3QGVA 4WFHD 2VLLA 3IK2A 5EU5B 1A3LL 5D7JD 3DROB 4NWTH 1IKOP 1SVBA 4G82A 3B9DA 1YLBB 4FABL 5LGHH 1DCLA 1QX1A 3QR0A 4LLYA 4U4IA 4XP1L 2YMXH 1XWVA 3IJSB 4ACTA 3ZYZA 2ZX6A 1U36A 1SEQL 3CX2A 5L8JB 4QRRB 2CGRH 1CXKA 3BKYL 3PABB 3JWOH 3PV7A 2Z7ZA 4M5YL 1A1OB 1ETZA 3ARZA 4QRAA 1DQDL 2DQTH 5DD1H 4HEPG 3K0YA 5EZIL 1XGPB 1LK3H 4AZUA 2WVVB 1R3LA 1IBZA 1GGIL 2R4RH 4YLQT 4TQEH 5DS2A 5FGCE 4JB9H 3BH4A 3VI4B 4UT7H 4AW4A 2FLRT 1L7IL 1IT9H 1KG0A 3GB7A 4JO2H 1JGEA 3FPXA 1A6WL 4MMXB 4PPTA 4WW2B 2XKNB 3T08A 2YEZA 1L6PA 5M94B 3QJSB 3QSKB 1MDTA 2FSDA 2ZUVA 4ZO9A 1KTDB 4TL5A 5D7JC 5I1LA 1ZLWH 1KCBA 4APXB 5I2IB 1SMAA 4Y2DA 1C08A 2CA4A 4FFZL 3H3BC 4PJGB 3QDGE 4U1IA 5JXAH 3CU1A 1FFNA 1MF2L 4QHLB 4JW3A 3FFCE 3FULA 4NPJA 4UV7L 3VXMB 3O3UN 2NTSP 2VO8A 1PZBA 3IGUA 1MCEA 2CDGB 3D25A 4GG8A 3LPFA 1DANT 4H44C 4L3FA 4WY7H 2ADYA 1N7MH 1PGRB 7CGTA 4GQRA 1DVFD 4H25A 1MG2C 1WT5A 5LBVA 3L3HA 3BKML 2FAUA 4PRHA 4EUPH 4EZKA 4UTCA 3RGVA 1FZOB 2YQGA 2XZCH 3IMRA 1RZJH 4JQIA 5AVWB 4GAJL 3HBPA 3T6ZA 5SWZB 2CK0H 4OLZL 4UB0H 3UAAA 5CJXA 1DVTA 3ARDA 4J28A 3HC3L 4WFFD 3RGHA 1WE5A 1PS3A 2W9DL 4GAGL 5MENA 3ARTA 3V0FA 1R3JB 4N2AA 5C09A 5BS0E 4P99A 3SPVA 4ZFZB 1EGJA 1RUMH 1HINH 5EUOA 4HA1A 2X4OA 5HGAA 5DQ9B 3WY2A 2VXUH 3DC0A 1OSZB 3OKOA 3MQIA 1AKJD 3F7PC 3GS0A 3E8VA 4YNYB 3BD5A 3IMVA 5IJDC 3GPSA 4PMEA 3SGJA 3CXDL 1A4KA 3ECVA 1HHJB 5I6LA 1NGYB 2LGNA 1MLCB 1PSKL 5GGQH 1DVFC 5KYXA 2XZZA 4KRNA 5GRZA 3RIFK 4AYMC 1HHIB 4OJFH 2YK1H 3LXAA 3M7OA 5E08H 1X9QA 4DP6X 4DEWA 3RZCD 3HI5L 3BWAA 1FRGH 1U58A 4XNXL 2NCMA 3BQUB 4I9WE 3U2SB 4O2CA 1MH5A 5CM1A 3IKKA 3OF6A 3G6DH 1IC0A 4J12A 2V3FA 4RDBA 1CC3A 1FAIL 3B56A 1TZAA 3FUEA 3KW8A 3I9GH 1EXHA 3W57A 2VE6A 5D71H 1KIPA 3ZL1A 1T1ZB 3WJJA 1KPVB 1TJMA 4PY8I 1IAIM 3FQRA 5F7FA 1P84K 3UADA 3QEHB 4UILL 2GJZB 4LOEA 1EAOA 2V9UA 2ATPB 2BIIA 2IWKA 3OBAA 3QXVA 4ELME 3K71B 1WWWX 3ALPA 3K4ZA 3L1GA 3ZKQD 4E9LA 4P2QA 5LXVA 1M7IA 3FFOA 5E94B 1YG9A 2BNRE 3F7YB 3SPIA 3ZPDA 2D03H 4M6NH 2Y06H 1MHEB 4L3EA 5ANME 4D3CH 4CGTA 1OP3K 5T1MB 1IFHH 5EB9A 1RZGA 2NLJB 2NNCA 2MOGA 5AW0B 5HYSG 3ECWA 2ZX8A 2AQ3A 4CNIB 1MVUB 5D1QA 2GVYA 4TNWF 1SJXA 4EI5B 4EE2A 1REIA 1TPXB 2XFXB 4F7EB 4GXFA 3TV8A 1ND0B 2OX5A 3NPZB 2QFPA 3PJLA 1S7UA 3KL0A 2R0ZL 2JKIS 3FUKA 2VLJD 2AXJA 4RFOH 3I6GB 2EH7L 4XX1E 1H0DB 3FUHA 3WE1A 1MNNA 3GEWB 3HI6H 5T3XH 5KVMC 3FO0H 1Q9KB 3L08A 1BZ9B 3F6IA 3ULAB 2BSTA 1BJ1H 1AGEB 5ITBH 2JIXA 3BVTA 2BY0A 3WNKA 1UB6B 2NXZD 1TQWA 3P54A 4X9HA 3HTLX 2MCMA 2JMRA 3BD4A 2YPLD 4DESA 3LQZB 2J4WH 1UD8A 2Y5EA 5F97E 3MRRA 3TEZA 5EOCH 3QWOA 2DQDH 3IPBA 4ZUSB 5HHXL 3O6FB 4P2OA 3MPCA 3ULVL 4HIJA 2P5WB 4P4RA 4O2EB 3QXDB 4QHKI 3Q5OA 4J3OG 4AM0Q 4WK4B 1HNFA 2DWYA 3OG6B 3WUWG 1QLEH 3TBCA 1N8ZA 5BRZE 2YJLA 2NNRA 1T66D 3N91A 4XP6H 3LZPA 4U6HA 1WWCA 5DJYB 1XHHA 2F53B 4UDUA 2DYPD 2CO7B 1MFNA 4DP5X 1P5UC 4PJDA 4X5XA 4IOIB 1D9KB 3UZQB 1TKWB 4FXGB 4NFDA 4TSCH 4JFED 2MQGA 4AL8H 5I6XB 4E9SA 2OL3L 3IGAA 5DJAB 2NXZC 3CZFA 3KHQA 3KPLB 3WXVL 4YHNA 1GSKA 4TVSa 1E9QB 3C5SB 4J3OF 1JZJA 4L23A 2VDRH 3BUTA 2CJUH 4AYGA 4E42B 4L18A 4ZPVA 1CFTA 2HLAA 1SGKA 4YAQB 4AGOA 2FWOA 3RP1A 4Z7NE 4ACPA 2EACA 3WU1A 1CE1H 4UZSA 3L2LA 3HG1D 4FQHB 1IGYA 1CD1B 3FCGA 3MHZA 4DO4A 1AYOA 1SM3L 4PBWD 5E8EA 1S2EA 2DW5A 4I8DA 1SY6L 4IRZA 1T66C 4L8BB 4DQOL 5KS9A 1BFSA 1E2WA 3MV9B 1NBZB 2HVJA 3V6OE 1GJIA 1W0WA 4NN7B 4QLWA 5ICXB 4FCHA 2HJLA