5B1CA

Crystal structure of den4 ed3 mutant with l387i
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
101
Chain Sequence
SGMSYTMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKVVGRIISSTPLAENTNSVTNIELEPPFGDSYIVIGVGNSALTIHWFRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope protein E
publication title Modeling and experimental assessment of a buried Leu-Ile mutation in dengue envelope domain III
pubmed doi rcsb
source organism Dengue virus 4 dominica/814669/1981
molecule tags Immune system
total genus 14
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5b1cA00
5H37A 1Z3RA 3J2PA 1RERA 5KVDE 4GT0A 2R29A 5IREA 4BZ2A 1SVBA 4L5FE 5IZ7A 3G7TA 4FG0A 5LBSA 1OK8A 1OANA 3UYPB 4UTCA 2R69A 1ZTXE 5KVGE 3UZVA 2JV6A 4UT6A 3N43F 1URZA 2I69A 1PJWA 1TG8A 5JHMA 3MUUA 5JHLA 3IRCA 2ALAA 4FFZA 5LCVA 2GG1A 5GZNA 3C6EA 4BZ1A 4GSXA 2JQMA 3N40F 3N44F 3C5XA 2P5PA 5KVEE 3P54A 4UTBA 3UAJA 5AAMC 2JSFA 4UT9A 5KVFE 3UZQB 3WE1A 1S6NA 5AAWC 1OKEA 4AL8C 1UZGA 2HG0A 4AM0Q 1Z66A 2H0PA 4X42A 5LBVA 5GZOA 4ALAC 3VTTA 4FFYA 2V33A 3N42F 3N41F 4UTAA 3UZEC 3J27A 5B1CA
chains in the Genus database with same CATH superfamily
4NKOB 3O4LE 3TP4A 5IK3A 3CN3A 1S3RA 2XG4A 1I1CA 2H1PH 4PJ9C 3BRFA 2ESVA 4HK3N 3ULVF 3ZT6A 4AVHA 2NSMA 3K4AA 2IALB 1KSRA 3OKNA 3SKOB 3VFVA 1RZKC 1DDTA 4PLJD 1R9FA 2CCWA 3BUDA 1OAXH 1AXSB 43C9B 3LZPA 2Q6WA 1NCCL 3V7MA 1TYJA 4CKVX 1HZHH 4B5ZA 1F2XK 3R7QA 1WZMA 5B4MC 4HPYL 4IRSC 1ZHKA 4WEEA 4XE5B 4YOKA 5PCYA 2KKQA 1B6DA 1GYVA 3Q3GB 1FFOB 2AANA 5H4ZA 4ZUUB 1L9TA 2P8MB 4PP1C 4F33A 1VAHA 2VR6A 3ET9F 4Y5XB 5LBSA 2JKLA 1MCWW 3DX9B 1UM5H 3UPAA 3SGEI 4Y1AD 5E9NA 4S10A 3K8MA 3MLWL 3ZTCC 1KPRB 5F0PB 4LSSH 2B1OA 4GKSB 1CDUA 4MAYB 5DA0B 1QLEL 3S5LB 1CMOA 4AJ0A 1KYUA 3WG7B 3AWGA 2IFGA 3C60A 4R5VA 4JREB 1JPGA 4TTDD 4AWJC 3HS0A 3O45B 2QGEA 2WY3B 2YXVA 5GSVB 3E2HC 5AL8A 5EEZA 1ZWIB 4PIBA 3L6FA 4G6JH 2CO3A 2Y7QA 3CDZA 1J7VR 1FCGA 2I60L 3ARZA 3GRWH 4PJ5D 4LLUA 5AVXB 3ULUD 4OZIF 1TQCC 2XX1A 3S5LG 4HUKB 2Y6TE 3P0GB 3HI5L 1MEXH 3O81A 1Y7VA 1ED3B 3DA0A 4H44C 1U95B 4PJAE 3BYTA 4OQTL 4MD4B 1LO2H 2KS0A 1FFRA 2ZYIA 4GBXA 5D1XC 3MHZA 4PJ8C 5CCKL 3IFNL 3EHBC 4PJIF 4OLWL 5FC9A 2R56L 3U7AA 2FYYB 3O0LA 3QCUH 4FGMA 2W07A 2UZIL 3K5SA 1CFNA 3ARDA 3NK4A 4YHML 1T66C 4I77H 5HY9A 2VUYA 4ZSOE 5ABZA 4R97B 5CJQL 1QO3A 3OKEA 3K8LA 1AXTL 5GS0C 1QLFB 1SXNA 2C4FU 3MRCA 4IOFC 5EORL 4XCNA 2HUHA 4NBXB 2GC4C 1ZT7A 3OR6B 4OZGB 4Z76B 4X4YA 3Q5OA 4LPVA 4AVJA 4UILH 3TO4A 3NEOA 5FYJE 4DPRA 5HGDB 2R2CA 1JZHA 3HZVA 1A4KA 4LRIA 3IJSA 5AW7B 3T0XA 4D9LL 3MLPA 3T0EB 2F7RA 2R29L 4KX7A 4A6YL 1LO5B 5GISH 2BIHA 3AROA 4L05A 1AHKA 2G4GA 4FFYA 1SJVA 3AITA 3TWCL 3TN0B 2J88H 5DMGC 2IDFA 4PP2A 2Y23A 3S37X 1BD2D 2FLMA 2QHLA 2K9FB 3NOIA 4ZUVB 1EAJA 1KYOK 3ISYA 5CEXB 2HTKD 2KLSA 4ODVH 1DQDL 3S37L 1M56B 4MJIB 2DLHA 1F13A 4X6EB 5J8OA 1NGXB 3NA9H 4BFRA 4PREA 3GMRA 4N8CH 5AVVB 1A6UH 2WVTA 1WG3A 2QQQA 1NEZG 4IKNA 3VXPB 3D39E 3J07A 5ECJE 4W9LC 3PHQA 4N0UE 2E6QA 3H53A 1II4E 4AW7A 2SEBB 3HKZA 2ZICA 3QJHA 4FG0A 1TPXC 4TRPH 5FYJL 2H1XA 3BESR 2PETA 1JZJA 2WXJA 5CP3A 1GMEA 2R69A 5C09D 4EN2A 4X6DB 1JV5B 1HSBB 4WFFE 2Y24A 1L3NA 4QTHA 4YEEA 1ZMYA 4XC3H 1HEJC 3PG2A 4Z7UE 4HS3B 5A16A 1QBAA 4OZ4B 2ENJA 3MJ9A 1CU4L 1RPKA 2GHZA 3KGSA 3O9WC 3EFFA 3MUUA 2ED8A 1OSZB 3HNTH 3QORC 3SDCB 4AE1A 5FLUA 3PUCA 4UDTB 3STZB 2PXYA 4PRNA 1MCRA 5AOKA 3RNQA 5HYJD 2O93L 1V3MA 2DI7A 4DGUA 2MCPL 4G8GA 2AAVA 4BQ6A 3O6FC 2JKWA 3QZPA 2DMBA 4FEMA 1F3JB 4AGQA 3NQIA 1U41A 4MD5B 3SYCA 4QYOA 1Z3GL 4TKWA 1ZIBA 3OQ3B 2IDUA 5B1AB 4NQQA 4KKCD 2BIOA 3TBWB 3I85A 1YEFH 1ZT4B 3K3QA 5ACZA 2A9NL 4B5EA 2J8UF 3V6OE 1J9SA 5I15H 4NO3B 3VD0A 4Q9QL 1W9XA 4XE0A 4KI5C 4K2UH 2PO6B 4R3SA 2Q86A 3SDAA 4LSTL 3WS3A 5AAMC 2W9EL 4GAJH 2ZYRA 3KPRA 2I7OA 2QTVA 4JRFA 4QPEA 4TQIA 2Q7AA 2C5DC 1LQSR 5AWNL 3UEZA 2FX7L 2XN0A 2OJZH 2PCXA 3GK8L 1PKOA 4X6FB 1WFIA 3G5WA 1H3VA 3TIDB 3Q2CA 3L95B 3W9DA 5JPNC 4IIQA 4KDWA 1FVCA 2WUCL 3BQUA 3NSXA 5GXBB 3NCBB 1UASA 1KCSL 3CSBA 2VDNL 2IBBA 4AEHH 2KH2B 1GGBH 3PPEA 2W9DH 3BPNB 4PRIE 3VI3B 4H1LB 3U4EB 1MFMA 3AABA 4M93B 4X9HA 4ZFZA 2Y22A 4DZBA 5K1VA 3QJOA 2DEYX 4AX3A 5HJ3B 3UYPA 3HPJA 4Y1AB 5AZ2L 3TA3D 1KJ2B 3TIEA 1AD0B 1QHQA 1HHKA 4Q89A 3I50L 5EZLB 2IDCA 4H1LG 2HVKA 3MRFB 3W11D 4N0YH 1BF5A 4FLOA 4X99B 4N87A 2KZBA 2QTEA 1FSKB 4KX9A 3I02A 2J4WH 2PYEE 3PHSA 5ACMA 2N56A 4NKQB 1A0QL 1UD6A 4PJ5B 5F7EL 3FFDA 5JHAA 4JCLA 4HISA 3FO1B 3QDME 3DGCR 4X5WA 3NIDF 1T1YB 3IGUA 4E9QA 5I6XB 1MCSA 4YVNA 2NDGA 4UBDC 2YEZB 4X8CA 3MOBH 1EX0A 1RIVH 2DKUA 4QIRA 3V5KB 4CSZA 1OAKL 3CUPB 2BY1A 3ZE1B 3SPHA 3OKYA 4F57H 2OQJA 2HG5A 3BP6B 5LCVA 2ICEC 4HSAC 3G9VA 4CMHC 4NNYB 4U3HA 1BG9A 1LHZA 1DQIA 2JJVA 2EUVA 1OAUH 3ARYA 3FB7A 1WSST 3OJ2C 3RDTC 1HT6A 4AENA 4EBQL 4NHUA 4NWUL 5C3IA 2OR7A 3QHFH 5IW6B 3MBXL 1KJVA 3EYQD 3FQYA 3HCVA 4V2CB 5TE7H 5F7LB 4D0DB 3BP4B 3VD9A 1JWSB 4AEEA 3K74B 1WDAA 2DQIH 3WTTA 5DHEA 4JM0A 3MLYL 5B7EA 2KBGA 1FYTD 1E9PB 5SWSA 1B4TA 2ZNXA 3BWSA 4Z7NF 5MP6L 4UU9A 1BD2B 2WGNB 1OCWH 1Y0LA 3QUXD 4BKLA 5EEWA 4IK6A 4JFTA 2ZKYA 3DO3A 3C2AL 2FX9L 4KROD 1J0KA 1PKQE 5FDWA 3TOPA 3M17A 3LKNA 3PABA 4FFWD 1EK3A 3ESOA 3U0WL 5GS1B 1RULH 2QHRL 5D2NE 2OA9A 3UTSD 4XPHH 4IJTA 5DLLA 3QEHB 5JR1L 3RKDC 1KCRH 3NACH 1GZPA 3KBFA 1R34A 5I8KL 5IG7A 2XRAL 1T3FB 3ZZ1A 3LH9A 1V3JA 2ITDA 3FB6A 4OUUB 3MV9D 3IJYB 4KMTL 2WWKT 3SPCA 4B9IA 4JZNA 5L4MA 3FXIC 3UZEC 1ZGLP 1G6RH 1NIEA 2X1QA 4TQEH 5E7FA 5ICYA 4MLSA 5C09B 3APMA 2WTPA 4M7KL 5DS8A 2ARWA 1E5CA 3VNYA 5C0AD 2WZ0A 2AEQL 4W70A 3QNZA 1G7MA 3QUMH 5E00B 2WLZA 4LIQH 2PCPA 1BGXH 1LTXA 3GBDA 5DJYA 5EHFA 1UT2A 4GMSL 1N68A 2UWEB 2R15A 5C0EB 1OARL 2YLHA 1JDCA 5HYJB 4JHUA 4MJHA 1JK9B 4RDQF 3O3EB 1JNJA 4ETYA 1A1MB 2A4EA 4JGMA 5DUMH 5KBKA 4TNVK 5K5YA 1LD9A 3FOLA 1F4WH 1ETZB 6PCYA 1YEKL 3OWRA 2KUTA 1RZGB 4BH7A 4I4WA 5ECGA 2Y3NA 3MACL 2QMJA 2GJ6B 2HVJA 4WW1B 1ZEAH 2AABL 2D31B 2EVGA 3QRGL 4LPTA 3HRZB 1RZIB 3FCTA 5ESQA 5FKPB 2B5IB 4XWGH 4PB9L 1LEKB 2HKHH 4DPBX 4MCYA 4M3HA 3GF8A 2EUXA 2F8OA 3CDCA 4BZ1A 1PSKH 4OIIL 2CLZA 4OH2A 4R0LB 3IT8D 4RGNE 5AW9B 5IM7B 4WF7A 4HQQH 2C7FA 4LHUA 2L4OA 2JI1A 2IFFL 2VDOB 5I8OH 3SY0A 1FNEA 4ZPTB 1T1ZB 3FO9B 3EJZC 4PTTB 4LXFA 3ZHNA 5F9WB 1EXUB 5JHDE 1PZ5B 2CIKA 1DBMH 3QIBD 3U0PA 2VIRA 1DQML 1INQB 3IU3A 3T3PF 1UB5B 3QCTH 4LSQL 4LB8A 3E6HB 2GBVA 4NQSB 2DPKA 1PX4A 1G43A 4FQLH 2FWLB 2K9UA 4TNEA 1X44A 2AQNA 3CPLA 1CDGA 3UJIL 5HHNA 2EDDA 3TA3B 4ANXA 5DRNA 4X7TB 2C34A 5KOMC 2IDTA 1EJOH 1RHHB 4IS6B 4KAQH 1OSPH 1PDKB 2Y1ZA 5JLZA 1CTMA 1HHGA 3HZYA 4YHKH 5E4IA 2Y2TA 4HC1H 1T80A 1UD5A 3OPZL 3QO0A 5EU6A 4X42A 3DHUA 1XX9C 4BJLA 1I8KB 2CMRH 5AW4B 4Z3EA 1T0MA 4XBGB 1MWAH 4UM8B 5IROC 3TVMA 5I6MA 3U46B 1U91B 2X2YA 2MQGA 2R1XB 4XPBL 1UT1A 1JN6A 4MB5A 1G9NL 4M5ZH 5LQBH 1ZLEA 5DZOA 3GLDA 4AJVA 5KS9A 2R4SL 2IANE 1KGUA 4WLCA 3GXDA 1MIEL 2BNQE 1KXTA 3UCQA 5C0CD 3BIKB 3VJ6A 4QTFA 4X50A 1KXVC 5INCB 5MEOB 2VSDA 3P9LB 4KKPA 2DOCA 4XMPL 4Z6AT 3BXNA 3LEXA 3FB5B 4HYTB 4PBWD 3RUGA 1DVFC 3CFTA 4AG4L 1L5GA 1CFVL 5DEFA 1EVUA 4HFUL 3KVPA 1EGJH 2OMZA 3QUGA 1SEQH 2F08A 2Y3AA 3FS9A 3L3IB 2JVUA 3OL2A 3HEIB 1J1XL 1ZA3A 1IKOP 4WU5B 3IFLH 2FT7A 3UP6A 2ZP0T 2IADA 5A2IH 2GC7C 1Q9LB 2FECL 1A9EA 1IGYA 2XKSA 3F2LA 1CDBA 3VXMA 3TASA 3ARPA 2XQYG 2ZSVB 2P7TB 1AYOA 5DD0H 2FL5A 3QIUD 4F9PC 1CC3A 3TCLA 2QVMA 5HDLA 2P8PA 2EECA 4TNGA 3BP5B 4MQ7B 5CZXD 5DGRA 1FYTB 1EH9A 2D4DA 4HHAB 4X2UA 3FYIB 4PSPA 4QRRE 3NAAL 1QTSA 2CR6A 3QUXB 5F7BA 3ZIMA 2F53B 1NFIB 4DGYH 1A6AB 1CI3M 1OGSA 1TJHL 2CM5A 1X4ZA 4KROB 2ALAA 5IQNA 1K85A 4X4XA 2AKRB 4EPSA 1HWGB 3DSFH 5BZWA 4XAWL 5IJKC 1BA9A 2EDBA 1GCYA 4NN5B 3G5XA 1G6VK 5HGAB 2UZXA 3EYSH 2AV7B 3UTSB 5SV4A 1TZAA 4UOW0 1QASA 2J73A 4WV1B 5I19L 5F1IB 5JUEH 5E2WH 3C5ZD 1NBYA 1QYGL 3IAPA 1PD6A 3V6OC 3BHBB 2XZCH 1EIBA 3MV9B 3REVB 2FYVA 2X4PA 5HHPB 4AQ1A 7FABH 1I9EA 4C55A 1FJ1B 2VE6B 1S8DA 4ZX6A 2WQVA 4GRLA 2LABA 4W6WB 1FG2A 1N8ZA 4Y5YB 5D4JA 4A2LA 3KGRA 5IQ9A 4WJKB 4JN2A 3DX6B 1FL3B 4WI6A 1TQBC 1T7VA 2QT6A 3MLVL 3ABMB 1FZKB 3MV01 4WVRA 4IBTA 5I82A 2ZG2A 1K3ZA 4HWZB 2NYYC 5DLMH 4J3XA 3VSUA 4Z7QB 4HJ0D 5DR5H 1SM3H 4AH2A 1FQ9C 4P07A 4A38A 1RI8A 1NANH 1JK8A 5ADOH 3L7FB 3EUUA 1S5HB 2LU3A 3MUZ1 3PWPB 3UEQA 4RFOH 3PIQA 3ZUNC 3WJJC 3GXNA 2IH8A 4G7VL 3V0IA 1H8OA 3V9CA 3KPQB 4HJSA 5EU7E 3ASNB 1KPUB 3T71A 1GKEA 2AJZA 3B8SA 3FOMA 3OAYK 4ELME 2GABA 4QRUB 1KXQA 5AVZB 3M8OL 5IVXE 3RAJL 2KL6A 3L54A 5DMIH 4Y2OA 3RVXC 3VFGH 1IGIL 4E9YA 4OCWH 3DO4A 3SYAA 1EAQA 1IKNA 4ZXBD 3BVNB 4JGUA 1INEL 3O2WL 3LIZH 1GZHC 3QG7H 2CHZA 2AJSH 1YEGH 2DIAA 4WWOA 4XMTA 2A74C 1SRDA 4NWTH 2J12B 4OGQC 3F7YB 5DQDL 2OX5A 4GP4B 4IMKA 2IF7A 1AJ7H 1IILE 3LB6C 3MRGB 5E2JA 1OP3K 4Z0BL 3UAJC 3C12A 3ZKNC 1UM6L 4YXKL 1GS8A 1RJLA 2CGZA 7PAZA 1N19A 2JMRA 3OMAB 1D9KD 4KOBA 2EABA 1H3PH 1HIML 5H35A 3ECBA 2V2TA 5MEPB 3F00A 2NXYC 5FUCE 4TUJB 3UTTE 3UIYA 5E9DA 4GAAA 4KKBD 4I3RH 4DQOH 1SF3A 4MDIB 5ANMA 4NRYA 1G6RB 2WB1A 4R83A 3U1QA 4H2CA 2JKNA 3C08H 1JIBA 2DQCH 4YDZA 2VDRH 2ITCA 2EVHA 3DHPA 1TCRB 1T22B 1NFAA 3BT2L 4HXBH 1TTRA 1M7XA 5KSAB 1QWHA 3QUMB 1KIPA 2A6DA 3MRIA 1AGBB 3I74A 2VM3A 2CIIA 3LKQB 4HIIA 3G5VA 3ULVD 4JKKA 3C5JA 3DWTA 1AACA 1FFTB 2RH0A 4ZS7H 1XBDA 5E95B 3SPVA 1SYSA 4HIXL 4OSUL 5HVFB 4U6VH 1JHTA 3GI9L 2CA3A 4QXTA 1BVNP 3RWFA 4LP4A 3AU1A 3VM7A 1FAKT 3F8UB 1XIWA 2NY6C 3CVIL 4Z8FL 1NPNA 2DQFA 1S5IL 4EKXA 1WAAE 5IQMA 4W9KC 5HI3D 1J5OH 1BVKA 5A2JH 1P5VA 3HN8A 2PUQT 3LZRA 4LSPH 4TLSA 3QZWA 2EXWC 2OR8A 1V3KA 5I1KH 4CVXA 4N2BA 3WMSA 5CKAA 3IJHA 3D0LA 1NDGB 2DQJL 1QNIA 4MA1B 4WUUE 4UDUA 1FRGH 5CU9A 3MV11 1G7JB 5GS2H 2P52A 4AJYV 2XXCB 3HN5A 2DTMH 3AY4C 3NRFA 4GRWH 4OZHB 3WIHA 4YBLC 2MNWA 4TXVB 2BSSA 3ZL2A 1OLZA 3NCYS 1C5BL 4LPUA 5IJDC 2L7JA 3QIUB 3DSNA 1B4JH 5B1CA 1FN4A 5B1KA 3X13A 3GKZA 5DJXA 6FABL 4IHOA 2BXZA 2AK4D 4J1UB 2PR9A 4AXWA 2AJXL 2HRPL 4FG4A 4KFMA 4AYEC 5BO0D 5F3FA 3DX1A 5J9PB 1YNKH 2NPLX 3V5DA 2WN3A 4RMVA 5GRYA 1RL1A 4JDTH 4FQXC 4KUZH 4RMBA 4AL8L 2BNRE 1U8JB 4BCYA 2OTUB 2YAEA 1E4HA 3FAXA 1Y18B 5E1AA 4F9LA 4IOIB 5EBWB 4PJHB 4BRJA 4PRPD 3L3JB 3VU2A 2Y9RT 4MQSB 3C5ZB 1CDCA 1T2QL 4M48L 1L9RA 4HWUA 3QFJB 2PPDA 2YUZA 3GNMH 3P1VA 2PWGA 4MJ2A 4L4VB 3IXAB 4IOSA 3SD2A 1F2QA 1G9ML 2HVBA 4LSVH 1E4XL 1MWAB 1R5WB 3HRPA 3FF7A 1J8KA 4I48A 3ORJA 2H41A 5I1IH 4CUCA 3DUHA 5J1AB 2BZDA 5DWPA 4OGXL 3ZY7A 4IEFB 3RNKB 3OKKA 3BJ91 4NERA 4QO1A 4E42B 5I1CH 4IKIA 5E6YA 5I6KA 1E40A 4D0CA 3SCMA 2O6DA 3SE9H 1LDPH 1GC1H 5IFJB 3QWRA 3IFPB 3LQZA 1OAZL 3N1FC 4P4KD 3B2VH 4H5SA 4L9DA 5DDHB 5E6IA 4IRZA 1OZUA 2GVYA 3CE1A 4GUCA 3BKMH 3UMTA 4DP6X 2YMXH 1PZAA 5IMOB 1EUUA 5JQHC 1FV1A 1WD8A 3L3OB 2NR6C 4TSAL 3A4EA 1D5RA 2QQLL 4N26A 1H3XA 1ZVSA 4M43H 5CO1A 1FLRL 1ZLWH 3X3GH 2NQCA 5A7BA 1FC2D 3REWA 4ZXBB 4LPYA 5BRZE 2DIEA 3CQPA 1YNLH 4U1NB 4YZFF 4TLTA 3T6VA 1JTOA 1RUMH 4LEOB 4JHWL 4JUTA 1NCIA 4HJTA 5DD1H 3V0HA 3E8UH 5I0ZA 3OMZA 4FX5A 2YC1B 1T7XA 1DVZA 1T6WA 2ATPA 3CFCH 3MXWL 5IWLC 4TOYL 4P23A 4FABL 1DE4B 5FKAB 2XZQH 2GITA 5TE4L 2CJ3A 1P4BH 2ZUQC 5IHHA 2ZOKB 4Y4HA 4R6UA 1D9KB 2CR0A 3IRZA 4N6RB 3TBVB 4YDLC 1U3NA 1KMGA 4A1RA 4J4PD 4HSCX 2X4UB 3QJZA 3D0VB 3FZUD 5EEVA 2EUWA 2E7HA 3G6AA 3GIVB 1OHZA 4CSPA 3NZ8A 3WLWC 2YD4A 3UTZA 4U33A 5DRWA 4B96A 5IB1B 3NFNB 3OSKA 4G80B 4MJ5A 4JHVA 4FP8H 4L3FA 5D1QE 4NC1E 1RPUA 5HD8D 4K3GA 1HCYA 4MSWB 5IB4B 1BIIA 1R6VA 4NM4H 3MR9B 1KENL 4MXWH 4AI7A 4Y5VB 2F7QA 3T1FA 4HCRL 1FVDA 2FECI 2Z1KA 1WCQA 1N9PA 4ZAKA 3VXSD 4DUVA 2WKLA 4XNXL 3SPIA 1HESA 3P0VH 2IWFA 2WZPA 1GR7A 4P5MA 5DJ6A 1BVLA 4PIRF 4P46A 4WTZA 4XB3A 3LD8B 1QSFA 5JHMA 2EIDA 4OY9A 1E4WL 5BQDA 1DJSA 1UA7A 4FZ8H 4WI8A 3FTWA 4JO4H 2HP4A 3T4AA 2X44D 5C0BD 3EXJA 5DRXB 4PJDB 1D7DA 3FT2A 2X10A 4GSXA 1XR9B 2VW6A 4Y4FC 4BQBA 1AHWB 1YMMA 4FG2A 4Z7WA 4LLYB 1WGOA 1XCTB 2UX6A 5ICZB 5T33L 2NNFA 4YE4H 3CZEA 2IWGA 2KPWA 5MERB 5AL0A 5BV7C 3K8KA 4WNQA 4G83A 3AAZA 2GIYA 2BCKB 3PE9A 2JXMB 1KOAA 3P30L 5KVEE 5CJOL 4JFZH 3JTBA 4GW1A 2VL4A 2F5AH 3N2JA 2N0MA 4GKZB 3G6JA 4KDVA 1FC1A 4N86A 5E56A 1P6FA 4DVRL 2K6WA 3T8XA 2C3GA 4F8OA 1Y07A 2AK4B 3W39B 5E5MA 4G3YH 5FF6A 4KZEL 2XPZA 4OZIB 1CFTA 1YUHA 1FH5H 2G9HA 4AKOA 1F00I 5FGBC 3WV0A 4OV5B 1KIQB 4P2CG 1TXKA 4B9JA 3MX0A 5EOCL 3RTQA 2VSKB 2EE9A 3R8QA 1P4LB 1J8SA 1NOLA 4PJIB 5DTFA 4G6FD 2UUDK 4U3SB 2GFBA 2LVCA 3VWKC 2IC2A 2YLKA 1V54B 1H5BA 1JHKL 4HIJB 4PRPB 5EU7C 3E6FB 2AVGA 2G2RB 1RIHL 4M7JH 4F3FB 4XP5L 3HG1E 4JFFB 3VAEA 4Q4EA 3NEXA 5I1AB 3IMRA 5KVEL 3X17A 2FWSA 1RAMA 1JGLH 1A2YB 2NCEA 4UAOB 1BYNA 3BPLC 3TT1L 3C6LD 1LK2A 2WWOA 2QKIC 2BINA 4FMKA 3L9BA 4PJXE 3EDEA 4K8RH 5D5MA 1MHEB 2VMEA 1K5WA 1QPXA 3VFUA 1IEAA 5C86A 5I0DA 4Z23A 4AQAB 4BD4A 3S35H 4IU2A 2GJZA 4GQQA 4WW2C 3VQMA 3WN5C 3S48A 5DJ8B 5LXGL 1IGFL 3I9GH 2DIBA 2ERJC 1MCEA 1GGCL 4UV4L 4P4KB 2HKFL 3SQBA 2Y07H 3SO3C 4NZDA 4UT6A 4ETQA 5LXVA 4C83A 3P2DA 3LEYL 4N2MA 1UXMA 4BGDA 4H20H 5FUCC 1D5IH 3B7TA 3HE6A 4U6YB 4QLRA 4F58L 4LDCA 3FUDA 5DHYB 1A3LH 4QKTA 5EO9A 4WGWB 3JT2A 4X4ZA 1NGWA 3D3VA 4OVUA 4ERSH 3HI6L 2XV3A 1BLNB 1DUYB 1NEPA 3V0WH 4PWFA 1I3GL 4HPHA 1NCAH 3FO0H 3LPOA 4OCYH 3NN8A 3MNDA 2NRDA 4BUGA 4P49A 5D7IE 3CJJA 1CG9A 2BH0A 2CK2A 2FBJH 5FHBL 3HHSA 1UQSA 1AOZA 2A38A 3EUDA 3NZSA 4J8RA 4ZOAA 1EO8H 1VZGA 4ES8A 1H6UA 5ALCL 3WHE1 4AQEA 3DETC 1UWYA 2QPUA 1OTTC 4HWBL 1H8NA 4NSKA 2WPGA 4YC2B 3MODH 3RWEB 4PJ9A 4D0BB 5IEHB 1HQ4A 5L2KD 2DYPD 4LEXH 4OLYL 4OZFH 5AYUL 4EIBA 1WFNA 4AK1A 5T8IA 3DYMA 2NY5H 4HETA 4DT2A 1UZ6E 4JQIH 3WFHA 3QEGH 4AL8C 3LXAA 4JJOA 5I8EB 4GUPB 3EH5B 3T4YA 1LO3L 5CEZE 2A83B 1N4XL 1C7SA 3SE6A 2J8UB 3GSVA 3D33A 4AKQA 2WAQA 4JE0A 4Q56A 1CFQB 4PAZA 4W9DC 2DBJA 2E47A 3CH8A 3LHPH 2X0WA 4DTGL 5FO7B 2Z9TA 4K8RD 5DUBA 1P7HL 2ADIA 3SKMB 2EDKA 4B9GA 5FW7A 1ZLVK 1T1WB 4EMZA 4FF9A 1G9MC 5D4IA 3UOAB 2X9WA 5CR8A 3VXSB 1IAIM 1LP9E 4G9DA 5GHWH 3WFCH 4W4OA 5C9KA 4WO4A 1UXLA 4XH2A 3SQOH 3VRJA 1MQKH 1DQLH 5EG6C 1BCIA 3WIIL 1J8HA 1MFNA 1NKGA 3TBCA 4F2MA 2F19H 1UXSB 3U9PL 2HUEA 4GEIA 2R1YA 4G6AC 4HGMA 1N5AB 2YRZA 5DJCB 2PTTA 1MFCL 2NTFB 2H2PC 1TTCA 2DQGH 1YAIA 3FTSA 5E8EB 1MW0A 4GRMB 5CEZL 2ATAA 4FFZH 1LNUA 1ACYL 4P9HL 4XAKD 5D1XA 5KN5A 5JIPA 3PP3K 4JO2L 4OM0H 1M3JA 3PJLA 1HCFX 4J6RH 5DURB 3FJTA 2JE8A 1CDHA 2WJ5A 3SJVD 1CBVH 4Q74A 1B2WH 3LS4L 1LQBC 2J25A 4ZZFA 1RU9L 2J1YA 1SUJA 1T1XA 3FU5A 2MOGA 3DV6A 1E4XI 4L1LA 1JGDB 1KCVH 1DDHA 3AT0A 2UXTA 2GG1A 3A6CH 4MCZB 1CYGA 2QSQA 3DXAA 3GSNH 4Y7OC 1DBAL 1GW0A 3SZ6A 1ERNA 3P9WB 1A3RL 1NC2D 3P4MB 4KC3B 1R3KB 5F6HJ 1BFVH 1MCJA 4M6AA 4F7EB 15C8L 4BFJA 4DOHE 1PNDA 2EIKB 2XICA 2MFNA 3NIDB 2CBPA 2P8LB 4OFYA 5TK2A 1A4AA 3ARFC 5GGRA 2Q7YA 5E2UL 4G6FB 4E2OA 1YN6B 3CVCA 3BZ4A 4I0PC 3IJ9A 4PWJA 4A7SA 5TDOB 5E51A 5F7DA 3RX5A 4UAHA 2VJ8A 4JG1H 1G4MA 2WLLB 5HVGB 1P4UA 2NNAA 1FZMB 2XETA 4U2YA 3EJYC 4GG6E 2VXUH 2YAPA 4O58H 4K3HA 4RSYA 1AC6A 1WTGT 2FSEA 3HW7A 3ATBA 3IDGB 2ADYA 4HS6B 4MRCA 1BAFH 1VSCA 4DP5X 2G5BA 3DX7A 4XMVA 5AAWC 1RLWA 1IQDA 4GKNB 5AKTA 3C6LB 3HMXL 4YR6A 4EZMA 2OMUB 4L1BA 3H2QA 25C8L 4M7ZC 4Q6IC 2OTWB 2QEJA 3NCXA 2OYKA 3CFBA 1K6QH 3KYMB 1CLYH 1OQXA 2GBUA 5BXFA 3TH4T 3DURB 4FHJA 4AK2A 5AOZA 3CFJB 4BE6A 5HDBF 1GOGA 3AJ7A 5I26A 4Z7NB 5I1EL 4Z7OE 2OI9C 2VLLB 4BZ2H 1BPLB 4IW4C 1R75A 1SMAA 3WFBH 5AEAA 4RISL 3BWUC 1WCBB 4JFPA 5JDJA 5L6YL 1Z9NA 2EKSA 1TNMA 5KS9F 3BN9C 3DX8B 3O9WA 5HYSG 2XN2A 5MEQB 1MW1A 5TPWL 3WNLA 1R0AH 1IZKA 1IGMH 3B56A 3EOAA 3GMQA 4ZPVA 4PUBL 5F9OL 3STLB 5C0FB 3MKKA 5IUCA 1L3WA 3V0JA 2D3VA 2VC2L 4YEFA 3RUGF 3FCUB 4PQXA 2VZOA 2VDQH 3JXAA 5AOLA 2XWTB 4KFZC 2CGRL 4NC1C 4L8CA 5KW9H 3V4UL 5M95B 2DEWX 3QI9C 2WXGA 5FFLA 4UZGA 1RZQA 3F7PC 5HHOA 1UYWL 2CDFA 5AKRA 2Y36H 3ALXA 2ZP9A 1F1GA 4FCAA 1BM3H 4MWFB 3ZTJH 5E2TL 4LQFL 1CD9B 4A37A 1SLUA 4JZJA 1I9JL 3NFPB 4D8PA 4DEPB 2X4SB 1XSIA 4ALAH 2FO8A 2QQNH 2QVFB 3EKCA 3LZFL 2I9LB 4OB5L 3VG9B 1AZNA 2WBWB 4L8SA 5L2KB 3TX4A 2AEPL 1HILB 1RZFL 1T83A 3SGJA 4M8QB 1JPFA 3MRRA 4RIRA 2YAQA 4PJEE 3QEUB 2X4NA 5JPNA 5F6HI 5D96C 1KB5H 4HWEL 2DQHH 3GO1H 2EKJA 1YYLH 4XX1E 5EN2B 4XMLL 4M6OH 1IKFH 4NQCE 3F04A 2PMZA 1M53A 4QHMA 5CBAB 5JNYA 5DI8B 3UERA 5HVWA 2EDLA 3IU4L 4C56E 1N67A 4DGVL 3WDJA 2R9HC 1MFBL 1N2RB 3BPOB 2CRYA 1N7ML 4RDQG 2Z0UA 4JPVH 4JO3H 1DQQA 1XF2A 1JVOA 1WD9A 2R23B 1MUJA 2HT4D 1XCXA 3DHJA 4G59C 2ZWYA 2Z31C 2NY7H 4UTBA 3U6XS 3JUYA 2A6JA 3QJFA 4PWHA 1BX2A 4Y2DA 3L1GA 2DLTA 2ZJSL 1XCQB 2W0LA 4XBEL 4ZW3A 4YBQC 2QL1A 1A3ZA 1CCZA 3GS7A 3OPUA 1U0QA 3HNVH 1MPAL 2GSGB 1WS8A 1NGZA 4GPVA 4NYLB 2D03H 3U7WL 3HZMB 2V7NA 1CLVA 3GJFH 5ANHA 2R0ZH 2YOAA 4ZX4A 4LCIL 3OXSA 5CBEB 1EHNA 4HK0B 2R1WB 1FFNA 2RBLA 1HHJA 1QSEE 4JY5H 4WSGA 1P6WA 3T3PB 4V1DD 5I16B 2J5LB 5AFAA 4PB0L 1CDYA 2AJVH 3ARSA 2F5BH 2WUBH 3X2QB 4WI0A 4IRJA 3VYNA 1SJHB 2C3VB 3DIFA 4PS3A 1JDAA 3RL1B 1I9RH 3F12B 1GYAA 2IIJA 2DLEA 3IPBA 3LPPA 1PX3A 5KANG 1CQKA 3SJVB 4HMDA 4J2QA 5DT1L 5F6IC 1OGAD 3MGOA 5LBSH 1B0IA 2X6UA 3VXTA 4NC2B 2ICEA 5JIDA 2KZWA 1MI5E 4R26H 5FCUL 4I18C 4XP1L 3RPIA 3WEAA 1DHKA 3QRFM 5E5UB 2ORBH 3HLKA 5HYQB 2R0WH 3IDIA 3D05A 1NC2B 3QIWC 5JORA 4JFDA 3O3DB 3H9SD 1OCRB 1J11A 3LDBC 1Q9KB 3DGGA 3KHOA 3O41A 1JGVH 1PZCA 2X4RA 4HCGA 3RJOA 4NLAA 3UJTH 3VI4E 2YD7A 1TO5A 4P2RE 4KXAA 4UIMA 3FUHA 4KPHH 1AZCA 4JFOB 3VMNA 3W0WA 4YSSA 1I85C 4N8VA 1A8ZA 1ZLSH 4WO0A 5K9KB 3H9YA 5JHLL 4OFPA 3GSUA 3DC0A 4XTRD 2XXGA 3A4DA 1OE2A 3V8OA 4MMZB 4ILDA 12E8H 3TBTB 4AMWA 1VFAB 4HMCA 4GW5A 4NZTH 4AYSA 1XF5B 1O6VA 1QA9A 3NABL 5IQOA 1NGPH 1UA3A 4P5KB 2D0HA 3WL9B 3OKLB 3UH8A 3FFCE 1C08B 3WFEH 1CFSB 3V4PA 9PCYA 3NH7H 3W37A 1KLGA 3UZEA 1AD9A 3ZMEA 2VN6A 3FTYA 5CGYC 2ESVD 1JDDA 4PS4L 2H6PA 1YRKA 1U8OA 3O4LA 3DKHA 5JPMB 4DWHA 1FAIL 1EZSA 2MQ0A 1TTAA 5DCCA 4XMKL 1WK0A 1YEHH 3KR3L 4O2CA 4N22A 4JG5A 4P06A 5HI4C 1IVLA 1X9RA 1OCCB 4RWYH 5T5NG 3T2LA 5GJTL 4PJ7E 3WEOA 3JWNG 3Q1SL 2NOYA 4FXKA 3BSZL 4HLEA 4XMWA 1DFBH 1S9YB 5J89A 3KD4A 4N1EA 4UNVA 3BMVA 4WUKH 2EO7A 4UT7L 3ZQ9A 4NQTA 3TT3H 5F96L 1GYWA 4RFEB 1HHIB 1UCTA 3GSNB 3MXVH 3MNWB 4KDTC 2AI0H 5F9JB 4DO5A 3C60D 4FULA 3PL6A 5ICUA 2Q10A 4OT1L 1KTRL 2I24N 1J1OH 3MBEA 2Q8BH 5JXEC 3JTTB 4G6KH 3V4VA 5AKVA 3U2JA 4PGCA 1WFUA 3MRMB 3MRQB 4IBWA 1SJMA 1XGUB 2WMPB 3APCA 4LVNB 5CP3H 2R69H 5K39B 3PY9A 3NJLA 5KYXA 4HJIA 4CU7A 2R29A 1CDJA 5EA0L 2ZOLB 1WBZB 3ZTNL 1BJMA 3JV4B 2P28B 5SX4H 5L9DH 2VQ1B 1CB4A 3G7TA 3UADA 4O2FA 4ORGA 3L3KB 1LGVA 3ARDD 4R90H 1NJ9A 4N9GB 1UVQB 1QD0A 4QRTB 3LMJL 5DMJB 4ZSOA 2AXGA 1DYZA 4MX7A 5EOTA 1KGJA 1U30A 3Q5YA 3ZE0F 5T1JA 2FATH 5DQ9A 2K70A 2HWZL 1NZRA 3RA7H 5J11B 3TO4D 4ZUTA 3F6IA 3PP4H 9CGTA 1MG3C 2A9BA 4KRPB 4M61A 1NUGA 2AJUL 1T21B 3QXDA 4PJBA 4X80L 1JXKA 5BQ7B 1LVEA 2PTUA 2A77L 3IB4A 4TUOB 4YAQA 2OAAA 3KZ8A 1A1NA 1WUNT 5DJAA 3KDMA 1NICA 2YD6A 1F86A 4YS4A 1SXZA 3QUZC 1NANI 3VFOB 4V1DB 1ADQH 1S7QB 1TKWA 1UACH 4HLJA 4MA7L 4B7IA 1W6LA 4KGLA 4LLWA 4Y9EA 3TZVA 2VDQB 4YDIH 3D69A 1XGRB 2CLVB 4GSUA 5IHLB 2DWSA 3ETTA 4X98A 1L7TH 2WXLA 1U8IA 3CVDA 1YEIL 3GSOA 3L3GA 1KXVA 4GP8B 1TR7A 4NQVB 5I23A 3WE1A 1NCWL 1MVUB 3LN5A 5GRUH 2Q76A 2QPFA 2DH3A 4K7FA 1OGAB 2JQAA 1SOQA 2BSBA 3C8KB 4FQCH 3CZLA 2Z64C 4GAYB 4MDJB 4IYKA 5GGTH 2QQKL 1DJXA 3I75B 3R06A 5B38B 5D7JA 1MCIA 2B59B 1BBDH 1QBLH 2DQMA 3WUWG 4DNLA 4N0UA 2OXGA 3N9GH 1KBPA 3C09B 3L4TA 3QQ9C 4ODHL 2N0KA 5DYOB 3RGHA 2X05A 4DKFL 1ICTA 4ZTOH 1I8IA 1RZ7L 1SFDA 1W8NA 4NGHH 1WRFA 3H7LA 1BMZA 1KB5B 4E9SA 3H9SB 2Y6SC 2VLRA 2DB8A 1S7WA 4ZFOB 5I1DB 4G1MB 2I26N 4NRXB 3VWJC 5B38G 2H26A 3IE9A 2G60L 2WVVA 4R4ND 1OWRM 2WYHA 1SMOA 4G1EA 3UPRA 1FFQA 1USZA 4KO7A 4XC1L 3TYFA 4I2XB 4I5BB 4NDMA 1OPGL 4ECNA 4JANA 3B9KB 4XNQB 2A6IB 3CMOH 2JCCE 4ATWA 2X42A 1CE1H 4DP2X 3KVDD 1YMHB 3L4WA 1A7OL 1M1XB 4YSQA 1ZTMA 3GS4A 2YQBA 1G7IB 1HL5A 2AV1A 4E9VA 2X3CA 3DIDA 4U05A 1KZQA 3QCVH 5FHAL 5M94B 1EAPB 4ZFQA 3T0EE 5AENA 4KVPA 4JQXA 3PUUA 3CCHB 3SDAD 3WS6C 1A7NH 1DL7L 2UY7B 2W60A 2WBXA 3K4ZA 3KPRD 5TDNB 3GJFB 5EFIB 1NBVL 3W9EB 3FUMA 5J1SC 2WWMC 3O0RL 3MA7B 5KYUA 3FTGA 5IK3B 1TZIA 2DN7A 5ID0A 2XG4B 1XB6A 4BDVA 1NCBH 2O26U 2ESVB 1OTSD 2NY1B 5DHVA 4TVPE 1JGUH 1VA9A 3OKNB 4RGOH 3HC2A 2WLJA 4LCCC 3RVTC 3RY6C 1HYSD 5AAPA 4LL9A 5JYMA 4DIXA 4X9FA 3BQUD 4NFCA 3PPSA 1ZY9A 2OMTA 2O5XH 4KHXH 2Q6WB 1CZ8L 5D1ZI 5LVEA 3DBXA 2APTA 3IWVA 4ZW6A 2NTSP 1ZHKB 1ZOXA 3VXNA 4PGEA 3R1GH 4JR9L 5IMLA 1F6FB 4XP9H 5C7XH 1KT2A 2CBOA 5CM1A 2BM3A 5D93C 4F33B 4IJ3B 3WJJA 4PBXA 4Z7WF 4I0KA 2FZ3A 1SY6L 3OLIA 5F7AA 5F9DC 1A6VH 2A0LD 3ZDWA 4LSRL 2OYPA 1RUPH 2IWEA 3ZUCA 4PJCA 4X6DE 4ZW8A 4K3DH 1AZBA 2ZZUT 1TJIH 4FN0A 2YJLA 1EZVY 3EIFA 3C60B 2AGJL 4NCC1 3WOVA 3G6JF 1JPGB 4S1DD 4XCEA 3O8XA 1MCPL 1RP9A 3HS0B 4TNVF 4G8IA 3NZHL 1GZHA 2FD6L 3EYFA 4TVPL 4G5ZH 5AUMA 3L6FB 2Y7QB 3CDZB 3HG4A 2A74A 4PWGA 3WFDH 2PYEA 1GW6A 3DV4A 4LLUB 2E6JA 3E38A 1MWOA 1I1YA 3SGDI 1SQ2N 4N0CD 1Y6MR 5I73B 4GBXB 4LAQH 4X0NA 4CADB 3ALWA 1MFDL 4NUQA 1PZUB 3K1KC 4TNWK 5B3JE 3QG6A 2W07B 5I75C 5EC1A 3AB0B 1AI1L 1CFNB 2GEQA 3ARDB 4ZFGL 1Q9WA 4OLZH 5HY9B 2GPZA 2APVA 3TS8A 1FE8H 1QO3B 1VRSA 2IMMA 3OKEB 2ZPKL 3OMIB 4K3JH 3O6LL 4XCNB 5ERWA 3Q8EA 4L1HA 3L8QA 1UKSA 4KK5C 4R7DA 1ZT7B 3BZ5A 4X4YB 5D70L 1HJBC 1TMQA 1WWCA 2XPGA 4GEJA 4GO6B 4RMUA 3TO4B 5KG9A 2O1AA 2VR3A 3HZVB 1A4KB 3IJSB 4RCAA 1HH9A 3D52A 4L5FE 4MMXC 5KVFH 3FFOA 2RAMA 4JDZA 1U8HA 2YSSA 5IZ7A 5J6GA 5L8LB 1WIOA 4XVUD 1B3IA 4H0IA 1V5JA 2LE9A 2XBDA 4PP2B 4BZ1H 2Z7WA 5H2BA 4JRXA 1NCHA 5IOPA 2UY6A 3FRPA 2DQEL 3I6GA 4Y1AE 1SHXA 5H94A 2EH8L 3H4FA 3KL5A 1IM9A 1YEEH 4QXGL 1PKQA 1QR4A 4CAGA 5D4HA 4F8TA 3ZZLA 4PREB 3HMWL 3IVKA 3GMRB 2IOIA 1IL1A 3FBKA 4PMFA 5D2NA 4F24A 2WNXA 1X9LA 3TEZA 3S2CA 3PHQB 2WLYA 3BZFA 1L7IL 1Z7JA 1T2JA 3BCFA 3UMNA 3CN1A 4DN4L 1KN4L 5AOIA 3CAFA 1BEXA 3ULUE 2DM2A 3CLEL 2BIMA 2EC9U 3QJHB 4GQ9L 1IFHH 1XVSA 3D06A 4UB0L 3AY4A 3OKMA 3BJLA 5K59F 4L5FL 4J3TA 3RB7A 3I3EA 1AR1C 4QTHB 4OCSL 3CIAA 1PYWA 3PXHA 3C9NA 3H4HA 3V10A 4ZZKA 3NGBC 3NVQA 5A16B 1F45A 1P1VA 4JFXB 4ABVA 3EFFB 1MCWM 1NMCC 1HZLA 3GSQA 3ZE1E 1QMUA 4XPFH 3MREA 4PRNB 2B3IA 3RNQB 3PFQA 3OB0H 1VPOH 2XQBL 4G8GB 3AMKA 4OCXH 3DK0A 4F5CA 3MA9H 5IBTH 4OBSA 2BC4A 2V9RA 3MTRA 1HAWA 4QYOB 3U46A 3ZE2E 5I30L 3IAQA 5AW3B 1QLRA 2AXFA 2DDQL 3THML 2ZWKA 3FSAA 4Z7VE 2HT3C 3WJLC 1VJSA 1F0LA 2BY3A 5GS3A 3Q6GL 3NUKA 4YHZH 1HI6A 3ULUL 4R3SB 2B2XH 2Q86B 3SDAB 3WS3B 4C47A 4DO6A 1CUOA 3PJNA 5I1HL 3D4ZA 3KPRB 4I13B 3X1FA 2E76C 3OXRA 4CBPA 1THAA 1COBA 4YSRA 1ZE3H 1BZOA 4P48A 1RUQH 1NMBL 3GD1C 4U1HA 2OTPA 4L3CA 5I9QB 1QUPA 1AIFA 2I07A 3UROR 3W9DB 4IIQB 3VDBA 3FSOA 1FVCB 4IGBA 3BQUB 1LO0H 3ESVF 3A6BL 5T1DL 5IF0A 4JM2A 1JBJA 1OIOA 1DCLA 4OTXL 1DR9A 3BVTA 2AZUA 1S7XA 4QYAA 1ECYA 2GB2A 1KJ3H 1WS7A 2AJYL 2LOEA 4FQ1L 1N3NA 4K5OA 4ZFZB 3UG5A 5D2LE 4DZBB 4N4YB 1J5DA 4ZMQA 1YNTA 4AGOA 1GOFA 1UATA 4FTDA 3UYPB 3HPJB 4X5XA 3TIEB 1IU1A 3F7KA 1F6LL 3AW5A 4ABWA 1XFPA 3QR0A 4QRPA 5C09E 1HHKB 3UBFA 4A68A 2OMXA 2KDGA 4U6XA 1KWKA 2ZF8A 1VDGA 2HVKB 2I25N 5JO5A 1HKLL 5AW2B 3PLYA 1MRCH 3MLRH 1JG9A 3MRLA 3I02B 4KKAD 4LU5H 4UT9L 2BRRL 4QXUH 1FZJA 2DWYA 2V9TA 1N6QH 3OKOA 4JAMA 2YA1A 3TVMD 3FFDB 2BS9A 2ICCA 3AZUA 3IGFA 4GXVL 3RVUC 2F0CA 1ULVA 3KJ4B 2XIDA 3MUY1 4YFLF 2AEIT 4P0DA 4X5WB 4Y5XC 3FUFA 1HNGA 1BXXA 2VDKL 1YJDL 2VXSH 4KKLD 2IANA 2CHXA 1HINL 3VNZA 4AVIA 3U79A 4YWGH 4BSVB 2BNQA 1DBJH 4MAYC 1EO5A 1IGCH 3RZCD 3HAEA 2VW7A 4N2EA 2OQJB 4FA7B 4XWOD 2HG5B 2NCMA 2JJSA 4G7RB 4HX1A 4NO0D 4KK9D 4AV5A 4OI8A 2QV2A 3OF6A 1F4XH 5KVGH 3FB7B 3ZT5A 4PLNC 4AEIH 2VYRE 3JVGC 4AENB 2YKLH 4NHUB 4NKIL 3FYEB 3QZOA 4KY1L 4WWKC 4ZS6D 3VXMD 4LVEA 1KJVB 1TENA 1X5XA 3AXLA 3HCVB 5IIEA 1AZUA 4WCYL 1CLCA 4Y9CA 4HKBA 2E9IA 3HS9A 4FKHA 1JZ7A 2EYRA 1BQHA 3L3DA 3NFSH 4PS8A 2M2DA 3ESNA 3NJMA 3N42F 4H2AA 5SWSB 3BVUA 4UU9B 1Y0LB 4BKLB 4WFGD 4QF1A 5FYKU 4PVBA 2B0SL 1UH3A 3NYKA 5FDWB 2Z92A 3GHPA 3KDPB 4PLKC 4R97C 3M17B 3LKNB 3ESUF 3PABB 1AANA 2ZCLL 4QRRA 4NT6A 1X3DA 2KDYA 5KSUA 2LTQB 4JPWH 3VB8A 4XXWA 4AYGA 3LN9A 1FZOA 3O2DL 3N40P 3L9RA 2IAAC 5FA3A 2V9UA 2BSTA 3PNRB 4FDWA 2IBZX 3B2XA 1GZPB 3D85A 3HC4H 4J3OF 4ONHA 4U1SA 5IG7B 4LCVA 1UWEL 5DO2C 1UWFA 2ITDB 3FB6B 4KQ3L 3FQTA 3T0EC 1XAUA 4JZNB 3PQYD 1QNZL 2F1BA 3HG5A 1KB9K 2CUHA 4JUSA 4MJJA 1UUNA 1VGEH 1TZGH 2VDOL 4R96A 4TQHA 4PG2A 3TN0C 5ICYB 2OMBA 2X89A 3Q7JA 2XWDA 4Z5RA 1UENA 3JWOH 5LWYH 3KPMA 4FD0A 5DS8B 4LKXA 2X1XR 3MGAA 4HMEA 1I1AA 1YAZA 3QNZB 1G7MB 2PP9A 3N1PC 2QGDA 5DJYB 3QJVB 1CGSL 4PJFA 5FECA 5FGBA 5DJZA 2BJMH 3U48A 3DVGA 3OX8A 2NY3D 3RDJA 3ZBMA 5HJBA 1T4KA 4HWNA 2EDYA 4L9LA 2KI6A 2WOYA 4KXZH 1LD9B 4YPJA 1UT9A 5AD0A 3FOLB 2B16A 3DDFA 2PWDA 5FWQA 4AC4A 3ARBA 3WEXA 1KC5L 1V7MH 5GGRY 1BQLL 5KSBA 1Q38A 4BH7B 4I4WB 4L4TE 4O2EA 5DO8A 3S4SG 3TJEH 4ELMA 1EUTA 4X9IA 2V17H 4M6NH 3T2OA 5IVXA 3Q2LA 5IJCC 3BRGC 4OJCA 4NUGL 3HZ3A 3FCTB 5DHXB 1FYTE 5ESQB 2X4TA 2JSFA 4CJ1A 1T6BX 2AEWA 3KGUA 5I0VA 3CZUB 2G3ZA 4MCYB 3SDCC 2OZ4L 1B0WA 1U3ZA 5GGVY 2CLZB 3I9IA 4RNRA 3U30B 1L9PA 3X3FH 4W9GC 3EYVA 1Q4NX 5B21A 4B9CA 5C3LD 3SY0B 1FNEB 3COOA 4LHQB 1WEJH 3MCKA 3QUYA 1Y6KR 2NW2A 1WZ1H 2QMKA 2CIKB 1I7RA 3U0PB 2VIRB 3FTVA 3IU3B 4XNYL 3VRLF 1FGVH 2VQ4A 3QNFA 2X6BA 3MDJA 1FHNA 3TONA 1MRDH 4Z95H 4MNGE 4U1GB 2PO6C 3CPLB 1YQVH 5HHNB 5E9DD 5DRNB 2P5WE 3AWEA 3MMEA 3UTTA 2V3DA 5FYKH 1SXBA 4NPJA 1G1KA 5C0AE 1CD0A 2H3KA 2IWKA 3DTUB 1HHGB 2R7EA 3ZSSA 4QLWA 4B3EA 4PLJC 5K9OA 4B9PA 3QO0B 4NO2B 5HDBB 5EU6B 1E6JH 4S11A 8CGTA 1T0MB 4K94H 3TVMB 1JN6B 1MF2L 1MJ7H 2A7BA 1ZKAA 2GEEA 1QRNA 3JTSB 4M93C 3EGSA 4ZTPL 5BO1L 1B0RA 1OANA 2ZAGA 5KS9B 1GGIH 1FNAA 1UCBH 2XNAA 2Q3XA 3FH7A 4N0YL 1I3RA 4NP9A 1N5YH 1KXTB 1OGTA 1WBXA 1V7NL 4PYHA 4POYA 3K4DA 4BHUI 2CAKA 2VWEE 3BXNB 3LEXB 3BAKA 5HHMD 3RUGB 3S5ZA 4KBPA 2LHAA 5DEFB 1OF2A 4IRZH 1L5GB 1MCHA 4FQ2L 4MXVE 5CSGA 2OMZB 4TTDC 5GRVL 5TD4A 5EO1B 4PFEA 5C3TA 4DVBA 2A1WH 1ZA3B 3K6SA 2IADB 2YFNA 3T8MA 3NRPA 4WUUA 4XNMA 4YX2L 1MIMH 3SDDA 1M4KA 1S7VA 3KAAA 2ZUSA 3SKJH 5CKGA 3ULUC 3VXMB 2CU9A 4Q8BA 1AR2A 1OL0A 2FL5B 1AS6A 3TCLB 3LXUX 1KTDA 2P8PB 1UJ3A 1QFWL 3TH2T 3DLQR 3N06B 1JZDC 1AGCA 5I74B 5I6XC 4XN8A 1GY2A 2J1WA 1IQWL 3AC0A 3BUTA 4ZMAT 1NAKL 4TSCL 4X4XB 4JFYA 5BZWB 3WYRA 3GBML 4UNIA 3G5XB 1S7SA 4APQD 2UZXB 3CSFA 1QHOA 4CVZA 3LRSB 5K93A 4RMSA 1XD0A 2J5WA 2QV4A 4D3CL 4K5MA 1ZHBA 3RURA 1Z66A 1K3IA 3EJUA 2BVOA 1FVEA 1NBYB 4WI7A 1QQDA 4WI5A 4YDKH 2ITFA 4IOSD 3SDXA 2X4PB 1PQZA 1CGUA 4AQ1B 5D72L 3B1TA 5DUJA 2ZOTA 1CGYA 1QKZL 1S8DB 4KTDH 5HYFA 3RHWK 2WZ6A 4GRLB 1FG2B 1N8ZB 3MRKA 4LDEB 5C2BL 5IQ9B 3CTTA 1MJ8L 4JN2B 3OMNB 4G2AA 2HTKC 2HLAA 3GZKA 5C0CE 2VDMH 4NEHB 4WJG3 3SCMD 4G43A 5F8RC 4U6TA 3Q8FA 3HFML 3LQAL 2Q1EA 4H40A 1JK8B 3QWRD 2BHFA 1QBML 2NY3B 2YS4A 3O3AA 5AVRB 1AXIB 3PIQB 2XJKA 3BSHA 1OT2A 4WAFA 3VW3L 3UTOA 5AOMA 3K0WA 3PWLA 1JYXA 4HUVA 3ZYJA 2AJZB 3FOMB 4OZHE 5KBLA 1P9MC 2QLVB 4RMTA 4MJ6A 3A67H 4U1MA 4N2HA 5CHNA 4Y2OB 2FIKA 1KWGA 4OJFL 4JK0D 2CKBH 4YK4B 1IAIH 3PWUA 1RMFH 3BVWA 5EF3A 4X8GA 1MDAA 4W9CC 2VO5A 4FMVA 1WFTA 1HCZA 4WEBH 2JKJA 4LCWA 4KVNL 1CLZH 1U33A 2OX5B 4LLQA 4PJBF 3UAFA 3U4BL 2PABA 1XWVA 4LEBA 4PV1C 2WLIA 3O2VH 3BD5A 4P23D 3FUIA 1SF5A 2OM5A 3MAWA 5KVDH 2F8XC 2KHAA 5J13B 3OJMB 4P2QD 4ACTA 4AC2A 2P26A 4KKCC 1RJLB 5E4AA 2F54E 3PV6A 1NC4A 4Y4HD 1A7BA 4TVSa 5H35B 3ECBB 2V2TB 2YJQA 5MEND 1J9QA 5JOPE 2IDSA 1CD1A 3HRZC 5E9DB 4DEWA 1NGQL 5L8JB 2P3YA 3IJ7A 5ANMB 4ZMTA 4NRYB 3WSQL 2YR3A 2Q2EB 1KUMA 1U6AL 2HX9A 2BIIA 4FQIH 4HV8A 5CMAA 1EDYA 3QW9A 5TF1L 5C0RL 4R0LC 3W2DL 2EDMA 3WBDA 2ITCB 2VR9A 3VYOA 3VXUE 4HT1H 5D1QA 1EVTC 1XV8A 3GSRA 4GKOA 4ZOCA 1KIPB 1OTUD 2A6DB 2D4FA 3MRIB 4FNPA 3U6RA 2H0PA 4QHUA 4AYDC 4ZAKD 1HXKA 1F8TH 2CIIB 4HIIB 3G5VB 1GYCA 2IQ9H 1E42A 3IDYB 5ENWA 5F9WC 1A4JA 2MTPA 3MV7E 3SPVB 2JJTC 1SYSB 1VERA 4AW4A 2VR5A 3EOTH 1ZCRA 4OF6A 1QSFD 1JHTB 2YBGA 2BZCA 3GHEL 4QXTB 3RWFB 4F91B 2E7CA 3AU1B 1XIWB 4QEGA 3TA3C 4WHDA 4K71C 4GSDL 2DQFB 2AQPA 3E3QE 4JDVA 1JPEA 2WQXA 5G4NA 1IAOA 5JIQA 2R8SH 5I28A 4LVOB 3CVHH 1BVKB 1YMMD 1P5VB 5HHMB 2WK2A 2WM0A 4KRNA 3QZWB 1MWAL 5GRZA 3W11C 4F8LA 5BVJA 2Y0SA 4CVXB 4A2FA 2O6FA 3IJHB 3D0LB 4UT6H 4UDUB 2EXYD 1AO7E 1JZEA 5TDPA 2GHWB 1ACZA 1DQJA 2A9ML 2J3SA 4JJ5A 3P0YH 3BKJH 3FB8B 5ELIA 3M46A 4BCXA 4C58B 2BSSB 3P77B 5A2LH 2VT0A 4M4RA 2Z31A 1FPTH 5LAXA 3KL3A 3DSNB 3L08A 5EULV 1FN4B 3FTZA 3UTPE 3X13B 5DJXB 5F7KC 4IHOB 1ZHNA 5H4YA 2DICA 4AXWB 4MTMA 4R7LA 5IR1A 4L3AA 3T09A 1UM4H 3UTQA 3VH8A 4ZI8A 5EO0A 1QATA 5KAQF 4HDIA 3C2SA 1QFUH 3KVQA 4P9ML 2ISDA 3RTQD 3V5DB 5F1SA 4LT7A 3U7YH 1Q1JH 4N8PA 3RVVD 3IXTA 3BKYH 1LDSA 2CO6A 4MNHB 5FUZL 5E1AB 4U0RB 4NKDA 1RZKH 5CJ5A 2BSED 3HBGA 4YXLL 1MCDA 3S8WA 1HN1A 2X6VA 4UIKL 1PLGH 3IYLW 3ZVVA 4PV8A 2VJXA 3IPFA 3EYQC 3QXTA 2VRKA 3ULVE 1E5BA 1S4IA 3M1OA 4HJJL 2YAOA 3HG1A 4KJQD 4X5LA 3T6QC 4E0RA 4PJCF 3DSFL 5A6IA 2FEDD 1F3DH 1IC4L 2R0KH 4M7LL 4M6MH 5IGXH 3U83A 2ADJA 3S5YA 3QUXC 4I48B 3H42H 3M86A 2VH5L 4ADJA 2GSIA 1TTUA 5B8CA 1U8PA 5MHSE 4KROC 1ZANH 3DMMC 3EGDA 2WSPA 1OKEA 4PJXA 3OKKB 4QO1B 5IV2A 4FFWC 4NP4L 1EHLL 4NN5C 5BW7A 3SCMB 3V9EA 3S3BB 7FABL 4N2AA 4JW3A 3TV3H 4YNYA 3WXWL 4WV1C 3LQZB 4KHTH 4H5SB 4HWBA 5SX4I 4G8EA 1IBHA 1IVTA 2C4FT 2DD8L 2YPVH 4ZTEA 1I85A 3HE6D 2BDNH 1WTLA 4K7PX 2VXTL 2RQEA 4Q2ZA 1ZVSB 2FH6A 5I6PA 1RJCA 1WUZA 3ULVL 3JZ7A 4Y5YC 2IOMA 3UGEA 3VACA 3H3PH 4JFEA 3REWB 3V0GA 2AK4E 4K7PL 4ADIA 1EGJA 1SPDA 3U1PA 3GXFA 2WINA 1A14H 3LRMA 1ZXQA 3BVDB 1AZZC 1RZ8A 3GLAA 4XP6H 5DUPH 5A7EA 3GIZH 5IBLD 4OF5A 1HCVA 3TEYA 3JVFC 3PGFL 2ZWZA 4O51A 5GS0H 4R84A 1YPZE 5D7IA 4M5YL 2M26A 2LLNA 3B9AA 3ZRCC 5T3ZH 2O5YH 2ATPB 5CZVL 2EDXA 3ECUA 4TPRL 4P23B 2XX0A 3OAYH 3SE4C 3B7YA 4PRPE 4PJ9D 2GITB 4P2QB 2FIRT 3RILA 3S3DB 3FSWA 2APBA 2BP0A 1AQDA 1BZ9A 1UOKA 2IAMD 3QG7L 4Y4HB 2IH1A 5DK3A 2GBAA 2NY2D 2HFEA 3IMSA 2VKXA 1DUZA 2XVGA 5EZOL 4B60A 1CN4A 4A2MA 3BIAX 2VWEC 3G6AB 2ZD0A 3GJEA 3T77A 3D6GA 3NZ8B 4QXWA 1F90H 3UTZB 2WC7A 5DRWB 3KE0A 5J6HA 4MJ5B 1PFCA 2YD5A 3KPSE 3UG4A 2EIBA 4URKA 1BIIB 2HFGL 1RSFA 1O6SA 5CLZA 3QEQE 2F7OA 5FYLH 3T1FB 1OP3H 1FVDB 1NCTA 5CR1A 4B9FA 4ZAKB 2FJHA 1XSJA 5ISZD 1INDL 3H9HA 4WO4D 4HZ1A 4P5MB 5DJ6B 1XGTA 3QIBC 3D25A 1QFWI 1LP9A 2EZ0D 1J8HD 1EAOA 1YN7A 1QSFB 3VSQA 5DWUL 2CWRA 1X5ZA 3EYUH 4LGRB 5IQ7H 4KKRA 3CH1A 2CDEA 2QDVA 4ZMZA 5G2NA 5I5IA 5IP4A 3LQAC 3FT2B 1OF0A 4YPGA 3E0GA 1F6AA 5GJSH 2XLLA 3V4LA 4TLKA 1UZGA 5GIRA 1YMMB 3MROA 4AM0Q 4Z7WB 4K9EL 4WTZG 3B9EA 3ZU8A 3EHBD 1H8SA 3D7PA 3NCJH 1ACXA 3NJXA 5HHXL 2Q3AA 1R1CA 5GGUA 3HFFA 4WNQB 4WHTA 4EAEA 3AAZB 5D7HA 5T3XH 2Y5TA 5EU4A 5FB8A 3BPCA 3LS5H 3QQDA 4HLZH 1NSNH 4XMUA 1A7QH 1T5XA 5DJDA 3G6JB 5JIIA 1CD8A 5K1JA 3KBHE 2R0LH 2PWEA 4N85A 5AZEH 4JX0A 1QEWA 1ET8A 4G6ML 3T8XB 3ELQA 1A47A 1FNSL 5E5MB 5FF6B 3DXAD 4RZCA 1VEPA 2OSLA 1CFTB 4TULH 1YUHB 2G9HB 4YDNA 1OALA 3MX0B 3RTQB 3M7OA 1NCOA 1KTKE 4OFYD 2DKMA 5DTFB 1BQ5A 2Q20A 2J8UE 1EV2E 2W1NA 2W80C 2BVYA 3JUZA 4JM2F 4O02L 5BMFL 2GFBB 1D5BA 1OHQA 1ZHLA 4MA1C 4MFHA 2NYKA 3ULSA 1W0VA 1FDLH 4JFWA 1H5BB 1ZJAA 5TGBA 1CXKA 3RVWD 3F85A 3EYOA 4QMEA 5LN4A 1YNTF 1PG7W 1I8LC 2X53A 2WOBA 5CIPA 1WV7T 4LQ1A 2E59A 5EIIG 3CC5A 3Q9QA 4QJ5B 3QIUC 4JKMA 5JQ6L 4GG6A 1MAMH 1J9RA 1MCOL 5DVOA 3IDUA 4YXHH 5CZXC 5CZKA 2WNGA 3GBNH 3KLKA 4HBQA 1KY7A 2O61A 4F7CA 4XP4L 4XXDA 1V27A 5D5MB 4IKJA 4UTBH 5C0BE 1GAFH 1IEAB 1UEYA 3VFUB 5J1TC 4IU2B 2GJZB 3BGFB 1PZ3A 2YO3A 4AUJA 3A21A 3BAIA 5JTWA 3JBG7 1SLWA 4JMNA 1TJGH 5DD5L 4MHHG 4HIHA 1DJYA 3RWJA 4Y7MA 5ALBL 3SQBB 3VGDA 5EU5A 3OLGA 4IBVA 3C5ZC 4DN3H 5CGMA 1SJEA 4ETQB 4C83B 5D7LE 5D1ZA 4XGZA 2ENSA 1MREL 3ZX1A 4J3OD 4KRLB 3HE6B 3BAYA 4QOKD 2K3TA 5CZRA 3I2CH 5EO9B 4BE5A 5JW4N 4H4NA 1TQSA 3CZGA 2X12A 3LV3A 1RUKH 1NGWB 1DTUA 1XO8A 4HAGA 4H13C 4PJGE 1M9WA 4X8JA 4NQEA 5HHOD 1VEOA 1CG9B 2X6MA 4HEPG 1D2PA 4QXVA 3IN2A 5L4FA 3HHSB 1UQSB 1ZA6A 4HJ0C 3NIDE 4J8RB 5KBPA 4ZO7A 4OBRA 5FOJA 4FRWA 5CINH 2MJWA 4HKXA 3KJ6L 5GSRA 4AQEB 1SXCA 4EE2A 4NSKB 4C57C 2LU7A 5KYWA 1R33A 3X3GL 3W38A 35C8L 1J9CT 2Q7NA 4PJ9B 1HQ4B 1MELA 4X0KA 2HLFD 3VFNA 4LCCA 1HFUA 3WFHB 4RGMB 2NY2B 3BOVA 3E3QC 4P4RA 1YA5A 3FU8A 5INDA 5EBMA 3MVSA 2XDHA 3T4YB 3CHOA 4ZXBC 2OL3B 3SBRA 4GXUN 4QWWD 5DZPA 5A2BA 3Q44A 3KYNA 3AG4B 3GSVB 3UBHA 2JQZA 2N7BA 2OK0L 3BW9A 2V5RA 4ZBJA 1E4JA 3UABA 1AGEA 4KI1A 1NCCH 1L0QA 3X11A 4LAJH 2ADIB 1JXGA 3ML8A 1UWGL 1GMIA 5FW6A 3VMPA 3KEHA 1X4XA 4ZUSA 4Y2DD 1IEBA 3BI9X 1MLBA 4G9DB 2E0PA 2QSCL 4WO4B 4XH2B 3VRJB 4ELKA 4MDRA 5I5MA 3UC0L 5K9QG 5IMMA 1OT4A 3MLWH 4XZUA 4QHKJ 3E2HB 3PFUA 1J8HB 4U1JA 2Y06L 3RI5K 1QLEH 1UWXK 2R1YB 3GDBA 4XBMA 3SGKC 2PTTB 4KKBC 5DFAA 1UOVA 4PJFF 3OGCA 3KXFA 4Q52A 4W9HC 1XR8A 5EIQA 3MCYA 1Y1UA 1QSEA 2FQDA 2YN3A 3MNVA 2WBKA 1LNUB 3FU3A 4IRJD 5D1XB 4APXB 5KN5B 3EHBB 4Y5VC 2I60H 2X0VA 1O9WA 2BCMA 5B1BB 2QKSA 2FWUA 2Q5BA 4GQPH 3HI5H 5KSBF 1WO2A 1JOIA 2WXOA 3A3YB 3NMEA 4HU2A 1PTZA 4JVPA 4OQTH 4ELMF 3ULVC 4BFBD 5G4MA 4QTIL 1IAMA 3IFNH 5IVXF 5CCKH 3D9AL 4OLWH 1T1XB 5DS2A 2AJ3B 3QH3A 4ZD3L 3DPBA 4E9WA 2UZIH 3LKSA 5L2KE 2Q87A 4AIEA 4YHMH 1EMTL 3LD8C 1DDHB 1U58B 4NN6C 1Q72L 5CJQH 3HC3L 3K91A 1MI5A 4OCRL 3DXAB 4X6CE 1AXTH 3SQRA 2ZG3A 4RAHA 5EORH 4F2FA 1P1ZA 1ZVHA 5HI3C 1DN0A 2LT9A 3V4VH 1ORSA 4UI2A 4K73A 1IC0A 4JS7A 1H15B 5GGRB 3H6JA 3WEMA 1FI8C 2Q7YB 5E99L 1V8HA 1CICC 1NM9A 4OF7A 5CJBA 3BZ4B 1WJ3A 3W0WD 3TNNA 5CU5A 2R29H 3G3LA 1PG7X 3TTSA 5F7DB 3VI4A 4A6YH 4Z3JA 4I9XA 3AT9A 4P2RA 4JCWA 1UXWA 2NNAB 1LJMA 1JUFA 3LNFA 3TWCH 1I53A 1PG7L 4LO9A 3G6DL 2FSEB 2RCSL 3M88A 3INOA 4FADA 3ARGD 4KTEL 4GUQA 2FRGP 3CLWA 4GAGL 2G5BB 3C6SA 3DX7B 3FU7B 1KYOJ 1JFQL 3EAKA 3SD5A 1IQDB 1QG3A 1TQVA 1UGNA 1O9ZA 4AQZA 1DQDH 1TFPA 4YR6B 3S37H 2X9XA 3WN6A 2YK1L 4CDGC 2BP8A 1IM3A 3T4AB 3ISWA 8FABA 5BXFB 3CFBB 2X38A 1EZUA 3R4DA 2Z0BA 2IPTL 2UUDH 1T89C 3EJJX 2WZ5A 2N3JA 3N42B 3FW6A 2FUQA 4LCUA 3FFCA 4HH9A 5F88A 4KNTA 1BJ1H 4L4JA 3O4LD 5BUPA 4P5RA 4JFPB 2EKSB 5FYJH 3UC2A 4BUHA 1XGYL 1DVUA 4XO5A 2ZUVA 1KY6A 4QHKI 3O9WB 1AZVA 3UP1A 3SJVE 4K8RL 2PPFA 4PRHD 3EOAB 2EINB 3GMQB 1X5YA 1NL0L 4ZPVB 1TG8A 1IBDA 1E9QA 1PMYA 2GKIA 3CIQA 4R7NB 2X6CA 4XNUL 3VQLA 4K9EC 4UQAA 1KFAL 1CU4H 1FNHA 2I7SA 3F64A 1ETA1 4L8CB 3QRBA 4JB9L 5J5EA 5F3BA 2J55A 2PR4L 3OJDA 3ZGIA 2MCPH 1WITA 5HHOB 2CDFB 4J3OG 4AE0A 3RJDA 1GSKA 2OSWA 3PL6D 4GSRA 1Z3GH 4UM9D 4X9GA 3MBED 2XQYK 2ADFL 1G7LA 4JZJB 4D8PB 5IEKA 5GRJL 4P4KC 3D18A 5EUKB 2A9NH 3FMGL 1A8JH 2E4FA 1ZLUK 4YGVA 3ZDXF 5I6OA 3BGAA 4L8SB 5SX5K 4Q9QH 1J5CA 2CRIA 3HN3A 4V2BA 5ACLA 1JPFB 4HOXA 4LSTH 4E5XA 3MRRB 4RIRB 5AB9A 1JCVA 2W9EH 2X4NB 2F58L 3F7QA 5G5DA 5JPNB 4JNXA 5IESL 2P1YA 4G70B 4YSTA 2D8KA 4PCTA 1JZ2A 1NBZB 5JNYB 4KKNA 4QHMB 3T1WA 2GW5A 3GK8H 1SN5A 1RLBA 3WNPA 5T5FL 3LZLA 2WUCH 3TYGH 3GYRA 4ICWA 1DQQB 3DX3A 1XF2B 4L29A 2E7BA 1H6EA 1KCSH 1MUJB 2VDNH 4KTYA 5DJ0A 4XNAA 2C1PA 1J05A 1NLDL 2VMJA 3JWNE 2A6JB 1KIRA 3QJFB 5FO9A 1BX2B 3D08A 2X9ZA 2XZZA 3SDXF 1TFHA 1Q8MA 4Y2DB 3TNMA 1N64L 1NFDA 1IBFA 1XT5A 2CO1A 4YC2C 4NENA 4V33A 3WNKA 1IBZA 1IX2A 2HN7A 1X5LA 5AZ2H 2EDTA 1NGZB 3ILPA 4OD1H 4PGBA 5FYJD 2V7NB 4TNFA 2H8PB 2Z91A 3GPSA 2DLGA 3I50H 2AXHA 2JKSA 3OXSB 43C9A 4JO8A 4J4PC 5I17A 2NZIA 2DH2A 3FZUC 4FKEA 3EDDA 1X5GA 5EUOE 1FFNB 1OP9A 4C4KT 1HHJB 5DHVH 5AKSA 3HHRB 3Q2VA 1CDIA 1E5ZA 5A1AA 32C2A 5L0QB 5GRVK 3TZVD 1BSIA 4W9FC 1ZLVH 4ZO8A 3RIAK 4WI0B 4IRJB 5HD8C 3L1OL 5HDQH 3DIFB 1A0QH 5F7EH 3QHZL 1TQTA 2TRYA 4XO3A 2YARA 4P2OA 4ODWA 4AJWA 3KW7A 3S2AA 2XN9A 1BFOA 3UXFA 3B8YA 4FQJL 4F37F 2P80A 2WHVA 5AYQA 3NP3A 3TU6A 1KPVA 1QP1A 1URZA 3MGOB 2C9XA 3VXTB 4FMFA 1GC1C 3CNKA 2CJUL 5D7JD 1BZ8A 3RPIB 1OAKH 3JVGA 3GGWA 4L37A 5K1NA 1FL6A 1X7SA 2F2HA 2WCPA 4WHYH 3EO9L 4WWKA 3IDIB 1EEUA 5JORB 2VZUA 4X7DC 1NBQA 3HR5A 3RWGA 1TTGA 2VLRD 3O41B 3D09A 3PHOA 3TJHD 5EDXA 2X4RB 4EBQH 4NWUH 3GINA 1QX1A 1AOHA 2AQ3A 4UIMB 2BNUA 5DD6A 2O5ZL 5FWRA 3MBXH 4MAUL 1YYCA 4OZFA 3W0WB 4FYQA 3HKFA 4N8VB 4OLUL 1L0PA 3U82B 4XOBA 1Z32X 3CWGA 3SSGA 1KDJA 4DH2A 1AFVL 2H9GA 3MLYH 1BG1A 3QPQD 4FYRA 1DCEA 2JCCA 5MP6H 3GSUB 1GJIA 1Q0YH 2CBQA 3C2AH 4JKPL 2FX9H 4GW5B 3BDYH 1QA9B 4N8VG 3MQIA 3U0WH 1IGTA 2A2QT 2QHRH 2XV0A 2EYSA 3QFDA 3V4PB 2XPYA 3ZYOA 1KLGB 5JR1H 1AD9B 4P5SA 1E6OH 5I8KH 2XRAH 3GFUA 1BZQK 2PYFA 3GZQA 2H6PB 1BREA 1XHHA 1AKJA 1U8OB 3O4LB 5TFSL 5TF0A 3IGLA 5EF0A 4KMTH 4ZUVA 3ZRFC 1KIUA 3FNKA 4DKEL 1NEZA 4O2CB 4OD3L 1J1PL 2GK0A 3FRUA 4LARL 4S1QL 4YSEA 4M7KH 1GZQA 1Z3RA 3P4NA 4LLDA 4AMXA 3PYCA 1OGAE 4P3WA 4W6XB 4ZUWA 4FXKB 1V55B 3C6LC 4Y1TA 2EH7L 4WKZA 1NDMA 5ITBL 3KNBA 3LEVL 4UNTA 3M45A 3WFBL 5EU3A 1OARH 5A2AA 3K2IA 4DW2L 4QRFA 5HPMA 5KSVA 4C54A 1NGYA 3H9SE 4JL1A 1IFRA 4X6DA 5GGQL 3PL6B 4OJDH 2HYMA 1TJXA 2WP3O 3O8XD 3MBEB 1YEKH 3V4VB 1U8KA 3PGCA 1NMAL 2WLNA 4PGCB 5FK9B 4AQ8A 43CAA 5AW0B 4I2XE 4F1SA 2TSAA 4KI5E 1R5VA 1IT9L 3MACH 2AABH 2PYED 2Y7LA 5ESAA 4OFQA 3CXDL 3QRGH 5JA8B 3BX7C 2DJSA 4BWWA 1G7PA 2WO4A 2ID5A 4PRDA 4HG4J 1S3KL 3LB6D 4PB9H 2P42B 5F7HA 5E6UB 4EQ2A 1XMEB 1U42A 4AQOA 2ZKXA 4MA8L 3QXVA 4OIIH 4O2FB 5F93C 4ORGB 4PGJA 2WXHA 5IVOA 3CX5J 4PCYA 1CGTA 2K45A 1NJ9B 2IFFH 3SODB 5C0ND 1U8NA 5ABAA 4MMYA 4BHUA 4D7BA 2XXMB 5I0YA 4ZSOB 1E4KC 1U3HA 2AXGB 4MX7B 5EOTB 5BVPL 4FNLL 1DQMH 1OCOB 5DQ9B 4IU3A 4OGAD 4ZFOL 2HKAA 4EUPG 1CFBA 4LSQH 1TZHA 3VG9C 1KTLA 4ZUTB 4Z3GA 2XKNA 3MU3A 2OR9L 5IUSA 3QXDB 3KWVA 4PJBB 1V10A 1VENA 3CN2A 3ZTEA 1T0NB 4OFKA 4KVCL 4PW3A 4RFNB 1BIHA 4MA3A 4YAQB 1CFMA 2E8ZA 1A1NB 3GBLA 5DJAB 3KDMB 3V52L 1GPOL 5CJXC 1YG9A 4UOW1 1OAYL 2VN5A 5EOQL 1TKWB 4JRXD 4EI0A 3BPOC 5C0IA 3OPZH 5L7XL 4LLWB 4NZFA 3C87A 4H0LC 2X09A 4TMPA 4YN3A 3TZVB 3D69B 3FCSA 3NCYP 1IM9D 4ZMPA 3CDGA 4K8RC 4X98B 1G5GA 3RWHA 5KUKA 4L18A 1U8IB 1MLCA 3L3GB 3GSOB 2YUWA 4XPBH 1G9NH 3II1A 1JZ5A 3L5JA 4XHJD 1JNHA 1YVLA 2R4SH 3LN5B 2Q76B 4OGZA 4CVWA 4KWUA 3MRFA 4K7FB 4FS0A 4QHLA 4U4BA 1EZLA 1MIEH 1RFDL 5DJ2A 2MCAA 3P2BA 2BSCA 3R06B 4MJID 4NOFA 5D7JB 3ROOA 3UCRA 1WF5A 2X1OA 5ICXA 4XMPH 1NCDL 4N0UB 2OXGB 3QK0A 3QYNA 4AG4H 2BPBA 1L0YA 5EZIL 2JTDA 1MN4A 1U92A 1CFVH 4HFUH 1I8IB 4UMGA 4Z0XA 3U2IA 4YIQA 5HXMA 3OKDA 2J5LC 5D7IF 1TU2A 3X1BA 1J1XH 2VLRB 4LBAA 1S7WB 3GTVA 1UA6L 3IBEA 2H26B 2WVVB 4G1EB 3OD3A 1PY0A 3UPRB 3TYFB 4NDMB 1D5ZA 5TH2A 4JANB 3LN4A 3OAUL 3TEXA 3SEPA 3HE7A 1ZT1A 3SIKA 4YZFE 3ALPA 3U4KA 2R0WL 3BP6A 4FTVD 2XG5A 3HB3D 1RURL 3NAAH 2AV1B 1F3DJ 5KZCD 3QXWA 4PLOB 1TJHH 3L4YA 1GIGL 4EXPX 2VO8A 1ID5I 5C07A 1QFHA 4AYFA 3HAEH 4Z7VA 4XAWH 3FTXA 2LFGA 4KNUA 1ZSDA 1CT8A 2W60B 2BS8A 2WNWA 2NY5C 3S3JA 2J8OA 3SDYL 1UKQA 4U6HA 2HLEB 5H8DA 1MCLA 4AIZA 1IC7H 1CR9L 3FQUA 3IPEA 3FTGB 5C0JA 5I19H 1TZIB 5ID0B 5KANI 5KYUB 4BDVB 4CKQA 1E9PA 5IT2L 5DHVB 1QYGH 2GYSA 3AWFA 3DRQA 2D7PA 2FX8L 6TAAA 2B39A 4IGBD 1LP9F 4UT9A 4MJ4A 4RGND 2OMTB 4J6IA 3KW8A 2YD2A 1NCNA 3VXRA 4JM2D 3DBXB 1ZXKA 3ZPDA 1N6VA 3DDGA 3LRHA 3OTTA 4PGEB 3VXNB 5KTEL 5IMLB 1BAGA 4M62L 2YEQA 3QEHA 1KT2B 4MMZC 1T04A 3WKNA 3IMVA 3MLVH 5CAYB 4I1PA 5KAQG 3TCTA 3CPUA 4CC4C 1T3FA 2FZ3B 2YHGA 3DX2A 4KJYA 4TTGA 3MCG1 3WDHA 1JZ4A 5D2LA 2B9AA 4OUUA 5I2IA 3M7FB 5J3HD 4NQXA 4QRPD 2VCOA 3MN8A 4PJCB 2G3NA 3H2WA 4PJDF 3L5XL 4H25A 5SWZE 4LEEA 3JWNC 4FFYL 4PGZA 4BFEA 5DMKB 3LX9A 3OSVA 4G7VH 4HPOL 2IOOA 5B1JA 3TPUB 5DD3L 3CFEA 4NPYA 4XCEB 1BXVA 3O8XB 3SE3C 5JPMC 4XN4A 1IC5H 2CRMA 2UXVA 4G8IB 3M8OH 1DJZA 1JF1A 3RAJH 3STBA 1IE5A 3EYFB 3AREA 2NX5A 1DFBL 5AUMB 2RFXA 3RWIA 3S88L 1IGIH 3BUBA 2A74B 2PYEB 3DV4B 3FU6A 4NO5A 3CGTA 3TT3L 1JXFA 1E3ZA 1INEH 1F97A 1I1YB 3PF2A 3VA2C 4AVKA 3O2WH 3UBXI 4PYGA 4HBCL 3KL0A 1K2DA 3VGAB 2HRHA 1JXDA 3QG6B 5EC1B 5DQDH 1OP5H 3Q05A 3OZ9L 1Q9WB 2YD3A 1HQRA 1FA4A 4Y16A 3AS1A 2XKUA 2BIQA 2R69L 1S7RA 3CHPA 3TLRA 1S7UA 1JF5A 4Z0BH 1PPIA 1V3LA 5ERWB 3WIAA 3O2DA 1UM6H 4YXKH 1PIGA 3OF6D 4YMPA 4R7DB 1MJJA 1JYWA 4GG6F 3PWJA 2Z7UA 3MJ9L 2CRZA 4JHAL 3Q8AA 2XPGB 1H3TA 3UZQA 5KG9B 4LVNC 3FK3A 4O9HL 1C1EL 3S34L 1GTFA 1HH9B 4MZIA 1J8RA 5KBMA 4ZMOA 4JDZB 1U8HB 2FNWA 2YSSB 3QWQB 5J6GB 3VFRA 5KJRL 1FF5A 3V2AR 2CNZA 4FZEL 2FJFA 4B41A 2AQTA 4BFGA 3AQDA 1WWBX 4PY7B 4HJUA 5H2BB 2H2SD 4WKXA 4JRXB 5DK2A 5IOPB 3BT2H 2UY6B 3I6GB 4LVHB 5H94B 4QRRD 4Z7OF 4OW6A 3ECVA 2FQGA 3KWWA 1IM9B 1KCKA 2XWJA 2HT4C 3OHXC 1A7RL 1PKQB 2WXNA 2NUPA 3LHAA 2K8QA 5HHVL 4JQVC 2R2BA 4L8DA 3IVKB 3K2UL 4HIXH 3IS0X 4NCC2 4OSUH 4QRAA 1IL1B 4JJHA 1C12A 5PAZA 2GTZA 5D2NB 3GI9H 2FEEL 2EDNA 3S9DB 2C3HA 2VXVL 4CN1A 4XCYA 2YQ2A 3CVIH 3BZFB 4Z8FH 2WBJA 1GTNA 1S5IH 3Q9PA 2F15A 4OLXL 3BE1L 3ZW3A 5D8JL 1KCUL 3OKMB 2ZKHL 3NJHA 4S1RH 4XBGA 2X89D 4GRWF 1PLAA 1XEDA 5JZ7D 1JWUA 2DQJH 3D4YA 1PYWB 3IRPX 3C9NB 1I1AD 3QR1A 2EO1A 1M7DA 3QBTB 1ES0A 3R8BB 4KJWD 4WU7A 3BYYA 1DANU 1HC1A 3GSQB 2CGYA 2EVFA 2G75A 3MREB 4IMLA 1C5BH 4OR1A 4Z3HA 2EE0A 1M2VA 3RPBA 2QZQA 3FB5A 6FABH 5IKCA 2XQYA 2AJXH 1Z5LA 2BC4B 4FTVB 4JRYE 3WTUA 2HFFA 4EKJA 2HT2D 4WZ9A 3HB3B 5DRZA 2HRPH 2JCWA 2AXFB 5IREA 2CO2A 1RIUL 3ARBD 3WNNA 5KZCB 3ZKXB 3HR6A 5L2JA 3MLXL 2OJEA 3C09C 1LK3L 2VLKE 3S8GB 4BFFA 4AL8H 1HI6B 3ROLA 2WXIA 3OR7A 4L4TA 2JLLA 3HVDA 1TITA 3KMDA 2X2IA 1R19A 3OXRB 4NBZB 3CFMA 1KYDA 2DMGA 2K7PA 3B83A 1DSYA 3HG2A 1ONQA 1T2QH 4M48H 4U1HB 1X5KA 5E94A 3APDA 4NS0A 3T2QA 3QDGE 2JI3A 1NH6A 2GJ6D 1AIFB 2I07B 2GQHA 2J6EA 4JG9A 5LGHL 1KELL 4WK4B 1JNNL 3DMMA 4IGBB 3TH3T 1NLBL 1YY9D 5F71A 4W6YB 4RGNB 1G9MH 1I7TA 2X28A 4F15B 4K55A 1E4XH 5IF0B 3CQFA 4JM2B 5LCVL 3QUYD 1B4LA 3K7UA 3GXUB 5GZNA 2VJ0A 1S7XB 2IPUG 4EN3A 4XTRC 4F92B 3RHWF 1N3NB 4OGXH 1ADQA 1W8OA 1DZ0A 3D0AA 1S46A 1YNTB 1ET7A 1MFVA 1QFPA 1Z5HA 3R4RA 2TRHA 1MKFA 1NA8A 4LBEA 4X5XB 3NCFB 4QRPB 1FO0L 4FNSA 5DHMC 4MNGA 2OMXB 3UTTD 4U6XB 5IMKA 1OAZH 1L9SA