5B1CA

Crystal structure of den4 ed3 mutant with l387i
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
101
Chain Sequence
b'SGMSYTMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKVVGRIISSTPLAENTNSVTNIELEPPFGDSYIVIGVGNSALTIHWFRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope protein E
publication title Modeling and experimental assessment of a buried Leu-Ile mutation in dengue envelope domain III
pubmed doi rcsb
source organism Dengue virus 4 dominica/814669/1981
molecule tags Immune system
total genus 14
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5b1cA00
1ZTXE 3J2PA 5GZNA 1Z3RA 3J27A 3G7TA 5B1CA 2GG1A 3C5XA 4GT0A 4FFZA 2JV6A 5LBVA 4GSXA 3VTTA 1TG8A 3UZVA 5AAWC 3UZQB 4UT6A 3N44F 2H0PA 2R29A 2JSFA 3N41F 4X42A 2HG0A 5KVGE 4UTCA 1Z66A 4ALAC 3MUUA 3N42F 5GZOA 1OK8A 1S6NA 1SVBA 5AAMC 5IREA 1URZA 4FFYA 5KVEE 3UYPB 2ALAA 2P5PA 3UAJA 5IZ7A 4UTBA 5JHLA 3N43F 3UZEC 3N40F 4UTAA 1UZGA 4BZ2A 4UT9A 3WE1A 5KVFE 1PJWA 1RERA 2JQMA 2R69A 2V33A 4L5FE 5KVDE 5H37A 5LCVA 2I69A 1OKEA 1OANA 5LBSA 3IRCA 4AM0Q 5JHMA 4FG0A 4BZ1A 3P54A 3C6EA 4AL8C
chains in the Genus database with same CATH superfamily
5TH2A 4AYID 4PBDA 5GZNA 3RG1C 4F2ME 5J1SC 1IBDA 2UY7B 3G3LA 1P6AB 5EBMB 4R3SB 3GMRB 3O4LB 5T1KA 5I1JH 3EH1A 4M1DL 1XIWA 5HD8D 1MY5A 1XO8A 5EOQL 4G1EA 2QGEA 3P2TA 3ETSA 4Q6IA 3E9UA 1FH5L 4YDKL 1N3NA 1UM5L 5DRNB 3F64A 1VGKB 2HVJB 5CBAB 3O45B 1BYPA 1D5RA 1DHKA 3NZSA 4L4JA 4LL9A 4GT7A 4NZUH 4N0UA 1KPVA 4B9ZA 5F0MB 3WS6C 3Q3GB 4FA8A 2YSTA 4G9FB 4H20H 5C0FB 5K1NA 2XWTA 4HVBA 1J5IA 4BCZA 3KYOA 2DQUH 4XCEA 3RVVC 4PJIF 3CPLB 4O02L 3BIKB 1J10A 1DQML 1YMHB 2EKSB 3G5XA 4IOIA 3S3BB 1ZVHA 3BVXA 2OX5A 2P8LB 3OMNB 2WAQA 4BV1A 3LQMA 2FGWH 1GS8A 2PCXA 3QUZB 1PAMA 4U7MA 4EN3D 4TUKL 2OMXA 5HYJA 4IBQA 3KPSA 1R1CA 1S8DA 2CKBL 3UJJL 1DEDA 5E56A 3LN5B 3UCRA 3W37A 3BYYA 1PY9A 1QTPA 3UBGA 3WNIA 1JK8B 1D5BB 5C0BE 2JCCF 2FYVA 1I8LC 2ZKXA 3QXVA 1Y0LA 2J43A 3BMWA 3V0GA 4MS6A 1XGYH 4IS6B 1UM6L 5J1TC 1AHMA 1UUNA 3NTCH 4ISVB 1IC7L 1L3NA 1QYGH 1YYMH 2CR3A 2JJSC 3SKUD 1A7BA 2ICES 1MSPA 2XZCH 3B9KB 3KL0A 4POUB 3N42B 5E6RB 3H56A 1T7VA 3MRFA 2BSED 5FB8B 4PGEA 4JFZH 4P5TA 3DMMD 5GRUL 4OCXL 2FTAA 5K1JA 3QQDB 3T4AC 4RBPH 3ZIMA 3FT4B 3QUXB 1W9XA 3V5HB 4ZYKA 4NSKB 4LRIA 1J0YA 3LKNA 4QRTA 5GHWH 4LSSL 3WHXA 4N6RA 2PCFB 4ZJ9A 2BHFA 3Q2WA 2UUDH 1HCZA 1WA0X 1P4IH 3ARGA 1D9KD 2F54E 5K9OB 3B8SA 4U0QB 3UTSA 3K6DA 3SPGA 1I1AB 2Z8RA 4K9EL 1HC1A 3B8YA 1GGCH 1M6UA 5CKGA 2OSWA 1AO7D 4FYTA 1Q4NX 1QASA 4PAZA 1S7TB 3QPQC 4OUUA 2O5XH 4PB9L 2YGPA 1YEFH 4ETQA 1DFXA 3EH5B 3PAYA 2D31B 4X6BB 1JTTA 3SB3A 4FQXC 4C57C 2FQGA 2WV3A 3CPUA 1HSBB 1HINL 5EFIA 3JVFC 3HE7A 3HI1B 4I87A 5E5RB 1R19A 4FHJA 1NBVH 2JTDA 5FCUH 1K5NA 1YECH 5DJXA 4ZUTB 1IC5L 1U93A 2Z3FA 3DYPA 2EUZA 1FG2B 3IBEA 1SHSA 5J89A 1U6AL 4ZMWA 2IH3A 3N0PB 3PNRB 4WHYG 5L2KA 4G9DA 5HDQH 4TRPL 2CJUL 4IHOA 4IOFD 1F2QA 1ZWIA 3RTQC 3O41B 4LSVL 5D1ZD 4GRMB 3KPLB 2E74C 4IIQB 1EHKB 1ZA3A 4PVLA 2VDQH 1A6TB 2VR4A 3FTGA 4CC4C 5LO7A 1CDIA 3H4HA 4X4KA 4BZ2H 4WI9A 3IFOB 2EH8H 4BK8A 4MD0B 5F7AA 1FAIH 1TYJA 4XZUB 3X3GH 3NCYS 5EN2B 2MTAA 5TQ0L 1YEIH 4ZS7H 5BO1H 3GRGA 1DBAH 2WUBL 4Y4HD 5J9PA 2L7UA 3UP1A 4Z95L 1PLAA 3HN5A 1DBKL 1KGXA 3KYKH 1AQDB 2ZXDA 3IDGA 4PVMA 3WO3B 1E40A 3BUDA 2UZPA 3LQAH 2DL2A 2YEZA 4XVTL 1RZKH 1W0YT 3HG1B 1IBHA 1FJ1A 2XQYA 3L2MA 5IK3B 4PIBA 4F7PA 3H9SA 4R90L 2YRPA 1USQA 3OBAA 4ACPA 2V5MA 4G6AC 3S48A 2BVQB 4PR5B 5F1KC 4BK5C 3QUYA 4M7KH 4OD1H 4Y19B 4PJ9C 3HRZB 4Y9GA 5E00B 1ETZB 3A67L 1I1YB 2G5BA 3TJHC 4ZFGH 4OW6A 4H2AA 3VXNA 3SOTA 3BPLC 3VFMB 4UQ3B 1V3KA 3MAWA 5E1IA 3VXRD 4LPXA 3AQYA 3A6BL 2ZONA 4BFEA 2ZKMX 3LQZB 4AQEA 3K81A 3QORB 4H8WH 3UIZA 3QWOA 4PRBA 3RZCC 1JBJA 3O6FB 5DK3A 2D3NA 1EZUA 2ENPA 3T2NH 4MVBD 1C8PA 1G87A 4ONHB 4ODVH 1AO7E 4HUUB 5KJRH 3RWJA 1HKFA 1OAKL 4HQQH 5H37A 3MV8D 5GSVA 2IAAC 3BVWA 3LKOA 4Y4FC 3ARFC 4I88A 4MA8L 5FGCE 3TBBA 5J1AB 5H2BA 4IRJB 2BFVL 1ERNA 3IU4H 3CBRA 4JDVA 5TDPA 3GSQA 3QIWA 2A9DA 3UTOA 4YSAA 2MTPA 2VSDA 3NDYE 2WLLA 4HGKC 3CQQA 4UIMA 2LTQB 2PPCA 3MLVH 3P11L 4XBPB 5F7FA 1KLGA 2P28B 2B8OT 1YEKL 3L5XH 4OGXH 3FQWA 5GS0L 2EXYD 1ONQA 2Q2LA 5KSVB 1CI3M 3GSNA 1J9RA 2BP3A 4Z7WF 4LFHG 1G7HB 3W11D 4OJFL 4CKQA 2CO3A 3HAEB 3IJEA 2Q86A 1KYOJ 1YPZB 2E9WA 3PHAA 5CJ8A 2PW1A 2AQNA 4NYLB 2OP4L 2Y6SC 3VFTB 2ZP8A 5FFGA 1X9RA 5I6LA 5ACZA 1BIHA 4C83B 1RPKA 2D0FA 4OTXL 4K3JL 2JQZA 3EFFA 3TNMA 4E9SA 2C8NA 3VRLF 3R06A 4KTGA 3QZOA 1YNTB 5KYYB 9PCYA 4LK4A 4OGAD 5E1GA 1IJNA 3AMLA 1J18A 2WTRA 4YDVA 4YXLH 3VRIB 1KPUB 4PJGF 1NLDH 3HPJA 4EF3A 3FUEA 2PWEA 4PY8J 4R8WL 4UDTA 3VFNB 5D7LB 2DH2A 2P45B 2MRYA 2Z35B 1MOEA 3KH4A 3VVVA 3WO4C 4Q52A 2ENJA 5ETUB 3S36L 3VFGL 1E8XA 1WGOA 3SHSA 3C5ZA 3CV5A 1MWAA 2JKLA 1NAML 2YD6A 4MNGE 2YPVL 4N2CA 2R0LH 1IX2A 1RURH 3FU5A 1ECYA 1KG0A 2WZ6A 4FLQA 3E1ZA 4WNQB 3IPBA 2FWLB 2ERJB 4JHAH 2O6PA 2XDHA 4IRSA 4HT1H 3V6ZB 5FF6A 1F4YL 2CLVA 3EBIA 2VLKB 2V5YA 4C47A 1RJLB 2J4WL 3NCMA 1KCLA 5D7JD 4FN0A 3VXRE 3HHRB 5D4JA 8FABA 5B21A 3LMJH 4Y8DC 2VMJA 3LEVH 1C12B 4PJAA 1F4HA 4ZOEA 2XVBA 1UGNA 1KCVH 1M2OA 3LIZA 1LD9B 5DJ0A 4E0RB 1PSKL 3MJ8B 3MNMA 4ZMVA 4U31A 4POYA 2Y07H 4XCCH 1CMOA 1FSKC 2NR6D 2X28A 2IH8A 2JI3A 1TT6A 3B9DA 1U8HB 1OAQL 2ZX5A 5EB9A 3MV8E 5DJ6A 2A5UA 3SCMC 4DZ8A 4M7JL 2IWEA 4MAUL 3SDAB 2MOVA 3GRWL 4DP9X 5AKVA 1MHCB 5DZPA 4Q6KA 5IOPB 3PHSA 5LCVL 2LLLA 2XTJD 1HOEA 4DVRL 4E5XA 4JL1A 2ICWJ 4LASH 4RAUA 5B22A 4HJ1A 4N9OB 3EYQD 3FCGA 4MYPA 1NA8A 4LLWB 5EZLA 1B9ZA 4RFOL 1S7SA 5KSUB 4K3DH 2GEQA 4KXZH 1U3YA 1YEGL 1MREL 1OM3L 3V7MA 2V5SA 1GS6X 3QC5X 5CHNA 4XBEL 4CW1B 3CLFH 1MW0A 2BS9A 4BKLA 3DVGA 1NIBA 1H3WM 3T3PE 4Z7QE 4UQ2A 1AY1L 3JVGC 4O9HH 1NM4A 3CU1A 1GYCA 2VDLL 4LIQL 2YA2A 3SDXE 1NKGA 3AREA 1ET7A 4F58L 1PLBA 2BVUA 4U1SA 4WO4B 4XWOD 5CCHE 2R2BB 1CXIA 4X7SL 2OSLB 5EIIB 3ARRA 4KX8A 3GM8A 2B5IB 4B6ZA 2JB6B 4AVJA 3QCTH 3C60B 1A7NH 3L4XA 3HPLA 1VIWA 2YXVA 3D4GA 1JZ8A 2LGNA 4IGBB 5T3XL 4DIXA 2W80C 1O6SA 1S78C 2UY6B 3BSZA 4HK0A 4Z0BL 2J8UB 3UDWA 1ZEAH 2J2ZB 2Z65C 3CFKB 4KKAC 4KK6C 2EDQA 3PWPD 4OZGF 4MZRA 3RJOA 5HYSG 3U6XS 3BGMA 3KPMB 1JXDA 1NGYB 2A3TA 4OCRL 1DVUA 1OK8A 2MOQA 2JJTA 3O4OC 3MRDB 5C0RH 6CGTA 5LXVA 2OL3L 3BZ4B 4CN6A 5DJCB 2WLYA 2QPDB 2HLEB 5AUMA 3VGDA 3RB7A 1A4JA 1A3QA 4AYMC 4HETA 3MV7D 4PG9A 3OXRB 4NN5B 3ZLQC 1TQWA 1B9KA 1RHHB 2UYLB 4QHMB 2VC2L 4FZ8H 3S6CA 2JELL 3HHSA 5I8OL 1YEJL 4LLMB 1E7VA 4ELMA 1BCIA 2YWZA 3GHBH 3WKMH 1P9MC 1SHXA 4YHNB 3OKYA 5AL8A 1SYVB 2Q7NA 1TUPA 3GO1H 3RPIA 1OAZH 1TVHB 5EORL 5I8CA 1FFOB 4EUPA 3TBWB 2XTJE 3B2PA 3MODL 2ESVB 5EZJB 2ZNXA 2VE6A 1AE6H 5GGTH 5JA8B 1BZEA 1WZAA 1RL1A 1LO3H 1QFWL 3L3IB 2GUOB 2IOIA 2A4ZA 2B4CL 2ZD0A 4PQXA 4YXHH 1AIFB 2GTZA 4AH2A 1OPGH 2BHUA 3BD4A 3T0AA 5FIEA 2ZOKA 1HU8A 4AGMA 3QI9C 4ZUVA 4FQLL 2DKUA 4QTHA 3SKNB 4A2FA 4J7RA 4L5FL 4QHLB 1IAKA 3HZ3A 1OKEA 3P4OB 5B39A 3VG9C 4WWNA 3NFSH 3DECA 1KJ3L 4OLEA 1Z9MA 2ED9A 4NRZB 4P2OC 4Y2LA 5MENA 4HV8B 4HAGA 4KKCC 4H8VA 2RFXB 1KELH 4PCKA 4W9CC 5FYKH 4BSWB 3V4VB 4AL8C 1NC2D 3U1QA 3O2WH 3CFBA 1U0QA 3JWDC 3SE3C 4Z7VF 1OF2B 4N1CA 5AG8A 3EJPA 3CHRA 1DJSA 4MYWB 1A65A 1SHWA 3ARDB 3GHEH 4Y4KA 2CA4A 2ICCA 3PHQB 3BP6A 5KSAD 2F74A 4BDVA 1NCBH 2NY2D 5JXED 1HH6B 1QO3B 4O02A 5B3NA 3BPNC 5D2NB 4U3HA 3F05A 4YHKH 1I9JH 3PV7A 4GLRI 1F02I 1SXSA 1C7TA 5CINL 5EV7A 4MD5A 4UCFA 4F7TB 3P9LB 3UPAA 2AJXH 1DQDL 3PWPE 4DVBA 1JWMB 5DQDL 1Q9KA 3EOTH 4Y2DA 3F84A 1UKQA 2R4SH 5TDOA 4YDLB 5FWRA 1G7MA 4HK3J 2CKBA 1BIIB 1QRKA 3QISA 1CICB 3DO7A 3PS6A 4G80A 1WIUA 2EDRA 2RGSA 3TT1H 1AGBB 3APDA 1MN4A 5MERA 2D4FA 5FFOA 3MLRH 4GAGH 1MJUH 5KEZA 3QA3B 3F58H 1A6ZB 4NUPA 5AW5B 3PWNB 1T0PB 5IHUH 4L4TB 3K0WA 3MV7E 2ICEA 3IS0X 4Y9CA 1YUKB 5HYJB 1BOGB 4ABQA 3GSVB 3T6QC 4FQIL 4NN6C 1KNOA 2FHBA 4YDMA 1KWKA 4FFZH 1AC0A 5FK9A 1UXMA 1XBDA 3QG7L 1C5BL 1ZS8A 4XOAA 1BQKA 4GMTL 4HMCA 4CU7A 4K5MA 2VDRL 3DX6A 3E7JA 1LK3L 2XFXA 2X88A 3V0WH 3MGOA 4M8QB 1GTFA 2FBRA 3UZEC 3QZWG 2GY7B 3BC9A 3MRFB 1HHKB 1IKFL 4Z7WB 5B8CC 4WJKB 1SLXA 5I16A 1PZ2A 1QUNA 1CC3A 1BXVA 3GSOB 5BV7C 1BVNT 4M8VA 3FO9A 4KQ3H 3ZHFA 4AG4H 4MTMA 2Y72A 2BSSA 3WY2A 5T1MB 3P0VL 4FNRA 1I8IB 1OVZA 2BNRB 3ARGB 2F7IA 4PRHB 4ZTEA 4TQHA 2B2XL 5KTEL 1IEHA 4N25A 4M62H 3MCKB 3UTSB 3THML 5ISZD 4PJGB 5HDLA 2ZNWA 3ZE0B 2WWKT 2N01B 3NJVA 3GI9H 3RBGA 1IAIL 1PYWA 1AAJA 4U2ZA 3W5NA 4PU2A 3NJHA 3HNVH 1S5IH 1YYML 3MGTA 3KWVA 4IEFB 1JHKH 2EYSB 3ZVVA 4KC3B 3GMLA 3OB8A 1HSAA 3I6GA 4AITA 1J05A 1JI2A 2Z8SA 3D39A 3TOPA 1K72A 2FRGP 3G6DH 4NQCA 2YN5A 3BVVA 4AK1A 4WJG3 4MJHA 4GRLC 2ZCHH 1CN4A 3MFGB 5C0EA 2VZOA 3MGAA 4K7PY 4ZUWB 1T1YB 1X5GA 2FD6H 4JQVC 4R26L 4IBVA 4Y5YB 3H7BB 2WB1A 3HI6L 3V5DB 5IJDC 2FR4A 1HWGB 1QHPA 4PLNC 4JG9A 1IM3D 4WTWA 3QNYB 4TQIA 1GYWA 1FPTH 2O5XL 3FAWA 4RVBA 5KVGE 5IM7B 1AI1L 3EYOB 4HDIA 3L45A 4YGVB 4NQSA 3NPZB 3TZVB 2IFFL 5DVOA 1BMWA 5EA0H 5DZNA 4YLCA 3ZY7A 2EDTA 3FZUD 4B96A 3F7PC 1FNEB 2YEZB 5G4OA 4GMSL 5DJ2B 3UO1H 1YECL 2WK2A 4IBZA 1FJ1B 3EOBA 3HG5A 3IE9A 3VI3A 4KWUA 3PGDB 3B6SA 1PDKA 5I71C 2Y4SA 1U42A 3QDJA 5FO2A 3MLSH 3F5WA 4YSSA 4RNRA 2GSMB 1QLEB 3O6MH 4IU3B 3LRSB 3II2A 1HHHB 1UB5A 1QFOA 3KPOB 5T1LD 1AJ7H 1U41A 4UINH 4JHWH 4DEPB 3ZZSA 2ZXCA 1PKQE 2I24N 4TLKA 3SQOL 4PJFA 2EH8L 3SGKA 3OLGA 1JGEA 1KPRA 1E28B 2EE0A 2GTWA 1FAIL 4WU5A 4XXDB 4NN7C 4PRBB 4JM4L 2YBGA 3B83A 3HC4L 5BO1L 1CDYA 1QBBA 5KVFE 5ISZE 4MX7A 2JFCA 4ZI8A 2ATAA 3SE6A 1S9YB 3ZL4H 1T5XA 3V0AC 5DC2A 1NCWL 5IUCA 1HHIB 3ZYOA 3LQAL 4HAFA 4NO2B 1LO4L 4Z77A 3FUDA 4RAVA 4UDUB 4GXUN 3WTVA 3TIDB 4PIRF 4GY4A 2J6EH 3NJJA 3LKOB 4E9YA 4MB3A 5K93A 2VLRA 2ZF8A 1JCVA 1AXSA 2VN6A 3WDJA 2Y36H 3QIWB 4P2QA 4OD1L 4H13C 4DUWA 4BGDA 6PCYA 4JY5L 4PJ8C 3TO2B 1UYWH 2OR8A 1AR1D 4GG6E 5J12B 2PYED 1Z3RA 4K73A 4JFPA 1T0NB 5B1JA 3UGUA 3O0RL 3QNXB 5G4NA 3KLAA 3RWGB 4OLYH 3CHPA 4OI8A 4LEOB 1WD8A 2EEXA 3VX0A 1CT8B 4JO3L 1UZ6F 3VRJB 3T2NL 1RJZB 4PLKC 4ODVL 3ZSTA 5C71A 4HSQA 3GMMB 5KJRL 3OG6B 4Q9CA 1UJ3B 5ES4B 5EO9B 3QDAA 3VB8A 1RY7B 1A7OH 4HXAH 2Q7YA 3HPJB 2YPVA 2D9QB 4OZIF 1G9NL 5KZCD 1KTRL 4OZ4A 3HG3A 4FLSA 2HJKA 3IU4L 4N2IA 5CEXA 2OMUB 2JSFA 1U8PA 3V4LA 1CGUA 3GUFA 3T65B 1UD5A 4M5ZL 3QEGH 2FDBP 3CVHH 1CR9L 3QUMH 1JHTA 4XP9H 4YZFE 1T6BX 3UTQB 4DTGH 3QHZH 5C08B 3HTLX 4F9LA 3DOSB 3ZDWA 3DVNA 3SPJA 1D2PA 3F7RA 4OSUH 4YZWA 5EZIH 2YMXH 2VM9A 3ESOA 1YEEH 1G6RH 3RWCA 4MCYB 1ID5I 2VMFA 4XNAA 1QP1A 2YEVB 5ANME 1VACA 3MRLB 4ZMTA 3QC6X 1H5BC 2G2RB 4XHJD 3FKUS 2FJHA 4JDEA 3S0PA 3MMEA 2V3EA 4L9LB 2XU9A 3SBPA 3ESPA 5IOKA 3IGKA 1F97A 3FFCA 3UFIA 1JFQH 1ECZA 2V9TA 3RGVC 4PJAB 3GRWA 3WIAA 3D4YA 3JTBA 2ED6A 3CFUA 5T3ZH 1MRFH 4L0PB 1P7HL 3NRQA 4JEGB 5HHMD 2NY4D 2QSTA 5I5JA 5AALA 2FIKB 2DM2A 2ZICA 4KOBA 1NBZA 3FXIC 5A2KH 3IN0A 3VE0B 3O11B 3C5JA 5DC9B 4I7ZC 4WQOA 1CG9B 4X98B 3BN9D 2CDGA 5I1CL 2A9ML 2IBZY 3CMOL 1X5FA 4LCWB 4ZW6A 2IDTA 3QEHA 3AB0C 5AWNH 1RUKH 2XQ0A 2R0LL 5DSCA 3M17A 1R3JA 4OCSL 3WIFA 1G7JB 3II3A 4JHAL 3IKCA 5EC2B 1E5YA 3H9HB 1F8TL 1KEML 3FSVA 3WNMA 3AS1A 3VFVA 4E41B 2GCYB 2ARWA 2CBQA 2DYPA 2PYEE 3MJ9L 3DJSA 2D7PA 3T1FB 2HFFA 1Q9WA 5F88A 4N87A 4QOKD 4I3RL 4HUXA 4B7LA 3SY6A 2XIIA 4A7SA 2WQRA 2NYKA 3JWNC 4MAYA 1KCVL 3FRUB 3KM1A 1OZTG 2WB7A 2X9XA 2A6IB 5FFLA 5FECA 2DQFA 2QR0A 2Y2WA 4MB5A 1U3ZA 3M7FB 4ACTA 3H0TA 4R0LA 5JDJA 3G7TA 1ACCA 4L8CA 2YQ3A 4WW2C 1GW0A 2OPCA 2WGNB 2A73A 2BS71 1FZOA 3Q9QA 4HKBA 4KXCA 1NBQA 3U6XA 4WENB 3EH2A 1UUSA 3WKNA 2WYIA 5F7MC 1NTDA 3D69B 2YPKB 1BBJB 3B2XA 1CL7L 1T1ZA 2AXFA 5C9JA 4QWWD 1BM3L 5DEFB 3MO1B 3FOLA 3GBLA 3KPRB 2CMRH 2FX7L 4NOBA 3ULVC 5IWLC 5DS8A 1DE4A 3TBYA 1CFQA 4YHPB 1ZV2A 5TE6H 2K45A 4Y7MA 1AXTH 5LQBH 3ABMB 3AY4A 3IDMA 3BGMB 5EU7E 5EU5B 2EVIA 2TSBA 3VI4E 2N0KA 4AGNA 4O9HL 4R7LA 4BK4A 4ZFFB 3WNOA 2CLRA 3A3YB 4ZTPL 4WZ9A 4KXBA 4OI9A 2NTFB 2MHAA 2WUCL 1J9SA 3RU8L 3RWFA 2PLTA 1PCSA 1OE2A 1K6QH 2B1AL 1A4JB 2CWRA 2NY7H 2J3SA 3H54A 2D7TH 1NKOA 2VMCA 3DBXA 2OFQA 3IJ7A 1MCEA 2XKNB 5EUKA 1HYSD 3LZFL 4AZUA 3H3BC 3HZYB 5IREA 2COVD 4W9ZA 1FRGH 3HHSB 3OSVA 5HHME 4X9BA 5ANHA 1R5WA 2FSEB 4MBRA 3TGXA 3AS3A 1BREA 5HBBA 1YC7A 1INEL 3UO8B 3S5LA 32C2A 3RWEB 3U4BH 4ZX4A 1DBJL 2AQSA 2PTTB 2NSQA 3L3HB 4PTTB 3DRTA 1F1GA 3UPCA 1HXMA 4YAQB 1ZEAL 4PBVC 3ISRA 2F19H 3RUGE 4EUPB 4YHLL 2E9IA 3GZKA 5HYQB 5I73C 1A4AA 4K23H 5GZNC 1JG9A 1JF5A 2YQ2A 4WY7H 4R2GC 3U83A 5MEOA 2PF6A 5C07B 4PJ6A 1PJWA 3IXAA 1RERA 1V7NL 4MA1C 4AQAA 2I7OA 4TLUA 1XIWC 1WICA 3MV9D 1RAMA 2ZOKB 2YD4A 3BSHA 4NC1E 5KOMC 5HGBA 2BC4A 3NSYA 2E7HA 3O9WA 4GXVL 3VFPA 4HJEA 1I53A 3NZHL 4Q6IC 2MIZA 2IPKA 2WWOA 3P4NA 4Y5XB 4QOKE 2P5WB 3WLBA 3MUGA 1YYCA 1EGJL 1O5DT 4PSRA 4TNVK 4KU1A 3OJ2C 2XWDA 2Y9RT 4KKBC 1XZ0A 1FZJB 1PEZA 2EZ0C 2QPSA 3GHBL 3WKML 1MHHA 1WZLA 1NIFA 1PJ9A 3TN0D 12E8H 5ADOH 5JHDB 4HC1L 1W0VA 2IAMB 1ED3A 1WAAA 3GF8A 5JDSA 3O3DB 4U05A 5JOFA 4JM2F 4GW4A 4X6CA 1D3CA 5TDNA 3GO1L 4TTDC 2CO7A 1NC4B 4ZFZA 1OAZL 4KFZC 3OG4B 1H8NA 5FYLD 4N2KA 1AE6L 4BKTC 1IC0A 3FB5A 1SDAB 4PJXA 4D9LH 2EYRB 3CFNA 4YXHL 2CGZA 4W4OA 1TEGA 5K59E 3VWKD 2IJ0C 4K2UL 2QKSA 1F3DJ 1M4KA 5DRWB 1F11A 1KY7A 1BJMA 1UWXH 2DDQH 4ZAKA 3HB3D 1SJEB 1BBDH 5MP6L 5AEAA 5I66B 1WRFA 5FCSH 1S7VB 4V33A 1RZQA 3U82B 5LNDA 1SUHA 4DN3L 3NFSL 1NUFA 1T5WB 1MCIA 5GRJL 1NZRA 4X42A 4MQTB 1EH9A 1KELL 4JFOA 5FYKL 2I7SA 3F2LA 1G6VK 3GZQA 1FZMA 5L7XH 1GTNA 3TO4B 1UADC 1GGBH 2AABL 4KQ4L 4AYGA 2YWYA 1ZT7B 2XA3A 4P5TC 5FOJA 4E9VA 3SBQA 3V8CA 4OF5A 2VDNL 3QEUA 5FK9B 4DNLA 3GJEA 1XD0A 2XN9D 1AH1A 5JPNA 4H26A 4H5SB 1RK0B 4IBUA 4LRIC 1A7PH 2W81C 4CL7A 1NDGB 5KG9A 2GC7C 2VSCA 4PRPA 4QT5A 4XCYA 1PGRB 2J57A 4TOYL 4YHKL 2CIIA 3MGOB 4R7DB 2Q6WA 2OMVA 3MJ7B 3T8XA 2ZPKL 1JDCA 4YBQC 3UAJA 2AJXL 2L8AA 5DMJB 1IEBB 1AG6A 1QLFB 3EOTL 4N2DA 1KB5L 2QQLH 5I16B 4O58L 3TT1L 2XICA 3MV9E 4WWKA 2HT2C 5F9JB 3MRKA 2XWRA 1G0XA 3KPNB 3X1FA 4WFGD 1SY6L 3INUH 4H4NA 1MPAL 3H53A 3HE7C 4LEXL 4ORZC 4RESB 2NY5L 3QZWB 3UIYA 1JPST 1NGXB 2YOCA 3EHBD 5ID0B 1OF0A 1BLIA 2VIRB 3DROA 3IETA 2ICWB 1XWVA 2XN2A 4FNQA 4GRWF 1HQ4A 2CKNA 4HH9A 4EIUA 2AI0H 1RZ8B 1HH9B 1QSEA 2F68X 1MFNA 2C5DC 1PYWB 2NW3A 4ZQKB 4PJEA 1ILSA 1NCCH 5AVYB 3SYPA 1BZDA 4U1JB 4EI6B 4PJBA 4W6YB 1EEQA 4TV3A 1J5OL 2ZTBA 4WEUD 1UFUA 3S88H 3U9PH 3WBDA 5FYLE 3IDIA 4X6DA 5KN5A 2CO2A 3G6AA 3BUBA 3ILDA 4XBMA 3G04A 3QHFH 3NIGE 2E7LC 2EIZB 1R24A 5JPMB 2M1KA 4RISH 2C3WA 3BIAX 4ILDA 4Z7NB 3OAUL 1AMXA 4IMLA 4FXKA 4PN6A 2VW7A 5DLLA 3O4LD 4KO6A 1VAHA 2IH9A 3U0TA 4OFDA 1JZ3A 3MJWA 4L29A 4UUJB 5SX5H 4EZKA 4M62L 2XZAH 3G6JA 4ZO6A 1ACZA 1JN6A 4WU7B 2DWXA 3UERA 4DOHB 4KTYA 1L6PA 3CZUB 4N8CH 4NXKA 2FL5B 1P5VA 3UZVA 1LVEA 1ZTXH 1RZIA 2QSVA 3CZGA 3VQ2C 4QXUL 4O4YH 1SJXA 3QUYC 1RXLA 1MFCL 2DKSA 2OMTA 1KIRA 2N56A 3WJMB 2X40A 3TH2T 4X5PA 5L6YH 2E6PA 3VDCA 2XN9E 1BQRA 2J71A 3K6NA 1T21B 2KDGA 4K8RC 3K71A 1OB1A 4XRCA 5GJSL 2AJSH 4U1GC 4H0HB 2F58L 2ZWNA 1BM7A 1G9HA 1UATA 1O7VA 2J25A 3EJJX 1ZT4A 4P49A 3G6DL 5KSBF 2BNQD 2P5ED 2DLIA 1T1XB 2Y06L 5L0QB 1VESA 5F9OL 1ZHKA 3QS3A 1WZKA 4M48H 2ZCHL 1WTGT 3OF6D 3QUZD 4WHYH 1NSNL 5A6LA 4PGBA 2ZYHA 3ZQWA 2TRHA 5I30H 5GPRA 1OHZA 3REWA 3B2VL 2J1XA 4I89A 4JQXA 1BD2D 5AZUA 4AE1A 4KZ0A 4WFGE 3D0AA 4QNPE 1JGEB 1KSRA 1DLHB 4KPHH 1YMMA 1LDPH 2WWKO 3SN6N 2XVKA 3FFOA 3FO1B 5T1DL 2CUHA 4Y0GA 3JWNG 2JI1A 4P06A 4WTQA 4GPVA 4W9LC 4PHXA 3P4MA 3QCVH 4CBZA 1RIVH 5DVKA 3B9KD 1H3TA 5IF0A 2NNCA 4M4RB 4GSDL 4LSPH 1NCOA 2NUPB 4IRZH 1MLCA 2A83A 4EI5B 3AGVA 2XA8L 2J5LB 3QUXD 2BVOA 2IBGA 3GD1C 2W1NA 3E8UL 2VLRB 3V0IA 1AXSB 3MLSL 3MBWB 3NJXA 5KBKA 4HJ0D 1G7QB 2CGRH 4N8VA 1SOQA 1AQMA 1KENH 3OKEB 4UU9A 3HLKA 1L3WA 5D6CA 5DA4A 4BUGA 4ZX3A 5BNXD 1A6PA 1E9OA 1QNIA 5AW9B 3LKQB 5HJ3A 3EJRA 1WP6A 4X4YA 1T04B 3O4LE 4QHKJ 4U6XA 5I26A 3US0A 4XX1E 3K74B 1FNGB 4OJCA 3FUIA 4P5RA 1JPEA 4KI1A 2ZOLB 5DQ9B 1KYAA 3UC2A 1MCOH 4TSBL 5AVWB 3TX4A 3C5ZC 1Z9OA 1F42A 4QRAA 2OCFD 3CD4A 2FZ3A 1IGFH 2X4OA 4M5TA 4TULH 5I6XB 3TU6A 5DC4B 4Z8FL 1K4DB 4P46B 2HZHA 1I9EA 4HLJA 3KLHC 4EXKA 1PX8A 4L8BA 3DETD 3S4SA 2J1ZA 4ZT1A 5TGBA 4AV0A 1KJMB 2ZSVA 3SJVA 3GS0A 2HJKB 4IRSC 2DV6A 3UC0L 5CEXB 4A2GA 1BAFH 4D8PA 4P3DA 3BVDB 2IALB 2ZXBA 4WGKA 1JGLL 3QEQA 1Z9LA 4YWGL 4U33A 5IROC 4ZSOB 1A9VA 5IMKA 4ZRGA 5I8EA 1CFNA 3PDOB 2BNQE 2DS4A 4X0KB 2P5EE 3RP1A 2HTLD 2WJ5A 1DQKA 1RU9L 4OKDA 2HJFA 3VYPA 3MLUH 3ZKXB 2X4PA 3NJGA 4UOW0 3VXQA 3AG1B 5I6KA 3MRMB 1MFAL 15C8H 2QPFA 4RFNB 1NM9A 1A5FH 5CEYA 2H32B 2ILLA 1BD2E 4QRPB 3OM3B 1VFOA 1LP9F 3DX8B 4J4PA 2I9TA 1LL1A 3KWWA 2ZQKA 3P9MA 4NZRH 3RA7L 1HESA 3PLYA 4R7XA 3FQTA 2GSGA 1U2YA 5EEUA 3HG1D 4J3VA 2F7RA 3AT9A 4JM2B 4WJ5B 4MZ3A 1UWEL 3GSUA 2R2EA 2R39A 1S2EA 3GSXA 1E9QA 1NBZB 3GXUB 4M9OA 3QEGL 4EZMA 1WIOA 5TF0A 1M3IA 3QQ9D 4Y19D 5CIPB 4CVXB 4DTGL 2DQ6A 3MJ9A 3KDPB 4M9PA 2BP0B 1U9KA 3VGAB 3GHPA 6TAAA 4F93B 1Q1JH 4LOUD 2DLGA 2HKAA 5D7IA 1WH0A 2YMXL 5DJAB 1UGKA 3HI5L 2BVPA 1YEEL 3AREC 2BXYA 1L7TH 3CSPA 3QZBA 4XN9A 4GG8B 3QORD 2YD5A 3FK3A 2VABB 5FA3A 5L8LB 3FQXA 1VERA 2GPZA 3O6FD 43C9A 2DYPB 5AOJA 1I1CA 2RBLA 1Q9WB 3NAAH 5F88B 5BQ7A 4L23A 4Q7DA 3OKMA 3B7YA 4CVWA 1AZVA 2YK1L 4KHXH 4KY1H 4F8PA 5IMMB 4UMGA 1M57B 4Y7OC 1EO7A 2DMHA 3QT2A 2PW2B 1KTKE 2KS0A 1IFHL 4M6OL 1YNLL 4TQEH 3VGHA 3UDWC 4IRJD 1JFHA 4UQBA 4KJPD 1KYUA 2JF1A 2MNUA 3E3QE 5AB0A 2WBJB 1XB8A 3PQYD 3ZKMC 3IMVA 1QFUL 3AU1A 2MEJB 5AWNL 2JJTC 3TNNA 1D7DA 4LCCB 1RUKL 2BS8A 2BSDA 1CD1B 1CXKA 4JY4B 3T4YB 1T1ZB 4FF9A 2AXFB 4I77L 4BELD 2PP7A 4PP2A 3EDEA 3ILQD 1WJ3A 4YJZL 5IFAL 4GO8A 5E0QA 4ANXA 3MRCA 1NMBH 1CFQB 3BVUA 3EJQA 2CK0L 3HOGA 5DI8A 1IQWH 5M95B 2F0CA 1UURA 2HLAB 4C56B 3GI8H 3IKKA 1G0YR 2C1OA 1NDMB 1L6ZA 4L37B 4JFDB 2Y3AA 4ZMAT 3U2IA 4ZS6C 3ECUA 1NCTA 1Q72H 3S7GA 2Y7NA 3WELA 4UV7H 4WW2F 4NHCL 5AB2A 3DTDA 2HJLA 5DK0A 2C9SA 4N2BA 1JRHH 5ABDE 3F6IA 4LOEA 1TU2B 2V17L 3ML9A 3TEYA 3LIUA 1RULH 3ROOA 4AUYA 2DLEA 2A4EA 4N26A 4OM0H 1N8ZA 3HG1E 4J2XA 2VDPH 3HG2A 2NYYD 4HGWA 2BCKA 3KXFA 5T3ZD 3HS0A 1YA5A 1R3IL 1R3KB 4OT1L 3HRPA 2UZXA 2WCGA 2FSDA 4NO0D 2MJWA 2VXVH 5BOPA 4XMTA 1MNUL 2GFBA 4Y19E 3EZJB 3DJZA 4MQSB 3DRTB 1QQDA 3UJTL 1HXMB 4ZD3H 4PJHA 1PTZA 2V2WA 4FQHA 2VLKD 1AXTL 4PP1C 2WKLA 2OCJA 1BVKA 3IS1X 3LS4H 1EZLA 1EGJA 3CLWA 1EWHA 4MMXA 4XVSH 4NKOB 4QJ4B 4MCNA 2DRUA 2PPEA 4GQQA 1WZMA 3KWUA 5EU4A 4G6KL 4NNYB 3HN3A 1Z5LA 3VFPB 4DKEH 2YA1A 4OQTA 4HC1A 5FYJD 4JG1H 3BAXA 1CDUA 4KK9D 3VH8A 5AD0B 4Y4KC 4JJOA 4X7CC 3OLDA 4PLOB 5AYQA 2IPUK 1WBZB 5C0CD 1L5GB 3SDAD 2MCMA 1XZ0B 2G9HB 3QO0A 2MQCA 4EQ2A 1A14H 2I69A 1BFOB 4GBXA 3NJLA 5HPMA 4Y2DC 2HTKC 3PQYE 3US1A 4BFRA 5TDNB 2NCMA 1I85A 4X6CB 1A21A 1M6OA 4FQ2L 3UPRA 1KTDA 3BE1H 3GMNB 3MRNA 3Q6FB 1ZLEA 4F7MA 1CBJA 3GBNH 3T8MA 3F65A 4IBLT 4JZJA 4KK5C 5E24E 2CNZA 4K0OA 1F4AA 1YPZE 3BFQG 1M7DA 2WWMC 1HZKA 4XMKH 1OTSC 2CO6A 4BCXA 1DANU 2ICEC 4YFLI 1EZVX 3BWAB 4ZAKB 2IBBA 2J7LA 3K6OA 5IBLC 1D5IH 7TAAA 3CWGA 1EZVY 4WO4D 3GSWA 3T77B 2X2IA 3CXHJ 3MZTA 1W72H 4KROD 3D0VA 4J8QA 1IAIM 2DEYX 2G30A 3QJFB 3VU1A 2PP9A 5H37G 2LFEA 5FOBA 3QG6B 4OFYA 3C60D 5IT2L 3JUYA 1FZMB 5C3LD 3W2DH 4Y1TA 5IB1A 2R1XB 3KDMA 4N3UA 3D7PA 3OPZH 4XE0A 1X9LA 3D1MC 1Z5HA 2C7FA 3BX7C 1U8MA 4HJIA 2PXYB 4K9EC 2K9FB 2GITB 2Q3ZA 1DO5A 5T3ZE 5AOKA 1IE4A 1KB9K 3CSGA 3Q8CA 5IVXA 1U8KB 5AW1B 1RK1A 3ULUL 1WBYB 4G82A 4PRPB 5DMIL 3BCDA 5E23A 3WIIH 4WI8A 3OJDA 5ERWA 3LYRA 5AVUB 1JV5B 2OMVB 1EVUA 3MNWA 2A6JB 4BQ8A 4ZW5A 1SY6A 3ZGIA 2VLKE 3V6FA 5HYFA 3U9UA 4P9HC 1XL4A 4X7DC 1NL0H 1DLFL 1XH2A 5FUCE 1HL4A 3TYGH 1MH5A 3V55A 3WUWG 1JXKA 3CUPA 2BP8A 3HC3L 1S9WB 3FU6A 1CD0A 4LHUA 4UOQA 2W9DL 4X5XA 4DO6A 4PWEA 4S0TD 1A2YB 4AVHA 1OCOB 3F7VA 1B0IA 1N0XL 3K2UH 1A0QH 5F7EH 5FYJE 5AVZB 1VFMA 3WSQH 5L7XL 1GGBL 2C9VA 4LSDA 4QRUB 5D4QA 1I7RA 2XY2A 3CLEL 2AVFA 3MFFB 5C0CE 1FC1A 4ECNA 2ODHA 5HI5C 1QSEB 3QWQB 2ESVD 1PLGL 2R0KH 1UCBL 4MS8C 4FJZA 2JKRM 1PG7L 1AXIB 2ITCA 3B9EA 4PJBB 3OAYK 4AGQA 4PJIE 4NZTH 3T1WA 2N3JA 5B1KA 3B7SA 1DQIA 1LK2A 3HFMH 4F2MA 4DPCX 3VWJD 3FQRA 2COQA 5KN5B 3TA3B 2D03L 2CO1A 3BH9A 3G04B 4N0FB 3NJNA 1ZMYA 2HFGH 4BH8A 1YRKA 5AVSB 2VLLA 1GYUA 3VGEA 2B16A 1NFIA 3F12B 2UWEB 4KJQC 4M93B 3C8HA 2PUQT 4JGUA 4R7NB 1L9QA 2GIXA 4HMEA 1MLBB 3GBDA 5I1IL 1LP9B 3IJHA 1J88A 2JCCE 1BVNP 3INOA 4JO1L 3KPPA 2XJLA 3ARBC 4ANVA 3WI9A 1NICA 2NT1A 3G6JB 4W81A 2P26A 2VT0A 2DBLH 4QPEA 3WYRA 2Z31A 1ASOA 1OP9A 2Q3AA 1DQLL 1JPFA 2KPNA 1OQXA 1DO6A 3FT2A 5K69A 1AP2A 4RGOH 2HX8A 1GXEA 3CG8A 1AFVH 5CEZL 5F0PB 2J8UE 2Z8WC 1MHPL 5DD1H 2IDUA 3BESR 1VFAA 4GP5B 3GM0A 2FUTA 3JT0A 4QF1A 2EIDA 2KBGA 3M46A 3QHFL 1RUMH 3SGKC 5AZEL 1CICD 3CHQA 1S7UB 2X05A 3BPOC 4Y1AB 2WXIA 5DD0L 4IQHA 1HQRA 3DURA 1X4ZA 4LGPB 4LKCB 3B43A 1A6VH 3MLXH 3TA4D 3N06B 3WS3B 2CPUA 3MXWH 1Z9NA 2YD3A 4ODHH 4U6YB 1AKJB 1WCQA 3LNDA 1G7IA 3F00A 4QR7A 3VFWB 4L4TD 4PGBB 4UNVA 2FLBT 4U1NA 3I3DA 5A16A 2YUWA 3VCLA 1A8JH 2HWZL 3V4PA 2JWYA 4HAKA 5GS0C 3LCYA 3BXNA 5J6SA 3G08B 4ZTOH 1KLUB 2ZUQC 3CDGB 3BUIA 1URIA 3JTTB 4HHAB 4N8CL 1ZLSH 1ESOA 1YMMB 2NY0D 1NJ9A 4B3EA 5TFSL 4J3OD 4YC2C 5EEXA 2WLIB 3R7RA 4K15A 3CFEA 2APSA 2OK0L 4X4ZA 1A25A 4OM1H 3CJJA 4S1SH 2D73A 1BVLB 4A2LA 4TQ8A 3KBEA 5IF0B 1ND0A 2ZUVA 2ESVE 4KUZH 3OAZK 4KJYA 1MLCB 3SQBA 5B1JC 1YDPA 2V0AA 3BYTA 5C3IA 1DYZA 1SMDA 1SN5A 2NPLX 4WTZA 1WUNT 5GIRA 1FDLH 2NXYC 3SPVA 4Z1PA 3GIZH 1ZGLB 4YHYC 2MKLC 2YD8A 3OLEA 4G1MA 5B4MD 4S1QH 5CM1A 4G8EA 2ZKWA 3Q2LA 2FE0A 4PRHD 1RV6X 4WNSA 3QS2A 2WO3B 2UXFA 4HJSA 4YL4A 2H1LM 1T83A 5CF3A 4S1DC 1T6WA 3MOAH 5F3HB 4KHTH 5HJ3B 2XTLA 1A7QL 1I1RA 3D2TA 3K72A 3IFNH 4KPHL 2AGJL 4PTUA 5T5NG 1KFAH 1OAYH 1DBMH 1BZQK 1AD0A 4LT7A 3FB7A 1UXWA 4CVZA 1JZHA 5T5FL 3FQUA 3KLDA 2WLHA 1RIVL 1JZ5A 4X0NA 2E7BA 4QDGA 3U7YH 3TWCL 2DLFL 3S4SB 5TGBB 5JNYB 2ITDB 1YAIA 3QCUH 1ZLUH 2JKIS 3RDTB 4YHIB 3UYOD 2OMNA 5D71H 4AE0A 1OB0A 4LLUB 5JW4M 3FHAA 1JK9A 3H2QA 4GLRH 2YPLB 4MA3A 2Y7QA 2IOOA 2FWOA 3L3JA 5I8EB 1CFNB 1RJYA 3IJ9A 1D5MB 5B3JF 4AV5A 3MREA 1CLYH 3BAEH 1X7TA 4L4TE 5E9DD 4W70A 2E76C 4F7EB 4YDJA 1ZANH 3HR5A 1D6VH 1FVCA 5JA9A 3I84A 4MNHB 1CLOL 3TZVD 3GS4A 4LSRL 3O3EA 2FBJH 1E5ZA 2SEBA 1IGCL 3P9MB 4NENB 2NXZB 4JFEB 5EUOF 4ZMZA 2AV7A 3DMMA 7PCYA 2YD9A 5JW5A 3X17A 2NSMA 3FQTB 4GAAA 3AVEA 3KS0J 3PP3K 2ZWSA 3FU7B 3LXCA 2AMGA 3EO1B 4W68A 4FC3E 2P49B 4ZG1A 5LBSH 2WKOF 2WXNA 4WSKA 1SXZA 4Z7WE 1WYJA 2BW4A 1DL7H 3HS8A 4ONFL 5DF0A 3BWSA 2XZZA 1VZGA 1D9KA 5LDUA 3MBXH 4UT6H 2CDEB 3FQ2A 4FS0A 2WXJA 4MAYC 1ODAA 2AEIT 4G6JH 4Z9KB 3ZGHA 4BFIB 3HMXA 4NQED 1AO7A 4CMHB 2VUYA 5D1XB 3CXHK 1AHKA 4R0LC 3VRLE 5LGJA 5KYXA 1FIEA 2FEEL 4Z3FA 3IMTA 1CU4H 4PRHE 4AYDC 1A9EB 3OKKB 2VQ4A 4BKSC 4PJGE 2WM0A 2VRKA 2PPAA 1FO0B 2B3IA 2BPBA 2I60H 3GXIA 5ESQA 1CS6A 4NC0B 3VXSB 5GZOC 5KVFL 2F8XC 3RDJA 4RQQA 4U3CA 4FXGB 5DS1A 4KVNH 3N1PC 2XTSA 2VDKB 3IMUA 3C2AL 3IPEA 4S0SD 3E2HC 3U7WL 1QTYT 2BFGA 3NN8B 3LEXA 4PWFA 4AL8H 3AY4C 3TFKD 1ZT1A 1INDL 2KZBA 1WZ1H 2QADC 1KTCA 5DVLA 1EHAA 4X7TA 1NCJA 3JWDH 1ZKAA 1ZTXE 1CXFA 2AXHA 5D1ZA 4M8UA 3ALPA 4HGMA 3DVIA 5I0ZA 3FCUB 2XWBA 4R97C 3CDZB 5CZKA 4PP2B 1RLWA 3RX8A 3EGDA 4OLUL 1GKOA 4F57L 4Y4HA 5C0JB 2O72A 3LZQA 1U30A 4KJWD 1RIUL 4DPAX 1NGPH 1MRDL 4RFEA 2JIXB 5EPMA 3STLA 1E50A 5DHYB 4MLIA 1P5UA 2C1OB 4XN2A 1A3ZA 5ECGA 2QKIB 4JRFA 2B4CC 5E9DE 1RZPA 1OCCB 2KDYA 1I7TA 1JZ4A 3VAEA 4G6FD 4PGJA 4LFHD 4DGYL 1HCFX 2WZAA 4N1HB 3L7FA 1I9IL 4UM8A 4MNGA 1TTGA 1ZHNB 3NDZE 4Z0XB 3NACL 5IIEB 3PDDA 4I18B 3L3DA 2DQEH 1JMXA 5KJ7E 3K3QA 1XF3A 5FA4A 4LSQL 3ZHDA 5F9WB 5IJCC 1WWCA 3GYRA 3UABA 1YEDA 4MBOA 4NM4H 2WXHA 5DFVD 3WL9A 1RSFA 1YSOA 5IB5A 3K2IA 1ET8A 2VMEA 3RKDC 5TQ2H 3CZEA 1WCBA 2ZP9A 3VXRA 4RWYL 1SLUA 5FR3A 1YNKL 3HVDA 1RZFH 3IDNA 3O9WC 1KT2B 4QLWA 1FYTB 2YC1A 2IC2A 2ROYA 4P05A 5JIMA 3TF7C 4MJ5B 2VZ1A 4GRWH 1NMBL 5T5NF 3RE0A 3BD5A 2BSRA 2QDVA 2C1PA 5D1QA 2P43B 3ZKNC 4HWBL 5LJYH 1IQWL 1E2ZA 1FV1B 3EJSA 5AAWA 4NQEE 5DZAA 1XZWA 3P77A 3ERXA 3FFDB 3OR6B 3MV8A 2ZSWB 3Q5TA 4HIHA 4NXSA 3RI5K 1AHWB 2NY1C 4KVPA 5BV7H 1HILA 1U4FA 2WSKA 4PV9A 1CFVL 1BLNA 3DX1A 4QJ5B 3V4UL 4X5RA 4X2UA 3IMWA 5BZZA 1TJHH 4RX4D 2OBGA 3BW9B 4W4OC 4A6YA 2E7MA 3QO0B 1OTTC 2Z93A 2OSXA 2AEPH 3MTRA 5INCB 5IBUG 4OZGE 4UTAL 3TL5A 5ADPH 2AP2A 1LEGB 4ZOAA 1Q9OA 1ZPLA 3QR2A 2YAEA 1C5CL 5LB1A 3T6ZA 4E41D 3BFOA 5E6IB 3RWHB 3MPCA 1AZUA 1D2OA 1WPCA 1O7DC 4FOMA 1EEZB 1L9PA 4JZJB 2DWEB 3U7AA 3IDUA 3UEQA 4WI6A 5JHBA 3L3GA 4PI2A 3VXPA 4R4FH 1JVKA 2OKMA 4L1BA 1K2DB 4DKEL 1BFVH 4L4VB 3P69A 5HXMA 2B0SH 4JG1L 3LKPB 5JPNC 5J6HB 2VXQH 5AYUH 2QLVB 3KJ4C 5GGRY 1T6VN 1V3MA 1IAOA 2G60H 2WP3T 2X09A 3OZ9H 4ZFOB 4JO5A 2XXFA 1TQCB 1QPPA 3CC5A 4JUSA 2F7PA 1H0DA 3UAJC 4BM7A 2GJ6B 4X5WA 1DQJA 1OGSA 2NTSP 3KPRD 1UD3A 2DQIL 3MROA 3EYUL 4L3CB 2VB5A 1YUHA 1RUAL 4XNDA 3K6IA 4WWKC 3TIEA 5D7JA 3E6HB 3U30B 1KIPA 3GBNL 4LPTA 1RJCA 3EIFA 4UAOC 5DD5H 4NUQA 5AB1A 2NX5B 3N50A 2XWXA 3WAKA 4HCGA 4Z7OF 1ORSB 3WFZA 5I18H 2GK0B 2WYZA 4HXBH 4BUHA 4PY7B 2YXFA 4TLSA 2FATH 1MH5B 1Y6KR 3L6FB 4P99A 2ADFH 2CNYA 1W72L 1PD6A 3DOIA 3A4FA 3RI5F 5A43C 1EO8L 2HSIA 4Z7VE 3WEXA 1MUJA 2IMNA 3HC0B 2FWUA 4JGMA 2GKIA 3F7VB 5BO0D 4LXFA 4W9HC 3BH8B 4I48A 3OPZL 2WTPA 2CXGA 1QKZH 1I7RB 1TCMA 1KIUB 3NZ8B 3VXTA 3O2DH 4OFPA 4IDJL 4LNRA 2DIAA 1FCCA 4JPVH 2HN7A 3G5ZA 3CN4A 3M6DA 1JNNL 4PGDA 4FXKC 4HS8H 2Q8BL 3ZYIA 3T3MF 5C07D 2FO4A 3EH3B 2BY3A 1A4CA 4LPUA 3CZNA 3WTTA 4X7FC 4J1UA 1HHJA 4E41E 4ZXBC 3EFDH 3AJ7A 4FFVC 3QJTB 1N5AB 4N5EC 5KS9F 1IGTB 3TYGL 5FKPA 2P5WD 3LV3A 3WXVH 3K5RA 2VR6A 3S96B 5L2JA 1R3LB 1E6OH 2Y69B 2F5AH 4PVBA 5BVJA 3TP4A 3GMOB 1PEWA 3RVWC 4H1LB 3VX1A 3BLKA 4DFHA 1KXQE 3I9GH 4H25A 2R15A 3RBSA 4AYFA 3D6GA 3MRRA 5EUOB 5JHDD 2VQTA 4RGNB 2IAMD 3REVB 2JB5H 4NQDD 4QD2E 4FNLL 4UZUA 4AMKH 3LZLA 3UTPE 1CDHA 3L5JA 2I5YH 2XV0A 4U6HA 1P7QD 3EYFA 5DWPA 3PWPA 5E5UB 2WQAA 3O0LA 3BZEB 1GL4B 1QLRB 3PNWA 2G0LA 3HZVB 2WSPA 1A3RH 3KPRE 2FUQA 4OLWH 4LL4A 4WRLA 2BNUA 1ZGLP 2YLKA 1YQ2A 2EO7A 3N85H 3HFML 1VFAB 3MRPB 2XBTA 2EVJA 2X6AA 4GKZA 4JQXC 1UKSA 4EBQH 3I6SA 2LU3A 4O5LL 1ES0A 2R29A 2AK4B 3MV7A 3S37H 2GVYA 4JFHD 4WUUE 1OT1A 3QDHA 2HT4D 3BQUB 1HQRB 1IAII 3DURB 4K3EL 4AQ8C 1PD1A 2BMKB 4JPIA 2CLZB 1BVOA 3EBHA 1BHGA 4XPHH 3ABLB 5C0BB 3OX8B 3TPUB 1EHLH 2J21A 3V9CA 4QHNA 1DQQB 2PABA 3TO4D 4U1NB 4G6AD 3QFGA 2QBWA 4QXTA 1XTMA 2HAZA 2FNBA 3L7EA 3BXNB 2XY1A 1IGIL 4PJ9D 1QR1B 4GW5B 1TMCB 4JFXA 2OM5A 4BCYA 3DUUA 1KTJA 3PWJA 1TQBC 3NFPA 3BWUF 1CGTA 1NJ9B 1O0VA 2PO6B 3DA0A 1AFVL 1F13A 1S9VA 2RQEA 5FKAA 1XGZA 5IEKA 4A68A 1NLBH 1RFDH 3U46A 1P4UA 3RZCD 2UXTA 4EPSA 3IEAA 3KGUA 4QRFA 4QXVA 5F96H 1FVDB 4ADIA 1U8CB 5C07E 3OC5A 1H8LA 2F54B 2ZJSH 1G9NC 1HDMB 3SPVB 1AC6A 1UOKA 3GJFK 4WGWB 4L2YA 5DUML 4FAAB 1ITCA 4UILH 3NBNA 3NA9H 2Q2EB 2P5WE 3TWYA 5T5FA 1DDHB 4Y2OA 2QSQA 1SJHB 3BP7B 3MLYH 1ZLSL 3CVIH 4JFFB 3K72B 2AZAA 4Q14A 1S9XB 3QUKA 3CH1B 4AVKA 2CA3A 5JXEA 5DHXB 1P1ZB 1ZV5A 4JFQB 2N7SA 5JHDE 1N64L 2ETWA 1FG9C 3AM8A 3HZMB 4TNFA 4NQDE 3OGOE 5IHHA 5ALBL 3LPPA 3JWNH 4NQXA 2K4WA 1E90A 3CN2A 3STBA 3BAYA 1U8NA 2NCEA 3DC0A 1E4KA 1FP5A 4KUZL 3FQNB 2H47C 5CLXA 5I1AA 1WV7T 3IAQA 1CF8L 1ML0A 5I76B 2A6KA 4ODUA 4NP4L 4C4KT 1TZGL 3GIZL 1S7RB 3MLWH 3S3CB 5GS1B 4Q8BA 1E4WH 5E6UB 4MA3B 4EN3B 2Y7QB 1DBBL 3KG5A 5DS2A 3PG2A 4LLVA 2EO1A 3S37X 3QH3B 4UTBH 3ULVH 3NJFA 5DZ9A 3VVWA 5D72L 1ZHLA 2WANA 1WE5A 4APQA 1LQSR 3RZWA 1WEJH 3P9WB 5JOEA 5K9QI 3ASWA 4FFWD 5DJDB 1OAYL 3LD8C 3UBXA 3KYMA 4EZLA 1M1XB 4R96B 1G9MC 5E1AA 4I9WD 2CJSA 1A1MB 4MJJA 1S7QB 3DRQB 4BH7B 2AV7B 1NBYA 4MJ4A 2YAOA 5JW5B 3L4TA 2XWJA 3GFUA 5EULV 2EDBA 1TNNA 1GY2A 2DW5A 2CIKA 4N9GA 1QOKA 1CXHA 5CILL 3P40A 2R59A 2E56A 2GT9A 1T20B 3E38A 1JVOA 3QO1B 3P1VA 5ISZA 3QUHA 2VISA 3JV0A 1UZ6E 5JLZA 1V7MH 1XCTA 5HDBF 7FABL 4Z18A 1I8MB 3BAEL 5E5LA 3EJYD 4MQ7A 4A55A 1MIEL 2Z0UA 3MBEB 5SWZA 1JV2B 4XWGH 1CF1A 3ME0B 3K1DA 4QMEA 2A6DA 4DEUA 2HLFC 3G5VA 2FBJL 1U8OB 4EI5D 2DQCH 5JW4Q 1DVSA 2CG9X 4PFEA 1MXDA 1HEZA 2KPWA 5DLML 4GG6A 3X11A 1UXLA 1IB5A 5D8JH 1JD9A 4NPYA 1H15A 4NQVB 2IAND 4JPQA 5AB9A 3DKHA 1DSFH 4HKXA 3MHZA 4B60A 5IHLB 4OJEH 4ALAL 4XP4L 5CP3H 1OPOA 5D70H 4YHOH 5E08H 4F37F 3KYNA 4TL4A 4G6ML 5F93C 1KXTA 5ICYA 1PFOA 3NA4A 1KFGA 2H8PB 3BDBA 1JPTH 3LN4B 4MCMA 5CBEB 3QRBA 1XD1A 1C5DB 1IM3A 4KMQA 1TYRA 4PMEA 1J9CT 3L2LA 2CALA 1SEBA 5E03A 1CU4L 1ADQL 2Z92A 4Y4HB 3RVXD 3WAJA 4K7PL 2NY3B 5IMOB 2BZCA 4XP5H 3U1SL 3M1BB 4G42A 1GYAA 4X8CA 4DOHE 3D5OF 1MFDL 3HS0C 4WEBH 3DX2A 1IEAB 4KVNL 4P46D 4KKAD 3BRDA 4O2CB 4IKKA 4ONGL 2QGBA 4GUPA 4I9WE 5GGSB 2UXVA 4XNUL 5IJVB 4GKNB 1P84J 1FL3A 2DY2A 1G84A 1VENA 4XI5D 2YMOA 2WQSA 4GS7B 1E2VA 1UEMA 2Y25A 5MI0C 3Q7JA 5ANMA 3T3MB 4HWBA 4N0YH 4MMXC 4LSUL 5T1LA 4Y2NA 3SE9H 4NQUA 2WXPA 4LAQH 3RVUD 1PZAA 1F90L 3ORJA 3VXRB 4X6FA 2N7BA 4FTDA 4XB3A 3GMQA 5KS9B 2P24A 5CUSL 3SDCC 5D4HA 3ET9F 1TKWB 3S35H 1N59A 4D0BB 1G9EA 3V7AG 1O6TA 2A74B 1AOZA 2BSRB 4JCWA 2C1PB 4YX2L 2IDFA 3CDYA 1TSHA 3FDWA 4HFUH 2VLMD 4JVUA 5D7SH 4QRPD 2LQRA 2FJGA 3MLZH 4XNXL 5C92A 4DN4H 3LNEA 3IDYB 2AMUA 3DXAB 4GBXC 1FVEB 1M7IA 1X6NA 1BF5A 1A3LH 1CL7I 4HIHB 4U7KA 3PRZA 2XPZA 4JM2D 3TFBA 1I85C 3OKDA 4M1GH 3MN8A 1AKPA 4UTAA 3R4RA 4R5XA 2APWA 5DEJA 3ZTDC 5EC1A 4MWFA 4NT6A 2DQEL 4R84A 4JG0H 4TXVB 5FGRA 3ZE1F 3V95A 4L1LA 2F6AA 2ZIDA 3QSKB 1JYWA 1H8OA 1T2QH 4G3YH 1UVQB 3DSNA 4XC1H 2QFPA 2G3MA 1T0MB 4YNYA 2PYEA 3B3BA 5TQ2L 4P2OD 5EO0B 2IANE 1RZFL 2B14A 4Z7QB 2GTQA 2QVKA 4WI5A 4NX0A 3PJNA 4UQCA 1U95B 4U1MA 4N1EA 2BSTA 3SDXB 3KL5A 3TV3H 1HHGB 3N5AA 1UQSA 1QHQA 3BHBA 3KD4A 4RBPK 1VFBA 4M6AA 3EFOB 1YN6B 4X80H 1MCJA 2IH1A 3QQXA 2X4NA 4Y89A 2OQJA 5AQ0A 3RY5A 5B38A 3O2VH 3HNTL 4BHUA 5BV7L 3CX5K 3D12B 4HKZA 3UBHA 2WXLA 2MCPH 5L4MA 5HGAA 4ZUUA 3BDYH 2BOCA 3GB7A 3NPSC 4WK4B 4YBLB 5KBLA 4RGMB 3ETBJ 2NDGA 5CGYD 4YSPA 5HHVH 1AD9A 2P8MA 5SWSB 4ICWA 1ZVSA 2AJVH 3JT2A 4CC0A 1H0DB 2A7BA 5I5RA 4HZLA 1QEWA 2BY0A 4CJ0A 2G75B 1BDYA 2NY5C 5LBVA 1F4XH 2AQ3A 2AZUA 3C6SA 3VI4A 4APXA 1MI5B 1A64A 2OW7A 2HPOA 3LH2L 4N8VG 2GYSA 1LDSA 4ZSOE 3D07A 5CSZA 3TIEB 2NQDA 3L3OA 3FCTA 2DI8A 3G5YA 4C56D 3KGTA 4K8RH 3NCBB 5FDYA 1T7ZA 4JE0A 2NT0A 4WHTB 4J3BA 4JFDD 3S35X 3X1EA 25C8H 4FKKA 2OMZA 2VLME 1BSIA 4QRPE 1DFBH 1E4HA 1XQ4A 4F7CA 1MFEH 3MRGA 2QVFB 1OP5K 5E8DL 2DEWX 3JV6B 1JGDB 4L3EB 5D7HA 5FHAH 2G60L 3FONA 4AZ8A 2X1OA 4OJAA 3KLLA 5H37H 3KBFA 5GJTL 3RUGA 2CRIA 4OCLC 1JE6A 4F1SA 1R17A 3ZDXF 2X2UA 1F5WA 4XN4A 5SV3A 1LEIB 2WNWA 4ZDHA 3L1EA 3GZOA 4HCRL 4MAZA 5FUZH 3Q6GL 1JZJA 2X4QA 2K6WA 3QPXH 5DUPL 5KANI 5AYTA 4ZMYA 1N19A 1BF8A 1PS3A 2K8QA 2YBRA 3P73B 4N90D 3G5ZB 2VUOA 3MXVH 5DTFA 3GNMH 3IF1B 4TLTA 4QOKA 2IADB 2DQJL 1NAMB 2R56H 5DMGD 2QQKH 3GSNH 2Y23A 4HIIA 3RWDB 1EBAA 3NP3A 1NEZA 5FC9A 3FAXA 3QULA 2HKHL 3D3VB 1U8JA 3L16A 4J1UB 3ZBMA 1CGXA 4R4BA 5I18L 4MJ6A 3MA9H 1CTNA 5DVPA 5DHVB 2Z31C 1S7WB 5DVMA 3RY4A 3KMDA 5EF1A 2I9LA 1GYVA 1QBAA 4Q56A 2W07A 4YPGB 2O5ZH 4LCUA 1J9QA 1KLFA 1P1VA 3EJZC 5BVJB 5HGGS 3A6CL 1LJMA 5TF1H 3BGFC 2WKGA 4P59L 5LLIC 2WP3O 1QKZL 4L8DB 3WFDH 4AM0B 3FCSB 1WITA 3GEWB 3O2DL 5T33H 1NINA 4P57A 3PV6A 3VXOB 4CMMA 1H6EA 3WFHB 4DP6X 3H3PH 4XNQA 2YD2A 2BY2A 2IPTL 1MWAH 5ICZA 4Q9RH 5HDWA 3GJFB 4ZPVA 2PR4L 3NFNB 1W15A 3B9VA 4ZZFA 5EF0A 3RWIB 2C7UA 3I74A 4KAQH 4BZ1L 4BRJA 4HS3A 4C56E 3AAZB 4UIKH 1BZ7A 2BHYA 1HOCB 3MV7B 5KYWA 1EEYA 5J3HC 4JFDE 3OAZH 1Q0EA 5HGHA 2X0VA 4NQTA 4GQRA 2AXWA 3DO4A 2X1WL 3LHPH 1J7VR 5J57B 3ZQ9A 2LVCA 4PRDB 1E4XI 4JPWL 4YQXH 4GRWE 2VDLB 3V0HA 1B0RA 3LIZH 3NSFA 4AEHH 3C75A 2MMXA 2LVEA 4YE4L 4M7LH 5KVDH 2NZ9C 3KGSA 4AMKL 5IQOA 3KGRA 1IM9A 1HE7A 3L7EB 4E42A 4F2EA 2PXYD 1IL1A 2I5YL 5CZXC 4FA7B 1N7MH 3MJGX 2EQDA 5HHPA 4Z3TA 3S8WA 1OD7A 3OR7A 1IFGA 4DP0X 4I3SL 3AG4B 3A0OA 2E5EA 3FN0H 1EEUA 1WF5A 5EOCH 5GSRB 1IMHC 2FHFA 1E9PA 1QI4A 3C5SB 3MR9A 5FKAB 1I3UA 3BUYB 5HD8C 1I3GL 4XGZB 2ORBH 1MVUB 1DN0A 2XWCA 3EDDA 4R5TA 3U46B 5C6PB 2YAQA 4N90E 1R6VA 1CDCA 3PUUA 1T83C 2J88L 4EBQL 2CK2A 2AJUH 2KZKA 3E6FB 4NM8H 2JKTM 3WNJA 5DGQA 5L8JB 4AYSA 2ADIA 3LTVA 3L81A 4GUCA 1NOLA 2O5YL 4MNQD 4NZFA 4A2EA 4XMLH 4G8IB 1NC2B 2IQ9L 3FB6B 4AEIH 1NBCA 2BX5A 3D85B 2OL3B 3B5HA 3TN0A 5JR1H 5C0GA 5FYJL 3QNFA 3VTAA 1EXUB 1QWHA 5C0DB 2ZX8A 3VM5A 1P84K 2X4UB 3BPCB 3VGFA 2IWGA 2M83A 5DJYB 2VC2B 4PJ8D 2WN2A 5KSAB 1Q38A 3T0WA 3VD1A 2NY2B 4XOEA 3ZTNL 5CSBA 3K8KA 3GPEA 4RMQA 4X6EB 1LO5A 3VWKA 4DKAA 1U91B 2DTML 3EZ8A 4NQXB 1RFDL 4UMSA 4A7GA 2YXWA 5KSBE 1PU0A 3BSZH 1FFNA 1KGIA 4FDWA 4JO4H 4UOJA 2JJUA 4QYOA 1WAPA 1I1FA 3Q5OA 5E6ZA 2ZJSL 3B2MA 5CP7B 5AOZA 5EO1B 3QPKA 3SY0B 2R83A 3MLTA 4Q4EA 3I75B 4PB0H 4XCFH 1KCRH 4IOSD 3MDJA 2TAAA 3NA9L 43CAB 2L4OA 3CCHA 1BZ9B 4HWUA 5HHXH 4GQZA 5DR5H 3DMMC 3VH8G 3JTSA 2KERA 5LBGA 2WCPA 1RZ7L 2O4EA 1OP3K 3WNLA 3CVIL 5M94B 2XN9A 3MRHA 4J28A 2ZCLL 4FQJH 4N2AA 1OTUC 3QGVA 3DDGA 1EHNA 4GINA 2B08A 4P5MA 4OV5A 3MSPA 1ZV9A 1X44A 3KYMB 3BN3B 3TBTA 3OZLA 1G7PB 1KJ2A 3BAKA 1D9KC 4HD5A 2R8SL 1B6DA 2BVYA 4HPOH 5ALCL 4M5YL 3AWEA 2NUTB 5KANG 4HEPA 1NBYB 1TJMA 3HG4A 4QTIH 2EVFA 3GK8L 3K8MA 2BSBA 4P2RD 3BEVB 1O9WA 3LZRA 1BJ1H 3NCCB 4Y1AD 3WIHL 5JQIB 3GWJA 2WYHA 3EYVB 3FH8A 5EIQA 4X8JA 1PKQB 4AIEA 1N0LB 2CUIA 5D2LF 5C9KA 5IMLB 5FW6A 4BXVA 1AKJD 1OARL 2YKKA 4J3UA 3U36A 4M1DH 5DYOA 4FFYA 5ISZB 4RMVA 2V9UA 2EAEA 5EOQH 3ULVL 4MNQE 1T89A 2N59A 1CVSC 2N4IA 3VYOA 1GMIA 1ZHBA 1FH5H 5C70A 4WLCA 3FT1A 5GXBB 4YDKH 4HCFA 2HPTA 1UM5H 1T7WA 1WHPA 1UENA 3L4UA 4MQ7B 3DOHA 5F7WC 2KLSA 3CFDA 4YUEL 2E8YA 5D7IF 5MEQA 4XPAL 2C9PA 4IOFC 3UAFA 3AU0A 4XO3A 1KACB 4AQZA 1PZ5A 5D1ZC 1A4BA 3CZSA 1SDDA 4NDMB 1BFSA 5FX3A 3AC0A 1I8AA 2NY6B 3V79C 1XF2A 4RSYA 4YK4C 3HCVB 4WKZB 1TCRB 2UVEA 4YR6B 4ORGB 3L5WB 4O02H 3BQVA 2KKQA 3PHOB 5E2UL 1IIIA 3P3SA 5E9NA 4U2YA 4E9TA 1QRND 1ADWA 2UY7A 4OZHF 5EBMA 4R3SA 3SGDI 3GMRA 3O4LA 3WU1A 3FO2B 4JW3A 1P5UC 4TUKH 2X5PA 2DJUA 1K4CB 1NMCC 5B1BB 3RGBA 1WC7B 2CKBH 4X9HA 3U79A 1Y07A 3H6AA 4D8OA 1X7QB 2NZ1A 3DPBB 4LHUG 1LP9E 5DRNA 4NEHB 4JKKA 5LXGL 1VGKA 5CBAA 2X3AA 2KT6A 1GW6A 1MJJA 3KCPB 4PD4J 4YH6A 2CM5A 4JRYB 1G1YA 4XWGL 3TPKA 2VDOH 2FJFB 4F5CE 4F15B 8CGTA 1UOLA 3Q3GA 4G72B 3ZDXB 3TLRA 4UOZA 1RPQA 3H55A 1WHOA 3CTTA 3X3FL 4FFZA 5F3FA 4AOFA 5GRUH 3QWNA 1TVBB 1FUNA 5DHDA 1MQKL 2E4FA 2Q20A 2Y1AA 3CPLA 4WGVB 4FXTA 2BNQA 3BIKA 3OL2A 2P5EA 1MCRA 3RDTD 1YMHA 2EKSA 1GKEA 3K0YA 3MVSA 3PFUA 5KBPA 5D1QC 2P8LA 4X83A 3NESA 4GQ9L 3OF6A 5AAWC 2YPLD 3QUZA 4YHOL 3MA7B 5MEPB 4P2RE 1B90A 4Y1AE 1L9OA 5F0LB 4ZUSB 2DQDH 4KZEH 5A40E 3LN5A 1KYDA 4K9EH 4YSDA 3FRPB 1BD2A 4OR1A 5I2IB 3QIBB 4N6QA 2BIIA 1JK8A 1D5BA 4Y16B 1PVHA 3ZE2F 4W9IC 1S9KC 1N59B 4K5PA 2Q0ZX 3W57A 1NWOA 1QZNA 4IS6A 2EDXA 3FTZA 1IRAY 2WIIB 4ISVA 4BYHA 5I9QC 5JXAL 2OZ4A 1PKOA 1VCAA 3B9KA 4P9HH 1HWHB 4DP7X 5FB8A 4FLRA 2NXZD 4JFED 3W11C 2LFGA 3QQDA 4JRXB 1S46A 3FT4A 2CRYA 1GGTA 1PCXA 3QUXA 4GXFA 4ZNCD 2UZYB 2V2XB 3DV6B 4R2GD 1J0JA 1IC5H 2H6UA 2I27N 2DOCA 2I07B 3C09B 3V5HA 4NSKA 4WWPA 1J0HA 3F7LA 4X9IA 5EC1B 5DU7A 1XIWD 1U6AH 4IU2B 3SE8L 1OM9A 4YDZA 2PCFA 1TENA 5D1ZI 2CJUH 5E99H 3WNKA 1X3DA 3W1ZA 3HBZA 1AR1B 1XF5B 3DSNB 3DX9B 3WN5B 2X6UA 2GSIB 5L9DH 2K0RA 1TFPA 2GQHA 1QBML 5F89B 1QRNE 3V5KB 3NCEB 3JWNE 4LMQE 1SEQL 3IRPX 1B2YA 1GS7A 1C08B 1S7TA 1XX9C 3K80A 5TQ0H 3PREA 2D31A 3J07A 2YA0A 1J1PL 4X6BA 2KL6A 5D7SL 4Z95H 5ABAA 1UQSB 3MLZL 1DBKH 3ILPB 5I6MA 3SBRA 3ULUC 2VDQB 4DN4L 3WY4A 1VFBB 3RHWK 1KBGH 3QAZB 3HI1A 2BIPA 4PMFA 4PBXA 3SSGA 1R9FA 3F01A 3ESMA 4ZUTA 4R90H 5KZCB 1VJSA 2B7DT 2RJMA 1FG2A 1W8EA 1J86A 3D25B 5D7JC 2A9CA 3QK0A 3KPSD 4J6IA 1EZSA 3CDFA 1SVCP 5F7DB 3GRBA 3ATBA 1Q0XH 3KPLA 4GRMA 3FYEB 4IIQA 4XC1L 4YS4A 1A6TA 3L5IA 4WTZG 4WIQA 5AW3B 2Z91B 3OKOB 3ZO0A 2JKSA 3IFOA 3VI4B 2YPLE 3DTXB 4APXB 4MD0A 1IQDB 4HPYL 4M03A 4XZUA 5EN2A 1ZSDB 1WT5A 2WTOA 5GRYA 3SE4A 4WEEA 1AZZC 1J12A 2Z7WA 2WVUA 3WEMA 3ALXA 2NQCA 3L3OB 1ZK9A 5K1VA 1AQDA 4B7IA 2A9BA 2JIXD 1J8SA 4KFMA 1UTDA 1ACYH 2XTJC 3UZQB 4FCAA 2BJMH 2JCWA 5DMKB 1OAKH 2Q76B 2CXKA 2CDFB 3HG1A 3NCFB 3MOQA 3EYQC 5IK3A 4DP5X 5IKCB 4MA8H 5IVOA 3BRGC 4HKJB 5GGSY 1J8HB 2BVQA 1U8IB 4LQ1A 2MCPL 3UAEA 3WE6B 1RIHL 4JFEE 2AKRA 1Z3GH 3HZKA 4Y19A 3HRZA 3DUSB 5I1KH 5E00A 4MXWL 3P11H 1I1YA 5J11B 5DHEA 1YEKH 3RUGB 3J8F7 3VFMA 5GS0H 5F6IB 3LOWA 3M07A 2J6EA 1KXVA 3HG0A 3L4CA 2HT2D 4JN1L 1F4XL 1TJIH 2HKFL 3LQZA 4OJFH 4OZFG 4XWOC 5FO9A 3QORA 3GIVB 4TVPD 5AVRB 1QLEL 3AQXA 3O6FA 1P0SE 1ZE3C 4OTXH 3STZA 4ONHA 4OQ1A 5IW6B 1GZHA 3QJOA 4HUUA 4HIXH 1YJDL 1TMQA 3N1QC 3K91A 4N0UE 3IXTA 3PJSB 4PJDF 1U8JB 3P2DA 3RHWF 25C8L 4EAEA 5J1AA 4IRJA 1A9BA 5DK2A 5IQ7H 1PPIA 2W94A 5KYUA 3NGBB 3P3UA 3ULAB 3PQYA 3S36H 3VFGH 5FHAL 2WCSA 3T0VA 1T66D 3PY9A 5FM4A 5HY9B 2O30A 1F1AA 3ASOB 2YPVH 1QNZL 1OZUA 1G7HA 3KPSE 3HAEA 4PEEA 1YPZA 3QPXL 1DUZB 4B0MM 2OV0A 4L3FA 4NYLA 3CVCA 1CLCA 1EAPB 4G7RB 3SDDB 3VFTA 1F4YH 4BZ1A 4CMMB 5I23A 2VR8A 4C83A 3C8KB 4Q2ZB 5E6ID 5D2LB 2R9HD 2FX8L 4XNZB 1YNTA 2QQKL 5KYYA 3H9SD 4ZPVB 1G6RA 2YAPA 4JMNA 1FGVH 3VRIA 4NKQB 1KPUA 2C9XA 2X4TB 1XH3B 3MA9L 3QUYD 1PSKH 2WVSA 3D34A 3CDCA 3JSSA 2Z35A 2D2CC 3JQOB 5I1LB 2ZWZA 3IWVA 4PREA 2KLTA 3QQ3B 5E8PB 5KYWB 4JJ5B 5HGHB 4K8RD 1JHLH 4HFWB 5FV2A 2F1EA 2GHZA 1U8LA 4M7JH 1WSST 3VTTA 2MH4A 3CHXA 3GRWH 3IFLH 2HUEA 1OO2A 1F3JB 1SBSH 3D51A 4WI3A 4M02A 2GJ6D 4DVRH 3EAKA 3SOBH 1MIML 4LCVA 4WNQA 5IVZB 4CSSA 5IB4B 3IDXL 1FLRL 2OI9B 4XR8C 3WJLA 5T33L 4TTGA 4DAGL 3V6ZA 2VLKA 4ONOA 3WMSA 4EQ3A 1MREH 3H3PL 4JZOA 1BEYH 1E8YA 1UFGA 4EI0A 4XBEH 3ATAA 1T80A 4G8FB 4OLXH 4OIAA 2FT7A 3ZDZB 4NPJA 5HJBA 1C12A 2JK5B 2NX5D 3OWRA 4TVPE 1EANA 3MV9B 4JQIL 2ZF9A 4L48A 4NNPL 1EUTA 2P46B 4LIQH 4RA0C 2W9EL 2APVA 1LD9A 4HOMA 2X6BA 4E0RA 3MJ8A 2R51A 1DSWA 4F58H 1NGWB 5C0IB 4NQQA 4UIKL 4NWTH 2H1XA 3WHE0 2EABA 4PD4K 1U8HA 5JXEC 4S0HA 3UYPB 2ALAA 2OR9L 2H2SD 2NW2B 3DO3A 1R33A 4YO0A 4WKXA 3AM8C 3LHPL 4M61B 3SDAA 4YQXL 1MHCA 3T6XA 5IOPA 2ATKB 2OLDA 2ZKHL 5T3XH 2DQHH 3ZW3A 2VN3A 3BZ5A 1OL0A 1TO4A 4GFXA 2KUTA 4OV6F 2VR7A 2R23B 1BF2A 4LLWA 5KSUA 4PJIA 3S36X 3IJ8A 3HHMA 2VR9A 1MCDA 3CHSA 2QV4A 4CW1A 3CN1A 5EOCL 3NIGB 5E4EB 5EBWB 3VWKB 4OCRH 2R1YB 1YHPA 4KY2A 4U0RB 3VD9A 1NFKA 2IFGA 2RMNA 3O8XB 1JXJA 1HYRC 3HB3B 1MHEB 1NGQL 4L18A 1FFNB 1II4E 1O7SA 5JIKA 2J1KA 1C7SA 3VW3L 4PH8A 3ZE2B 1WFMA 4WO4A 4A39A 4APQC 3V10A 4NM8L 4WV1A 4URKA 1SXCA 3H9SE 2R2BA 1DTUA 3C5ZD 5DZJA 3QXDB 2DJ4A 4GSQA 1TEFA 2JB6A 4IM8A 3KLHD 3C60A 2H45A 3RFZB 1YEJH 3BZFB 3WTWA 3Q2VA 1FORL 5D96C 3CCHB 4IGBA 4PRID 3ISWA 3L1OH 4I1RA 1LMIA 2AITA 4RGND 3LKRB 4GKLA 4WSGA 3BUTA 2UY6A 2J8UA 4KOCA 4MMYB 3GBMH 1UXSB 4UZGA 2J2ZA 2XN9B 2YARA 3MRHB 3CFKA 4JKNA 3MODH 2XIDA 5IROD 3QDGB 2EILB 1CDJA 1E5AA 1TDQA 1X7SA 2GJ6E 3FQYA 4FMKA 3WIHA 3KPMA 1IKNA 1NGYA 3ECBB 3DGGB 5I19L 2B4CH 1GSKA 4V2CB 4I0KA 3D2UB 3MRDA 3BSZL 4RMWA 2R4RL 1PZSA 3BZ4A 5DJCA 1AZRA 4FQLH 1WBXB 2QSCL 1QWNA 1ORQB 3WEBA 4L5FH 4NJAH 5LKNA 2IV9A 2H9GA 4L8SB 2NX5E 2AK4D 3OXRA 2SODB 1U2CA 4NRXB 3SYAA 3BQUD 1RHHA 2UYLA 3KW7A 3QZPA 4QHMA 1JNLH 4GSUA 3U48A 1F4WL 3P02A 1TZIB 3H7LA 5K9KA 3ML8A 4HUCA 4LLMA 2X4SB 3ABZA 3DDFA 4BXSV 1BPVA 5HHXL 2GBVA 4HBCL 1LXMA 1CLZH 5DR5L 4YHNA 4QYAA 4XVUD 1SYVA 3D08A 5CD3A 2C9AA 1R46A 5AVQB 4H8HA 1TVHA 3K1KC 1FFOA 3TBWA 2LR4A 1TZHB 2ESVA 3L9YA 5EZJA 4CSZA 1VGEL 2K70A 2YSSB 3VFRB 2GAZB 3M88A 5GRVK 3VTMA 4M7ZB 4DO4A 3L3IA 2GUOA 5F6HI 2E86A 4DW2L 2YHGA 1AIFA 1E7UA 2Y3NA 3KYAA 4BA0A 4EOWH 1PZUB 3PABB 2XN0A 3VWJA 1N6QL 1DQDH 2PWDA 4M3KB 1FFRA 3QNZB 2WYTA 1CYGA 5DQDH 3SKNA 4QHLA 3M45A 3P4OA 5HVWA 4KKLC 3BH4A 4NRZA 4LLAA 1IGYA 4HV8A 1KGWA 4K5NA 2RFXA 1IZKA 2YRLA 5HJGA 5IJKA 1NDTA 4BSWA 3V4VA 4I85A 3FMGH 4L3AA 5FW7A 2X9ZA 2AAVA 3PP4L 3FZUC 4IKNA 5D5MF 3JYCA 4N0CD 2MCG1 1JF1B 1OF2A 3SD2A 2H4EA 5EU6B 5D6DA 4FQIH 3TVMB 3T2QA 4BD4A 2CRMA 2H41A 5F1OB 3ZKMD 4JFFD 3QG7H 3VMNA 1AQHA 1C5BH 4PRIE 3DJ9A 3ARDA 3PHQA 3UBXI 1L0PA 4XE5B 4GMTH 1HH6A 1MJJB 1AGEB 1QO3A 5D2NA 4RGNE 1KBBA 2VDRH 5EUOE 4OBRA 5F97E 5ICXB 1LK3H 1V8HA 4ZMNA 3VM7A 2XLLA 4E9RA 4ZODA 4MMZC 1HAUA 1CK0L 1EDYA 2DMCA 4F7TA 4TMPA 3P9LA 1KCSL 4P23B 4B5ZA 1JWMA 4AJWA 3N91A 4HU2A 1IKFH 1BIIA 1CICA 1RCYA 2EXTA 2BNQB 1AGBA 2P5EB 4WK0B 2YD7A 3NK3A 1THCA 1I8KB 2FEEI 3QA3A 3I6KB 1JYXA 1A6ZA 2PWGA 2EUWA 4ZS6D 4KNQA 3PWNA 3P0VH 2QHRL 5J06A 3ZX1A 4L4TA 4ODWB 2AK4E 4WUKL 3AY2A 1YQVL 1BOGA 2B2XH 3KM2A 3KJ6H 5KTEH 3GSVA 3THMH 3FUMA 1BD2B 5AW4B 5IP4A 1TO5A 3CVDA 1PZDA 2KI6A 3AABA 4JNXA 1IAIH 1FI8C 1UWXK 2WVTA 2B77A 4LESA 5KUKA 4M8QA 2VDOL 5ENWB 1T03L 5HVHC 3QQ4B 4M6MH 4U6VL 5C7XL 4DP4X 1VKXB 1KB3A 4NKDB 1HHKA 2WJ7A 4JBSA 3VO0A 4Z7WA 4LNVA 4KKZA 5DO2D 1FL5B 3VFSB 1DJIA 35C8L 3ZO9A 1KTLB 3QJHA 3PDGA 1ZA6A 3B2DC 3GSOA 3ZT5A 2D7NA 5I8KL 1KDIA 3UAAA 2PTVA 4HULB 5T1MA 1WWBX 1I8IA 4KRLB 3E80A 1T7XA 2BNRA 4FNSA 2YIHA 4Q9BA 5JHLA 1KZYA 4KMTL 4PRHA 2DQDL 4R26H 2V4LA 4KZEL 2X1QA 3MCKA 2UVFA 4PJGA 3ZYJA 4Y4KD 1ZXQA 3HI6H 3FT0A 4NLHA 2AC0A 2Z0BA 3ZR5A 2H5UA 1CFBA 1HNYA 4OGQC 5CJOL 5HHQB 2J1YA 3ZMEA 3LDBC 1HCVA 1KXHA 3BZDA 1T4KA 1AI1H 3RB5A 3MBED 1XBRA 4KUCF 1UT2A 2IFFH 4IEFA 3FF7A 3TF4A 2EYSA 2G3NA 3IFPB 4P9HL 4JFFE 1XGRB 2V7HB 4OD2B 4UBDC 1HXYB 4U4BA 4UOW1 4GMSH 1XH1A 5EU7C 1J1OL 3CFMA 3OZKA 2BK8A 4L1DA 4XHJC 1UH3A 3V0VB 1PLCA 4UT9L 2M2DA 1OTSD 5DYFA 5LNGA 4D7PA 2BWQA 4I13B 4IDLA 4JREC 5IBLD 4Z6AT 1Y18A 2GJRA 4C4UA 4W9EC 5E99L 1TPXC 3P3TA 2P1YA 4ZUWA 1T1YA 4UQAA 3UYRL 4AJ0A 4QRQB 4Y5YA 5L9DL 3H7BA 1OP5H 3V5DA 2NY4C 2WZPD 3WXWL 4DGUA 1B2WL 3SQOH 7PAZA 3BP5B 3QNYA 3ULUF 1JPGB 2O61B 3QFJB 3L1GA 5IM7A 4JM4H 3EYOA 3HC4H 1ZIBA 4YGVA 4KX7A 2NY3D 3Q44A 3TZVA 3BN9C 1GPOL 1MQ8A 3L4WA 5L4FA 4R7VA 3ZUNC 3UGEA 3BO8A 1KBGL 1NCWH 4NBZB 1GGIL 1FNEA 1LO4H 5DJ2A 4PG2A