5B1CA

Crystal structure of den4 ed3 mutant with l387i
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
101
structure length
101
Chain Sequence
SGMSYTMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKVVGRIISSTPLAENTNSVTNIELEPPFGDSYIVIGVGNSALTIHWFRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Envelope protein E
publication title Modeling and experimental assessment of a buried Leu-Ile mutation in dengue envelope domain III
pubmed doi rcsb
source organism Dengue virus 4 dominica/814669/1981
molecule tags Immune system
total genus 14
structure length 101
sequence length 101
chains with identical sequence B, C
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5b1cA00
2R69A 1Z3RA 2JV6A 2P5PA 3C6EA 5IZ7A 3N42F 4UTAA 1SVBA 2JQMA 1Z66A 3IRCA 1S6NA 5IREA 3J2PA 4BZ1A 5KVGE 5JHMA 2H0PA 4UTBA 1ZTXE 2V33A 4BZ2A 1OK8A 1OKEA 4X42A 4AM0Q 3C5XA 3UZVA 4AL8C 3P54A 4UT6A 2JSFA 1TG8A 3UAJA 4GSXA 3N40F 5B1CA 5GZOA 3VTTA 4GT0A 1PJWA 3UZQB 5LBSA 4FG0A 1UZGA 5LBVA 5KVFE 4FFYA 3N41F 5JHLA 5AAMC 2I69A 4L5FE 1RERA 2HG0A 5GZNA 3UYPB 3J27A 4UTCA 1OANA 4ALAC 3UZEC 2ALAA 5AAWC 4UT9A 3G7TA 5KVEE 5KVDE 2GG1A 3N43F 5LCVA 5H37A 2R29A 3N44F 3MUUA 3WE1A 4FFZA 1URZA
chains in the Genus database with same CATH superfamily
3HPLA 3QEUA 3UAAA 4A04A 2YRBA 4LL9A 1YY8A 4Z7OE 4R0LA 1F90L 5E0FA 2JV6A 3HS9A 4X80H 2QKIC 2Y1AA 4AW4A 4YX2L 3VRJA 1QQDA 5I24A 5F7BA 2NDFA 3EH4B 1CLOH 1G7LB 1JV2A 3KEDA 5TK4A 3UPCA 3W9EA 4JNXA 2OQJA 2D7MA 2ESVA 3QUML 1FZJB 3P11L 3QHTC 4KJWD 5ISZD 1FJ1A 3CNKA 1KG0A 4Z7UA 1F3DJ 2AQRA 2P42B 4M4RA 4X2UA 1FIGH 3FTZA 2J2ZA 4MMXC 1UASA 3R4RA 2P45B 3I84A 4I18A 2YS4A 4NKOB 1AR2A 3FCSB 1MFDL 1OK8A 4UZGA 2PO6B 4HC1H 5D2NA 3CHXA 1EX0A 4ZX6A 1AZZC 3ULVC 3VWJA 2IBBA 2EKJA 2YGNA 1YNKH 1EEZB 1M56B 2HYMA 3I02B 4KJPD 2MOGA 5I16B 1DE4B 2Q9OA 3A4AA 5F9WC 5HHVL 4OUOA 3V4VL 5D93B 2I9TA 1IKNA 3LH2L 3AGWA 3HG1E 4WV1B 3QCUL 4NUJB 3D3VA 2IANE 2IALA 3IFOA 4F7MB 5F1OB 1G4MA 5LDUA 3QIUC 1OGSA 4KGJA 4YWGL 3ABMB 3SDCB 3UBXA 2XFGB 2DLFH 2Y5QA 2APXA 3SDXB 3U46B 1PTZA 2X10A 3KJ4B 2IAAC 3PS6A 5EO9B 4N2DA 1NKOA 3BE1L 1FO0L 1AZNA 2OZ4L 3DK2A 4JGMA 3TCXA 3AXIA 3EFDH 1Z3GL 3LMJL 3U0TB 2I69A 4HW6A 4M61A 1KELH 2C9VA 4LF3B 3O2DL 2EIJB 4TNVF 1E28B 2B59A 1OP5K 4C4KT 1HEHC 4MAYC 4X8JB 4G7YL 1XV8A 1MSPA 1YEFH 5FYKD 5T1DL 3SKMB 5D1QC 3PE9A 1A7OL 3H56A 2QV2A 3HMWL 2BSCA 2QELA 3R18A 4KNSA 4MD4B 4Z5RA 1OP5H 2A6KB 3H9YA 3ZE0B 1KGCD 1XL4A 4WY7H 1RZ8A 3AUVA 4HWNA 4C4UA 4PS4H 2GTQA 2F19L 2GFBA 4IOSD 3U7WH 5FX3A 4B9KC 1VFBA 3PHQA 3FB5A 1ET8A 3ZKQD 1R34A 4FZEH 3QGVA 2A74B 2ZWLT 4HF5H 4KFMA 1HOEA 4OIIH 3RDTC 4GXUM 3WLBB 2YD3A 3CK0L 2A6IA 3D39D 2EEFA 4I5BA 3KGTA 2BVEA 3RGVA 4Z23A 5ID0B 2EC9U 1T2XA 1INQA 1FFTB 2AK1L 2BCMA 5AZUA 4QTIL 4PREA 4GAGH 1XSKA 4Q8BA 4Z76A 1KTDB 2VDNB 1F4WH 3FKUS 3SE3C 3T0VA 3GT6A 2EXYC 2BS71 3O8XC 5GGRA 3GMPA 3OPUA 1JL8A 3SDAC 5A3ID 4PJFF 3WDIA 5B8CA 1RUKH 4JJHA 1XBDA 3FT0A 2V5MA 1OHZA 1HINL 1UZ8B 4M5ZL 3FOMA 5INDA 1ZA6A 3CX5J 3PWPA 3QORA 3U7YH 1MQ8A 2PCFB 5FO8A 3EYVB 5BW7A 2BOBB 4JB9H 1IFHL 4HISA 1X4ZA 2EDOA 2MPAL 3IWVA 5JXED 2H41A 5DC0A 3TEUA 1B4RA 2IWKA 3LZOA 4KWUA 2FQFA 3D07A 4ACTA 2VM3A 5DI8B 1QEWA 2BY0A 4LLYA 5EU5A 1A5FL 2KL6A 4WI2A 3EGDA 4WIQA 5E9DA 4IKJA 3OAUL 3CHQA 3EO1A 1PPIA 3NFSH 3SE4C 3TBWB 4ZNEA 3BRGC 4QHLA 3TJHC 5IFAH 1KCLA 1X9RA 2ZX9A 4FXTA 4KGLA 3TN0B 3QXUA 2X6VA 5BQDA 4FJYA 4X6DA 4JLRB 1LEGA 3DKHA 6PAZA 1Z32X 5D7LE 3N06B 3NIGB 2W5PA 4TL5A 1TQBB 1HL4A 2BZ7A 3QIBD 3TCTA 1MREL 2BX5A 1S7UB 2GJ6E 2Y3AA 2EDQA 4MRBA 1PY0A 2A6JB 1QG3A 3OVUB 1FUNA 1QFOA 2X38A 3VXRD 4W9HC 5FLVA 1BAWA 2Z92B 1IC7H 3DMMC 4JKPH 1OGAB 4L9LC 4E9WA 3QRGL 2R2EB 1R5VB 1FZJA 5F6HJ 2IH8A 4J6RH 1DO6A 3HN5A 3MUHL 1XCTB 3QVAA 3A6CL 1A7RL 3EYQD 1RZKH 4X6CB 4KU1A 1K3ZA 3QR1A 1CVSC 1MCDA 3PXLA 3QW9A 2VLRB 2DBJA 5DUML 4BFFA 3E1ZA 4NKOA 3FCSA 3ZHLA 3H54A 4S1DD 1L6PA 1WTGT 2C9XA 2PO6A 4U0QB 5CAYB 1N67A 3TYGL 5F7WC 4AEIH 2F15A 4XVUC 1MHPL 4JM2B 1EEZA 3I02A 1KC5H 3LNFA 4JFTA 4JQVA 3II3A 5GIRB 1DE4A 3EJTA 3CXHK 5I16A 2XV2A 3CSYB 2EDYA 4M29A 3TT3H 3MLUL 4DPRA 1G9NL 1UFGA 3KBPA 1OSZB 2X2JA 3FUEA 2WLNA 4QMEA 4WV1A 1P5UA 5LBGA 4KUZH 4NUJA 2G30A 2I9LB 4LMQE 3UJIL 4CVWA 4F7MA 1ZY9A 2KC0A 4G6MH 4YSOA 3SDCA 4PJDE 4AVHA 1M42A 3UTTE 1NCBL 3PL6B 2NSXA 5HXMA 6FABL 2GHWB 2XWEA 3O3AB 5EO9A 2ZPKH 5KJ4A 2EDJA 1FAIH 2QPDB 3AFLA 4P07A 1UKQA 1XCWA 4LF3A 5E2WL 2GSGB 1E28A 1IE4A 2I07B 4KROD 4X8JA 1S78D 2K1MA 3OKDB 4AUYA 5L9DH 5ICUA 4OCWH 4N2EA 2NW3B 3SKMA 4IRJB 5E1AB 4O51B 3AT9A 3ZOAA 1MCOL 3SGEH 3K8KA 2R2CA 4MD4A 4R5TA 2A6KA 1YJDH 5DSCB 1RJYB 1HE7A 1VSCA 4G11A 3M6DA 4M1CC 3UACA 1Z9MA 2A4EA 1A6UL 2FIRT 3V4LA 3WOVA 1VZGA 2WC7A 4OJCA 2EP6A 2A74A 5AZ2L 4DVRH 1NIEA 5AKRA 5DR5L 3WLBA 2R8SL 2JB5H 4GW4B 1SJXA 4PVLA 3NIDE 5ID0A 2PR9A 3IT8D 5HPMB 4KRPC 4TVPD 1HL9A 4OGAD 4UQBA 1HU8A 2H6UA 3FMGL 1KBBA 1VERA 2XX0A 4XMUA 3OMZA 1WWCA 3IJ9A 1CZ8H 1PZDA 2KBGA 3OHXC 5GS2H 1KTDA 4J12A 1UJTA 3CVIH 3ENEA 4WI6A 5L8KB 3KPPB 1GZPB 1QFWM 4KRLB 2Y5EA 3BSZL 2VQ1B 5FHBH 2BWQA 3KVPA 4HAFA 3BYYA 4ZDHB 5BOPA 3HN3A 5IJCC 1T1XB 1RVFL 4L3FA 1KB5H 1AGEB 1UZ8A 4JHWH 4U0RB 1KXVC 2CM6A 1WFMA 2JCCE 3L9YA 2OR8A 4OCNC 2PCFA 2VDRB 3EYVA 2BOBA 3F64A 4JFHE 5GRXG 3NESA 4KOBA 3FUJA 3F58L 2KYIA 5JQIB 1RZPA 4X6EB 1JPGB 3A5VA 3CBKB 3Q6GL 1SFDA 4OM1L 2Y7SA 4NQCD 5DI8A 3EH3B 5LGHL 3L4XA 1QOKA 2EE3A 3NJKA 3TBWA 5H37A 4Y9EA 1R46A 3LY6A 4WWPA 3TN0A 2N0MA 4EAEA 1OP4A 4JLRA 2DDQL 5E95B 4PRHD 3UTOA 3VG9C 3BGMA 3OL2A 1NL0L 1IM9A 4R9HA 5G4MA 4KH2A 1S7UA 1YSOA 3QUZD 2K8QA 2Z31B 3FRPB 5HHMD 3KH4A 4WEUD 5KN5B 5JXAL 1PZ2A 2QADD 2A6JA 4FFYL 3LPGA 2UXTA 2Z92A 1FYTB 2FJUB 1OGAA 2R2EA 1R5VA 2C3GA 3UC0H 3VFUB 1AO7E 4ZFOL 5C0FB 1Y18B 2E76C 1KGYE 4BZ1A 5EEZA 4PJ7E 2WWMC 1XCTA 4OCRL 4P4KC 5BV7C 4X6CA 2JJTC 4L4VD 3UGXA 3JWDL 3O3EB 1IKOP 2VLRA 3IBEA 4PBVC 3RPKA 3VB8A 1J5IA 5FC9A 1M9SA 2WNKA 5AW2B 4GJTB 1ACXA 4MB5A 4OF5A 3TFKC 1UEYA 5D7IB 2RH0A 2JJVA 3B2VL 2O5ZH 3NPZB 3SJVB 3LN9A 1LP9B 1OGPA 1JVKA 2WJ7A 3P54A 3H85A 1DJGA 1KB9K 2YUVA 4GSUA 5GIRA 2NYKA 1YEIH 1XXDC 4Y7MA 2OJEB 2ZCKH 1OSZA 1AQ8A 4HUVB 4ZZKA 4N5UA 2DL9A 5DS8B 2V3DA 2I9LA 1WEJH 3RNQB 1VCAA 4C56B 3JWNE 5ESQB 2OTPA 4P23D 2H1LM 1AKJD 2XZCL 1MCLA 1N10A 4MA1C 1YQ2A 3BKYH 4HHAB 3G6JF 3PL6A 3U4AA 3RY6C 1SHWA 3F65A 1QYGL 4HJJL 5F6IC 3O3AA 1B90A 2HKFH 3PNWB 2J72A 4YXKL 3EFDL 1OCRB 3LRHA 4B5ZA 1E4WH 1MIMH 3OM3B 4ZW7A 2WBJC 4JRFA 4M3HA 1UT2A 1TJHL 1IQWL 2GSGA 4N2OA 3JTTB 2I07A 4IQHA 5I18L 3WNMA 5K69A 4PLKD 3OKDA 2CR0A 3QH3A 5DEZA 5EZLB 4K3EL 3UCQA 2NW3A 1J1PH 4IRJA 5E1AA 3OG4B 1R47A 5EWIL 4O51A 5DSCA 1UKSA 1RJYA 2ZIDA 3DXAD 3REVB 4TUJB 1SVCP 4X7SL 3UAJC 3NZUA 2YN3A 3TBCA 1BGXH 3D7PA 1YEWA 4FFVC 4EIGB 3ECQA 3VXUE 3S88L 3MNWB 1A3QA 3V6OE 2F7QA 3IETB 3LNHA 1G7MB 1GJIA 4P2RB 3V0GA 4ODHL 3CU7A 5GRYA 3RWIB 1GTNA 4GW4A 3TV8A 4N0YL 4X50A 4B0MB 5HPMA 2NT1A 3B9KD 5AYTA 4Z7NB 4Z7IA 3EYUH 4Z3FA 2QJDA 5FWQA 1ZVSB 2ZF8A 5GQBA 4HJ0D 2A2QT 3KS0J 5DT1H 4P2QD 3KPPA 5JHLL 4FNLH 1GZPA 1Z5HA 1YC8A 3JWNC 2EIKB 5IQ7H 4HBQA 5CJBA 4HP5A 2VQ1A 4ZDHA 1REIA 3US1A 1T1XA 3US9A 1AGEA 4P2YA 3TNMB 3PP4H 4PEEA 4JB9L 3TF4A 1AFVL 3FW6A 2A1WL 3WDJA 4F57L 3UERA 5K1VA 2X42A 3T8MA 4PI2A 3H2QA 4UINL 3EXLA 5L2KD 1WZ1H 4GRMB 3KYKL 1JPGA 2Q0ZX 4JY5H 5HHOE 3UXFA 1YY9C 25C8L 1EERB 5J13C 3BISA 3E9UA 3VI3E 3N1MC 3QJZA 2EH7H 3EUDA 4N8VG 4FQJH 2K8MA 5DC4B 4GSRA 1CFVL 4MHHG 3W2DH 1TJIL 2HLAB 3JYBA 4ABVA 4BQ8A 3MGAA 1AMYA 4DSYA 2FE0A 1INDH 3T71A 5TDOB 2ZKHL 3QQ4B 3M8OH 4PCSA 1J9RA 5C09D 5PCYA 2ZXEB 1S7SB 2CNYA 2CXKA 3V6OC 4H0IA 1URIA 1NGQH 2J88H 2Z31A 3FRPA 5FB8B 5KN5A 1UJ3C 2RCSH 5FYLL 1ZVNA 2BNRE 2EDBA 2MTPA 1FYTA 1JZJA 2VDPH 3DYPA 4MKMA 5IUSA 4PJ8D 1C1EH 1PS3A 4H8PA 3SKUD 3VFUA 5AOMA 1Y18A 5C0FA 1YUHB 1SDYA 2RJMA 1FZOB 3X1NA 3EDJA 4BE5A 3MRQB 3OZ9H 1MF2L 4H2AA 4HEPG 4O5LH 4FHJA 3IKCB 1U3NA 1LP9F 1RULL 2K3TA 3O3EA 1NMAH 4IGBB 1M6UA 1O75A 1A0QL 1UTDA 1P4IL 4LCCB 4MJ6B 5HDRA 1IC5H 2JK5B 5KZCB 5D7IA 1KC5L 3DX6B 3IEAA 5AOZA 1LP9A 3SJVA 4JN1L 1I1AB 4LASL 3SCMB 3QT2A 2EIZB 3RQ3A 4OH2A 5C0IB 4U1GB 2Q7NA 3D48R 4WI8A 5EC2B 3SYOA 2OJEA 3WFBL 4YJZL 2FSDA 3AREC 4NGHH 3UDWC 4WUKH 1MWOA 5DS8A 1A7QH 5HVFB 4DN3H 5H2BB 1H3VA 1LO3H 3RNQA 2ZG1A 4C56A 4I1RA 4YVUA 4Z7QB 1BHGA 4WSGA 3DJ9A 3MR9B 1QABA 5SV3A 2X4SB 4HHAA 5BVPH 4XX1G 5EO0B 2W9EL 3L3DB 1T7YA 1S6NA 1FAIL 2GQHA 3PNWA 4KI5E 3BZEB 1FRGH 3QDJA 2ZAIA 1UCTA 3CDGB 2BHYA 1H0DB 2IEPA 1KTLB 4KAQL 1D5ZB 3HFMH 4NCC2 4YBQD 3JTTA 3HBPA 5FK9B 1HKLL 1EV2E 3IMBA 1SUJA 2I85A 4OFDA 2FEDD 1Z9LA 2HB0A 3C6LC 2AEPH 5EZLA 2AJSL 1I85C 2VCOA 1B0RB 2ZZUT 1BAGA 6TAAA 3TYFB 2O93L 3NEXA 2DI7A 4HWBL 1PX3A 1SM3L 2FVNA 1Y6NR 3REVA 4TUJA 2EINB 5F9JB 4L18A 4AL8H 1MRCH 5FW6A 4RGMC 4ANVA 5E9NA 3VWKB 3RVUD 4B9ZA 2K3HA 3O9WC 2V6HA 3MNWA 1F58H 4XCCL 3WJMB 4X7TB 3IETA 2NSMA 1G7MA 2VDKL 3MRBB 4P2RA 4C59B 1WUZA 4YAQB 3RWIA 2QHLA 3LQZB 3ZHFA 5IIEB 2IADB 1XH2A 5A2JH 3HJEA 4OZIE 2I26N 3VO0A 2PXYD 4DGYH 3N1FC 1CZ8L 5MENE 2BS9A 1ZVSA 3CVIL 3K2IA 4FYQA 4O2CB 2ZG2A 1QFUL 4GRWH 1TCRB 5MI0B 2FT8A 1TTBA 4M1CD 4M8UA 3RFZB 4UQAA 4XC3H 2VB5A 3MJ7B 2CAKA 3BPCB 4JHWL 4N2HA 1MLCB 1E42A 3B7RL 2JI2A 4CC4A 4H26B 3ULUE 1F1AA 3CH1B 4JDEB 4OBSA 2IAMD 1M1XB 3TNMA 4HS8H 3EOYG 1IJ9A 4DK6A 2ZUWA 3T3ME 4KI5C 4UM9D 3RIKA 5BZWB 2IOMA 5J1SC 4L23A 1H6FA 1GPOL 4GRMA 3ZT5A 4OIBA 2Y7NA 4M7LL 5CCKH 1UXSB 2BRRL 5C9KA 3BCFA 4ZD3L 1E9QA 1KIQA 4XHJC 2ENSA 1UD2A 2OXGB 3RILA 1ZLEA 1SXSA 1YHPA 5LJYH 2H1XA 1X4YA 1AXTL 4M8QB 3MOBL 4HZAA 5HYFA 2A9MH 5BUGA 4E41E 5JW5B 4ABQA 5DF0A 2G60L 4YDKH 4FYRA 5TDOA 2DKMA 2K70A 3QQ4A 3S5YA 4Q0XH 5I66B 1I82A 3QJRB 4FP8H 4LKXB 4JRWA 3FOLB 1U3ZA 2Y6SC 2ZKYA 2VH5H 3R06B 3VYPA 5FB8A 3QDGD 1T6WA 2VLKE 1DLHB 2WAQA 1WIUA 1GGIL 2K7QA 2NSQA 3LNGA 4WZ9A 3NP4A 3TS8A 3JVGC 1BXXA 3U1SL 1OPGL 1YUHA 1FZOA 3KLHD 3MRQA 3GSUB 3Q05A 3AQZA 1E9PB 3C9NB 3ZHKA 2F0CA 3LKSB 4DKEL 1EVUA 2CLVB 4NQQA 4IGBA 4P2OB 3C08L 3ULUC 3QA3B 4MJ6A 4LCCA 4DFIA 5KS9E 2MWCA 3G6DL 3QUXC 2JK5A 4ETYA 3U79A 1NMCB 4WI0B 1K6QL 3DX6A 1H15B 5GS0D 3PP3K 3ARFD 1TCMA 1I1AA 2DWTA 3SCMA 2W92A 2EIZA 4ZFFB 5C0IA 1GGBL 3QO0A 3AQDA 4YZFF 1EBPA 3GRWH 2BVOB 2AK4D 3HLAB 5EC2A 2ED6A 2WW8A 4BWTA 4MDJB 4M1GH 3PP3H 4J3OD 2W60B 4PP1C 4MQTB 5H2BA 4PGJA 3ESVF 4Q4EA 3APCA 3MR9A 2FGWH 5J6GB 1WPCA 2V2XB 1I7ZB 1Q9OB 2APWA 2X4SA 3CC1A 4NWUL 5DRNB 2ZKXA 1MVFA 4GG8B 3NTCL 2D7TH 4GI6A 2VDLL 1SJHB 5D7JB 4ZMWA 1UZGA 2HKFL 4HXAL 5A43C 1A21A 2X2HA 5EO0A 4MDRA 3L3DA 1Z6JT 3NUKA 3BZEA 5CXPA 4Y1AB 2X3BA 1PFCA 4DEPC 5C2UB 4QDGA 1UG9A 4GQRA 3CDGA 3ZTEA 3S8WA 1H0DA 3BT0A 3BZFB 5FOBB 1ZGLB 1QFPA 3WXVL 1D5ZA 2DD8H 3S36X 1ZDQA 3DETC 1F1DA 5FK9A 3WTTA 1J0ZA 1LQBC 1I53A 2DKUA 4OZHF 2QMJA 4UUJB 4B95C 3QDMB 1MFCH 4MBRA 4YSQA 4HK3N 3KLKA 3ZL2A 2LOEA 4FA6A 1KBPA 4HBCL 5CP3H 3S37L 1B0RA 4IK7A 2YAFA 2CO1A 3FQWB 4JL1A 3TYFA 5I76B 3PFQA 2HPTA 4Y2OB 4HAKA 3THMH 4OLWL 2CUHA 4M1DH 2FWOB 2ZXDA 1DQTA 3ARGC 4OZHA 1AD0B 3RBSA 1NCDL 3ORJA 3VWKA 2HTLC 3KXFD 4BUGA 4WI3A 1HE8A 4X7CC 3WJMA 1NCNA 4X7TA 4LT7A 4NQDD 2WBJD 5JHDE 5KVFL 3Q48A 5E2VL 1MRDH 4F27A 4YAQA 4K94L 3VXMD 5A40E 4D9LH 3D2TA 3LQZA 4O00A 1UM4H 4Y2DB 2IADA 1EO5A 3FCTB 3MBEB 1MEXL 4YO0B 3X11B 3WTVA 3ZIMA 2X5PA 4O2CA 3ZHDA 5BJTB 1MCNA 3DSFH 4W6YB 1TCRA 3HHSB 3P4LA 1RFDL 3QJTB 4NNPL 2MEJB 2A0LC 3UAJD 3RFZA 1VFOA 4OAWB 3HB3B 3V7AE 1EO7A 3AW5A 3BN3B 3MRRB 1U6AL 3MJ7A 4QGTA 5A2IH 3BPCA 5JOEA 5I0WA 1MLCA 4XMKH 5E6SB 4K3GA 3SE9H 3FQXB 4H26A 1XSOA 1CK0L 3CH1A 3QJXA 4JDEA 4K5MA 1M1XA 3QEQB 2DQFB 3L9EA 2XJKA 5E2JA 3RWGB 2M1KA 5HYJB 3TOPA 5D5MB 2PTVA 3ZDZE 1XGTB 3UBFA 5BZWA 4A37A 1BZQK 3CJJA 4N9GB 4NO0B 4XE0A 1NTDA 2GUOB 3VRLE 4G42B 1UXSA 1RZJC 2CPCA 4HAGA 1UD3A 2FRGP 2OXGA 4GG6F 1AR1D 1JYNA 4M8QA 4OD1H 4PLJD 2MNJB 3IDXH 2YSTA 5FYKE 2XKNB 4Y4HB 5JW5A 2DEYX 4WUUD 4ZOAA 2NY4C 5IJVB 5I66A 1R19A 3W0WA 2F5BL 4LKXA 1BIHA 1IAIL 4RLDA 5F7KC 3FOLA 3R06A 1G6VK 3FTGB 4EI0A 1AD9B 4Q52A 1DLHA 1YY9D 3NMEA 4FQ1H 3NABH 1WFTA 5I6NA 2JKJA 35C8L 4PRPD 1G9EA 3TJEL 3KMDA 1NMBL 3E3QE 3RWHB 4AX3A 3LZQA 2V3FA 5DURD 3VSUA 4L4TD 3WN6A 4LVEA 2YXVA 1FL3B 3GSUA 5DFAA 1E9PA 3C9NA 4XBPB 4XP4H 3V4UL 1H5BB 5SX4I 2XQYK 3MZTA 4JAMB 1V3LA 2ZD0A 1OPOA 5AZEL 1XGPB 2CLVA 4P2OA 4NT6B 3QA3A 5F7LB 2E7MA 5EU4B 3BD4A 5EOQH 3F84A 5F8RC 5AVTB 4KRMB 4WI0A 1H15A 4GQ9H 3ARDD 2X40A 4FTVB 4NOBA 2D0GA 3KDPB 4ZFFA 2B2XH 2QLVB 4KKBD 4DPAX 2BVOA 3HLAA 3NH7L 3O3BB 4G8FB 2WKLA 1BM7A 1S9YB 4JPWH 4MDJA 3L3OB 4APQB 2Q86B 3VRIA 2W60A 3MRKB 3UYRH 1GC1H 4DO5A 4OD3H 3SGJA 5IBLD 3I50H 3T0EC 3WIHH 4LCUB 5J6GA 2V2XA 1I7ZA 1Q9OA 4N90E 5DRNA 1RZQA 4GG8A 4MSWB 5DO2C 1SJHA 5D7JA 4HPYH 4RETB 3CDCA 2NZ1A 1CXLA 1DQQA 3NSCA 1HH6B 3AWEA 2LGNA 2TRHA 3MLSL 5CMAB 1WE5A 4Y1AA 5FUOH 3QFJD 1T80A 4U7SA 3FAXA 3EH1A 1SN0A 2G5BB 3BZFA 5FOBA 4K7PX 1ZGLA 4PYGA 1CT8B 3FUIA 5SWZD 4M6NL 4QRPD 4Z7WE 5MP6L 1XIWC 1HQRB 2X1PA 5J8OA 3RVXC 4UUJA 1KJMB 3QDMA 3E3QC 2QQKH 5H37G 3FC8A 5GS2D 1MAKA 2JXMB 1QI4A 2DWXA 1UH3A 3FQWA 5I76A 4M8VA 3R0NA 4ODXB 2MPVA 1ZA3B 2AQSA 1ZEAL 2BNQD 4NCDA 4ZNCD 2FWOA 1I9JH 4NQED 5DRZB 1W8OA 5ECJE 2OK0H 1AD0A 1CDUA 2NY3B 4U6TA 5EOCJ 4WFHD 3KYMB 1D3CA 2ADFL 3WTXA 4FF9A 2BFGA 4XZ4A 1JI1A 4MXQD 3H3KA 1G1OA 1NSNH 4Y2DA 4G8GE 4PJBE 2O61B 3FCTA 4CSSA 2R83A 1ROWA 3C6LD 3MBEA 4AGLA 2C3WA 4DP8X 4YO0A 3X11A 4UIKL 2DS4A 4AH2B 2J5LC 2Y2TA 4XMPL 1SN2A 1QHOA 3EW3B 3VD3A 3HHSA 5D5MF 4IKKA 2VZUA 1ZOXA 4OAWA 1E3ZA 1EMTL 3BPLB 3MRRA 5KEZA 1ZVHA 4AZ8B 2AXWA 1AKPA 3RVVD 5DS1A 3FQXA 3KPSD 4JE4B 2Y1VA 4Q9QH 3QEQA 1M57B 1FNFA 1PBYA 1MW0A 2DQFA 4FYTA 4RH4A 4GBXC 3RWGA 5I19H 5KYNA 5HYJA 4FLOA 5EF1A 4ZOCA 3JWOH 4KKRA 5D5MA 1XGTA 3TWYA 4FQLL 1DDTA 3OD3A 2NNXA 4POZD 2QKIB 2OR9H 4QO1B 4NO0A 2WNGA 2GUOA 2JTDA 2VQTA 4G42A 2XV0A 5I0DA 1J5HA 4TQEH 2EH8H 4BYHA 1KCWA 1ZTXH 4XNZB 1JMXA 4EVNB 4N3TA 3QXDB 4TKWA 4BA0A 2QSCH 4HZLB 1RPQA 2XKNA 5KG9B 1MFEH 4Y4HA 4KI1A 2IDFA 3NOIA 5CZXC 3SOBH 1F45A 4MMXB 5IJVA 1RSYA 4JG0L 4POYA 4FNTA 1KCKA 4Y4KD 2VDNL 4J3SA 3FTGA 2E7LA 1AD9A 5K9OB 4H0GA 2R7EB 4Z0BH 1J18A 5HY9B 5BS0D 4XHJD 1GW6A 2BVPB 3H6JA 5AG9A 2MCMA 1BX2B 2Z1KA 2ERJB 4K3DL 2X70B 5I1CH 2WUCH 5FDYA 2YBRB 2EJ1A 2AAAA 3RWHA 4LP5A 2ZXWB 1JGUL 3L1GA 1T7VA 3H9HB 5IJBC 5L7XL 5JHMA 4FL4B 4LESA 1FL3A 3GZKA 2YGOA 4CBZA 3GI8H 4FQCH 4XBPA 3BWUC 3WNKA 2XTJD 3KR3L 5MHSE 3WUZA 2TAAA 4JAMA 1RUML 1XGPA 2Y6SD 3QIUB 1NCGA 4NT6A 5EU4A 3MGTB 4HMDA 1AANA 3WFEL 2FYVA 1KCUH 5K59F 2DB8A 4DEUA 1XD0A 4ODBD 5TE7H 4P2CG 4Z7OB 3R7RA 3B3BA 4G5AA 2JSFA 3TBBA 4ZYKB 1FE8H 5AOIA 3BQUB 3B2UC 1N70A 4N2NA 2YD5A 4FG6D 1K2DB 3O3BA 4G8FA 3IB4A 1GTFA 1S9YA 4TUUA 5I6XB 4MQ7B 3L3OA 3NA4A 4APQA 2Q86A 3MRKA 3WKYA 5LXGL 3FUKA 4IRZH 4KZ0A 2OYKA 1PJWA 5C08E 4OF0A 1YMHB 3LEXB 3GSNB 2NNRA 3TZVD 1UB6B 4MSWA 4H20L 4YBLB 1KNOB 2DYPD 5E7FA 3BUQA 1U58B 4BZ1L 1HH6A 5CMAA 1QFHA 4AYSA 2PYED 4OF8A 4KKPA 2X4TB 1SNRA 3OLDA 4H4NA 2DD8L 2YPLE 3TO4C 2G5BA 4JJ5B 5LWYL 3CZJA 3CFUA 3IJSB 3P0YH 1CT8A 1T83C 5DZOA 2C1OB 5C0NC 2BS8A 2Z7WA 2R69H 4L3EB 4PP1D 1HQRA 2NR6C 3B37A 5B7FA 1LJMA 2F61A 3FFCE 3PHOB 1KJMA 2J7LA 4BA8A 3CQFA 5T3ZH 4ALAH 1MHCB 2VRAA 2JXMA 3THML 3NJVA 5BOJA 1A7PL 1AQDB 3HG1B 4ODXA 1OALA 1ZA3A 4P3DB 3UZVB 5C3TA 2IANB 4BFJA 5DRZA 2XV6B 3O6MH 4L4VE 4XBMA 1NEUA 1TU2B 3CBRA 1D7FA 1KZQA 3FUDA 3O8XB 4AY0A 1UKTA 3FCBA 1MCPH 2YFNA 3G9AB 4NRZB 4Z3EA 3FRPG 3H42L 4P05A 3Q2CA 2A4CA 3KYMA 3C8HA 3DETD 1UM4L 1XF5B 1FDLH 5E6IB 2O61A 5C8JB 4Z7VE 3D50A 4YVNA 4GP4B 4HWZB 2D73A 5D55A 4X5RA 2PTTB 1D5BB 4AH2A 5CCJA 2EO1A 3IRCA 1CFTB 1L9OA 2DRUA 4R7NB 3BAXA 5JNYB 2TSAA 1IIKA 1P7QB 3ARGD 3BUYA 2NY1C 2X1OA 4NI6A 3SE9L 5L4MA 2HTLD 1H3TA 4AZ8A 1XB3A 4V2BA 4PPTA 1SMDA 5KW9H 3MDJA 2CHNA 1LDPL 4YSEA 4JGNA 2R2HB 2EC8A 3FN0L 4X9FA 4ZXBD 2ARWA 5ALBL 3A67H 1T20B 1T7ZA 1PSKH 3ABGA 1MJ7L 2QKIA 4OZ4B 4QO1A 4ORZC 5TGBB 4S1QH 1A9EA 1TFHA 2WXOA 5IHBA 3EO9H 4M03A 2C9PA 1FN4B 2B9AA 2X6MA 3KLHC 5CILL 2YO3A 1QPPA 1KBGL 4EVNA 5I1GL 1X5FA 1Q4NX 3QXDA 2PPFA 4HZLA 4ANUA 4JFFE 2OP4H 2B08A 4J3UA 4XMWA 2R1YB 2OSWA 5DJXB 3ULVF 3CLWA 5FFLA 1FHGA 2NW2B 4MMXA 5JA8B 4GQPH 3UTQB 5IT2L 3P3YA 3QCTH 1J5DA 2N4IA 1JF1B 5TF1L 3TGXA 5K9OA 3KLSA 2AJXH 3BDYH 2R7EA 1P0SE 3QPQC 4OLUL 5HY9A 9CGTA 2BVPA 1BX2A 3CZGA 4QNPF 2X70A 2ZJSL 4S0SD 1LE9B 2FQEA 4JREB 3QI9C 1ZPLA 2YBRA 1GYVA 5DZPA 4PD4K 5D4JA 5DD5H 1JZ5A 2VDRL 5JIIA 4AJVA 3AABA 2K6YA 3H9HA 4CC0A 3F7LA 2H9GB 2ZSWB 4HV8B 5DUPH 2CPUA 3BGAA 4P2QE 3WMSA 2NX5E 4XPTL 1LVEA 2EDEA 1MCEA 5EN2B 2FT7A 1ZTMA 3QIUA 3A0OA 3D85A 3TTYA 3MGTA 4RGOL 5TE4L 5CUSL 1BP3B 5D7LB 3CPUA 5KANG 4XVJH 3FO0H 2G2PA 4QWWC 4EDWL 2W9DH 4ZYKA 3BQUA 2IPUK 4WDIA 5HI4C 5BRPA 4HFWB 3O0RH 2V9RA 4Q7DA 3GBNH 4JVUA 1K2DA 1FC1A 4MQ7A 3I50L 3U9PH 4Y9BA 4OLYH 3CXDL 4K23L 3VJ6B 2D9CA 4HZ1A 1J10A 4KHXH 3D05A 3D33A 1YMHA 3LQAL 3LEXA 3GSNA 4LLUB 1UB6A 1KNOA 2QTVA 3WHE0 5FPIA 2JIXB 1U58A 1RLBA 5IREA 3S35X 3K46A 1ACYL 2P1YA 3NJFA 4FQXC 4FCHA 2X4TA 2Q8BH 4JJ5A 3IJSA 5JIMA 2C1OA 5ABAA 1HSAB 5A2CA 4L3EA 4QXTB 4KRPB 3AITA 2XOTA 2BY1A 3PHOA 4W9CC 3CN2A 3T0ED 1MHCA 2V17H 3G6AB 2J8UF 3AU1B 3OHXB 1AQDA 3HG1A 1E27B 8FABB 1RUPH 4P3DA 3UZVA 4JG5A 1BFSA 2EIDA 2IANA 3AQYA 3EJUA 5DVLA 3MJ6A 4UOW1 1FYHB 1TU2A 1XR8B 2BHUA 3O8XA 2Z8VC 4B7LA 3N0PB 1DVFB 1EJ6A 1G9ML 4ICXA 2WUBH 4NRZA 1OLZA 4PJDB 1TQVA 1ZLUK 4Y5VB 2Y1ZA 3UTTB 4QXGH 4HIEB 5I74B 4ANKA 5FGSA 4AVIA 5GSVB 4FEMA 4K8RD 1XF5A 3EBHA 1XIWD 5I1LB 3VFOB 1F3RB 5F21B 4D0BB 4CKVX 1ZLUH 3UX9B 2EC9T 1C8QA 5F6HI 2EUWA 3MRMB 4M5SA 5B1AB 5MERB 2X4NB 4HWZA 4JCMA 3Q1EA 2PTTA 2WYTA 4ONOA 4A66A 1D5BA 3PDDA 5I6MA 1CFTA 3X3GH 4R7NA 3SGKC 5JNYA 1P7QA 2K45A 4MXWL 4TQIA 5DHXB 3SE4A 1H8NA 4Q9QL 1PZBA 2R2HA 3O2VL 1QLFB 3PXJA 4MJHA 3CFTA 2A5UA 3M88A 4IEFB 1T20A 5GGRY 3ZRSA 5AVQB 4MNGE 4U1IB 1CGXA 4OZ4A 5C2BH 4UTAH 2CU9A 1OAXH 4P04A 1PCSA 1WBYB 1BF2A 5IB2B 1DJWA 1WZKA 5DZLA 3LXAA 1QRNB 4B41A 1FN4A 5EUOE 4YXHH 2R2BA 1E4XH 3NCMA 3ZZLA 3RA7H 4M7ZC 1M7XA 3OJDB 2VM9A 3WTSA 4CGUB 3T0AA 5TD4A 2IH3B 3O4OC 4CMHC 3N1PC 5KYYB 1HIML 3QUYB 4LPUA 3UBXI 1O6SB 2R1YA 5DJXA 2MTAA 5T33H 2NW2A 4LPXA 4K5NA 4Z7AA 3WFDH 3UTQA 3VGHA 4HU8A 3KL3A 1KEML 4P5SA 5C0RH 2CKNA 1DBJL 1BYPA 2WCGA 4R4FH 4HU2A 4PRDB 1JF1A 2HZHA 4POUB 2JCCB 4ENEC 2VR8A 3SY6A 5TQ0L 5FF6B 2WUCL 3Q8BA 4UAHA 4Y2NA 4KQ3L 5DMGC 1RURH 4XB3A 2YMOA 3MV8E 1LE9A 4X0KB 4DO4A 1FWXA 1S46A 3WKMH 4HIXH 4V1DB 2H9GA 4X7DC 3WBDA 4GI8A 1EJOL 1U2HA 2HJKB 4FNQA 5D96C 4HV8A 2XTSA 1TTFA 2VW4A 3O6LL 3BCDA 1VLXA 5EN2A 4AE1A 4F7KA 4I9WD 4Z77B 4IIQC 4RGND 5D7LA 2LU7A 3RHWK 1JWMB 3HS8A 1BD2E 4MA7L 1ZAGA 3OMAB 4QHPA 3MLVL 4NZUH 2UV3A 2ZXAA 4HFWA 4JO3H 5CU9A 5JDJA 2DWEB 3ZDXE 2G3MA 2CLRB 3BW9B 1W0WB 1UGNA 5KSVB 1UXMA 1IAII 3DRQB 5IGXL 1IQDB 4PJHE 3VTTA 4N5ED 4NPKA 3STZB 5BRZE 1N5YH 1FBIL 3H9ZA 3HBZA 3VJ6A 1AO7B 3UZQB 3VFSB 3W11C 3IWUA 1QVOB 1B3JA 4M8RA 3U2JA 2JIXA 2F53E 4N2AA 3BO8B 2BSEA 3RWDA 2DMGA 5DD6B 1Y07A 1A4KB 1PIFA 1RH8A 3P0YL 3B2UD 5C07B 3UAEA 2IGFL 2X9ZA 2Y7LA 3KL0A 4AC2A 3PYCA 3BN9C 3LZLA 5CJXC 5C0BE 1HSAA 2HG0A 1OLLA 4QXTA 1XL6A 4O2FB 1A4CA 4KK5C 3LZRA 2DKSA 5DUJA 1TQSA 1JHLL 3VMOA 4PJDF 4IHBA 3G6AA 3VU1A 2PR4L 4TLSA 5F7EH 3OHXA 3S34L 1E27A 8FABA 3DX3A 4AQEB 3SBWC 1T0MB 1X3DA 1XR8A 4AYGA 4P5RA 4S2SB 5LCVA 2Y6TE 3RL1B 3PQYE 3WDHA 1DVFA 4N8UA 5I1IH 2DBLH 1J48A 3TO4D 4IYKA 4U1KB 4J3TA 1ED3B 4PJDA 2CK0H 3IK2A 3UTTA 4HIEA 1P6AB 2F8VA 5GSVA 1W0YT 5GJSH 2DQGH 4NFCA 3VFOA 5I1LA 3ARUA 4D0BA 3LKRB 3WGUB 3MRMA 4S1RL 5MERA 2X4NA 4LIQH 3F6JA 1NAKH 3VFGH 4N1CA 4G2AA 3RE0A 2B5IB 3CSBA 3MX0B 1PLAA 4KXZI 4TOYH 2F58L 5J13B 3ZZ1A 4X5XB 4BGLA 1RUQH 4PRIE 3DVGB 3ML9A 4LHUD 1T4KB 3OQRA 3FSVA 2VXQA 1CYXA 2ZWKA 1HDMB 5EN3A 4NM4L 2DQHH 4UOJA 1QLFA 2DICA 3MNZB 2HMIC 4IMLB 5KOVC 3Q8FA 4ZMQA 3NIDF 4PHXA 1MRFL 3PV7A 5CSZB 2ZSVB 1PX4A 5I15H 4IEFA 4YHZH 3BGFC 3VXUB 1T21B 3NRPA 4X42A 2B4CH 4NBXB 2ZUUA 1WBYA 5E94B 3P73B 4EEEA 3RTQB 5IB2A 4GQQA 1R3IH 3OLEA 1QRNA 1YPZE 3EJZC 5EOCL 4G7SB 1MPAL 2NY1D 3MV7E 4G6JL 3OJDA 1FSKC 3HNSL 1S3KL 4K9JA 4Y16C 2IH3A 3TVMC 3OKKB 3BI9X 5KYYA 2H2SC 2HX7A 3QUYA 3S4SB 1JBJA 2OX5B 3SDDB 2JJTA 2F8XC 3GHBH 1DBAH 3MU3A 4IKIA 1XX9C 3QRLA 1CGSL 4NJAL 5B4MC 4GRLB 4PRDA 4YOKA 2JCCA 3GGWB 1BPLB 4AZUA 1L9TA 4NQDE 2QPFA 5FF6A 1UD6A 2ITEA 3BVDB 4MCNA 4KMQA 4YHML 1SBBA 4PY7B 2GIMA 3QZBA 2TRYA 4P46B 2VZ3A 2CBQA 4QTFA 4X0KA 1MJUH 4AIOA 1N64H 4ZAKB 4NJ9L 5HHOB 3DDGA 4XCFL 1A7BA 4QXUL 2SODB 2H1PH 4V1DA 3AREB 2QVKA 2HJKA 3HC0A 3CFCL 4OFVA 1FL5B 4XP1L 5TE6L 1GOGA 1EQWA 1WFUA 4IRSC 1L9PA 4RDQF 1X5YA 4OCYL 3EYSH 1GOFA 4PJ9B 4OD2B 1N4XL 4OI7A 4JY6B 1JXJA 3U1QA 4Z77A 2D2OA 5FW8A 2EZ0C 2YBGA 4BELD 1JWMA 4K9EL 3N6YA 1B4TA 2VERN 4N8PA 3T4YB 3ZTDC 2DIBA 3QI9D 1QATA 5E0QA 2AJUH 3NCBB 2DWEA 4PJ7F 2CLRA 3BW9A 1W0WA 2J12B 5KSVA 2BNRB 1JPTH 2DLIA 3QQDB 4GO8A 1IQDA 2ZCZA 4OLYL 3RZCD 3STZA 4MNQD 4RZKA 4M02A 2OMUB 3OR6A 1DJZA 1KIUB 2P5PA 3WGVB 1AO7A 4IKLA 3UZQA 2PWFA 4EI5B 3VFSA 4TYUA 4R90L 1RPKA 2ALWA 1QVOA 1V3KA 2B1AL 2YQGA 3NCFB 3SO3B 1IGCH 5F7MC 1RY7B 1TSHA 4F5CE 5JTWA 4UDUB 3T2NH 2XWJB 2O6FA 2Q8BL 5DD6A 1A4KA 2MQ0A 3T09A 1IKFL 4FQ2H 2Z6FA 2E9IA 3ECWA 2J1WA 4RQQB 3E8UL 1G0YR 2COVD 1NWPA 2YGPA 4O2FA 1CD9B 3PV6B 5E6ZA 2DI9A 3SEPA 3K2KA 3I6KB 5CLYA 1IEHA 2X1QA 2CO6A 3RNKB 4E2OA 2CJUL 3F7PC 4EIZC 1L7IL 1F97A 3X1EA 1PL3A 2W0FB 3VW3H 4AQEA 2DMHA 2A83B 3G5WA 5L2JB 5DJAB 1T0MA 2HT4C 1S9XB 4AV4A 3BUIA 1A4JB 4S2SA 3RL1A 3NK4A 3IKKA 1JF6A 3S3BB 2WLIB 5AOLA 1BJ1J 2YRZA 4QXGL 1ED3A 4U1KA 5AKSA 3BXNB 2KMWA 1OP3K 1LEIB 3HCVB 1QI5A 4ELKB 1MOEA 2EADA 3RIAK 1TEYA 4IHOB 3SKJL 3ZKND 3VNYA 3LKRA 3GXUB 4EQ3A 4URTB 5IQ9A 1OP3H 4WI7A 1W16A 5FDWB 3VG0L 3GMMA 4GSDH 3EOTL 1EA9C 1CFBA 3MX0A 3L5WB 5J11C 1MFBL 2Z0UA 3HNTH 4X5XA 3V79C 2ARJB 1B2WH 4R26H 3ZQWA 3DVGA 2PPDA 1EAOA 1JV5B 1T4KA 3NSFA 2YK1L 1HDMA 1RZKC 4AVKA 3SSGA 5IVNA 3MNZA 3CUPB 2DQDL 4IMLA 1CIDA 3HLKA 5CSZA 4BH8B 3NG5A 2ZSVA 1IC4L 3SBRA 3PWUB 4PIBA 3RP1A 1ZLDA 1IT9L 3VXUA 5DD1H 2OZNA 1T21A 4LFHG 1NC4D 5CN2A 2C26A 2X4PB 2YN5A 1UJ3A 5E94A 4YPGB 1IEAB 3P73A 4FXLA 4YHYC 3RTQA 1IAMA 5FM5O 4TLUA 2VXVL 4LP8A 5DZAA 4Z3GA 3I9GL 5DZ9A 4BFBD 4OZIB 2XWXA 5D1XD 1ASOA 5C1MB 5MENB 2AKRB 2VDMH 5CBAB 4LCWE 2X89D 3WE1A 3BD5A 5C7XH 2H0FA 3H4FA 5GGVY 1E6OH 3FTSA 5E51A 4WFGD 3S4SA 3N0AA 2C3XA 4HIJB 2OX5A 3SDDA 3WFDL 1PZCA 4LZKA 4OCXH 3L5IA 4NQEE 3MUZ1 4X8XA 2N01B 3SDYH 3FPYA 1XAKA 4GRLA 3HHMA 2P26A 1H6UA 5FM4A 3MLYH 4N1EA 3GGWA 4UQ3B 3QUXB 3HEIB 5GGUB 2M83A 5DJYB 3X2QB 4CUCA 2XN9B 1EXGA 3Q06A 3VI3F 5JIPA 1WA2X 4B9IA 4X4ME 4PY7A 4P46A 3MOAH 4JFED 1TSRA 1NCWL 4ZAKA 5HHOA 3ZXAC 3ME0B 2EYSB 5KTEH 2NY2B 3DHUA 1C08B 4DGIL 1MFUA 4NZTL 3AREA 3TEYA 1A22B 2NY0C 3UDWA 4BQCA 4BWWA 1KGJA 1MIEH 2O26U 1FL5A 3C5ZC 3R7QA 5BZZA 3GUTB 5AW0B 4HLZH 5DFVC 3FUNA 2IV9A 3DK0A 4OD2A 4PJ9A 2CNZA 4X83A 4YLQT 4JY6A 5KUMA 4E41B 1K5NB 3S36L 2HRPH 2V4LA 4H44C 1A6PA 3IFLL 3PDOB 2WZPA 1E5UI 4QUOA 4YDIL 1FGNH 3ZZSA 4JO3L 1CUOA 3BUPA 3NJMA 2VLKB 3E9TA 1RV6X 4LSUH 4HJTA 4A2GA 3BRDA 3VSQA 2BNRA 3QQDA 5L8LB 4PJAB 4TV3A 3TONA 5T3ZD 1ECZA 2OMUA 3ALXA 1AOHA 1KIUA 4ZODA 3WELA 4EI5A 1OM9A 4PUBL 5IJKA 4DNLA 1I85A 4J3BA 2OL3B 2X2IA 4XX1E 2Y07H 1DVQA 4UDUA 1QLEB 2YEVB 3VQMA 2XWJA 5GXBB 1X44A 3BEVB 1BBDH 5J4MA 3NJXA 5KS9B 4WSJA 3EYFB 5IQLA 3S3JA 3HRPA 4RQQA 2PW2B 3OC8A 2AEQL 5BS0E 5M94B 3QIWD 1BIIB 2ZNXA 1IJNA 3PV6A 3LEYL 1OWWA 5CEZH 3I6KA 5EV7A 5C0AE 5F7EL 3RNKA 4KZDH 3FT9A 1CE1H 2FX9L 2B9BA 3SB3A 4LCIL 3Q5TA 2W0FA 4YDJA 4XP6H 3TA3B 2A83A 3BVWA 2NY6C 5L2JA 5DJAA 3NDYE 3EKCA 4KI5F 1S9XA 5HJBA 4BCZA 2HRHA 1KWGA 4ZX5A 4JR9H 1J1XL 2XZQH 4NBZB 2J5WA 2WLIA 4UWQB 5LXVA 4RX4A 3F8UB 3BXNA 5HGAB 5FM5M 2AMUA 2P44B 1CN4A 4LOUC 3HCVA 3N1GC 2OW7A 5HHPB 3WNNA 2WZ0A 4ELKA 4W9EC 3K81A 3ASOB 4IHOA 3VSTA 3ATEA 2G9KA 4Z7UE 5FDWA 1RZIB 2P5WE 2CRMA 4OF6A 3ZTNL 2E3VA 2Q20A 4PJGF 1KYDA 2VR3A 4EZKA 3BVUA 5LNDA 3L5WA 1HHJB 1HVXA 3GXFA 1RUQL 1T1YB 5D7KE 3DA0A 5AVWB 3ZMEA 2ARJA 3FO2B 4PG9B 4DAGL 1NJ9B 4OR1A 4Z78B 1JV5A 1DBBH 4KPHH 1GGCL 3FU5A 4IMKA 4DK5A 5ISZB 4Y9FA 3WHXB 4L3AA 3DOSB 3GO1L 4I4WA 4R8WL 3CUPA 1QW8A 2BSBA 2A9NH 1FIEA 4BH8A 4ZX4A 2V9UA 3PWUA 4NO3B 1B0GB 1ONQB 3LH8A 4MAUH 4HIIB 3UPRB 2PYEE 3H3PL 1S7QB 3K7UA 5JHDB 2X4PA 3H55A 1NCCL 1AS6A 2AQTA 4IJ3C 4WGKA 2WCPA 3TWCL 4YPGA 1IEAA 2J25A 3GSXB 5IY5B 3WIIL 3FT2A 1H3PH 1MFAH 4KK6D 1DVSA 4WI5A 4DQOH 4OZIA 3HPJB 4NPYB 4WSKA 3CU1A 2GEEA 2FIKA 2VLMD 1GOHA 5AKTA 3V8OA 4DO6A 1NBCA 2AKRA 5MENA 3ULUF 5CBAA 1WWAX 3MV11 4YK4B 4R0LC 4HIJA 3T3MF 4GIAA 1PJ9A 2ADGB 2AXJA 2YD1A 5ADOH 4L8SC 3LIZA 5CNHA 2BZDA 2F7IA 1WVZA 1MAML 4X4ZA 1JGEB 2VAAB 1Z9NA 1TPXB 1EO8H 3BFQG 2LTQB 3PUUA 5GGTH 4UQ3A 4HOXA 4IOIB 3QUXA 4JKMA 1QTSA 4JPKL 5DJYA 4JO4H 2XN9A 4ETQB 5BUPA 3MV9D 2DLTA 3DI3B 4HQQL 2Z8WC 5CFAA 1TENA 2F5AH 4Y16D 1NGPH 2YOCA 3MPCA 3ME0A 3BKCL 2EYSA 5DVNA 3DJZA 4YHKH 1GCYA 1C08A 4Q89A 1CF8L 3BZ5A 4CAGA 2UUDK 4I18C 3MJ9H 1XGYH 2KPWA 3DBSA 2VR4A 5D2NC 4N0CD 2D2CC 3GUTA 1HILB 4DWHA 4HKZB 3ZUCA 1QR1B 2YA0A 4AJWA 2UUDH 4IBTA 4K7PL 4E41A 1K5NA 3O4LD 4HUWB 3BZ4B 5DK2B 3PDOA 4Q9RH 1XSJA 2QT6A 1U92B 4NQVB 4LNVA 1XMWA 4G71B 2AJZB 3RI5F 4AOFA 5C0EB 3CN4A 5JZ7C 1IKNC 5C3IA 4JG1H 5T1KD 2VLKA 3REWB 4LSDA 2QL1A 2VN7A 3D39B 4K94C 2C9QA 4EN3D 4PJAA 2B1HH 1QUPA 4IBSA 3MBXH 5JPMB 2HT2D 3RAJL 3D87B 4K07A 4PJCF 4BXVA 1CICC 4LSSH 4XNXL 5KS9F 4IK6A 5IMMB 5KYXB 1IGFH 1IGCL 3TM6A 4DP5X 3GXMA 2UZYB 3TF7C 2JI1A 5I73B 3LD8B 2H32H 2A38A 4BHUA 4RWYL 4OM0H 3BEVA 4BV1A 5KS9A 4H8WH 1WAAF 4XBGB 3VGFA 1LM8V 3EYFA 4HUCA 4ABWA 4UB0H 5GISL 2PW2A 2WXFA 5GZOD 3VFVB 4WO4C 1A6VL 4HALA 1TXKA 2PCYA 5EF3A 1KXHA 2YD8A 1BIIA 1GY1A 2ENJA 1MZYA 4WFED 2BHFA 5F7DB 1AJ7H 3WN5B 1WIPA 5ACLA 4ZW3A 3ARZA 3L4YA 3MNDA 3TA3A 4LGSB 1U8CB 1S7TB 3FT3B 5I0ZA 1JGLH 4JN2B 2VNCA 3BJLA 2KLSA 3KAAA 5I8EA 4M7LT 4PVMA 2K7PA 4NKIL 5HGAA 4AEFA 3RGVC 2QPSA 2CBMA 5HHPA 4KVCH 3SPIA 5LGJB 3FBQA 2CZNA 3GSNL 2J1YA 2VUYA 2YQ3A 3I6LE 1FP5A 4XTRC 3QIBB 1RZIA 2HVJB 3JSSA 4ZTPL 5HI3C 2BIMA 3RFRA 3LS4L 1DBKH 2PW1B 3TIEA 4Z7WB 1DO5A 1HHJA 3DX4A 1T1YA 1ETB1 3HI1B 1KV3A 1IAOB 4Z95H 3VXRB 3B4NA 3JV6B 3FO2A 4PG9A 3WO4B 1NJ9A 4ONFH 3RZWA 4ZMXA 2ZAHA 4Z78A 4ZW6A 1INEH 3L08A 3QORC 1A25A 5BW7C 2EXTA 4ZQTA 1A14L 1GGYA 1U91B 3H4HA 4LAQL 3WHXA 3DOSA 3DGCR 3UBGA 4EUPB 4UQCA 1FNAA 1RK7A 2GSMB 2L7EA 2DW5A 1UWEH 3ZKXC 1TTGA 4NO3A 1B0GA 1ONQA 5DMIL 4HIIA 5FV1L 3UJJH 4B53A 2G9HB 5KAQG 3UPRA 3DUSB 3W9DB 3D8MA 3EO0A 5JHDA 1S7QA 2VN4A 1SOQA 1S2EA 1QWUA 4N2LA 4XXWA 5G2NA 3STBA 1DLFL 4KQ4H 3GSXA 5FYLD 3VD9A 4Y2LA 4G8GB 4PJBB 2XWTB 4KVNH 4MS8C 3DRTB 5J12C 3HPJA 4NPYA 1R0AL 1BVOA 5EH1A 3C8DA 3I6GB 3RPIB 2ATPB 3VNZA 4FFZA 3SDXE 4KMLB 4TSAH 5DWPA 4RNRB 1O5DT 4RFOH 2GT9B 1T1WB 4N0RA 4GRWE 2EDTA 4AG4L 2ADGA 2BW4A 4K5PA 3ZDZF 4EXPX 5DMYA 4NP4H 2ZOLB 1PAZA 4QRAA 2MJWA 1VJSA 5CS7A 4Y19E 1JGEA 2VAAA 2ZKMX 4HX1B 1JGVH 3LYRA 4JFWA 5GGSB 1LLAA 4IOIA 1MXGA 1UWGL 3NRQA 5FO2A 4G9FE 2BXYA 4ETQA 1TZIB 2GITB 4OCSH 1EEQA 4M9OA 2X87A 5KYUB 5KSBB 1S9WB 1KULA 3ZTCC 4MJ5B 1NCTA 3LJ3A 3WSQH 4U7KA 1YEJL 5KJ7E 4PP2B 5C0CE 3I75B 4FJZA 1GGUA 3V4PB 3WAJA 3VD1A 1YQVH 4ADGA 4BFEA 5HDQL 4HFUL 2PO6C 3QJFB 3MACL 3MXVL 1HILA 3ARBD 5I6PA 1TYEB 1DVYA 4HKZA 2IPKA 2DQTH 3OF6A 1QR1A 5GGVH 1PVHA 3ARPA 3GNML 4PVBA 2UYLB 4HUWA 4HKBB 2IPTL 3BVTA 4S10A 1HWGB 4UILH 4I9XA 4NUQA 4Q6IB 1KN2L 4NQVA 1FH5L 1U92A 5DK2A 4AL8C 4HMEA 2AJZA 3IU4H 4QJ4B 3B5HA 5C0EA 5D93C 2CK2A 3CSGA 1AACA 1J8RA 3IRZA 2EDMA 2QSTA 2NPLX 3ATAA 5GZND 3REWA 2APBA 3CMGA 2VR5A 4FD0A 5KVEH 4R3SB 5E08H 1DQJB 2CKBB 3P3SA 4LDCA 3JTSB 1CURA 5IV2B 3SDCC 5I0VA 4YMPA 3BMVA 3L4CA 3D4GA 3HC3H 3JQOB 3QZWB 4RMBA 5IP4A 5JPMA 4LPWA 1BYOA 1E2VA 4PM1A 5HD8D 4L3CB 1A9BB 3TU6A 5DFVD 4XVTH 5IMMA 5KYXA 1UVQA 1JRHI 2DM4A 2HUEA 3KJ4C 3FT4B 3KYNB 3PG2A 5ALCL 2UZYA 5I71C 3KWVA 3L4WA 1ETJA 1RIHL 3EFOB 1RIVH 5ITBH 1HKFA 2R0WL 4ZUUB 4ZPVB 1XR9B 2QSQA 1M2OA 4XBGA 1TQCC 2D03H 3DX9B 4D9RE 1BQKA 1OTSC 4QY8B 3QG7L 4UNUA 1S5IH 3RWEB 1YMME 3RKDC 3X3FH 1HXYB 3UZEC 2QVIA 2XV3A 2JELL 3NPSB 2PCPB 5F7DA 3FL7A 4ZFGH 3BUTA 1TF4A 1K8DA 5ACMA 4JFPB 5E8EB 3O2WH 3IFPB 1U8CA 1S7TA 3FT3A 4XP9L 4HWEH 2A74C 1AYRA 4WTWA 4JN2A 5C08B 4D8PB 3VFPB 3CFEB 1V10A 2WXMA 2F7OA 5F89B 3GK8H 4XVSH 2WZAA 4JRYD 1X5HA 4Z7WF 5HI5C 5LGJA 4PRHB 1CXHA 5I75B 5GGQH 3QIBA 4Y8DC 2YPLB 3W38A 1DBML 2HVJA 3HMXH 3QR2A 3QUZB 2ZCLL 2PW1A 4BXSV 4Z7WA 1JVOA 1S5HB 1DZBA 4J39A 4M93B 4NAJA 3BESR 1IAOA 1IAKB 1GZQA 2EDWA 1I8LA 3FFCB 1RHFA 3JV6A 2ADJB 5SWSD 5LG6A 4KPHL 3LZFL 5DVKA 1PG7H 1W0VB 1UOKA 1B2YA 1CLYL 4NSKB 1OM3H 4YL9A 1W9XA 1U91A 1SLXA 1RL1A 2J43A 4EUPA 4GIPD 2OBGA 2XBZA 3RGHA 4L4VB 1YNLL 4N68A 2MCG1 1AQKL 4X5QA 1RLWA 2DQJL 1JTTA 4ELMF 2G9HA 3DUSA 1ITBB 1KLUB 2QLYA 4XB7A 5CGYC 3W9DA 4WVRA 1IC0A 4JRXD 4Z8FL 3IMRA 5LCVL 5FYJL 4G6FB 1MFAL 1BXUA 4DQOL 2P9RA 3MUGB 4YXLL 1QSFD 2V7NA 3BWUF 5ETUB 1GYUA 1NCAH 4G8GA 2X6UA 4PJBA 4Z7VB 3DRTA 4K3JH 1JZ8A 3I6GA 3RPIA 2ATPA 1U0QA 1TQBC 1YLBB 5CD5C 4RNRA 2GT9A 1T1WA 4GMTH 1F4HA 2A3TA 3MV01 5FS5A 4XPFH 4YHNB 2YFOA 2H7WA 4S0HA 2IV8A 4A2EA 1F2QA 4OIFA 2MQCA 1C5DB 2F6AA 4HX1A 1U8MB 2QQNL 5GGSA 1CFMA 4D8OA 1OCZB 3H9SD 2OYMA 3AXLB 3GSWB 1LK2B 1TZIA 2GITA 1ZLWK 1F0LA 2VXQL 2DQUL 1UT1A 5KSBA 1NGPL 1S9WA 4UT7H 4MJ5A 4YHKL 6CGTA 2B14A 4NLHA 3CLFH 5L6YH 4GAYB 4PP2A 1ZLWH 3I75A 1GMIA 3L6FB 3V4PA 3GXIA 3DHJA 2ZWSA 1F4XL 4J7RA 2HT3C 5AVVB 1SEQH 1DJYA 3UYPB 3QJFA 4ZUSB 5L4JA 3S35L 1AGDB 4R5XA 5C0GB 4JFFB 3TIDB 1SOSA 2ESVD 1NOAA 4Q9RL 2LR4A 2UYLA 3MO1B 4JM2C 5IVOA 4HKBA 3FTUA 3DXAB 4Q6IA 4LSRL 1TFPA 3PUCA 1E5YA 3OJ2C 4HUKB 5CD3B 3RU8L 4OV5B 3F2LA 1FHNA 1YYML 1EUUA 2FK9A 3ZT6A 5E56A 3ECVA 5IG7A 2GI0A 3V2AR 4JFZL 1YEDA 4NHUB 1FPTL 3FQNB 1PAMA 3LIZH 2UVEA 4R3SA 3GXDA 4UQEA 1DQJA 1AZCA 2CKBA 5D72L 1F4YH 2NR6A 3JTSA 1OWRM 1IIIA 1OAYL 5IV2A 4LSSL 3B9KB 1K3IA 1ECYA 3QZWA 1WT5A 3PL6C 3HC2A 4L3CA 1A9BA 3VWJD 4F7CB 2C4FU 1WISA 2YXMA 3NCYS 4OIAA 3FT4A 3KYNA 1EFXB 3P0GB 3RBGA 4AGQA 4Y4FD 2JKNA 3W3BA 4LCYB 4P2QB 2F68X 2LLLA 3N3EA 3EFOA 1SMOA 4N0FB 2NX5B 1GKEA 4RMRA 5AL8A 4ZPVA 1XR9A 2Q6WB 3TO2B 3WFCH 5I2IB 5IESL 1ZE3C 4LCVA 4OLZH 1JWSB 3NQKA 1DL7L 1P6FA 1V7MH 3QC6X 4HS3B 4HOZA 4L37B 3DX9A 4XAWH 4QY8A 4N85A 1FZKB 1RU9H 3WV0A 1K85A 4IRJC 3RWEA 1Z1WA 1HXYA 1BW8A 2PCPA 5FGCE 2UY7B 5HYQB 5L2KB 3S4SG 1EWHA 1M2VB 3Q1SH 3KW8A 4B7IA 3WNIA 2ZXQA 4JFPA 4JPQA 5E8EA 3IFPA 3TPUA 2DQEL 5IVZB 1V3MA 4LPVA 5C08A 5FCUL 4J27A 4D8PA 3VFPA 1UENA 2AZUA 2WPGA 3CFEA 3JV0A 4FMKA 5T3XL 5HDBF 3ZBMA 4YE4L 1E5ZA 3H2WA 5F89A 1E4KA 4ZOEA 5GRVK 1OAZH 4RA0C 3DVNB 3NGBB 5JIKA 3LHPL 4KTDL 4BQ6A 2OL3H 2YPLA 3OGCB 3VD2A 2DEXX 2UY6B 1NWOA 3QUZA 2C7UB 2E74C 2RTTA 2AS5M 1D5RA 3MLWH 1KDJA 1S5HA 1OZTG 5L88L 1D7DA 2CIIB 1IAKA 1KTCA 3FFCA 4JDTL 3T0BA 5HDWA 2ADJA 3MLPA 1EEYB 1F41A 4PJ8B 3HTLX 1W0VA 1U36A 4NSKA 1CTNA 4LQFH 5D7IE 4CMHB 4NQUA 3U4BL 3RGVD 3KM2A 2P8MB 3U9UA 3AACA 1FAKT 4G82A 1QBLH 4L4VA 5J3HC 4CVZB 2I5YL 3EBAA 4LSVH 4U6YB 2ED8A 1NFIB 1M4KA 2WLMA 3OSKA 4XTRD 3OAWA 1GZHA 4MJID 1KLUA 3OMNB 4DHLA 3RY5A 4WWKB 3G7TA 2QZ5A 1D9KC 1LK3L 1PZAA 2Q10A 3MUGA 4H8QA 2C4XA 4BZYA 3B9AA 4Z7VA 2GJJA 3PHSA 2NXYD 1MG2C 2XRAH 3MKKA 5F7NC 3QARA 3RJOA 4DKFL 1JDAA 1HHGB 3GLZA 3PWPD 4XO5A 5JPNB 2DQ6A 3W5NA 1WFIA 4OQTA 4P9HL 1GC1C 2G3NA 2VITB 4YHNA 2VL5B 1H3UA 2Z31C 3C6EA 1L6XA 5KJRL 1C5DA 1J8HE 3V6ZB 1U8MA 3LQAC 3HVDA 3T2LA 5E9DD 3AXLA 3GSWA 5AYQA 4IDJH 1LK2A 3PF2A 5I1KH 3NSJA 5C97A 3UYOD 3CMOL 1PIGA 4MNGB 1MXDA 1MCJA 2FUQA 1R6VA 1BMGA 4IJTA 4LEBA 4GAYA 3ECBB 3L6FA 4XOCA 2XWDA 3LXCA 4OGQC 4TVUA 3PGCB 5EEYA 5EEWA 1ZTXE 3C12A 5EUOB 4UBDC 2AVGA 3NAAH 3UYPA 4ZUSA 3ETSA 1AGDA 2ILLA 1F42A 3HR5B 4JFFA 4PJ5E 4KK9D 4TPRH 3TIDA 4B9YA 3VM7A 4P2RE 1BF8A 4M5YH 1MI5E 3OG6B 4PVNA 3HZYA 3MO1A 4TXVB 5B22A 5CP7B 3CLEH 3DXAA 4GXUN 3MN8A 4Z7NE 1U3HD 2CGRH 1UACL 3MRGB 4XPHL 3QDAA 1AZRA 3DBXB 4OSUL 4I0KA 5CD3A 1KTBA 4OV5A 2XIDA 3TASA 1OOWA 1E9OB 1MWAH 5E08L 1X5LA 3ZLQC 4MGXA 4NHUA 5KBPA 2VE6B 5JQ6L 2DLGA 2FDBP 2GBAA 4HJGB 3HC3L 1SUHA 3MV8B 4WFFE 4BUQA 3U0PA 2L0DA 3B9KA 4XVTL 3W81A 5EB9A 2Y2YA 3KGSA 2PXYB 4ERSH 1MCQA 4U7MA 4F7CA 1U8OB 2YARA 3BIKB 3V0VA 1EFXA 4PSPA 4O9HH 5F71A 3VUAA 4LCYA 4P2QA 2E7HA 4HPOH 1S4IA 1DQIA 2XWCA 1CU4H 4N0FA 2NX5A 4MB4A 3TO2A 2Q6WA 5IIEA 5I2IA 3FQTB 2L7QA 2ICWA 1N7MH 2FQDA 3DX8B 2DL2A 4HEME 4HS3A 3VCLB 1L3NA 4L37A 2IAMB 2M2DA 2V5RA 3TNNB 5DMJB 1BJ8A 1OZUA 3ATBA 4OVVA 1IILE 3LKNB 3QHFL 1OANA 1SQ2N 1QBBA 3FTWA 4PB0H 3LTVA 2DN7A 2P48B 4CSZA 2UY7A 5HYQA 5L2KA 3ZDXB 1M2VA 1TR7A 3S9DB 4ZRGA 2ROXA 5F9AC 4BRJA 3JV5A 4MVBC 4PJHB 5E4OA 5BRZB 1VGEL 4XMZA 5IVZA 1QHQA 1SHMA 4TNFA 2G3XA 32C2B 5G4OA 5JUEH 4Z8FH 1U8NB 2JWYA 4U1JB 4JPSA 4Z3IA 5HDLA 2F53B 4E0RB 2D7NA 2DF3A 3DHMA 4U4BA 3BIAX 1N6UA 3N1QC 3ARQA 1JFQL 4BSJA 2HJLB 1SJVA 2XZAL 4J6IA 2E27H 3OGCA 2UY6A 5C6TH 5KWYC 3DVIA 4F7TB 2IJ0C 4OJAA 1CQYA 2C7UA 3O6FC 1KT2B 5C0BB 2NY5L 3WEBA 3ARVA 2WXQA 4KDTA 3ZL4L 2CIIA 2X6CA 1BXVA 2HFGL 5AVZB 1EEYA 4PJ8A 2GCYB 5CWSB 1T6VN 2A73A 2G2NA 5HVHC 2P8MA 4EE2A 2X44D 3DGGB 2LU5A 5HI5D 4TUKL 1RZFH 2NUPB 4CVZA 1CO1A 1ES0A 3BFOA 1MCKA 4U6YA 3OLGA 1NFIA 1U8KB 2DJUA 3K2UL 5FFGA 2XCMC 2UZIH 5GJTH 4K4KA 3MUY1 3TX4A 4WWKA 2IWEA 3RKPA 4PU2A 2H4EA 1QTYT 2FLMA 3VXRA 3CC5B 1P84J 3CZUB 3LB6C 1HHGA 3HNVL 1IGTB 5JPNA 4XP5L 3QPXH 3BLBA 3DUHA 3IPBA 4D9QE 3T6VA 4OGXH 2Y7QB 4Z18A 3LCYA 2VITA 4PRIB 2PPEA 5GS1C 4IRSB 4I77L 3KJ6H 1KENH 4ZQKB 3V6ZA 1CGYA 1F8TH 1CJYA 2AABL 4FZ8L 3PFUA 1LYQA 4IIQA 1OTTC 4ENZA 3OKOB 3U0PB 3R1GH 1CMOA 2J4WH 3TN0D 3HOGA 2N1KA 3GJFK 4MNGA 3CVHH 1DFBH 3SPCA 4ADJA 2MCPH 3H1ZA 5CD5D 1L7TL 1SEQL 1NEPA 3PGCA 1YPZB 5EUOA 4IGBC 1IM9D 3MV7B 4LCCC 5CLZA 3DROB 2PNDA 4ALAC 3HR5A 3RX8A 3UH8A 3ASNB 4F7PB 4QOKE 5TFSL 4W9KC 3DPBB 2YZ1A 1I1AC 1OGAD 3CZLA 5CP7A 3SCMC 3NDZE 1A6TB 4OLEA 1PLGL 4U1GC 3N43F 3MRGA 3AS1A 2CHWA 1SLVA 3DBXA 3GD1C 5EULV 5BZDB 2FBJL 2BIPA 3GSOB 3QNZB 4QXWA 1E9OA 3LIZL 3MLZL 3S5ZA 4NQDB 1ULVA 5CJXA 5CLWA 1F4YL 2VE6A 2HT3D 4OFYA 4HJGA 4ZK8A 1ACZA 3VXMB 3MV8A 3E80A 5I30H 5HJGA 4LSQL 1ZXKA 2YR3A 4GS7B 4NWTL 5AOKA 3B6SB 1ZGLP 2VLME 2PXYA 4NP9A 1F13A 1CGUA 1U8OA 3BIKA 4LARL 2XWRA 5IMOB 4G80B 4XODA 1DJSA 1EAJA 1TETL 1FVDB 4BKLA 3PAYA 1SLUA 1WAPA 1I9IH 3V0VB 5TDNB 1NCHA 3FQTA 2ICWJ 3DX8A 4N22A 4UYPA 3VCLA 5F3HB 1JPSH 3VVWA 1LO2H 3HS0B 1BAFH 4PJ6A 3TNNA 4MJ2A 3CZFB 3GI9H 4B60A 1IGML 4GLRH 1OAKL 3LKNA 2ZOUA 2Z4QB 4N86A 1E50A 2B39A 2XKSA 1UURA 3GHEL 3JUYA 3KWUA 4AMXA 2IBGA 2BJML 5I1DB 2Y36H 3OZKA 4PJHA 3ML8A 4U31A 2K4AA 5BRZA 3VWKC 4HLJA 3V7AG 1IGIH 2PP7A 5JA9A 5HGDB 3P30L 4PJXE 32C2A 3QZLA 1U8NA 4HWUA 4U1JA 3ALPA 4M5TA 4XNYH 3HE7D 5MEOB 3BKJH 2F53A 4RESB 2IMMA 1OSPH 3IDJB 1THAA 1W6LA 4TSCH 1Y6MR 4WUUB 4E0RA 1MJ8H 1ESOA 2EIBA 4Q6KA 1JZGA 1YN7B 4TVPH 4ZTOH 1OE1A 3ZW3A 4MMYB 2R56H 1COBA 2HJLA 4FQHB 4TSBH 2GK2A 2Q3ZA 2MQ3A 4HC1A 3ISRA 4F7TA 3Q9PA 1QLEL 4JE0A 5MI0C 1UOLA 2ROYA 2VDQB 5C0BA 1BYNA 4YHYB 1IAIM 2TSBA 1HZKA 4KK8C 4K2UH 1WFJA 2Q8AL 1IUZA 2GCYA 1GVIA 5CWSA 3VFTB 3TVMA 4AI7A 3PCYA 1G1KA 2BMKB 3QBTB 4QJ3B 4XH2B 5DURB 2CA3A 4KNUA 3DGGA 1E40A 5DGRA 2NUPA 1AS7A 3KLDA 3F05A 1QFWL 2ZYIA 1KJ3L 1H9DA 2FJSA 5F0LB 2JE8A 2HH0H 2WJ5A 3D6GA 5IROC 3NZHH 1KFAL 1FGVH 3CC5A 4K9EC 4O02H 3ARDB 3SQOH 1ZLSL 4P59L 4HIQA 1IGTA 4QEGA 3IF1B 4O58L 5IHZB 2VL4A 5DEGB 3CFJB 3ELQA 4XHQA 5CINL 3WD5L 4XI5C 2GI7A 2AJVH 1DCEA 4Y1AE 1I3VA 2Y7QA 3PGFL 1R1CA 4ODVL 1PZ3A 1XFPA 4PRIA 4Y1TA 3BH8B 1Q90A 3RWFB 1RZJL 4IRSA 3D4CA 2DYRB 4ZQKA 4ODUB 1EZUA 1TZGL 2W0LA 1FNSL 1I1CA 1YPZF 4XOEA 3OKOA 3P2DA 5CJQL 2WQWA 4KTEL 1UA3A 4PWGA 4JHAH 5B38B 4BE6A 2FB4L 4XPBL 1J5OL 1MCRA 1Q8MA 3QFJB 4XNUH 3C5SB 4DQAA 2BHZA 1NANI 1CL7L 1FFPA 3LPOA 4GKSB 4GUOA 4PMFA 1X5JA 5SWZB 3GKWH 1YPZA 4LMQI 4QRPB 3HG4A 1AQHA 1CFNB 4JGUA 3MV7A 3CIAA 2CO3A 3FZUC 3DROA 1NBYA 5CFHA 3EADA 3MJ8B 4LCWB 4F7PA 3A6BH 1T6BX 2MRYA 5I8CB 3DPBA 3R8BB 1FYTD 2FTAA 4BK8A 1YEGH 5E5RB 1A6AB 2CGRL 2EO9A 2FATH 4BRVA 4G8IB 1A6TA 5ELIA 4BWUA 1BFVH 4YHIB 1BLNB 1GYCA 4FFZL 4NQEB 4A1RA 3MVSA 1AI1H 1UM5L 1WYJA 4LSTH 2R51A 2WLZA 4LK4A 1DVUA 2NZ9D 2WGNB 1KB5B 5AYUL 3GSOA 3L5XL 3QNZA 5EZIH 5BZDA 3FUHA 2AJYL 3S6CA 2OMYB 2Z7ZA 4NQDA 2BY3A 1P4BH 4M6OH 4QRSB 3SGJC 1I4FB 1PZSA 5FUCC 2DWYA 3LXBA 5FHAL 3VXMA 3OLIA 3CFMA 2GW5A 3UTPD 2FX8L 3B7SA 4F20A 2F54E 2YD7A 4ERSL 2H2PC 2HXAA 5D7JC 4UT9H 3B6SA 3V52L 1SOKA 1UFUA 3W5MA 4EZMA 2V7HB 5IMOA 3SJVD 4PCKA 2VDOH 4G80A 1MNUH 1UOVA 4HPOL 4N24A 2NY6B 1UB5B 2ZG3A 2FBOJ 3PWJB 1FVDA 1S7XB 3IE9A 4GP5B 3K3QA 1Q0EA 3WNPA 4EQ2A 5JMRA 4XMLL 5TDNA 1NFDE 1A7NL 1VPOL 4XR8C 3CQPA 4HIPA 5FXCH 3A4EA 5BMFL 3RX5A 2K0RA 3MCLH 1KWKA 3T08A 1YNTB 4KKZA 1NCUA 5F3HA 2EDXA 3KPSB 3LHAA 5E6UB 5D70L 3HS0A 4C56D 2Y7MA 3VYNA 5FYKL 2DM2A 3CZFA 1BQ5A 1LXMA 2UWEB 2QVFB 4KRNA 1H6EA 2Z4QA 3S3SA 15C8H 1WSST 2GJRA 4MZ3A 5I1DA 3ROOB 5PAZA 3QDJD 4OLXH 4MWFB 5IOPB 4MQXC 4N2IA 5F1NB 4RMWA 4G1MA 4N26A 5HGDA 3ARYA 2WLJA 2HKHL 1GS8A 4B9CA 1NQBA 2VC2H 1Q0XL 1DDHB 3QAZC 1GL4B 3FQUB 3CZSA 2AQ3A 3VGBA 5MEOA 4Y2DC 3PREA 4QYOB 2BSTB 3IDJA 4NAMA 4PV8A 1NPUA 4WUUA 1WZAA 3MBEC 4LDLB 1DFXA 4F5CA 1YN7A 4JO2L 4MMYA 4A2MA 4XAKD 1XDTT 5C6TL 1Y6KR 1E5CA 4FQHA 3VFMB 1R9FA 2O6DA 2V9QA 2Z93A 4Y4KB 4MNHB 3HB3C 4BCYA 1NBQA 1D5IH 5BS0B 2EYTB 4OTXH 3VI4E 1ZT1B 2VXSH 3O0LA 1CBJA 2FAUA 2OA9A 5EZOH 5E1HB 2BMKA 2EDLA 4XH2A 4FTVE 3OSVA 4JO1H 4LE8A 1I9RH 1DUYB 4L8SB 2XTJB 4F2ME 4F3FB 5LBSH 1KPRB 4QPEA 1IBYA 3OPZH 5CZVL 2UZIL 2H26B 2JLLA 2QDVA 4YHLH 5DJ0B 1TJGL 5CJ8A 4P4RB 4JPVH 1N6QL 4W4OA 3B1UA 5D4QA 1PD1A 1KBVA 3P4OB 1ZS2A 4KY1H 4Q97A 4UV7L 3VFWB 1DCLA 1DJXA 1GHFL 2YMXH 2OI9C 5AWNH 3QZWG 3ARDA 4Y4HC 4C55A 3NYKA 4N6QA 4XXDB 4LIQE 1USQA 3LKQB 2P5WB 4FMFA 5CJOH 2Z7YA 3B3IB 4EPSA 5IHZA 5DEGA 3B5GA 3CFJA 1IBGL 1FNLA 3CSPA 4OGXL 1T03H 4PY8I 1JJUA 5DLMH 3UG3A 5FGBA 5F1SA 5A2BA 2E7LC 2BVTA 3F85A 5L4IA 1KENL 2QGDA 3BH8A 3RWFA 2OJZL 1F8TL 3HE6C 4P48A 4GUCA 2WZ6A 3I2CL 1B88A 2OMWB 4B97A 4URKA 1NLDH 4ODUA 1SJEB 4FI7A 4NUGH 4I88A 3TZVB 4DCQB 2E75C 4L1BA 4LRNH 3DDFA 5E4IA 4JFSA 2J4WL 4JRYE 5B38A 1BQRA 1CLZH 3HW7A 3OXRB 2WXNA 1DFBL 4YHPB 1TTRA 2PTUA 3QFJA 5SV4A 3SGDI 3UG4A 2PYEB 4MB1A 1SN5A 4XXCA 2CMRL 4AIXA 5D71L 4AEHL 1H5BC 5KSAD 2YRLA 4GKSA 1KPVB 1V7NH 4ZS7L 5TQ2L 3LX9A 5D2LE 1MW1A 2F2HA 4M48L 5J6SA 4JS7A 5SWZA 3K8MA 4QRPA 1CFNA 1OD9A 3GZQA 4AEEA 4TM9A 4E9RA 3MA9L 4OI8A 4LL1A 4JQXA 4G6AC 4HJ1A 3QQXA 4JZOB 4ZFQA 4W9GC 3V6FB 4ZMPA 1VRSA 4DGVL 3MJ8A 4LCWA 1JOIA 3APMA 5DLLA 1SF3A 5I8CA 1MCWW 1A6AA 1OTTD 3B2MA 4G8IA 2L3BA 1U8LB 3NJGA 1BLNA 4YHIA 4HDIB 4NC1C 4NQEA 3UGEA 2VLJE 4GXFA 2A77H 4ZMLA 2JKWA 4NN5B 1KB5A 3TTSA 4DZBB 2EUVA 1ZIAA 3KHQA 2DAVA 2WAHA 2VXUL 4H88H 2OMYA 4KH9A 4L1HA 4QRSA 1UWYA 4BZ2H 1I4FA 5I30L 4NPJA 4PFEA 1QSFE 3IJHB 1W8NA 3QULB 5KZCD 3JVFC 1DANU 4HEPA 2V7HA 3NJLA 3PWNB 3ISYA 1I1AD 2XI9A 3ZTJH 2W95A 3SCMD 2IDTA 3FSZA 1UB5A 3PWJA 5LVEA 1S7XA 4HG4K 3B1TA 3IN0A 5F9OL 4UQIM 5FM8A 3V4PL 4AKOA 1IV8A 4AIEA 4W9LC 2D3LA 3DX1A 1YNTA 1PNCA 3CFNA 4ONGL 4FJ6A 3KPSA 4A6YH 1I1FB 6PCYA 2R0LL 4UV4H 2Z65C 4ZXBB 1UC6A 1E6JL 2KPNA 1QLRB 1E43A 2B4CC 2ORBL 3NCXA 1HZLA 4PRAB 2WKGA 4YIQB 2YAEA 4G3YL 4FFWC 1KEGL 5IFHL 3T2PA 1IGIL 2NY3C 3ROOA 1NZRA 4MWFA 4R4ND 2VDPB 5IOPA 4ZZFA 5F1NA 1UYWL 2P52A 4OI9A 4DW2L 3UJTH 2Y9RT 2DJ4A 4NQXB 1DDHA 1AHWB 1HHKB 1TOXA 2D4DA 2AQQA 3FQUA 2CKBL 3ZL1A 4KKCC 2NXZD 4ANWA 2BSTA 3ZVVA 5I8OH 4DKTA 2ZX5A 4RSYA 3ZKXB 4JQIH 5MEPB 1Q1JH 2V3EA 4LOFA 5DZVA 4KUCF 3VFMA 1MVUB 4Y4KA 3EHBC 1X6LA 1UZ6E 2ZWZA 4MNHA 1N0XL 2DWSA 3OKLB 4J4PA 4ODTL 1QO3B 3BPLC 5DQDH 3K6SB 5DEFB 5BS0A 1JZDC 2VSMB 1CXFA 3V0HA 1ZT1A 4NEHB 2ATKB 2YD2A 1BG1A 1ADQH 3C2AL 1FORH 4OGYH 3CWGA 1XO8A 4LSPL 3AT8A 1NKGA 4EIBA 3KPRE 1DUYA 4FKKA 4L8SA 1JHKL 4F3FA 1KPRA 3Q3GB 1X5MA 4U33A 1NBVL 4Z7UF 2H26A 2HH0L 4F93B 5DJ0A 4P4RA 2YAPA 4B5EA 4XNZC 2DM3A 2O5NA 1RMFL 1LHZA 3P4OA 1C16B 1BEYL 2ARJQ 4P3CL 3VFWA 4HUXB 1BG9A 1BJ1H 4XXDA 3N44F 1B0WA 3LKQA 2P5WA 5DHYA 1XB6A 3B3IA 3GBEA 2V9TA 2AJVL 4I2XB 1QACA 2QHRL 3M7OA 3M7FB 2R4RH 2CDFB 1JYVA 2BW5A 3I9AA 5C0DB 3Q7JA 1X7QB 4QAWA 5JW4N 3DVFA 4G59C 2IBZX 4X9HA 3K71B 1S7VB 4M62H 1ERNA 5I6OA 2YKLL 4NZ8A 2OMWA 1SJEA 4IM8A 3D52A 4L3EE 3Q2WA 4DCQA 2ERJC 4RISL 3TZVA 4F8PA 2FO8A 2DQIH 2D7QA 3ILEA 3OXRA 1EH9A 4YHPA 1CTOA 1T0NB 3MYZA 1O9ZA 2JB6B 4FL4C 2PYEA 4B6ZA 4ECNA 1URLA 2J21A 4BDVB 2ED7A 4HT1H 1H6TA 1EHLL 4B9GA 1KPVA 4XI5D 5IK3B 2H0EA 3W0WD 1K9TA 1VF5C 1T2QL 2WBKA 3WE6A 5F3BA 5I5RA 1K72A 3D9AL 3P4MB 2V5YA 5E8DL 3CX2A 3F6IA 1JS4A 4FLHA 3V6FA 3BAEL 4JZOA 3OX8B 3UEZA 3C6SB 1CICA 2EYRB 1X7SA 4JCWA 1KYUA 3ELAT 1UCBH 4GRWB 5IBTL 5I71B 3BQUC 1ODAA 5GS0H 4I1PA 3QHZL 2YC1B 1U8LA 4HDIA 5GRWA 3FB8B 1XMEB 2XWZA 3IFNL 4OQTL 5I6XC 4Y19B 1JNNL 4YSAA 4A39A 1HNGA 3GRBA 3X1BA 4DZBA 1TQCB 5BV7H 4J3OH 4G9FB 3U0WH 1J0HA 3ESPA 4JGJA 4WO4A 4HCGA 3C60D 4P2OD 2CE6A 3CHSA 4DP9X 5HJ3B 3T2QA 3FZUD 2L4OA 3IJHA 2OSYA 3WEMA 1WF5A 2AFNA 4YBLC 3DOHA 4K55A 3QULA 4NRYB 5C0CB 1CTMA 4YR6B 4IBWA 4NIYE 2LT9A 2CIKB 2VGLM 4X8GA 1E4HA 2Y3NA 4UYQA 2IGTA 4DN4H 1W72B 4H25B 5DWUL 4BK4A 1AHMA 1Z5LB 3BT2H 1A1OA 3GBML 3B34A 4M43L 3B8YA 4ZXBA 5F44A 2G2RB 3DI2B 3IXAB 5JR1H 1QLRA 4DT2A 1DQKA 4PRAA 5D7JD 15C8L 4YIQA 2AEIT 1QWNA 3T6XA 2VISB 1OB1B 4YFEA 3W39B 4R6UA 4ZO8A 5TDPB 2W65B 4X4YB 4GEIA 5K9JH 4E42B 4NQXA 2VLLB 1AHWA 1HHKA 3ZKSD 1BQLH 4W4NA 5E6IC 3HC4H 2EXWC 2XICA 5AUMB 3QDMD 1U30A 3QNYB 3ZZQA 4GW5B 4B0MM 1HQ4B 3VD4A 3CFQA 4YC2B 5MEPA 3KBHE 3LN4B 1J9CT 2J6EH 1CDHA 4KKAC 4X6DF 5DK3A 1MVUA 2OYPA 4M7JH 2Z3FA 2ICES 3RWCB 2VIRB 4DP1X 3K0YA 1MUJB 3OKLA 3D25B 5JMOC 1QO3A 2CWRA 3EF4A 3M86A 4HSAC 1A64A 1O7VA 5DEFA 5A2AA 4KDVA 1YMMB