2J6WA

R164n mutant of the runx1 runt domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
SMVEVLADHPGELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHNAIKITVDGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords RUNT-RELATED TRANSCRIPTION FACTOR 1
publication title A Mutation in the S-Switch Region of the Runt Domain Alters the Dynamics of an Allosteric Network Responsible for Cbfbeta Regulation.
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00853 Runt Runt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j6wA00
3QYNA 4A63A 5LGYA 2XWCA 4HJEA 5LAPA 2P52A 2J20A 4AGNA 3IGKA 3D06A 4IBWA 2GEQA 5AOMA 1GZHC 5AOIA 3WTTA 5AOKA 2J6WA 3EXLA 2BIMA 1UOLA 2MEJB 3TS8A 3IGLA 3Q01A 1H9DA 2AC0A 4MZIA 1CO1A 3ZMEA 3Q06A 1HJCA 3QYMA 2BINA 5A7BA 1EAOA 4AGPA 4KVPA 4G83A 3KMDA 4IBZA 2X0WA 4IJTA 1TSRA 4AGLA 3WTUA 4IBYA 3Q05A 4AGMA 1HJBC 1TUPA 3WTVA 3VD2A 3WTXA 4IBSA 5AB9A 4L0ZA 4IBUA 5G4OA 2ATAA 2J21A 1IO4C 2AHIA 2XWRA 1EANA 2YBGA 2WGXA 4L0YA 1EAQA 4G82A 2FEJA 2PCXA 4LOEA 2J1YA 5BUAA 3D07A 3VD1A 1HU8A 4GUQA 3D09A 3VD0A 3US0A 2ADYA 1GZHA 3WTWA 4AGQA 2J1WA 2J1ZA 5G4NA 1KZYA 2H1LM 3D08A 5ECGA 3EXJA 4QO1B 2VUKA 5AOLA 3WTSA 1CMOA 5G4MA 2J1XA 2IOIA 2X0VA 4IBVA 2BIQA 2RMNA 3US1A 1T4WA 4MZRA 5ABAA 1LJMA 4IBTA 4XR8C 3KZ8A 4L18A 4IBQA 4GUOA 1E50A 3D0AA 3D05A 4LOFA 5KBDA 2X0UA 3WTYA 2BIPA 2BIOA 2IOMA 2IOOA 2OCJA 4LO9A 4AGOA 3WU1A 5AOJA 1YCSA
chains in the Genus database with same CATH superfamily
3APFA 1KNOA 2P5WB 1OTTD 3DECA 3IBOA 2Y6SD 4CU6A 1S7SB 2V5TA 4PJ5D 4P3CH 3OHXB 4KHTH 1CXIA 4XPGH 1F4YL 3ALXA 3PHAA 1Z9PA 1ETZB 2NYZA 4IIQB 3C6EA 1S46A 1C12B 2B7DT 3MZGB 4YDVA 3O6KL 3WMPA 1DFXA 1CVRA 3TBBA 2GJPA 3I84A 4JKPH 2C9PA 1QFWM 2C9RA 1V3LA 3VXTA 3WJJC 2K7PA 4YEFA 4MA1B 2BHZA 4P2QD 4QXVA 1BD2D 2QZ5A 5B8CC 5GIRB 2DQGL 3E9UA 1IGCH 3C6LB 1Q9KA 5FCUL 3VXMA 5DJYB 1VFOA 4DGUA 4GG8B 4F33B 2FZ3A 4FZ8L 3KDPB 4MNQB 2H3XC 5KSUA 3CFNA 4HUCA 5EDSA 4LHQB 3STZA 2Q10A 1F18A 2P7TA 1O9ZA 1TTGA 3D9AL 4Y16C 1FO0A 1IT9L 3AS3A 1QFHA 2WBWB 2XWJB 3BH8A 4PLJD 1FI8C 3MPCA 1S7UB 3LN5B 4JCWA 2GSIB 5DJCA 4QOKD 5JXEA 4A7UA 2EEFA 5BW7C 2NTFB 3JUZA 2CKBA 3IXTA 3OXRA 2AZAA 2VL5B 4A39A 3TFKD 2QQKH 3EH3B 1CFNA 3CVHH 1AIFB 4U6YA 3UTZB 3UAFA 5J1AA 3F6LA 3NFPA 2IJ0C 4HKBB 2K7QA 3WL9A 2ED8A 5D6CB 5GRUL 3S3PA 4UZSA 4KJQD 1EDYA 3T08A 3PWNA 5B3JF 4G9FE 1JHKL 4H8VA 4ZFFB 1GC1C 3RUGF 3EW3B 4E9TA 5TE7L 2EDRA 2J71A 4A2MA 5EIQA 1VZIA 1D7DA 4WIQA 4ANWA 4Z95H 3EF7A 3FHAA 1KB9K 1NKOA 2NXZC 2AJVL 1AC0A 4FADA 1PFOA 2F54B 1JGVH 2CLVA 3L9RA 4Y4HC 5B38B 5GS1B 2OP4H 4E5XB 5J1SC 3U36A 3D39B 3GSVB 3KPQA 4L1TA 3HNTH 5ESAB 5DZPA 2HP4A 1U8MA 4GRLA 2WAQA 1N0LA 3N0PB 2EYTB 1MFAL 1BX2A 3KPSD 3O81A 3O9WB 2YMXL 4OD2B 4IRJA 3H6JA 1G0DA 5GS3A 4LPTA 1SXBA 1XDTT 1G6VK 1YUHB 1B2YA 3SYAA 4OZHB 3HZYB 2V2XA 3TBCA 3ZMNA 4CDHA 4W68A 5BS0A 2WKOF 5IWLA 3HG1A 4QXTB 4OD3L 5JXEC 3MR9B 1E4HA 5FYLH 2R83A 2X53A 3VGHA 3TLRA 5JORB 3LKQA 4WCYH 2JB6A 4J8RA 1P6FA 2F7RA 2VDOH 3LPWA 3QCUH 3RZCA 3LZPA 2YPLE 1CUOA 4UOJA 1KYFA 3KEDA 5D2NE 2GUOB 2LVCA 3HZMA 1NEZG 3BYTA 4Q14A 2YC1B 4X7SH 2M83A 1HC1A 1WGVA 2WB7A 3QPXH 4E9YA 5CLYA 3LKSA 5I19L 5D7IA 4HAGA 3DSFL 5DMYA 3KWVA 2Q86A 5TTRA 4RX4A 2FSEA 5I15L 1FNGB 5D2NA 1RP8A 3BVUA 1OE3A 1I8MA 3HR5B 2IAMD 4D3CL 3MYZA 1KGCE 4N2DA 1G1KA 5JHLA 5LQBL 2O5XL 4PBDA 1F4WL 3HI5L 4M1DL 3WFHA 1CO1A 1OGAA 1WC7A 2ODHA 4JHWH 4DP4X 4KUZH 1JGEA 2APTA 3NJIA 1YEEL 3U0PB 3ARGD 3PDGA 5IP4A 1N70A 1OEZW 3MLRL 1J5OH 3DX9A 2XZAH 1BEXA 1SOXA 1GSKA 4IRJC 1HEZB 1H5BC 1SMAA 4P4RB 3QFJB 4Y9EA 5F0JB 4PHZA 1D5IH 1T0PB 4PJBA 4NOBA 3H53A 3QZLA 4Y5XB 3VH8G 1WA0X 3PWUB 4YE4H 4ELDA 3R4RA 1NCAH 2WXNA 3E8UH 4OB5H 1YMMD 4KZ0A 4JFFE 3TOPA 5IV2A 3DTXB 4Q8BA 5K1VA 2MCMA 2DQHH 1QKZL 3VRJB 3IETA 3IAPA 4JVWA 4AW7A 3P3SA 1R3HB 3MUZ1 4XVOA 4QHMB 2QVFB 4L0YA 1DJYA 4MCNA 1DL7L 4XE0A 1XGUA 3DRTB 4JFFA 3RKPA 2RD0A 3ZE1B 1UUSA 2YPKB 4MDJB 3UZVB 1YY8A 1HWHB 4NZDA 3PL6D 43C9A 5JMRA 3KPNB 3MV7D 4H13C 2I9LA 4PJHA 4WW1B 5DVLA 4J2XA 4GUQA 3EYFA 1DLFH 4HS3A 4FYSA 1MQ8A 5D2NC 2E3VA 5DS2A 3O4OB 4CSPA 2C3WA 1J5DA 4Z8FL 2YD4A 1JAEA 4EN3A 1ZGLP 1BMWA 4G7YH 5FWQA 2A9MH 2ZWSA 4G6MH 5I76A 2GC7C 2LU3A 2M1KA 4KWUA 1NMCC 5FAAA 4U0RB 2ZXGA 4OCSH 3VXRA 1S7XA 4B9JA 5CILL 4PRIB 4X6DE 4AENB 1EAJA 3AITA 2QL1A 4DAGH 3FXIC 1SFDA 3P0YL 3TP4A 1T1XA 4XNZB 5EIIA 5DMIH 4MRCA 3RA7L 1BF5A 1TT6A 3T4YA 1A2YA 2XZQH 4X6DA 2VMFA 1N67A 1TLKA 1JPEA 4NKQB 5CP3H 3CFDA 3LNGA 3TV8A 4HIJA 3MV8D 2AJXH 1TENA 2QSQA 3GTNA 5GRVK 4HWBL 3FU7A 4JRYA 4FQQA 1TIUA 1NDGB 1V05A 4Q0XH 1IBYA 4LCCA 5IW6A 3V5HA 3PG2A 1QASA 4FQCL 5KBPA 1TQWA 5LAPA 4C55A 2AQ1A 1ZA3B 3E6FB 3OMIB 1U91B 2YJLA 1P2CA 5F88B 3WTTA 5KBMA 1G9NC 3PDOA 1F90L 5CIPA 5HHNA 1WGOA 4EN3C 1W0WA 3UJIH 4QHKI 2A73A 4RNRA 5BOZG 2C8NA 3PV6B 3P0VL 1K6QL 4LSVL 2X2HA 4MA7H 2N7AA 3FOMB 4LDLB 4NBXB 3TN0B 4UMSA 2VXUH 1EWHA 3P40A 4IRSB 5T3ZH 5T5FL 3P3YA 3D33A 2D4FA 5HGHA 5FA3A 1SFHA 3OR6B 2ADJB 3CDGB 2JJWA 1HNFA 2ZG3A 3EJYD 3IKCB 4I0PD 5CCHE 1RURL 3RTLA 4ZDHB 3I85A 4DGVH 5IMLA 3WNKA 1JS4A 2UVEA 5GRWA 3ZDYE 4LP4A 2MNWA 1OL0A 2DIBA 3CZSA 3LH2H 5IESH 2VXVH 4BUHA 1A6UL 2HT4D 3DGDA 4HJ0D 3ARED 3QAQA 4NC1E 1DQTA 3HLAA 1FV1A 4GXUM 4H44C 5I73B 4PJIE 5DC4B 4LEEA 3ARPA 3KBHE 4YDKL 2F7IA 3NACH 5FO8B 1A14L 2FHBA 3VQ2C 4TYUA 1AQKH 1QI3A 5FHAL 3O2WH 4Z7OE 1A4AA 2WWNA 3HJ0A 4LSTH 5CXPA 1F8TL 1IB5A 1ZK5A 2W38A 3FT3A 4KKBC 1PD6A 5E8PA 5E08H 2R1XB 1DZBA 3ULUE 5J13C 1DJXA 2Y2TA 3BUYA 4FNLH 3OJ2C 3PWVA 2NY0C 2VB5A 1KV3A 3IMTA 3MRNB 3QDHA 4CKQA 2UXTA 3KYKL 3MBWA 2TRYA 5EZLA 1TTFA 4RFEB 4HLZG 4KJPD 4LOUD 4ZOAA 1J5IA 3PREA 2PO6A 3UC2A 5F9JB 5EEVA 2WJ7A 4OJDH 2CCVA 4A2GA 3JTTA 3NN8B 2CA3A 2F61A 1RIHH 1QUNA 3L2NA 4LLYA 2BHYA 4XP4L 3HNVL 5I74B 1I7UA 4TLSA 2J8UE 2ZCLL 3FQ2A 3KNBB 1JZDC 4OZ4B 2CJTA 4BSVA 3OAUH 1UB5B 4UAOB 5F96H 2W07B 2K4AA 3X1EA 2R0WH 3M88A 2J8UA 2GITB 1TJXA 3DUUB 4LVNB 3H3BC 2A74A 4A63A 1DQLH 2HX8A 4X9GA 1KJVB 5KS9E 5F7NC 2O6CA 2EIMB 4ODXB 5GJSL 1PKQA 2J73A 1M71A 1ES0B 2LTQB 1J8RA 3P73B 4G72B 4JO5A 2XWTA 4PEEA 3WFCL 5K9OB 2H2PD 3ESMA 4NJAH 2VDLH 4XMWA 1KT2A 2OXGB 3V4VL 4M43H 1HQ4A 5LBGA 4BEIA 4OCXL 4JFVA 1X5HA 2NY6B 4G9FD 2Y5TA 1NPJA 4Y5YA 5AEAA 5D7KE 5B39B 3K2IA 3ME0B 3QHZL 1A1NA 4MJ4A 1RAMA 2PWGA 1RULL 4XPBL 3ULUC 4FXGA 4IBZA 1ORQA 3L3OA 1NEPA 4QTIH 4XMPH 5BZWB 5IFHL 5E2VL 2HZHA 1XSIA 3VXNA 2Z91A 2WW8A 4LAQL 5JR1H 3MRDA 3EO9L 4LL9A 2YSSA 2F58H 4JR9L 3HEIB 1C5DA 4XCFL 1I9IH 5F7UA 3QIWD 3BI9X 1TITA 4Q9RL 4IS6B 4GKOA 4GMSH 3RVVC 1U8OB 4LCWB 3P9LA 5JHDB 2BY0A 3CC1A 2NT1A 1TTAA 1EANA 4ZXBD 1SYSB 2VLRB 4KX7A 4X9FA 1X3DA 4DKFL 5FKAB 2YR3A 4YDZA 1VEMA 1EK3A 1YC8A 2AEQL 1YMHB 2HX9A 1URLA 4LSQH 1HOCA 3FUFA 1K4DA 5TFSL 2CD0A 4H8HA 2R27A 2WO2B 4M6OH 3WXVL 1WFUA 3EBGA 2IH9A 5HDQL 2R0LH 4JFXA 3F3HA 3MNWA 1DVZA 2F5BH 3ZDXB 4U1MA 1KXVA 4AH2B 2WBXA 1YEHL 5EFIA 1DR9A 2QQQA 2XQYK 3C5ZD 2KBGA 1KJ2L 3FCBA 4W9JC 2OXHB 2DWEA 3K91A 3OF6A 3MC0A 1BEYL 5LCVA 3WUWB 4S1DD 5IK3A 1AGEB 1R3JA 3LQAC 4WGKA 3FKUS 4MB1A 4MJID 3O6FB 3HMXL 4XNYH 3AADB 4JANA 2NY5L 3I75B 4GSDH 2DQCH 2FAUA 3UFIA 4BFFA 4MXVE 3OJDA 4DK6A 3BP4A 4PJGA 5E8DH 1ACCA 1F86A 1JGUL 5MENE 4YHIB 4MAYD 4P5MB 1Q0YH 2NZ9C 3KHOA 3VFSB 3PHOA 4WU5B 1KIUA 2ADGA 4HGMA 1KB5L 4UM9D 5E95B 2YFOA 5IR1B 4WO4A 1XF3B 3S96B 1KIQA 3O3DB 5HHXL 4IU3A 5DVOA 5B1AB 3WNJA 4OZFH 3D50A 4Z7WF 1VZGA 3ELQA 4Y89A 5KYUB 4ZMAT 4X4XB 4Z7UF 2G75B 4TNWK 3U4BL 5AD0B 5ANME 5D2LB 2P26A 3RB5A 2QADD 3D48R 4TTDD 1QFPA 3LKPA 4OTXH 1R3LB 4UBDD 3W2DH 3TFBA 1OARL 4B9KC 3OC8A 1I1FB 2R69H 3ZHNA 3F84A 2XN1A 5DVPA 3TBSA 4X5XA 4G8GB 1QEWA 2V7NA 3O3EA 3VJ6A 5DI8B 5T5FA 2BINA 5KW9H 4NN6B 4PVNA 3WE6A 1HHKA 4HKJB 5HHVL 3AWGA 3DI2B 5LBSL 4MA8H 3TH4T 3U7AA 2MPAH 1ZDQA 3IJHA 3VM7A 4FQ1H 4ZPVA 4LCUA 3D51A 3EFFA 1JL8A 3FO0L 2KERA 4S1SH 5EBWA 2XNAA 5HGAB 4RH4A 1LO0L 1LEGB 2AKRA 1SEQH 3VW3H 3AQYA 3SN6N 4BD4A 5J7CC 1M7XA 2VDKH 3GKZA 1G7JB 3JWNH 2DIEA 1VGEL 3D30A 3I9PA 3EOTH 5BVPH 3KBFA 1S9VB 3OWEA 4LHJB 5KN5A 4XWOD 1JXKA 3FF8A 2RFXB 2X4QA 3FMGL 3D07A 3Q8CA 4ABUA 5KVMC 3DO7A 1RU9L 3GMLB 2BW5A 4Y1AA 4XCYB 3PP3K 4HJJH 4DUVA 4WHYH 4OLUL 3WIIH 4HMEA 5KVGH 5FGBC 4PM1A 2VSMB 3DX6B 4D9QD 2HFGL 2PPFA 2Y7NA 3NBNA 3GHPA 3H9YA 4IU2B 4LQFL 1PG7H 4WK0B 3QULB 1QACA 2Z4QB 3BAYA 4U1HA 3TBTB 1UM4L 5F1SA 3V7MA 4P9ML 5HD8C 2Y7QA 3D18A 3VTTA 1TZ8A 2XTJB 1P0SE 4ZS7L 4UUJA 4LARL 1N4XH 2RQ8A 2WLKA 1I82A 1UM5L 2WY3B 3Q9QA 3QJZA 4D9RE 1I9EA 2VAJA 1CR9L 1NGWB 4XMUA 4YSQA 5KBDA 5FYKD 5T5NG 4K0OA 3RX9A 1CIUA 1NDTA 4AMKL 3MKGA 1T6WA 1IGJB 5IY5B 3P4NA 5D7LA 1O7VA 4NM4L 3F7PC 5IREA 3ML8A 3BUBA 2VDQB 2C3HA 1TOXA 1X5GA 3ASNB 5DLLA 4DVRL 4E9QA 3CDZB 2NY3D 1JNHA 5JIQA 2ZSWA 3V4VA 3DKHA 4APXA 2BVPA 3AUVA 3KHQA 4PJFB 4YJZL 2UVFA 4Z7VB 3FULA 3ZT5A 4HW6A 2ADFL 4X9IA 1Y0LB 2FQFA 1ZV2A 4TVPL 1H9DA 1ZS8B 1R9FA 3BAEH 2R7EA 3PUCA 4V1DE 3O3AB 1Q72L 4I8DA 4CN4A 5K9QG 2NY2B 1FG9C 4YHNA 3ULUD 5D7JD 1E27A 1QEXA 3D2UD 4ZAKA 3RWCA 5CAYB 1GXEA 2WAHA 4QJ3B 2K3HA 4V1DA 3OVUB 1FNEA 2OSWA 4UQ2A 3FRUA 3MRPB 2DJUA 2FH8A 2ZAHA 4GH7B 4YHLH 2XRAH 3FB8B 4OKVA 4LDCA 4UANA 2PYEA 4AG4H 2BSED 3IB4A 4UV4H 4N0RA 2K6WA 3TJEH 2QSTA 4HWZA 5EN2A 3IWUA 2V37A 4QRPB 4X4KA 1WLHA 2ZXAA 1E8WA 1FORL 1A7PH 4Q89A 4XBMA 5EB9A 3VQ1C 3VFGL 4EIBA 1J8KA 2KZWA 5HDBB 5F3HA 4B0MB 2BHFA 1MRFH 1UWFA 4OCNC 2R2HA 3RWJA 3TPUB 1FNFA 1XF4B 4QTHA 4LKXB 1VA9A 1ZTXL 5FV2A 2BRRH 3WKMH 1EHLL 4XZUA 2PKDA 1BVLB 1U3YA 3QEHA 3BVXA 4EXPX 1O5DT 3GXDA 3UXFA 5FUZH 5HJDA 4CMHC 1ETA1 3N1GC 5K9KB 1UT1A 5HHOE 1KJ2A 2W9EL 3NK3A 3OD3A 3BAXA 1PGRB 3CLEL 1NCIA 4HULB 3BDYH 1KBGL 2HUHA 2VUKA 4NO5A 4FMFA 5E1HB 5IBLD 4B5ZA 3KYMB 3NJFA 1HXKA 4RGNB 5DJDA 3UTTD 4KVNL 2WYIA 5BRZE 4OUUB 3TV3H 3VYNA 8CGTA 3SDDA 2I07B 1VPOL 5JW3H 2ZOTA 1DVFD 2EDWA 4J12A 4WUKH 2HN7A 5D7KD 3LDBB 4W4OC 3UH8A 3FCTB 3N1FC 5IW3A 5H35A 4HZLB 5F89B 4F92B 1IM3D 5KAQG 3A6OA 2QELA 3UP6A 1UVQB 3MLXH 4HUKB 3V5DA 4BZYA 5B7MA 3HI6H 1HNGA 1KB5A 4Y4KA 3T2LA 5CMAB 3N43F 4O4YL 4GEJA 3QRFM 1XT5A 3POCA 3C8DA 4H88H 4IOIA 2ZXBA 1NBVH 2YAMA 1XX9C 3JV6B 1UEYA 1XGRB 1JWMA 4KQ3L 3OTTA 4AC2A 5CN2A 5EPMB 4IEFA 3ETBJ 3DYPA 5TPWH 3L1OH 1NC2D 4MX7B 4N8CL 1OAYL 1BZOA 2IGLA 4AJWA 2Y1YA 4ZFGL 4H26A 4XX1G 3AY2A 4J2QA 2WLNA 4X6CF 2UZPA 2FNBA 5L9DL 5E8NB 3WFBL 3PABB 1UYWH 4AIEA 1TTBA 3ZE2B 3TT3H 2X4SB 3GMQB 3MLUH 5CUSL 3WJLA 3L7FB 1YHPA 3BLPX 4PWHA 4YX2L 3GLEA 3MV01 4KTDL 2WTPA 3BKJH 3Q06A 4FG6D 4TKWA 4CILA 2EYRB 1I4FB 3BN9C 4NDMA 1NFDB 5LBSA 2DD8H 3ENEA 3SSGA 1PW3A 2IWFA 3SDDC 2NY5C 1ACXA 2VH5H 3G6JE 3MOAL 1S9WA 3MOBL 5FGSA 4GMTL 3RI5F 3SCMD 2UUDH 1XIWA 3QPQC 4J1UA 5HGDB 1OM9A 2QEJA 2V2WA 3QUXD 3RNQB 4AQOA 4O2FA 3MMEB 1HTYA 3JWDL 4BH8B 5ETUA 3BXNA 2YGPA 4PJEF 2QHRL 3IU4H 3V4PL 2W0FA 2ZCZA 4ZUSB 3CSYA 3JTSA 4L3CA 4Y4KC 1AOZA 1IE4A 4ERSH 4MDIA 1FZOA 1CIDA 1RPUA 1G7HB 4QLRA 4Z7NB 4JY6B 5L88H 2X4PB 3Q2NA 2MWCA 3V6BR 3VD7A 4NHCH 4L3EE 1FZKB 1FAIH 2B9BA 2P24B 1IVLA 4HOMA 3S8WA 1YECL 2R9HC 5DO2C 2RA1A 3U25A 4MLSA 2EH7H 1GGBL 2CIKA 4GP8B 5EOQH 1ZEAH 1D7BA 3WJLC 3HAEG 3ZRCC 4NQSA 1NCBL 4ENEC 3TPKA 1W72A 3L3DA 4YN3A 4TPRH 3MLZL 1EJ6A 3FSVA 2X2YA 3K6IA 4NCC2 2JE8A 1EEYB 5DZAA 2HG5A 2CSPA 1UD3A 4OLVH 5G4MA 4BWUA 4P5TA 5D4QA 1DEEA 3SDAB 3FTZA 1MAJA 5C8JA 2OPCA 5MP6H 4FFYH 4GS7C 3RUGA 4ODSH 2BFVL 4Z7OF 4J3OC 3VI3E 1ZT1B 2IOOA 1BZDA 1ZAGA 2H32H 2X1QA 3DX0A 4PTTB 4WW2B 3SPIA 2JQZA 4BQBA 4GKZA 1YYMH 2AVFA 3ZUCA 3D3VB 3V0AC 5IJBC 1W6LA 4HS6B 3W9EA 3WEAA 2CBTA 3QFDA 2IXQA 1MSPA 4GXVH 4S0SD 3SBQA 5I6OA 2WN2A 4N2AA 1XR8B 3B9EA 4B6ZA 3BP5A 1NSNH 1MWAL 1I1YA 5G2NA 3VFWB 5HYJB 1OSPL 4OIIL 4FI6A 4HT1L 1KN4H 4RWHA 1JXJA 4YHOL 3U2SB 3C2AL 4CMMB 4GUPA 4BJLA 1W8NA 5BQ7B 1M2VB 4DUXA 3VD3A 3EYVA 1JN6B 3QZBA 1B6DA 3EO0B 1S7VB 1D9KA 3GSWB 2JQAA 1ZS2A 2HRPH 5ABZA 3R0NA 3HS0C 1EFXA 4R5VA 4JRXA 1PPIA 3RU8L 1I8LC 1MOEA 1EZVX 1NGZA 1M7DA 3KPRE 4WO0A 5TH2A 2NW3A 3S48A 5IHZA 2JCWA 3HE7B 3LNHA 4XPTH 4D94A 2HVKA 4O2CA 2DICA 2FVNA 2CO7A 5KSAB 1WE5A 2KQNA 3UERA 3SGEH 5I1IH 1YEJH 3AQXA 2PYFA 3SY0B 3Q6FA 5KVEH 2J21A 2FIKA 4K23L 5AUMB 1YQVL 2CXKA 1OAXL 2KT6A 4LSSH 5AW8B 2J12B 2K0RA 2EIZB 3KLSA 2E59A 4U7SA 4ODWB 5C08D 4EBQL 2QPDB 2AJ3A 3QJFA 4JFQA 4MHHI 3EDEA 3BGFB 4XN2A 2WMPA 2WP3O 4ONGL 2WXIA 3VD0A 3ZR6A 4WHTB 3RJOA 4X6FA 2OMXA 1G5GA 4U4BA 2VN3A 1ZHNA 2J1ZA 4I3RL 1SF5A 8FABA 4JUSA 4APQC 4E68A 4LFHG 1R24B 4F7KA 1D9KC 1F4AA 4B96A 2CHZA 2LE9A 4HZ1A 5I1AB 3LH9A 4YHMH 1IKNA 1SVBA 1HWWA 2X4RA 4QHKJ 3LZLA 4CW1A 1PDKA 5E6UB 4G1EA 2ZJSH 1P84K 1VESA 1XGYL 5H94A 3KZ8A 5KSBF 5CR8A 3FSOA 2QJDA 2ARJQ 1ODUA 4BZ1H 4NKMB 2AEWA 2DRUA 3WEXB 3RTQD 4HCRA 2D7MA 4U1SA 1OLLA 3QC6X 3ZLQC 1KENH 1NMBL 3GM0A 1O7SA 1TFHA 4PB9H 5KVDL 3ZO0A 2DN7A 3KPOB 5A6LA 1U8IA 2OL3H 3BEVA 1F3RB 2WZPD 2NZIA 3TA3D 1YUKB 5CO1A 2DQUL 2ITFA 3VFTA 5C0IA 4KNUA 5I1CH 4HIIB 5BZXA 2VR4A 1LO4L 1LHZA 3VFNB 2HSIA 2OBGA 2NMSA 4HXAH 4XPHH 5BMFH 4FERA 4G9DB 1QBLL 3MRQB 3VA2C 3A4FA 2R2EB 4OCYL 1EEZA 3GTVA 3TIDB 2N59A 1PIFA 1T5XB 1BCIA 3HA0A 1OCWL 5EC2A 4QT5B 5PAZA 3Q01A 1CICC 5A6IA 1UOKA 3R1GL 2FX9L 1KNOB 1AANA 2PXYD 4A37A 4ZFOL 1NICA 4EI0A 4P2QA 5IHWA 4PH8A 1A1MA 3UG5A 1ONQA 1EAOA 1E90A 3KYOA 4N22A 1IKNC 5LXVA 2GBUA 3A6BL 3TXAA 5JLZA 4JO8A 5TDNA 3C08L 2YSTA 5EU4A 3LS5H 3W0WA 1GIGL 2XN9A 2NY1C 3WFEL 1AYOA 4L3AA 3ZIYA 2NXZB 5EORL 4PCTA 4LASL 2HT2D 1G7QA 5BRZD 3V4PA 3CBJB 3DHMA 1U42A 4GW1A 4OGQC 4I1RA 1E6OH 2YPVL 3VI4F 5AB9A 2BVQA 1BAFH 3MYJB 4LLMA 5D7SL 1Q9KB 1E4WH 2VZ3A 4OJEH 3QZNA 5DQ9B 3VXMB 4S10A 2BVTA 4NZRL 2FZ3B 2VN7A 2OMNA 4JKKA 5KSUB 1X9QA 5AKVA 3FHEA 2P7TB 5DEZA 5EEWA 4DCQA 2I60L 2YEZA 3U48A 3BH8B 3HC3L 4JY5L 3NIGE 4ZQKA 1EH9A 35C8H 5LGJB 3D09A 5DJCB 5DYOA 2L7JA 4LMQE 1F13A 2J4WL 5DO2D 2BSBA 1U2HA 2CKBB 3IXTB 3OXRB 3SDXF 4QJ4B 2HG0A 4UTBL 5SWSE 1CFNB 3A3YB 2E4FA 4U05A 4L8SC 4U6YB 3BIAX 3D08A 5J1AB 3VGBA 4ENED 3I2CH 3NFPB 3WL9B 1H19A 1L3NA 5CJQL 5GRZA 3PWNB 3HMWL 2R23A 1LD9B 4JG0H 1FYTE 5AOLA 5I1GH 2EJ1A 1L9NA 1U6AH 3G5YA 1JG9A 4M93C 3BE1H 1JZ3A 4BZ2H 4Z5RA 3I6LD 4M62L 4AKQA 3FTGA 2WXJA 3WN5A 4M7ZB 1NCDL 4R97B 5K69A 4HEMA 4WFFE 5EUOE 5LG1A 1I3UA 1N6VA 2CLZB 2BP5M 3L9RB 2CLVB 1C5CL 4FNTA 5FYJE 5CZRA 4L9LA 2B1HL 3MBXH 3U36B 5F6IC 2AXGA 5LWYL 1U8MB 3TWCH 2D31A 3S34L 1N0LB 1BX2B 1XH3A 4IRJB 1IKFL 1H5BB 3CN1A 1U30A 4RA3A 1IJNA 4Z0XA 1MWAA 4N90D 1QNZL 2V2XB 3HC4H 2AV7A 4AGNA 5BS0B 1ZLUK 3HG1B 4RDQF 4OF5A 3U9PL 4K5MA 1CGTA 2QPSA 3K72B 4YK4C 3RGVA 3MNVA 4Y0GA 3LKQB 1X5ZA 2JB6B 2P45B 4J8RB 4L3ED 5DWPA 2ERJC 3B34A 3SPJA 3V2AR 4JKPL 4MD4A 2VDNB 2GK0A 1GY1A 3G5ZA 3H9SE 3HZMB 3ARGA 3L9EA 1XSJA 3BMWA 3GWJA 3GHEL 3LKSB 1MAKA 2YPLB 2Q86B 2FSEB 5D2NB 1NINA 1NOFA 1IC1A 2Z6FA 1CS6A 4P5RA 2CO6A 1I8MB 3CSPA 2XDHA 1MZZA 2DBLH 4PJXF 2N7SA 5DC0A 5M95B 4XO9A 3W57A 3WFHB 2EXYD 3WEBA 2V4LA 4DO6A 1OGAB 5L2KE 1WC7B 1YMMA 4L9LC 1JGEB 1OTUD 4FHKA 5TDOA 3DX9B 4TNWF 4G6FB 5TGBB 1QTYT 3GBLA 3CVBA 2HKFL 5DJZA 4B9FA 1NFKA 4R2GC 1E9OA 4UWQB 1EZVY 3TL5A 2DLGA 2YUVA 1DQIA 4PJBB 4PLKC 4XB7A 3PL6A 1H6FA 5GRYA 2RJMA 3L4CA 1RJZB 4ZTOL 2WQXA 1DTUA 1SZNA 3K4DA 3IETB 1QNIA 2VW4A 4GRWE 3MLYH 3RX8A 4X0KA 1T1YB 1XGUB 4JFFB 4Q97A 4PRNA 2GT9A 4Z95L 4Z76A 1ZLUH 5FPIA 3KPLA 2MCAA 4L5FL 3HBQA 1YY8B 1HXYB 3ZE0B 43C9B 4PJHB 3VD9A 3EYFB 5B7FA 1FZMA 4YWGH 2OP4L 1RZJC 1WD9A 1UACH 2DLHA 4F3FA 3QI9D 1TJHL 1ULVA 4L29A 2HTKD 2E6JA 4I77H 3OAYK 1RFDL 4GNKB 1UURA 2GJ6E 4EN3B 4KV5E 3QZWA 4Q52A 3KG5A 1Q1PA 2ZT9C 3CSFA 5I76B 4XWGH 4EE2A 3P2DA 5HDWA 3VXRB 3L5XL 1WZLA 2YD9A 3UL4A 1K8DA 4YQXL 1KFAL 5BJTA 5AB0A 1Q4NX 2FGWH 4XNBA 2DTMH 1T1XB 4XVSH 3GMNA 5EIIB 1SVCP 3H4HA 1JCKA 5L4IA 2MNUA 3V4LA 3D85A 3QCUL 3T4YB 1A2YB 1KLUA 4X6DB 4PJ9D 1BPLB 2BSRA 1A6VL 1ZLEA 2MMXA 3CFDB 3CZKA 3CDYA 3EFOA 4HIJB 4OGXL 3LHPL 2G3MA 2O61A 3H7BA 4CSTA 2B2XH 3PAYA 4JRYB 3ZKXC 4ZFOA 2IDTA 4FQQB 4LLWA 5IVOA 4NQEA 2VITA 5IW6B 3LKNA 3V5HB 4XVJH 1FA4A 4KXCA 1G7IA 4BFIB 4NZTL 3S3CB 3F58H 3NMEA 1SNRA 4WWKD 3U1SL 4HG4J 2AQ3A 4XVUC 4Z7WA 3E3QE 4KUZL 1CFQA 1P2CB 2Z35A 4YOKA 2WWKO 3JSSA 4Z7UA 1AHWA 1KCSH 4EDXA 1GRWA 3PDOB 5D9SA 4H1LA 1F3DH 1QWHA 2YPVA 4KKCD 3L17A 5CIPB 4Z9KB 5HHNB 1TZGH 3F65A 4BFRA 1W0WB 1YEFH 3PNWA 2VZ1A 5F1IB 4IBUA 1OAUH 2A73B 3OLEA 4A2LA 4Z7QB 4M4RA 4RNRB 3FB7A 5E0QA 1D5IL 1F5WA 1DSFL 2LLNA 4IKKA 4JL2A 1UA6H 1E5YA 4MLIA 4XCEA 1IGYA 1NCAL 1TZAA 1MVUB 5DHDA 5DHMC 4KQ4L 2DQHL 5FA3B 5HGHB 2EDMA 3KM2A 3ZO9A 2J56A 4IMKA 4LE8A 1JV5A 5LVEA 3AG2B 1F02I 3SPHA 1E42A 2Y07H 5DJ2B 4K3EL 3GT6A 3W5MA 2CJUH 3HLAB 1FV1B 4MSWB 3U9UA 1CQKA 4R7XA 4D0BA 2WCSA 2YKLH 2EADA 3ZDYB 1DE4A 2P5ED 4PJCE 1DLFL 4A68A 1THAA 2VTFA 4FQJL 1SGKA 1D5XB 2Z7YA 5I6XB 1E2VA 3HBPA 4AEEA 1T7VA 3P77A 1J7VR 4KUCD 1HL8A 1U8LA 4G7YL 1PX3A 3SY6A 2A9ML 5KTEH 1SEBB 1A5FL 3A5VA 4TQHA 4PFEA 3FT3B 2F8OA 5E8PB 3FJTA 4OCSL 2VERA 4W70A 1G9HA 4O58H 4NQXA 1AHWC 1JI2A 2Z31A 3BUYB 3VG9C 2F1EA 1V7MH 4D8PA 2NR6C 4UNVA 3RVXC 4AEIL 4URTB 5I8OH 3DOHA 3FU8A 3MBWB 3E3QC 5EZLB 5C3TA 2A9DA 5FYKL 4PSRA 4O5LH 3WO4C 3ZTNH 3E38A 4O00A 5DHVB 5AG9A 2Q87A 1FNAA 4JKNA 2X3CA 3JTTB 4LLYB 1QUNB 4UV7H 2AJXL 1CQYA 2P80D 4X7CC 1I7UB 2HPTA 2IPUG 2DMGA 2WTRA 2YBRA 4BSWA 4NO2A 4I0KA 2WNKA 4BSVB 2A38A 2WYTA 2VXSH 4GW5A 1NGPL 1I31A 4TF4A 2J8UB 4IIZA 4TSAH 1QHQA 3ZKNC 1QSED 3QJXA 2JNZA 5BVJA 5SX4H 2A74B 3KL0A 4ODHH 2KDGA 2OZNA 4AEHH 3VI3F 4N0CD 1AI1H 5FUCE 1J8HD 1M71B 3BRFA 1JI1A 3ESOA 1OV8A 5SWSD 2XWTB 3G6DH 3UJIL 3VXUD 1I3RA 3ARDD 3MKKA 1IFHL 1CGXA 4KRLB 1KT2B 4K94L 4MA7L 5LGHH 4CC1A 4D0DA 1A7OH 1CURA 1E2ZA 1MIEH 2D9CA 1FYTD 2Z31C 2AQPA 2Y5TB 5FCSH 1KYOJ 4Y5YB 3PV7A 2KUTA 3MO1B 5GGUA 5TQ0L 3DJTA 4XP9H 2BO0A 2PMZA 3HN5A 3AUWB 5TF1H 3EH5B 4WFFD 1BW8A 2W65A 3GBMH 5IESL 1W2KT 4FXGB 5ENWB 4ZXBA 1ORQB 3L3OB 3V9CA 2X89A 4TTGA 3RDTA 1A6ZA 1K9TA 3VXNB 2Z91B 4Y9FA 4PGCA 4RAVB 2D2OA 3MRDB 1PL3A 2HFFA 2YSSB 4RISH 5IT2L 1C5DB 2FATH 3IF1A 1F0LA 3J07A 4JFPA 4Q9QH 4RMQA 5C7ZA 2PWDA 4YSCA 1YNTA 3MRJB 3CXHK 1RHHA 3P9LB 4EI5D 4UDTB 5E1GA 2W0PA 3MRKA 2K9UA 1ZHBA 2FDBP 3DJSA 1GZQA 5GRVL 1QBAA 1ZVNA 4KTEH 3JZYA 1PG7W 5E24E 3GBDA 5BXFA 2OYKA 4CGTA 2BNUA 1DVUA 4KH9A 2C3VA 1HOCB 1K4DB 2AQTA 4L37A 2Y7OA 5IB2A 4IDJL 2WCPA 2XV3A 4R5XA 2E7LA 3MNWB 5FYLE 3WYRA 4QRTA 1ZV5A 1JZ6A 4P2YA 1RIHL 4JLRA 4U1MB 4MAYA 1XCTA 5EFIB 4H20H 5KBNC 4TNEA 4GAFB 1IGFL 3V4UH 2DWEB 3SE6A 3WNOA 1R3JB 4UM9A 5J6GB 2Z8RA 3HUJE 2DLTA 3RDTC 3H3KA 4WI3A 1CPUA 4JANB 1XZ0A 5L2KD 2AI0H 2R2BB 2GBTA 1NL0H 2Z64C 3LEXA 3CX2A 5LKNA 4WV1A 3OJDB 2FQDA 3BP4B 4PJGB 4HU2A 4XC3H 4UT6L 3HUJA 2HWZL 1ZE3H 3IBEA 4HD9A 5FK9A 2XVBA 4DTGH 1IM9D 1KCRH 4K73A 2VSCA 3ULSA 1KIUB 5E6SB 2ADGB 1X9LA 5AB1A 2XWXA 4KKLC 3DV6A 4NJAL 1TTCA 1JGLL 4CADA 4WO4B 1OSEA 3II2A 4NKIL 4M43L 4IU3B 2CPCA 1X4XA 4LPWA 4AT6B 5IW1A 1BXUA 4G43A 3S8FB 2B1AL 3IMSA 1JFQL 3L4ZA 2P8MA 4W9HC 5F7DA 2KYIA 1Z9NA 4RLDA 1YAIA 3QZMA 4YBQD 5CGTA 2VWEE 2DM2A 5CD5D 3LKPB 4MCMA 3ZDZE 4BRJA 4X6CA 3DX7A 4J3VA 2X41A 1MNUH 1NA8A 1BOYA 5HVFB 2BCKB 1RSFA 3TBSB 5JR1L 2F58L 1QEWB 4HF5H 4NLAA 2V7NB 3O3EB 4ZOCA 5BZZA 3VJ6B 4Q58C 1I9IL 1PQZA 2E9IA 3WE6B 4LSPH 4YXKH 1HHKB 2B8OT 3QEQE 2FEDC 2GJ6D 4GMSL 4KUCF 5C0CE 5C9KA 3HN8A 3HS8A 5I2IA 4M7LL 3HOGA 5AVWB 1EVTC 2FD6L 3IJHB 5I1KL 5J3HD 2WGNB 3IT8D 3EFFB 3RQ3A 3US9A 2P43B 1M1XA 2XNAB 4J7RA 1ZVSA 2D8KA 1T0NA 1TJGH 1NPNA 4XOBA 2AKRB 3U7YH 4YSRA 2WIIA 3BD5A 3Q1SH 4K7PX 3DETD 4PJEA 1OVZA 1CGSH 3LZFH 3RKDD 5BO1H 1N7ML 2I32A 5GSRA 5KN5B 3RFZA 1QSFE 3DMMC 2X4QB 2F5BL 5D1QE 3SB3A 1E9PA 3DO7B 5DUMH 4Y1AB 1HEJC 4DKEL 1OOWA 2FLMA 2NY4D 4ZMLA 2NXYC 2DKUA 1SMDA 1IAII 4UQ3A 4FJ6A 1HWGB 1VDGA 3NIGF 1YPZE 3O3BB 1HI6A 1Z3GL 3ZYOA 3GK8H 4GSDL 2VMEA 4JGNA 1HL4A 4U1HB 4CC0A 2F08A 3WDJA 3BZ4A 3OKKB 2Y7QB 3D18B 1Q0YL 1SBSH 1EHAA 2ZUWA 1OTSC 2MJWA 4UUJB 2QTEA 1LP9A 3BUPA 2FECI 2ZWYA 5IB3B 5CD3A 1F58H 3CC5A 1E0OB 3ETSA 4W9LC 3F7LA 1ZLSH 2F8XC 5CSZA 2J6WA 3P4NB 1LXMA 2CGRH 4B27A 4WTZA 1DBAL 1YYLH 1RY7B 1UOLA 15C8H 1ROWA 3I50H 5EUOF 4GUCA 2Y6TE 2AV1A 3B9VA 3L4UA 4G7VH 4WEUD 5IROA 2HCZX 2C3GA 5T3ZE 1WV7T 4PS7A 3W2DL 3TEZA 1N19A 1JNHB 1DVSA 2FWLB 2R69L 2ZSWB 3V4VB 4APXB 2BVPB 3SDYH 3GRWL 2A9AA 1KF9B 3BFWA 4HSAC 1KDIA 1P53A 2XY2A 2JIXA 1I1RA 3FAXA 5D1QC 1PLBA 1MFEH 3VFRA 4CUCA 4MA8L 5LHDA 1H15A 2QLYA 2LLGA 2MPAL 3MLPA 5G4OA 5LAXA 4BK5C 1WICA 4OY9A 4Y9CA 3HE6D 5C0JA 3T2NH 4YHNB 4Y1TA 2A4CA 3TWYA 5FDWA 1E27B 4ZAKB 3RWCB 1MFMA 4IGBD 4EIZC 1G6RH 2ENJA 4LZKA 2VN6A 4V1DB 1U8JA 2PLTA 5IMMA 3IN0A 3FRUB 4UQ2B 3QDJE 1MEXL 1OAQL 4KZDL 3VW3L 4N87A 4PWJA 3RJQB 3FPXA 5J0BA 3OPZH 4OKVB 2PYEB 1DYZA 4NIKB 4IOFD 3KBEA 3EOTL 5FHBH 4HWZB 5ELIA 5EN2B 1E28A 1FFNA 2ZYIA 3NJHA 3NVQA 2EP6A 3EZJB 5T1MA 2VM9A 5FW6A 5HI4C 2UZXA 1HCYA 3QO0A 5F3HB 3QXUA 1JPGB 4LCIH 2R2HB 2ZZUT 2E7DA 3OQRA 4QTHB 1FWXA 3SODB 3AQZA 4C56E 1JRHI 1XF5A 3UTTA 1B2WL 4IBVA 4G70B 4XZUB 5F9DC 3EJUA 3QEHB 3QG6A 5TE6H 1OPGH 4TSCH 4JZJA 3CIQA 1SQ2N 4HEPA 1Q8MA 1KCVH 2F18A 1IM3A 3AGVA 3F85A 3TEUA 5F7LB 3AQDA 1KJ2B 2ZICA 1GCFA 1GMIA 4Q6KA 4K55A 3SIKA 4OLYL 2FHCA 4NO5B 4HUVA 1ZANH 1U0QA 1TQBC 5DJDB 1J12A 3P9WB 4MHHG 3ARWA 4X83A 3SDDB 2P49B 5HHOB 4LLVA 5GHWH 1J9SA 4F8TA 4GI8A 2DJMA 5HYSG 2HN7B 2A4EA 1NMAL 5H35B 1X5LA 4PJ7F 2AJYL 4UT6A 5DZNA 5EIVA 3OKDA 4U2YA 2Y22A 5DFVC 1VEPA 1WTGT 5C0DA 3V5DB 3TZVA 2CQVA 3H9HA 3BPNC 5KSBA 1QSVA 4EI6A 1KB5B 4Y4KB 1OCRB 2FH6A 4M29A 4IOIB 4KKLD 1OE2A 4OF0A 1JWMB 3AS2A 1UWGH 4E41E 5KJ7E 4CRPA 3CHSA 1CL7H 2CR3A 2EABA 4IEFB 2UXVA 4QRRD 3QYMA 3FW6A 4L4VE 1XTLA 5A2JH 5IM7A 4H26B 2BNQA 4OFPA 4XPFL 5IFJB 4TUKH 4ZBJA 1LDPH 4YL4A 1YEIH 2AEIT 3MA9H 3SCMA 3A24A 3B2DC 2DDQH 1YZZA 4JZJC 1LMKA 3RVTD 4IHBA 4O02H 2F19L 3SBWA 4A2HA 3QUXA 5HHPA 1KGUA 4N26A 2ZCHH 3L81A 1A4JB 1S78C 3POHA 4R4FH 4AG4L 4L23A 4NNPH 1DBMH 2JLLA 4FYQA 3DGGA 2MQCA 2FEDD 4QNPE 3BAWA 1EO8H 4B7IA 1BECA 1S9WB 4NHUA 4MNGE 1A7PL 1XIWB 4J1UB 1CXEA 4GS7B 5F7EL 4L2LA 4YHYC 2V5MA 3MJ9L 5IB1A 2RHEA 1SJVA 2X38A 2V2WB 3RZWA 3CN0A 3DK0A 3FONA 1MRFL 4O2FB 5ETUB 4WJ5A 3TZVC 2W0FB 2BOLA 2OW6A 2W60A 1AYRA 3NPSC 2VR9A 3CSYB 3JTSB 4EXKA 1ZIAA 5C0RL 5JIIA 2ODIA 4HHAB 1NCCH 4YNYA 1KZYA 1SJEA 1FZOB 4LHUD 4PBXA 4PWFA 3FQ4A 5FUZL 4UMGA 2BCMA 4FMVA 3T0EE 2ZUYA 3CPUA 3ZKMC 1SM3L 3PFUA 5D8JH 2FO4A 3QQ9D 3BDYL 1ZDSA 4ODTH 3SDCA 3V0HA 1E5UI 4AWJC 3DX2A 4R0LC 3T0EA 5TE4L 1ZA6A 4EOWH 2CIKB 4JPIA 3TV3L 2CBMA 5JW3L 4NQSB 1RI8A 3FH8A 1RZPA 4F7PA 1BQLH 1VHPA 1W72B 3L3DB 3SDXA 4K7PY 3NA4A 3NDZE 1VACA 2IC2A 2HG5B 3L4YA 3MLXL 2LLLA 4P5TB 2OW7A 5AAPA 1DEEB 1QP1A 5L4FA 3HI6L 3LN4B 3MX0A 3DUHA 5C8JB 3CXDH 2VQUA 2VIRA 2X40A 3RUGB 4OZFA 1JF6A 3SE8L 4WSJA 5D71H 2TAAA 3QEQD 1I1CA 1OD9A 1G1OA 1UA3A 2YXVA 4GKZB 4WHDA 4F8QA 3FU0A 5HJGA 1PFCA 5DGQA 1AR1D 3SKNA 1NAMB 2XBZA 3W9EB 3QFDB 2IXQB 3EUDA 3GBEA 1X5YA 1AXSA 4XNMA 2R69A 4GLRH 4WGWB 3MLUL 1TO4A 5CGYC 3P54A 3GRWA 5B22A 1AXTH 1QI4A 4CU7A 1E43A 3BP5B 1OM3H 1YA5A 4E2OA 1UGKA 2CRMA 1I1YB 3SDCC 1XD1A 2H0EA 3T0EC 1QSFD 2DD8L 2E75C 3Q1EA 4GUPB 1KTKE 1HHIA 4HQQH 2CM6A 5D1XA 5ERWA 3ZL4H 2YLKA 5CEZE 2VH5L 2APSA 3QRLA 3EYVB 5J6HA 2XQYA 1E6JH 3CLWA 4E42A 1D9KB 3PXJA 1T4KA 5GISH 2CU9A 3JWNE 1Z9SA 4NQVA 4U6HA 4PRPD 1EFXB 1X4YA 5CNHA 3V7AE 4JRXB 2G5RA 1IZKA 4XNUL 1H3XA 1H3PH 3EGSA 5AYQA 1NGZB 3IU4L 1M7DB 4P8QA 4QO1A 1FCGA 4QHUA 1V3KA 2NW3B 2ORBH 3HG2A 5TH2B 1G1YA 5IHZB 1WTLA 2ED9A 2VDRB 3QJTB 2HVKB 5CFHA 4O2CB 1U4FA 2ICCA 5J89A 1B88A 5ADOH 3P30L 4J3UA 5L88L 1QWUA 2PYFB 3Q6FB 3ULVE 3BKYL 2FIKB 4MB3A 4LFHD 2XIIA 3S5LA 4MYPA 5I6MA 1KXQA 5HI4D 3QS2A 5J56B 3ZT7A 4LSUH 3ZGHA 1ORSA 4LIQE 3F7VA 3QJFB 2AJ3B 5EOQL 1T66D 1ZEAL 5AENA 2VE6A 4MBOA 3FN0L 4YBLC 2B59A 4POZC 1CMOA 1HESA 2WMPB 1PZAA 3C12A 5MEPB 1LGVA 4RSYA 3QORD 4JDZA 1LJMA 3QS3A 4TPRL 4X6FB 2OMXB 5MERA 2IV9A 2X9YA 1ZHNB 1E50A 5D1XC 1EQWA 4OLVL 4JM0A 1BDYA 8FABB 3RBGA 1CICB 3SKMA 1FGVH 4TQPA 2CKNA 5E4IA 2R51A 5A2AA 3U83A 2F0CA 4MQXC 3AMKA 3ARSA 2YGVA 2M26A 2FK9A 2XQBH 4YHZL 1RZKH 3J27A 1EAPA 4WI4A 3DHPA 2IH3A 2X4RB 4JKLA 2GQHA 4GIPD 3WLWC 2WZPA 3H3PL 3TA3A 3WDIA 4CW1B 1U8KA 2EUZA 1PDKB 3NQKA 4G1EB 2NY1B 1OAJA 2X1OA 1FO0H 5H94B 2VC2B 3JWNC 2ESVE 1X6LA 3TCTA 4CVZA 4R9HA 4GXVL 4U1SB 1FQ9C 4XNQA 1E4XH 3QDJD 4F5CE 1W9XA 1KXTA 1OP9A 3GO1H 3HW7A 2V3EA 2BWDA 1NSNL 2BP0A 3MXVH 3BKCL 5ICXB 2MH4A 5IVXA 1YDPA 5GGSY 1ESOA 4YFLF 1HDMA 2HH0H 3ARUA 1VJSA 3RWHA 4F5CA 2HMID 4FXKC 4RWYH 1T2QH 4NBZB 4NWUH 2NW2A 4XT1C 4H8QA 2HLEB 4LPUA 5CINH 1NCJA 2DOCA 2BS9A 2OMUA 4J3XA 1QR1A 1MH5B 3QQ3A 2HRPL 4IJ3B 5GS0H 4YSDA 1EEZB 3RBSA 4CGUB 1RVFH 4OLZH 4C56D 5EC2B 4L8SB 2Z7UA 5ES4B 1C7SA 2IGFH 3HRZC 4P2QB 3R06A 2CAKA 3VXSD 1ONQB 3RDJA 3KYOB 4FNQA 3A23A 4FD0A 4AL8H 5I5IA 4I1NB 3GEWB 5JLZB 2D2CC 1CT8A 5ILTL 5C9JA 5TDNB 1YEJL 3MJ9A 5EU4B 3MRBA 3W0WB 2XN9B 1J5CA 1MVFA 2ARJA 2V9TA 1G0XA 2J72A 3APCA 1JHLH 4GW1B 4IOSD 4LU5H 3D5OF 3B3BA 2BVQB 4M6NH 3RIAK 3N04A 4LLMB 2OYLA 3WNLA 3IJ8A 3FFCE 3QDGE 1CE6A 3N1MC 4NB7A 4V2CB 3OQ3B 3GLDA 2IH8A 3EZ8A 3BLBA 4A67A 1JZIA 4G7QB 2BSDA 5ID1A 4PJ8D 4QWWD 2YEZB 4K4KA 4ZQKB 1IX2A 1SXSA 3PIQA 3KYAA 5KOVC 2AANA 3UAEA 1RUPH 5DYOB 5D1ZD 3VRIB 3OB8A 4UNTA 3OMNB 4P57A 3P9MA 4YK4B 3X1GA 1KB9J 4YHML 3U46A 4DK5A 1CD9B 4JFEA 4L4VD 3ZHKA 1NANI 1U58A 4HP5A 4KJWD 1IBZA 2ZJSL 4NNXB 1WWWX 1N0XH 3DXAE 5DRNA 1RK7A 2XIBA 3VDBA 4BZ1L 3VFMA 2RH0A 2R23B 4AJVA 1VENA 1VAHA 3NCXA 4W9ZA 1S7QA 1KENL 3G5YB 3HAEH 1FAKT 4M8QA 4AK2A 5I5JA 4PW3A 4Z5RB 4HX1A 3FTGB 1AZCA 3FK3A 5D7HA 3WN5B 4HA1A 4ELKA 3GMRA 4PY8J 3DSNA 5AAWA 4K71C 4TUOA 5FYJU 3IFOA 1B0GA 5SX5K 5LB1A 4KHXL 5I1CL 5H37G 5I16A 4L9LB 2WQAA 3HNSH 4FQXD 4UCFA 1JE6A 4HXAL 4XPHL 3BD3A 3Q5TA 1SJMA 2AXGB 3V0EA 2ICWA 4BKSC 4Y19E 1UXWA 1ZT4A 1XH3B 1NGYB 4LP5A 1HJCA 2QSCH 4Z0XB 4R2GB 3VG0H 1YPZF 5AKTA 1MWAB 4C4KO 4HU8A 2CO4A 3UGEA 1HX0A 4OGAC 5KWYC 3DRQA 1IGTA 4PG2C 1PS3A 2AV7B 1SHMA 5IVNA 2KL6A 2VKWA 1INEH 4JDVB 3VFPB 5DJ0A 3OHMB 3G3LA 1WBYB 3QWQB 5IUSA 2MPVA 4N0FA 3RGVB 3MNVB 1HJBC 2OFQA 4A6YL 4OVVA 5KVFE 2IWEA 3T1FA 2VL4A 3WTXA 3WEOA 4GXUN 3C5JA 4F7MB 3QQ4A 4MQSB 3S37H 4MD4B 2GK0B 3G5ZB 2VLJA 4HVBA 4CAGA 4PV8A 1OWRM 1LK3H 3FOLA 1E6OL 5CF3A 2ZUVA 3R8QA 1MRDH 1O9WA 1LE9A 2JJSA 2CO6B 3H42H 5AAWC 3WBDA 3ZZ1A 4NENA 4K5PA 4UYPA 2YD0A 3US0A 1SOQA 1CC3A 3DNKA 3NUKA 4A7GA 1YMMB 3E80A 2VR6A 1L5GB 1FF5A 3GZKA 5E1QA 1ZSDA 35C8L 4FGMA 3LXBA 3MN8A 1B0WA 2Z0UA 4DP1X 5SX5H 3QNYA 2NNRA 2X4UA 1F4YH 2MHAA 4NIYE 3CZLA 4GINA 1E9OB 1NH6A 3QJSB 5I24A 4P2OD 3DIFA 1OO2A 2ZNWA 3A21A 5I1GL 4P2RD 5CIPH 3L3HA 3BE1L 1D6VH 2E9GA 2DQGH 4Q7DA 5F1NB 3NSCA 4JPKL 4FDWA 2DQIL 1X7QA 1IAKA 1M7IA 1BM3H 4X0KB 4DP6X 4Z76B 1UB6A 2Y2YA 3MJ6A 2GT9B 2JTYA 4PRNB 3H7LA 4FZ8H 4Z3FA 3KPLB 5A3ID 2AGJH 2H32A 3DDFA 1YNLH 3QZPA 1Z3RA 3HHRB 3D9AH 5CEXA 3NRFA 5CEZD 2VQ1A 2VZUA 3AU1A 4OBRA 1FZMB 3KM1A 1D2PA 4I9WD 4F3FB 3MBXL 4PGZA 4L29B 2GJZB 2JJSC 1A6TB 4AZ8A 3VRLE 1G4MA 3OX8A 2Z1PA 3WIHH 2FYYA 1HCZA 1U8CB 2I9TA 3QZWB 4WI8A 5IJKC 1TLMA 3QUZC 2XZCL 4PJ9A 3AG3B 1LO3L 4XTRD 2ZKMX 2EE0A 1MLBA 4HHWA 3HC4L 3FDWA 3NABL 4O51A 1W8OA 1K8DB 1WAAE 4B3VA 5BJTB 3IRZA 3H9ZA 1DHKA 2XKUA 3GMNB 3MBEC 2XA8L 1GTFA 5TE7H 3ATEA 3ULVD 3D85B 5TK2A 3C60D 1FJ1A 1KLUB 3A4EA 1X4ZA 3NIFF 4IJTA 2DQTH 5HTSA 5CCKH 2BSRB 4WWKA 2G2PA 4ONOA 2AJVH 5FO9A 3LZQA 1AZZC 3EFOB 3GYRA 3NRQA 5I1DA 5KVEE 3H7BB 2O61B 2VMJA 3DVNA 3K80A 4LLWB 3WHE0 2XBDA 4NQEB 2VITB 1JWUA 2P5WE 3LKNB 4RGOL 2DBLL 1MFAH 4WFGE 2YMXH 2CPUA 1G7IB 3UCQA 3MREA 4ECNA 4AZUA 1MCSA 2A6JA 2C1OA 2E7CA 3KWWA 4N6QA 2IBZX 3VTMA 1CFQB 2GK2A 3DPDA 3LX9A 2Z35B 3EDFA 3SE4C 3IDYC 1AHWB 5F0PB 3FAWA 3VG9B 4AYFA 5D9SB 5B3NA 5IOPA 4H1LB 5JOFB 5K1NA 3JV5A 3IGFA 1NC4D 3UBXI 3PNWB 4Y8AA 3OKLA 1CTNA 2V3DA 3FB7B 3WO4B 3KLLA 1GKEA 1RIUH 3ZVVA 2YQGA 3K2UH 4XCEB 1IGYB 3GPSA 2N0MA 4KNQA 2P5EA 2Z7WA 2I25N 4MNQE 3LNFA 3ILPA 3MCKB 4IMLA 1F2QA 5I19H 1KBPA 5DD1L 4NQCE 1L9OA 3BC9A 1JV5B 2M2DA 5I15H 2FEEL 4ZO9A 4LL4A 4FS0A 5ABAA 4D3CH 3VACA 3ORJA 5LQBH 2O5XH 4DN3L 4ZZFA 1F4WH 3HI5H 4M1DH 1JK9B 4DPRA 3FO1A 4D0BB 2PTTA 4NN7B 4NQCA 3ZSSA 1DE4B 4M1GL 1YEEH 2HUEA 4BZ1A 1UACL 4OM1H 3MLRH 4PWKA 5LN8A 2DTSA 2BZCA 4I77L 4J28A 1D5BA 1FIGL 4JRLA 1FL3A 4JJOA 1JHTA 2WXQA 3P77B 5KZCB 1YEDA 1U8LB 4RQQA 2RAMA 4WENB 2VW6A 3IDIA 3ISWA 3KLKA 2OL3A 2YD3A 4ZFQA 4BM7A 1LQSR 2WTOA 4XWGL 4Z3HA 4KK8D 3ABLB 3PWPE 1ITBB 2H6OA 3ARFA 1KXHA 2Z31B 4H7VA 1UFGA 2AJUL 2XXCB 3A47A 3HI1B 3HRPA 3ZMRA 1E3XA 3P2TA 3I6SA 4AMWA 4FTVA 4IIQC 1DL7H 5JOEA 4R8WL 3D39E 2QSVA 3T8VA 3LD8C 1QSEA 4QGYA 3BGMA 3IYLW 4M00A 3O11A 1CU4H 3FN3A 5GQBA 2WTRB 2F7OA 3QDGD 3ETTA 2YBRB 1U3ZA 3HC2A 3MGOA 3KJ4C 3BZFA 5T1KD 2E7MA 3VXUA 3KXFD 1RJYA 4GW5B 5I8KL 1P7HL 2NOYA 1BJ1J 3D4YA 1JCVA 4JMXA 3X1FA 1OK0A 2N1TE 1C5BL 2UYLA 5BVJB 3EJPA 5CILH 2FWOA 3NEEA 1GGYA 1VLXA 6TAAA 2BNRE 3B1UA 3NZHH 5EC1B 4DP8X 1DDHA 4XO4A 4AYEC 3DJRA 1TZGL 3P0YH 4N5ED 3CPLA 1KYUA 1COBA 1I3RB 4PG9A 3V0IA 2DL2A 4HYTB 5E9AA 3DXAD 4D0DB 1JIBA 1UA6L 2BNRA 3Q2CA 2NNXA 3FN9A 4U6TA 3ARFC 3MVSA 2VO5A 5IUCA 5LNDA 2ZUUA 1AVAA 2R1YA 5ALCL 5AL0A 3MLWL 4HWBH 5GGUB 5C6WH 2OK0H 2JJTC 4P23D 1AXIB 1MPAL 3TNMB 1SHSA 2ALAA 1AG0A 2Y0SA 4NO0A 4ZXBB 4WSGA 1GS6X 4FYRA 3QR0A 3RDTB 2CJUL 1A6ZB 5L8LB 3BAKA 4LVHB 1IJ9A 2OA9A 1IEBA 2HFFB 2WZ0A 5BUGA 3GXTA 4ZS6C 2APFA 1SN5A 4RRPG 3IF1B 4JFPB 5J5EA 4HDIB 3S3BB 1KN2H 2EINB 2UZIL 5DUBA 2Q9OA 1F90H 3WKQA 1NKGA 3WE1A 3QIBA 1YNTB 1RHHB 3F05A 4ZW6A 3P4OB 3U4EB 5KTEL 3WUZA 3MRKB 3G5XA 1GZQB 3FCUB 1K6QH 3P0VH 4LSVH 1DO6A 1A3ZA 4M48L 4X9YA 5BV7L 5BXFB 2EDKA 2EXTA 4O58L 1YAZA 2KI6A 5EWIH 4HFWA 3ZE1E 2C3VB 2EVFA 4DO5A 2PP9A 1MLCA 4C54A 5CZVL 3ULVF 3LNDA 1SXAA 4FHBD 4KI1A 3V9FA 1WZKA 3ZTNL 3FB6A 5IB2B 5DDHA 3QJOA 5H2BA 5CJ8A 4QRTB 1RCYA 4X4MA 4YSPA 4H4NA 2XG4A 1R5WA 2C7FA 4JLRB 5LNEA 3RVWD 4MAYB 1BQHA 1XCTB 4YDKH 2XZZA 1P6AB 1BVKB 4TQEH 1A9EB 4L48A 7PAZA 2GKIA 3EH1A 3K1DA 4GSQA 2V0AA 4UM9B 5AZEL 3Q2WA 3ZGIA 4M8VA 1S6NA 2QTVA 2VDOB 1XZ0B 5AW4B 2HT3C 2CUMA 4KRMB 2O1AA 3QWRA 3LEXB 4P5SA 4TSAL 4F8OA 3GSRA 4TN9A 1GSMA 4WV1B 1ET7A 4NRXB 3ZRSA 5JZ7C 1PZ5A 1UJ3A 3AVEA 4LGPB 5ISZE 5FIEA 3HUJB 1JZHA 4AEHL 5FK9B 2ZIDA 1AI1L 3EHBC 2X7LA 4OJAA 2QADB 4PJ7A 3ULSB 3P2BA 3G6DL 3KYKH 2XKNA 3L6FA 4L2YA 4F2MA 2EEDA 5ISZA 2ZX8A 3K1KC 5LGHL 5F93C 1JUFA 1PNCA 4ETYA 3RL2A 5HSFA 5IW1B 4G43B 4M3JA 4XP4H 3HNVH 5BRQA 2Q7NA 4MJ5A 4OZGF 1S9KC 2ZCLH 4GBXD 2P8MB 5F7DB 1YG9A 3UAJC 1I8KA 3NSXA 4PGEA 3GBML 4FQ2H 4EUPG 2NXYB 1AZNA 1I1AD 3W39A 1NWOA 1BJMA 1NM9A 3T6ZA 4X6CB 3DX7B 3INUH 4DP5X 4JM4H 3GSQA 1T2JA 2PN5A 1KG0A 1BHGA 4PS3A 3I02A 3WTWA 2R0KL 3JWOC 2FATL 2NY7H 4XCCL 1PQZB 2XJLA 3D4GA 4Q9QL 1EXGA 1AQDB 2VXTL 4OQTL 2NQ3A 2IPUK 5I2IB 4P46A 1N6QH 3WFCH 3AGWA 5C0AA 4A7SA 3L3GA 3MROA 3QJRB 5AYTA 3QUML 5DZLA 2IBZY 4AIOA 4U0RC 3NA9H 3FQYA 3RWGB 2XQYG 1M1XB 1UJ3C 2YK1H 5MEOA 4OCXH 4N8VA 3FZUD 1ZVSB 5DO8A 1AOHA 1T0NB 4GQRA 3CFKA 1S3KH 2ATKA 3AY4A 4OIAA 4K3DL 2A0LD 2WIIB 3QHZH 3BPLB 1RULH 4PJEB 1J0KA 5EA0L 2OCJA 2EDOA 3FS9A 1WDAA 4YDJA 3TO4A 4Y2DD 5CLXA 3EDKA 2B15A 4LAQH 1E9PB 3BZDA 1E5ZA 3EO9H 4JR9H 4H20L 5HHQA 2LV4A 4XCFH 3V4UL 4DP0X 3CFJA 3QJVB 4Q9RH 4NQDE 4MAUL 4G8IA 2OMYA 4HH9A 5CZXD 2EDDA 1F1AA 4MS8D 1HI6B 1ZXQA 4Q9CA 4Y4FA 1NL0L 2RALA 4DKFH 3E1F1 2G0LA 4ZMYA 5HP5A 3KL3A 2E8YA 3ES6A 4XC3L 1M57B 2AEQH 5I6NA 4XXCA 4DTGL 4FFZL 5GZND 2E76C 5CS7A 2EZ0C 1J05B 1LP9B 4P46C 2KZ1B 3OKOA 5GPRA 3WXVH 2X09A 4X5PA 3CC5B 2H2SC 3C6LD 4KXBA 5ALBL 5HDQH 1TG8A 3X1NA 3R0MA 4ZW7A 1J1PL 3M1OA 4MNQD 4K8RD 4I2XE 4FL4C 5CSZB 1DN2A 3EJZD 3AY4C 1CG9A 4IKLA 3O2DH 4NKOA 1KJ2H 2IANA 4E9SA 1XGPA 3GXPA 4Z3JA 3WY3A 2AV1B 4XHJD 1YNKH 2H45A 1T80A 3HLKA 4I2XA 4FCAA 3L95A 1RZ8A 1EDQA 4NS0A 4POUB 3HMXH 3HE6A 1OSZB 3TO4C 3UX9B 1XB8A 4N3UA 2AAVA 5KANI 2QMKA 4BGLA 2P28B 3GI9L 3W81A 1JGUH 4YXKL 1IBHA 2JIXB 4CKVX 3S4SG 3VFRB 4XCNB 5LAXB 4FYTA 3IJEA 4Y4FC 1R46A 5C0JB 1JGIA 5EBLA 1TQBB 2E46A 2CBOA 5FDWB 5HHXH 5GZOD 1BYNA 3F12A 3FRPG 4NP4L 2ICWJ 5B7EA 2G2RA 2WXKA 1N3NA 1U8JB 4Q56A 5IMMB 3RPIA 5AVUB 1GGCL 3U4BH 2F54D 4S1RL 1UOWA 3U2IA 3V0FA 1PKOA 1WZ1H 4ZS6D 3OMZA 4N9GB 3SBRA 5BO1L 2ITCA 3D39D 4JUTA 3T0XA 1E28B 1FFNB 1OARH 1ID2A 1K5NA 2UXGA 1TZIB 3O9WD 2L4OA 3TIEA 5LJYH 3MV11 4KRPD 4LCWE 5T1MB 2EAEA 3OSVA 5JHDE 3VGEA 3BCDA 2UZXB 3MRFA 3LIZH 2IWKA 2D73A 2VLRE 2XWEA 3ILDA 3QO0B 1K3IA 3BWUC 1QZNA 4D8OA 1V7NH 1EHXA 4FKEA 4XMLL 2CHDA 5AOJA 3MODH 2OLDA 3MSPA 5HHVH 5DMGC 3PU7A 1WEJL 5E4EB 4X8XA 2R39A 4JGUA 1XF5B 3UTTB 4XH2A 3NFNA 2R2CA 1KTBA 2GJRA 8PAZA 4K15A 4D2NA 3FO0H 3RIAF 4JZJB 4NI3A 3RX7A 2QDVA 1AS8A 1LO0H 2GAZA 5K93A 4GRMA 3SOBH 4LEXH 4PV1C 2VO8A 3B2XA 2R0ZH 1XH2A 4PY7A 4G7SB 4WVRA 1F58L 4HUVB 1F3JA 1Q0EA 3FSAA 1VGEH 4J4PC 1WH0A 4U1KA 1FHGA 2CBQA 4QRQA 5EMYA 4J6RH 3S36L 3QYCA 1AAJA 4LLVB 4XI5D 3ROLA 1XEUA 1QO3A 1YEWA 1EERB 1RU9H 1YYLL 2G3XA 4YHYB 3CFQA 3I50L 3OKDB 3V10A 2OMVB 2EIDA 4NZUL 2BOCA 1DCEA 3V0VA 3VFOA 5C0DB 2HFGH 3TZVB 3H9HB 4U0QB 5KSBB 2HA1A 3S0PA 4B53A 3NPSB 2QKIA 5IEHA 3A6CH 5I1HL 2GJJA 3PFQA 4P48A 3SDYL 3QFJD 2AQ2A 1IUZA 1O6VA 2ZOLB 4HKZA 3PAUA 1NEZA 1UM4H 2AABH 5GSVB 1W15A 2E7BA 4ZS7H 1M05A 1FDLL 3AFLA 4LARH 1UM5H 1VSCA 5SWZA 1MFEL 4O9HH 5IM7B 2BNQB 1HKLH 1CR9H 4KOBA 4E41B 3LEVH 5D2LE 3KLHD 3UAJD 4YS4A 1Q94B 4R0LB 2ZXEB 4AMKH 3CLFL 1G6RL 2OZ4H 1R6VA 3RE0A 2ENQA 2W92A 4LKCA 5HHPB 4W1TA 3TU6A 1TQVA 3TEYA 5J11C 3OPZL 3Q8FA 4G8GE 3QDMD 3BP6A 1B6UA 2ZX7A 3KCWA 1NOAA 3DGGB 1BLNA 2ZYSA 3TASA 2NSXA 4DZBA 2FR4A 2EO7A 5FO7A 5DRXA 4YHKH 1BP3B 3VH8A 3QUMA 4NHUB 1UG9A 1P4BH 2OX5A 3AXLA 3V55A 5IB1B 1H0DA 4OFIA 4XX5A 4CBPA 3FONB 1HYSC 1W6WA 2IMNA 4WJ5B 4LK4A 4PRID 3CWGA 1D5RA 2QKIC 2Y69B 1QTSA 1V55B 4YNYB 5TE6L 3VB9A 2KPWA 1A7BA 2WP3T 1OPGL 1ZKAA 3FT9A 5GS2H 2A77H 3PE9A 1KBWA 5I66A 5IFAL 2DJSA 3DURA 5IQ7L 1RUQL 2VRKA 3QG7L 2FO4B 5K33A 4PREB 2X6VA 1MZYA 2ZAGA 3WXWL 5MHSE 3SDCB 3NAAL 1IBGL 3OC5A 1XB3A 3O45A 4RMVA 4TLTA 1GKOA 2CGZA 1ZA6B 3T0EB 3QIUD 2F9BT 1HZKA 4JPIB 4U6VH 2WWMD 1LMIA 3SPVA 4A1RA 5KEZA 4F7PB 4EVNA 1GOHA 3ATDA 2K70A 5CM1A 3CXFA 3ESVF 3N06B 2CLRA 3SDXB 1VACB 4X42A 5DJXA 1DUZA 2UWEF 4LF3A 4EZMA 1ZTXH 5C09E 3D69A 1EHLH 2ROXA 1RP9A 4F9PA 3MX0B 2X1WL 4G11A 4LLDA 2Q8BL 2VIRB 3LRKA 4OZFB 3KMDA 2H2SD 2BWQA 1HCFX 4X6BA 3TN0D 1CL7L 5C09A 4ZW3A 2X6BA 3ESNA 4IRSD 2CDGA 1ODAA 4IBYA 3D34A 1EZLA 2W9EH 5KBKA 3CLEH 3UACA 4PRHA 5HYEA 1KBGH 4R5TA 3I9AA 4TUKL 1LDPL 4P4KA 3AT8A 3MA9L 4QYOA 1EXUB 5DZVA 1BXVA 1AXSB 4XNMB 1WIUA 3GI8L 3Q8BA 1XFPA 4O02L 3K0YA 3KL5A 4OSUL 3G08A 4PRPA 4YBLB 5F21B 4H0GA 4TM9A 3IJ7A 3AT0A 3KVDD 5IEKB 5AVRB 2Q8AH 4R4FL 5HDOA 3AM8A 4HS8L 4NNPL 2B39A 1EMTH 5D1XB 4WEMB 1HHIB 4Z7VE 2DM3A 3FO9A 2WLZA 3RY6A 4GAGH 5C0BA 3PAVA 1KLGB 4Z77A 5J6HB 4JZNA 4E42B 1X6NA 4OZHF 3ZTCC 1T4KB 1DDTA 4EMZA 1B4RA 1N2RA 4U6HB 1ZE3C 3QZOA 5MP6L 3CDCA 1AGDA 3EGSB 4N8CH 1YEKL 4HHGA 5L4JA 4QO1B 3AACA 4QHUB 2B4CC 1IBBA 4DW2L 5D1ZI 4BKTC 1NCCL 4HOXA 3WFBH 3WS3A 1MCBA 4ZUVA 4YVNA 5EO0A 5CUSH 4XNAA 1I85C 2EVGA 4XO3A 4ZJ9A 4NZFA 5DF0A 5M7QA 2YD1A 4YX2H 1A7RL 3S5LB 4U7MA 4OV6F 1ORSB 3QEUA 4P4KC 1Q9WA 4PJDE 5HDBE 4L4TA 3F7VB 2Q20A 2PW2A 4X99A 1HL5A 2VE6B 1KGWA 3MOAH 4N6RA 1AQ8A 1DVYA 2B59B 3VWJA 1BQLL 2EUVA 1P84J 3BH9B 4I18A 4JDZB 5DRZB 4KKRA 5MERB 3JWDH 4QRBA 4XBEL 5CEZL 3S35L 3V6ZA 5HYQA 1L7IH 2QHRH 2VUYA 1H3GA 3V4PH 3BQUD 4K9EC 3RY6C 2ZUSA 1GAFL 3O6MH 1MJJA 3KE0A 3CXDL 3PF2A 3UEZA 5AOKA 5SWQA 4EZJA 1T1ZA 2DYPD 1PYWA 1EAPB 4M4PA 5J06A 4J4PD 5D71L 4FA6A 2JTDA 4MD0A 3K8KA 4RGNE 2IH3B 3T0DA 2NY6D 2UX7A 3AG4B 2GUYA 1PZ3A 1MIMH 1B4TA 5B1KA 1YECH 2BM3A 2NY2C 4NKDA 1RUAH 1GGBH 3ZE1F 1UZ8A 2HKAA 3E6HA 4WNSA 1AXTL 1KXTB 2L7UA 1QOKA 1OM3L 2BP0B 1TUPA 3REWA 3VD2A 3NCJL 3H2QA 5IVXB 3Q2VA 5IOKA 1HDMB 4ESKA 2WO4A 3ZL4L 4ETQA 2NW2B 1M4KA 3GINA 4BRVA 5AG8A 1KTLA 5JHDD 1E6JL 3VWJC 1ZGLM 2GCYB 4GJTB 3BH4A 2OMUB 3S2AA 2VLRD 5GISL 4G82A 1QR1B 1X5KA 2BFVH 1YJDC 1G6RA 3QQ3B 3UC0H 3QUYD 2V8MA 2HLFC 4H2CA 1D5ZA 5BOJA 5A2CA 5FOJA 2EILB 1H3PL 3LB6D 4NJ9L 3ZE2E 1RHFA 2CK0H 2Q0ZX 1ZLVH 1AS6A 2K78A 1N68A 3GZQA 2IQ9H 3AS1A 2ORBL 4HSCX 1T7WA 1S5HA 3R06B 4N2KA 4QJ5B 4PR5A 3IXAA 3E0GA 3F2LA 4UTCA 4YLBA 1RK1A 2OR9L 2XTSA 2YOAA 2WNWA 5ADOL 3WY2A 2UZYA 3Q8AA 1NFDE 1CT8B 3II3A 5C9JB 4OFYD 3TTYA 1KYAA 2BY3A 1MWAH 2ARJB 3SYCA 4PJ8A 4K71B 1C8PA 1DZ0A 2XETA 2Z9TA 3IGAA 4LSUL 4HT1H 1PF3A 3UO1L 4AQ1A 1TCRA 4RGNC 4YHOH 1HHJA 1KACB 3C2AH 3KH4A 1FHNA 4A2EA 3SHSA 1DJSA 1IAOA 3O6FD 3PS6A 3HZKA 4L18A 1LVEA 1J9TA 3KDMA 3W5NA 1CE6B 3FU6A 4DN4L 2B77A 2WXRA 2E0PA 2F15A 1KSRA 3G6AA 4W93A 4HPOL 2BIPA 1TQSA 2MQ3A 4KK5C 3RU8H 3VU1A 4RGMB 5ID1B 4Z7NE 5JIHA 2QFPA 5KUKA 1WFMA 3R18A 4GW4B 4PCKA 3X14A 1FGVL 3PIQB 5AKSA 4OJYA 4HK0A 4N2OA 5EBGA 5EEZA 1FH5L 1H6EA 3ZZLA 2XQBL 1KEGL 4KKAC 4MMXA 3P9MB 4P57B 4Z7AA 3FT2A 4YUEL 3U46B 4M1CC 2DLFL 5E0FA 4JFEB 3UBXG 1BYPA 1DVTA 1JF1A 1IGMH 2LR4A 1U58B 3GD1C 4PJAE 4B41A 2FLRT 3AW5A 4K23H 3VNZA 4NGHH 2HJLA 3LQMA 2D7TL 1QFWI 2ADIA 4IDLA 5DRNB 5I8CA 2BPBA 4OFKA 5AFAA 3VFMB 4XAKD 1CDJA 3O41A 1S7QB 1WVZA 4M8QB 4PJAA 1Z0MA 3CH8A 4HX1B 2GIMA 4ELKB 3GO1L 3GMRB 1WWAX 3DSNB 3MXVL 4G8GD 5LGKA 4I5BB 3IFOB 1B0GB 2CR0A 4NAJA 5LN4A 4WAFA 2HH0L 3H6AA 4I3RH 5FA4A 3WNPA 5HPOA 5I16B 4RWYL 1T2QL 1D6EA 2Z8SA 3K8LA 4FLHA 3DGCR 1CB4A 4GPVA 4PN6A 3GSUA 5LBVA 4EEEA 1SYVA 3S3SA 3D3VE 2ICWB 3N91A 1BZEA 1UXWB 2OJEA 1ZT4B 4O02A 5IBUG 1MI5A 4WUUE 1XHHA 3UTSE 4JZOA 1IO4C 2AHIA 4OLZL 3D4CA 4WKZA 5KYYB 4RAUA 1UT9A 1IGTB 3HCVA 1IILE 2IGFL 3VCLB 3TJPA 3B7TA 3LVTA 3OAZK 5IG7A 4UQAA 4WUUA 4ANXA 3UTSA 1U93A 5D72L 4MMXC 3BT2H 5FO2A 3MRIA 2C3XA 4AL8L 1NMBH 5HYJE 4N0FB 3ASWA 3J2PA 2CZNA 5B1CA 3T1FB 4NO3A 4TXVB 5KVDH 4FCHA 1EJOL 2WM0A 4RRPM 3WJMA 2ADYA 3C5JB 3CSBA 4BE6A 5GGRA 4HJUA 2WWKT 4XP5H 3L4VA 2DQUH 2VLJB 2F74B 5F2FA 4PV8B 3ZBMA 4E9WA 4LU5L 3FOLB 4QKXB 5DD0H 5ESVA 3T6VA 3BO8A 3X3FL 3OXSA 4LLAA 1W0VA 1GYAA 4NENB 2OQJA 2YN5A 2ETWA 4MASA 2NDGA 5IHHA 1OCWH 2XTJD 4RA0C 4NSKA 3RRQA 3ARYA 3SDAC 3R1GH 2FX9H 4Q2ZA 4QXGL 4X6EA 4N1CA 4PGDB 1ZSDB 4P2RA 2V7HA 3NCMA 1RUPL 3IFNL 4QY8A 3VDAA 5E7BA 2P48B 1IBDA 2OM5A 3MBEB 2ZX5A 1ZJBA 2X4UB 2MHAB 1YLBB 3C08H 4JQVC 1BOGA 1GIGH 1E9QA 1UZGA 3BWZA 1ZY9A 2X70A 1QAWA 3WFEH 3T0AA 4FFVD 3QQXA 5EORH 5DEGA 1HE8A 3FTXA 1BJ8A 2X3AA 4LASH 3WNIA 2Q3ZA 3E2HC 4KNTA 3T9WA 4QYAA 5JW4Q 4POYA 1X7QB 1IAKB 1M7IB 1U3HA 2EEAA 3PYCA 1UB6B 1UD6A 3OAZH 2H32B 2YQ2A 4ZTPL 1N59A 3ZJAA 5CEXB 1PY0A 4G8FA 4KBPA 1OCCB 4N8VG 3KWTA 2VQ1B 3AU1B 4F7EB 1NM4A 4JY5H 3HNSL 4A7QA 1GS8A 3EBAA 4R7LA 3IDYB 4OT1L 3BT0A 3OX8B 4RESB 2FYYB 2J4WH 2I9TB 3ABKB 3LV3A 3JUYA 1OGTA 4R7DA 1ZHKA 4UTBH 4KI5E 2X9WA 3N42F 1MJ8L 3N9GL 3BRGC 4NRZA 1MLBB 1AO7D 2HKHL 4PBWD 1INEL 5CJQH 4PUBL 1D3CA 1JYWA 1HT6A 2CGYA 2DEXX 3WKNA 2XBTA 3L4XA 4JPVL 1QFUL 1VRSA 2JF1A 3ZDXF 2BOBA 4QRPD 3LRGA 1CN4A 2PUQT 1HCVA 3MRCB 1YN7A 1VCAA 1ZK9A 3GUFA 5ICUA 2K4WA 4KROD 3S37L 4WWKB 2O72A 4PVBA 3B37A 3FQTA 4GG6A 3BYYA 5E4OA 1Z32X 2E8ZA 1ET5A 1D7CA 2ITEA 1C5CH 1IQDA 1LK3L 3CHXA 2FWSA 3ESUF 5BRPA 5I1DB 4Z3TA 3R7RA 3BGFC 3U9WA 5HI3D 1N12A 1JXGA 1NC4A 3DO3A 1MHHA 1TVHA 1U3HC 3T6XA 3QNXA 2DKSA 3H42L 1VFMA 4X8JA 3CZEA 3CFBA 3MREB 3PWJA 2DQDL 4M6ML 4ZO8A 5T1LD 2OR7A 2C1OB 3BVNA 4I89A 5T33H 1QNZH 3KWWB 2YZ1A 4ODBD 7PCYA 1DJWA 3I6GA 2GABA 3T0VA 2K1MA 1VKXB 3U9PH 4AYFB 1UXSB 4OZGA 4AYDC 1QQDB 1EFQA 4XVTL 1F45A 3T04D 2EXWC 3OKLB 4FJZA 2GI7A 2DBJA 3LSOA 4H0LC 2X4NA 2W88A 4XN7A 3HB3B 1CVSC 2DQEL 3SGJA 3LD8B 3VXME 2ZP9A 3T6WA 2P5EB 3OB0H 4JQXA 4QHLA 5AVZB 3T09A 2W9DL 4KI5C 4OM0L 4IMLB 3GHEH 1E7UA 2F2HA 1D6VL 1N64H 3Q44A 4ELMA 5E1AB 3LKRB 1P7QA 2EH8L 3EGDA 4N9OB 1CLCA 1BM3L 3KJ4B 2FO8A 1O6SA 3GSNL 4JM2C 1ECZA 3ZHFA 2AGJL 1U92B 3MACL 1YNLL 1REIA 2YD6A 5DK2A 1CDCA 1G0YR 3FO1B 2PTTB 4NQCB 3SZKC 2YAFA 3NJGA 1MQKL 3MRLA 2MOGA 1T0MA 2DWYA 5I0ZA 1CLZL 4WK2B 5F7HA 2CA4A 1L6ZA 3WIHL 1FL3B 3WI9A 1JHTB 2HKFH 3MFFA 2ZOUA 1YEDB 4RQQB 3WGVB 1SXZA 2FGZA 3IDIB 3T1WA 4AUJA 2OL3B 4EN2A 4DWHA 3FUJA 5F7BA 2G4GA 2DWDA 3ARFB 1NBYB 4ZTOH 1OXYA 2ZP8A 1RZFL 5T1KA 1A7QH 1HAUA 2V3FA 3LOWA 4XX1E 3KXFA 4PRAA 3PWPB 3B2VH 4HKXA 4FTVB 3EDDA 5E70A 2F8VA 3S3JA 4PD4K 2DQTL 3B9KA 3T77A 4K8RL 5CCKL 2YEQA 4UQCA 4L5FH 5T3XE 4KTYA 3BGMB 2VLMD 4JQXC 3IMRA 5H37H 1EUUA 4EIUA 3O11B 4HWNA 2JJVA 2YUWA 4AQEB 4U1GB 1RZKC 1TJHH 3GFUA 2R4SL 1M6OA 3MGOB 1PZSA 3BZFB 3QEGL 3VA6A 4XB3A 3VXUB 3LEYH 1RFDH 1RJYB 4DP9X 3HG1E 5BS0E 1L4IA 2CNYA 1DQDL 2DEWX 1S5IH 2WBJA 1EBAA 1HU8A 4ZMZA 2WQSA 2H1PH 2UYLB 3IJ9A 3C9NB 3L5XH 2FWOB 1DVQA 4M3HA 3RI5K 4YQXH 3FQRA 1KFAH 2GB2A 4P23A 4YZFE 5D7EA 1DDHB 3FQXA 3NQIA 5B4MC 3NP4A 2VJ8A 3MFGB 3CPLB 4NZJA 5EUKA 2JLPA 3GBNH 4PG9B 4DOHE 5E2TH 5D7IE 1RIUL 2QKSA 2BNRB 4ZPTA 1QA9A 3K2UL 1A6VH 4WF7A 3MV9A 1LWRA 1E40A 1Y1UA 2AQQA 2R1YB 3CUPB 3LHPH 4OGXH 2RACA 3T3PB 3B2MA 4MAZA 2CO1A 1OGAE 3UBGA 4AUUA 3V0WL 1T6BX 2FT8A 1MCWM 4M7ZC 4R97C 4PJFF 4NO0B 3ZZQA 5GS0C 1TQCC 2JCCA 3B9KC 4JQIL 4K2UL 5GXBB 4DO4A 1N5YL 3NCYS 2MSPA 4NZTH 2G9KA 4AGOA 1DUYA 1IEBB 5DTFA 5KANG 1JMXA 3U1SH 3DBXA 5C2UB 2YAOA 4LSDA 2YQBA 1YCSA 1DBJL 4OM1L 4PJBE 4WFED 3D3VD 3EOBA 5DUBB 3PY9A 1LDSA 4GRLC 3HAEA 4AL8C 3EHBB 3QIBB 1GTNA 3GZOA 2LQRA 3G5XB 3LTVA 2WBJC 4JFHE 4LHUG 1DSFH 2H47C 4CA4A 4K7FA 4Z3EA 5IWLC 2X4OA 1XXDC 4NC2B 3FT0A 3LZOA 2OTPA 4HZAA 4HFWB 5I9QC 3VVWA 3MGTA 4KQ4H 2A2QT 1HNYA 4OW6A 4FKKA 1MLCB 5EF1A 3Q3GB 1OP4A 2X1XR 3ZE0E 3KJ6L 2VSKB 4PJHE 3UYPB 3TNNB 3RZCC 4X7EC 5DDHB 4UB0L 1QBML 4Q6IA 5H2BB 4DUWA 5HYFA 1UCTA 4K3EH 3KW7A 5E56A 2G30A 1J0YA 1R5WB 2XG4B 3OJMB 5AW6B 4MDRA 3RURA</