2J6WA

R164n mutant of the runx1 runt domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
SMVEVLADHPGELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHNAIKITVDGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUNT-RELATED TRANSCRIPTION FACTOR 1
publication title A Mutation in the S-Switch Region of the Runt Domain Alters the Dynamics of an Allosteric Network Responsible for Cbfbeta Regulation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 23
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00853 Runt Runt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j6wA00
1T4WA 3VD0A 2IOMA 3WTSA 2IOOA 5AB9A 3Q06A 4MZRA 2ATAA 2ADYA 3WTWA 2YBGA 5AOIA 5AOLA 5G4NA 3KMDA 1TUPA 2XWRA 5KBDA 2AC0A 1EAOA 2J1WA 5G4OA 3D0AA 5AOMA 2H1LM 3ZMEA 4IBYA 4IBUA 1CMOA 4QO1B 2MEJB 3WTVA 3IGKA 3D05A 5A7BA 1CO1A 3Q01A 3IGLA 1UOLA 2WGXA 2FEJA 1HU8A 4HJEA 3VD2A 4L0YA 1GZHA 2J1YA 4IBVA 3WTXA 3TS8A 1HJCA 2OCJA 4AGPA 4AGNA 4AGLA 4IBSA 4MZIA 1TSRA 4IBTA 3VD1A 4GUOA 1EANA 2VUKA 4AGOA 2BIPA 5ABAA 1H9DA 4IJTA 4LO9A 2J1ZA 3EXLA 4IBZA 4KVPA 3EXJA 1KZYA 3US1A 2AHIA 4IBQA 5LGYA 3D07A 3QYMA 3US0A 4G83A 1E50A 2J6WA 3WU1A 2J1XA 5G4MA 4G82A 4LOFA 1GZHC 2BINA 3D06A 1IO4C 3D08A 2BIMA 4IBWA 3QYNA 4A63A 3KZ8A 2RMNA 2X0VA 1LJMA 5AOKA 2BIQA 4GUQA 2PCXA 3D09A 4AGQA 5AOJA 5BUAA 2J20A 3Q05A 2X0WA 5LAPA 4XR8C 4AGMA 2GEQA 2IOIA 1HJBC 1YCSA 2XWCA 5ECGA 2P52A 2BIOA 2J21A 4LOEA 1EAQA 4L18A 3WTTA 2X0UA 3WTUA 4L0ZA 3WTYA
chains in the Genus database with same CATH superfamily
5CJQL 5DHYB 1U36A 4IM8A 4P9MH 2ZD0A 3O6FA 4N5ED 3PNRB 5ACMA 12E8H 2IGLA 2WBJB 4HJGA 4HS6A 5LBSH 4BQCA 5LVEA 3RPIB 4DVBB 1S5HB 1E9PB 3DVNB 3RZCD 4LSSH 1BVZA 1AIZA 4J12A 3V52L 2EVFA 4DN4H 2VDQB 1P6AB 5L88H 3T71A 1VGEH 3QO0B 5CWSA 4UDTA 5DMIL 3H42L 5KSAA 4QO1B 2ZPKH 3JWDH 3TN0D 3O4LA 2HPOA 5IFAL 1IGCL 2YK1H 4H4NA 4H13C 1UEYA 1MUJB 3LQAH 4GP8B 3B56A 4NN6C 5MHSD 5FIEA 3NJXA 2IF7A 2EVJA 5IJKA 1U3HA 2HRPL 2R15A 1WWCA 2CAKA 3NACH 3LYRA 4KXDA 4WWPA 4YDVA 5IEHB 4L4TE 4OF5A 1U9KA 2XXGA 3GXTA 4KQ4L 4UIKL 2NTFB 1WA0X 2PP9A 3GIZL 1MFUA 3I02A 5IF0A 2VH5H 1SJHB 5FV1L 2P5WB 3NSYA 3PF2A 3WO4B 3WN6A 5FYJE 5IKCB 5ELIA 1T2JA 1MI5E 5DUML 5I1CL 1UM5H 2F7OA 1ZHNA 3FC8A 1ZLSH 2HFTA 4MWFB 1R46A 4NZTL 4IJ3C 3P30H 3Q3GA 2E4TA 5DS8B 3P1VA 5E8NA 1ECYA 4WY7H 4S10A 5EF1A 3LAFA 3ESUF 2NXZD 3GB7A 1NCBL 4FA6A 3O6LH 4X0NA 5EF2A 4BZYA 2Y07L 2KZ1B 1N10A 1I82A 4DZBB 3HC3L 3L95B 4KROB 3HG0A 1NMBH 4Y1AA 1WIPA 2QVFB 2HG0A 2PWHA 2EIEA 3A4FA 1DDHB 4FKEA 4XP6L 1YN7B 5F7DB 5ISZE 1F42A 3SDDB 2IAMD 5IMLA 2EO9A 5DZLA 5F3HA 4JO5A 2QR0A 2EE2A 5MEQB 1GZQB 1F1GA 1A9BA 3BXNB 1CFNA 4Y8AA 1B3IA 3QFJB 3H4HA 3QUXA 4L2YA 1ZIBA 2WBWB 3VMNA 5T1KD 3V4UL 4OI8A 1FNGA 1T66C 5D6DA 1FFQA 3M1OA 5I26A 4PGZA 1XR9B 1NFDE 3C6LD 3ZTJH 3O11A 4UNUA 2LHAA 2B3IA 5J4MA 4KI1A 1JGLH 5CR1A 5DC9B 1IGYA 1G6VK 1NCDL 4WFHE 4AVKA 5AW8B 1L3WA 3K4AA 2R0LL 3UBXG 2MIZA 3E9UA 5FC9A 3TBSA 3CHPA 3VI3E 1YPZA 3L54A 3X14B 4ODHH 1TEFA 1KJMB 5EPMB 3FB7B 3WFBH 3KPQB 4WI3A 3ZL2A 4TNGA 4R4NC 1BP3B 4UZSA 1FFPA 5IREA 2IAAC 3GK8H 4CU8A 4U1NB 4L4VB 4BH8A 3MXVH 4I89A 3GPEA 3T6QC 1OAXL 2X2JA 3WLBA 5KYUA 2DWEB 1A4BA 2OTPA 1KBPA 1SPDA 1MFAL 1GS6X 3NRQA 2NR6A 5KBLA 4JY6B 2WXJA 3L3GB 1XHHA 4FQLH 4FG4A 3NIFB 3MA7A 1R75A 5IR1B 4AG4L 1NFIA 2OZNA 5SWQB 3KPMA 2Y5TB 3NSFA 5TD4A 2N3JA 5HYQA 3QK0A 1KCRL 5ANHA 5FDYA 4L0PB 2RA1A 1DJXA 4Y4KA 1HX0A 1JYWA 2Z9TA 5J3HC 4HHAA 3FFCB 4KZ0A 5I0ZA 3VG0H 3M1BA 1RLWA 3O3DB 5HI4D 2VZSA 3ECQA 1HZHH 4W4NA 3W1ZA 4TVUA 5LGKA 4UIMB 3HG2A 5F9JB 5IJDC 3VD4A 4H26B 3BAEL 4MFHA 1D7DA 1NJ9B 4IOSD 1SEBB 1TITA 1KJ2A 3QIBD 2ED6A 1SJVA 2F1EA 1BGXH 2HLAB 4GS7B 5EU6D 4PMEA 2L0DA 3SKMA 5AOJA 1EXHA 4HKXA 4B5ZA 4YGVA 1HHHA 4LCUB 2OMXA 3TGXA 3G6JE 4F9LA 2H2PC 1YEKL 3MJGX 1EFXB 4KV5F 3PGDB 1VERA 2NY5H 1YEFL 3T0EE 4OJFH 4D94A 1QWHA 3CPLB 2YAOA 2N59A 3HUJB 5H94B 4DT2A 4JFWA 3AXLA 4WFED 1DVFD 4LSRH 4NSKA 4J3WA 4D9QD 1P7QB 1I8KB 1WCBB 4F7EA 1N64H 4I8DA 4LLMB 3DXAE 4HC1H 3R19A 4Q2ZB 4EN3C 1LD9A 3E7JA 1JCVA 2EDDA 5I82A 3OKDA 4UU9A 2QZQA 1TKWB 5AYQA 4GRLD 4LLDB 2XN1A 3M45A 5E94A 1T3FA 5CBAB 2E7MA 4RAVA 1NKGA 4M1CD 4PY7A 1PZCA 1SEQH 3K6IA 1BD2D 3EYOA 3QWOB 4UINH 3MJ6A 5AUMA 4AM0A 4KAQH 1JZ5A 4Y2OB 1ZTXH 4KDWA 1GC1C 1VZGA 1BG9A 3D4ZA 4OIIL 4BFOA 6FABL 2J2ZB 4GNKB 3R8QA 4N2HA 4WIQA 3QQNA 3GSUB 4JY4B 3K80A 5KANI 3VGDA 1GS8A 2G4EA 1GIGL 1BOGA 1OKEA 3I9GH 1W0YT 3LRSA 1ZMYA 3MRHA 3SE3C 5IIEA 4ZTOL 1H15B 2IC2A 2CO7A 5FDWA 3EO9H 2V9RA 3EJYC 5SWZD 1G6RA 4XBEL 1P5UA 3H2WA 4ZXBB 5JW4M 3RIKA 5BVJB 2DQIL 4W93A 1P7KA 1YY9C 4OKVA 4MJ5A 2J1KA 4LL9A 5JYMA 4E0RA 3SDAA 1E9QB 4GMTH 1M7DB 4AQZA 5JUEH 5L8JB 1OHZA 2V17L 4LSDA 5MI0C 2GQHA 1OL0A 5I23A 1NCWH 5JR1L 4TUOB 2BSEA 2AK4D 5DUBA 3MLPA 4N0UE 4OUOA 3DBSA 1ASPA 4XAWH 3WIHH 2X87A 2JKTM 1J9SA 4KFZC 4E5XB 3ARDB 4NPYB 1MWAH 3VD1A 1P5VA 2JE8A 5DD5L 5D1XC 3KGUA 3ZDXF 4TOYH 1H9DA 2C9SA 3OGCB 4HUWA 1IKOP 3D30A 3GXIA 4WUKL 1RJLA 3UADA 3VGEA 5J11B 1T7XA 1KIUA 4N6RB 1EXUB 2Z4TA 2YARA 4HK0B 3VXMD 3DIFB 1BMWA 2X41A 1MRCH 4KJQC 1ZXKA 3US0A 2XG5A 3DHMA 4LKXA 1FH5H 4XX1E 1MEXL 1WICA 5EUOA 5B8CC 1NAMB 1E65A 3VI4A 4HXAL 1OCWH 3UX9B 1T1YB 1S7WA 3BDYL 3BUYB 3HC4L 3UJTL 2JJTC 2I07A 3ZHDA 4LAJH 5TPWL 4NUGL 3P0GB 5DK2B 3QIUA 1IC0A 4K7PH 3GHPA 3W11C 1EV2E 1Z5HA 3BE1L 2A74B 5L0QC 3F6JA 4JDVB 4JL1A 3DDGA 4JL2A 3V5HA 4AGQA 2BM3A 25C8L 1MLBA 3OBAA 2Y7QB 1YEDB 5C6TH 2ORBH 3UTTA 1I8IA 3CZUB 1JIBA 3OR7A 1PG7H 4RQQA 4XVJH 5EIQA 1HTYA 5L6YH 4BGDA 1XVSA 3CWGA 4OGAD 1EJ8A 2P28B 4I0PB 4QOKA 4BJLA 2GYSA 1FIGL 5DJZA 4P5TB 1HL4A 1O6SB 3CIAA 4XGZA 1RZPA 3QG6B 4BBWA 4BSVB 3KLQA 2V3FA 3PGFL 3POHA 5F0PB 5DMGD 3CFKA 1RJCA 5K9OB 4HV8B 1CF8L 4HGWA 3VXMB 4LQFL 3FL7A 4GB9A 1UVQB 1AAJA 4UBDC 1I3VA 4JGMA 2NYZA 4JHBA 3TA3A 2VXUH 1KPRA 3ABZA 4EI5D 2I69A 1NMCC 3VXRE 2PPDA 2ZYSA 2CBTA 1WC7B 2EH7L 5DVKA 1M71A 1BQUA 3TONA 3MUZ1 3FHAA 3O6FD 3RTQC 1RIHH 3MA9H 5IB3B 4OM1L 5F71A 1KJ2L 1LXMA 4FYTA 2MEJB 3OLGA 5DJ2A 3TEWA 3GF8A 1E6JH 2XETA 2Q3ZA 4N5EC 5J13C 5E1GA 3PIQB 1WAAE 4PLJD 5F7EL 5ISZA 1LL1A 4BCXA 2X4UB 4JDTL 2D9CA 4HJEA 3ARXA 2B2XH 2ADFH 1S7SB 4OGXH 5FGCB 2VDPH 3AS1A 1A9EA 4N0RA 3O4LD 1YECL 4YQXH 3B9KC 4QLRA 4BDVA 3OVUB 4R90L 3TN0C 1AZBA 1A14H 1QHPA 1W72H 3DMMA 1XO8A 1NPNA 2SODB 1FFRA 4UT6A 1U3HD 2VR6A 1HAWA 1MRDL 3OPZH 1KT2B 3STZA 4PLNC 3LPFA 4FN0A 3QFDA 3SKOB 4KKRA 3N1FC 2BOCB 5E2WH 1HWHB 2EDHA 4P2QA 5E08H 3ILPA 3KM1A 5KVEH 1YSOA 5T33L 2VLRE 1G7QB 2YD6A 5CEYA 4QD2E 2ZXCA 3HMXA 1AGDA 1QR4A 3FSWA 2EUXA 1D7CA 3IDGB 3WAJA 4JO4H 5ICYB 2V2TB 3DOSA 3FONB 4N3TA 2XN9E 5DHEA 1G6RL 2HKFH 3ZKMD 4K7FB 1UM4H 2WXLA 1QR1B 5FOJA 5JHDA 1BVKA 2FT6A 1MLCA 4D2NA 3V4VH 2Y5QA 1AKJB 4MXQD 4IKNA 1KENL 4UYPA 4BK5A 1NFAA 1GVIA 3VD3A 4QRPB 5AAMC 3ZRSA 2DI7A 3QUKA 1CFSB 3DGGA 4Z7VE 4HULB 1IQDB 1NFDF 2BP8B 4HFWB 1FLTX 1NOLA 1T2QL 1HHGB 4XO3A 3DYOA 2DQUL 2XWTB 4S1RL 4YNYB 5IBUG 2W60B 2Q8BL 4NP9A 2JK5B 2CHNA 1F3JA 3AFLA 3QCVL 3QUXD 3TBBA 1IBGL 3VFMB 2NY0D 4QRRA 4WO0A 1TTUA 3EGXB 5HGAB 1K4DA 1P84J 2MQGA 4L3FA 5D7LE 5T5FA 1VACB 1PYWA 3OLDA 1ZT7A 3GGWB 3HI1B 4GIPD 4OLWL 1D9KC 1R4XA 3JTSA 5HDOA 1IL1B 2Z4QB 4TVSa 5D7KD 2BHFA 2W80C 1EBAA 3BKJH 1E8YA 2XQBH 1S2EA 3ARPA 3QISA 4UT9H 1A7PH 4AYFB 2YRZA 4JPWL 3OWEA 2NTSP 4Y19A 4NO2B 3T0XA 2APSA 2P42B 4QT5A 2AF2A 5A2CA 2K7PA 1JWSA 1JDCA 3LN5B 3LRKA 1D2PA 2YJQA 3LHPH 1TZGL 2CR3A 2YMOA 1HXYA 4KO7A 3TPKA 4MTMA 5GXBB 3QHFH 4JPVH 1F8TL 4Q6YA 2CKBH 4AQ1C 4NN5B 4XNXL 5F1OB 4AGLA 3LZFL 5C09B 1FN4B 2ZTBA 3HR6A 4GUOA 2QVIA 2HAZA 4YGAB 1JD9A 2ZOLA 1BQKA 3EOAA 4NNYB 1QRNE 4ABVA 4P2AA 1LEGA 3JWOC 2NR6D 4R7DB 2FGWL 1CD1A 4IDJH 3KD4A 3RWFB 3AZUA 1UACH 3QB7C 5BZZA 3S37L 4MNQE 2D4FA 3GT6A 1H9VA 1BDYA 5IVXF 4X9HA 1TJIH 5DHVH 1IGIH 4NUJA 3LZOA 2TRYA 3NCYS 2B0SL 4ZMPA 2JIXA 3DO4A 4Y4KD 3UAAA 2DQFA 1H6UA 5F9OL 3CFCH 2C9RA 3P73A 4AYDC 5KVMC 1UM6L 1NUNB 3CGTA 2PO6C 2YPKB 2ERJC 3G6JF 4PTUB 5FWRA 3AQDA 5KZCB 3T2NL 3CIQA 4NI6A 3US9A 2D03H 3ZVVA 3VFRB 4EVNA 2HFEB 2MNWA 3S97C 3UYRH 3GS4A 2ZAHA 4M7JH 1GSKA 4XP5H 3B7SA 4BUGA 4K71B 4AQOA 3W9DA 4EE2A 4JJHA 4MQTB 1JVKA 2W0KA 1H6EA 1X6LA 4HG4K 5E6UB 2HT2D 3N04A 4DKTA 1I7RA 3ATDA 4Y88A 1OSPH 2V7NA 5BMFH 4XMPL 4UT6L 4EZLA 1G9HA 4ZOCA 3BH8A 1JYNA 4X4KA 4HIEB 1MVFA 2ITDB 3QHTC 3NFNA 4IU2B 1A6WL 4K5MA 4HWEH 3I50H 3PWLB 4CSZA 3Q06A 4FFVC 4WCYH 2YBGA 1HL9A 2CLRB 1I1CA 4WW2F 3WSQL 3WE6A 3GSWA 5IHBA 3HMXL 4NQUA 2V6HA 3V6ZB 3CBKB 4X5RA 4G6AD 2K78A 2ODIA 2IBBA 1S7VA 3T6XA 3O45A 4ZTPL 2WOBA 5MHSE 1ZHKB 5AVYB 1CE6A 3CFTA 3LZLA 4M1CC 5ESQB 4DPBX 2O6EA 4PJ5A 4CMMA 1CK0L 3T9WA 4HIIB 5E0QA 1LO3L 1KXTB 5D70H 4FL4B 1ADWA 1S9VA 1RZ7H 2YKLH 4QHNB 2G3XA 2EXYD 1D5XB 2HJFB 3FT3B 2VL4A 2ADJB 2HRGA 3P2TA 3DJRA 5CSBA 5IMMB 5KBMA 1SYVB 3VW3L 3AGVA 1JZ6A 3HLKA 1ZT4A 2IV9A 2VSKB 1ZA3A 4ZQKA 5C7XL 1XGPA 3GZQA 3EJRA 4O2EA 4PJ9B 4MGXA 3BQUA 4FGMA 4EUPB 4ONOA 2WN2A 2WKLA 3U46A 2EUVA 1DE4B 4ODUB 2BSED 4QRTA 3MACH 3PWPB 3B2DC 1U93A 2ROXA 4D9LL 1INDH 5IW3A 1QSEB 3V0WH 2NNRA 2F1BA 5E6IA 3K74B 5BQDA 4AK1A 1SMDA 2PTTA 5CD3A 1IC4H 1G94A 5T5FL 4ZUUB 1IM3A 3D69A 4H8VA 4MXWH 4UQ2B 3C5ZC 4P8QA 3CVBA 2OZ4L 3ZMNA 5E56A 3U4BH 3ZGHA 5F7WC 3MKGA 2GJ6E 2X4QB 1H3XA 4Y16C 2DEYX 1J0YA 3BSHA 2BDNH 2DYRB 5C0AE 5J9PA 4M6ML 1Q9LA 2R4SH 4DGIL 5BRZA 4JGNA 1OPGH 2G3MA 1ZVHA 1OTTD 5C0GB 3RAJL 5DS1A 3MBWB 4TULL 3QIUD 4RCAA 4FNSA 3WFHA 3FQ4A 4V2CB 4QKXB 1LDPL 2A73B 4WI8A 4HCRA 2YGNA 3NIGB 5CSGA 3C6SB 5I1EH 3DSNA 5C08B 4P4KD 1CT8A 1EAQA 2P8LA 2OMZA 1N59A 1P4BL 3WTTA 4AKPA 2HN7A 3UTTD 1O9ZA 1BZQK 3LNEA 4LLYB 5LCVA 1CGSH 5SWSA 2FECL 2Z8VC 3R4RA 4LPCA 2DQDL 3CX5J 4QOKD 1NGPL 4QF1B 4WWKB 3RA7L 1OQOA 4MZRA 2ATAA 5M95B 4WGVB 2XSKA 1MCDA 1R3JA 3H9HA 1B2YA 5I73C 2LV4A 3UOAB 3LEVL 4YHYB 3SN6N 4H2CA 1QZ1A 3D0VB 1KGXA 1U4EA 3INUL 3S5YA 4V2BA 4O51A 1DR9A 3QUYD 1L9OA 5EZIH 1CXKA 3TA3D 2W5PA 5KYXA 2CDEB 4HWBA 1WAAF 1OGTA 1PL3A 2UV3A 1PKOA 4F57H 2WTOA 1SUHA 5I30L 2D7OA 3CFNA 2H9GA 2APXA 4EI5C 1QBLL 2EZ0D 5GSVA 1EVUA 2AJSH 2W65A 1KFAH 3WXWH 4PJCB 2Y7MA 1O7SA 1H6FA 4DP1X 1FBIH 2ZCKL 4A55A 1QSFA 3DSFL 5F3BB 3KEHA 3LRGA 4M6NH 2A6DA 3G5YB 4E9SA 5A2FA 1KJVB 3RHWK 5HJGA 1EANA 4WNQA 5EC1B 5K1NA 3MRKA 1T0NA 1H0DA 2F7IA 5INCB 4AVIA 3AACA 2WQRA 3OJDA 2QHLA 2OA9A 1GY2A 3A6CH 4G8EB 2ID5A 4OD1H 3SPGA 1V3LA 1YMMD 4JFEB 4LFHD 5KSAC 1OE3A 5F1IB 3DMMD 3ZMRA 3CSPA 3VWJA 5E5RB 1RUPH 2OR7A 4EIGB 1E3FA 4FEMA 1BYOA 5EV7A 2W92A 4LOVA 5D7LA 3T04D 1ADQL 3T3PF 3TM6A 1KJ3L 4J6IA 5CZVL 5JTWA 3GUTA 1WISA 5IJKC 2OW7A 4P2QD 3SQOL 1IO4C 1U3HC 1PZBA 5EC2A 4M7KH 1VKXB 3FTXA 1DEEA 3WXVH 2BY3A 2NLJB 3EO0A 1TOXA 2BW4A 1GC1H 1NGYA 1S7UB 2N01B 3KYOA 3T8MA 1R3KA 3HE6D 3MODL 3OF6A 1A6AA 4HF5L 4E41E 4HKZB 5GJSH 4J4PD 1Q9WB 4WFEE 4CC4A 4A68A 1R24B 4PAZA 1DVXA 1AYRA 2XY2A 3NH7L 4LLUA 4Z7VF 5AVSB 4OIBA 5JOPD 3B6SA 3FUFA 3O9WB 4N9GB 4JZJA 4OKDA 4POZD 2VSMB 4KTYA 1NDMA 5CGYD 3E6FA 1HILA 3UIZA 4LOEA 1WA1X 3MRPB 3J27A 1GS7A 4LBEB 3ZGIA 4U1GC 2YD2A 5DRZB 1BD2E 1ZRUA 3ATAA 5F6HJ 3V9EA 4Z3FA 3OR6A 2J43A 5L7XH 2NXYB 2PYFA 4YXLH 4HWZA 2VLLB 5LJYH 2ADGA 2XWDA 5BPPA 2KC0A 4MXQC 5L4MA 2UY7A 3WTSA 2Q2LA 4UYQA 2IOOA 3C9NA 4A37A 4EQ2A 3X11A 2R2EB 2RR3A 3IWVA 4AYSA 3KMDA 4WV1A 1MCKA 5F6HI 1XH0A 4J3BA 5I6XB 3IJHA 1CXHA 4PJAA 3ISWA 4G6KH 1BM3L 4HBQA 1I1FA 1BREA 2VE6B 3QULB 4KKAD 4QRRD 1D5BA 3D39D 4Y5YA 1DLHB 3MLVL 2Q7AA 4FFTA 1JAEA 3BGMA 4YDJA 3EYFB 2AK4E 4R7LA 1K2DA 1JXJA 5IB4B 3NFPB 4XVTL 1VB9A 4W1TA 3FBKA 5EU3A 4BSJA 5T5NG 5EZJA 1YA5A 3FDWA 1T7YA 4YBLC 4M93C 1QLRB 4OF6A 2QPDB 3PAZA 4MNHB 3PJSA 1ZD6A 1CU4L 1Q1JL 4WAFA 2WJ5A 3BSZA 3FQUB 1NINA 1N4XH 4XN1A 5K1VA 4Z3TA 2YS4A 4Z77B 5CD5D 1KGCD 5GHWL 1ACCA 4Y19D 2NPLX 2XFXA 5CCHE 3KW8A 1G7LB 1A1OA 2VUYA 5DD0H 5LCVL 2PCPB 2WJ7A 5C8JA 2AAVA 1NMAH 5C6WH 2AJVH 5L2JB 1HOCB 2OMTA 3L3OB 4RGNB 5DT1L 3OKEA 1PTZA 3F7PC 5DVMA 3MRQB 2MSPA 4U33A 3JWNE 1KB5H 2X44D 3UZQA 2J8OA 3UACA 4J23A 2BNQA 3HC0A 2QKIB 4EEEA 1TMQA 5CBEA 3H9ZA 3WKNA 3QXDB 1I7UA 1MDAA 1DJZA 4FQQA 1QLEL 3DJZA 4PRPB 3TBYB 3WUWG 1A2YA 3SJVD 4E9QA 3TVMD 5E99H 3VMPA 2I9TB 5JPNC 4IBWA 4E2OA 3KS0J 4HWBL 2G2PA 2I9LA 2XZCL 3CMOL 3O4OB 4MMXA 3GMOB 3RZWA 3VWKB 3MOAH 2IDCA 2YQ3A 1CFQA 2NR6C 5EHFA 3EYSH 2AJZB 2FVNA 3L4UA 2BNRA 3BVDB 1K8IA 3MLXH 4N8CH 5AWNH 4AWJC 3D85D 2X09A 2QQQA 2I5YL 2ATPB 1KCVL 2YMXL 1KXVA 2H6PB 2JIXD 4HHGA 1E3XA 1FLRL 3NGBB 3OSVA 3T1FA 6TAAA 3CVHH 2VC2B 1FVDB 3EGSB 3L7EB 5IEKA 5E9NA 5JDSB 5HHOE 3FQRB 3MFGB 2Z65C 3MREB 1G5AA 3MXWH 3QXTA 2EVIA 4Y4KC 1FZJB 3ARRA 3KJ6H 4YX2H 1NM9A 4BHUA 1NIAA 2AXFB 2ZF8A 1CDIA 4ELME 1Q9KA 4Z9KB 5E5UB 4UOW1 2P46B 2H1PH 1UOKA 5BS0E 5CSZA 2UWEF 3ASWA 1HSAB 1KTBA 3G5ZA 4IU3A 3GSOB 1D5ZB 3S6CA 2ZX8A 1M05A 4PH8A 1NOAA 3NFSL 2VUOA 3HRZB 1E4KA 3QNZA 1DQTA 1K4CA 3NA4A 2FEDC 3LPPA 4NIYE 4KJPD 2WIMA 1XR8A 3L5HA 2E7HA 2HT2C 5D9SB 5KVDH 2OI9B 4FJZA 4UM9A 4F9LC 2N7BA 3KCPA 5IB2A 1JPTL 4OJCA 4RRPA 3MRMB 1RJZA 1WS7A 4ZS7H 5I0XA 1R5WB 3GPSA 5CN2A 1VEPA 1C16B 3KWWA 3U7YH 4FFWD 1KCWA 2XTJB 1UWXH 4G1MA 4KZEL 4KXZH 2FT8A 1MCOH 1A21A 3LS5H 4M3HA 1I9EA 4XCCL 4GMSL 3RWGB 3CSYA 3RBGA 3U0PA 3NJIA 3IJYB 4MB1A 4IRSC 4ZMXA 4N5UA 3KPSD 1NGWB 1I53A 3V6FB 4XHQA 4ZFFB 2EE3A 4TRPH 2XI9A 4G6AC 2JCCE 3RIFF 4JK0D 1NLDH 3FS9A 1F4YL 4GO8A 3GMLA 5ANMA 3ECBB 3PUCA 4IBSA 4LCVA 3LH2L 1DSFL 1G87A 2GI7A 5HVWA 1FAIH 4ZUSB 1S7XB 2ZCHH 2QDWA 2D2OA 4QY8B 2ZWYA 5KYWB 3WUWA 3DECA 1THCA 2FSEB 2GSIB 3MQIA 2VXSL 4EMZA 3TO2A 5I71B 3V6OA 2AQPA 1JWUB 4FTVB 3VXPA 4U6HA 2BVPB 4MJIB 2JQZA 3BQUD 3M46A 3WJMB 4PEEA 1P5UC 1IT9L 1FGVL 1FCGA 2V2XA 3CN0A 3Q5OA 4G3YL 1P53A 1QVOA 1ZPLA 2CIKA 3H6JA 4MD5B 2DIEA 4LLAA 2MNUA 3LVTA 3VB9A 4KO5A 5L2KA 2UYLB 3SDAC 3SE8H 3WDJA 3LKRB 4IGBA 4AH2B 3U1QA 2GC7C 2OTWB 1KN4L 4E42B 2E7CA 3AJ7A 2YWYA 4N20A 3DX4A 3KDMA 2OL3B 1IGML 3UROR 1IM3D 3H7LA 4EXPX 1AO7E 2AEPL 3K6FA 4OCXH 1AY1H 4DEWA 3NZ8A 2CLZB 1ML0A 2XVKA 2R4RL 2XBTA 3V5DA 1TZAA 4DGUA 1J1OH 2J5WA 4MKTA 4QYAA 3BSZL 1ZPUA 3HCVA 3HBPA 2P52A 2NZ9D 5DFTA 2WXFA 1LVEA 2X2UA 3GTTA 5GZOC 4BQ8A 5KG9A 3Q8AA 2X70B 2ZP0T 4JG1H 1SLXA 1TQCC 4Q0XH 5PCYA 3R18A 4S1QH 3V0VA 4HEPG 3OGOE 1JZIA 5I8KH 1WFNA 4XN9A 2O6DA 2GSGB 5GS2H 1OTTC 2LVEA 2PW1A 2EYSA 1AIFB 1KN2H 3HG1E 3NRFA 3S3SA 1OLZA 1MFCL 1SMOA 5HYEA 1Z9MA 4HJ0D 2A77H 4H8WL 1JZ7A 3D2UA 5H35A 2LW3A 2R7EB 2W0FB 4G7VL 4XOBA 1B6DA 2AJ3B 5AG9A 4OU3A 2C9AA 4OLZH 1VGKB 1KC5H 1SF3A 1QUNA 4YSRA 1HXMA 2J8UA 3B2PA 1RU9L 3CFEB 1V05A 3QZWG 4XNMA 5A7EA 4B6ZA 1K6QH 4Z7QE 4ZTEA 3PWUA 4I2XA 2JTYA 3WEOA 4H5SA 4HUCA 3WEXA 1EHLL 3HFML 2IMNA 1FJ1A 5LXGL 3ZDXB 3IAQA 2CR6A 4W6WB 5A2AA 4P2RB 1IAMA 2O5XH 1JK8B 4HCGA 1HS6A 1J11A 3QDMB 3TT1H 3X12B 5JYLA 4NJ9H 1HVXA 3SCMA 4AGPA 5BO1L 2EC8A 3S88L 3TA3C 4DIXA 2JKRM 3UZVB 1T2XA 2GUOA 4PD4J 5CGMA 2VDMB 3CFDB 3UTSD 1UKSA 3PABB 4KX9A 2IH3B 2V3EA 5F89B 4ZW6A 2QGDA 5BVPL 5AD0B 3EDJA 3NP3A 5DMKA 4F1ZA 1WSST 3A22A 2UZIL 4KY1L 1XZ0B 4NKMA 4Y5VA 2GJRA 5IROD 4PGCB 5HP5A 3ERXA 3QDJB 2OSYA 4RFNC 1FFTB 1YYCA 4O02A 4QCIA 1HL5A 1JNJA 4S11A 1QKZL 3V52H 3U2JA 2GT9A 5CP3A 4PYGA 3WELA 4PN6A 5IK3B 2HX8A 3LH8A 4OVVA 1IU1A 1XCQA 4KHTL 1GGIH 2Y36L 2FX8H 3H42H 5DMIH 2YBRA 3D06A 1K72A 4ZMVA 1XCTB 2XG4A 3BYTA 1Z5LB 4A63A 3NJJA 4AM0Q 3VWJD 3AUWB 1S9XA 1RP9A 2WXRA 5IFAH 5CINL 5A2LH 3ZIMA 4GT7A 2VR3A 2QTVA 3E3QC 1Z9SA 2FZ3B 3DMMC 4B9KC 3HVDA 3BPOC 1QOKA 4HEPA 3AS2A 3QSKB 2WOYA 1WFJA 1MG3C 4LHUB 4ODXA 1N70A 4QTIL 2N1KA 2ADIB 3NDZE 1AQDA 2ESVA 3OF6D 4KQ4H 1HHKA 1YHPA 4OFIA 2VQ4A 3VXOB 5ES4B 1M9WA 1QABA 3CSFA 1NQBA 2DN7A 3UIYA 5KVGH 1ORQA 2PPAA 5DUMH 1LK3L 2Q86A 4RMVA 1P4IL 5CKGA 2MCAA 8PAZA 5HYJA 3MTXA 4NZTH 2WZPD 1RZGB 2EDYA 4ZD3H 4K7PX 3IBOA 3QZWA 4HT1L 5GGUA 3U6RB 2FH8A 4L3EB 3K8KA 4CADB 5AQ0A 4N2MA 5HGBB 1JVOA 3L4YA 2J6EL 4LKCA 4OCLC 2IH8A 1EAOA 2Y07H 4G8GE 4G8FA 3E0GA 4OF0A 2FGZA 4Y2DB 4BK5C 1PG7X 4TL5A 1WIUA 4WDIB 1QW8A 4WFFD 7TAAA 4XH2A 4ICXA 2Z8RA 1S3RA 4XO4A 1E43A 1ZCRA 1W72B 4LNRA 3PV6B 1B0GB 4HS8L 2P8PB 3A67H 3KBEA 2QMJA 4GAYB 4QRSB 1Y6KR 3VXQA 4FS0A 3OXSB 3EF4A 1OIOA 1CVSC 5AZEL 5MEND 5B22A 1Y7VA 5JO5A 3JV4B 2DQJH 3IDYB 4R0LC 1VADA 3MLRH 4Z7OE 3QWQB 2BO0A 2Z92B 5AALA 1IVLA 3AAZA 3MLWL 4A7TA 1ILUA 4U6YB 3RI5K 5HYSA 3QZMA 1PGRB 1NCDH 3WJLC 4YHOL 3N0PB 1SOSA 3F12A 1CE1H 5CILL 3ZQWA 4R5TA 2QSCL 3F05A 5LBGA 3RVVD 4MA1C 2R0LH 2OTUA 4AYEC 4OT1L 2ZWKA 4FADA 3PP4H 4UTAH 3FCTB 4JJ5A 4Q89A 3TF7C 2EDJA 3V4VB 2DJSA 1RI8A 1CXLA 2MNJB 1T20B 2HFGL 1M57B 2XQYG 3CHQA 3FHEA 1PSKL 3I3BA 2AV7B 4GW5B 1FVEA 4HSCX 3LIZA 2BNQD 3WY1A 2CO2A 1FPTL 2BIQA 2G5BB 3EUDA 4K3EL 4XPAL 1NFDB 3DBXA 4NQCA 1OAXH 2CD0A 5HDRA 1I3GH 2PXYA 3IPBA 4FHKA 3NYKA 3SPVA 5JORA 2M8XA 4DAGL 1JGUL 4H25B 1GGCL 1MFAH 1BF5A 2BNRD 3QI9B 3ARGA 4MBOA 5D93B 3W0WB 4AG4H 5KYYB 4L05A 2BFVL 4BKTC 1AXSA 1HHJB 3DOIA 4PS7A 1KCRH 4U1MA 3AMLA 2W07A 3VRLE 2YPLE 3LN9A 3QG7H 4Y4HB 1ACZA 1K5NA 1QA9B 4X6FB 5DJ8B 4Z7UE 4O02L 1E5AA 4HZLB 2LQRA 4G6MH 5IJVA 2WKOA 3L3IA 4CN4A 3EOTL 1OY3B 2Q7YB 3I6LE 4JFXB 5IJCC 4ALAC 1YYLH 1TR7A 2MCG1 5D4JA 1DBJL 3BAEH 4JZNB 1MZYA 2OQJB 2WINA 1WRFA 1FC2D 2HVKB 4G5ZL 5IFHL 1RUML 4U1IA 1FE8L 3CXHJ 4U6XB 1DHKA 1UJTA 1CDBA 2XN2A 3BN3B 3B43A 4TNVK 4W9JC 4ZDHB 1TZOA 2R2BB 4UM9D 4ZMQA 1FYTA 2BRRL 5I1GH 4LPYA 2DS4A 1U8HA 2A6JB 1RHHA 5T3XL 5J1TC 1YEFH 4KJPC 3VVVA 3QO1A 4MBRA 2WGNB 3BPNB 3E8UL 4FF9A 1YUHA 3LXBA 1X7SA 2ZXEB 4FA8A 4KZDL 3ZTNH 4YUEL 3ES6A 5LN8A 3WE1A 3NSJA 1HZKA 3MRNA 43CAB 1YMME 4LT7A 4F9PA 3ILQD 5T1DL 2PR4L 3DRTA 4NN7C 1JI2A 4PJDA 5HHXL 4IOIA 4P2CG 4I9WE 5ITBL 5IVXB 2A83B 5KWYC 1XF5A 2R1YB 4PP1D 5C2UB 2H3KA 1BMGA 2A7BA 4AMWA 1BJMA 3GLEA 4F8OA 1RURL 1W0WB 3HE7C 4XX5A 1MJJB 1GTFA 1M2VA 5ABDE 4GBXC 4HD9A 4OIIH 2BRQA 1ACYL 5SX5H 4NQDE 4QHUA 2NY3C 5BQ7A 1H3VA 4R4FH 3O8XA 3E9TA 2HT3D 3MUGA 3G04A 3DTXB 1U8CA 4O9HH 3T0EB 4JO1L 1OSYA 4UOQA 3QQDA 4N87A 5CUSL 4FG6C 1OTSC 3PXLA 2QHRH 5EA0L 4PIBA 4Y9EA 5A16B 3JVFC 3IN2A 3L1OH 2XC8A 3RDTA 3EO1A 2XTLA 3VG9C 4L3AA 5DQJB 1ANUA 3DXAB 3VAEA 5AVQB 1C1EH 5L2KD 2DQIH 2V4LA 1ZSDB 4JPQA 5EMYA 3EYUH 1QZNA 4IGBD 5JHAA 3LHAA 4TMPA 4M7ZB 1J1XL 2WZAA 5JR1H 1UZ8B 1QYGH 4AKOA 3ARWA 1YDPB 3CDFA 1B9KA 2EQDA 5D1QE 2DPKA 5E6IC 1WVZA 4YSUA 1J9RA 3B1UA 4NNXA 4RAUA 3TOPA 2AQSA 4WW2B 1KEML 1Q72L 2WTRB 4AJ0A 1T6BX 4WU5B 4LF3A 3LKPA 2C4XA 4IJ3B 3PHQA 4OD3L 3PAVA 4OF3A 4OZIA 4JM4H 3SPIA 3U9PH 4HXAH 5ICXA 4GKSA 3VXNA 3D39E 4FLQA 3BDYH 2V5RA 4GSUA 1YPZF 1T1ZA 4HAGA 5TPWH 1X4YA 1HKLL 3KHQA 4D8OA 1ET7A 1EZSA 2R69A 2B59A 2MOVA 3O2DA 4N0UB 4FLSA 5I1JH 4Z7QF 5EBMA 3IDJA 5HDBE 4WWNA 5ESAA 4QKTA 1OP3K 4LIQH 3BHBB 1DFBL 5GSRB 25C8H 3VXSB 4YHNB 2A4ZA 2W59A 4NRZB 2YKKA 2YD1A 4YPGB 2F53B 3H9SA 5FO8B 3EAKA 5FECB 2N4IA 4HIJA 2NW2A 3K8LA 4XMTA 1W16A 2L7QA 2XNAA 5T1LD 4L5FL 1C9SA 1CICD 5KSVA 2GK0A 5EIIG 4D0DA 4QI3A 1O5DT 4NQVA 3NESA 1U0QA 4ORGB 4WO4C 3NCMA 5JHLA 4GLRI 5GJTH 1ITBB 1CF8H 1DVZA 2A4EA 3VFPB 5DJXB 2L04A 5IVZA 3U79A 2WW8A 1JZ4A 1N2RA 3PHSA 3UAJA 2W9DL 4AUUA 1YJDC 1CFBA 5K39B 2OXGA 3EOYG 4QR7A 2BP0B 5FGBA 3SJVE 3EFFB 3C60B 2FCBA 3BWZA 3ISRA 3RVWD 2EH7H 3ZE2E 5MEOA 5CJXC 5GRVL 3QORB 2ICEB 3CLEH 4QHPA 5FXCH 4I3SH 2BSRB 1GYUA 5CKAA 5FPIA 1JOIA 4ZW8A 2IBZY 5AKRA 4A6YA 4UAOC 2AXGB 1JN6A 2YAMA 4OLVL 4XRCA 2BS9A 1KJ2H 3BUTA 3T0DA 3MGTB 2J3SA 3ETTA 2G9HA 4WKXA 1INEL 4HLZH 1MCRA 5F7EH 3ZKSD 3V5KB 1A0QL 3UTPD 4M5SA 5E4EC 4J1UA 5HY9A 4LU5H 4F2MA 2CBPA 3V0DA 3MGOA 4JFFE 1BBJA 1YECH 2OSLB 1U30A 2QADD 1F02I 5LHDA 2AJYL 3HS0A 4JFPA 3DUUA 4R90H 1AMXA 1ZGLB 3HZYA 4UDUA 4GRWH 3HB3D 5T3XD 2R9HC 4ZAKD 1MRDH 4JDZA 4DQAA 3V79C 1NC2B 3BP7A 4FE9A 5HGDB 1SY6L 5KOMC 2XU9A 5I74C 2A9AA 4MJ6A 1JZHA 1Q0YH 2IANB 2J56A 5K59E 4LCYB 1UWEL 4OZHA 4F93B 1PZ5A 4XMKH 2VXVH 2D2CC 2DLHA 3EZJB 3SIKA 1CR9L 2GY7B 3FUMA 5E5LA 2BLFA 3UBGA 4KRNA 2VN7A 3SGDH 2F54A 3QEUB 5IG7B 5HYJD 3W81A 4CC4C 3QJHB 3L45A 1MVUB 1Z2KA 1HNYA 1U92A 4XZUB 1TTFA 2IPKB 3KPSE 3F7LA 2EDFA 4JZJC 5EIIA 2O5ZL 3IU4L 1A7RL 2BJMH 2FHCA 3HIZA 5EFIA 2IH1B 3IGLA 1DZ0A 2DWSA 4MHHI 4H0HB 5C0IB 1AC0A 3VFSB 5KTEL 1KENH 1U8KB 5GGRA 4GQ9L 5HI5D 2JELL 3GEWB 5D7IE 1KTKE 5EZOL 3DGDA 1AFVL 3GS0A 3BZEB 4DP7X 3MR9A 4NKOA 5BZDB 1FSKB 1PX8A 3LY6A 4BFIA 2VLRB 5IOKA 2WIIA 3DTDA 4HJJL 1T2QH 5FS5A 4GXUM 3WS3A 1P9MA 4S1RH 2Q8BH 1J88A 1HI6B 3P2BA 1IAIL 4ZOBA 5HHPB 2HH0L 1PY9A 4AENB 2X38A 2EKSB 4AQEA 3N2JA 4PMFA 4X5WB 1U95A 3T3PB 1P1ZB 1JE6A 4LPUA 4N0CD 5DGQA 1KLFB 4NFDA 3QIWD 1ZT1A 2NY4B 2R56L 4Y5YC 3SDCA 4KMLB 3RX9A 3FCSA 3L3HA 1VFMA 5EOQL 5FCUL 2YQBA 5CCKL 1SHSA 3ARBB 2ZG1A 4JY5L 3WIAA 1O6VA 2MRYA 4OLWH 1KDJA 4F33B 3Q7JA 1JNLL 4EXKA 5D2LE 3MV8A 5MERB 3RYMA 5EZLA 3TJEL 2R69L 2VISB 4B0MM 3O2DL 3GMMA 3TZVA 2X1OA 3QEQE 4BZ2L 4XAKE 1U91B 1U2YA 4Z7VB 4EKXA 2AS5M 1TO5A 4Y5XB 1LYQA 2E59A 1ZLUK 3VSTA 3WENA 3QRFM 1JERA 4G7RB 4JPWH 4ZMZA 4O58L 4DP2X 2VR8A 2X6VA 1I9JL 4JPKL 1SRDA 43C9A 1YY8B 3C8KA 3RKDD 4OSUL 3ARYA 3UL4A 5ID0B 1DQQA 2UXFA 2EYRB 3P4NA 4WQOA 4YDLB 3L3JB 4V1DE 2E5EA 2ZOKB 5I2IA 3O3EA 3FO2B 2FSDA 1KBKA 3K72A 5DHDA 4NQCD 2MCMA 1CTOA 3MO1B 2PXYD 3VRLF 3DO7A 3P9WB 5F0MB 3JV6B 3KLHC 4XMZA 3DRQB 4DETA 4Z7UF 4GFXA 4ZZFA 2MHAA 4LB8A 3P54A 4MCZB 3LN4B 1P7BA 1WWAX 2EDEA 3ARGD 1Y07A 3CQPA 3ZBMA 1PFCA 4L37A 2ZP8A 4KJWD 5AZ2H 5E9DA 3SY0B 4MMXC 3GM8A 2NUPA 2E6JA 5EOTB 3VYNA 1LE9B 3T77A 1RZ8B 2VDOL 3VFVA 2VL5A 2Y4SA 4LVNB 4OTXH 3UJJL 1KXVC 2B0SH 4RISL 4PW9A 2LLNA 4NRYA 4FFYA 1GCYA 4A6YL 4KX8A 1GZPB 1A6PA 3TBTA 5IV2B 2WO2B 1BIIA 1A6UL 1BFTA 2YXVA 3QDGA 3ZU8A 2NT0A 3GHBH 3O41B 3T1WA 4KHXL 5FGSA 1C12A 3L3DB 1AR1C 5FUZL 5A2KH 5KJ4A 4GW1A 5IW6B 4JHAL 1QRNB 2GITB 1NDTA 1SDDA 1WZ1H 1BQ5A 3UTSE 2VLJA 4LCCC 4XCFL 3QC5X 1BWWA 1NGZB 2OAAA 1CIDA 3OXRB 2VLKE 3PP3H 1TLMA 2SEBA 2PYED 3G5XA 2NW3A 2GFBB 5CEZL 3O3AA 1FYTD 1JHLL 4TTGA 3FOLB 1UWFA 3HZ3A 1KB5B 4XMPH 4MAYB 4UT6H 2D31B 3NN8B 3PWJB 5EOCL 3VGAC 4J8RB 3F7KA 4QRBA 4PJ8C 1MW3A 5CIPA 1A6WH 2R2CA 1OAUH 4CVXB 3L4WA 4WW1A 5CLZA 2AJXL 4LGSB 3V0IA 4IQHA 2CGZA 2Z31A 3UDWA 1HQ4A 1BWMA 1XV8A 3GMNA 4DO5A 2XN0A 3VXUE 4M61B 4LEOA 4HDIA 4YHIA 2IPUK 3M88A 4ZSOA 2LTQC 3CVHB 3RTQB 2CQVA 4KKLC 2IEPA 1N6QL 1B0RA 2CA4A 4JREC 2F5BH 1KNOB 4MJJA 4FXGB 4PJIA 5ICZB 3HJEA 1BQRA 4PP1C 4AV0A 2HZHA 2AP2A 4WUUA 2K45A 2ATKB 3P3TA 1LO3H 2X4NA 5KEZA 2CCLA 2DYPA 1RK1B 2X42A 4R26L 4UQ3A 3T8XB 5I19L 4J39A 4Q9RH 4R2GD 5DJ0A 4PJXE 3RZCB 4ZNEA 1MHPH 4ZUTB 1MHCA 2X4PA 3VRJA 4AVHA 4Y1SA 4FLHA 4XR8C 3U7WH 3ZHLA 1XEUA 4GT0A 2UWEB 3V6OC 2D3JA 1PY0A 3OKYA 4G11A 4QTFA 5FYKU 1KPVB 5C7XH 4PJGE 3NVQA 4GG6B 4UCFA 4PS4L 4MJ4A 2Z35A 3W57A 3DPBA 4Y2NA 1Q94A 3HN3A 1A4KA 2APFA 4YL4A 2VMCA 1FHGA 4D9LH 4W70A 4JO3L 4IGBC 3T65B 2Y69B 4X7TA 2PR9A 4F8TA 1XAKA 2A38A 4LAQL 4HH8A 1BEXA 4G80B 4MDJA 3QQXA 4PG9B 2ADYA 3DURB 5T5FH 2YC1A 3GZOA 4WFFE 2YN5A 3S3JA 2UX7A 3A4DA 4NC0B 5HDBF 4PP2A 4KGLA 1A7BA 4DW2L 3WNJA 3VQLA 5BNXD 3P11L 4WI7A 1FL3A 4MB3A 1Z0NA 2N1TE 1G9NL 2DLFH 3PG2A 4OUUA 1Q0XL 1S3KH 1BYPA 4M6MH 4OCSL 5F88B 1NC4B 3CK0H 3GJFB 4HKBB 3WS6A 4DGIH 1A25A 1ETA1 2E7BA 3CN4A 3LNHA 4CC1A 4TNFA 2G0LA 5MENE 3BAXA 4TULH 1DBAH 3QUMA 4PLKD 2EDBA 2NXZB 5I18L 4AQ8A 4WFGD 1GGTA 3MLTB 5E95B 3IRPX 3M1CA 3IK2A 3SBWA 3X17A 1LDPH 3IDNA 2FQGA 1MFEL 3CFBB 3MV01 4UT7L 4XHJC 3MBEA 4K94L 5DDHB 4OJYA 4QXUL 4FQ1L 3NSCA 1BV8A 2WTPA 3H9SD 3CUPB 3UEQA 1S7TB 2AABH 1CWVA 2DQDH 1Z9NA 3PL6A 2WNKA 3Q13A 2IAMB 1NGPH 4M1DH 2EDRA 4WI0A 1OZUA 3Q2WA 5JW5A 1ICTA 4GI9A 1RZFL 3KLDA 3RVUC 5DGRA 5GGVL 1F6AB 4O4YL 4ZPVB 4FQXA 4FFZA 5T1KB 3KPRD 5K5YA 3INUH 5CGBA 4G9DA 1LNUB 1FL6A 2J1XA 4WJG3 4HUVB 4OFPA 3Q9QA 4W9HC 1ES0B 1WGOA 1E4HA 3C6LB 4OCRL 2XPGB 9PCYA 1OSZB 4U3XA 4ORZC 3H9YA 1AZCA 3ULUE 5BZWA 3SCMC 4P57A 4DP4X 5I30H 2GI0A 4ALAH 4KX7A 2HSIA 5HGGS 2KLSA 2O1AA 4D0BA 3X1FA 4NFBA 4IHOA 4YK4B 3LSOB 5F0JB 2FK9A 3GXPA 3L3KB 2DRUA 2IPTL 2DQEL 2EJ1A 3CZSA 2P24B 1YUKB 2CMRL 5D7IA 3IDIA 3QQ4B 5KUKA 4Y5VC 5LBSA 1RL1A 2IALA 5D5ME 3ZLQC 1GYWA 3BZ4B 3MYJB 1G7HA 4Z95L 4QJ4B 4H1LB 2J21A 4IRJD 1MIML 3ZTJG 1J8RA 2P5EA 1QFWH 5AYUL 5EO9B 1TCRB 1XGTA 3I85A 4KWUA 5K59F 1TU2A 3CFIC 2RD0A 1GGBL 4W4OA 4ZMAT 1FRGH 2QEJA 2IDUA 3MRGA 5CEZD 1QQDB 2FBRA 4BFGA 5FKPA 1Z3RA 3WKPA 3H53A 2QADC 1YEEH 3O0LA 5HVGB 3EH2A 3A0OA 2IFGA 4MLSA 4XCEB 1KJ3H 3JYCA 4H7VA 3SQOH 1N19A 3BCDA 4IRZL 2HMID 4HSQA 1FZOA 4XXDB 4YHZL 5DU7A 3SO3B 1L6XA 5IQ9B 5KSBA 4JFOA 3MODH 3CQFA 4MB5A 6CGTA 2YD3A 3WTVA 2H0JA 3QXVA 5A7BA 3AQYA 1I1YB 5FO9B 2WGXA 2WVUA 4N8VB 1OAKH 2OXHA 4PJ7A 2YD9A 3UBXI 4PJHE 1U6AL 1ZKAA 1PZSA 3NH7H 3BIKB 2K9UA 3FCUB 3LEXB 4MA3B 3ET9F 3TNNB 2IWKA 3DYMA 4RLDA 1C5DB 3TLRA 4BQ6A 1T21B 4FERA 2F8VA 3BIBX 2H32A 4DPCX 1VESA 1TMCB 3CLWA 3QIBB 4N24A 5GIRA 2JI3A 1HSBA 2X53A 4X6BA 3IDMB 2HT4C 4XTRC 1RQ5A 3SGDI 3WLWC 5JNYB 4C56E 2IXQA 1NGQL 1CIUA 3C8HA 2Q7NA 4PJEA 2Q76A 3H85A 1KTLA 3T3ME 1KV3A 4E41B 3RJQB 3EHBD 3H4FA 3TXAA 4A7UA 1XBRA 2BSBA 1EK3A 5D2LF 1DVFB 4OZFB 3DHJA 3ZYZA 4QHMB 5DD6A 2XBZA 4JFQA 2OYKA 3STLB 3PHOB 2WLIB 4DUVA 4NJAL 3OKKB 3TCTA 3SDCD 5I1KL 1YYMH 2WZ0A 5IW1A 3MLVH 3SQBB 4GRLB 2GC4C 2TSAA 5D2NB 4AEHL 3LQZA 2DQCL 4N0CC 3SDXA 1A7QH 4F58H 5B3JE 3ARFB 3KLAA 3QRLA 4YDKL 3D4YA 5DZ9A 5T3ZH 1M6OA 1BD2B 4XVTH 4GG8A 2ICCA 4Z5RA 3ZIYA 1SVCP 3MV8D 2VMDA 1HNFA 1W0VA 3QUML 4PREA 3FQWA 3TNMA 4E9LA 3CDGA 1PBYA 2AI0L 3TZVD 2Z91A 3DVFA 2YPVA 2GCYB 4G8IA 4ISVB 2CE6A 4HCRH 2KQNA 3CZLA 1Q1JH 2IFFL 4ZBJA 4DCQA 4LCWA 4NHCL 3MRBA 1M7UA 4P05A 5C0BA 1CD8A 1EBPA 1IIKA 2YWZA 2O61A 1M4KA 2UZXA 2RFXB 5SWZB 5LCVH 3FBQA 3T0AA 4ZFZA 1LWJA 1S78D 4JR9H 4B3VA 1FI8C 1W2KT 4F7MB 3C08L 3ME0B 3MDJA 2C9VA 2NY6D 5DT1H 2CNYA 1ZLVK 3HG5A 4M02A 3RKDC 3OAYK 3LKQA 3ULSB 2GAZB 2AK4B 5EU4B 4NQSB 1IBFA 5C6PB 3WFDL 4B9IA 2WLNA 1N3NB 3D9AL 1Q4NX 1E27B 1H5BA 2ZXBA 3F62A 5E51A 4OV5A 2LAGB 2VRAA 4JFZL 5ECJE 1EAPB 1YJDH 2PXYC 4JAMA 3EH5B 4QRUB 2JLPA 5E9DD 2M26A 4HWBH 2XZCH 5IMKB 4K8RC 2YXMA 3EOBB 3ARGC 3NDYE 5GS1A 1RIVL 1V7MH 3ROLA 1CDCA 4KTEL 32C2B 2I5YH 1KCVH 2A4CA 2YMXH 4KJWC 1W8NA 3DX6A 2X7LA 1OGAA 4M4RB 2WLLB 2X4OB 4LVOC 1W6LA 3SGJA 3BAJA 4P9ML 2YAQA 1TT6A 2ENPA 3QDGD 2GPZA 3AMKA 3MKKA 4OQ1A 4CMHC 4N2DA 2G4GA 1ORSB 5LBSL 2Q3XA 1I1AA 5EWIH 4LSSL 1BBDH 4YSEA 4P2OA 3S3CB 4B97A 1YMHB 1W9XA 5L88L 1JPFA 2VLJD 1VGEL 2AVFA 3VFOB 2RTTA 3GBLA 3PXHA 1QO3B 4LE8A 3VRIA 3GC3A 3JWDL 3AREA 5TDOA 2AQQA 4R97C 4MYWB 3MCKA 1KDIA 1S9WB 1T04B 5H4YA 1KYDA 4Q9BA 1ZIAA 2XIBA 3MRCA 1DN2A 5HHOB 3NACL 3BO8B 4XP1L 3WIFB 1JPTH 3WAKA 5A43C 2G75B 3CFJB 3UTPE 3QP3A 2ETWA 1G7MA 2NSXA 3F7YB 4N2LA 2VH5L 4YEEA 3GRGA 3KWUA 1A8JH 2DWDB 4G9FA 4XCCH 4GMSH 1XGRB 4F9PC 4EI5B 4JFHD 4ZUWB 1UM5L 3QR0A 4HG4J 2EVGA 3MFFB 3P30L 1OWRM 3LS4L 1O9VA 5D1ZC 5JLZB 3O6FB 3RVTC 9CGTA 1U8MA 3V9FA 4QYOA 5AYTA 2DYPD 2MJWA 3DHPA 3WL9A 4HJGB 2FLBT 5DJYA 5AAPA 2CJSA 4Y9CA 2G3ZA 4BWWA 1VFUA 2IADB 3O8XC 2VIRB 3QUGA 1P84K 3NZSA 3TBWA 3WY3A 1ZGLP 5HDLA 4BKLA 1NGXB 2VXSH 2X6MA 3N1PC 2D9QB 3KM2A 3FTSA 4WI9A 4AJYV 3VD0A 2VZTA 3KH3A 3QNXB 5FO2A 3RDTC 1E5ZA 5GS0C 2B5IC 2WXKA 1IT9H 3C5SB 4NQTA 4G3YH 2QGEA 3EH1A 3EUUA 5EDSA 1QPPA 4PJAF 5E2TH 2GIMA 3MCLL 4ABWA 3JQOB 1T80A 4WJ5B 4WWID 3ZMEA 1KN4H 4HIPA 5J6HB 2FE0A 2H26A 5DEFA 4NERA 3CZFA 4OJAA 4B9JA 3K4ZA 2AEPH 3ROOA 3X3GL 3FOMB 1GH7A 2A6KA 4GI6A 4WU7A 2R4RH 3II3A 1JGLL 1FWXA 4PTTA 2YPVL 3CFQA 3RWDA 4Q6IA 1URLA 1ZHNB 3M07A 3BSZH 4RMRA 1IAIM 1TZIB 2AANA 1LP9E 2YAEA 1T1WA 1NCHA 1LQBC 1D6EB 1G7IA 2FTAA 2JI1A 3CDCA 4F3FB 3OKLB 3GB7B 3NSXA 5DQ9A 4ETYA 3C09B 3WFBL 1UB6A 2CXGA 3IF1B 3VH8A 2Z8WC 2X4TA 4X6DA 3UYPA 4PLKC 5TH2A 4R8WL 4O2FA 3MNVA 2H6OA 4OJEH 1BFOB 3GK8L 1MFCH 5AVZB 3F7QA 1C5BH 3MXVL 4J3OG 1LWRA 3FH8A 3P9LA 4GAFB 1UKQA 4N2EA 4D7BA 4BIKA 1YC8A 2L4OA 4G7VH 1JCKA 4P5KB 3PL6D 4NO5A 3KYNA 5DZAA 1FNEB 4ZQTA 4NM8L 2ZWZA 1J1PH 3WYRA 1A9BB 3MRIA 4AZ8A 2C5DC 2BPBA 1CFNB 3NMEA 1E28B 4FQLL 2PTUA 4R7NB 3QUXB 4BD4A 1NEUA 4XBGA 1E3ZA 5ERWA 2NY0B 1EHLH 3HFMH 5KN5A 1IBHA 1YEGL 2JXMA 4H40A 5LXGH 4XP4H 1KSRA 2R0ZL 1L9TA 2VMEA 3IFLL 2H0FA 4PJHA 3RY4A 1U58A 2FECI 1ND0B 2XQ0A 1T5KA 1Y18A 4GKNB 4Z7WA 4XN8A 5D5MF 2JV6A 3UAJC 1TVBA 3ZOAA 4PUBL 2ZSWA 5DTFB 3S88H 5T1MB 2WXHA 1CS6A 5JIIA 1RV6X 2R83A 5FGBC 2WXNA 1P0SE 4M48H 4ZI8A 3MRJA 4PJBE 2AXHA 1MG2C 1X7TA 1K8DA 2B4CL 3EYQD 1LILA 2NY1D 4NO3B 4KY1H 1YPZB 2P43B 3QNYA 1WEJL 3U82B 4MMYB 5GZNA 1C7SA 2B3RA 3WTYA 3MSPA 5FCSH 2FL5A 3CH1A 4Z7QB 1FFPB 2P5ED 3QWRA 2D7QA 2LE9A 3B7UX 4JVUA 4Y9BA 2NY2C 4M7LL 2DB8A 4BH8B 1MH5A 1EHAA 2JI2A 3HKZA 2NY5L 4AE1A 1I85C 3ZE1F 1ED3B 2Y36H 4BH7A 4F24A 1TG8A 1WBZA 2V2WB 1FGNH 1ETZA 2EXWD 3F84A 1WBXA 1RSYA 2G2NA 4GIAA 3DIVA 2PW2A 2ZXDA 3Q1EA 4JCMA 1XB8A 1N64L 5CINH 3HS0C 5LGJA 3IMTA 4DFHA 4K2UH 5C71A 1MVYA 1NFIB 1X9QA 2EEBA 3KPMB 3R1GH 1CFMA 5LAXA 2PYEE 3OZ9H 5HYQB 3FPXA 1BVLB 4EI0A 4F7PA 3H7BA 4TPRH 1TPXC 1J5CA 3L8QA 3FUIA 3WNIA 4NYLA 3M86A 1S8DA 1ZTXL 1IKNA 3BT0A 5D6CA 2HMIC 5ID1B 1DVUA 1H8OA 5JW3L 3CC1A 3CDZB 5J1SC 3M1BB 5AKTA 2QSVA 1EQWA 4LP5A 5E1QA 4M56A 5IHHA 3I9GL 2WV3A 4LLVA 1A6ZB 5DHYA 5CM1A 3P3YA 2VN3A 4L8SA 4E68A 2WBJA 4HT1H 4UQ9A 3FPYA 1VAHA 1XX9C 3FJTA 4DVBA 1S5HA 1E9PA 3DVNA 3PDDA 3D07A 3CN2A 4IBQA 2OMWA 2BP3A 4LPXA 5D72H 4F7CB 1TQWA 3PQYE 1T7WA 3SKMB 3K71B 3ZRCC 4M03A 4GEJA 1F4XL 3ZTEA 3H3BC 4FYRA 1MJ7L 2YA0A 3NPSC 2L3BA 4LZKA 5B3JF 2B1OA 4RA3A 4XNZB 2YFOA 5DLML 4TKWA 3WIHL 3WMPA 4F8PA 3JTTA 5F7YC 1WO2A 5EF0A 2VAJA 3P77A 2XV3A 5CGTA 1MUJA 4TOYL 3HG4A 5AVUB 3UERA 5KW9L 1P9MC 3U2IA 1LD9B 3EHBC 3HJ0A 3UBXB 2XPZA 4JVPA 3UTOA 4ZZKA 4GAGL 5D7JD 4Q97A 5HI3D 2G2RB 4PQXA 1AGEB 1MRCL 5E94B 4N1HB 5IEHA 4CSTA 2KYIA 3CH8A 5DD3L 4PY7B 3SDCC 3TP4A 3DJSA 1BAFL 2P5WA 3EJUA 2VLME 5IKCA 2EABA 4BQBA 4PB9H 5KAQG 2Z1PA 3MLWH 3CV5A 2JFCA 4K7PL 4BELD 1AVAA 4H8QA 4LCWD 3NCCB 4MWFA 2PUQT 5DS8A 3LRSB 5C0BD 5CILH 3IMWA 5D96C 3B2MA 2CO7B 2QSCH 1G9NC 1N8OE 5FDWB 15C8H 1G6RB 2BCKB 3TO4B 3O2WH 5C6TL 3BESR 5DXWA 5J1AA 1GXEA 4FXTA 4OAWB 3BN9D 2FWOA 4MJ5B 4C8XA 2ICWJ 1N5YL 1HCZA 4XVJL 3S5LB 2EXSA 3QJUB 3MOBL 4KRPC 1S78C 3RI5F 1EGJA 1FZKB 1PSKH 4DZBA 4PRHD 4OBSA 4K5PA 2Y2WA 2D3VA 1FPTH 4IK6A 5F7DA 2N7SA 4K94C 4K3EH 4Q9QL 1B4RA 3SDDA 5HPMA 3EDEA 4TNEA 2ICWI 1A02N 3WCYA 3SQRA 3FH5A 5MEQA 3NEXA 1GZQA 1TTRA 1J8HE 1J10A 1MCWM 1Q9OA 2VM4A 1T1XA 1JGUH 1KIUB 1GGCH 1KCKA 3BXNA 3DK2A 2YA2A 1U3YA 2VXUL 4JRFA 3QFJA 4QIRA 5IB5A 4P9HC 1U8JB 5FFGA 2DTML 2XG5B 3ML8A 4RGMC 1T0OA 4WVRA 5FAAA 1OGAD 1QMUA 1A64A 1F3DH 2BFVH 4RMUA 1XR9A 2Y6SC 1OCCB 5I6OA 2OX5B 1RIHL 1QACA 4HK3J 4XNQB 2AZAA 2YD0A 2ZXWB 1XIWA 2JKWA 4U7KA 2BS71 1MNNA 3KPRE 2LLGA 3QIUB 3SD2A 1NUDA 1UUSA 2XDHA 2ZUSA 4O02H 1R5IA 2FH6A 2QQNL 4P2OD 3EOTH 5C07E 4Q58C 5BV7L 4YEFA 5CP3H 5DA4A 2ISDA 2AZUA 3X14A 2VDPL 5FYKL 1DBJH 1MLBB 4P4KB 1MF2H 1YEHL 4HIHB 4S0SD 4XWOC 3KPQA 3UTTB 1I8IB 3PYCA 3FU9A 4QRQB 4G5ZH 5IFHH 1JGDB 3C75A 4U49A 1FE8H 3Q48A 4HU8A 4HBCL 4P23A 1XSIA 5FUCE 4JJOA 4QOKB 4EBQH 1AG0A 2GBUA 2WNXA 4L4VA 2R8SL 3H6AA 1D3CA 3WEBA 1NA8A 3OPZL 2HKAA 1MCEA 3DROA 3KPLB 3F6LA 1AXIB 2YPLB 3E8UH 1OVZA 4QGTA 5EEZA 5E08L 4NGHH 3KCWA 5KVEL 3QUYB 3GO1L 4G9FD 1YEJL 4KVNL 2Z31C 4JS7A 4F92B 4TS6A 1WFUA 5SWQA 3UDWC 4BCYA 5IR1A 1JZ3A 4Z7AA 4XI5D 1KB3A 2Y5TA 2I7OA 3ZZ1A 2HVJB 2PCYA 2WCSA 3PUUA 5CEZE 4YHML 1ZVSA 3TPUB 3HPJB 3O3BB 1IC7H 4JPIB 1DN0B 3VE0A 3FFCA 4MASA 4Y9FA 4RFNB 4XVOA 3O3DA 1S46A 3D3VA 1ACYH 2ZWNA 2LU5A 4UIMA 1QFOA 4M7LT 3OV6A 4H26A 1OGPA 4G7SB 5CUSH 4MMZB 4NB7A 5EA0H 1AZVA 1NJ9A 4FP8H 2PWFA 5TE4L 2OKMA 2VWEE 3ASNB 2HLAA 2A9CA 1VZHA 3SBRA 3OMAB 1YMMB 1WP6A 1A7NL 4N8PA 2O93L 3BUBA 3QJSB 5I75B 5H4ZA 2WWNA 2MTAA 4FCHA 3T6WA 3TESA 1QEXA 1EFXA 3PGDA 4MVBC 1LP9F 5PAZA 2FIKB 3KYMA 3STZB 5H94A 3CPLA 3HUJA 2D0HA 4EN2A 1DFXA 5K33A 1OD9A 4P2QB 1P7QA 1I8KA 1WCBA 2FHFA 4HLJA 4LLMA 2FYYA 3SODB 1RZIA 4NQDB 4Q2ZA 5CEYB 1MQ8A 4AGNA 1KEMH 5DQDH 3R06B 1Q72H 2XICA 1DQMH 3HE6B 4M29A 5DD1H 5KBPA 1AGDB 1TKWA 4QHLB 1WHOA 4LLDA 5C9JA 5DJ6B 2ZYHA 4I1NB 5CBAA 4FABH 2XQBL 2DJ4A 3PU7A 2YAPA 3WNPA 1A7PL 1HXKA 3DOSB 4U2ZA 3QZOA 1WQVT 3EXJA 4Y2OA 4AW7A 2V3DA 2EH8H 3WS6C 1GOFA 4QJ3B 3GBDA 3UAFA 1M56B 2Y7SA 3VFTB 3VM7A 2HWZL 3MGAA 4R6UA 5A3ID 4CVZB 4X7FC 3GSUA 1HKLH 1MLCB 3EBIA 4XPGL 3KWTA 3U36A 3GEFA 3FYIB 3GXNA 2P3YA 3SBWC 2CKBL 5ADOH 1H15A 2XWBB 3LIZH 3KZ8A 5LN4A 1EJ6A 3DGGB 3IAPA 3MBEC 5D7SL 3L5IA 4JKWA 4ZXBA 5JA9A 3ULVC 5E8DH 3FSVA 1WG3A 4EDWL 5BVJA 4NZFA 3HMWH 2YRBA 4KXBA 1M7DA 3WKYA 5E8OB 5J12C 1F3JB 3OKMB 1UWGH 4K8RH 2YJLA 1BJ1J 3NJGA 2XWEA 2I32A 4PJBF 1UT1A 1UA6H 2CHXA 4E5XA 1GR7A 3ARDA 3D39B 2XWCA 4NPYA 1IIIA 4IMLB 1TJIL 4MZ3A 3AU1B 1IGIL 4AEEA 3OZKA 3OGCA 1OT4A 2A0LC 4M4PA 4FQXC 2IQAA 3F65A 5IQ7H 4N6RA 3FN3A 1EXUA 3JTSB 3CFCL 2W9DH 3DIFA 5HDBB 3WTUA 5I1DB 3TCLB 4WK0B 3OZLA 4YWGH 2VR5A 1NAMA 2FB4H 3AWFA 3PNWB 4I1RA 1SLVA 1MCLA 1T1YA 3GMRA 1IVTA 3BUYA 3BPCB 4TSCL 2XRAL 3FRPB 4M7JL 4XP5L 5KBDA 3HHSA 1RZJL 3AG1B 2E75C 4I7ZC 4YSAA 3GIVA 3AS0A 4RMQA 1JWSB 2G9KA 5DK2A 3ZUNC 4DEPC 2NY1C 4ODTL 1HXYB 3V7AE 2A74A 2MWCA 3L9EA 1INEH 2C3GA 5BMFL 1OSPL 5FYKD 1KIRB 1A0QH 3OSKA 2OCCB 2CRYA 5GGVY 2Y7QA 3BJ91 1YEDA 4NENB 3C8DA 4L29A 4RGOH 1FF5A 2DLTA 3EOAB 3I50L 4B3EA 3H2QA 5IT2H 4W4OC 3MLYH 1NANI 3SJVB 1LEIA 4GQRA 3TVMB 4P5TA 3ZL1A 1R3LB 5I9QC 3QG6A 3IMBA 4W9ZA 5E00A 5K9OA 4HV8A 5EO1B 4G43B 3VXMA 5GGSY 2FX9L 1IB5A 5IQMA 5F6IB 3D85B 1UVQA 3L13A 2VXTH 2D3NA 2XKNB 4XBPB 4B53A 2DQFB 1UWEH 2VNCA 4XMVA 3P73B 1CR9H 2OP4L 1KZYA 2EDNA 2BOLA 5D70L 4OCYL 1WC7A 1COBA 2E9WA 2YKLL 4OCMC 3FO1B 4G7YH 4P3CL 1KCUL 3CJJA 4Z18A 4PVBA 1W91A 4EVNB 4MDRA 2Y24A 1P4LB 4LSQL 1N0XL 2BK8A 3D48R 4HPYL 5GS0H 3D5OF 1JRHL 4MAZA 4X0KB 2O5ZH 3IU4H 1A7RH 2GTZA 4NBZB 2LU7A 3DV4B 3PIQA 1T5WB 3FU5A 3FMGH 1ULVA 4JO8A 4MA8H 3JYBA 2VDRH 5CMAA 1INDL 2JELH 3KGRA 4GUCA 3BH8B 5EZOH 4ESKA 1AFVH 3Q05A 1KTCA 3OHXC 1GHFH 3NIGE 4ZT1A 2FDBP 4MCYB 5D1XA 1NOFA 3BFQG 2QGBA 3L4ZA 1BZOA 2E0PA 5C08E 2VZ3A 5AVVB 1IJ9A 5FM5M 3CZJA 1AGBB 2ZG3A 2BOBB 3RB7A 3BFWA 2A1WH 4TVPE 3VGFA 3C5XA 4QNPE 4KI5E 3UO8B 4EI6B 2BOCA 1DVTA 2VERN 2R56H 1PS3A 2OR9L 3EDFA 3KPSB 4X6CE 5HI3C 4OZIF 2XIDA 1PQZB 1OPGL 1CE6B 2P5WD 5EOQH 2D0GA 5JOEA 5CCKH 2VITB 4O2CB 2AERT 3ASOB 4JY5H 4P46D 2ZKMX 4CMMB 4N25A 3P3RA 2EACA 1IJNA 3T4AB 3WY4A 1S9VB 3IDGA 3TJEH 2R69H 3HZMB 1V3KA 4HEMA 2V2TA 3FONA 1D2OA 3K5SA 5I1EL 1VDGA 1EA9C 4UQCA 4K7FA 5HVHB 1SOKA 1MHEA 1U8OB 3G9VA 3BKYH 1I9JH 1XGPB 3X1GA 4ADIA 4JPKH 4JG9A 3BQUB 3CSGA 4UV4L 4PJCE 4HUKB 4P3DB 2OYLA 3MRLB 3DETC 4M6OL 4KNQA 5DC4B 1L5GA 2C7UB 3JXAA 1N5YH 1UJ3B 1ZVNA 3BN9C 4QRPA 3B9EA 2EDOA 3HZVA 1C8PA 1IQDA 1JP5A 3PDOB 1KIPB 2BP8A 3NJLA 3SDDD 1WAPA 1HHGA 3LDBB 4P0DA 5JHLH 2PTTB 2XWTA 1IM9B 3S34L 1INQA 4KC3B 2JK5A 3IKCA 3OJMB 5D2LB 3TTYA 3D69B 5EZIL 4EAEA 3GJEA 2EO7A 3QFJD 1NKRA 1ZAGA 2WVSA 4JFEE 4BSWB 4ZO8A 3AB0B 2YZ1A 3NG5A 1BX2A 2OMUB 3VFMA 4P3WA 1JGVH 1BFVH 3MBXL 2VJ0A 5HGAA 1GGYA 4X9IA 4ENED 1Z32X 5GS1C 5J9PB 2YAFA 3UPAA 2IWFA 2DDQH 1VACA 3UJJH 4F5CE 2AJSL 3FB8B 3HI1A 3NIDE 1XIWD 5IMOB 1RY7B 2Z4QA 1V54B 2F18A 4A6YH 1USZA 4QAWA 3N1MC 4RNRB 1HQRB 4V1DB 2ALWA 2KERA 4U3HA 1MCIA 2BIIA 2RMNA 2Z1KA 1EVTC 1J8SA 1I1AC 4FHBD 4UNTA 1CD9B 3LKSA 1CT8B 4NO2A 2ICWB 2BSDA 1G7PA 3A6CL 4XN7A 4OD1L 4XCFH 3LN5A 1CN4A 1L6ZA 2BX5A 3FYEB 4P23D 3AREC 1UCBL 4P07A 3MPCA 5C09A 2XIIA 4PW4A 1N6UA 3NSDA 3GI9L 3QJQB 1UD3A 1FO0H 3BVVA 1WV7T 3KBFA 3LTVA 4XCNB 4NNYA 4KFMA 3R4DA 4M7KL 1QLEB 4X8CA 1J5DA 2ZICA 4WKZA 3BZDA 3BUDA 2AJXH 4R7DA 3QAZB 3QQ9C 4OZHF 1A8ZA 5KYXB 3FU8A 3DO3A 1OGTB 1AXTH 1BZDA 4JMXA 1R33A 5GJSL 2PNDA 4CJ0A 3ECUA 4X83A 4LSVH 4XI5C 3UTSB 2LAAA 3LD8B 4UAOB 1N6QH 3FFCD 5AOMA 1DJYA 4CNIB 3QJTB 2DWYA 2IDQA 3D3VD 1BLNA 2YPKA 5TDNB 4PTUA 3FU6A 1OWWA 2R29H 2A6DB 3B83A 3E2HB 1JV2A 3X3FH 3SKNA 4N2OA 4R26H 4U1KB 4W9GC 3VFRA 1MCHA 5I19H 3BZ5A 5KANG 4HIXH 4YXLL 1H0DB 1UGNA 4X4ME 1AACA 4WGWB 4FA7B 1NZRA 4MNGB 4PB0L 4XE0A 3SGEH 1ZANH 1A9VA 1KULA 1IAKB 3LMJH 3QR2A 4I87A 3VDAA 4DZ8B 3SYQA 5D71H 2F9BT 3VWJB 2D8KA 4RAHA 1EFXD 4PS4H 5DSCB 1IFGA 4KQ0A 1NCGA 4RGNE 3HG3A 3MC0A 4HIEA 2ITDA 4NDMA 4HIQA 3WMQA 2CUIA 4IU2A 3ABMB 3PWLA 2FJSA 2J55A 1REIA 2D73A 3TTSA 2VJ8A 3EO0B 1KLUB 2CLRA 3ULUC 3IFOB 1A3ZA 1MWOA 1GJUA 4Y4FB 2H5UA 5I15L 4PRPE 1FZMB 4X8GA 3V6ZA 5BRPA 2ZP9A 1DQDL 2BC4A 4PJ6A 3DI2B 5DWPA 2QT6A 3P11H 1PKQE 4Q6IC 4EOWH 1N4XL 1ZHKA 1G9NH 3P0YH 1Q0XH 4OCSH 3VACA 3B5TA 5ESQA 4U1LB 4WI4A 1T0MB 2DD8L 4J28A 4JRXD 2EADA 1HILB 3M17B 3PY9A 1E5CA 1E90A 2R2HB 2AJVL 4Q8BA 4R4ND 5EBWA 4QHNA 2EVHA 2HJFA 2V0AA 3OR6B 3FT3A 4ZJ9A 5A3IC 1XH3B 2EXTA 1KYUA 5I66A 5IMMA 4HWZB 1SYVA 4Z3EA 3ARTA 2C1OA 1MFEH 2R1WA 3B34A 4UT7H 4K94H 4ZXBD 1BYNA 4R96A 1SNRA 4NQEA 5HPOA 4QXUH 4FQ1H 4DN3H 4JKMA 5L9DL 3FB6B 3VXTB 1LO4H 4DP5X 4WV1B 5JIHA 4P06A 1DE4A 3HI6L 3IJHB 5E99L 3PWPA 4PJAB 1CGUA 4I77L 3FF8A 1I1FB 1KELL 5KS9A 1QSEA 4P9HH 4Y5YB 5AWNL 5T1JA 1RZFH 1T4WA 4N8CL 3RWJB 1N6VA 1CFTB 3MNMA 2BVOB 4LL1A 2F61A 5MENB 4PRHE 4ZUUA 1K2DB 1U8IB 5G4NA 2V9QA 4JFDE 4UQ2A 3ATFA 5F2FA 4ZUVB 1P2CB 2RJMA 4FFYH 5EU3B 5I8CB 3MHZA 2BY1A 1SDYA 2PO6A 3F04A 4OCRH 2X4QA 3KJ6L 4KNUA 2JKIS 1IEBB 4H44C 2XTJE 3PJSB 4IBYA 4PWIA 3NZUA 2XV0A 1KXQA 2X3BA 3U30B 1DQVA 4JM2C 2Y23A 1QBAA 4U05A 2EEXA 1RXLA 3MUJA 4FKKA 2XFXB 4XN4A 4HOMA 5F8RC 5B21A 2IPTH 5AVRB 5C8JB 2DQEH 5HHNB 2OMTB 1EEQA 1ZS2A 1KEGL 2CHWA 1UWXK 5GZNC 2O6PA 3OKEB 1AHWB 3L9YA 4ZK8A 2H2PD 3C6SA 2CM5A 2V9UA 5EEVA 5SV3A 3K2MC 1X5ZA 2PWEA 4RMBA 5BV7C 2BNQB 5AYUH 4A2MA 1HESA 3LNFA 5CBEB 3VTTA 1LEKB 3RX8A 1ZHBB 4UAHA 5CIPH 3CBRA 4FQQB 3RIFK 1GGBH 1A2YB 1X5JA 4EN3D 1G1KA 3VSQA 4YXKH 2I9LB 3LS5L 4TQ8A 5IBTH 5K9KB 1VA9A 1IZJA 3CU7A 4JKPH 4WK4B 2BNRB 1QFPA 2Z7YA 4M00A 1ERNA 3DX7B 1N8ZA 4X8JB 3D0VA 2F5AL 3F7VA 4B9YA 5BJTB 3IPEA 3RFZC 3BQVA 3T1FB 1XF4B 2Y2YA 4TRPL 5IEKB 1JZ8A 5E4AA 3GBMH 1YN6B 4GW4A 2WM0A 4KV5E 4KVCL 2CWRA 4PJIF 1NLDL 4YHZH 1X5GA 2CDEA 3KE0A 5D5MB 2XKUA 2P7TB 4ZMLA 3BZFB 1DVQA 4Z8FL 5JXEA 4J3OC 1FAIL 2ZCHL 1Q9KB 1RMFL 1SN2A 3WDHA 3H3PH 1U6AH 1F4HA 1XMEB 2ZJSH 1CB4A 3V6BR 4PJCA 4WJKB 2QDVA 3FRUB 1O5PA 5GRUL 3G5ZB 5E5MB 1YY9D 4IU3B 5F3BA 2GEQA 4L8SC 3RNQA 2WBJC 1KG0B 1M05B 3G5YA 3UP1A 1KJVA 3KJ4B 1ZTXE 3QNZB 3WNNA 4QNPF 4OZGA 4FQCL 3NRPA 2V5SA 5DVOA 5INCA 2AQNA 3SE8L 4R7VA 3FO0H 2DW5A 4X6CF 3LKNB 2WVVB 1HEZB 5IB2B 5D1XD 3ZE1B 1RJZB 4LARH 5AAWA 4GOSA 1FAKT 3KPNB 4LVHB 3CC5A 1ZHLA 3C5ZA 4OCXL 4Y89A 4ZX5A 2FLMA 3WTWA 2H47C 4B5EA 5E2UL 2AKRB 3W5MA 4HALA 1DJGA 3CPUA 3NCBB 4XPTL 2ZOOA 3KL0A 2QL1A 5I1KH 1J1OL 2WYTA 4I5BB 4N2NA 2NLJA 3V8OA 2X6AA 3C2AL 4UMSA 1S7UA 2DQCH 4AI7A 2YSTA 3MV9E 3GMLB 4YDKH 4JG1L 3V9CA 4HKZA 4PV8B 3W11D 1Q9WA 5A2IH 3QUMH 2I25N 5I8KL 4Q9CA 3I6GB 1WFMA 4P2RE 4C56B 3HNSH 3WO4C 4WEMB 4DUXA 5CZXC 3BD4A 1R5VA 1QWUA 1IAII 3I9AA 5F0LB 3QDME 1L7IH 4A7SA 2MQ0A 3VD2A 3O9WA 5IM7B 3TO2B 2YZ8A 3ULVH 4OQTA 2WXIA 2P48B 3CXDL 4M5YH 2A77L 5F7AA 1SUJA 3GS7A 4GUPB 2EUZA 3MRPA 4LBEA 4LRNH 4FXKB 4P4RA 3K2IA 5DRZA 3V4PB 1AE6L 2B20A 4YJZL 3JWOL 5J89A 1F45A 4OLZL 4DEUA 4UQBA 1I4FB 1KC5L 4IBTA 5L2KB 2VLLA 1UATA 4IGBB 4XZ4A 4L1DA 3OC8A 1R3IH 3RWHA 2R2EA 3NIDF 4D0CB 4KVPA 1EZLA 3WFDH 3KDMB 3D9AH 4FFZH 4FNLL 4MX7B 4L8CB 3SDDC 4OFQA 3ZQ9A 4JFZH 2ZUQB 2A9BA 3TFKC 3TT1L 2HG5A 1G4MA 4N6QA 4NJ9L 4JGJA 1DLHA 1JPEA 4K7PY 5CR8A 2A9ML 3DUSB 2WQSA 1RIVH 1XF1A 1DQIA 3PV7A 1F4AA 4KTEH 3EYFA 5CZRA 3FU7B 4TTDD 5CJ8A 5IB4A 3EH4B 3NFPA 4Z7IA 1UFGA 4ENEC 1RIUH 5FM5O 3HFFA 3MVSA 2Y3NA 4PWFA 4JNXA 4N22A 5BUAA 3EH3B 1HT6A 4IBLT 1OT1A 2FJHA 1XIWC 4MNHA 4NM4L 5G5DA 3UYOD 4Z77A 3ZHKA 4E36A 4HLEA 1J48A 5E8PB 4IHBA 2EIBA 3B9KD 3RRQA 4MXVE 3TIDB 1GGIL 2NUTB 2FX8L 3LPOA 5L2JA 1HOCA 3L3OA 3N43F 4NBXB 4L18A 3M6DA 1J5OL 1RZJC 3EBAA 2EDTA 3MRQA 3VD7A 1K85A 3UTQB 2E7LC 4RBPH 1VFBA 4L3EE 2B1HL 3NPZB 3BWUC 4AEIL 4P23C 4ZO6A 5T1LB 1FUNA 2QKIA 2VSCA 4LMQE 4NLHA 1CICB 4I2XB 2BZDA 3QXDA 4H5SB 3S4SB 2GJPA 4AX3A 3CSTA 4HFUL 4LPVA 4PRPA 4XP1H 4BZ1A 4KJYB 1IGJB 1H3PH 3TBYA 5K9JH 1XD1A 5GRJL 4Z0XA 3S8WA 2I9TA 5EOCJ 3GMPB 3KL5A 1UG9A 3VWKA 4YN3A 3ZR6A 5HSFA 5KVGL 1EDQA 3OAUL 2H6PA 3CZKA 4UF7C 3CN3A 3EGSA 5JDSA 3GSQB 3L9RB 3LS4H 4ZD3L 5AW1B 3MREA 4RETB 1PZ2A 4KKCD 4NKMB 1FZJA 4F2FA 5KZCD 2H32H 5I0DA 1I8MA 2AXFA 3ZUCA 3KAAA 3RU8H 3BYYA 1MKFA 5F9WB 1PAMA 1HC1A 2NNXA 5DRXB 2YGVA 1M1XB 1HSAA 2F8XC 1XCQB 5ABAA 4QXTB 3NABH 1RPUA 1D5ZA 3QQ3B 4E9WA 2XG4B 3EJPA 4MS8C 4W81A 2TSBA 5GGQH 4EJ1C 4GS7C 1S9XB 5DRWA 1R17A 2Y3AA 1X5KA 4JPSA 1EZUA 4WK2B 4WNJA 1SBSL 1WITA 4LASL 3A67L 3MCLH 1DJIA 3NJFA 1FFOB 4HUNB 3ZKXB 3HB3B 1CYXA 4ZAKB 4IKKA 1E7VA 1G4RA 2Y1YA 2W91A 1FDLL 4TSAH 1D9KD 2ZG2A 4HLZG 4H8PA 2QSQA 4X8XA 2XOTA 2DQJL 2L8AA 3H1ZA 3MLRL 4D8PB 2JB6B 3X3GH 3RWGA 3IJYA 4ZS6C 1NGWA 2YPVH 3V6FA 3EJCA 2Q86B 4ZFFA 7PAZA 3OQRA 3FB5B 4BE6A 5HYJB 4AMKL 1CE1L 1KY7A 4W9CC 3OQ3B 3W0WE 3ZZQA 2P8MB 1OAYL 2QFPA 3QZWB 3ECBA 5GGUB 1B0IA 3EJJX 2GTWB 1MNUH 2DLEA 5ECGA 5GS2D 3PP4L 4UTAL 3BJLA 4ZUSA 1W8EA 1S7XA 3FUNA 3X13A 4ZMYA 4QY8A 3K46A 2FSEA 2GSIA 2C3VA 4R8WH 5CLYA 1Q38A 4NQED 4ZYKA 4E9YA 5GRYA 5L8LB 4U1JA 4WTQA 1JWUA 4FTVA 3WJMA 2LFGA 4MJIA 4HCIA 5FFLA 5KBKA 4XH2B 1PZDA 4N28A 5HHMD 4ZXBC 4FULA 1UXSB 1I3GL 5G2NA 3PWPD 2QSTA 2BVQB 4MD5A 4OF7A 3U48A 3WNOA 1MCQA 5JPNA 2UYLA 4NM8H 3DTUB 3KW7A 4FQIL 1S7RB 4UILH 5DEGB 3LKRA 2WXQA 1QSED 1F90H 1IBDA 4AH2A 2OTWA 1TF4A 4P2YA 4E42A 3VXQB 1LP9B 2XZAL 2WN3A 4KUZH 2C9PA 2OL3A 1OAJA 2L7UA 3QIWB 4G2AA 5FA3A 3BRGC 3ARDC 1CMOA 1ZGLM 1YEGH 2R0ZH 1CO1A 1VADB 3KXFE 4HH9B 2CLZA 3IFLH 3QG7L 2PO6D 4X9BA 4XPFH 5J11C 1G9EA 4HGMA 5E8EB 2MQCA 2JWYA 2XZQH 1WUNT 2EKJA 4PUBH 5FF6B 2Q2EB 3JSSA 4FG2A 4DUWA