2J6WA

R164n mutant of the runx1 runt domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
SMVEVLADHPGELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHNAIKITVDGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUNT-RELATED TRANSCRIPTION FACTOR 1
publication title A Mutation in the S-Switch Region of the Runt Domain Alters the Dynamics of an Allosteric Network Responsible for Cbfbeta Regulation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 23
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00853 Runt Runt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2j6wA00
3QYMA 2BINA 2GEQA 4IBSA 2OCJA 2IOIA 3IGLA 4HJEA 2X0UA 1H9DA 5AOIA 5AOMA 4LOEA 2AHIA 2BIMA 2IOOA 5AOLA 2FEJA 1HJBC 2BIPA 3IGKA 3KMDA 3VD0A 4MZRA 2MEJB 2P52A 3D09A 1HJCA 2J1ZA 5LGYA 3US1A 5ABAA 2J1XA 2AC0A 5AB9A 2BIOA 2J21A 3EXJA 5ECGA 5BUAA 3D08A 2ADYA 1EANA 3D0AA 3WTXA 3VD1A 4AGNA 4L0ZA 1UOLA 2XWCA 1GZHC 4IJTA 5A7BA 4G82A 2J1WA 4AGQA 4G83A 2J6WA 3WTTA 1TUPA 2YBGA 4AGOA 1HU8A 4IBTA 1EAQA 4KVPA 4L0YA 4XR8C 3VD2A 5G4MA 1LJMA 3D06A 4IBYA 4A63A 4MZIA 3Q05A 5G4OA 4LO9A 1CO1A 4GUOA 2H1LM 2X0VA 3WTUA 2X0WA 1GZHA 3WTSA 2VUKA 1TSRA 3US0A 1CMOA 1KZYA 2ATAA 3Q01A 1IO4C 3TS8A 2J1YA 4IBZA 2PCXA 5AOJA 5G4NA 3D05A 2BIQA 3WU1A 4IBWA 2XWRA 3ZMEA 2WGXA 3WTYA 4GUQA 4AGPA 3WTWA 3EXLA 1YCSA 1E50A 2RMNA 3Q06A 4IBVA 1EAOA 5KBDA 4AGLA 5LAPA 3KZ8A 4AGMA 4LOFA 4IBQA 3QYNA 4QO1B 5AOKA 3WTVA 2IOMA 4IBUA 2J20A 3D07A 4L18A 1T4WA
chains in the Genus database with same CATH superfamily
1DVXA 3LKQA 4HUUB 5F3BB 1X5LA 3DX6B 3V55A 4WUUA 4OZIA 1GXEA 5HGBB 4TVPL 5DZOA 4KY2A 4XE5B 5JHDE 2VR5A 4DESA 5DMIH 1R3LB 1S7TB 3KWTA 3UL4A 2EDRA 1PY4A 2W60B 1SEBA 3V8CA 1IX2A 2E7DA 3DHUA 4ELMB 3ILQD 4F7MB 2DEXX 4ZMPA 4E68A 2D0FA 2PTTA 1CVSC 1P2CB 4QKXB 5IVNA 3L9EA 4XCNB 4JHZA 1NCOA 3HPJA 2CRIA 4DKFL 1G5AA 1MFMA 4Y19E 1SOXA 4KGLA 2J1XA 1JZHA 4LDCA 2CDGB 4P48A 2BX5A 2C3XA 1J8RA 1G7IA 4JFDB 2RFXB 4MA1B 4FQCH 1UD2A 2RJMA 3SDYL 3T1FB 1U0QA 5BV7H 2FECI 4L3AA 5F9JA 1FZJB 1MY7A 4R4ND 2LR4A 4WWKA 5EZIH 5AVRB 5E2UH 3GEFA 3D34A 4LQFL 5AL8A 5I1CH 5KTEH 4WSGA 5JA9A 5ESAA 4GRLC 3SDCB 2Q8AL 2WWKO 4P2OD 1TTGA 4IRJC 2EYSB 2VIRB 4D8PB 2KZKA 5GS0C 2PW2A 1FE8L 3ZYZA 4FNTA 5IHUH 2AEQL 4MMZB 1P4IL 3MYZA 3A3YB 1UACH 3DXAA 3PPEA 4OF5A 4KZ0A 1GGYA 3BD5A 1FVCA 4C47A 1A4BA 2DLFL 2GJJA 3GC3A 3OKNA 5TF1L 4O2CA 3V4PB 4X7SL 3TASA 4M8UA 1EGJA 1IBDA 4XAKD 2XICA 4JY4A 4I8DA 3C6LA 1KN2L 1P4BL 3SBQA 4PRHA 5JPMC 1A65A 4IBZA 2H7WA 4NKMB 4CBPA 3U0WL 1R24B 5ILTH 2XG4A 4Y5YB 3J07A 3MA9L 3TZVD 2QJDA 3Q2VA 4JFOA 5I1AA 1XX9C 4M6NH 5FCUH 1PNCA 1YY8A 5D8JL 3I2CL 1T7YA 2Z0BA 4BYHA 5F44A 3TN0A 3O8XC 3I6GA 3OKOA 1K5NB 1G7QA 4LRNL 2DM4A 4G8EA 4DCQA 3I6KA 1QFUH 2F74A 2HKHL 1H6FA 3DJ9A 3KHQA 4J2QA 1B2YA 3RBGA 1RZ7L 2APWA 2CDFB 1LXMA 3HNTH 4WFHD 3HNVH 1ZHKB 5EBMB 3OJMB 4L48A 5INDA 4JFZL 3L45A 2WSKA 1CG9A 1OP5K 1JGEB 2A1WL 4OH2A 5C0CB 4OQTA 1WFJA 3QJHB 2QVIA 3KPRE 1OP3H 3IWUA 4QOKB 3EG9B 3OVUB 2FEEL 2BIMA 4NKQB 4RAVB 2D3JA 4DT2A 1JHTB 4BCXA 2DWDA 3S6CA 3STZA 5D1QD 5DVOA 2H32B 3P4LA 3KWWA 1S5HB 4NPYA 3DOSB 4BCYA 4E5XG 3VWJD 4C58B 4D9QE 4PJ5A 4B9GA 1OM9A 2UWEF 3H55A 1LGVA 1RIUH 4PJ7F 3FCGA 2MMXA 4X7CC 5B3JF 3IDIA 3EBGA 2OZ4L 4KRLB 4JDZB 4DVRH 1DVFC 5E8NB 1KYOK 3U6RA 5EU6B 4N0UA 2X87A 4OM1L 4WENB 3FXIC 1NIEA 2ZUYA 4P5TC 2HAZA 2WBWB 3ZDYE 3O0LA 3NMEA 4MWFA 1O6SA 2E9BA 4X50A 4KXZH 2ZKHH 4IKNA 3E2HB 2LTQC 1LO4L 5EOCH 5IJVB 3QZLA 3LV3B 1SMAA 2G30A 3SGEH 3T3PF 3MPCA 4HUVA 2WXIA 2UV3A 5AYTA 4EEEA 1NFDB 2H4EA 4Y1AD 2UZIL 2X5PA 3EFFA 1JFQH 3MV7D 2YMOA 2ZYHA 5FO7A 4DEWA 4NRYA 2X1WL 4U0QB 1N67A 3GMMA 3QDJD 1P5VA 4N86A 2BNQD 1JTPA 1S9YB 3H3KA 3UBHA 1V5JA 1WUZA 3QIWC 3QNYB 3O6ML 2ATAA 2X53A 1UWGL 3FT3B 1MCJA 1QQDB 5CMAA 1MKFA 1QBMH 3VXSA 3U1QA 2E4FA 1XO8A 2DTMH 4G80B 4HK3N 5LVEA 4OW6A 2WXHA 4ELKB 3BWUC 1AQDA 1MRFL 4JG9A 3FQTB 1Y6NR 1KB5L 2DMHA 4ZMAT 5I1CL 5KTEL 1YSOA 2VTFA 2WXJA 4F24A 2A6JB 2CD0A 2YSSB 3QJSB 3TBBA 5FYLE 2X3CA 4MJIA 3WL9B 3JYBA 3SE8H 1U8MB 3FQUB 2FUQA 3BQUD 4QEGA 5K39B 5IHUL 3BEVA 4D8OA 4DPCX 3CE1A 2KLSA 5FWQA 3CDFA 3IJSA 1FAIH 5MEND 3BDYL 4HIHB 4MDJB 4PMFA 4HC1H 1SHMA 2BP5M 2F5AL 4HIJB 4F8LA 2VL4A 2D4DA 3BAWA 1NIAA 3HZVA 3K8MA 1YUHA 4NENB 4POYA 1QA9B 4AX3A 3CQPA 4ONOA 2VM3A 4R5TA 2X4SB 4XOBA 3EOYG 1KWKA 2AHIA 5DD6B 4GBXC 1K3ZA 5CEXB 1BCIA 1BVLA 2VR7A 1DSYA 3QEGH 1IC5H 1JRHI 4WFFD 2YUZA 2OMNA 5DZJA 4CVXA 3WNIA 5EU3B 2NUTA 1DVYA 5JOFA 4TXVB 1CTOA 1J9RA 1FYTA 4I77H 3V7AE 3ARED 2ETWA 5J06A 4WHYH 2XX0A 4X6EB 5DS2A 1A9BA 4KHXH 1L7TH 1QFUL 1FP5A 5KEZA 2YUWA 5IQOA 3CFQA 3SKOA 2F53E 2VLKE 1Q9WB 3HNTL 3HNVL 4JCMA 2H0FA 4W9KC 3Q9PA 2R27A 2MFNA 3ZHLA 1IFHH 1UUNA 4O4YH 3ILQC 1U8IA 4FFYA 5IY5B 3ARDD 3MV9E 4GXUM 3L9YA 1JF1A 2DI7A 5E8EA 1K8DB 4OGYH 2FTAA 1T0OA 3DJTA 3O3UN 4YDZA 5GJSH 5HI4D 2QR0B 3SZKC 3DNKA 2IO5A 2WKOA 3IMWA 4I18C 4ONHB 1GOFA 4OGAD 4F27A 3K6IA 1G43A 4JO8A 1J86A 4KROD 3ARFA 4JPIB 1FGVL 2V9TA 4M8QB 1QR1A 1S9WB 4HMCA 2BVTA 3SKUD 2Z34A 3QG6B 1U41A 1OWWA 1JJUA 1GGBH 1XGTA 4MGXA 4XO9A 3P1VA 3SKNB 1ES0A 3KWVA 2OULB 4U1LB 1RIUL 4P2OC 2WNGA 3RIFF 3V0VB 1OPOA 3L17A 4PJ9B 1AD0A 1CF1A 3HBPA 3L1OH 1KCWA 3B2UD 2EIEA 2QQLL 1HE7A 1HXMB 4FJYA 4EIZC 1G9MH 1XF3A 3RILA 3PU7A 3EJCA 1M05B 3JVGA 4CSPA 3V6OA 2ZKHL 4AGMA 3CXHJ 4P8QA 2VERA 4LSVH 2YWYA 1HXYA 5D2NC 4PJHE 5HPMB 4NCDA 5EOCL 5A6LA 1G6RA 3KS0H 4ZAKD 3EGXB 3SEPA 2F68X 4I2XA 1ED3A 3D07A 3HE6B 1Q9LA 2IG2H 3H1ZA 4MAYA 4X8JB 3I75B 3F58H 5JMRA 2QLVB 5GHWH 5LNEA 5JXEA 1P9MA 2H5UA 2O72A 1NIFA 4JFVA 4WRLA 3ZGHA 4AEHH 1QLEB 5T3ZD 5KS9F 1T1XB 2J8UB 3UG4A 4BFIB 1NLDH 2J6EH 3MO1A 3UTTD 4WUKL 1FZOA 3BVVA 1QWNA 3OQ3B 3V4UH 1HQ4B 1GGCH 1QBML 3KVQA 3WNJA 3O45B 1WFUA 1TVBB 4XN8A 1BAFH 2WXGA 5B3NA 1IARB 2A4CA 2A83B 2CR6A 1I8KB 4OIBA 4G6ML 3LPWA 3UTZB 4H8HA 5HHMD 2D3LA 4M93C 3MRJA 2ADJB 3V6ZB 1B0GB 3H9ZA 4JKNA 4C83B 5K59F 2ZXQA 2NY2D 3SE8L 4LVOB 3SYOA 3UZVA 1H5BB 4JMXA 4IQHA 4Z1PA 1ZA3A 5LG6A 2P5WA 5BJTA 4HK0A 1FAIL 5I1JL 1W0VB 5C09E 1U3YA 2EDDA 1SFDA 4LRIA 3WXWH 1KTBA 4AYEC 3M6DA 3V0HA 2DQDH 5JUEL 3MJ7A 4XN1A 5D1QC 1YYML 2WB7A 4DPAX 3BAKA 2FECL 2FEDD 4NO0A 1I9JL 1YEGH 2WIIB 4GXFA 4MMXA 3S34L 3S5LA 5IESH 1DR9A 2WWKT 5D5MF 5IMLB 2NYKA 3MBED 5D1XA 1K4CA 4X5XA 1HVXA 2J72A 3D06A 3KHOA 4MXQC 5DK0B 4WNQA 1IC5L 5CJXA 4MDIA 4A04A 1E3ZA 2CA4A 2KZBA 3T04D 4NQCA 1DQKA 1QI3A 3ZGIA 3MRHB 2JIXB 3KH4A 2OMZB 1KZQA 3DGCR 5DXWA 5GGRA 1I8AA 1JTOA 4KHXL 4I48B 4KQ3H 3X3FH 3L95B 3FU9A 1UKQA 1U36A 3NH7L 4WI0A 2VLLB 3QA3B 1YPZF 4G6FB 2NT0A 2VM9A 3FQXB 4L1DA 1PEWA 1PPIA 2X6CA 1IFHL 2AJ3A 4O4YL 4UT9A 3CZLA 2BZCA 2XC8A 1OAZH 5HXMA 3D8MA 2NNAA 3VB9A 4N2KA 5E1IA 5ERWA 5E2WH 4WKXA 1M3JA 3GMPB 3EH2A 5DU7A 4Z7VA 3LSOB 3QK0A 5GJSL 3D39E 5D7IE 4K7PX 3H6JA 2HLAB 3ME0A 1SN0A 3B43A 4LGSB 2BNRD 2BSRB 1NINA 4LKCA 5ID0B 2UXTA 3SE3A 4K0OA 1FVDB 2Z92A 3WDIA 4AMXA 2WVVB 1BIIB 4GSRA 4N8PA 2OAAA 4QRPA 3SO3C 4APXA 2IQAB 3MZTA 3WFEH 2EP6A 3AQDA 3UTSB 1ZRUA 4K3EH 5JO5A 4GRLB 4IMKC 2WJ5A 4XO5A 4IRJB 1GKEA 4ZUUB 5GRUH 1E67A 1Y18A 1TIUA 4U1NA 4F58H 4URTB 3V4LA 3G04A 3TXAA 1MFBH 1TZOA 1TQTA 3BQUC 2XN9B 3KBFA 3LHPH 4R8WH 5BUPA 4FQQA 3KAAA 1OTUD 2GIXA 4LEXL 4TYUA 2AI0L 4X6DE 5DEGB 3SDAA 3DURB 3RVTD 4NDMB 5ITBH 2VABB 1N8ZA 3K8LA 3AMKA 1KGYE 3S5YA 2Y6TE 3O3DB 4LESA 3ZT7A 5IB2B 1A1MA 3UYOD 1RAMA 5G2NA 4YC2C 2Z7YA 5JPMB 1OB1B 1OE3A 4LAQH 5DJAB 5IMOA 2XU9A 4AGNA 2BW4A 3TL5A 1WDAA 2I07B 3OM3B 5GHWL 4EVNB 3MRFA 3OF6A 4XMXA 3TO4D 3JV6B 1SOKA 2ZOLA 4XRCA 1V3LA 3QNFA 4UI2A 3R8QA 2NY1D 1A9VA 1NLDL 3GI8L 3O8XB 5JDSB 2MCAA 1MAKA 3V4UL 4IMLB 4FG6D 1GKOA 3DX7A 5J1AB 5GZOA 3VXRE 1HKLH 3HPLB 1MCDA 1S4IA 4LLUB 3S97C 4M1DH 1D5MB 5CJOL 4KDWA 4HQQL 5L7XL 2ZOUA 4L29B 2DQFB 2JVUA 1BWWA 3NIFE 1VACA 3IJYA 2JV6A 1MREH 2VDML 4NRZB 4RDQG 3DVGB 4X7EC 3RDTA 4E41A 3HUJB 1XT5A 2MJWA 2HZHA 3ARDC 3UTQA 1QASA 1JHLL 2IWEA 1JF6A 2HG5B 2NX5A 1SDDA 2H47C 3PUCA 2YEZB 2F18A 3QJVB 5HI4C 4OGAC 3JZYA 4QY8A 5FYJH 4RGMC 1D5XB 1O5DT 4WEBH 1PG7X 1X5IA 3G9AB 1ITCA 4GAYB 3JTBA 3QNZA 4O00A 1G7MA 1PW3A 3FONB 5IBTL 3RWGB 2XWTA 2ZSWA 4XMWA 3VU1A 3BP5B 1ONQB 4NM8L 4QRRD 4KV5E 1ETB1 4HK3J 4G43A 4X0KA 2YQGA 4B97A 3GM0A 2PETA 2QSCL 3WI9A 2KLRA 3ULSA 1NBCA 1OCCB 5TH2B 3FUEA 3QSKB 1OKEA 2Q86A 3LN5A 4MD4B 2J88H 2V8MA 3MUHL 3DVNA 4P5TB 3RU8L 3SGKA 2QMKA 3UZEA 4PGCB 2J73A 1PGRB 2EIZA 4KQ3L 5F89B 4KJWD 3X3FL 1N0LB 2WANA 3DA0A 1A9EA 5F3FA 3BIKB 4Q2ZA 3VXMA 2I9TB 4ZAKC 3IDGB 4BZYA 1C7SA 3S96A 2P46B 3UERA 1HWWA 1R47A 5C0IB 1QMUA 1OAZL 1AGBA 1SF3A 1A6UH 2R29L 2ESVE 3O3AA 2V3FA 4FTDA 1BD2B 3DX9B 5GXBB 1DJSA 5F3HB 2Q5BA 3ULVH 4JFXB 2BZDA 1JRHL 2Y7QB 2PXYC 3ARBC 2G60H 1Z9SB 3QIWB 4G7SB 4H8WH 2FO1A 4MSWA 3LNEA 4HD5A 5F1OB 3GD1C 1Q1JH 2RGSA 2EDMA 2OCCB 5K93A 3O9WA 5CLTA 3PNRB 4U6YA 5E1QA 4OI7A 1A0QH 1OLLA 4KRPD 3KPPB 1ULVA 3LKNB 5EFIA 2WCSA 4HH9A 4QTHA 1QACA 5BUGA 2IDUA 5EF0A 4AYSA 3MYJB 1CFMA 4AGOA 1HU8A 1A1NB 4KUCD 3FKUS 1IM9B 1T0MB 2OFQA 5JOPE 4CRPA 2ZJSH 4M6MH 4PRPB 5GRUL 1IGTB 4GXVH 1Z7JA 2NY2C 1W15A 3IVKA 1MFBL 3BIBX 3QUKB 3I6LD 1CO1A 2EZ0D 1NDTA 3K2KA 2A6KA 1IGCH 4PJGB 2IFFL 3RVUD 1Z3GL 1MCIA 4LCCA 3US0A 3B2DC 2IALB 1KXHA 2WOBA 3MNWB 3HG1A 3NCBB 4OM0L 4RRPM 3LRSB 3M17B 4J1UA 1A66A 4Y2NA 4X0NA 2JJWA 1J1OH 4G8GD 4M8VA 2VW4A 3BRFA 2C3HA 2ERJC 4APQD 5ICZB 1EEYB 3EBAA 1VERA 2KHAA 5GRVK 4GBXB 3M88A 3TYGL 2VCOA 3WEBA 3FQWA 5T1KA 3MBEC 5F7UA 4PLKD 1NCNA 4MS6A 1OM3H 4YMPA 3VA6A 2D0GA 4KO6A 2ZP8A 2EIDA 4BKTC 2J5LC 3BRDA 3BMWA 1D5ZB 4HX1B 2CBQA 1FLTX 4FQLH 5J11C 2XNAA 3C9NB 2FX7L 4CMHC 3IN2A 2IOMA 4UNUA 4OLZH 1TENA 2E3VA 3QQXA 1EZUA 3IPEA 4G8AC 2H3NA 4M1DL 2H1PL 2F8VA 1RZJL 1CBVH 3MRRB 4IIQA 1UWXK 2ZKWA 3FRPB 1BREA 1NCAH 1TJIH 2R1YA 1U9KA 3MODL 4FG2A 1XGRB 4UT6A 1F58H 3LH2H 3QI9A 4K3DL 4MQ7A 4YVNA 4I3SH 2K8MA 3P77A 4C4KT 3N50A 4XP1H 3V0DA 3TV3H 4LL9A 4PD4J 3X14A 1ZPUA 3US9A 2FBJH 1UM4L 3E1ZA 1E4HA 43C9B 2COVD 3P9MB 1AQMA 3G6JA 3PXLA 1JPGA 2BC4B 5CEZH 4YDMA 4WEBL 1KGWA 1RUKH 3BZFB 1KT2B 5J6SA 3WAJA 3SIKA 3WXVL 3MJ6A 4KJYA 3DX1A 3PP4H 4XWOC 5CHNA 2N0MA 3L48A 2IBZY 3C08L 2K4WA 4I0PD 4QXWA 3BKJL 1FG2B 4LLAA 4P2OB 3JYCA 5E8OB 3SBPA 4QXVA 4Z7WA 1AOHA 3S37H 4Y1SA 1EFQA 4G71B 1CFQA 3BWAB 2F1AA 2E47A 4P06A 4W1TA 4AXWA 1OTUC 2CO2A 5K9QG 2WW8A 3ARQA 1XBRA 3RVTC 1BZEA 3OMAB 1G1KA 1M9WA 3AM8C 3N9GH 4GUPB 4AZUA 4HCIA 4MFHA 2N56A 2W9EH 4L37B 1W9XA 2VLMD 2ITCA 3PHQA 5D2NB 1E9QA 3ARWA 4KKAD 1L9NA 2J1KA 5J6HB 1KCVH 1BVOA 1KIQB 1N18A 3O6FA 4ONGL 5T1LA 4MTMA 3H2PA 4Z77A 5ETUB 4QXUH 4LPYA 1KJ2A 1U8LA 1MOEA 1ORQA 1O7VA 1N68A 5LQBH 3KPLB 1E6JL 1UJ3A 3H9SD 2Y25A 3T0AA 4W9HC 3O3EA 3ULVL 2EDLA 5F1KC 3OAYK 1CDGA 1XCQB 2NY1C 4PRDB 4U1KB 2G60L 1I3VA 4H8WL 4GRMB 1JDCA 4KXDA 2R1XA 2WC7A 5DJ0A 1Q1JL 2GEEA 2AW2A 4HJ1A 3NG5A 5E1AA 2G2NA 2OL3B 2Y24A 1MIMH 4FG6C 4RFNC 4JN1L 2XXCB 3K72B 5CCGE 4MCYA 2DH3A 4KBPA 1QAWA 4YFLF 1EAOA 3H0TA 1D5RA 1HHIB 3SYPA 3VFGL 1AD9A 1TJGH 1T04A 4YFDB 2Z8RA 5L2KD 5I6MA 2OKMA 1BXUA 2OMUA 4M93B 1DO6A 2ZJSL 4M6ML 4BFNA 1UD6A 1I9RH 4FI7A 2BSDA 1G9HA 1JWSA 4GG8B 3QZPA 5I17B 2OMYA 4E5XA 4HIXH 1XV8A 4LIQL 2P80A 2SEBA 1BM3L 5DFAA 1XIWA 4YHPB 3V0FA 3P0VL 1FNSH 4Q6IC 2VDRB 1E5ZA 3RWJB 4WTZG 2VQ4A 4PBVC 4BWTA 2AK4D 3B9KC 1ZSDB 1BBJB 2UWEB 4U7KA 5D1QB 4LPVA 1AGCA 4KI1A 4ANWA 1JGVH 4PJ7B 3RX8A 2CK2A 5J12C 3CXHK 3BPLC 4PY8J 3ROLA 5AW3B 2W0LA 4XE0A 1JGDA 1A7QL 2R4SL 3BWZA 2WZAA 1RZKC 2BP3A 2KKQA 1OM3L 3BAEH 1XH0A 1J10A 4UDUA 4LCVA 2JK5B 5A6MA 1LMKA 3QZWB 4Y2DA 5KJ4A 4OLYH 4KTDH 3KPMA 1J8HA 4D0DA 3MX0A 1QHQA 3OWRA 3T3PB 4H2AA 4FABL 4XN7A 1AGDA 1XGYL 4LCWE 4ENED 2J1WA 1U3JA 4ZO9A 2FLRT 1B4LA 1WA2X 5ITFB 1TJIL 1YEEL 4A68A 3EO0B 1Q0YL 3LH2L 5D9SA 1F4HA 3MV7B 4PJEA 2Y07H 4UQAA 4X9BA 5B38B 3TV3L 1BQLL 1JN6A 1NFIB 2FBJL 2B1AH 4JRXB 2YEVB 3TBTA 4DO6A 4B9ZA 2BNQE 4YL9A 4KMTH 1D5BA 3MCLH 3UAJA 4QNPE 4I0KA 1CWVA 2G75B 2YGQA 3DX6A 4LAJH 2ITDB 1AQ8A 5CEZL 1R19A 4PBXA 2B8OT 4OD1L 1M56B 2DJ4A 2ZSVA 3MRGA 1EHXA 4KRPC 4XP6L 5JHDA 4IRSC 1H8OA 1R3LA 6TAAA 1S7TA 1F41A 1F4AA 3AZUA 3SO3B 3STLB 3PP4L 3UDWA 3IMTA 4NP4L 1T7WA 4P5SA 5C8JB 1A7BA 2NDGA 4X9GA 3RFZC 1UGKA 1CLCA 3VTAA 3ZE0F 4BZ2A 3S37L 1G94A 4PJBE 1KXTB 1MVUB 3BQUB 3FRPG 1LP9F 1MZZA 4Y19A 5FPIA 3F05A 3ZL2A 2EZ0C 4Z7OE 3WNPA 2WM0A 5MENB 3L9RB 3IS0X 1ZV9A 3QYNA 4NUPA 5JXAL 1FZJA 3N9GL 3MFFB 1T2QH 2Y5TB 4KFZC 3UTPD 3RWCA 1MJJB 2YXVA 4BQBA 3FUFA 2PPFA 3OKYA 1KCVL 4LHUD 1J0JA 1TT6A 4YC2B 3FHQA 5DZLA 1MJ7L 4APQC 4BSJA 3CZEA 4QXUL 4PV1C 4D8PA 2VIRA 4N87A 1N6VA 4PLKC 5LQBL 2O30A 2WQXA 2Z65C 1U8NB 3VVVA 4JQXA 3WJLA 1RUQH 3MNZB 1UWFA 5LXGL 3Q2NA 3D0VB 1KCUH 3B2PA 1Y0LB 4Q9CA 1OCOB 3B6SB 2JCCA 3TIEB 3VQ1C 1MIML 1S7UB 3ZKNC 2N59A 4WWPA 1ET7A 2D73A 4WU7B 2CJUL 2UY6B 4PJCE 1QZNA 3T0EE 2PNDA 3D69A 4UUJA 3SQBB 4L8CA 1ZY9A 1GZQB 5GSVB 3ESUF 1ZV5A 2VWEE 4M7KH 4ZS6D 3APMA 1JAEA 1OARL 1TJGL 2MTAA 3A67H 5EZJB 2X1PA 4XC1H 2Q8BH 3TV8A 3BZEA 3L5IA 2WKGA 2X2JA 4LSQL 4PS4L 5DFTA 3NJGA 4CU6A 3BUQA 1JIBA 1EJ6A 1XF4A 3ARDB 1GY1A 4N9OB 1XXFC 4HIXL 4HJUA 4OD2A 1MPAH 2APFA 3BVNB 5CN1A 4V2BA 5TD4A 3U4BH 1SVZA 1FNSL 2NOYA 5IFJB 4L8BA 4NZRL 4I3GA 5DLMH 4RGMB 5JW3H 3GHBH 2QKSA 4G6AD 5DRXA 3E3QC 1A6ZA 1TCRA 5F0JB 1Z2KA 4JQIA 5A1AA 1JGVL 5C6PB 2C7UA 2CDFA 4AKQA 5I26A 3GZQA 1ZLEA 2NY5H 3PQYD 4G7YL 4X9FA 5EBMA 2IDCA 4H0LC 2D7TH 2I85A 1DSFL 2CKBA 2ZYSA 4JANB 4DZ8B 5KJRH 4IHOA 4KO9A 4I0PC 3JV4B 4TVUA 3BAEL 1WFMA 3QJHA 2WYTA 2B9AA 5HI5D 5DJ8A 1S2EA 1KPRA 3QWOB 4X6CA 3I6SA 5DDHA 2PYEA 2AK1H 2K9UA 1JZJA 1HHHB 4RAVA 2OR9H 3D4CA 4UWQB 5A2FA 2WVUA 4JM4L 4KTDL 1B9ZA 1YEJH 1E8XA 3CXFA 2DKSA 3LRMA 3L2MA 4HJSA 4OF8A 4L4TD 1FNLA 4PRID 5F7LB 1S5HA 3BEWB 1DCLA 1E50A 1KEGH 4PW4A 4LP8A 5EU4B 1M6OB 4ZFZA 4KKAC 4YIQA 3UBFA 4IK7A 3L3KB 3CVBA 2V9UA 4P57A 2XCMC 4ZAKB 5KS9B 3JT0A 3EH3B 3IDXH 3TTSA 2YPLE 1NGWA 2YD0A 4H7VA 1SY6H 2DQUL 2GK0B 5E8NA 2N4IA 2NNCA 2B1AL 5L4JA 2PXYB 3NJLA 3S8FB 2WLLB 3PHAA 1A6TA 2NSQA 4HJJH 2WWMD 2XKUA 2XY1A 3F6IA 4JFQB 4JS7A 1NZRA 4ZDHB 3S0PA 3MLSH 5IJVA 3QZWG 3BH4A 5C6TH 4B6ZA 1HEZA 1DEEB 5B7EA 3T65B 2J12B 4BQ8A 1C5BH 2YMTA 2EO9A 4GIOA 1NFDA 2VDKL 3KEHA 1JYXA 4X9IA 5HHMB 3V52H 1PD6A 4GKLA 1QBAA 2LVEA 1GGUA 3GIZL 4MXVE 2NY2B 2RR3A 3QH3A 1SHXA 4LLDA 4O5LH 1S9YA 3LX9A 2DQ6A 3QNYA 5DMKA 2D7PA 3RB5A 2UXFA 1QQDA 1HFUA 3MOAL 1NGYB 4MNGB 4W6YB 1HZKA 4F7PB 5B38G 4IU2B 5AW5B 3GJEB 4HEME 2ENJA 5D5MB 5EHFA 5HDQH 3RE0A 4ELKA 3QCUL 5JPNC 4G9DB 4HETA 4YBHA 1URIA 4KO7A 3TPKA 3GBNL 2ERJB 4EN3D 1I1YB 3EKCA 4YSOA 1AG6A 3MBEB 5TK2A 2VZSA 2JWYA 4X8GA 4HLEA 4OJDH 1OT4A 5DT1H 4ZK8A 3JXAA 2ARWA 5K39A 3UG5A 3IK2A 4U6VH 2J5LB 4TSBH 1PZAA 4GSDL 5TK4A 5EC2A 3Q7JA 2XFGB 3QHZH 1KCUL 4PWHA 3SGJC 4HG4J 4GG6F 5J11B 1YPZB 5BV7C 4CMHB 1BWMA 4NENA 5AW0B 4GFXA 2K7QA 2OZNA 2YC1A 1F6FB 4ENEC 1JZGA 2VXUL 1OXYA 2J56A 2X4SA 1YEKH 5TDPA 3DIVA 4E9RA 4FN0A 5FEBA 4JFHD 5LWYH 4XMZA 1X4YA 3WY1A 3NAAL 3FPXA 4JFYA 2NQ3A 2OMTB 3MBXH 1DFBH 3ZDWA 3DJZA 4GUQA 1P6AB 5EU3A 4W4OA 3ZTNL 3CDGA 5KUMA 1U6AH 2EE3A 3GXUB 4RX4A 3EOAB 4MJ4A 4UQEA 1GYAA 4OFIA 3QUYC 2XG5B 2BNRB 4HMEA 4TTGA 3DYMA 4JO1H 4LOFA 1X5HA 2DIAA 2IFGA 5DLML 2BVOA 3GHBL 1QX1A 4M3KB 1RPKA 4URKA 1AR2A 1CJYA 4FMVA 2AMGA 4BJLA 5I8CA 2H2PD 3MCKA 3ZT6A 3D25A 3WS6C 1ZA6A 2ZUTA 3C2AH 3Q6FB 2VM4A 1FPTH 1MJUH 2D7TL 2QFPA 5KJRL 1OSZB 2WQVA 3K3QA 35C8L 3VAEA 5EIIG 1S9VB 2H26B 2NR6D 2AK1L 1E90A 4PS7A 4GQQA 4ONHA 2OR9L 4FQXD 5AOMA 4QJ4B 2JXMB 2JJUA 2ZX7A 3HA0A 5EV7A 2OXHB 1B3IA 3PYCA 4MHHG 4J3XA 4NHCH 4RQQB 4JJOA 4UOW1 3ZRSA 4NI3A 5LN8A 3EH4B 4FQ2L 3QG6A 1BM7A 2I5YL 3T3ME 3MGAA 4C55A 1E28A 5F21B 4TNVF 5A3ID 2ARJB 1CFTB 1MW2A 1LEIB 2QVFB 2YARA 3U9PH 3IDXL 3TX4A 3D18B 1KCKA 3K1DA 3ARVA 4EIBA 3FCTA 4ALAH 3ALWA 2WBJD 1W8OA 3TA4D 1PX3A 2IXQA 5CUSH 4FG0A 4WW2F 2NY1B 4A7TA 2C8NA 4M5ZL 4A2LA 4Y4KD 4FFWC 5J3HD 1UJTA 2BLFA 4RFNB 1SOSA 4XHQA 4YHOH 4FYQA 4MKMA 1NCCH 5HHXL 3MLSL 1A4JB 1QPPA 3LZOA 3VWKD 4AV5A 2ZOKB 2LU4A 3WDHA 2OXGB 3KH3A 4ZS6C 3OGCB 1CLVA 2Q6WA 5DO2D 1C5BL 1S8DB 1RJLB 5I19H 4HBQA 3WIHH 3FF8A 1QFWM 4MNQD 3UJIH 4WI3A 5LCVH 4NLHA 3RZCA 4UV4H 5HJGA 5K33A 3AG4B 4B5EA 4DKAA 4LOVA 2J8UA 5C92A 5KG9A 4BFIA 4IOIA 4IYKA 4S11A 2QVKA 3HC3L 4ZRGA 1HK6A 3INOA 2OS7A 4IEFB 3ZTCC 5FECA 1MCWW 4HJTA 3VX0A 4Q6IB 5AAMA 2Y3AA 1V10A 3O45A 5M95B 5IJKC 1CD8A 3GINA 5CJBA 4ILDA 4NQXA 2A83A 3CVHH 3WTWA 3E6HA 2FH6A 2O93L 3ZKQD 3AXLB 5J12B 3UTZA 4U6XB 2EINB 3EJQA 5E1GA 2BSCA 1J1XH 3AY4A 3BPLB 4RMTA 3U6XA 4EDWH 2AEPH 2QZ5A 4WEUD 3WMPA 4QRRE 4C83A 1M1XB 3FSWA 4AGLA 3OPZL 5HGAA 3H7BB 2HT3C 3GSUB 3LKPB 5DT1L 1VLXA 2XBTA 2MHAB 4ODWA 5HI5C 2AV7A 1KIPB 4Y9GA 3P30H 2A9DA 3GBML 5FKAA 3L3GB 5K69A 2ZG1A 4TSBL 5JTWA 4WK0B 2CIKB 1SVBA 5C09A 3AQZA 3DIFB 3BPNC 4JE4B 2TSBA 3HMXA 5FIEA 1NGXA 1M6UA 3B7SA 4WHDA 3PREA 4HZLB 4MJ6A 1ZAGA 2FYVA 2BMKA 2WIIA 2CO4A 5A2IH 5IMKA 2KERA 4PJXF 3SDDA 5TE7H 1FNGB 2DQMA 3GPEA 3MNMA 4F8PA 5AB0A 5LWYL 1OIOA 3KNBB 4JE0A 4D0CA 1DBJH 5DK0A 1QFPA 4QHNA 1IGJB 3MBXL 3T09A 5FM5M 1OOAA 5E6UB 1MHEA 2R69L 3QFDB 4NNYA 1RQ5A 9CGTA 1BVNP 4HIIB 4HBCL 1ADQA 4N20A 2DMGA 2GUOA 5I1GH 4Z3IA 3GXIA 1EQWA 2QPEB 4WJKB 5B1BB 3IMRA 4X7TB 4XNQB 4KK5D 5JIKA 2Z3FA 2WWMC 3KCWA 4RFOH 3ZOAA 1S7XB 2IAND 1L7IH 3TESA 4H4NA 4KRPB 1U8JB 4IRSB 2VLLA 3QA3A 2YRLA 2A2QT 3LS5H 4AY0A 3LN4A 2AJZA 2YOAA 2OTPA 3BKMH 3C2AL 3FQXA 3S35X 1TJMA 4L0ZA 5FGSA 3K0WA 2VISB 4XBEH 1QVOB 5E7BA 2XTJE 4YHYC 1XF1A 3BFOA 2MTPA 5IQLA 1SQ2N 4H2CA 4EZMA 3AS0A 3RFZB 1YRKA 3VXUD 4I9WD 5EDSA 3LSOA 1SN5A 2BVEA 4HUNB 1CXEA 2JE8A 5T1MB 2HLAA 3D39A 4NQED 2Z1PA 4GAJH 2BRQA 1A3RL 2HMID 1AMXA 1I31A 1UM6H 3CC5B 4K3JH 4TVPE 4NHCL 3UBXA 1FVDA 3TEZA 3MLPA 4F3FB 4KX9A 2WVVA 3BW9B 4X4KA 5FS5A 1JTTA 4NB7A 5HI3D 2FJGA 3RA7L 3RTQD 4J39A 2PLTA 4U1HB 3VNZA 1GCYA 2V2XB 3DGGB 4N1HB 5I74C 4NCC2 3L8QA 4DGUA 2A6IA 2ADFH 4ADGA 3B7RL 1VEOA 4GRLA 4PS8A 3RWIB 3ZQ9A 4APQB 4EN3C 5IB5A 1G7JB 4L4JA 4HGWB 4ZUUA 4R7DA 4ALAL 2DQTH 4CNIA 4PGBA 3O11B 3OZ9H 3T4YB 3QO1A 2XN9A 1I1RA 4I3RH 5CUSL 2JFCA 2PR4L 4HZ1A 3T0WA 1YNTF 2B77A 3UP1A 3EXLA 3TFBA 1B6UA 3Q06A 3AUVA 5DFWH 3ZHNA 3KPSD 5DEGA 4EDXA 4TLKA 4X6DA 1YEDB 1IC4H 1KDJA 4N2NA 4YHOL 1NCCL 2CO3A 2FJSA 4ZUSB 2ED9A 1L9PA 2IPKB 2CR3A 3FW6A 3D5OF 3PGCB 3SQOH 4ICWA 5IVXA 2NRDA 3CLEL 3OJDA 2IIJA 5I19L 5KBNC 5IVZB 3IB4A 3WIHL 1D2PA 3IYLW 3O4LA 3ARZA 4P4KD 4BZ1H 2Y7NA 3E80A 2BK8A 3JV6A 3S7GA 3E1F1 1I7UB 2XN2A 4XPHL 1G9MC 3EYVA 4S1QL 2OBGA 3O8XA 4Y5XA 5AYUH 5E03A 3QNXB 1A1OB 5J1AA 3KWUA 4ZMQA 4F7KA 2R83A 4QUOA 3FTWA 5AG9A 3VXRA 2J43A 2P1YA 3IPFA 2X4NB 2KDGA 2ENQA 2H2PC 3OTTA 3ABZA 5AD0A 1M4KA 1F18A 4L29A 2DQFA 4LLVB 4P3CH 1G6VK 1TR7A 3K46A 4JPVH 4EDWL 3A21A 3L4TA 2AEPL 2XWJA 2LW3A 2CBOA 4XNBA 4JKPH 3IFNH 3KLQA 5T5FA 2WQUA 3CSYB 2G5BB 1A4AA 5DRZB 4I0PB 1X44A 1X9LA 2YSTA 3ULVD 4CL7A 2BOCA 3P30L 2WLNA 4NQQA 5DSCA 2NR6C 5HHPB 2AKRA 2CO6A 4FQXC 1HAUA 1QWUA 3ABGA 5DC4B 1KF9B 1URLA 1TO4A 3KXFD 1N4XH 4LVNC 2BOBB 1HILA 1E2WA 1A3LL 1EPFA 3ULVF 4Y16A 2ZAIA 3W0WD 1ZIAA 1X5MA 3S8WA 3DHPA 4AM0B 3FONA 4RWHA 2GT9A 4RESB 3RWGA 1DJYA 4CU7A 2DF3A 3S8GB 1U3HA 2C1PA 2AJXH 4W6XB 5A3IC 3IF1B 1OF2B 3BP5A 4Z3GA 3WBDA 5TE7L 1L3NA 1ZHLA 3HOGA 4U6HB 5BZDB 4PVLA 5AB1A 4WW2C 3EGDA 1ZGLM 5ACMA 5C0GB 4YHIB 3F65A 4PGZA 2WBJC 1T21A 3DARA 5C6WH 4HU8A 4UQBA 3QXWA 2VDOH 3H9SB 3NFSL 2X88A 4XMPH 3Q5TA 1RL1A 5I5JA 3P73B 1WZKA 5I1GL 2NDFA 3UADA 1TSHA 1XH3B 4J8RB 4U1GC 4LGPB 4EI5D 2XWDA 4Y4KC 1IBHA 3ZQXA 3S2CA 1L7IL 1J8SA 1N0LA 2A6DB 4K5LA 5CWSB 1G1OA 5E2JA 1HAWA 1J05B 3EO1A 1WBXA 4JGJA 1CXIA 4GW4B 3U2IA 2ODIA 3PY9A 5F8RC 3LS5L 3J27A 1ZEAL 3WE6A 2I9TA 3IDGA 5CJQL 5DJ2A 2YXWA 2W0FA 3P4OB 1KY7A 3PGFH 5DO2C 3LQMA 4XBEL 5C0IA 4OIIL 1KEML 1I8LC 1QTSA 3VYOA 4YGVB 3UROR 3PWPE 1PCSA 4WTZA 4AQ1A 1QPXA 3JWNH 3QZOA 5LGHH 3WJMA 43CAB 1OD9A 2NTSP 2ZUVA 4JFXA 5JORB 3RPIA 2F1BA 4GAJL 4H40A 5I2IA 5KYYA 4R96A 1UM6L 1UUSA 2XZQH 1DJIA 1W2KT 3C6SB 5SWSE 3KJ6H 3OXSB 2RB8A 1QSFE 2PP7A 4DERA 5ENWB 3IS1X 2EYTA 2AK4B 4FQJL 4J3SA 1KG0B 5JPNB 3QUZD 3QIUC 4D3CH 3MYJA 2FQDA 1SJHB 2ADFL 1NDMB 4RFEB 1T0MA 4GRWH 1FO0H 1P6FA 1WT5C 4PRPA 4PI2A 1PD1A 4AUJA 1N12A 2VMFA 4KHTH 5LGJB 3HRZA 4IJ3C 4I3RL 1JGUL 4E9LA 3HG2A 4PUBL 4G7QB 1Z1WA 3Q8AA 3L13A 3T8VA 4ABVA 5CEZD 4IK6A 3VXOB 3D6GA 3MNWA 5ACZA 4XBGA 3LPOA 4PGDA 1IC4L 5D4QA 3ALXA 5BV7B 1U93B 4N2HA 5CINL 4F33B 3II1A 3MUGA 3ZZLA 3QRFM 3VI3F 4F9LA 4C56B 3SQOL 5ICZA 1BFVH 1DVTA 2JKWA 4IRZA 4GBXA 2O5ZH 1VKXB 4ADJA 2F0CA 5AVYB 4UANA 3WOVA 2F8OA 5BZWA 3MJ9H 1KXQE 5KBMA 3O2DH 4BZ1L 4MCNA 1BZ7A 1VAHA 4GFTB 4OFYD 4MJ5A 3BGFC 4RDBA 1VGEL 1TNMA 2ATKA 1T4KB 1LO0H 3O4OC 5ESQB 3C9NA 3QUYB 4DIXA 1BQKA 3WYRA 1WCBB 1AGFA 1FIEA 4YXHH 5BQ7B 3JTTB 3T2NH 3IPBA 4F91B 4OCSL 4UTBA 3S9DB 1KB9K 5EEUA 3IJEB 3SODB 4XAWL 3FRPA 2DPKA 1T20B 4P3CL 2WN3A 2GHWB 3ZE0B 5CJ8A 4ZW6A 4JKPL 3IFNL 1LP9B 2ZXCA 4G9FD 1AXSA 2WK2A 1WA0X 3CGTA 5IQNA 5FLVA 4JRYE 4AEFA 3ZYOA 43C9A 2DZEA 1QRND 2CK0H 5E2VL 4NJAH 1I1AD 4J27A 3V0AC 4QCIB 2BC4A 2HMIC 3OMNB 3VQMA 1UZ6E 3KM1A 4O58H 2W65B 3BZFA 5E99H 2CR0A 2PCPA 3CMOH 1N19A 3NUKA 5HI3C 5C0BD 1EAPB 2F54D 3RTQC 1J12A 2FJFB 5I0XA 1W8EA 5DR5L 1CT8B 4JCLA 4AIZA 1BYNA 4HVBA 3MLTA 1ETZA 1GC1H 3LIZH 5CGTA 1TKWB 5E6ID 5JW4M 5MI0C 5MEPB 4HFUH 1NICA 1FG2A 4R4FH 4LU5H 4K7PY 1ND0A 3G08B 1NCDH 1HSAA 2ZX9A 1J0YA 4OGXH 1OALA 3N43F 1YYLH 2VDOL 3F8UB 3V4VL 4OZGF 4XMPL 3ISWA 1PKQE 1KBVA 5HGDB 5I8EB 1Q90A 5DJDB 1OTSD 1CCZA 2FHBA 2NPLX 2B14A 4GUPA 5CZKA 5B21A 2XWZA 4D0BA 2BRRL 5CCJA 1B4JH 5D2NA 9PCYA 4V33A 2ORBL 2C7FA 4E42B 1KIQA 5B7FA 4B7IA 3VGDA 3PGFL 4GO9A 5ETUA 2R2HB 1WZMA 3MSPA 4I85A 2O6CA 3TZVA 3HW7A 5LDUA 1F11B 1XD1A 2B5IC 2XN0A 2V3DA 3PWJB 4P4KC 5I15H 2VAAB 3ISYA 5LGHL 1KOAA 3QEHB 4KNUA 2NY7H 1XCQA 3D08A 4PRDA 3QRBA 4B3VA 1J0HA 3EHBD 3CDCA 2FYYB 1U58B 4WI9A 2FX8H 1Z5YD 4HKZB 3ZKMD 1AIFB 1PYWA 4PCTA 1IT9H 1TZIB 4MCMA 2IMNA 4YDJA 3KCPB 4EXPX 1IL1A 4HHAB 1EFXB 2MWCA 2VN6A 4JLRA 1BZ9B 4D3CL 1SLUA 3FCSB 4OT1H 4WW1B 1RJCA 1M53A 3PQYB 4OLXH 2B3RA 3C5XA 1I3GH 1GA2A 3RY6C 1FO0L 1ODUA 1YMMD 5D6CA 1LO5B 5IIEA 5LDSA 3NACL 2VRKA 4KHTL 3GNMH 1OAQL 2YR3A 5I17A 5FGRA 5IEHB 3ULVC 3GRWH 3MU3A 3BP4B 3N1FC 4HF5H 4H8WC 3MJGX 1UXWA 4NN7B 5IW3A 1MI5D 3BPNB 5L4MA 3WD5L 3QRGH 5JW4R 3VXNB 2BVPA 2UWEA 5D1QA 1CXLA 1WZLA 4JVWA 3OKEB 4XCEA 2Y36H 3NJFA 4L4TB 4PRIB 4R26L 4WF7A 5PCYA 3IJ9A 1I7TB 4FZEH 3SQRA 1NBYB 2FNBA 3ZMEA 3SE4C 4XB7A 1BFVL 2HVKA 1JZFA 3VWJA 3ZT5A 5AOZA 1BFOB 3B9DA 3U46B 1QFWL 2ZP0T 4POUB 3ASWA 3V6FB 4DPRA 1Z9PA 3O2DL 3QO0A 4TOYL 1E7UA 4BM7A 4L8SC 2YKLH 2DL9A 3VH8B 2P4AB 2VRQA 4CA4A 4N0FA 5KSBE 1LO0L 1LM8V 2P45B 3BLKA 5KSAD 3QEQE 3W9DA 1GMIA 4O2EB 4Z7NE 2G2PA 4EI5C 5JR1H 1YNLL 2GSIA 2L4OA 2WWOA 3T0BA 2MH4A 3QVAA 4LCWA 3KPQB 4AYGA 3T2QA 4QRBA 1QSVA 1U8HB 3ECVA 4JVUA 4ZO8A 5HYQA 4XNAA 3CH1B 3OR7B 5CR1A 2Z7WA 3RGVC 4Y1AA 3GI9H 1PZUB 5I6PA 3MOBL 4A55A 4YHYB 5B38A 4Y9EA 3T0EC 3DSFL 3PV7A 4I7ZC 2DWEB 5C07D 3QDJA 2NW3A 2Y7OA 3EOTL 2BNQA 3DROB 3RTLA 5D71H 2V17H 2ICWJ 2WUBH 3LJ3A 3NIFB 3MRKB 2P52A 2ITDA 3MRNB 1KLUA 1KBWA 3RPKA 3L5XH 4L4VE 3JWNE 4O58L 5E99L 3NJXA 3KEDA 3FUHA 1IJNA 5H35A 5KVEH 3O2WH 2J21A 3QUZC 1OOWA 3ESVF 1IBGH 1OAXH 5T33L 4LLMB 4XP4L 1DQQB 3MGTA 3ETTA 4H25B 2ZCHH 4EN3B 4HFUL 4R4FL 2MQCA 3VD1A 1UQSA 1NUGA 3MVSA 1ZLWK 4GG6B 5EF1A 4OGXL 1FNEA 1YYLL 4Z3FA 5EN2A 3T71A 4MX7B 4PJBA 4PRBB 1JS4A 1IC0A 5EBLB 5G5DB 2GSMB 4JPWH 2J71A 4ZD3H 2QPDB 3TH3T 1KULA 1AP2B 3DBXA 1KCSH 3MFFA 2Y5TA 3DHMA 4YHZH 3UBGA 1MJJA 3VGBA 1TZ8A 4UZGA 2FWLB 4NUJB 4IBYA 1P7QD 1HI6B 3EH1A 3L7FA 3DSNB 2XV0A 5C0AD 4YSTA 1I3RA 4UQ2B 4XMKH 4L8DB 4HDIB 4UB0H 3MFGB 3MLRH 4G11A 5I15L 4P2RE 1XTLA 1DO5A 1AANA 2NY7L 3MNZA 1A2YB 2CJSA 3P4MB 2ZONA 4LHUG 5IEKB 4DVBB 1W72H 3D0VA 4XGZB 1Y0LA 3AREA 3C87A 4NQDE 3U2SB 2WNKA 2X9XA 3BI9X 3BHBA 4JQVA 1IT9L 5EULV 5AALA 4K7FB 2ESVB 4K94H 2GI7A 2OYMA 3M1OA 5FLUA 3V4PL 3UG3A 3SQBA 1GH7A 3LS4L 4JM0A 3L3DA 5EIIA 1MFNA 1X7TA 4KVCL 4OT1L 4OLXL 1I3GL 3FQRA 4XMUA 3QQ9D 4K2UH 4XTRD 4AUUA 3MUJA 2HPOA 4AQEB 3D48R 2J20A 4Y2LA 5DVMA 1KGXA 4MAUL 2A38A 4S1DD 3BVNA 1VADA 2HFEB 2G4GA 1MXGA 1NJ9B 4OCNC 4FQXB 3V6BR 3X1EA 1TZAA 3I3EA 4HS6B 4PV8B 3WUZA 4LVNB 3IMVA 3QRGL 4P3WA 4NGHH 1NIBA 3MBWB 5C9JA 3APFA 5F9DC 1ZWIA 3LVTA 4ZYKA 5JHLH 5B8CA 3NFNA 1U21A 4GO8A 1UA7A 3VD0A 4MZRA 1H0DA 2XKSA 4JANA 4DZ8A 4CJ0A 4WW2B 3TJHC 1XVSA 3CUPA 5INCB 4WJ5B 4FA6A 2FVNA 3LTVA 2Z1KA 4PB0H 1N2RA 2HH0L 2WBJB 4DN4L 1UA3A 1HHHA 1JPFB 4GP4B 1UA6H 1JNHA 3FU7A 1OTSC 2NUPB 5TE4H 4Y4KB 3FTXA 5DD0H 4PJFF 3VD7A 3MOQA 3VJ6B 4BXVA 5D7JD 4Q9QH 3IE9A 4HWBH 4NERA 1JNLH 4XWGL 1AH1A 2FGZA 5KS9A 2UX6A 1DCEA 2E76C 2OQJA 4KFMA 3EDEA 4RWYH 4EJ1C 3GI9L 5D7SL 2YPLA 3HJ0A 1BLNB 5DD3L 2WYHA 1C5DA 3KLAA 1CI5A 4FA7B 5FA4A 4L0YA 3I02A 1NSNH 1H3GA 4OAWB 1MXDA 1MNUH 4EI6A 4LK4A 4U1SA 3ATEA 2WUBL 5HDBE 4EI0A 3EHBC 3UTTA 3WLBB 2O5XL 1IFGA 1LE5A 3AT9A 5DRNB 1WP6A 4R7LA 3VI4F 4HCRA 2DYPA 5FGCB 3ZKMC 3HS8A 2ATPB 1F3DJ 1K85A 1YA5A 5KVEL 5BXFB 5CR8A 1OSPH 3VH8G 1DEEA 1XL6A 3P54A 3QIUB 4JFED 4ORGA 1IBGL 1KENH 5D7LE 1FFPB 1YECH 1JWUB 1KUMA 1NCHA 5DA0B 3W2DL 1IGIH 3TBYB 5I16A 2BXYA 1MDTA 4UINL 1KJMB 5EO9A 3HC4L 4FMFA 4NO5A 4U3SB 3KPNA 4OQ1A 4IJ3B 1HS6A 5KBDA 2L7QA 1U4EA 1WIPA 2BWDA 1KBBA 2DQGL 3NCEB 1JSYA 4BH7B 3L4VA 4F8QA 4MBRA 4HT1H 3ENEA 5L6YH 1KCSL 3OB8A 1QTPA 3GJEA 4HSCX 4PJXB 4YHZL 1K5WA 1QKZH 2WO2B 3IE4A 1OY3B 5I18L 2H41A 3PLYA 2JJTC 1QOKA 2BSTB 4WHYG 2KT6A 5H37A 3AXIA 1M71A 2VLJD 5DS8B 5I76B 3GEWB 1OT2A 4Z5RB 2FK9A 5A16B 4M62H 3MLXH 4XMKL 1FORH 3VGEA 3MLRL 5DGQA 4AK2A 1FVEA 1M7XA 4MQXD 4QRQA 2NTFB 4MRCA 1R4XA 1SDAB 2HVJB 4ZMXA 1SMOA 3BGFB 3TVMC 1RHHB 3SY0B 2WTPA 2QSTA 5L9DH 4FERA 2EDHA 4R7XA 4GT7A 1ID5I 1VSCA 5KSAC 5C7ZA 2A73B 3QDGD 1KPVB 4P46A 4K94L 4XN5A 4X5WB 2IANB 2H6UA 4Q52A 3PHOB 1S9KC 5LNGA 4N8VB 5HSFA 1BPVA 4N22A 4QRAA 2WXQA 1LLAA 2ZWNA 4LNRA 1MCQA 1ZVSB 2P8PB 3D12B 2BS9A 2OMTA 1BAGA 2ICWA 2B0SL 1IE5A 3T4AA 1NMAL 1EA9C 1V05A 1Z5HA 1EGJH 3FN9A 3U0TB 4C4UA 3VXUB 1QSED 3L3IB 3OZLA 4YDVB 3LOWA 4L9LA 1KC5L 2XG5A 3M7OA 3Q8FA 2YK1H 4PYHA 1MLCB 1XR8B 1SVCP 3DMMC 1SJEA 4PW9A 3AAZB 1EDQA 1WBZA 2LHAA 3G6AB 3RTQB 4EN2A 5JHLL 3FB7B 5IREA 4RMUA 1XSOA 4J3BA 4K71C 5EC1A 1BF5A 1RK0B 2RBLA 4PREA 5FM4A 1RIVL 4QRUA 3OLGA 4OB5H 3OV6A 1IFRA 3EJRA 1YNTB 2GJZB 5MI0B 4BRVA 5FO9B 5I75C 3OG4B 5EUOF 3FFCD 2H26A 3PP3K 1B2WL 5AW6B 1DDHB 2JXMA 1FJ1A 3IDNA 4RCAA 5DI8B 3P3SA 1CXFA 5C0FA 5FCSH 1TZHB 4RQQA 4H8UA 5TE4L 4OZHE 1CYXA 3HIZA 3VQLA 5F7DA 3DDGA 4FZ8H 1RURH 4NAQA 1HOCA 1FN4A 2FBOJ 2DM3A 4HWBL 2NY5C 2WXFA 5JQHC 4B9FA 5FOJA 1LEIA 3LEVH 1U30A 3QZBA 4KNSA 4PG9A 1SXBA 2NW2A 1XHHA 3NCCB 2CBTA 3MCYA 4JDTL 5CP7B 4RWYL 2D9CA 3GKWH 1CLYL 4AWJC 2FWSA 2EECA 4XPAL 3L4XA 3T2PA 3V0GA 4LXFA 2B5IB 2YD9A 4P4KB 2GW5A 1CLOL 3TO4A 3WKQA 2CLZB 1NSNL 5BS0D 1I85C 2AAAA 4L18A 3OPUA 1G9NH 1G7PA 2E7MA 3U0PB 3BVDB 1F1GA 2JKIS 3OX8B 3I3DA 1BX2B 1D6EB 5D6DA 2I7OA 1JV5B 1K6QH 3B83A 4ZMWA 2ZOKA 2K6YA 2V5RA 4NKIL 1CFVH 1KENL 2H3XC 3OGCA 5AOLA 3LZNA 2E0PA 1GJIA 4FOMA 2BP0B 1PQZA 1IGIL 4NPKA 3T8XB 3UABA 2XQ0A 2ADGB 2X6VA 3GMQB 3JUYA 3Q1SL 4UOQA 3QQ9C 4XTRC 3ETBF 1BECA 2NY0D 2CM6A 5F9OH 2NY3D 3IDJB 5KN5B 3RIFK 1UYWH 2LU3A 1E4XI 2DYSB 5E8PB 4S1DC 4NKDA 3NCYP 3BLBA 5C7XH 1S3KH 5IG7A 1QLEL 1OWRM 1YMHB 4BE5A 2JQMA 5GGSB 4FQ1H 4Z0BH 5CU9A 3GF8A 4Q6IA 1WFNA 4HT1L 3MZGB 3KXFB 4H1LA 1OSEA 4HUWA 5ESVA 4ENZA 1T0NA 2XOTA 1QKZL 1BZQK 1IVTA 3ZDXE 1JK8B 4HJIA 3AXLA 1A7OH 3JWOL 1VZIA 5CKAA 1ZLUK 1AHWA 4Y5VA 1JZ6A 3GBDA 5DHEA 2BP8A 4X8XA 1IEAB 4HPOH 3AACA 1JD7A 3L08A 1M1XA 4QRRA 3NTCL 3MLXL 3D33A 4HKBB 3WFBH 1H6EA 3L3GA 4LIQE 1SDYA 1KIUA 1SJMA 4L8SB 4YN3A 4YLCA 3X2QB 3S4SB 1T3FA 4QXGL 1CZ8L 3ABLB 4JM2D 4KU1A 4NNPH 3VFNA 2Z93B 2N0KA 4ZTOH 4EI5B 3BUBA 5MERA 2GCYA 1CN4A 5E2TH 3VX1A 4P9MH 4XX1G 3WN5C 1AO7E 4UILH 4JM2F 3BSZA 1SXNA 4DHLA 1JWMB 4FL4C 7TAAA 4QR7A 4QPEA 3W5MA 2DJSA 2EE0A 3S2AA 3SD2A 1GMEA 2VGLM 3RGVB 1N5AA 4Q4IA 4IBWA 4HHWA 3DPBB 1EVUA 3NA9H 3DTXA 4TSCH 4MZ2A 1WYJA 3BT2H 4CGTA 4MB4A 3QFDA 4YBQD 3T0EB 5CBAB 3QEUB 1QATA 3F01A 1EGJL 2JKJA 1L9TA 4HIIA 4ZX4A 2ICCA 3W38A 2DTSA 4IU3B 3U36B 1HINL 1YEHL 4JZNB 4X7TA 4XNQA 2C3VB 4NSKA 5FO8A 5KYWB 5MEOA 5EORL 4WU5B 4IBQA 1F45A 2MPAH 4M7LH 2W07B 2DOCA 3E9UA 3IJHB 2VB5A 3KGUA 1HN1A 7FABL 1IGFL 3QUZB 1N6QL 2YPVL 3OLDA 2KPNA 4JVPA 3RVXD 4G8IB 4OUUB 1QVOA 3KYMA 4OB5L 3VG0H 4QJ5B 5B39A 5IGXH 1BVKA 1J0ZA 4G6KL 4N9GB 1QFHA 1TQUA 3L1GA 1HZHH 3ZDZE 3CFUA 5DHYB 4N8VG 3O6LL 3WEXB 3DPDA 1P4LB 1LWJA 2WLIB 3CC5A 3VI3B 1TU2B 1SUHA 2GIYA 3BW9A 3DK0A 3TEYA 5JHMA 3TBWB 4FFYH 1MW1A 5DQ9A 4U1IA 2GJ6B 3U25A 3T77A 1DN0B 1CGVA 2Y6SD 4AYFA 5E00B 2XFXB 1O9ZA 4G8GA 4BFRA 1VFUA 3X12A 4FP8L 4QHKJ 1TLKA 4HGWA 4KVNL 4D7PA 1KTDA 3GKWL 4NOFA 1JPEA 3RJDA 3BP7B 2WYIA 2OPCA 5KBPA 1L5GA 4AL8H 3T4YA 2F58H 4E9WA 4F1ZA 2CUIA 3WTXA 4PJAF 4MQXC 1OZUA 2RD0A 2OYLA 4LLYA 3U79A 3G5YA 3K6NA 2ZCLH 3BGAA 1PLBA 4LP5A 3W56A 4B60A 4GSXA 4GO6B 5HYSA 1ZDSA 2CIIA 4WDIB 2D3NA 3CFJB 3T6WA 4BCZA 4L3FA 2YD7A 4AEEA 1K6QL 3TT1L 4QTFA 5I9QC 4ETQB 2BWIA 5ICUA 4N68A 4F2ME 4YEFA 1PS3A 1XZ0A 3MV8E 1NH6A 2EKJA 3PGDB 3Q0HA 5HHOD 4KKPA 5IVZA 5I6LA 4TUOB 1NLBH 2VLRD 4G9FB 1K72A 4ALAC 3ZBMA 2GBUA 2OA9A 1UYWL 3NFPA 5KSBF 1I7UA 3CAFA 1E65A 4QF1B 3FF7A 1KNOA 5BZZA 2X6BA 3QQ4B 3SB3A 5C7XL 2YPKB 3C8KB 5T3XL 1XGZA 4P23D 1QRNB 4HW6A 4PJDF 4U4IA 1G6RH 1IO4C 2EICA 5GSRB 4Z0BL 2PCXA 4WO4D 1NAKH 2C5DC 3GSQB 4WWNA 1KSRA 4MB1A 3T1WA 2EKSA 1AXIB 1F0LA 2X4NA 5E5UB 1KGCD 4ZUTB 4RZCA 5DYFA 2HUHA 3THML 2R7EA 4LCIL 5C0BB 4Z76B 3P3UA 2P8MB 2ZX6A 3BZ4B 2YIHA 3C5ZD 3N43B 3BWSA 4PRHE 4HPOL 4QHMB 4OZGB 2G5BA 4ELDA 5E6IB 2OK0H 5DRZA 5CBEA 4I0PA 3FU3A 5GRXG 5CZXD 4LVHC 4XVOA 2R2CA 2VO8A 4FYRA 5HHPA 2UZYB 2FUTA 4HUXB 2ZUUA 1E4XH 3BPCB 2NT1A 3VSQA 2JTDA 1IKFL 1QPKA 2CO7B 5F6HI 4ZTOL 3IKCB 1BJ8A 3QJFA 4AM0A 1DJXA 3S36H 2BFGA 1WISA 4R84A 5EEXA 2NMSA 1ZTXH 4A6YH 1JZDC 2Z31D 2EYRB 1OF2A 4UTAL 3S3CB 4OCRH 5CGYD 3NN8A 3CHXA 1JUFB 2C1OB 5C0DA 3NA9L 2HN7B 2Z4QB 2FCBA 3PXHA 3BT2L 2KUTA 1EX0A 2AXGA 4S1SH 4PHZA 3QDMD 2XWBA 4GRWF 2HX8A 4I89A 4E2OA 2WTRA 1HDMA 3F00A 4XXDA 3EHBB 4N1CA 3EYFB 1XF2A 1CGSH 2EDTA 2M26A 2EH8H 4DZBA 4YXKH 5IB1B 4FFZH 3EJUA 2ZOTA 2R39A 1G1CA 1KTRL 4PG2A 2B2XH 4GW4A 3IAQA 4M7LL 5KYUB 3B8SA 4R6UA 3S4SG 2G2RA 3RL2B 1I9IH 4A7SA 3P4OA 5L2KA 1DBAH 1VZGA 3B37A 4ZMOA 1FFRA 1YMME 1R5IA 1Z9LA 5DJXB 3TOPA 4Y7MA 3X13B 2OZ4A 1HZHL 5MP6H 4E9TA 1AI1H 2F19L 2NY3C 4RIRB 3NIGE 4W9IC 1IGML 5JORA 4N90D 4JY5L 4N0UE 1T5XB 4G7RB 2AJSH 4JR9L 3C6SA 3DVIA 2VZVA 3N3EA 1X9QA 4E9VA 2VT0A 1MI5B 4XPTH 2BSED 4QTIH 1CDHA 4UT9H 1QSFA 5ENWA 2AK4A 3HNSH 4PS3A 2BVYA 1X5XA 3MRIA 4A2GA 4DKEL 2ZXAA 1U8OA 4FRWA 4LKXB 3Q01A 3DECA 2VDKB 2WD0A 5SX5H 3RURA 1R3JB 3LB6D 2PW1B 4IBLT 3FFOA 1RUAH 1BOGA 2F58L 3HS0C 1D5IL 5DJCB 5H94B 3EUUA 4NFDA 2ZCLL 2HKFL 1CXKA 5D1ZA 3TVMB 2BZ7A 4GKZB 2YJQA 5DQDL 4JM2C 1IB5A 3F12B 3LRLA 3VNYA 4AYBA 5KSAB 3G5VB 1LO2L 1SQMA 4ZNEE 1INDH 2IQ9H 3WFDH 3NJIA 3RVVC 2VC2H 4RSVA 5BNXD 1KB5A 3MMEA 4L3ED 5DEFB 3ZHDA 1FWXA 5IM7B 1VKXA 4P3DB 5I1DB 5BW7C 4F20A 1AZUA 1ORSB 1XDTT 1T89A 1ZT7B 5EO0B 1NLBL 3WHXB 4Z7UE 5CEYA 1FLRH 3SCMD 4UU9B 3HBGA 1B4TA 4YBQC 5AAWC 5CD5D 1KDIA 2PABA 4MD5B 3MTRA 5C07B 4K07A 4HWNA 5ESQA 4JFDD 5HHNB 4OCLC 2W0KA 1RJYB 3OJVC 1YNKH 3SN6N 5T1DL 3LXBA 2J2ZA 3DMMB 1UXSA 1E5BA 2EE6A 1YQ2A 2DIBA 5F93C 1AZCA 4N26A 1T80A 5C0ND 1D9KD 2CXGA 3WS6A 3QXTA 1T20A 3CNKA 3WFHA 5LKNA 4P2CG 4K71B 2R1WB 1SN2A 3NJVA 3H7LA 5IK3B 1LP9A 3BVXA 4GY4A 4KTGA 2R59A 3RVXC 4CN4A 3NSDA 1NEZA 1L9SA 4NNXB 4XP5L 3T6ZA 5I75B 2IV8A 2VR3A 4JRYA 5AVZB 3QFJD 4PJ8D 1JHKH 5EMYA 4QCIA 4UM8B 3OAYH 1CURA 4JK0D 3HHSB 4I5BA 1IEHA 1JCVA 3LNGA 1I9EA 3TWYA 1C16B 4S0TD 1E42A 1RU9H 3CK0L 4Z8FH 2JKRM 4BK4A 1EAPA 1UT1A 2Y6SC 3QC6X 1ZTXL 1Q4NX 1CT8A 4A6YL 2F9BT 5IB3B 5ISZD 1P7HL 1XH2A 1UD3A 3M07A 4LHUA 1CS6A 1P7QB 1TKWA 3B4NA 3AVEA 5C0AE 1PLGH 3FQNA 4X98A 3QFGA 1S7QA 3UX9B 2CCWA 5J5EA 4TSAH 3Q8EA 4DW2H 4UNVA 5E8DL 1G0XA 1UB6B 1J11A 4PJIF 5DJDA 3CLFH 2W5PA 1CGSL 2CG9X 4LPTA 2EH8L 1I75A 1JD9A 4YXKL 4FFZL 1UURA 4WK4B 3VFVA 1H3PH 1V54B 3D05A 1A7PL 2GYSA 4YHLH 5BRZE 2B2XL 5AG8A 2DQIH 3EF7A 1EHKB 3ZK0A 4GW1A 4E42A 1GOHA 1WAEA 1NPJA 4LGRB 5CLZA 5SWZD 1O7DE 3K6OA 1VHPA 4G5AA 1F11A 1FBIH 4YR6B 5FW8A 3MLUL 5BPPA 4UAOC 1AI1L 2IH8A 4AT6B 3CFEA 3KDPB 4U3XA 4QOKD 5FV2A 2BY3A 2LAGB 3HJEA 4G1EB 4P23C 3DOIA 3H42L 5H2BB 1U58A 2ZWKA 4WO4C 1TZIA 5ID1A 3SJVE 1KIRB 2MNUA 3KCPA 1IKNC 2OL3L 1CYWA 2Q9OA 4JJ5A 4HHAA 4LSSH 4QTIL 4C59B 4CBZA 5C71A 3HNSL 5CSGA 1PBYA 3FCSA 4NBXB 2UYLB 4NZFA 5TGBA 3C5ZC 1B6DA 4I2XE 1OLZA 4WFGD 1MCPL 3CSPA 3JWNC 4CSTA 4G3YH 1XGUA 3S37X 1XCTB 1R5VA 1RUAL 2FEJA 3TT3H 2ENPA 3LKOB 5CZXC 4AH2B 4DP2X 1XEDA 3IGUA 2GK2A 3N1MC 3NZUA 4LSUL 5HYJB 4PJFB 1ROCA 4PV9B 4HUCA 5ANME 1FAKT 3L5WB 1JPSH 4MMYA 1NL0H 3JSSA 4OD3L 3UO1L 1ZT4B 3VXNA 2VDRL 5E08H 2IQ9L 1WFIA 4L4TA 2YMXL 1QLRA 5KVDL 1NBYA 2YAMA 4DGVH 3WN5B 2XIDA 4ZPTB 2Z31C 4FL4B 4O02H 1Z32X 1BFOA 2QGBA 4ZUVA 1NPUA 3UYPB 5CGYC 3WDJA 3PIQB 4XXCC 5HGHB 5ADOH 4BDVA 4ANUA 1FLRL 2NLJA 3HBZA 3VI4B 1BYPA 5M7QA 3NRQA 3VH8A 1WRFA 1U33A 4PRAB 5DK2A 4XO4A 3VRJA 2P5WE 5GS2H 2CO1A 4M9OA 2YQ3A 4KY1H 1AY1H 4FG4A 1YNKL 2WXNA 4XC3H 1S6NA 3SBRA 1P1VA 3AFLA 1C7TA 1ADWA 3QARA 3ULUH 1ZT1B 2HX7A 3LVEA 1Z9NA 1U8HA 3QJRB 2ED8A 3G6DL 4JFEE 4KDTC 3PAVA 3AS1A 4DP8X 5L4IA 1R34A 1CMOA 3QWRD 4NX0A 2QKIC 3HR5A 3CVCA 3HI6L 1DJGA 3SE6A 2EH7L 2ZKXA 2R0LL 1NAMH 4ABQA 4PGEA 2YBRB 3HI1B 4XNMB 3DROA 2WB1A 3MREA 1LHZA 1JHKL 3PDOB 4X4XA 4XH2A 5I0WA 1SEQH 3RVWC 1EH9A 1YCSA 4UT6H 2EADA 3D0LB 4AENB 4LBEB 2H9GA 4Q89A 4NFCA 1CLZH 2CZNA 4CVZA 4Z8FL 6FABH 2ICEA 1F86A 4QRTA 1C12B 1FIGH 1VFOA 2GTWA 3GIVA 4KKBC 4NRXA 4LLMA 3EJZC 1EUUA 3CSTA 1ASOA 1DQQA 4KH2A 1SXZA 5TQ2H 1FFOB 4EN3A 1PLGL 2FATH 2VLJB 2YN5A 1FCGA 1BJMA 4RGND 3RWHB 4GG6A 4YX2H 4NO2B 2A9BA 3H2WA 2X70B 3BJ91 1YN7B 4NWTL 1EDYA 4DW2L 2IGFH 1UZ8B 2RQEA 2X4OB 3EFOB 5KYXB 3HLAB 3FSOA 4EMZA 1GW0A 3CLFL 3WGUB 1AP2A 2IOOA 3K6FA 3QDGB 1PL3A 4YHLL 4NZUL 4B7LA 3UAEA 4OGQC 2QQNL 4F7CA 3RHWF 1W8NA 3D1MC 4ODXB 1S7WB 4QRPE 2X9WA 5GGVY 3UZQA 5I9QB 1HI6A 2ZUWA 2EDEA 4E9SA 1XGQB 3FZUD 3SHSA 1D7FA 2GTZA 3DSNA 1GC1C 3SDXA 4A2MA 5IMMA 1OANA 3NZHH 4UQ2A 25C8H 1FBIL 3AWFA 1SYVB 4PLOB 2LT9A 3QZNA 3SCMC 1X7QA 2WY3B 3QPQD 2G5RA 4N3TA 3SD5A 5CD5C 2EILB 1JNNH 3E8VA 3PV6B 4H88L 1QSEB 4OCXL 4XGZA 4OKVA 3U2SA 4S2SA 3O2VL 4ERSL 4HHGA 1UD4A 3F7VA 3QW9A 4HALA 1IM3A 4E9YA 4FLRA 4K7FA 5ELIA 3PWPB 1KJ2H 4LSSL 3I84A 4AGQA 1M7DB 1U91B 2DICA 3P9LA 4FDWA 3TYFA 4NHUB 3PNWB 5GZNC 4YE4L 3OAUL 3FB8A 5C0NC 1D9KC 3CN2A 3MRCB 1NC4A 5EUOB 1JV2B 4NN5C 5A2JH 1HH6B 1P5UC 4XMTA 2KC0A 4QYOB 4CSZA 5I1EL 1WSST 3TT3L 4HEPG 4HKJA 1ZLDA 3GO1L 4LVHB 2HX9A 2A74B 4RMSA 3FFCE 2X4TA 1AKJB 3QS3A 1AOZA 3NZSA 4LO9A 1BQSA 4PJ8C 1WFOA 2FL5A 1UWEH 4JPSA 1E9PB 1JPSL 1FL5B 5TFSH 2GITA 1NL0L 1RZIB 3WTSA 1XSIA 3VMNA 3GMOA 5E08L 2Q0ZX 3K6SA 1OP3K 3RIAK 5HJBA 3CVHB 3CZGA 3KLSA 1XSJA 3CSBA 5LBSL 3OJ2C 1PEZA 4CMMA 4DGVL 3FT9A 3J2PA 1OGTB 4XXWA 4YZFF 5HY9B 3FT4B 4O02L 5DJYA 2H8PB 1S78C 3NSCA 3HE6D 1LK3H 4WUUD 5AYQA 4WJ5A 2KLTA 1C9SA 3IETB 4E41E 4M7JH 4HJGB 4NKOA 4FNSA 4ODVH 3LYRA 4LHQB 5BS0E 2NSMA 1JYVA 3VQ2C 1JPFA 3O0RH 1DUYB 1N9PA 5E51A 1HH9B 4YHNB 4OZIF 3GB7B 1NKOA 1AY1L 2NUPA 2VL5B 3L81A 4XC3L 1Z9MA 1MCWM 2X9YA 4PY7A 1N3NB 4BV1A 2FX9L 1UOVA 4MQSB 1WA1X 4I9XA 4ADIA 3RAJH 3VWKA 3IBEA 5DQJB 3W9EB 2DYRB 1H19A 5BOPA 2JQZA 3LN9A 1PLCA 4HP5A 1BLNA 4MNQA 2JKLA 2W9DH 3LZRA 2Y1VA 2P9RA 4TNFA 3DHJA 4WWKD 4X6BA 2NY3B 4OAWA 1NAML 4AQAA 5AZEH 1YEFH 5E24E 4LDLB 3WLBA 4HOXA 4JHWL 2R9HD 4V1DB 4KKLD 3FQ2A 3MR9B 2GVYA 5DRNA 3D3VD 1OGAB 5AW7B 3VE0A 5FGBA 1I7RA 3QXDA 4N8CH 1UB5A 1TTUA 2GIMA 1CLZL 4HISA 1E8ZA 2R0ZH 2JQAA 4RZKA 1FIGL 4H44C 4JY6B 3LNFA 2HVBA 1S5IL 1MFUA 2IH3B 4AYID 4H26A 1EAJA 1A3QA 3DXAD 3ESMA 4UMSA 2PCFB 4KOBA 4PY8I 2FATL 1KJMA 2QADC 1IBFA 2R29A 1AZZC 1TJHL 5MHSD 1X5ZA 2P5ED 4U3SA 4AM0Q 2YZ8A 1SHSA 3C6LD 3FO9B 2IGFL 4JFPB 3HS0B 3NOIA 3F5WB 1SPDA 3QQ3A 1NWOA 4BH7A 2JIXD 1U8PB 2BHFA 2PYFB 4UDTB 4PJ6A 4JM2B 5IFHH 3KL3A 2B7DT 1FRGH 2N3JA 2ZXEB 4ZZFA 2DAVA 3FN3A 1JPTL 4NIKB 5BO0D 4BZ2H 1F56A 1B90A 3G5ZB 1PKQB 5I0VA 4G6FD 3TF4A 3QPXH 5I76A 2ZNXA 3NSFA 4J8QA 4XCCH 1KFAH 4R4BB 1TSRA 4M4RB 4Z6AT 1T83C 4UOZA 3VCLA 4FNLH 4Y9FA 5D2LF 2FZ3A 1R3IH 2NTFA 2J3SA 2JKXA 1B0RB 3FO2A 2B20A 3ELAT 4AQZA 3VYPA 1RHHA 4ZX3A 3N42F 4YEEA 2CCVA 4PFEA 3E0GA 4KTYA 4L5FE 1QO3B 3BXNA 4ZTEA 4R5XA 4R9HA 1ZLSH 3IRPX 4EOWH 2VOTA 1TTFA 2IANA 5CGMA 2LU7A 1P84K 4YO0B 2BSBA 2Q7YB 3BH8A 2OR8A 3REWB 1LD9B 4PQXA 1MHCB 1TYRA 3UTSD 2DLEA 1J1PH 1J5CA 1HTYA 4DEPC 1VF5C 2EVJA 1S3RA 4UAHA 4QO1B 5IHBA 3ULUE 1WBYB 4MYPA 4MXWH 4AJWA 4BKLB 2OM5A 3IAPA 3VXUA 1GSKA 2V7HA 1MY5A 3CFDA 1Z0NA 4NQEA 3GWJA 4PJ5D 5DRWB 1NFAA 1K2DB 3SE9L 1TTAA 1KJVA 1MLCA 4M61B 1GS7A 4K94C 3GMLB 2I9LA 1UFGA 4XNUL 3G6AA 4OF6A 4UQ9A 3UO8B 4MJ2A 1A4KA 1YLBB 1XB8A 3JVFC 5J56B 3QUXA 2BJMH 1BFTA 1Q9KB 4PJAB 3S3SA 1YNTA 1LK3L 4JB9L 4Y4HD 5F8QC 3RWFA 3TNNB 3QGVA 2R0WL 3OSVA 5KWYC 4BRJA 4RGNC 3UC2A 4M7JL 4NZTH 2R2BA 5JNYB 1H3TA 1JERA 4JFFE 5FDYA 1MCEA 2I32A 5T3XD 1P53A 2VSDA 2VZ1A 3O0RL 1HEJC 1IZKA 2FE0A 4P4RB 3AU1B 4S1RH 1TZHA 3RIKA 3C5SA 3LEYL 1RFDH 3KPSA 3TPUB 2ITFA 2Z0UA 4OZHA 2CKBH 1F3JB 4KKCC 2OTWB 4MA3B 1VPOH 4I0CC 3FOLB 3NIDE 2VN3A 3TO2A 3FZUC 3LCYA 5KSBB 3I9AA 4JHUA 5CP7A 4N0YH 4RISH 3RJOA 5AVSB 2PO6C 3RYMA 5HHOB 3VXSD 3B3IB 2FT7A 2OJEB 3R1GL 2DBLH 4PJDB 5HBBA 3A4EA 2IH1B 2VLRB 1F6AA 2CLZA 1OAYH 4HKXB 4UAOB 1DYZA 4J3WA 4EBQH 1GVIA 2VDOB 4Z7WE 5G4MA 5AZEL 1YEFL 4K5PA 4P23B 4XNYL 3VUAA 3NDZE 2TRYA 3Q13A 4ACTA 3U0PA 2X0VA 4HFWB 2HJFB 3OX8A 4WO4B 3IDYC 2OTUB 4MJID 3V0EA 3BO8A 4N8CL 1ZTMA 2OMWB 2RTTA 2X40A 2R0ZL 3S3DB 3ZKSD 4YHMH 2J1YA 4PMEA 3BIAX 3EO9H 1QBBA 1JZ8A 2YGVA 3EDKA 3NCWA 3C5ZB 4TNVK 2X4UA 3EJTA 5FDWB 4KX8A 1E4JA 1TFPA 3BISA 3GKZA 2XN1A 4F5CA 1HEHC 3RNQB 3QULB 4QDGA 2TSAA 1DVFD 1D6VH 3CHRA 3GUFA 5FF6A 1CD0A 2B16A 2BFVL 4M1CD 3KPOA 4P5TD 1BSIA 5IR1B 1SYSB 3KXFA 1A14H 1WC7A 4AE0A 5JIQA 2AJVH 1FRGL 2IPTH 3LMJL 3W0WA 3APCA 4ZFOL 4OBSA 2XXMB 5J13C 4XMLH 3ZRCC 2L0DA 4BZ2L 4PVBA 1FYTD 3QPXL 1M9SA 1CIDA 1IEAA 2Z31B 5KVGE 4GRWB 1GW6A 5J9PB 1FO0B 1DQJB 4W4NA 4XCCL 2EXYC 1S9XA 4ZW5A 1QUNB 3P2BA 2Y4SA 1BD2D 5GJTH 3QDME 2ED6A 4L8SA 4PWEA 5AZ2H 1TMQA 2D3VA 3S4SA 1XMWA 1BXAA 4BKSC 1HOEA 1A25A 2Q76B 3CD4A 6CGTA 3HI5L 4XB3A 3V5DA 4GLRI 4EOWL 2LFEA 3C5JB 4XCFH 3H4HA 3QUMH 4X80H 2FWUA 3US1A 3V5KA 2C9VA 1AO7A 4OLWH 1JVLA 3W57A 4W70A 4KUZH 3FH7A 4LCYB 1N0XL 1RERA 3BYYA 1J1PL 1IM9D 1JVOA 1HXKA 1N8OE 2AVFA 2RA1A 3BUPA 3WO4C 1OCWL 4ZMVA 4NO3B 3BGMB 2QKIB 4PB9H 2ZXDA 3S5ZA 3TGXA 5CBAA 3EOBB 3HB3C 5HP5A 1HSBB 2WKOF 3MGOB 4WWKC 4TTDD 3CCHB 3SPGA 3FB5B 4KTEL 4JCWA 3IXTB 4JZNA 2FLMA 4OSUL 5I1HH 4M4PA 1LE9B 2R9HC 3K71B 4KKLC 4KJQC 4PGJA 1H3UA 3TU6A 3MRQB 2XV6B 1WEJH 4XT1C 3HZYB 2VXTH 2W07A 2GKIA 3FUDA 5EUKB 5I23A 2KPWA 2CPUA 3X17A 4ODUA 1EMTL 3QUZA 5IF0B 1MEXH 4HPYL 4X6FB 1CK0H 1UOKA 2BJML 2WOYA 4XOEA 4HXAH 3UBXI 5T5NF 3CWGA 5F1NA 4XPFH 1ILSA 3UOAB 3RUGA 3IFPA 1NFKA 5PAZA 1TZGH 1DQVA 3KPTA 3IAGC 2FR4B 2A0LD 2P8LB 2AJYL 2XA8L 2D7QA 4OGZA 5JIHA 5JW5B 1FHNA 3C6LC 4NN6C 4YSRA 3CSFA 4FE9A 3OKLA 1BQHA 4OLUH 4S1RL 2BIQA 3VI3A 4MAYD 1AC6A 4J4PA 2CALA 4PSRA 4BGLA 2CKBL 2XSKA 3EJYD 4NQSB 1FFNA 2OSWA 4NZDA 3DO3A 3QXUA 4TQ8A 1DN0A 4LVEA 4K9EH 4F57H 4J3OH 4JDEB 4PN6A 1KPUA 3OL2A 5FUCE 5BOZG 5EOQH 4G42B 2QTVA 3TN0C 4L3EB 3RFRA 4N0YL 4RISL 4JRFA 4ELME 4GIPD 3BP7A 4MQTB 1DQLH 3LQAH 1DQML 2WXLA 5BVJB 5DUBB 4G8FA 4WFED 1OAYL 1KBKA 2EACA 4N1EA 4P5MA 4OFYA 4W9ZA 3PPSA 2WUCL 1FH5H 3SCMB 4OJCA 1L9MA 1ACYL 1UVQB 5JQIB 3HG5A 4R90L 3QJOA 2G9KA 5D4HA 4MD0A 3U7WL 4WDIA 2XZCH 4X4MA 5LB1A 3CFJA 5EPMB 4YZWA 3LKSB 1M7IB 3D30A 3ZTJH 3T6XA 2W38A 5F72S 3EO9L 2RCSL 2G9HB 1D9KB 4YPGB 3ZKXC 3CHOA 4F2MA 3IXAB 2R0KH 3MV8A 3ZZQA 1N7MH 4NN5B 2VXVH 4TUOA 4X5RA 1P5UB 2QSVA 3EYOB 4DN3L 3BN3B 1ODAA 1J5OL 2ZIDA 2EABA 2XKNB 2CLVB 3X1FA 5KSVB 3C8KA 1WWCA 2X4RA 3MA7B 1INEH 3BAJA 4BGDA 1I1AA 2Y0SA 3QFJB 4PJ8B 4FQPA 4YDKL 5DMJB 5IOPA 1G9NC 5D1XD 3VFOB 2JCCE 4WI7A 4LPWA 1U3ZA 1DVZA 2YZ1A 3B56A 4Z76A 2F54A 5F9AC 2VDPH 4NQCD 3ZXAC 2R8SH 2VRAA 1UT2A 3QAQA 5ISZB 3TEXA 4OZGA 4ZMNA 2Y1AA 6PCYA 5E6IA 1J9CT 1PZ5A 4FKKA 4Y4HC 2CHXA 4PJIB 3CJJA 1SBSH 1CDYA 4PCKA 1FH2A 1QBLH 3KDMB 3FOMA 4XVTL 1Q72H 3VRLF 5AZ2L 1TVHA 4YL4A 4K8RH 1J18A 3BPCA 4NBYB 3GJFH 2E8YA 3ES6B 2FWOB 3W81A 2D7NA 4CGUB 1NUFA 5FYLL 3QUML 4X80L 1JDDA 5T1JA 3C8HA 4NUGH 3VFWB 1YVLA 1IEBB 3UIYA 1FL3B 5EB9A 1R5WB 1L6XA 3BFWA 2FJUB 1JUFA 5KVFE 5I6KA 4KZDL 4TQHA 3GZPA 2Z4QA 3OKMB 5SWZB 4Z7VF 4K5OA 1IQDA 4PB9L 5C0CE 1E27A 1I53A 4EUPA 4MCZB 2GSGA 1WVZA 4R7NB 5FM8A 4KZCA 4X6CE 3S3BB 4LLWB 3BH9A 2PYEE 4JAMA 3ZL1A 4NC0B 3BAXA 4Y9BA 1XB6A 3EYFA 2X10A 1U95B 3Q8CA 1M7UA 2G3XA 4OCYL 4FAAB 3CPLA 2FIKA 5KYUA 1DBBL 4L1HA 4GLRH 3RL2A 1MEXL 4H8QA 2GJRA 2AQTA 1IAOB 3MCG1 1DQIA 3NDYE 3REVB 1ADQH 1RZQA 3K6DA 1NGPL 2GFBA 3SDAD 2IJ0C 3FPYA 2HG0A 4WFGE 1YMMA 3DV4B 1UCBH 3Q2LA 2EDYA 2QADB 4GB9A 2CPCA 1WZAA 2GEQA 1TZGL 4PP1C 3HHMA 4MXQD 4NZJA 5FV1L 5IHZA 4PCSA 3GMRA 2AJUH 1JZ2A 4HGKC 5E94A 5EU6E 4M43H 5C08D 5FOBB 1O0VA 4L3CB 1T5XA 2E59A 2ZWSA 4DQAA 1FC2D 3CFKB 3N85H 4Q8BA 3MRMA 4M1CC 2NNRA 1MI5A 3RL1B 1A6AA 3EZJB 1YQVH 4ZI8A 3HZMB 3I9GH 2C4FU 3FQ4A 4K9EL 2YA1A 4F57L 4JKWA 5DMIL 1JZEA 5EOQL 3BMVA 2IADA 4QHUA 2E46A 3KGSA 1T1WB 1I7ZA 5CSZB