5HJ3A

Crystal structure of host-primed ebola virus gp, gpcl.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
225
structure length
199
Chain Sequence
EVQLLESGGGLVKPGGSLRLSCAASGFTLINYRMNWVRQAPGKGLEWVSSISSSSSYIHYADSVKGRFTISRDNAENSLYLQMNSLRAEDTAVYYCVREGPRATGYSMADVFDIWGQGTMVTVSSASTKGPSVFPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Host-Primed Ebola Virus GP Exposes a Hydrophobic NPC1 Receptor-Binding Pocket, Revealing a Target for Broadly Neutralizing Antibodies.
pubmed doi rcsb
source organism Ebola virus sp.
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein
total genus 36
structure length 199
sequence length 225
chains with identical sequence E, I, M
ec nomenclature
pdb deposition date 2016-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hj3A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hj3A01
2IBZY 3MLVL 1BVKB 1BZQK 5E6YA 4UOW1 5FKPB 3CXHK 3ET9F 1L0XA 4POUB 4UB0H 3NACL 4M61B 1UXSB 2P5ED 1Q72H 3MLRL 1OVZA 4XGZA 2D31B 1KJ3H 2XN9B 2CLVA 4PJ5B 2V7HB 3FAWA 4TQEL 4U7SA 3VFUB 4OT1H 5E6IC 1X4XA 4XBGA 3DVGB 1OM3L 3L5WB 3QIWC 2NXZB 2ADFL 3GEWB 3MGTB 1OWWA 4WU7A 1A14L 1FZOB 2P8MA 3RWEA 4POZD 3QIBC 2PYEB 2BHZA 4TUOA 5KSVB 3CCHA 2DQDH 3UBXB 2P4AB 2FX8L 4DVBB 4PP2A 4JY5H 5IG7A 1DLFH 4QYOA 1BFOA 2B8OT 3RWFB 4XBGB 4S2SB 1IC1A 1ZSDA 5AD0B 1C16B 3MRIB 4LPUA 4JE4B 4LLDB 3CVIH 5H35A 3HE6D 3PV7A 2BFVH 1J87A 3WHXA 3ARXA 4EN3A 43CAB 4Y16B 2W0FB 1E6OH 1RK0B 2QL1A 3VFOA 3RU8L 7FABL 4KROC 5FKPA 5KS9A 2JELH 2OR7A 3CFCH 4YXHH 1I85C 3QHZL 1N59B 1MWAL 5TJWK 1S5IL 4X8JA 3OKEB 5AAMA 4XC3L 1QR4A 1GJIA 3VXSD 5JLZB 1HE7A 2OQJB 2AXFB 1I3RA 1TPXC 1NCDH 4IRSD 1WT5C 3ULUE 1ZVSB 2VDNH 2C3GA 4Z77A 4FMFA 5DHYB 5SX5H 1CE1L 2BNRB 1MCJA 4MJ5A 4RBPH 3AXLB 2LVCA 3HE6B 1GIGL 1L9MA 2ESVA 2ZSWA 4JFYB 3VGAC 4G8FA 3IDNB 3O9WC 2R0LL 1GC1H 4ZQKB 1YNTB 5F1OB 5IB4A 3GMPA 2DI9A 2BVYA 1JZ4A 1WBZB 4JFZL 1CDYA 5EUOB 1MCBA 4KY1L 1AFVH 2NZIA 2P5WB 4MVBD 4I18A 1JMZA 2XA8H 3N1MC 4NRZA 3BEVA 1JI2A 4GS7C 2YRLA 4HD9A 4L3EB 5CBAB 4JO4L 4OKVA 3UPAA 1X5XA 1U8NB 2LU4A 4MA3B 4O2EB 4X5LA 4DN4H 5DK2A 5MHSE 3IDGA 5GGVL 5EZLB 1MAKA 1U8MB 4GQ9L 1BECA 5SWQA 4YR6A 3HZVA 4JO2H 5HI3C 1YMMA 4OFVA 5TE7L 3T04D 1U3HB 5IBLD 1VEOA 2A38A 1MREL 3V0AC 4WHYH 2XN9E 4TUJB 4YHPB 5EOQH 5L88L 3DO7B 3TCXA 1VENA 5BOPA 4A2MA 1MIML 5IFAL 1TITA 3PABA 1FRGL 2X1PA 4XHJC 2NNAA 1AQDA 4OZGF 5BW7C 4R8WH 2A77H 2IQAB 3SKJH 2DQEL 3OJDB 1EEQA 4FOMA 4WFED 2BVPA 1KN4H 1WIUA 4LEOA 5KSAA 3QO1B 1MQKL 2ZKHH 1IGIL 2RIKA 4X6CA 2BZDA 4A6YH 5HVHC 3FT3B 3OKOB 2NXYB 3CDGB 1D5XA 3RAJL 3RKPA 3EYSH 5HSFA 2NNAB 3WFHA 3QWQB 2V2XA 4S1QH 3VGBA 3HN3A 1DFBL 3UO1H 5HDOA 4I0PB 2DQJH 2QADC 3BQUA 1K8DA 4YIQB 4Q97A 2OI9B 4LHUA 3E8UL 3S5LG 4UINH 1HEZB 4Y5XC 4XH2B 2DM3A 3BESR 4EKXA 4XX1E 3LMJH 3R1GH 5DTFA 2CR6A 3QO1A 4I8DA 3RGVA 4G9FE 5FXCH 3UZVB 5FHBL 5E0QA 1A1MA 1BD2E 3OKLA 2D03H 4NT6B 4LASH 2DLFH 3M45A 3QZWB 3PABB 5I9QB 1CR9H 1IAII 3MREA 1NGZA 1KIQA 3BQUC 2RCSL 3QFDB 2HRPL 3DO7A 2AXJA 2EC9U 3H2WA 1WZLA 4WWKA 3ZHKA 5ADPH 2BXYA 1B4RA 4PS4L 5DHVH 1FFNB 3V2AR 5KG9B 1GAFH 2FJHB 1ZLSH 5KVDH 5D93C 5CD5C 2GSIB 4K3EL 1Y6KR 3E6FA 3QIWD 3FO9B 5EUOA 4L8CB 4KDTC 4U1LB 4C56E 3TYFB 1D6EA 3CSGA 1Q1JH 2DJUA 4LCCB 2EE6A 5CUSL 1HZHL 1NUNB 4KRPC 4JLRB 1F00I 4L3CA 3VDBA 1KN4L 3GMLA 4DN4L 1N5AB 3QUMA 4HLJA 4WNQA 4R8WL 2M1KA 4XXCA 2FL5A 2HP4A 3V6OC 1Q38A 1HIMH 3VXTB 4HKBA 5HI5C 4I18B 1YPZB 4TOYL 3UC0H 5MP6L 3ARWA 5KTEL 2ICWI 5JZ7D 4DZ8A 5IBUG 1HHKB 1Q94B 1PQZA 1DVFA 2VZ3A 4HUWA 43CAA 2R69H 5EU3B 5FYLD 5GJTL 4KRPD 1JZ7A 3MRGB 1K4DA 1Q9WA 1T80A 3TO4C 3HE6A 3KGRA 3KLHD 1JGEA 5J6HB 3AVEA 3RWFA 1Q1JL 1OP9A 1S5HB 3K4AA 1RFDH 1F3JB 1N4XH 4JN1L 5GGVH 5C70A 5IQ9B 5FO8A 3BWAB 4HIJB 1CE1H 1X5FA 4HZAA 2DOCA 2GTWA 4JG0L 3HNTL 3LS4H 3QPQC 1JP5A 4YEEA 4X4YB 4OZIA 4JVUA 4Z8FH 1FYTD 5HHXL 2XY2A 4YO0B 3HMWL 5FECA 4LCWA 4PJCB 2HFEA 2CLVB 3QHZH 5I2IB 1QEWA 3FFCE 4JFEE 1UM5H 2J5LC 2BDNH 4PJCF 4QHUB 5LGHH 3C6LD 1NMAL 3O45B 3CUPA 3OKNA 4H8WH 3OKMB 3QH3A 1KB5A 3NH7L 3PXJA 1BP3B 4KMLB 3OJ2C 4LP4A 3TZVA 3L1OL 3TV3L 2BFVL 4EUPG 2R0LH 2C7UA 2H8PA 1KLUA 4OIIH 1UWGL 3O8XA 3LV3A 3MRNA 3O6LL 3BWAA 4QRRD 2Z92A 2NY1C 3QG7H 3O3DB 4JY5L 4UINL 4F15B 1QBLL 4NQVB 5GRVL 4HLZH 4OZFA 3ROLB 3S36L 1BF8A 1U58A 2ADGB 1FZJA 3B9EA 5JR1L 5HHVL 3VWJA 5CJQH 5D5MB 4XCCL 1I8MB 3UO1L 4L8SB 4PJ5D 5DZOA 3MUY1 1KPRB 1F58L 4HJGA 2BHYA 2PYFB 3FFDB 4ZNEE 5F7WC 1U8LA 1PJ9A 4GAYA 4S1DD 5CAYB 1A6UH 1HHKA 5SX4I 1QFWI 1AIFB 2PO6B 4R4ND 2L0DA 1LO0L 2OBGA 3VI4F 3W81A 1K6QH 5T1KA 2R56L 5ACLA 3SGJA 3IJYB 1ZHKB 4WHDA 1XGTA 2QSTA 4F9PC 2EDRA 3ULSA 4QTIL 4G8EB 4HX1B 3ARZA 4LSSH 4R0LA 3QDME 4OLUL 1EAPB 3SKJL 1SEQL 1MFBL 2VXSL 3MBEC 3ZL4H 4YDVA 1P7HL 1SY6H 1NEZB 2CGRH 1YDPA 4LVHB 1LEKB 4MA7H 1CBVL 1TZIB 1XIWA 4MXQC 5GGVY 5BJTA 1D6EB 3M07A 4S10A 2F9BT 2MQ0A 5JOFB 4N0UB 1MHPH 4NO2B 3MJ9A 4QHMA 1EXUB 1S9WB 3WSQL 4F80A 1FFOA 5JNYA 1ITBB 3K74B 5SWSD 4LK4A 2JCCA 4NWTH 3SE3C 2FLRT 5D71L 3EGSA 3V8CA 3TFKC 4EVNB 4OZ4B 1KTRL 3DLQR 2DD8H 2J8UB 2A0LC 1LEKA 3SBWC 3IDIB 3EYQC 4F33B 3L5IA 3RVUC 4JRXE 3MV8D 3UBXG 2EC9T 4I0PD 4MAUL 3Q6GH 5EC2A 3MV9B 1QKZL 1YEKL 3PHSA 3NABH 3UJTH 5FA3A 3CDFA 2XTJD 4U3XA 3ZTNL 1C5CL 4OM1L 3QNYA 2X44D 4DCQB 4M4PA 4Y1AD 1PLGH 1ROWA 1B2WL 1UH4A 4GW5A 1QYGH 3UTSA 5H8DA 5CEZH 3Q2CA 4HG4K 4HH9B 1G7IB 3A6BL 2MJWA 3EFDH 2AQ2A 4OTXL 3TESA 4HFWA 5IHBA 4PRBB 4ZDHA 5FOBB 3UP1A 5T1KD 5C9KA 2VLJB 2DTML 3C6SA 4QRPD 1FYHB 4JJHA 3O4OB 3SCMD 1J8HB 3Q5OA 3RZWA 4GRWH 3OKOA 3HC3H 2WBJC 2NY2C 4JM2A 5SWZD 4W81A 3GSOB 5GRWA 5F88A 2NX5D 4L4VD 3U0PB 1HSBA 1KEMH 1YNKL 3RWJB 1RQ5A 2EDWA 4C55A 1AGBB 3UPRA 4WHYG 5EO1A 3U0WL 5KVEL 3T65B 3RU8H 3GSWB 4NM8L 3KXFA 4FQCL 4U31A 4WTZA 4PJCA 4LSVL 2XV6B 4ODHL 3RNKB 3VDCA 4PJAB 3MCKB 3HG1D 1NGPH 1UQSB 4QWWD 4WVRA 3GMOA 3PHOB 5AWNH 4HEME 1A6PA 5B4MD 4LIQE 4P4KA 2BRRL 5J9PA 3MUGB 4CJ0A 2WINB 4DUWA 5I8EA 1KC5H 1KTDA 3OAYK 3FTGA 4IRJD 3D18A 3X3GL 2GJZA 3N85L 4YR6B 1EJOH 5KSBF 3SDAA 4M6MH 3MODH 3JVGA 2P45B 3EOTL 1NAMH 4YBQC 4NRXB 1QHOA 3IDGB 2LV4A 1JZ2A 2XFXB 3F5WB 2IANB 2AV7A 4KQ4L 1I7ZB 2F5AL 1LO3L 4K3DH 5C0BA 1AD0B 1I7UB 2X70B 2PTUA 4BH8A 4NGHH 3WDIA 1MWAB 5GS1B 5DVLA 3DSNA 3JV6B 2X9XA 5E2VH 4FQIH 3RI5K 1EHNA 1I8LA 4XP9L 2I60H 4GLRI 4YNYB 1Z9OA 1NMCC 1FGVL 4WNQB 3W11D 4MZ2A 1MHCB 5FGBC 4HULB 5CSZA 5C0BB 4JLRA 1NFDA 1S7VA 1F3DJ 1V5JA 3DXAE 3BT2L 3G6JF 5K59F 5CEZD 1JK8B 1U3HC 2MOVA 2IAND 2D9CA 5I71B 5HJ3A 4YE4L 2NR6D 1ZHNA 2QJDA 4Z7QE 5MERB 3EOAA 4XMLL 1JN6B 1ULVA 3RA7H 1MCWW 1JMXA 3JV4B 3JVGC 4NQDA 5CWSA 1TJGL 4Z77B 4AJ0A 2A0LD 3PDDA 1CGWA 1WZ1L 1JNLH 4KTEH 4XNYH 1AXSB 3V5DB 3ECBB 1LNUB 4S1RL 3TZVD 1URLA 2YD1A 1N59A 2H2PC 2H26A 2CQVA 4MB5A 4NQCD 3VXNA 2AJVH 2G75A 3BJLA 4JY4A 5D7LE 3STLB 4UDTA 2FATL 5MI0C 2EZ0D 4Y4KD 1BEYH 2VISB 5HHNA 1C1EL 2IPKB 3MRIA 5BO1L 3NVQA 1OTSC 3HNVL 3W0WB 5CINL 1DE4B 4MNGE 1QR1A 4RGOH 1HSBB 3H3PL 4PUBH 5HHOA 4L4VB 3V95A 1NCAH 4LF3B 5TE6H 5C0GB 1I9JL 1OW0C 1UEYA 2NY4D 2A6IA 4CVXA 3I50L 4X4ZA 5HHOE 1JF1B 3L3JB 5L2KD 3S37X 1YY9D 3NZ8B 2X2YA 3T3MF 5CLWA 4JPKH 2N4IA 4FQ1L 5GISH 3GMMA 2FJFA 4CNIA 3QI9D 3TZVC 5KVGH 2ICEA 2H1PL 1N6VA 1ZT1B 5HVGB 2DJ4A 5DMGC 1ZHLA 4DKDC 4FP8H 5CEXA 1LE5A 1BIIA 4L8BA 4MLIA 3VFRB 2VWEE 4XBEL 4DAGL 4CRPA 2F53D 2HWZL 4FQJL 4MHHI 1UZ6F 2BSED 2ZUUA 4YHZL 4JDVB 1UFUA 3T3PE 1UG9A 3H9SE 4XVUD 3DGCR 1WTGT 3CFBB 4QOKA 3W9EA 4LARH 3MA7B 4J3XA 3RJQB 1HSAA 3HI5H 5JQHC 1WWAX 3MROB 5D7IF 1RUMH 3UXFA 1TQBB 1Q9LA 3AMKA 1DQDH 3H9SB 1A7BA 4U7MA 1LK3L 4F37K 3TFKD 3ULUH 2KL6A 2XKUA 2BOCB 4YFLF 1JGLH 5CZVL 1MI5E 5E08H 3O41B 3TNNB 5T1LB 5TQ0L 3C8KB 2E27L 5TF1H 5DUMH 4LVNB 1GPOL 5EFIA 5K59E 4HKJB 3AAZA 1KBGH 4HKXB 4G9FB 4PV9B 4QGTA 1VKXA 3ARGC 2B1HL 4Z7QF 3D2UB 2IG2H 4IS6A 5GRUH 1MNUH 2J8HA 3D0VA 3MV9D 4M6OH 2R9HD 1PX3A 5IMKA 3SO5A 2BSTA 1HCFX 2R1YB 3WJLA 1CDCA 1YUHA 3PP4L 2BOCA 3U9UA 1YQ2A 5IQ7L 3LN4B 4O2CA 3C08H 4PRHB 4OLVH 4MCZB 2Y1VA 4L8SA 2ZUYA 1DQLL 1NUGA 4YBLB 1TVBB 5DJ8B 2ESVB 3GJFH 2EDBA 3QXAB 4JFYA 4LAJH 4XP6L 1MUJB 5I1JH 3DARA 2CDFA 4QKXB 4PRIA 4NQVA 4A6YB 5GGSY 2FIKA 3I9GL 1AH1A 3TBYB 3HFML 3FB7A 3VFPB 2XI9A 1ZHBB 1VSCA 1EUTA 1S78D 2GUOB 5I1IH 2GAZB 5I1EH 2WBJD 1LK2B 3GI8L 5A3ID 3MRJB 4LHUG 4Q9BA 3QRGL 3S5LA 5C0RL 5HYJE 1UCBH 2DMBA 1V3MA 5D70L 2A6JB 2X1OA 3MCLL 4JM4L 1T0NB 5DVNA 4QHUA 5IV2B 1GZPA 3UTTA 1QPXA 2B4CH 3GMRA 4R3SA 3RFZC 4PRID 5JTWA 3WNLA 1E4XI 1RIVL 3JWOH 5C8JA 3PQYB 4FQQA 3BYTA 25C8H 1LMKA 4NKQB 2R4SH 3OG4B 1WC7B 3DX8A 3ZO0A 4TNVK 1LE9A 1G9MC 4I13B 1LO2H 3V0WL 3P9LB 2HA1A 4HGKC 4IRZL 4Z7VF 3RY6A 3VFNB 4W4OA 4PJEF 4DOHE 3L3GB 1BIHA 5IBTL 5E99L 4JZJB 4D3CH 1ZLVH 1OB1A 3QUYC 4LLQB 4WI9A 2QBWA 2OL3A 3QJFA 1N26A 3WIIL 1WIOA 4Q0XH 5DHVB 4J23A 2AK1L 5DDHB 3D39E 3U4AA 3ARGA 3B5GA 2X42A 3GNMH 4KKAD 4HXBH 1CXLA 2WK2A 4M3KB 4M61A 5C08B 4MJ6B 2WMPA 5F96L 1TETH 5C0JA 3EHBD 3WIFA 4R4BA 1ZV5A 4RGNB 1U8QA 4S1SH 1VFAA 2X4UA 4YGVB 2V6HA 4HWBL 5JHDB 1BD2B 4ZAKA 2P46B 2F15A 2G2RB 1H8NA 4U33A 1KELH 4ZFOA 1T66D 3B2VL 4XWGL 5ID1B 2ED7A 5EO9B 4TN9A 5BXFB 4PJHE 2Q3AA 8FABB 1NCNA 3G08A 4K55A 3SGKC 4WO4D 5K9OA 2KZ1B 3O4OC 1UCTA 3U9UB 3EUUA 4ACPA 1BQHA 2BSSB 3GSNL 2BVEA 2W91A 2ZJSH 2DKUA 4MNGB 4P2OB 1IQWH 2X4QA 1TETL 4L4TB 1MF2L 5GS2H 1F5WA 2X70A 3O4LD 4NC0B 4UBDC 5EIVA 4BH8B 3MRQB 1KIQB 1TZGH 2DM2A 3P4LA 2OK0H 3T2PA 5A2JH 3MV11 3GRWH 1W72H 5FYKH 2XFXA 3F5WA 4ZG1A 2XQYG 3DWTA 1UADC 4L5FL 2GJ6A 3C8KA 5FCSH 5GHWL 5ISZD 1SMAA 3AREB 4BFEA 3O6FA 5E99H 1S9YB 2CK0H 1JNHA 5I73C 3FQUA 5EPMB 5IM7A 3KVQA 4XVJL 4LU5H 1NUDA 3CFJA 3GI9L 4J6RH 3WDJA 2PW1A 3D39A 1IM9D 1IKFL 1I9IH 1EZVY 3HUJF 4CMHB 3MO1B 4CADB 3NPZB 4ODWA 3ARTA 2GTZB 2EYTA 1CXKA 5IESL 2F8XC 3LN5A 1M05B 2OX5A 12E8H 1T22A 3IDXL 3QIBA 3QUML 1XF4B 3MA7A 3W9DA 4GMTL 3ZE0F 3CFBA 1FL6A 4OJFL 3OBAA 5EBLA 1JUFB 3MLXH 4GW1A 3C8DA 1W72A 4PB9L 4PY7B 2Y5EA 1PY4A 1IGFL 4QHLB 1T2XA 1GGCL 3RGVB 3RWJA 3NZHL 1P4IH 2GYSA 3LB6C 3GRWL 4N5EC 5GGQL 1P2CB 4J2XA 2JJTA 3FKUS 1MF2H 3SEPA 5DC0A 4GAGL 4LKCB 5IEKB 4JEGB 3SY0B 2BVOB 3U1SH 3V0VA 1BMGA 2JK5B 1F42A 3D25A 4RFOL 3VCLB 2YPKA 2NY6C 1AI1H 1SYVB 1DQLH 1BX2A 2EEDA 2HKHL 2YPKB 3V7MA 4LGSB 2I9LB 4Z7VB 1RZKC 3SOBH 3VFMA 3UTTE 1U8PB 5B39B 2KH2B 1NFIB 3GRWA 1M71B 3ZKXB 5C0GA 4M00A 1SMOA 2FEEI 5KSAD 2VLME 4K3JH 1U8HB 5IKCA 3RDTA 3HZVB 2ZG1A 1W72L 2AVGA 2NY4B 5EU6E 5FYKL 3O6FB 1DE4A 2AJSL 5D1QB 3R8BB 3ROOB 4JKLA 1R0AH 2GJ6B 1ED3B 3BEWA 3INUH 1I3GL 5D1XD 4PJGF 1NLDL 3F7YB 3PWLA 1RIHH 1OQXA 3KPNA 2R2BB 4JY4B 1JVKA 1OD9A 2V2TB 5LGKA 4NFCA 4NZDA 1NSNH 1KTLA 3Q3GB 4Q0XL 4KMTL 2YN3A 4PV8B 2Y36H 5FK9A 5GQBA 4LLYB 3GZKA 2WSKA 4JREB 1BZ9A 1PYWB 1DQDL 2WBKA 1D5BA 1G7PA 4N68A 1MCIA 2H9GA 4IRZH 1A4JA 4FXLA 3TWCH 1BQUA 4APQD 3SDXA 4TULH 4TUKL 1NBVH 5IMLA 2RGSA 2AEQH 4I48B 1I8IA 4FQJH 4FXGA 5A43C 2HWZH 4QRUB 1RMFH 4IOSD 3GSNA 3FN3A 4WDIA 2DJSA 4HUMB 4ZO9A 1VFOA 3WUWB 4ZUWB 3MRRA 4NZJA 1S9KC 5DMGD 3DIFA 4AZ8A 5I1KH 1XH3A 5F89B 2CDGB 3WIFB 1FAKT 1FJ1A 1AIFA 1MCFA 1PFCA 4DW2H 1CXHA 3VFOB 3UDWC 2BNQD 4WFGE 1H8OA 2W0FA 4GAFB 1RURH 3ARGB 4HJGB 1K5NA 1I1YA 4LRIA 4RGMC 5MHSD 3HPLB 5EZOH 3MBEA 5BXFA 4MXWL 1KPVA 5D5MA 5DRXB 1IJ9A 5BRZB 1HWHB 4WTZG 3N9GL 2EE3A 4X7SH 4WUKH 4XPGL 2OMNA 5KSVA 4I2XE 4NYLB 2AABH 2VMFA 3LKSB 1LE9B 2HAZA 4IRJB 3ARDA 2QQKL 4PJHB 3CPLB 5D1ZA 2VDKH 1U8QB 3OWEA 1RUQL 4JFQB 4LRIC 1PZ5A 3GSQB 4P9ML 5ACZB 4WV1C 5ILTL 4QY8B 3WL9A 4ALAL 2A83A 1CDJA 4MXVF 3VXSB 5F7EH 3GSQA 1IGYA 3OKKA 2AJVL 2ED8A 3F62A 4DGIL 5HYEA 2A6JA 4JO1L 1NFDF 4ONOA 1BQSA 4LLQA 4H0IA 4UBDD 5GGSA 4UAOC 2XOTA 2VDRH 1HINL 4NKOB 3PIQB 1KUMA 3SJVE 4I0KA 3TO2B 3U6RA 3H9YA 5HGBB 3MNZB 5L0QC 4R97B 1GRWA 5GRZA 3RA7L 1ZKAA 2L7JA 4FTVA 4FTVD 1SVZA 1VADA 3V7AG 5C0EB 1A1OA 2XICA 4R26L 1SJEB 3DHJA 5EU3A 1G7IA 1A6TB 1PX4A 3WJJA 5BRZD 3RKDD 3B3IA 1QNZL 4D0DA 3MRLB 4WHCA 1Y6NR 2YPLD 3IFLL 2BNQA 3LDBC 4YXLH 3IJSB 4TRPH 4IDJL 4XRCB 5I75B 1IGTB 3O2DH 4I4WA 3IVKB 4TVPL 3T0EE 3LS5L 1QSVA 1XT5A 4QF1B 3WO3B 5TF1L 3VFSA 5MEND 4IDLA 2VSDA 5EBMB 2VLKB 5KW9H 4X7CC 3FQXA 1XEDA 3V7AE 5D6DC 4KPHL 3TYFA 3QIWB 2F54B 4HLZG 3VWJD 1FCCA 1AKJD 4JY6B 3S97C 5DEZA 3BPCA 4LLYA 2X41A 4W68A 4Y4HB 1T7YA 4OQ1A 4QXWA 1EHLH 1J18A 2XPGA 2ZOLA 2LABA 3QEGL 5SV4A 1OQOA 5EA0H 5LCVL 4XHQA 3RHWK 3T0DA 5SWSA 2CUIA 4AEHL 4R4FH 4XVTL 5F9DC 2HT3D 3WKML 4CU7A 1I9RH 2IBBA 1RZKL 3E3QC 3MZTA 3EJJX 4U6HA 1LP9A 2OTWA 4D8PA 2EICA 4FNLL 2H1PH 5FGSA 4KK8D 4XCEB 1E28A 3DTXA 5DRZB 4TPRL 3HC3L 3BGMB 1XGYL 5DJCA 4LHUB 3DROB 4Y4FA 3BZ4B 2ATKA 2VR4A 2O5XL 2YK1H 1MJ7H 3EYOB 1T21B 1YY8A 3KLHC 3RWCA 3RWDA 3ZDYF 1RI8A 5IJKC 1AP2A 1QYGL 2CPCA 1B2WH 5HGBA 1T5XB 4Z7OE 5JZ7C 5CINH 4KI5D 3U36B 4XT1C 4OZFH 5DD0L 1W2KT 3ALXA 4LF3A 2ZG2A 2C7UB 4MJ2A 4F8QA 1T4KB 2DDQL 4HUUA 4HWZA 1DUZA 1SEBA 3K80A 1BIIB 1QR1B 3ARPA 3BKCH 2W9EH 3BH9B 4J4PC 2ICEB 1T04A 3BP4A 4YQXL 5T3XE 3OJDA 1NLBL 2K7PA 3OHXA 5IROA 5HDBF 2BNRE 5IFJA 1UWEH 2VISA 4G5ZL 1FH5L 1F4WL 2W0PA 1XF4A 3ULVH 3BDYL 1BAFL 5D6CA 1XGRA 1JPFA 1ZS8A 2JJSC 2VDOH 3IFOB 5E2TL 5CJXC 3ZKNC 3ECBA 3PWNB 2DYPB 2PW1B 1JF1A 4OZHE 4JAMB 4HIEA 1A4KB 3REVB 2YUVA 3RP1A 1MHPL 3D6GA 3NGBC 4FQLH 4FFVD 1QPPA 8CGTA 4NN5B 3IFPB 2YHGA 5DJYA 3DUUB 2CGRL 5IMMB 4HHAB 3WO4C 4UIMB 3TIEA 3MRGA 1SEQH 4RMTA 3EOBB 1FGVH 3IDYB 2CDEB 2ERJB 1AGDA 3WS6A 4J4PA 5E1AA 2YRZA 3IETB 5DYOA 5J1AA 4EIGB 4V1DE 4D9RE 2A9MH 3R06A 2H41A 3OL2A 4OF0A 2F5AH 3U46A 5DWUH 4R96B 4NM8H 3WEXA 4JFFE 3G6JA 1EK3A 3BPNB 4O51B 1EZVX 2HT2D 5GGTH 3GBML 4NQDB 1B90A 5CWSB 4M6ML 3NCBB 1YPZE 1S7XA 2WWMC 4F57L 43C9B 4GG6F 3GBNL 2H9GB 4NN6B 4H0GA 5DRWB 3VGGA 3RJDA 5KW9L 1WAAF 4CW1A 4JFPB 3T09A 2EIZA 4YFLI 4LLMA 2D7TH 1NC4B 3H9ZA 1P7QA 2N56A 3OXRA 1OAKL 1PVHA 1QO3B 4G6FD 4JPIA 4P4KB 4WWKB 4FQCH 3OAYH 3RNQB 1FNSH 3CAFA 2Q76A 2VQ1B 1AD0A 3VG0L 1FLRH 2VDLH 3H7LA 3DV4B 3DVNA 5D96C 3EOBA 4YWGL 3MUZ1 4N0FA 4HWUA 1C5CH 4OM1H 4P57B 4PJ7A 4DVRH 4NRXA 3QULA 5DJYB 5CS7A 3RY4A 2EDOA 4JRXD 3TBSA 3AUVA 3HNTH 3LS4L 2XNAB 2QSCL 1DANT 1HEZA 3ARYA 4I9WD 3QDAA 4NZTL 1MY5A 4GG6A 2QHRL 3ULVC 3VGDA 1NFIA 3E3QE 1CTOA 1N4XL 1G9EA 2JIXD 2AJXH 4OTXH 1FZOA 5ABDE 4P46B 1W0WA 3BE1L 4MB3A 2HFTA 4JB9L 4PJ7E 1FBIL 1DQMH 3OPZL 3WSQH 3VXMD 5JORB 3PGCB 1LO4L 4J3UA 2VLRE 2EE2A 3GIVA 3QUYD 3QEUB 3QWOA 4K2UH 2LVEA 4HH9A 4JFHE 4KUZH 3K8LA 4NM4L 4ZOCA 4M3JA 1BHGA 5KTEH 4G3YH 3QDGA 4XVUC 4ORGB 1J05B 1TCRB 2RBLA 2W0KA 3U0PA 3ZL4L 2EDEA 4G9FD 4APQB 3I2CL 3TPKA 1OTUC 3B6SB 3V5HB 1ZHBA 5BMFH 1R3LA 2YEZA 3VRIB 4XC1L 2DL2A 5C9JA 1R6VA 3VXUE 1S9VA 2A9NL 5FCUL 1UZ8B 3BN9C 4F33A 3WN5C 4Z7UA 4N9GB 2GTZA 1TVBA 1X5AA 4X6FB 4F7PB 3L9RB 4GRLA 5IIEA 3PWPA 3MOBH 2CKBB 4FS0A 4E42A 3BKML 4PG9A 1VCAA 1KCUH 4XCCH 1T1XA 3PG2A 3MA9H 4J12A 3DSFH 2HTKD 5ADPL 3NN8A 1NKRA 1M7IB 1MFBH 5DFVC 4M4RA 1EO5A 3MV9A 2HLAB 3B9KA 5F7LB 4Z7NE 3O11A 4YDVB 1I1AD 4HKJA 4QXUH 3V6FA 1GGUA 2BMKA 3GMQB 4Y19A 4BYHA 1QA9A 1R3JA 5FHBH 1D5ZB 1YYLL 4GG6E 4OKVB 4PJIA 5JO5B 3REWB 3QAZC 1LO0H 1ADQL 1EJ6A 2GEEA 2PYEE 3O3AB 4GXVH 2AJYH 1HKFA 2X4RB 3BH8A 2BCKA 3O3BB 4QTHA 1EBAA 5C0IB 1FFOB 3FOMA 3RZCB 4IRSC 4ZD3H 1CL7H 3V8OA 4KGLA 5ISZB 2HLFD 4UMGA 5T33L 4PTUB 2LAAA 3VA2C 2Q8BL 1VB9A 4ZO6A 3S36H 1YMHA 1G7LA 1KPRA 2AK4D 4Z8FL 4WUUA 1J1PL 5BJTB 5T1LD 3E1F1 1F6AB 4LCYB 3OAZK 3VRLE 3MRPA 1ZLUK 3KJ4C 1ZVSA 3PDOB 4FQ2L 3MJ8A 2CXKA 4ZAKB 3LN9A 3SDDD 1N0LA 1NMAH 4IRSB 1NQBA 1HH6B 1I4FB 4J3OC 5DS8B 1L0YA 5GJTH 5SX4H 1E6JL 4X9HA 3S98A 3TJEL 1AO7E 2A77L 1MPAH 4KVNL 3RIAK 3KPSE 1FRGH 4LMQI 3SOBL 4EN3B 3QQ9C 4LCIH 4X99B 3C8HA 1F6LL 4JG0H 1I8MA 4Y16D 4YDLB 5J1TC 4R7NB 4KQ3L 2D7OA 1CFTB 4YO0A 4J3SA 1C8PA 1FHGA 3C5ZB 5DD5L 4MMXC 2ZWLT 2OP4L 5DEFB 3IS0X 1NMCB 2ENYA 2IQ9L 3UBXA 2ZPKL 1HZHH 5IP4A 1L6ZA 5GGQH 5HI3D 4N5ED 4N0RA 2W9DH 1LO5B 5CCKH 4O00A 2P8MB 3RWEB 3PDGA 4NKOA 1E27B 2ZPKH 4GQ9H 4NUJB 1U91B 3NZHH 4DFIA 3UTZA 5I8OH 2AGJL 2C3VB 3IGAB 1ITCA 4KQ3H 2DWDA 3T0VA 3TF7C 1DDHA 2XN9A 3OV6A 3UC0L 2X1XR 5GSRB 2ZSVA 1IC4L 4OF7A 1YMME 1Y0LB 2Y23A 4JPIB 4IRJA 1P5UA 1R3KA 4UQ2A 1JGVL 1ZLVK 1U6AH 4EXPX 2MWCA 1NFKA 3LKOB 5JW4N 2X05A 5DQJB 4PRIB 3LOWA 3I3EA 5EIIB 1KJMA 2H2SC 1KPVB 5EZIL 4POYA 1ZHNB 5KAQG 2IADB 4JFOA 3FOLB 4K3EH 2NTSP 5KVDL 1ZLSL 2BY0A 4MS8D 43C9A 4TVPE 2NY1B 4H5SB 4RZCA 3E6FB 4JKWA 4WEUD 3GUTA 2DQJL 4PRAB 3VFGL 5EN2B 2E5EA 3QEQE 2OLDA 4ZUWA 2E7LC 2R0KH 3QHFL 1IZJA 2JELL 4MAYC 4OIBA 4U1MB 5ICZA 2R0WH 3RAJH 4RISL 3FB6A 3AU1A 1JWMB 4ZOBA 5E1AB 4Y4HC 2B0SH 1QFWM 3U82B 2DQIH 1FORL 2MTPA 1IGIH 5HXMA 1WFOA 3MXVH 5FDYA 2AEPH 4DGYL 5GXBB 5C3TA 4RDQF 5F9WB 4BZ1L 1IKNC 2FX8H 5SWZB 2DBLH 3E8UH 1JV5A 2W65A 1JBJA 4WWKC 3ESVF 1IFHH 2WUCL 4C83A 1J8HD 4HEPG 2YD6A 1FNHA 4POZC 4YPJA 3ARDD 1GGBL 5KG9A 5E8NA 2ZUWA 1AD9B 2AKRB 2NY0C 1UC6A 1MREH 1Q9LB 5JW4R 5EOCH 1CDHA 4I0PA 1R24A 5D6CB 4NQEB 1U8OA 5T1DL 4HCRA 2FX7L 1U8JB 1HSAB 2I5YH 2PTVA 1YMMD 5IFJB 4EXKA 4WFFD 2DI7A 3ES6B 1C5BL 2DWDB 5IB5B 4X6BA 5F9AC 1I8KA 2VLLB 4G80A 4K94L 4D3CL 3ELAT 3FHQA 2ZG3A 4HS3A 1R3HB 5B4MC 5I17A 1I1AB 1FG2A 4TYUA 3D3VB 1YEJH 5HGHA 4HUVA 2FHBA 1G9NL 4JM2B 3V9FA 5FUOL 3TVMD 1WITA 3MV7E 2GJJA 1N8ZA 4DUXA 1MAMH 2AV1B 4F2MA 3CXDL 1FO0L 2FGWH 5F1IA 1BX2B 1YEGH 5DUPL 5IHLB 1P1ZB 1YEHH 5DVOA 3WFHB 5GSVA 2APTA 3FJTA 4KAQL 1FPTH 4RAVB 2WIMA 3UTSB 3CFDA 3GJEB 5IHUH 3QUXD 1DVFC 2UUDH 1ACYL 4NUGL 1L6XA 3K46A 4NBXB 4DN3H 4R4NC 3DRQA 1HH6A 1I4FA 4C4KO 3ZYOA 1T83A 4JDZA 4XXCC 1RZFH 5E94B 4AMKL 5H37H 1UWXH 1WF5A 3ULUF 3R0NA 5E9DB 3MRPB 1NEUA 1XCTA 4KKBC 1Q0YH 1SJVA 3VXNB 2FSEA 3P11H 3OAUH 4FRWA 3BO8B 3BEVB 1Q8MA 5CMAB 4UDUB 5BVJB 4PTUA 3CFJB 3S4SA 4XCNA 4J8RA 3BIKA 4FXKB 3RUGB 4F7EB 4YDKH 4NO2A 5E6ZA 5GIRB 2Z8SA 4E41E 5E2WH 4OLXH 2IALB 3RWHB 2VLMD 1T03L 1XIWB 1RZGA 2WLZA 2Z0BA 3T0EB 5CGYC 3GBNH 3GMQA 4NQCB 1NCBH 5CSZB 2OZ4L 3VFSB 2XZQH 5EH1A 3BDBA 5F1KC 2MSPA 4NCC2 1S3KH 4HSQA 5F1NB 2EDYA 4UOW0 1TIUA 5D93B 1N0XH 3IJSA 4ELKA 1KJ3L 2W59A 4KVCL 5CZVH 1FDLH 3B5TA 3ARFD 1BQHB 3CJJA 1KT2B 4UB0L 3IT8D 4D0DB 2I07A 4P5MB 1UB6A 3T3ME 4E41B 2PN5A 2YC1B 4OFDA 1RVFH 5T3XH 3EW3B 1DLFL 4MA1C 4GJTB 1LVEA 2ARJA 4LBEB 1WEJH 3QUZB 2QKIB 3VRJA 5AD0A 1FAIH 4OIAA 4L8SC 4U1HA 2PW2A 4NZUH 2UZIH 2NMSA 5C0BE 1CLOH 1I85A 3MV8E 4FFWD 3PGDA 4OZGE 1XGQB 2R23B 4EUPH 1X7QA 3B6SA 4ZS7L 3S34H 1DBJH 5HHME 4OT1L 3P0VH 1UZ6E 4YPGA 5DMIL 1VA9A 1BBJA 5GGRY 3MLRH 4LOUC 5GRVK 2Y07L 4Y1AE 1J10A 4X6EB 1Z3GL 3D3VE 4RWYL 3MCKA 2HVKB 2VH5H 4HGMA 3C87A 4UTBL 4IMKC 2Q86A 3MLVH 1BGXL 1MCWM 3T8XA 5D2LE 2OS7A 2HVKA 5JORA 2NY1D 4N8VB 1HXMA 2EYRA 3DGGA 3QEQB 4GOSA 1N7MH 2HT4C 1FVCB 2Y72A 2NR6C 2DAVA 2N1KA 3ZYJA 3J8F7 4QYOB 3KPSA 4Q58C 4HQQL 4L8DB 4DQOH 3C60A 4M62L 1D9KD 5KVMC 1R3IL 1JPTL 1OCWL 3QDMD 4QRTB 5I75C 5CGTA 5M95B 5HY9B 3W39B 3RIAF 4YDLC 3GSRA 2C1PA 1QD0A 2EH7L 3QO0B 4OI7A 1A9EB 1R3IH 4PTTA 3F58H 4L3AA 2IF7A 3DGGB 4U1KB 1Q9WB 1HHJB 4NNXB 2EEBA 3D69A 3I02A 4N0CC 5D7JA 4MGXA 2HFGL 2EZ0C 2JTDA 1KTKE 5ICXB 4F7MA 1BQLL 2W38A 3S3JA 3KAAA 5DD3L 5DGQA 2IH3B 5FUZH 2NY7H 1FJ1B 1DR9A 4BZ2H 1QSFD 3L3DB 1BVKA 2GQHA 4S1RH 1DVFD 2QTEA 3WUWA 1GC1C 1A2YB 2CR3A 4JG1L 3DOSA 5FA4B 3F58L 3UROR 1P9MA 3QUMB 3SDYL 2EKSA 1JGUH 3I6LD 5IMLB 2AS5M 1KNOB 1HKLH 1YA5A 2YRPA 2OZ4A 3SQBA 1A4JB 3KPPA 3ME0A 3NIFF 3BFOA 2J8UA 4GKOA 1CIUA 3O2WH 2XWJA 2IALA 1CLOL 1U92A 4KMQA 3BKYL 5EA0L 2UZIL 1BBDH 1HI6A 1EFXD 3BDXA 4CMMB 2PO6C 1SYSB 1OGAA 5JNYB 4MJ4A 4O5LL 5FGCE 1CK0H 1FQ9C 3T2OA 1YUHB 1PSKH 3ZE2E 5JW3L 2KZWA 4MJID 4HWEL 2I60L 3MXWL 3ARBC 3FONA 3B5HA 4ZXBC 3S35L 2ZCLL 4RWYH 4QT5A 1D6VH 4G6ML 4JFDB 1FV1A 4WY7H 4QRSA 1FNEA 3S3SA 2ICWA 3AAZB 4ZAKD 3N06B 1TTFA 4Y4KC 2Z35B 5E6IA 3U0TA 5ALBL 2X40A 5B21A 4JDZB 4P46C 4IM8A 4PLOB 4NKIL 3P40A 4FMKA 4Z7VE 5ADOH 5T1KB 2QHLA 1FAIL 4MA1B 1TZHB 1FNGB 3FQWB 3RIFF 3N1FC 3MJ6A 3BP7A 4E42B 1A4KA 1TNMA 3VJ6A 4RAVA 3QFJD 4M1GL 5IMOA 3B9KD 5AZ2H 4JQVC 4YDKL 1TJHL 5JIHA 4YIQA 3TH4T 4OCYH 1BFVH 2O5YH 4AL8H 1Q9OA 4M5YH 1CD9B 4LSVH 5ITBH 4KVCH 1N0XL 4JPVH 5K33A 4DK3A 4I0PC 2YKLL 3FB8B 3CVHL 3QYCA 5D2LF 5FGBA 4U1GB 1UH3A 3CNKA 3O6ML 4DWHA 1DBBL 5HDQH 1KEML 2NXYC 4HH8A 2YR3A 5JXAL 1L7IL 4ORGA 4DFHA 3RZCC 1PAMA 3OKNB 3MLUL 4KUCD 2C9AA 4HIIA 1KLGA 1FL6B 4N0YL 3CIQA 2QQQA 4RIRA 3CLEH 2GK0B 3LRSB 5C0DB 1S7QB 4QRQA 3K8MA 2FD6L 1YNLH 3HG1A 1P1ZA 1QFHA 3DMMD 4UU9B 5EUOE 1RUQH 1T21A 3HZYB 2RQ8A 1MCKA 3TIDA 5IMOB 2NY4C 4ODVL 3TJHD 1FO0H 5HGHB 1HYSC 2JJWA 1P5VA 4OD1L 3X14B 5SWQB 3N9GH 4HZLA 1N6UA 2APFA 2NTFB 3BHBB 1J1OL 1EUUA 3VE0B 3DMMC 3VXUD 4QRPA 4ZFZA 3HI6H 4XMKH 3UTQA 4OF8A 4U6XA 3EIFA 3NFSH 1V3JA 5TQ2H 4DTGH 3EYQD 2OJZH 4Z0XB 2P47B 3SE4C 1MCOL 4XAKD 5KSBB 2G75B 2EO1A 3QEHB 3QUYB 4U1NB 1P7QD 4IOIB 4NHUB 4KAQH 2I5YL 4XX1G 4JREC 2P43B 3JWDC 3LIZH 4G8GD 5IVXF 1LNUA 3SQOL 1QSFE 2YBRA 4PGEB 5IWLC 5I8KH 5GZND 2VZTA 4WTXA 4EI6B 5T1MB 2VLRA 1KCSH 3QNXB 4PJEB 1U92B 5F7FA 2DM4A 1H3XA 3QQ9D 2V5SA 1GZQA 1BWWA 5TH2A 3NCJL 5MEOB 4Y7MA 1EBPA 4Y2DA 2VXSH 4PJEA 1I7RA 4OCRL 3GB7A 3RX5A 4BZ1H 3DURB 5EBMA 3MLWH 5L7XH 1Z2KA 2Y36L 2FX9H 5TFSH 1ZGLB 5D7JD 5DJ0B 1FORH 5T5FL 1J11A 2HN7A 1KB9J 2BNQB 1AC0A 3EO0A 3P4OB 5GS3A 1O7SA 1MRCH 5C0JB 4NQDE 1NGZB 3KR3L 3ZDXE 2HJKA 1A6ZB 1HH9A 4UT7H 3SKMB 3VI3E 1A1OB 4ZTPH 1C16A 5C07E 3TO4D 3QO0A 3ALWA 1INEL 4PP2B 5IG7B 4NNYB 4TSCL 4JZJA 2BX5A 1DP0A 4ZMAT 3L3GA 3U7AA 5C0FA 1UWGH 1J0KA 5FF6A 3VDAA 3K8KA 4M7JH 3L1OH 5ETUA 5J13B 4K8RH 3EJZD 4MAYB 3VH8B 1JPFB 1ZS8B 3NH7H 1RPQA 1MCLA 1YJDH 2A74B 1OAXH 3HAEH 5DMKA 4FQQB 3GMOB 2Y9RT 5B38A 2R0WL 1B6UA 4XNUL 3RVXD 4QO1A 1FNFA 3VXSA 1PEZA 5KSUB 1A6AB 5DFVD 3U1SL 1KLGB 3CFKB 3HMWH 3S4SG 4R9HA 2NCMA 3QA3B 4HG4J 1Y18A 2HT2C 3BKJH 4D9LL 5DS8A 2YD8A 1WZMA 1LK2A 2A1WH 3LKNB 4MNQD 4U1IA 5DJ2B 4NUGH 2B5IB 4ZFFB 1MFEL 3MLXL 5GS0C 3SE9L 4OJFH 3M8OL 3I6KA 1FPTL 1WWWX 4U1HB 1CFTA 2JJSA 5KSBE 3S7GA 3UEZA 2VUYA 2VZVA 1JPST 3JUYA 3PF2A 3CFEB 1VDGA 3DXAA 5F44A 4PBWD 3BMWA 1MAML 5L2JA 1IM3A 1IKFH 1B4JH 2Y25A 1IC4H 3BGMA 5DRNB 2GKIA 3P30L 1S9XB 5DRZA 5C7XL 5EWIH 4Y4KA 5E8EB 3THML 1RAMA 3QI9A 3STBA 3TJEH 5DMYA 4FXGB 3O3AA 1ND0B 1CFBA 2E9JA 5E7FA 1FN4A 4PJ9B 2Q7YA 3U0TB 3HC4L 4KKAC 4NRYB 4IOFC 5CUSH 4ENEC 3AM8C 5IW6B 5ANMB 4U1GC 5T1DH 5I30H 5L8KB 3WUZA 4P2QD 4N8CH 4XPTL 3U48A 3KYMA 4PRPA 2X4OA 4Q6IA 1FSKC 1S9XA 3JUZA 2WP3O 1OLZA 1GAFL 3H3BC 5DRNA 1KENL 4NPYA 1BWMA 4MNQB 4WTWA 1HHIA 2AXGA 4Y5XA 4N0UA 2IPUK 3PGFH 5KOMC 3IB4A 3L9RA 2V2TA 2NZ9D 3ZSSA 1CL7L 3F7QA 3DXAD 1J7VR 3GM0A 4XTRD 1CR9L 4J3VA 1R3JB 1SM3H 1F3DH 3ZDXF 1J0ZA 2MFNA 5D2LB 2D03L 3STZA 2P8LB 1X4ZA 3O11B 1LHZA 1J0HA 2IGFL 5CBEB 4BQBA 3V5HA 1YYLH 3BIBX 5DA4A 5AZEL 1WGOA 3RL1B 5TE4L 4P5KB 3WD5L 5LXGH 4Z6AT 3GBLA 2HG5A 4PRNB 2R2EA 3V5KA 2VNCA 1RK0A 2DLIA 5C0CE 1AHWC 1D5IL 1VEMA 5D7LB 5L2JB 2F58L 1AJ7H 1F90H 2AJZB 4Z7VA 1ZA6A 4PIRF 3EYVB 1A7PH 3PGCA 1RULH 2RR3A 1DN0B 4H25A 4Z7UB 3VWJB 3MOBL 4LVNC 4NO3A 4Z95L 1LEIA 4WO4A 1SVCP 3SDXE 4E5XB 4RBPK 2BP3A 3D25B 4PGJA 1G84A 5ALCL 1H0DB 1YQVL 1TVHB 2CXGA 4ZFFA 4B0MM 2KKQA 2J4WL 2IH1A 4OD3H 3L5JA 3QDMB 4JANB 1R5WB 4MCYA 3P9MB 4I2XA 4X6DF 3BP5B 2I27N 1T20B 1CVRA 4FABH 1NMBH 3BIAX 4NQED 4Q2ZB 3NCYS 4RFEB 4OQTH 3B83A 1AQKH 3GIVB 1O0VA 2DQCH 1KCUL 3OR7A 4HC1A 1N6QH 1WQVT 2CLRB 4TVSa 3IFNH 4MDJB 4OUOA 4P49A 5DJZB 4X6EA 2C3WA 5D1ZB 2ICES 2AGJH 4NN7B 5CFHA 2GTWB 3MGOB 4O9HL 3OXRB 4W6YB 5TE7H 1HDMB 5GJSH 3HG1E 4JZJC 3CD4A 4X98B 5B3JF 4H20L 3V4PL 3RTQA 4WIQA 2GSGA 1QRND 3LRGA 5JOPD 3RL2B 3BZEA 4XC1H 5BRZA 3I9GH 4JFFB 4N9OB 1KULA 4OFYD 3RY5A 4JJ5B 3LZFH 3QULB 3HKFA 4FTVE 5ISZE 2QSCH 4XHJD 4Q6IC 1A9BB 2EXWC 3QUZD 4WV1A 1JPSH 5E9DE 4LVEA 1FL5A 2FDBP 1MHCA 1QLRB 2D7PA 4RQQA 4W6XB 4PLJD 4C54A 4DGVL 4K2UL 2X4QB 5L8LB 4R96A 5J11B 1MCCA 2DQGL 4U1MA 1JPGB 5F93C 4X7EC 5EOTB 3OPZH 3L6FA 4J3WA 2IG2L 4HPYH 1RHHB 1N5AA 1ZVHA 3RVTD 4LIQH 2B39A 2HJLB 3I6LE 3QEQD 4LPXA 2ORBH 2WIIA 4EUPB 5J6GA 1D3CA 2O26U 4FG6D 4LLUB 2H2SD 1YEDA 5IMMA 3DRTB 1KB9K 2KPNA 3A67H 3MFGB 3GKZA 3MLZH 1YEEH 2C5DC 4Y19E 2CUMA 4XCNB 3FO9A 3PWUA 4LSUL 4MQTB 3C09C 1IILE 5T33H 1KTLB 1Z9MA 5DR5L 3PL6C 1HYRC 5HHPB 1C08A 3GBMH 4UQ3A 3BO8A 3TIDB 2YS4A 4PRHD 2Y5TB 4WGWB 2DKMA 2P5EA 4HPOH 2MHAB 1YECH 3QFDA 5DWUL 4JFEA 1KN2L 1OAZH 3KXFB 4NWUL 5HHQB 4NOBA 1Q0XL 3BH9A 2QQNL 1OP3K 4E9LA 5DJXA 3MMEA 2DQFB 2SEBA 1SEBB 3K1DA 4OZHF 1RD6A 1MRDL 4ONHA 3VXRB 5FAAA 3I85A 2VXVL 3MA9L 5JDJA 2V17H 3LH2H 3VFNA 2NY0B 1RJYB 1T5XA 2X10A 3GMNB 5E5RB 1J8HA 2CO6B 5F70A 5KVGL 4PJIF 1A47A 1UM6L 1OM3H 1G7MB 1S7UA 4ZXBB 4E5XA 2VDML 1DL7H 4XAKE 4G42A 4ZDHB 3QBTB 3BXNB 5TDPB 4YZFF 4QRQB 7CGTA 5EU5A 4HK3N 1V3LA 4W4NA 5HYSB 3H6JA 2MCPL 1NAKL 5AYUH 4ELMF 2FH6A 1I1CA 3DYMA 4D0CA 3WFZA 5FB8B 1K4CA 3TGXA 1F4WH 5GRJL 2CD0A 1WWBX 1INQB 3LEVL 1N5YL 3UMTA 2IAMD 4K7PY 3WFCH 3A0OA 5F6HJ 3CSBA 2VZUA 5EB9A 4YHNA 1ONQA 4K3GA 2WW8A 3QIBD 1YPZF 5EC2B 5J12C 2CLZA 2Z35A 3HA0A 1ZT4B 5E6IB 3ISWA 1DBKH 1RUPH 2COQA 5D2LA 3WXVL 1R24B 2D4FA 1IAIH 2GK2A 4M48L 5EU6A 3SDAC 3GKWH 5AUMB 4XPBH 4F37F 2D7MA 1HNGA 1OSPL 1K8IB 4Y5YB 3DV6B 4NPYB 2O5XH 2YK1L 5ISZA 5I73B 1OTUD 3ZHDA 1UWEL 4PBVC 3D0VB 3OR6A 2NLJB 2BCKB 2APWA 3O3BA 1NGYB 4QTHB 1HILA 5TGBB 2B2XL 3FFCB 1YEDB 1MCEA 1OHQA 3BKCL 4HKZB 3VFTA 3DJ9A 5EC1B 2P8PA 5CEYA 1IM9A 4YE4H 3QCUL 1QA9B 1Z5LB 5CILL 4DEPB 2YD4A 3D48R 2APXA 2E9BA 2XWBA 5D6DA 5DK3A 3L5XL 4C59B 1HYSD 4L4TA 4MD4B 4XP1H 2OXHA 3ZLQC 4QT5B 5KVFL 3IVKA 1UGNA 3MJ9H 2RAMA 3BD3A 1CXFA 5DI8B 3LEVH 4PJFA 3WKMH 2E6JA 4PRHE 1A21A 4XVTH 4Y4KB 5E8EA 5LBSH 3TNNA 5IVNA 2D3VA 5B38G 5LCVH 4CVWA 4NGHL 1OGAB 5T3XD 4X7TB 1VACB 4PJ7F 3F12B 5CIPH 3C5JB 4ZQKA 2ID5A 3H9SA 4GUPB 4MD5B 4EIZC 4P23D 5JPMB 5I1AA 1FIEA 4JKPH 4K3HA 4MJ5B 2VLKA 3NFNA 4U6YB 3VXRD 3FO2A 2FZ3A 3G9VA 3BYYA 3RL2A 3BZEB 1OGAE 1EJOL 1JWUA 3CLFH 5K9QI 4I9WE 3U2SA 4X98A 2GY7B 4JKPL 4GSDH 4OBRA 1OAYL 1XZ0B 5EU4A 4LDEB 1UKTA 2XRAH 5F72S 5T5NG 4Z7WA 1T7VA 4ZO8A 5GGRB 1VFAB 2MPAH 1LD9A 4JRWA 2QQNH 2GITB 3LCYA 1MY7A 3DMMA 3EO1A 1QSFB 1FVCA 3B3IB 1DN2A 2Y06L 3ARQA 2EDLA 3T8XB 1FL3B 5J3HD 4C4KT 4FA8A 4HV8B 1PZ5B 5F9WC 3RPKA 1A7NH 3UBXI 3HR5B 2VE6B 1G9ML 3CPLA 3GSRB 1TQBC 1JL8A 4KPHH 5GGRA 1FFRA 4GBXC 5C07A 4ELME 4QRTA 5EU4B 4NYLA 5IB1B 5JXEC 4M7LT 4LSUH 4NC2B 1BD2D 2J2ZA 1IC7H 4ZSOA 2VDOL 2IC2A 2X89A 1XGPB 4PGCB 5IW1A 1AR1C 1SJHA 1HQRB 2D31A 2OR9H 3O2DA 4E41A 2HJKB 1KACB 4X7TA 2M2DA 3BW9B 4LIQL 4OLZH 4BZYA 3U7YL 3OGCB 3VD3A 5F9JA 1IAIL 2HN7B 3WXVH 4R26H 4IRSA 5DQDL 3LKSA 5ICYA 1OAUL 3UZQA 1YEFH 4ODSL 2IFGA 1AGCA 1CLZH 1X7QB 5DD0H 3U2SB 2ITCA 4QCIB 2EDDA 3UAJD 1N2RA 3EDEA 3TNMB 2AABL 5KN5B 2VKXA 2BK8A 4HUNB 3C2SA 4Z76B 1M6OB 1F6AA 4JFPA 4KZEL 4D9QE 2QKIA 3VRJB 5DJ8A 1J0YA 1JFQL 4MSWA 1YMHB 1K2DA 3D2UD 4MJIA 3N50A 4H20H 4JO1H 3CH8A 4PR5B 3V4PH 3QRFM 5I74B 5GJSL 3TH3T 3X17A 1QSED 1MVUB 4V2CB 2MKWA 5JW5A 1NKOA 1AXTH 1X5GA 4TPRH 4JO3H 2BRQA 1U41A 3ALPA 1BVZA 2X4RA 2HJFB 4OGYH 5JXED 4ISVB 2VOTA 2EO9A 4X9IA 5CP7A 4NHUA 3JV6A 4XP5L 1IBGL 3CX2A 4FNLH 5C0CB 3VFWB 3L3OB 2BJMH 5ERWA 5H94B 1A1NB 1UENA 1D5ZA 2QQKH 1T1WB 4GT7A 2V17L 4LGRB 1NGWA 1OPGL 4MMZC 4OB5L 2ZOKA 2AQ1A 5DT1H 3T0EA 5GRJH 4R4FL 3DUUA 4AEHH 5E95B 1D5BB 1G7PB 4G7VL 3B2UD 5FDWA 3NIGE 3QEGH 4F7EA 2MCPH 4H8WC 1KN2H 2DWEA 4NSKA 3IAPA 3B2UC 5I8EB 4HCRL 4RFNB 4D0CB 1A6UL 3OF6D 1XIWC 5D9SB 1QLEL 1H3VA 5IIEB 2JB5H 1BVLB 5D7LD 4HIXH 3HZYA 4OV5B 2BNQE 3K81A 1Z6JT 3KPNB 4RAHA 4DKAA 2F74B 4ZXBA 3PE9A 3T1WA 3WV0A 4MXVE 3IXTA 3ULVE 1YY9C 4APQA 1NFDE 3TWCL 4IDJH 2VQUA 2SEBB 1KSRA 1EMTH 3IFLH 4YK4B 2IGFH 3GJEA 1BFSA 5C0NC 3O6FC 4BFIB 5EBLB 1X6LA 1TDQA 2B1AH 1NCWL 4HS8L 2BDNL 2OCFD 5LGHL 5EUKB 2H3NA 4PJDA 3QIBB 5FOBA 3SKOB 2MKLC 1F4YH 4DK6A 4PJ8D 5A2IH 1WV7T 1O5DT 3MRDB 5I76B 3I75A 3S6CA 4HUKB 4OCXH 3T2QA 3FAXA 1PKQA 4BK4A 3JBG7 5DD1L 1I3GH 2VDRL 1ZK9A 4G80B 2DQFA 2DBJA 5DA0B 2XWTB 5J0BA 2IPKA 3ES6A 5C71A 5MI0B 3FT2A 2ZOKB 3WFEH 1U8JA 2HT3C 5JOEA 1T22B 4Y5YC 2DQGH 1JWMA 4L4VE 4FQPA 2E8ZA 3RNQA 3KS0H 2H26B 2V9RA 5EOTA 2HJFA 1C08B 2XPGB 2ZOLB 5EWIL 2DQCL 2OJEA 2OSLB 3P30H 2Y6SD 1RUAH 4WWKD 1NMBL 4LSDA 3EZJB 4IBLT 4MHHG 1RIUH 3S9DB 1IAOB 3LKQA 4GRWE 2EH8L 1A6WL 1SBSL 3HHRB 1JZ3A 1I7TA 4R7DA 5IGXH 2OTUA 2X7LB 3L3KA 1NBZB 3DRTA 4ZO7A 2V5MA 4Y4FC 2VZOA 2NX5E 5FYLL 3GHEL 4O9HH 3LEXA 4R2GD 4JM2F 1KNOA 1MFEH 1JZ6A 3LKOA 1QP1A 1TTGA 4X4ME 4UUJA 4ZS6D 4DW2L 3GK8H 4NQDD 3D85B 1FGNH 5FYKE 3MR9A 3BOVA 1FIGH 1P4BH 5IT2L 1XCQB 1AQKL 2BHUA 4HWBA 4M6NL 3D87B 1KYOK 4OBSA 1DQJB 3RX7A 1IQWL 2J88L 1I7ZA 1T7WA 5ICXA 3KYNB 4F7MB 4TUKH 3BSZH 3HMXL 4LKXA 5INDA 3FOLA 4LASL 3NTCL 1IEBA 3KPSD 4ZOAA 3VE0A 3IGAA 5A1AA 3ZDYE 1BJ1J 3HRZB 1HNFA 4JZOB 4I2XB 4YHLH 2XYCA 3BVNB 3HS0A 2Q87A 2W1NA 4WFHD 3LV3B 1B0WA 1J1XH 4ZFGH 3PIQA 4ZUVB 2WNGA 3FL7A 3TA3A 2F58H 3PXHA 4HJ0C 3T1FA 3HR5A 1D5IH 4AIXA 4WCYL 4PJ9C 1F02I 1H3WM 3WL9B 2DLGA 3M1BA 3OX8B 4N1CA 1MCQA 1CF8L 1QHPA 1T0NA 4QLRA 3G5VA 3FFCD 4K9EH 4EI5D 4BSWB 3H3KA 4EJ1C 3BP5A 1R0AL 4D9QD 3LHPH 5CJ5A 3OB0H 4OFYA 3MC0A 3TT3H 1C5DB 1SM3L 3FQRA 4K3JL 4X5WA 1QRNA 1VFUA 3WIIH 4E0RA 5EU7C 2PCPA 3IDJA 4ZTOH 4XWGH 4GRMB 2J6EA 4L9LB 2XKSA 1JGDB 1H9VA 4YGAB 4Y16C 4U6YA 3THMH 1OLLA 4WI7A 2VC2L 3NTCH 3K4ZA 4PJGA 2Z8RA 3MBEB 5I1AB 5EBWB 3QUZA 1P84K 3BSZL 1AI1L 3GMRB 4S11A 5L88H 2IWGA 2NY2B 2R4SL 4K94C 5IV2A 1WT5A 3HUJA 1Q94A 5EZJB 3BP7B 2V7NA 1SHMA 4M6NH 2CDGA 3GNML 4RFNC 1EDQA 5JDSB 3DO3A 4CVZA 4M93B 1P4BL 2HRLA 1ZLUH 1VFBB 1EHXA 1QSEA 1RZJC 3GK8L 3SGDI 3S8WA 2E7MA 3VXUB 4WEMB 4HJJL 1WSST 5D70H 1A7OL 5L6YL 3GJFK 4PB9H 3FB7B 3VFPA 1D5MB 1OSZB 1U3JA 2P8LA 1CG9A 4WW1B 1UKQA 2C4FU 3HB3D 1WCBA 2HLAA 3B9KB 3QUMH 4PJ9D 2DIJA 5CEYB 1J1OH 3DUSB 1LO2L 4JQVA 4OZ4A 2IJ0C 2UVEA 3RWHA 5IGXL 4Y0GA 3FFCA 2AK4B 1TENA 3JXAA 4GBXB 3VWKD 1I9IL 3VWKA 3BIKB 4FXKA 3RUGA 2YUWA 5FK9B 2R1YA 4YHIA 2VRAA 4MQ7A 1TNNA 4Z5RA 4YDIL 4UDUA 5BVJA 4R97C 1H5BA 5D2NA 3V4UH 4GRLB 5AUMA 5JXEA 3DXAB 2XWJB 4OF3A 4ZS6C 1ZE3C 1OGTA 5BS0D 1UB5B 1M6OA 4Z0BH 1I1RA 1S7TB 2BMKB 3MREB 1MCRA 1XR8B 4Y19B 1VGEL 3VG9B 3I6KB 3RUGE 5E9DA 4WWID 1ZT4A 3VU2A 3GSUA 3MLTB 2ADJA 4D9LH 1KIRB 5C0AE 5FKAA 4HDIA 3QWRA 1I8LC 1L7IH 1IGTA 4L1DA 5LQBL 4LCCC 2NXYD 3QPXL 1GPOH 3M17A 5M7QA 3G5ZA 4PRIE 4P46D 1IZKA 3JWNC 1M71A 4F58L 4MJIE 4S0TD 1C7TA 4X0KA 1KJ2A 4G6JL 3QISA 4K8RL 4S0SD 5K9KA 5GSVB 1K8DB 4QRRB 4O2FB 4AL8L 5ITBL 2P5WD 1G7JB 1BM3H 5C0EA 5ESQB 3TN0A 4MAYA 3NZ8A 4MVBC 3ZE1E 2W07A 3CK0H 1ZA3A 4EI5B 1VERA 2BNUB 3MRNB 3FT3A 5ID0A 1EMTL 5C0FB 5F1SA 3DYOA 1P6AB 5HHOB 3C6LA 2VE6A 3QDJA 4WI3A 4QHLA 4O58L 3C9NB 2V9QA 3VXPB 4F7TB 2BOBB 4G8GE 4ZUSA 5FYKU 1OAQH 4ZSOE 1G1YA 1UVQB 2MHAA 2A74A 1IGCL 2DQHH 4OI9A 5JQ6L 1D9KB 1INDH 3FMGH 4JM2C 4M1CC 4GKNA 4PG2C 5HHPA 1ZGLA 1KCLA 3VMOA 2G5BB 1PSKL 5I1HL 4I3RL 4XMKL 4O5LH 4M1DH 3UYOD 3HI5L 1F3JA 2NYYC 2VL4A 1ORQB 1JV5B 2W65B 2ZCHL 5FM5O 4XCFL 5DT1L 25C8L 4RX4A 5J06A 4DKEH 3QNZA 5MEQB 4N0UE 4X83A 1JHLL 3DV4A 3DVNB 4K8RC 1DVFB 2HJLA 4RAUB 5L9DL 4OGYL 5DEGB 4R2GB 3MFFB 4HKBB 1A0QL 4PGBB 4JO3L 1B3JA 3LD8B 3U46B 4P2OA 1JI1A 4TSAL 3TO4B 1LEGA 2AERT 3D85A 1P7QB 2LE9A 1IGMH 4LCUA 2G5RA 4LSQH 1CQKA 5A40E 1AXIB 4U49A 2UWEE 4X6CF 4OD1H 1I9JH 3IDNA 4LCCA 4GKSB 1MI5B 4C57C 5HHOD 2CMRL 4GAJH 5FM8A 3IJHB 5DHYA 4N90D 1ORQA 5DQJA 3RUGF 4J8RB 2GJZB 5I16A 1CLZL 3C08L 2D4DA 1FFNA 3S96A 2DYPA 2XXMB 4A2LA 3CC5B 1BEYL 1E4JA 4LEXH 4YHKH 4I77L 4ONGL 1I7UA 2GFBB 4KKLD 1KV3A 5GSRA 1NL0H 4R0LC 1AGDB 4FQIL 1ZTXH 4LPWA 1L7TH 2L4OA 2HKFH 2Y7QB 3LEYL 1WZ1H 2EKJA 3A6CH 1OTTD 3UPRB 1ONQB 4LLWB 1DBBH 2H6PA 5DMIH 3C5SA 4OFKA 4OSUH 4KDTA 4RA0C 3LPFA 2A6KA 3EOTH 3SN6N 4YHMH 3D1MC 3BT2H 4AH2A 3BRDA 5D8JL 4WU7B 3TN0B 5K9JH 3HZMB 3PHOA 3RWDB 2ATPB 5INCB 4H25B 4X8XA 3WLWC 3F6LA 1RUML 1CK0L 4HW6A 2V7HA 4XCYB 3VFUA 5C0DA 3VMPA 1YYML 3RVVC 4RIRB 3T77B 3HAEB 1NCCH 1UWXK 2NY5H 1NGPL 2OYPA 5IVXE 3V5KB 3KPRB 4YHZH 3GGWA 2UWEA 4KU1A 5CJBA 4GSDL 2AJUL 3GSOA 1HKLL 4WFFE 2BVPB 1R5VA 3MODL 2MMXA 3PL6A 1DANU 1NCBL 3F65A 4GFTB 2WBWB 4NQXA 5JHLH 4LMQE 5H2BB 3STZB 2A73B 1KCKA 5CGYD 3LQAL 4U05A 1A6VL 4M43L 1KC5L 3KPTA 1G0YR 1T03H 1NL0L 1RZJH 3QXAA 1FV1B 3VD4A 4EVNA 2DQUH 1CDUA 2H32A 1M4KA 4BJLA 1T1ZB 4UQ3B 1BQLH 4MCZA 4LEXL 3W2DL 2WAHA 4WJ5A 5AWNL 2WWKO 4UILH 5MENB 4ZPVB 4CJ1A 2D7NA 2BSTB 1U95A 5C0IA 1NCAL 1HOCA 1P9MC 3MJ9L 1LILA 2CJUH 4QXTB 3L95B 1LP9B 1IT9H 1TZIA 3BQUD 4KHTH 1OP3H 4PV9A 1MFDL 4XZUA 5BO1H 4KRMB 2ED9A 4KV5F 1H3TA 1KCRL 4WW1A 1IL1B 2UWEF 4PJ9A 1AHWA 4J1UA 2LQRA 1EERB 4LSQL 3ZT6A 4G8EA 4HX1A 3WFBL 4BZ2L 2B2XH 4LFHD 5SWZE 1BOYA 2ZNXA 3RX8A 1HOCB 1JPGA 2A6DA 4CVZB 2P5WA 2E7CA 3ARFA 2VH5L 2FH8A 3F7PC 3RPIB 4ZPVA 1FL5B 2JF1A 4XNYL 1W0VB 2IH3A 4NQUA 5TDNB 1Z3GH 4H5SA 4RZCB 4KK6D 4WHTB 1T1ZA 4F7PA 4G8FB 1E4WL 3C60C 1DBJL 4N9GA 1YDPB 1JPTH 1OCWH 4P23C 3I3BA 5FHAL 5C07D 4JZNB 3MROA 1JNJA 4CU8A 2C1PB 2YUXA 3JWDL 3ZTNH 3EYUH 2ZUQC 3W9EB 3UTTD 3WNKA 3UJTL 4RA3A 4ZYKB 3GSVB 3EO9L 4QRPE 2G60L 4X9BA 3TO2A 4UV4L 3NPSB 5FO7B 5IFHH 5F7DB 3MNWA 5AG9A 2FR4B 4LSSL 5IR1A 2FJGB 3MRHB 2Q7NA 3T4AB 1ZHLB 2ZSVB 4M02A 1JRHL 3RQ3A 5D71H 2XXCB 2R56H 2NY3B 1KB5L 2CIKA 3RWIA 3T77A 4CNIB 5D7IE 3K4DA 5E7BA 1HQ4B 5ITFB 2BSRB 5LWYH 1MCPL 2X9WA 5E24E 3WXWH 5IVOA 1MLBA 4F3FA 1NAML 4OQTA 3IXAB 3EDJA 4O58H 4U1JA 3VXSE 3MUHL 4CKVX 5IBLC 3WNNA 3RWGA 2IH1B 1FSKB 3U6RB 2WUCH 2VIRB 4CGTA 1UXWA 2VXTL 1D7FA 4K8RD 1OWRM 2VAAA 3TYGH 3X12B 1J0JA 3QG7L 2BRRH 3TBSB 4WO4B 4QTIH 4P2RA 4PLJC 3QQ3B 2E9IA 5GZOD 4XNMB 2Q86B 2B0SL 4LSPH 1PQZB 4HUWB 5AYQA 1YECL 3FO1A 4UDTB 4LCWB 1F4AA 1XH3B 5F89A 1GGIH 3PP3K 1MFCL 3L3HA 2UYLA 4PJHA 1F58H 5A16A 1A22B 2YZ1A 2NW3A 3TT1L 2XZAL 2CK2A 2HLFC 5CJQL 5E03A 1CQYA 5CBEA 5I16B 4OLXL 1Y6MR 2R1XA 2DTMH 4KZDL 4EN3D 4Y2DB 4DN3L 1ES0A 4JDTL 4APQC 3AROA 4Y5VB 3D9AL 4BA8A 4QHKJ 1JK8A 3F12A 2DI8A 4U1LA 1I1AC 5C0AB 5CEZL 4L9LC 1CICB 1DJSA 3OZ9L 3WEXB 1MEXL 2C4FT 4IS6B 1MHHA 2IBGA 3VXTA 1TTUA 2AI0H 3WO4B 3W5NA 3JV0A 1UJTA 1JRHI 1CFQA 2EYSB 1GSMA 4WRLA 1U42A 2R2BA 5ANMA 1G9NH 4KKNA 1ZANH 4YC2B 4PJAF 1MJ8H 1NDMA 4OD2B 3HZKA 1RUKH 2AV7B 4FZ8L 3VGAB 3VMNA 3WNMA 4PRPD 3N0PB 1CU4L 3SDXF 1U3ZA 1PBYA 3L3IB 5J13C 3QP3A 1KYOJ 5H37G 4NNPL 3RI5F 1EV2E 5HYQB 2WM0A 4NKMA 3D18B 1DCLA 4YEFA 3ARBB 4JFDE 1YEHL 2X5PA 3Q3GA 4G7YH 4X6DE 4N8PA 5CJOH 3IFOA 5C3LD 4JHBA 1NCUA 4K7PH 2XT1B 4ODBD 1SYVA 4LCIL 1TMCB 2X6MA 1KXVC 4XNQA 2O61B 2HRPH 3VFVA 3FRPG 3ILPA 1PG7L 1CZ8L 4ZTOL 4H1LA 3IKCA 1DSFH 3O6FD 4YBLC 1OW0A 2W0LA 4HWZB 4NJ9L 3WE6A 2J4WH 2FX7H 4FQXD 1K6QL 3HLAB 5JIIA 4XNQB 4CN4A 2PUQT 4V1DA 2ZUTA 1A64A 3DI3B 5INCA 3ARED 5IK3B 4EBQL 1J1PH 4WCYH 5FOJA 5C6TH 3RZCD 3HE7C 1XF2A 4RMSA 1AJ7L 1F90L 4NHCL 2JK5A 5JR1H 2PF6A 2R8SL 1FC2D 4NC1E 3KJ6H 2HH0H 3L3JA 5TF0A 5E8NB 4JQIL 2AJ3A 3T0XA 2XTLA 3MV8A 4OZGA 3O6LH 3D3VA 4OGXL 3EYSL 2DLFL 4OIIL 2NW2A 4YK4C 3WD5H 3ZTJH 2C3HA 3ZYIA 1BJ8A 3T2NH 3CMOH 2DQIL 1TXKA 3L3IA 1U8IB 5E8OA 4C56D 4H8WL 1XF1A 5HPMA 2YA0A 3BPOB 3QQ4B 3HMXH 3MUJA 5KAQF 1U8OB 1CZ8H 4PLKD 3MYJA 4ODXB 1JWSA 2J88H 1PG7H 4FHBD 5C0CA 3BAEH 5FV1L 5SWSB 3VXME 1U36A 1KF9B 3NAAH 5J56B 1CTNA 2FYYB 2XG4A 4OUUA 1ZMYA 4LVOB 6CGTA 5EN2A 3BKMH 1WBXB 1S9WA 1XGUB 5EOQL 1R5IB 5JUEL 4KI5F 2WV3A 5DQ9B 5EZIH 4LLMB 2P5WE 4P48A 1S9YA 3KHQA 5J6GB 1B88A 1DSFL 1ZAGA 1N2RB 2YD7A 2XA3A 1OSZA 3MJ7B 3KXFD 4R0LB 4WUUD 3I2CH 2PKDA 2ITDB 1QFOA 4FZ8H 3T0BA 4PGEA 3UYRH 1XGTB 3AB0B 4URTB 1QBML 5GGUA 4WW2B 4X4XA 4G3YL 4WEBL 4ZUTB 4K7FA 4QNPE 4R4BB 1DBAH 1MWAA 4KVNH 5HYFA 4GMSL 4P59H 3CX5K 3TBWB 4HAFA 3UTPD 2NY6D 3GMPB 1ZOXA 5K93A 3RDTC 3UDWA 1XGPA 4PGCA 5IW1B 2YD9A 2X1QA 4JB9H 2W9DL 4JKKA 4P2RB 5CCKL 3BE1H 5EIIA 2BNRA 5J8OA 2IQ9H 1GC1L 3UTZB 4DVBA 4JRXB 5DD1H 1ZGLP 4JDTH 3B9VA 1GIGH 4KZDH 1BD2A 4KDWA 4JAMA 1DUYA 1F2XK 3MRCB 1RUKL 4U2YA 3OKEA 1KEGL 4GKNB 4K71C 3BKJL 3OKYA 1FO0A 4JO4H 3IKKA 4BSWA 2E7BA 3PQYA 2A2QT 4RSVA 2AW2A 2Z93A 1YN7B 3K3QA 1E6JH 5F71A 4Z7WE 2XA8L 3LRSA 4Y8DC 3UTTB 3VG0H 3D5OF 3RWIB 4XNUH 4P2YA 2GHWB 4JFQA 2FB4L 1AGBA 1E6OL 5EUOF 3QDJB 3AS0A 3WYRA 1RU9L 2GITA 5FM5M 1DUZB 3P9MA 1OB1B 4FQ2H 3D9AH 5FO7A 4PRPE 4JFFD 1FYTE 4RNRA 1ZA3B 2R23A 4EI5A 3TBYA 3TYGL 3IXAA 1NCDL 2FZ3B 3HRZA 4ZTPL 2Q8BH 2ZUVA 4P5TA 1AO7A 2DLEA 3DHMA 3EYOA 4R3SB 3AREC 3OJVC 3DETD 1TQCC 4WHTA 1MFCH 4HIXL 3KR3H 3F7RA 3QPQD 2EC8A 3SPVB 4GW4B 3ZKMC 3KPOA 4QGYA 1ADQH 5IMKB 3AY4C 4PREB 2FJGA 3DTXB 1F45A 3S5LB 5T3ZE 2EDFA 3IAGC 4LRNL 5FCUH 3WNPA 2R9HC 3EBAA 3LKRA 4I5BB 5LG1A 4NC1C 1OGAD 4UUJB 3GMLB 3ILQD 3IF1A 3CVHB 5IVZA 1IL1A 4KI5E 2D7QA 4OCRH 4U2ZA 2ZNWA 3SDXB 4RMWA 4YBHA 5GGTA 3VFTB 5I1CL 3SGEH 3CSYA 1U8KA 3JWDH 1NBZA 2JCCB 3WJLC 1RZIB 1W0VA 1T1XB 4RMRA 3CGTA 4G7YL 1EXUA 4GXUM 3LIZL 3KPMA 3NACH 2A9NH 1JRHH 2W60B 3SGDH 2NY5C 4K71B 4AENB 3SDDA 3OKDB 1FH5H 3ULVL 1WCBB 2QHRH 2QADB 1GXEA 4U1SB 3H42H 3SJVA 5H2BA 2EKSB 2IPTL 5F9OL 4NT6A 3KS0J 3TA3C 3MOQA 5DFWH 1ZWIB 3BD4A 4KUZL 1NC2A 4MNQE 3QG6A 2AI0L 5DQDH 2PR4H 3O41A 3RDTB 4XPFL 1FLRL 2VDLL 4O02L 3VGHA 4GW4A 4ODVH 1EPFA 2Z91B 1ZEAL 3G5XA 3TBVA 5HBBA 4TTGA 2I9LA 15C8L 2HMIC 4N1HB 1AO7B 3QDJE 4PJFF 3HZMA 4GO6B 3VCLA 3HCVB 3E0GA 2G9HB 1QFWL 4GG8A 4JFXA 4AH2B 1G6RA 3EFFA 3PL6B 1HWGB 5DJ2A 2YPLB 1N3NB 1GHFH 1HCVA 4Y2DD 2KQMA 1GCFA 3TT1H 1S5IH 1PDKA 3KPRA 3KPRD 1MWAH 1WK0A 3ARBD 1YJDC 1G9MH 3IXTB 3QDGB 3W0WA 4M93C 1GGIL 5DO2D 2CJUL 4RX4D 3CFKA 1I9RL 2YKLH 2IQAA 4JPVL 4NFDA 4LSPL 2F5BL 4RRPG 3NCFB 4I3SH 4KXZH 4H1LH 4NQCE 1T5WB 2V2WA 2JJVA 2BVTA 2NY5L 4I0CC 4KJYA 5A2LH 2RFXA 5JPNB 1X5IA 1V7MH 2FBOJ 4MZ3A 4YHPA 3KPLB 3IS1X 5HVHB 5BZDB 3QAZB 3CFIC 1NH6A 4JR9L 3RTQC 4FFYL 1NC4D 2Z31C 2FCBA 4XP4L 3PUCA 4JVPA 1QQDB 2PW2B 1P6FA 2ADFH 2NY2D 4FQLL 2XACC 5I1GL 5CZKA 5TPWH 4O2EA 3MGAA 4Q6YA 4XAWH 4BSVB 3BUTA 1NDMB 3TBWA 3PWJB 3AU1B 4FQXC 3DIFB 3S35H 5CHNA 3L6FB 5E1HB 3MRRB 5LBSL 4YNYA 1QO3A 2FL5B 1N64L 2HVJB 1LDPL 4YHKL 2W9EL 1CD8A 4WV1B 3DURA 3JV4A 1OARL 1IQDA 3MRBA 4K07A 4MSWB 2FEDC 5D96B 3TIEB 2ERJC 4U3HA 4Z76A 4AQOA 1S7XB 1H3GA 5F8RC 4Z7OF 4YBQD 1QQDA 4EI6A 3CX5J 1S7RB 4QCIA 5E2TH 4O51A 5F97E 3ULVF 2HKFL 5EOCJ 2ZCKH 1ZTXL 2UZXB 1KFAH 2D2OA 1OSPH 1FC1A 5A16B 3MFFA 4DGIH 4YQXH 3PWJA 5BOZG 3C2AH 4MJ6A 3Q6FB 3OR7B 3DYPA 3GSWA 4Z7UF 4WU5A 4ETQA 4QRPB 4LSTL 5DD6B 3QQ3A 4JHAH 1U8IA 1MFDH 3AB0C 5E8OB 2E3VA 1ED3A 4EOWL 3QDGD 3IFPA 4OFPA 4PJFE 3WBDA 5HYJB 2NW2B 3V52H 1U8HA 3HI1A 4DKEL 2IAMC 3TJHC 1PKQB 1D9KC 2AJ3B 3EDFA 4PJDF 4HT1L 2NXZD 4YHOL 4M62H 3PNWB 1OT2A 2GCYA 1ZVYA 1OP5K 3WUWG 5FO9A 5E8DH 2KUTA 4MXWH 4U1JB 3SCMC 1MH5A 1XGRB 4PRBA 2VLKE 4G8GB 1G7JA 2EDQA 2WQRA 1BGXH 3HG1B 5HVFB 4TSBH 5IOPB 1RURL 3EYVA 1DL7L 2BVOA 4UTBH 3V6BR 1D5XB 3FB5B 1DEEA 3LQAH 2BOBA 1AE6H 5EO1B 2YOCA 3IU3B 4PY8J 2Y07H 2ZZUT 4ZNEA 1FG2B 3S35X 3BGFC 4XMPH 4Y2DC 1RZKH 3QG6B 1NC2B 5E5UB 4AY0A 5I19L 2F53A 2NX5B 5HYSG 2VLLA 1IAIM 2OTWB 4X6DB 5L2KE 4AM0B 3P2TA 2ADJB 4PP1D 2DLHA 3OSKA 4NWUH 4NZUL 4U1SA 3S37H 1WAAE 3MOAL 1S7TA 1JHTA 3IDIA 3ARUA 1UB5A 3C6LC 2JKXA 2D0HA 4ODWB 1WVZA 1RVFL 3FQTB 4P3DA 4Y4FB 2QR0A 3P4MA 5JQ6H 1XF5B 3X3FL 1JNNH 2JJTC 3UYPA 4XNXL 4HBQA 1G7HA 3LN4A 3WFDL 1VHPA 5DR5H 4FFVC 1NC2D 3G5ZB 4EEEA 5LGJA 4AG4L 1JNHB 4X9GA 1BREA 2XZQL 3SJVD 5JO5A 1OTTC 3A6CL 3LEYH 1ZXQA 3QPXH 3SDCC 4OZIE 5LQBH 3HZKB 4YFDB 4BELD 2E6PA 1WAAA 5EFIB 3INUL 3OKDA 1IM9B 2ORBL 3N1PC 4ENED 1KCVH 3CK0L 4I77H 4ONGH 4I4WB 1A02N 1M7IA 4TTDD 4GXUN 4MQ7B 4Z5RB 4P9MH 4DGVH 3TVMC 2IBZX 3GIZL 4EDWH 2CRZA 3KYKL 4JPWL 1RJLA 2I25N 2X1WL 4GBXA 5DMJB 4W70A 3OAUL 5DF0A 5JIPA 4P5TB 1ES0B 2E7LA 2CMRH 2CIIA 3C60D 3I6GB 3OQ3B 4GAJL 4PJGB 1G9NC 4RFOH 6FABH 4Z18A 4O4YL 1P7KB 4QRRE 4N1EA 2HTKC 5DC4B 4AMKH 3IAQA 3B8SA 4Z7UE 1KG0A 3X13A 4KDVA 4HUXB 5HD8D 5DJDB 5FA4A 4P4KD 4XRCA 1MLCB 2VKWA 3ABZA 5L6YH 3AMLA 5F9JB 4HJJH 5L9DH 1QZ1A 3U4BL 1AR2A 4PG2A 4M7LH 5I1KL 2FNBA 3WKNA 1N6QL 4X5XA 3L5HA 5DZLA 4U1KA 1YC7A 2W9LA 3S3PA 5FECB 1ERNA 3P77A 3CZFA 1MH5B 4OZFB 3ROLA 3T1FB 2HTLD 4WUKL 4XPGH 4YZFE 4OLYL 1RY7B 4P2QA 2FHFA 4P46A 4JRYA 3HE7A 2P44B 2GCYB 4RNRB 4B50A 4KK5D 5DXWA 4XVJH 4MA8L 5FO8B 2AQ3A 5I9QC 3HE7B 3G5YA 3FO0L 2I24N 4CAGA 1F2QA 4KKCC 5HYIA 5ALCH 3P77B 4NN6C 5J6HA 2E9WA 1IGCH 2DQHL 4Z95H 1HXMB 1UEMA 3CUPB 3QEQA 3TT3L 5HDLA 4X5XB 5INDB 4XGZB 1TZGL 3U4EB 4DOHB 3O4LA 1FL3A 3BPNC 4B7LA 1JE6A 4YXKL 5EOCL 3KWWA 2P5EB 1BBJB 4XPHL 2AEQL 1EAJA 4WI2A 3QDJD 4Z7WB 3DI2B 3OMZA 3EHBC 3V5DA 3HS0B 5TE4H 5E70A 1KG0B 1VPOH 2DS4A 1S7RA 2DBLL 4MQSB 2VERN 2GY5A 2CDFB 1LP9F 2AEPL 5FUCE 4OM0L 1OY3B 1TCMA 4CW1B 5MEOA 1MI5A 3VRLF 4LBEA 1BM3L 1I1YB 1B0RA 3MRBB 4EQ2A 1GH7A 2B5IC 4PJBE 4PRHA 2EDXA 4KTYA 1KELL 4RGND 4RISH 1B9ZA 1CF8H 1X5JA 2GSIA 5DVKA 2C4XA 3A6OA 4M7KH 3MRFA 1RIHL 4S1DC 4PJFB 3FN9A 3E2HB 4QHNB 1HHHA 1I3UA 4IOIA 2PXYC 1KJ2H 4RQQB 3MBXL 2R29H 3ARGD 3MJ7A 1RSFA 2XWBB 1F8TL 5T3ZL 5F3HA 1J1XL 1HHGA 3FT2B 3OAZH 1IGFH 4Z0BL 2P7TB 1H3PL 4YLQT 3P0YL 2LU7A 1HILB 3FO0H 4ONFH 3DX9B 1DTUA 5ESVA 4BKLA 5EO0B 2I26N 3LKQB 4Y19D 5IKCB 4KXZI 4PV8A 1B0GA 1U6AL 1WBXA 4LPYA 4LDLB 2EH8H 5BZDA 2FYYA 3O2VL 1RUAL 3FRUB 4P9HH 4KJYB 1JWSB 2EXYC 4PJAA 3F7VA 4ZUUA 2YSSA 4UTAL 3U4BH 2YWYA 4RFEA 1FGNL 5C9JB 4JQXC 3M8OH 2P42B 4AIZA 5F7KC 1A1MB 1PEWA 4PP1C 1R5VB 4JDVA 4XI5C 2JCCF 5C0RH 4FQXB 1A7OH 3ROOA 2BY3A 3GHEH 3T08A 1W8NA 2NPLX 3VFRA 3WLBA 5T3ZH 1NDGB 3IDXH 3IRPX 12E8L 1W72B 5KS9E 3MBXH 5CLTA 1IARB 2BNUA 1AKJB 3HAEA 5FYJL 2CRYA 1A6WH 1SBSH 2EDTA 1H0DA 3O2VH 3LQZA 2YMXL 3C6SB 4IMLB 4KROD 2Z9TA 4LSRH 5TDPA 1H15B 3SKNA 4V1DD 4D9RD 1YJDL 5I6XC 3UJIL 2OMBA 1MCSA 1FCGA 3GMNA 2VTFA 5D7LA 2CK0L 1XMWA 2R4RH 3NCMA 4NO0B 1EFXB 1B0GB 2MNUA 1YMMB 3WFEL 3WLBB 4JQXA 4HS8H 3QNYB 4U7KA 1CE6B 4PY8I 3RKDC 2LTQB 3MMEB 1TVDA 2OK0L 1KCVL 3MRKA 1AR1D 2Y7QA 2O61A 1X5YA 5HHQA 1EEYB 2PXYB 1A5FL 2DM7A 4UT6L 1CFSA 1NAMB 1U8NA 1DLHB 2CKBH 3WDHA 4PJCE 3F8UB 5JMRA 4FFZH 1UA6L 3D39D