5HJ3A

Crystal structure of host-primed ebola virus gp, gpcl.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
225
structure length
199
Chain Sequence
EVQLLESGGGLVKPGGSLRLSCAASGFTLINYRMNWVRQAPGKGLEWVSSISSSSSYIHYADSVKGRFTISRDNAENSLYLQMNSLRAEDTAVYYCVREGPRATGYSMADVFDIWGQGTMVTVSSASTKGPSVFPLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein
publication title Host-Primed Ebola Virus GP Exposes a Hydrophobic NPC1 Receptor-Binding Pocket, Revealing a Target for Broadly Neutralizing Antibodies.
pubmed doi rcsb
source organism Ebola virus sp.
total genus 36
structure length 199
sequence length 225
chains with identical sequence E, I, M
ec nomenclature
pdb deposition date 2016-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hj3A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5hj3A01
3VXMB 1RUPH 3MRMB 3J8F7 1M7IB 4L8DB 5D7JC 2FIKA 2ZCHL 3MBXH 3VW3L 1EHLH 4ELMB 3BN9D 5FDYA 1E4XH 1OT1A 2WWMD 4EDXB 1JGVL 3MX0A 4PD4K 3W2DL 5F7YC 1EX0A 3KJ4C 3K80A 3X11A 2Z91A 4O02L 1XF5B 5IW6A 3QP3A 1DBAL 2Q86B 3PHQA 4K8RL 4NKOA 4C56B 4JVPA 5IBLC 2BOBB 3KPQB 3FRUA 3HC4H 4EVNB 1KXQE 2YPLB 4YFEA 5IK3A 2KQMA 3U4EA 1A7RH 1S7VB 4PLKD 1A3LL 1U3HD 4EI6A 3DX6B 3VFMB 1QSEB 1YMHB 4ZPTA 1H15B 3X3GL 3JV6A 3KYNB 1CD8A 2HA1A 5L2JA 1NCBL 1WICA 3QIWD 3NCEB 5D1QD 3RP1A 4LKXA 1UM4H 3OKMB 3TN0A 4U1JA 4F3FB 4OF7A 2XNAA 2ERJC 4HS3B 2NY0D 2H1PL 2ZSWB 4RRPA 5FGRA 2JJTC 5MEPA 5HDQL 3VFGL 2E7BA 2NY2D 3BN9C 3VXRA 4PLOB 2WWMC 3VCLB 4XBGA 3GIZL 1TNNA 3V0WH 1HINH 2WZPD 4YHKH 4L4JA 4CMMA 5CJQL 4HKZA 4TUKH 4F9LA 5CSBA 3BISA 2ZG2A 4G6AD 4PLKC 5IVZA 3UO1H 1U3HC 3I75A 4I5BA 3WFBH 2RIKA 1QOKA 4BQBA 2IPTH 3QIWC 2AJ3A 5D1QC 3ZKSD 1VCAA 1JIBA 3LAFA 1F5WA 3O2DL 2NY0C 4XPFL 5D72H 4OI8A 3QQ4A 1UB5B 3TH2T 1S7WA 3H9YA 2NY2C 5CMAA 1MRCL 3NPSC 2JJVA 3M17B 3UEZA 1DSFH 2C4FT 3NACH 3EYVA 1RU9H 3UTTA 3TM6A 4CJ1A 4F58L 1IAIH 3RWDB 1JNJA 3DO7A 3MYJB 5KS9B 43CAA 2R4SH 2X89A 4U1NA 2YPVH 2G5RA 3LQZB 5DRXA 4NQXA 1E6JH 4CDGC 3GSRA 3P9WB 1ZLUK 3PGDB 4IRJB 3RWIB 4I48B 5KJRL 3WO4C 1I4FB 2Y72A 3O4LA 1GVIA 4DGIL 4JO4L 3UC0L 3D39B 5TFSH 4OKVB 2FLRT 4HIXL 2ZUSA 5EO1B 1MCLA 1FZJA 1EV2E 5LXGH 4G8FA 4FQ2H 4PTUA 4KTYA 4BSWB 2FJFA 4RGOH 2NY4B 25C8L 5F9AC 2GSIB 4KV5F 5CZVL 1U8LB 2QEJA 1JNLH 4POYA 3EJZD 4PJEB 1FZOB 3QHTC 3UTQA 4IMLA 4U3XA 5B38B 5EORH 3KPSD 5DURB 3D0VA 1W72A 1DR9A 1A14H 3P4NB 1V5JA 4H1LA 4MAUL 3OKEB 3FQTA 1TZHB 2WBJB 3SJVD 2QQKH 5D7IB 5JOFA 3F58L 3U0TB 3WJJC 4ISVA 3QUYA 2UZXB 4ETQA 3MC0A 1HXYB 1PEZA 2NY7H 4P2OD 4JHBA 5K9JH 1CD1A 1RZ8A 1JMZA 3PDOB 4LVEA 1S7XB 3FOLB 3AXLB 1IEBB 5TDPA 1RK0B 4WGWB 3T0VA 1DQQB 2G75A 4WNQB 3T4YA 3LRSA 4P23C 4MA3A 4Z77A 3EJZC 3HUJF 2R0WH 4MA8H 1QBAA 5CINH 3SY0A 2PYFA 5DYOB 4BH7A 4ZUSA 1G9NH 4AENA 5IMOA 5FUZL 3U1SH 5F44A 2J8UE 1OAQL 2XACC 5DEZA 4ETYA 2CGRH 3C08L 1P69B 4UDUA 4OCNC 1IQDB 5TE6L 3I50L 1J10A 4DTGH 2EDWA 4XP6L 1BWMA 4FZ8H 4Z76B 3HNSL 1F8TH 3ROOA 2VL5B 5FUCE 1CICB 4P2OC 3W0WA 2BFVL 5IBUB 5GZND 4K71B 4LLVA 2OJEA 4HV8A 1YEKL 1R5VA 4ODSL 1KEGH 1N7MH 2EIZA 2DRUA 5DJDA 2X9YA 2GK0A 4GMTH 3TBYA 1KB9J 1EXUA 3TWCH 5DHYB 4KXZH 3WIFA 1SBSH 4FQXB 5DUPH 5C0FB 5ITBL 1WCQA 4MS8D 5C09D 1VKXB 4FXLA 4OF8A 1L7TL 1KG0B 4UILL 5ADOH 4YHMH 2A74B 3CSBA 5LBSL 1QSFA 1CR9L 2R9HD 4R3SA 1BP3B 1LGVA 4D0BA 4PJIF 3MPCA 4F57L 2NXYD 4QRUB 4ZTOH 3WDIA 2YD5A 2F8XC 5E2TH 2JJSA 3LD8B 1S9VB 3CFEB 4D8PA 5I16B 1FNEA 1MCRA 3QSKB 3BKMH 5FA3B 1OQXA 5LKNA 4U7SA 5I2IB 1M71B 5D7LB 4F7CA 1LP9E 3FB7A 1J0KA 5GZNC 4LPUA 4YE4H 1XR8A 3T4AB 3HZMA 1FIGL 1R24B 4TVSa 4X6DA 2UVEA 2Z35A 3QUMA 1IM3B 1NGXB 4OM1L 3BYYA 4FN0A 4MA7L 1T1XB 2VZTA 4KC3B 5JHLL 4JFFB 4MS8C 3ARFD 5EZJB 3UPAA 2M2DA 1KXVC 4GRLB 4OV6F 1PYWB 3GSNL 5T5FL 5DJAA 2HKFH 1A1OA 5D9SB 4QRSA 2NXYC 2F53A 3MLTA 1CD0A 1HQ4A 1M7DA 2J88L 2AJXL 3ZKMD 3BQUB 3EO1B 1BWWA 5D7SH 3T0EE 5C0DB 3FQRA 5GSVB 4GMSL 3T65B 1OPGL 3FRPA 5E7BA 1LNUB 1E4WH 1YDPA 5KAQF 5DD0H 2J2ZA 1LK3L 3IDYB 1GXEA 2AXFA 3QPXH 3NBNA 5KVMC 1G7PB 1T6VN 4WFFE 3ZE1F 4P48A 4OQ1A 6FABH 3UBXI 4R97C 3GSUB 4GUPB 4QXGH 1QFWI 5ISZA 2Y7QA 1IAIM 3KPRB 5KZCB 2J8HA 2VAJA 1F45A 3ALWA 1LEIB 2JB5H 5EA0H 1HOCA 3BEWA 4XXDB 5SX4H 5JNYA 5E2WH 3ARFC 3W11D 4Z95L 4LPTA 3VXSA 5F9WB 3BIKB 2FO1A 4ESKA 4ZOAA 4PJDA 4MX7B 1X5XA 3JV4A 3THMH 3BWUC 1Q1JL 4X4XB 4GQ9H 3FQWB 5B22A 2PR4H 3SKOA 5I30L 5AG9A 4S1SH 5JXED 1K8DA 3V5HB 3GMMB 3QDJA 4Z7NE 4JRXE 3ZKMC 2IFFL 5CBEB 4ZO6A 4AY0A 1TQBC 4K07A 5FB8B 5HI5D 2NY6B 4KAQL 1PKQA 2WUBH 3RUGF 4X6FA 2QBWA 5ICYA 1MUJB 3I9GH 1TVBA 4JPVH 3B9AA 1CYGA 1YPZB 1P9MC 2VDML 4H20L 5A16A 3X13A 2FECI 3STZA 2W60B 3RWFA 3FHAA 3BPLB 2DQHH 1JTTA 3QFJD 4TQEH 5F3BB 2BVYA 4J3UA 4MAYB 2P5ED 2IAND 4GXVH 4XWGH 4Y4KB 2I60L 4R90L 5LAXA 4NRXA 5I8CA 4I3RH 4KKLC 4OV5B 2MKWA 3K8MA 1D5XB 3O3DB 1IGTA 4WEBL 2NW2A 4E41E 4JB9L 3I84A 2BRQA 4EIZC 4Z6AT 4JGMA 2C4XA 3CZFB 1NDMA 5JXEC 4PJ7B 1DN0A 1U91B 3PGCB 4YHNB 4BM7A 5I76A 1DUZB 5FGBC 4CVXA 4ZXBA 4M6NH 5EULV 5JR1H 3MRHB 1AQKL 5IFHH 4RFEA 4WO4B 5HYQA 2XZCL 4XCFH 5HI5C 2CKBH 2R0LL 3FAWA 3KPLB 3KYOB 4XC3H 1NEZG 3AS1A 2KKQA 5EU6E 1B3JA 4QO1A 2JF1A 1JVKA 5CILH 1WJ3A 2V7NA 5DS8B 2CUIA 3QI9B 4DGVL 4P5KB 2DBLL 2LE9A 1IJ9A 1FBIL 2Y06L 4U0RB 4LCCA 1KPUA 1KCUL 1T2QL 1HEZB 4NFDA 5F9DC 3TV3L 1KV3A 3KS0J 4M48L 2UVFA 4YZFE 2GJ6B 4O4YL 3OHXB 2QR0A 4ALAL 4HWNA 3FZUD 4PRIE 1CQYA 4OZHF 2RFXA 5H94A 1ZT4A 3KXFA 3TIEA 4R7DA 4JR9L 2JJWA 4L29A 2RBLA 5CD5D 4YUEH 2UWEE 3KWWA 3PWPE 1Z5LA 4M6OL 1ZLSL 3HR6A 3HNVH 4IOSD 4E5XA 4M5ZL 2NY1D 5D8JL 5KVEH 4J1UB 1G0XA 2H3NA 2A9NH 2D7PA 1FZKB 2EDJA 2VITB 4NJ9L 3EOTH 4QF1A 2A6KA 2C7UB 3DBXB 2CRZA 3ABZA 4PY7B 4UTBH 4HULB 1JPST 1MQKH 4GRWB 3LPFA 5E8OB 5EU3A 3DURA 3HLAA 2CH8A 4JO1L 3ROLA 3ULVD 3RL1A 4YQXL 3FZUC 4XGZA 3O2VH 4GG6A 2XN9B 1B90A 5AZEH 4BQ6A 3ECBB 4L8SB 2ZUTA 2FLBT 2QHRL 3RY6A 1KFAL 5ITFA 4PRDA 4M1GL 2NY1C 1ETZA 4LLYA 5IB1B 4OLXL 3NFSL 1LEKA 4LCWD 1WF5A 2ITCA 5DJ6B 2HFEB 1S9XA 4QHUA 4LVHB 1CFVL 3AU1A 4PJFF 4DAGH 3CLFL 4C54A 4K2UH 4D9LH 1GPOL 4JO2L 5IIEB 3TIDB 4QHNA 4U1IB 3VXME 1XR9B 1UXWB 3HPJB 1VENA 2DMKA 3B4NA 1PAMA 3G08B 1RIVH 4EDWH 4LNRB 3IFPB 2EDQA 1MRDH 2C26A 1I9RH 4NUGL 4ELME 4ERSH 1UXSA 3KNBA 1OLLA 4PJGB 5JW4Q 3ULVC 1NBZA 1UCTA 3LV3A 3WIHH 1T7WA 1ZA3B 3CLEH 4J6RH 3D2UB 4ZMAT 1C7TA 4NN5B 3D0LB 4XCEB 3H3PH 4UB0L 4LPXA 4CGTA 5I0DA 4C56E 5HYSB 2NQCA 5E00B 4ACPA 4MVBD 2E6JA 5AZ2L 5EO0A 1HSBB 1ZT7B 3L3OB 1QRND 5SV4A 1TJGL 4RFOH 3QEHA 5K33A 3MSPA 3CK0H 1QSEE 4OCXH 4PG9B 5J8OA 4Z18A 4N8VG 3WHE1 3N1PC 4FP8H 4OT1H 3IRZA 3CC5B 3RTQC 4O51B 4IDJH 1ZGLP 2OJZL 1ZVSB 1OAYH 3PV6A 1FDLL 1NL0H 1YYML 3U7AA 1T03H 5BXFA 3BO8B 3PDDA 1I7ZA 3TA3A 3HMXL 3ULVL 4KTEL 4HC1A 3VXUD 1NUNB 2QSQA 1YN7B 1XIWB 2J6EH 4UAOC 3SN6N 2VAAA 1LILA 3AROA 4CMHB 4NSKA 5L88L 3IU3B 2H41A 3AREC 3OAUH 4P46D 2VXQL 3VFRA 5ESQA 2CSPA 2DD8H 3DUUA 1ZT1A 2CLVB 2MWCA 3QIUD 5FM5M 3RGHA 5C86A 3Q6GL 1BPVA 3NZHL 5IMLB 5IM7B 2MJWA 5IJKC 3I85A 4JDZB 2C1PA 1T2XA 1MI5B 2H26A 3G6DH 4J3TA 3GMOB 4L8CB 1MCWW 3QIBB 4LKCA 1OGTB 5IHZB 4F7MB 5SX5H 5TF1L 2AXGB 2BVEA 5I74C 4L3AA 1Z3GH 4ZUWB 3CMGA 3EHBC 5DWUH 1WUNT 1JZ7A 1SEBB 3WO3B 2IPKB 3MNZA 3HZKA 2BY2A 4O5LL 4LCUA 4AG4H 4KI5E 3U48A 4GH7B 5B39A 1A47A 3AFLA 3QULA 4JN2A 5C0AD 4YXLL 2R0KL 3T8XA 2GUOA 3MGAA 1YNLH 2CJUL 2AEPH 4ODXB 3DROB 2P5WA 4QKXB 4YC2C 3DRQB 1FYHB 4P46C 1L4IA 2FB4L 2PCPA 2V2XA 4G5ZL 3QIUC 5JA8B 1DANU 5EUKA 5EBLA 4Q0XH 3QUKA 3CFJA 4YHZH 5DC9B 4AEEA 4S2SA 4APQD 2F5AH 3ARPA 2ARJQ 3HCVA 1W8OA 1NBYA 3UJJH 3CFDA 3HE6B 1B0GB 1EFXB 5E99L 3D39E 4K3HA 1FAKT 4HS8L 3TVMD 5IROA 1IC4H 1UGNA 4YDJA 4OLYH 3MJ9L 1IGYA 5EB9A 2R1YA 4LDLB 2YN5A 4RAVB 5HGAA 4F7TB 2IPUK 1NFKA 5E6IB 4JKWA 3QDHA 4NQEA 1NCAH 1UWGH 2Z8WC 4KK5D 3TYGH 3CPLA 3BZFA 3IDXH 4N1CA 5GRVL 4ZFZB 1IE5A 4ZD3L 5HHXL 4OZGA 1G0DA 1MCOL 1HK6A 1G7JB 1V3LA 3GJEA 2XIDA 1JK8B 2PTTA 3HE7A 3QFDA 5CUSH 4PGBB 4APQC 5J06A 5ACMA 4XZUA 5TE7H 2IQAA 4HIIA 4NQSA 5D7IE 4KVCH 4P57B 4JFXA 4IOFD 5DEGA 5H35B 4PJ8D 1TPXC 3GMRB 5E9DD 5FK9A 4PGEB 3O3AB 1P7KB 4RWYL 3TVMC 3IKKA 1E0OB 2FGZA 5IVXF 5K93A 3VXRB 4OZFA 3P77B 4MQXD 4I0KA 4TVPD 2ICEB 4XBGB 2B8OT 5C9JA 1JGLH 1JJUA 5T1KB 1JGDA 3OXRB 2CUHA 4JZJB 1FGNL 1XF4A 3QNXA 4JFZH 4NDMA 4KQ4H 4KK5C 1MJ8H 5E5MA 2K9UA 4HCRH 5D1XA 4WTZA 4QHMA 3PHSA 4NZDA 3RWGB 5HDBF 3HI6L 1T1ZA 3EO0A 2A73B 4G8GA 1S7RA 1TNMA 2MQ3A 3MCLL 4NGHL 4U1GB 4ZQKB 4DW2H 3RAJL 1JFQH 1B4JH 2B7DT 3SPVA 1E4KC 4L3EB 4IOFC 8FABB 1ZLWH 4PJ8C 3NIFE 4MQ7A 5IB3A 3QQ4B 1ZV5A 1NCCH 1MNUL 3DHMA 1F6LL 2LVEA 1C12B 3D9AH 2VZ3A 2P8MA 5BZWB 2FWOB 1LQSR 4MQXC 1A7OL 4J8RA 5I1DA 2DM3A 3DARA 4LHJB 3WFDH 1QO3B 1XF3B 2X40A 4QGTA 3NCJL 4FNLH 4R4BB 5BV7B 4U05A 1S7SB 4EN3A 1S7QB 3RQ3A 5EOTA 4XNUL 4U1NB 1W0VB 2AEIT 1AD9B 2YUZA 1E28B 2DIAA 3FONA 2FX9L 32C2B 4D9QE 5DUBA 4QRTB 2PXYD 1EEZB 1A6UL 5DMKB 2NY5C 4XBEL 3RI5F 4KK9D 4QRPB 4HUXA 4HG4J 1NAMA 2ZUXA 3QNZB 4K23L 5K59E 3SDDA 1ORSB 4KUCD 5HYFA 3QT2A 2EKSB 3HG1D 4OD2A 4QRRE 1ED3A 1LDSA 5D7LE 2VERN 3MRNA 4ORGB 4F7EA 1QP1A 4TVPL 1VACA 1UM6L 3ARQA 4YBLC 1I3RB 1UC6A 3OKOB 5HHOD 5EC2B 4JFDB 5C92A 1N0XH 2HFGL 2DYPA 1GGTA 1MY5A 1WT5C 3SEPA 1GZPB 1WIPA 4LP4A 2F5BL 5TDNA 4JFFE 1DLFL 4DFHA 3RIAF 5I73C 1RURH 4HHAB 5CEYB 2E8ZA 2NY5L 5D2LF 5SX5K 1AQDA 4LSTL 3TNNA 2OTUB 3MJ8A 3FFDB 5CZXD 3MOQA 5HHQB 2X10A 3OXSA 4KK9C 2AJUL 5DLML 3PWLB 3REVA 1JZ2A 3N9GH 2K7PA 4WFED 4HKJB 4HQQH 3CVHL 9CGTA 2BK8A 3C5SA 3EJYD 1I7TA 4NNXA 5JW4R 3L3GA 4A6YB 5TDPB 2EDFA 3KLSA 4HC1H 2G75B 4N90D 4KQ3L 4M1DH 5GJSL 4OCLC 3WHE0 3T4YB 2YC1B 4M00A 3JTSA 4HSQA 2X70A 5DK0A 4AMKH 5L0QC 4M5YH 5GGQL 1BD2E 4BZ2L 5BS0B 4R4FL 1J1XL 1OAKL 4J4PA 4ZUTB 3KPRE 1A3RL 3JUZA 1G7HB 4JCLA 1JPSL 1HHJA 3H9SA 1H3XA 1KPVA 5I66A 4KHTH 3MQIA 5EU7C 3FQNB 5CZXC 3S37H 4CU6A 3QHFL 1OHQA 2Y5TB 3C5JB 3IDMB 2H9GA 4I0CC 3ROOB 2QQQA 3S3JA 2AJZA 1XT5A 2PO6D 4XPGL 3B83A 35C8L 3U0WH 3MOBL 2NYYC 2OL3A 3EJYC 3QRGH 1NFDA 5DR5L 43C9A 5KSAC 4HUNB 2OR9H 1WZ1H 1HKLH 3R4DA 4F37K 1IGIL 4HEPG 3TBYB 4D0CA 1OTTD 2OX5A 5J6GB 1FNLA 4ORZC 4RX4D 4D0DB 5J13C 1A7BA 5BOZG 3BKCH 5D6CA 4KROD 1YPZE 2MFNA 1J8HD 1H5BC 4RA3A 4YNYA 2WMPA 2VL4A 3FO9B 4L8BA 4Q9RH 3QDAA 2P8LA 3OBAA 4X98A 1I1AA 3MV11 4UMGA 1HHHA 4UNTA 4HUWA 4XP1L 3F7VB 5GRJL 5IEKB 3V6BR 3AMLA 4NPYB 3G5YB 2VUYA 3LEXB 4KRPB 5IGXL 1C1EL 1T22A 2GI7A 1FNEB 4PREB 4U1SA 3LQAH 2ARWA 1A9BB 2ADFL 3T08A 1WK0A 4X8JB 4PJ7E 4OM0L 4EXKA 2BNRB 2PO6C 2CQVA 1HQRB 4JN1H 4ZTPL 4DUWA 3BP6A 5L2KD 4NUJA 3HC3L 2AXJA 1UYWH 2VLJA 1FV1A 4TOYH 3VFVA 2YKLL 3T1FA 1QVOA 5C07B 3WFHA 3EYOB 3NZ8B 1MFAH 1KJVB 3S37X 2VLMD 1OTTC 5JZ7D 3NPZB 4NZTL 4ODWA 3WE6A 4LLQA 4KROC 2G9HB 4Y16D 1AY1L 4LQFH 1FIEA 3IJSA 1ZHBB 2X1XR 1YEHH 4RMTA 4L3CA 4RQQA 5IR1A 3MBED 1F97A 1QLFA 4Y5VC 5D7KE 5DRZA 4ZUUB 1WEJH 4K3JH 1ZLWK 3EFDL 1G7IA 1RPQA 3FOMA 2GJ6E 3QG7H 1X44A 4PRPB 2BRRH 2CO7B 1CVSC 2IMMA 4WHYH 3LDBB 3QQ3B 5CSZA 1I1YA 4P2RA 3H0TB 3T0XA 3UTPE 3MV8A 4MSWA 4UNUA 2MCG1 2V17H 4U7MA 5F89A 1ZANL 4Z78B 2DQEH 2V2WA 3CXHK 4KZDH 3B9KA 1MREH 3IFNL 5HGDB 3BKYL 2A6IB 3DV6A 1WV7T 1PJ9A 5E1AA 1MHCB 3FN0H 3T2NL 4LSQH 2ZPKH 2YA0A 5JZ7C 3BGMA 1A1NB 2VISA 4PS4H 2KZ1B 5D7JA 3QDGB 3HZVB 4JQIL 3QJHA 5J0BA 1HOCB 2YPKB 3BEWB 1HIML 4Y16C 4KVNL 3U7WL 1GRWA 3EYSH 5DRWA 4PGJA 4GRWE 1MEXH 4Y1AB 5D6DC 1H3TA 3RBGA 4O00A 2DL9A 2F19H 3AGVA 4HBCH 3G6JB 1OSPL 2FATL 3ILPB 5IMMA 3MYZA 1Z0MA 3BXNA 2XN9E 5IMKA 4M7LL 1YJDH 3DXAB 3QEQA 3DUSA 4L4TD 2XI9A 3VE0B 1JP5A 1VFAA 1HH6A 3O0RH 3LHPH 2CDGA 4YGVB 1NCDL 4JFHE 3HTLX 5A1AA 5J1TC 2FHCA 2GSGA 2PYEA 3C6SA 3K3QA 5EO9A 4R0LB 4RDQF 2JJTA 1YEFL 2BXZA 5HJ3A 3O2DA 4NKQB 5F7HA 4UUJB 3UCRA 2Q87A 1AGCA 4RAHA 3REWB 5F97E 2UZIH 3VFTA 1JNNL 4XMPL 1K3ZA 1BZQK 4B50A 5KG9A 3QDMB 4YHPB 5ALCH 1NSNH 4PJGE 3C2AL 2WWKT 2NMSA 4OCWL 3DV4B 3W39A 2UYLA 5B21A 3SDXF 2NX5B 3MNVB 2ATKA 4M7JL 1UZ6F 1FVCB 4JPKH 3ARRA 1XFPA 4LARL 1NBVH 4JKMA 5EBWA 4EOWH 3QIWA 5D1QA 3HUJA 1B0RB 3K74B 1LD9A 2ADIB 2ZNWA 5CZKA 4AL8H 1T20A 1AP2A 4GRWH 4Q9CA 3FKUS 3TZVD 2HJFA 4OGYH 3HZYA 3TO4B 5I1EH 2EZ0C 1HHIB 3S5LB 1KIPA 4JJ5B 5I19L 1CZ8L 1IKFL 3BD3A 2VDPH 1AR1D 2BC4B 2HFFB 2OMNA 4Y5XA 5SWSA 1B2WH 2Z93A 4YDVB 3TJEL 3P4MA 4HGMA 4Y5YA 3AMKA 5IT2H 3QZWG 5C3TA 1RSFA 3MROA 2E27L 1JN6A 2OK0L 2DQUL 1IBGH 4LDEB 5AD0A 4JHAL 5HSFA 1TJHH 3O45B 4HWEL 3UDWC 7FABL 3TBSB 3SGEI 3PP3H 4ZDHB 5MEOB 3L3KA 1AI1L 1G7MA 3VFPA 2A38A 2ZZUT 4WUUB 2ID5A 1TIUA 4XVJH 5EC1A 4FXGA 1BFSA 4GJTB 2JB6A 5B8CB 3GB7A 1CXFA 4HPOL 4ZPVA 1A7QH 5GHWH 3TYFA 2OBGA 4M7ZB 1VPOH 4FQHA 5CWSA 1U58B 4YXKH 1MI5E 5ICZB 3CMOH 1UENA 2WIMA 4LLWA 1DQDH 4JFQA 1MJUL 2ZNXA 4PRHD 3RWEA 5IKCB 4M6MH 3GHBL 3DURB 4AK1A 5IFJA 5H8DA 4IRSA 4PJIA 1AHWC 3ZSSA 4UZGA 2CDFA 4LOUD 3WUWB 2OZ4H 3C5ZC 3PIQA 3T77B 4AIZA 3T3ME 1LK2B 1T7ZA 3NCMA 1IAMA 1KC5H 3OJDA 2L7JA 3EIFA 5SWQA 4HMCA 2I27N 5HGGS 4WWKB 3V6OE 5IW3A 3ARGB 3SDAB 1EJOL 3LKPB 4C57C 5IESH 2BX5A 4PB9H 1CTOA 2WV3A 4DCQA 1I8IA 2ITCB 2OL3H 2P42B 3K46A 4CRPA 3BZEB 2C5DC 1JNHA 2P7TA 3QH3B 1CLZL 1RFDH 1T66D 1SYSA 4XPBL 1RD6A 4YR6B 3SGDI 1D5ZA 3O6FB 4H88L 4G6ML 1L7IH 2FBJH 2GTWA 2MOVA 5C7XH 1C7SA 1VERA 4U3CA 4P23A 3MGTB 4LPVA 4ZO8A 5DMIH 4EBQH 3FO0L 1QSVA 2RCSL 1V8HA 4LOUC 4MCYA 3MRIA 4Z0XB 1KEMH 4O2CB 4ELKA 3UYPA 3MLPA 2KH2B 4N0CD 2EIBA 4PB0L 3MV9D 3V52H 5JUEH 4JM2D 4FQ1H 5DC0A 4DGYH 5MEND 4M9OA 3P4OA 2QLVB 1A0QL 1JHLH 4X7SH 2AI0H 3SCMB 4IIQC 1CU4L 3GMQA 1T66C 1BJMA 1NUDA 3WXVH 2ADGA 2LAGB 4XNZC 1JMXA 2WP3T 4P2OA 4Z0BH 1FFOA 2XZZA 3LIZH 1ZK9A 1XCTB 5IOPB 4P2QD 1IGFH 3O2WH 3FMGL 2XWJA 3B8SA 3MLRL 1OW0A 3V0AC 3VXRE 5JHDD 1A22B 1FORL 2O5YL 4HMDA 5ELIA 5LQBL 4Q2ZA 4OKDA 4LDOB 3UTSB 1FN4A 3LRHA 4MLSA 1TETH 2FEDC 3SHSA 3HKFA 3CXHJ 5DUMH 4YK4C 2YEZA 1FH5H 4DZBB 5A2KH 4JM2C 3RUGA 1TTGA 3GSNA 1MIML 3X3GH 3CDCA 5IBTH 4CW1B 1YY9D 4UQ3A 3L3HA 3QPQD 1J12A 1O0VA 1VGKA 2H26B 1U2CA 1A6WH 4F15B 2EC9T 2W65A 3VWJD 1F4WL 3RNQA 1YY8A 5EIVA 1P5VA 2AJVL 4MA1C 5F9OL 4OB5L 3DGGB 5C6TH 4MJ5A 3VFGH 4L3EE 4MD0A 1T4KA 1NGYB 1WFUA 4Z7VF 3QAZC 3O11A 2DMBA 4G9DA 5DI8B 1A8JH 1RUPL 2GQHA 1T83C 4G9FD 4EUPB 2PW1B 2D4FA 1QFUH 1LO5B 2WLYA 1MWAB 3MMEA 5C09A 1EHLL 4V1DA 3W9EB 2E9IA 3RDTD 3VRLE 3BSZH 1E4XL 3DVNB 2C3WA 3ZT5A 4XNQA 1DZBA 1AGDB 5E8EA 1SJEB 5EBLB 3FJTA 5JIKA 5CJOH 1YY9C 4M8QA 3SBWC 1OY3B 5GGSA 1G9MH 3PQYD 3DYOA 2AKRA 2XPGA 4LCYB 1A7RL 1JRHH 4QRPE 2PW2A 4Z7QE 3Q5TA 1KB5H 1DFBH 4TYUA 5J56B 5DJ0A 1MRCH 4P3DB 1UM4L 2JK5B 1YECH 5CIPB 2X9WA 1CL7I 3QRFM 1U8MA 4MDIB 4OZHA 4Q9QH 1CIDA 3PP3K 3IXAA 4QOKB 3MLXH 1IGJA 3VG0H 3SE9H 3RDTC 3QHZH 1J0YA 4U6TA 1U8KB 5AWNH 3V0WL 1HINL 4YHKL 4X9FA 4GSDH 3AAZB 1RVFH 3FT2B 1KLGA 4TTDD 3LMJL 3SKMB 4HKXA 1XZ0A 2FR4B 4TUKL 3UC0H 2IQAB 4WI8A 5DJZA 1RY7B 2NNAB 2VXTL 3Q3GA 1SMAA 2ESVD 2DICA 4KGJA 4PJXF 1U2HA 5MI0B 2V5MA 1KNOB 4P3WA 3UO1L 4L9LB 2D2OA 2E7CA 3JTTA 2DQGH 2Q20A 3WFBL 1RIUH 5FK9B 4KU1A 5BO1H 4JM2F 2EXYC 4OZFB 4XRCA 4NOFA 2V7HA 1A4JA 3FN3A 5DJXA 1P9MA 5H37H 5CEZD 5DO2D 1EO8H 5AAMA 1DQLH 5BV7H 5D72L 3MA9H 4NBZB 2NY3B 4C58B 5CKAA 4QCIA 4OFYA 1S7UA 3FTGB 4NBXB 5BS0E 3NACL 3MRQA 4Y4HD 2HVJA 5DD1H 1RU9L 2X4TB 4PBXA 2AP2A 2WBKA 3L5IA 4CN1A 1AXTH 2P24B 1X4XA 1IAIL 4G8GB 4MAUH 1D5BB 5B38G 1DL7H 4AZ8A 4PJFA 4TTDC 3MUGA 4N1HB 3ZE0F 1FL5A 1FVDA 1AO7B 3VJ6B 2YPVL 5FGBA 1CGUA 2FJHA 1E6JL 1BM3H 1OARH 1N2RB 2IQ9H 3HFMH 3IFOA 2ZKHH 4HIJA 4WW2B 3N85H 4QHKJ 1JHTA 1UA6H 5TFSL 3MODH 2M1KA 1RZGA 1MCSA 3GIVA 5FUOL 5JORA 5LXGL 1TZGH 5I1DB 4FQ2L 3QQ9D 1ZGLA 4LIQE 4ZS6D 3QFJA 1KT2B 1PQZB 1C08A 3SE3C 4IEFB 2YN3A 2GTZA 1HHGB 2IANA 1U95A 2FZ3B 1JNLL 1S7TA 4QWWD 2EDEA 4Y4HC 5ECJE 4Z7UB 4KJPD 1XCQB 5D5MB 1SYVA 5BQ7B 5AEAA 5EORL 2DAVA 4XCYB 4NQDD 1IEHA 1G9NC 4WI3A 3AB0B 4HS6A 4NCC1 3AUVA 3IJYB 2HLAA 1NAMB 1NEUA 4U31A 2VQ1A 1A14L 2Q76A 5EPMA 5C2UB 4KMQA 4PJ9D 2COQA 4A6YH 5A43C 2BFVH 1AGEB 1QQDA 1WWAX 3UBXB 3TP4A 2QQKL 2R29H 1KYOK 4X4ZA 1YEKH 3VGBA 4AM0A 2BNRE 4RMWA 1VACB 3MV7D 3TCLB 2ITDA 1K6QH 2NY7L 3P0YH 5BW7A 1SVZA 4N9OB 5IBUG 5JW3H 5K9JL 5LGHH 5JMRA 5FECA 3QQ9C 5C07E 4ZS6C 1CFNA 4FA8A 5BVJB 2X42A 3VXTA 1N64H 4QWWC 5ERWA 2X9XA 2DTMH 4V2CB 2DQTH 2BSSB 2R0WL 5GISH 5CINL 1QBBA 5L8KB 3SKNA 2OSLB 1G9NL 5BVPH 4DKFH 5K9QI 3ZE2E 5I9QC 3STLA 3U1SL 4F57H 3QA3A 4JAMA 3OXSB 2WINB 1BQHB 4NCDA 3REVB 4PRPE 2CGRL 2PTVA 4R2GD 4TSBH 3EGSB 4LIQH 5KANG 4E0RA 2YD4A 1D9KC 4DTGL 4I2XB 1A6VH 5HDOA 1X7QA 4TSAH 2EDHA 4FZ8L 1F8TL 5ID1A 3GJFH 1BOYA 1KN4H 3O8XB 4OM1H 3WL9A 4MA7H 5JW5B 3BW9A 5JHLH 1OAZH 1KEGL 1D5IH 1ROWA 4LBEA 1N7ML 1PSKH 4X6CB 3QDGE 4GMTL 5D96C 3MRLB 1I1FB 3HMXA 3TWCL 3OMZA 1HHJB 4MZ2A 5I8EA 4P4KB 4TRPH 3OR6A 4LFHG 5I66B 1R5IB 3NH7H 1SBSL 5DUPL 5J4MA 3FB8A 4XX1E 2EDKA 4Y1AE 5GRZA 1Q94A 2AQ3A 3MRPA 2QSTA 5ADOL 4NIKB 5F7EH 4YHML 2H9GB 1R3KB 3G6JE 1MCWM 3RY5A 3HRZA 2V5RA 1WWCA 2A6DB 4LCWA 3DXAE 3GMLA 5GGRY 5LWYL 4F8TA 4ZTOL 1CE6B 1NFDB 5E2TL 5KVFH 5HDLA 3RTQA 2DM7A 2MTPA 3BKML 1XGPB 3M45A 4B7IA 3MO1A 1R3HA 5C0CB 2FD6H 2VO5A 2VQUA 1RUMH 1S9WA 4Y88A 1YEIH 4GXUM 1FL6A 1DQJA 4Z95H 4Z5RB 3UTTD 3X12A 4HUUB 3ARDB 4FTVD 5GGRB 1FYTA 1R6VA 3TH4T 3QUXD 4E42A 3QDME 3MNWA 1W2KT 1IAKB 3AREA 3MREB 4ZO9A 1UKSA 3IYLW 4C83B 4CAGA 4F9LC 4X80H 2X2YA 4RGNB 1FFNB 1N5AB 1X4ZA 1FZMA 1OF2B 1U41A 2DQJH 2IFFH 4BKLB 4HWZB 4PGCA 4NRYB 1WZLA 3OSKA 3MJGX 5IJKA 2NX5E 5IVXA 5H2BB 2HKFL 2GITA 3BP6B 4G80A 5DHVB 3D87B 5C0ND 3T1FB 1OM3H 5AUMA 5D7SL 4I77H 2FRGP 4I18B 5E2UH 2E3VA 3CFKB 4LLQB 5EBMA 1E4WL 3O41B 5DD0L 2ZJSL 5I1IH 4UDTB 3IJSB 4RQQB 3MJ9A 1OB1B 3VGAC 4IM8A 3VXUA 1QLFB 4UQ2A 4U6HA 6FABL 4QXGL 2EYRA 3RWCA 5GGUA 3LKOA 2JB5L 4HK0B 5EA0L 5F6IC 4EI5B 5E2WL 3QUXC 1URLA 1MCJA 1S3KH 4Z9KB 4P46A 4EIGB 4OFKA 3QIUA 1MIEH 3THML 2O26U 2J8UF 4M6AA 4JRXD 4GQ9L 3EYUH 1HKFA 3MV01 5F88B 1ZHKA 2PR4L 5MP6H 1BVLA 5MERA 2H8PA 3GMNA 3QUYD 4WUUE 4XPHH 1O7VA 4P5MA 4LASH 5T1LB 2HN7A 3N1GC 5ALBH 1NC4B 4X7CC 4BFIB 2D7NA 2AAVA 5FF6A 3TPUA 1NJ9A 3I9GL 1HWHB 12E8H 4TUJA 1NMBH 3H9HB 4JPVL 3T2PA 5J11B 3O9WB 1CG9B 2VZ1A 4O4YH 1H3VA 5FKAB 2VR5A 3OKKB 2DQHL 1GGCH 3J7HA 1ERNA 4TQEL 2IAMA 3N1QC 3LS4H 4GXVL 4XHJD 3IVKA 4XWGL 4Q7DA 1IQWH 3VRJB 4I3RL 1U9KA 2G60H 2XWTB 3FB5B 1G7QB 1VFOA 3BP5B 3WS3A 5M94B 5D8JH 1IILE 3R8BB 5SWZA 2CDGB 2ATPB 4APQA 1AD0B 1B6DA 1ZOXA 3FB6A 4HJGA 5K9OA 4ZUVB 2ERJB 4HGWB 1BBDH 1ADQA 1WC7A 3CIQA 4OBSA 1NKRA 3KPPB 2Y36H 3EYFA 4YWGL 4M6NL 3V6FB 5JR1L 3W0WD 5IFHL 1NC2D 4XH2A 3O3EB 1YA5A 3TVMA 3C9NB 4XCFL 2CKBL 3RX5A 1MFNA 4XC3L 3BUTA 1T1YB 1LP9F 2VLKB 2AV1B 4JY6A 5D2LA 3U6RA 5CILL 2LU3A 3B2UD 5KG9B 4ODVH 1F58L 1GL4B 4QHKI 4MHHG 2APBA 2P45B 5CKGA 1AXSB 4XHJC 3W39B 1BIIA 3BX7C 1KYOJ 3OKLA 3C09B 1U3HB 3GJFK 2E7MA 4YDIH 2BDNH 4PV9A 1UQSB 4MJID 3NFSH 3BRFA 1K5NA 1FL3B 3QIWB 3DVGA 5E70A 1A6TA 1IARB 3H9ZA 4YUEL 5IJVB 1HSAB 3HNVL 4YXHH 3KLAA 3L9RB 4PJ8A 4RAUA 3TT1H 5KVEL 3HZYB 1EBAA 4HZLB 2VKWA 3HNTH 2NY2B 1KIPB 2BCKB 3NPSB 5I1GL 3L95A 3QG6B 2A9NL 4LHUB 5HI3D 2Z0BA 3VXPA 1LDPH 3EOTL 1C16B 3MA7A 4JKPH 5JLZA 3HI1A 3B2UC 3MROB 1Q72H 4UTBL 1MQKL 1VADA 3BHBB 2J1KA 3BH9A 5IW1A 2ZOLB 1JI2A 3UTSE 3OV6A 3PNWB 1T04A 4NZRH 2OMBA 2HT3D 5LGJA 4XWOC 1RUKH 1N6QH 5DJYB 3EDDA 1TJGH 3O2VL 3PXJA 5FO7B 5AZEL 5EC1B 3Q6FB 2LU4A 3BKJH 2JB6B 4KJQD 4GKNA 5HYSG 3KPOB 2FGWH 4FHBD 3GDBA 1IZKA 3K1KC 5BRZD 1YZZA 4LLWB 1EAPA 3C60C 3CVHA 4U1KA 3IKCB 3SO3C 3D18B 4Z7NF 4Y2OA 3VXMD 5JOPE 3ZYJA 2BSTB 4XXCA 2EYSA 4DAGL 4PJCB 3GBNH 4K2UL 3D6GA 1IC7H 4D9LL 5HI3C 5J3HC 4M61B 3CD4A 3QCUH 4LSDA 4M1CD 2X4QA 1F4XH 2LQRA 4KDTC 1CD9B 1FNGA 1WT5A 3MFFA 5CEXA 4X6EA 5HHME 3OJDB 2B1AH 1RIVL 4EDWL 1MRDL 3R06A 3VXSD 4ERSL 2YHGA 3TBVA 2BNUB 4M4PA 1Y18A 1QPPA 3WIHL 3CLEL 4J6RL 3LKNA 1J0IA 4XBPA 4XNYH 3EOAB 3QWOB 2YPLD 4UBDD 5DFVD 1INQA 3WNKA 3H3PL 4Z7VB 4KJQC 3S7GA 3QDJD 3NMEA 1KJMB 1NGZA 3NA4A 4MZ3A 1KACB 3CUPB 2BNQA 4WY7H 3ULSB 3HG1A 2Q6WB 3OGCB 4RFOL 1F4YH 4WDIB 3CK0L 4OCXL 1HI6A 4MJ6A 3QWQB 4FP8L 4OT1L 1D3CA 2E6PA 3EUUA 4IDJL 1JYXA 3B9DA 1OAYL 5HHOA 4M1CC 1NL0L 3UTOA 3DYMA 3LN5B 2X4NA 2GW5A 1P1ZB 3KPSB 2IJ0C 3HAEB 1XGQA 1T03L 2CJUH 1PDKA 4NQVA 5HY9A 3SGJC 3UYRH 1OLZA 4QOKE 1ND0B 2P48B 1I9JL 3F65A 4POZD 4HDIA 2VR9A 2J6EL 4XPTH 1P4LA 1U8OA 3P40A 2XFXA 4MHHI 3SJVB 2AW2A 1XGRA 1KCKA 4Y8DC 4YZFF 4UBDC 2EKJA 5DFVC 4JFEB 3OAUL 5EFIA 2DD8L 1HILA 4UT7H 2VIRA 4P2OB 4G8EA 5GZOC 2UWEF 5E7FA 3QEUB 5KSAA 1KJ2B 1YNKH 2XOTA 1VEOA 4AQ1B 4EUPH 3KPTA 4NQTA 1MWAH 1LHZA 3JZ7A 1S78D 2FNBA 1C5DB 4YDLB 5I71B 4JKLA 5GGTL 3EYQD 4M62H 1K8IB 4LSPH 3CSYA 1Z3GL 2X4RB 2FJGB 5DWUL 5HHXH 2DI8A 4POZC 4HXAH 4I4WB 4PJXB 2UY7A 4Q6IB 1A4KB 4AG4L 1T1WB 4X7EC 3MRBA 1JE6A 1NFIB 5C2BH 1YNLL 2AEPL 3RBSA 4HX1A 4G8GE 3KXFD 5DRNB 5CBAB 2JCCB 2B39A 1H8NA 5TF0A 1A7PH 5GS3A 2DQIH 2W65B 1KIRA 4IRJD 3ZDXE 1AO7E 5A3ID 5KOVC 1SMOA 3GMPA 3MRKB 2PO6A 1EA9C 4MJ5B 4YHZL 3IDUA 2EE2A 1FLRH 5C0BD 2F5AL 4Z7WB 3UYOD 3O6KH 2JKXA 2L7UA 5GGSY 3UJJL 1DDHA 3DTXA 4RX4A 1S78C 3KYMB 2EDRA 2Z4QB 3GI9L 5FAAA 1F4HA 3U9PH 2EYTB 1AGBA 4MWFB 2ZSVA 2NY4D 2D7TL 3EYQC 5CGYD 4EQ2A 1EH9A 1IC4L 4OLYL 1AXIB 5I18L 3SDXA 2ZOKA 4FZEH 4UIMA 4XNQB 4Y5VA 1MELA 1JWUB 4KJYB 4TNWK 3VRIA 1ITBB 2CIKA 4ODUB 5DURD 1NCAL 1UWGL 4Z7UE 3TYGL 5EN2A 4ELMF 3IDXL 5D5ME 2M26A 3VI4E 4G42A 4PJ5A 3V5KB 4X7TB 2PNDA 3RAJH 1LO0H 3MLYH 1YNTA 3H7BA 1Z0NA 1ADQH 3WJLA 3UPRA 4IRJC 3B9VA 5CP7A 4FQIH 1TMCB 1HXMA 4X6BA 5A3IC 3MLZH 3TJHD 1WSST 2FYYA 5CUSL 3WNOA 3VG9C 5L2KA 4Y4FB 3WLBB 5DVMA 1EMTH 4DUVA 5TE7L 5DXWA 4KVCL 4H5SB 3D25A 4R97B 5GS1C 1JUFB 2GFBA 4CVWA 2A77H 2VWEE 5L9DH 4W4NA 2Y23A 3GSXB 5C0IA 3V6ZB 2NY4C 3ZT6A 4Y16A 1Z6JT 5JXAH 4OLZH 3ARFB 4NO3B 3GSVB 1KUMA 3MJ7B 2YSSA 2YOCA 1DTUA 2V9QA 4X0KA 1JF1B 1FLTX 1JGLL 5HHVL 4JFZL 5H37G 3VD9A 4KQ4L 1MJ8L 4HCRL 4XBEH 5JPNA 2I5YH 4MXVE 3G5XA 3MRGA 1ES0A 2B5IB 1TQBB 3JTTB 1GAFH 1KJ3H 3TJHC 1NEZA 4CN4A 2F54D 3PWUA 4D2NA 1JFQL 3E2HB 1B4JL 4NQCB 2OQJA 4I2XE 1A3QA 4L9DA 1XF2B 4F37F 5FA4A 3EO9H 4U6VH 4YFDB 5CD3A 2BSRB 1NCCL 2ZUVA 4K94H 1JGUH 3D9AL 4IOIB 3V2AR 3VFSB 1MHPH 1K2DA 4LCIH 3TA3D 5HHPA 3F12A 4OIIH 3CAFA 4FQXD 1GOHA 2WUCL 4X6CE 4U49A 3WFDL 3P3YA 2H6PA 1U92A 4FNLL 1IEAA 3OKDB 4KI5F 2LVCA 4NBYB 4RGMC 2GY7B 4K3GA 5DLMH 1UJ3C 2QQNL 1Q9KA 4LSUH 5T5NG 4WUKL 3ZHLA 4H1LG 1I7RA 1JPFA 1QFWH 2W0FB 4L4TA 4ZAKB 3S9DB 3BMWA 1PX3A 3KVQA 3EW3B 5EU4A 3S4SB 1PD6A 1A6ZA 4MJ2A 2Z31A 4ZNEA 3V0VB 4AT6A 3ESUF 2VLRA 3MCKB 5GGVH 5E2VL 1NFDE 1BLNB 4K71C 1ZGLB 4WTXA 1A6AB 3ILQD 1BVZA 2P5EB 1BJ1H 5IHLB 5C0CE 3D3VA 1A3RH 5BCAA 3TA3C 5A2JH 4FQXC 5HHNB 4NKMA 4JFFD 1HCVA 1UZ8A 4GRLD 3VGHA 2XXMB 1Y0LA 4WGVB 2NLJA 5IQ9B 1INDH 2P43B 2VQ1B 2ADJA 2Q76B 4QYOB 5EBGA 3H8NA 1RURL 4YFLF 4JE4B 1Q9WB 5ESAA 3MLVH 4RGNE 4X5WB 5IB5A 2YD9A 3LD8C 4F7PA 3BQUD 2YK1H 3UJIH 2HTKC 3DX9B 1RJLB 3N9GL 1U93B 5J9PA 3O6MH 1VSCA 1PG7W 1LO2H 1AC6A 4MNQB 4HQQL 1TVDA 4MB5A 5E8PA 3B2VH 3GGWA 1BFOA 5D7IF 1DP0A 5J6HB 3ILQC 2OI9C 4X8XA 1JV5A 2F15A 4J7RA 1F11A 4JZOA 5T1MB 5ANMA 1I8KB 1YUHA 4R6UA 2MHAA 4WHDA 1FRGH 5HYJA 4AMKL 3C5ZA 4M5YL 1BX2A 2FDBP 4XP1H 4NQED 2Q3ZA 1AGFA 3T3PE 4WJ5B 3JWOH 4GRLC 1DEEA 3DRTB 2EE9A 3CSGA 5IG7B 3F6IA 4YHOH 5C0GA 2R2HA 4KHTL 2WWKO 3FT4B 3RI5K 1CFBA 3HE7D 1ZA6B 3JVGC 4E0RB 4NO0D 4DWHA 4MD5B 3L1OH 3S37L 3MV8E 4R8WH 3W5NA 3BQUC 4P9HH 4OLWH 1X5IA 3K2UH 4I13B 2BY1A 5FYJH 2NY6D 3P73A 4GW5B 3ZSTA 4XT1C 3LQAC 1MLCA 2C1OB 1RUAH 5HTSA 3U0WL 3QRGL 1PVHA 1DBMH 2OR9L 4MMXC 3NIFF 1WZ1L 1HKLL 3ULUD 3RWJB 1LWRA 2HWZH 2YA2A 2NPLX 2UZYB 1P4BH 2E7LC 3OX8B 2J8UB 4BZ1H 2I9TB 3BEVA 3EOBB 3FB8B 4HH9B 4K7PY 5E8NA 4XCNB 5F9WC 5D1XD 2HLFD 3RIAK 1JWMB 2VABB 4GBXA 1D6EB 2WLZA 3TNMB 4Q9RL 5EDXA 5DHVH 1RZKH 4XCCL 2AK4A 3MJ6A 1UB6B 4GW1B 2BSED 2VDQH 4P4RA 1DUYA 4IIQA 4GAYA 5CHNB 2HVKB 5TH2B 2HYMA 5TGBA 3UTZB 3VMNA 1CFTB 5FCUL 3LQAL 2FHBA 5GSRB 3ZTJG 4JPWL 5DQJA 2NY6C 3FRPG 4JN1L 5K59F 1GGBL 3WSQH 4XP4H 2OCFD 3TO2A 3VMPA 1J1PH 4QHLA 3VFWB 1S9YB 1UYWL 1DQJB 4TOYL 4OZ4A 5K9KA 4M3KB 2XWBA 3PABA 2XA8H 3BOVA 2RHEA 1QEWB 2X1OA 3GSOB 5IV2B 5ETUA 4LQFL 2XZAH 2HLFC 1YEHL 2GJ6D 2IH3B 1RHFA 3FT3B 4EN3D 1KN2H 4PV8B 4XNMA 4XX1G 4KGLA 3IS1X 2XKUA 3G6AB 1FZMB 2D31B 1SHMA 1WEJL 2DLHA 4JM2A 1RJYB 1QRNB 4HLJA 1WITA 1TQCB 3C8DA 5L7XH 3QG7L 1NCDH 2SEBA 2BRRL 4N9GA 4XTRD 4NC0B 3O6LH 3FAXA 4QTHA 3L5WA 3NCBB 1LP9B 1U8HB 4OAWA 2XG4A 3SDDD 4WO4C 1YEFH 4MGXA 5D71H 1LO3H 1YJDC 1TLKA 5I74B 2V17L 4LPCA 4N8CH 4MMZC 3FO2A 4YHIB 4KZDL 2BOCA 4WU7A 1MREL 5L8JB 3FO1B 5ESVB 1RJZB 1T83A 2H2SD 4LPYA 2X44D 1WBYA 2FX7H 2N1KA 2YUVA 3FN0L 3GBMH 4LSQL 4PS4L 1RZJH 1R3JA 4OQTA 4U0RC 2WQRA 4KKNA 1XGUB 3ES6B 1CFSB 5EOCJ 1VFBA 3SDCB 3LN4B 1HN1A 4YC2B 3RJQB 4JFYA 3EYSL 2AQ1A 5DDHA 3TBTA 1QFWM 1MEXL 3I6KA 1ORQB 2XN9D 5DSCB 4FFYL 1OQOA 5FOBA 2F19L 3DETD 4HBCL 3SBWA 4NCC2 4XTRC 2D9CA 2ZUQC 4LSRH 4DVBB 1YJDL 2X4SA 3SDDC 3ALPA 5DFWH 1XEDA 3O0RL 3LHPL 1OSZB 1U36A 3FHQA 2HT2D 1JYVA 3U9UA 1T3FB 4L1HA 3O3UN 4F9PC 4LMQI 4LF3A 3V8CA 2H2SC 1SEQH 4RZCA 4PJCE 1EAJA 2X09A 3DX7A 5F1NB 2DDQL 2DWDB 3R0NA 5C0AB 3S5LG 1P2CA 4A2MA 3IVKB 1MY7A 1T0NB 3LY6A 5BJTB 1YPZF 3WHXA 1AJ7H 3DECA 4HWEH 2EDOA 3BWAA 4WHCA 4IHOA 3H9SD 4QEGA 4MXWH 5M7QA 4HH8A 2ZCKH 5ALCL 3VFUB 1NSNL 2FL5A 4L8SC 3VXOB 3DETC 4HJGB 5K9OB 1T5WB 3MR9A 3PQYA 2CR6A 3G04B 1JGEB 3L7FB 4KHXH 1O5DT 4N0UA 4JPKL 4ZSOB 5IHUH 4LVHC 2Z8VC 5ID0B 4XH2B 4MDJA 1NBVL 5IB4A 4CNIB 4EOWL 2QQLH 1ZE3C 3UJTL 1YYLH 2HT2C 1K4CA 5E94A 4PJ7F 2CRMA 3V8OA 4AL8L 1ACZA 3S34H 4MLIA 1W0WB 4OGYL 4QRQA 5I1EL 1YEJH 4YIQA 3BH8B 1JL8A 1KTLB 2VDPL 1XIWD 3T0AA 2Q8AH 3KPSE 3B3IA 1B2WL 1DN2A 5IT2L 1I1AD 4OZIF 4KY1H 4G43B 1CGYA 4NN5C 1CDJA 5F7MC 4MCZA 1II4E 1IBGL 3T2QA 4YH6A 3BAEH 1S8DA 4LEOB 3DVGB 2L4OA 1UVQB 1TJHL 3SJVE 2CDEA 1OP5H 2ESVA 1P6AB 5ACZA 3U36A 5FO8A 4QTIH 3ARWA 4NYLB 4C59B 1SBBA 5DMJB 4PJ8B 5E9DB 1JZ8A 1MI5D 4G6MH 3QIBD 3S3PA 4XVJL 3VDCA 1F00I 5IEHB 2XKNB 2YUWA 1K3IA 3W82A 1A7QL 5GHWL 1VPOL 2P47B 1GC1H 3FQXA 3GK8L 2CR3A 5JLZB 1BOGB 4WI4A 3CMOL 2RCSH 1CK0H 2R1XA 2Z92A 1DQDL 3SE3A 3BN3B 4K7FB 3EOYG 1PZUB 2N56A 3MACH 5HGHB 5GS2H 3RPIA 1XIWC 4IS6A 4Y4HA 1TJIH 3TH3T 4HLZH 1CLOH 1I1AC 4NN6C 4JZNA 3OF6A 2OZ4L 4PRAA 4CMHC 4GRWF 4WI7A 2RGSA 1KC5L 1VESA 3FFCB 5FDWB 4K8RD 3IETB 5HPMB 1I7UA 1QHPA 4LLDB 2NZIA 4B7LA 4ZFFA 5KW9H 4P2RD 5IESL 3DSFH 3QXUA 2JCCE 4QT5B 4ZYKA 5IF0A 2OL3L 2IADB 3QIBC 1BZ9A 1CF8H 1N59A 4R7NA 1I8LA 3O3BB 2VYRE 4GG8A 3AM8C 3WUZA 4Z7WE 3HAEH 5F7DB 4ZOCA 3MLWH 4NM4H 1T21B 4JY5H 1L7IL 5D7JD 2FBJL 4LGSB 4WFGD 1OTUD 5C7XL 4MNHA 3BUYB 1Y6KR 5F1IA 2UUDH 2HRLA 3KPMA 2FEEI 5DMIL 4NZJA 3MRJA 1A9EA 3L3DA 3V6OC 2PXYB 4XP5H 1KEML 1Z9MA 4NQDA 3PL6B 2IALA 5IBLD 3L5XH 1KB9K 3QUZB 1QBMH 4NRZB 1NQBA 4PJGF 5JOEA 4HWUA 3VFNA 1KJ2H 4GAFB 4XB7A 3OKYA 3IDJB 3QEQD 4JRYB 3V52L 1PZ5B 5DJCB 1QR1A 4FQ1L 3HG1B 4Y2DD 4DGYL 2N4IA 1D9KA 1NDGB 3LVEA 2DLEA 1F3DH 1GZQB 1JHLL 4UIKH 4X7SL 1KLFA 2AI0L 1HI6B 2X05A 3HE6C 3ZDZE 3WXVL 2R1WA 4RNRA 2BVTA 4Z0BL 4BSVA 5L0QB 3LIZL 3D69A 5FHAH 4GRMA 1ZHLB 5EIIB 2J3SA 1UCBH 3TEUA 1OTUC 2EH7H 1IGFL 3O2WL 2VXSH 2Y25A 3FCTB 3SQBA 3B6SB 5FKPA 5KN5A 3PJSA 1FVEB 1L0YA 1KLUA 3X3FH 1MLBB 3MRRA 4S0TD 4EUPG 4OF3A 2WIIA 5EZLA 1TETL 4GKSA 2DJSA 3ZMRA 5AYUH 2VR4A 5E6YA 3VXNB 2NW3A 5DUML 1I85C 4HWBH 2ZG1A 1FG2B 5I1LA 1FH5L 1R0AH 3V79C 4WENB 1IKNC 2B4CH 5F3HB 4QXTB 4Y2DC 1N8ZB 5IBTL 4GKZA 1KCSH 1ZHNB 1A6WL 1HHKB 4L3ED 4U1MA 3HS0B 1G9MC 1I9IH 1R5WA 4HFWB 4CVZB 5GJTH 4OQTH 5IB2A 4P3CH 4PRBA 5C6TL 2CK0H 4NQCE 3PXHA 4PJAA 4JY4A 1H5BB 5JDSB 3U2SB 2VC2L 3E8UH 4YO0A 1HH9A 4HEME 5DVLA 4NHCL 2WW8A 3LEYH 5F1SA 5SWSD 4KZEH 1BJ1J 1N3NB 4JZJC 1RI8A 4TUOA 2QHLA 1NPUA 5CGTA 1H8OA 3MRBB 1QFUL 1CXKA 3LMJH 5INDB 1L6XA 3INUH 3BSZL 1DANT 1YEEH 1SJXA 2VXTH 3SE8H 3T3MF 4PUBL 2GAZB 3JV0A 4G6JH 5I6XC 3ESVF 4U1GC 3U4AA 4QRPD 1U8QA 1UADC 5HVHC 1AIFB 5D2NB 5CJOL 1G7LB 1G9ML 3CU7A 4OUUB 3U0PA 4KMLB 1JRHL 3G5ZA 1G0YR 1KB5L 1EZVX 4KI1A 1DFBL 1J8HB 2BVQB 4L4VB 4WI6A 4OZFG 3QCTH 5ICXB 4Y89A 1RK1B 4WI9A 4Y5VB 1KIQB 1QA9A 1YECL 2P5EE 4G6FD 2IANE 4JFDD 4Y5XC 1OP5K 4IRSD 1RAMA 2XY1A 2DWEB 3VRIB 4Y5YC 1CFQA 4DEPC 4Q9QL 2CIKB 5DZNA 1WAAA 4FTVA 3DIFA 5BV7C 4NKDA 3TF7C 1HDMB 3MLXL 1RHHA 3QUXA 3VG0L 3SE9L 2GT9A 4G42B 3QHZL 4QXUH 1CWVA 4AH2A 4YDKH 2ZG3A 1J5OH 5E6ZA 1KPRA 2R2BA 4NO5A 5AWNL 1U8IB 4G7YH 4DN3H 3RVWD 1CTNA 2VUOA 4GSDL 4PGDB 1QHOA 1RVFL 5C0JB 2APVA 5L2KB 2VDKH 1EEQA 1FE8H 2HJKB 4PP2B 5FUOH 2DQGL 1RIUL 2MSPA 5BO1L 3P9LB 2YBRB 4MNQE 5DJ2A 4HAFA 2CKBA 1ITCA 1D5MB 1RULL 3MBEB 5MEQA 4P23D 1OGAB 1ZEAH 1A2YB 2DL2A 1SY6L 1EO8L 4IRSC 1DQLL 2VSDA 5DT1H 5BV7L 2HG5B 2A6JB 4U6XB 3MA9L 2XRAH 2E7HA 1ZLVH 3KJ6H 1GGIH 4YBHA 1TVHB 3LKSA 5DJ8B 2I07A 5JPNB 2DS4A 3PWNA 5KSVA 2CLRA 3I02B 3RX8A 5DD1L 2R4RH 1E27A 1AXTL 1CDUA 3RVWC 4JRXA 5C0EA 1DL7L 1X3DA 4HKBA 3HC0A 3TBWA 3ZKXB 4WW1B 5BMFH 3E1F1 4HAGA 3CCHA 2UUDK 3PG2A 3P0VH 1BM3L 1OARL 1YMMB 2WANA 5KSUA 4BZYA 3BPOB 2IQ9L 5F1KC 3UBXG 2X1QA 3HFML 3QJFA 1MJJB 2ZKHL 2R8SL 3N85L 5D1ZB 2V2TA 1UA6L 2P8PB 3MODL 3L7EA 4R96B 2DM2A 1TZGL 1MCKA 1V7NH 3ULVE 5F9JA 5HXMA 3S97C 1FFPA 3A6CH 3DVIA 3MGOA 4E41A 3GRWH 4JFOA 4HUKB 1I7RB 4JQXC 3VRLF 1MVUA 2YRLA 1GHFH 3MRDB 4KRPD 3WN5C 3WNMA 5EU4B 3OR7A 1BQHG 2EH8H 1KCVH 2CIIA 5EU6A 4MXQD 1H3GA 4A6YL 3BDBA 3OG4B 1NC2A 1NAKH 2R29L 5C07D 4O2FA 4Z7QF 1CQKA 3VFOA 5EOQH 1G6RH 1J0ZA 1K6QL 1OW0C 1BHGA 3P0YL 4PR5A 4WI5A 5DD6A 4X99A 3RA7L 3X14A 5JW3L 5LGHL 1D6VH 1IAOB 4PTTA 2DQFB 5JO5A 2XQBH 2G5BB 4V1DD 2BHYA 4PRIA 1Y0LB 1N64L 3NFNB 3VGFA 5BZDA 2DTML 2DQTL 4LLAA 5GISL 2UWEA 1U8NB 4PRPD 4MJIA 1T5XB 1MCIA 5BVPL 4WU5B 2O5XH 3WIHA 4DKFL 4LVNC 4KRPC 2R2EA 5LWYH 5IB5B 3PHOB 4F7PB 1QRNE 5I15H 4U6YB 3W9DA 3E6HB 4X5XB 5T5NF 2J5LC 3TZVB 5TDOA 4QRRB 4MXQC 3C60A 4TSBL 3LSOB 5I1AA 3P2TA 4LIQL 3DX8A 5DEFB 1ZSDA 1T6WA 1JV5B 1A6VL 2FCBA 4TSAL 1BBJA 1WBZA 2ARJA 1AHWB 1Q9LA 1S5HB 4Y19B 5GIRA 1LVEA 3P30H 1KN4L 4U33A 4KDTA 2OTWA 4P9MH 4OCYH 4ZO7A 3CDYA 1AKJA 1OAZL 1EHNA 3GSQA 1D5IL 5EU5A 4HIEB 1DQMH 1PSKL 5J12B 3RNKB 3BVNB 4TRPL 1DVFB 5C0GB 3PWJA 2X4UA 2O61B 3NOIA 3NH7L 2J6EA 4RISH 3IDIB 2EDBA 1FJ1A 2Q7YB 3NFPA 5DA0B 4E9LA 3NN8B 5KSBA 1CT8A 3DXAD 2G2RB 1J87A 4K7PH 5F7EL 4F80A 2Y1VA 1QZ1A 2KDGA 5F8RC 5BRZA 1Y6MR 3CDGB 4BFEA 1PG7H 3O4OB 2EO1A 5CBEA 4PRHB 3EKCA 3VXMA 1ZS8B 2ZJSH 1JF5A 2MCPH 3WXWH 5KVFL 3MRMA 3MFGB 1QNZH 2GJZB 1M7IA 3SGEH 4H26B 4L8DA 4G7VH 1CDHA 1BD2B 4QY8B 2BVOB 4ELMA 3RZCB 4D94A 2FD6L 1RUML 3E3QC 5GGTA 3VWKB 3QBTB 4H25B 4WVRA 4X9BA 4EDXA 1YEIL 1GGYA 3P9MB 4OFYD 3SGJA 1NMAH 4W4OC 5C0AE 1XF5A 4P59H 4WHTB 4CADB 2J7LA 1FO0H 4KKLD 2Q86A 3WLWC 4C56A 1I8MB 4MJ4A 3KPQA 2I9LA 2YUXA 2YPLA 2NX5D 1S7VA 4M8VA 3DX6A 3VFMA 1QSEA 1YMHA 4XB8A 4XNZB 4X80L 3DI2B 3KYNA 2DQJL 4F33B 1MCEA 4PJBB 3I6GA 3OKMA 2XTLA 1ZLVK 4ZSOE 4F3FA 4R0LC 4YPGB 4TNVF 5F7WC 4HS3A 2ZSWA 2QKIA 1N0LA 1OM3L 3TO4D 4U1LB 4I77L 4K7PX 5E2UL 1CDCA 3C6LD 5CS7A 1N5YH 3VCLA 2LAAA 4FXKB 5A2LH 1XGTB 1PG7X 5I1IL 1I1RA 2D0HA 3MLUH 4J3VA 3KPNB 4UT9H 2DMCA 4PJHB 3MV9B 2GCYB 3GO1H 3IJHA 1MCFA 2XQYK 3SGDH 3IF1B 4O58H 1K4DB 4GAJH 5MENB 1H3UA 5AYQA 3NCYS 1S3KL 3L5WB 2VXUH 3P0GB 3ZE2F 1MIEL 4MA1B 4YWGH 3ZHKA 2EIEA 1CDBA 3EYUL 5FYKE 2NCMA 4P2QB 5E9DE 2BOCB 5MP6L 2EIDA 1A1MB 4XPHL 1IL1B 5JHDB 1WBYB 1L0QA 3TO4C 5F93C 4LASL 4TVPE 3MLSH 4OZIB 3WKML 1R3JB 4YAQB 1F58H 3M17A 4ZFGH 3C6LC 4CBPA 5ALBL 3LS5L 1PLGH 2X1PA 4NNYB 12E8L 3DWTA 1EGJH 4JFYB 1NMBL 3RWDA 2C3VA 3MYJA 5KS9A 1GGCL 5ENWA 5LCVH 3LS4L 1F2QA 2VSCA 3UX9B 3ARGD 2X5PA 3SDAD 4HCRA 3SKJH 4LLMB 3VDBA 3PWVB 3PGDA 4IRJA 1IQWL 3VWJB 3FFCE 3RWIA 4I48A 2G60L 1A21A 3E6FA 3D5OF 4IJ3C 3P11L 4JREB 3D39A 4PBWD 4NO2B 3G6JF 3WDHA 3FQUB 3U7YH 4OKVA 1KTDB 5C0BA 5I1GH 5EO1A 3NIDE 5GS1A 1F3DJ 1FP5A 1BBDL 4BSWA 4G9FB 1U8JB 2Y36L 4I1NB 4I3SH 1VFMA 2AJYH 5EUOB 5BW7C 5JQHC 2GSIA 2A83B 1LE9B 1U8LA 1M05B 3QXAB 4YGAB 3RDTB 4YBQD 4PJEA 1FZOA 3RKPA 4LHUG 1KCRH 4ONGL 2H45A 3QR2A 2B20A 3BWAB 4KKBD 1MRFH 4NHUA 5B38A 4ODVL 1CN4A 4P99A 3CFCH 2MKLC 3P4NA 5FYKH 4WWKC 3OL2A 5I17B 3ARGC 3SDAC 3PQYB 1BQSA 2VH5H 1C5CH 3OKEA 2FSEB 1TZHA 2BMKB 2WBJA 4N0UB 4YDIL 2BDNL 5D7IA 4KWUA 3SCMD 3U0TA 4L1DA 3A6OA 3KGRA 4HMEA 4JRYE 5IB4B 1HXYA 2VXVH 3HG1E 3OG6B 4JDVB 1VGEH 3RTQD 1Q8MA 4O9HH 1V7MH 3O6FC 4YXHL 2QL1A 2X1WL 3RGVB 1TITA 3PDOA 1F6AB 3TT1L 1EEYB 3FOLA 1TCMA 1BVKB 3AXLA 4QRQB 1RK0A 3CH1B 4I9WD 1DQQA 4HG4K 4WNQA 3HNTL 3EDEA 4WEMB 4YBQC 1LEGB 2VN7A 1TFHA 5DYOA 4LL9A 3IDGA 1LDPL 4JKPL 4KKBC 3UTSD 1J9CT 1Q72L 1TTFA 3WIIH 1FYTD 4PRNB 4IRZL 4NC1C 1U8PB 5CCKH 1UJ3A 3K4AA 4X4YB 3BE1L 3ARED 2ESVB 1CL7H 3BPCB 3U36B 4F2MB 5GRUH 4NZRL 3WNLA 1RUKL 4HLZG 3SCMC 1N6QL 4O2EB 4Z76A 2FH8A 2F54A 2VL5A 3BKJL 1CICA 2H32B 2FGWL 4LU5H 2ICWA 4IDLA 4R26H 2R56H 3MZGB 4N90E 3U46B 2R1XB 2Z92B 3UP1A 4Q97A 1RZIA 2BJMH 2KL6A 3BP4B 3H42H 4FQLH 1NLBH 1WIOA 5DHYA 3EHBD 3GBNL 1IC7L 1I9JH 1X6NA 4FQXA 5C0FA 2AEQH 3QCUL 1VKXA 1F4XL 1YQ2A 4TNWF 1KG0A 2X4PB 3HAEG 4D3CH 1ONQA 5D93B 2A74A 5F7NC 3D85B 2B1AL 4I0PB 3I6LD 1A5FL 1WWBX 3C8KB 4JFPB 3CFIC 4QRUA 1R3LA 4XNYL 2Y4SA 1BZ7B 1QFPA 2QADB 3MRCB 5IF0B 3ZKQD 1FQ9C 1S9VA 2X7LB 3CFEA 1F3JB 2NTFB 5I16A 3T04D 4F15C 5I2IA 1M71A 5FV1L 5D2NE 5D7LA 1EHAA 3QWRD 3F7YB 4WY7L 3T4AA 1SJHB 5GGTH 5DTFB 1BEYH 1R24A 4KK6D 3CX2A 1F4YL 3BZ4B 1IM3A 5F1IB 1LE5B 1QKZH 1B4RA 1J8HE 1NGXA 3JBG7 4L4VE 3KPMB 1IM9D 1T1XA 4JFFA 4HUVB 4S1RL 1KCLA 5EZJA 1JTOA 2AV7B 4GRLA 2IAMD 3HB3D 2J8OA 3UYRL 1PYWA 2IBZX 4ODHH 4DVRH 5DK2B 4C4KO 1TCRB 4PJ9B 4XPTL 5D9SA 2EE3A 3JVGA 4I8DA 5C08D 5SWZD 3V5DB 2F58H 3BQUA 1JBJA 3MV7B 5C0DA 5L2KE 3VFPB 5GSVA 1WVZA 4UT7L 3T65A 1LNUA 4GOSA 4AEFA 4BSVB 2HRPH 3GI9H 2VLME 2D7TH 3RPKA 1G7PA 2FIKB 4KK6C 1YNKL 4UU9A 1NLDH 1JPGA 5I18H 3GSUA 4GUPA 5D96B 3TT3L 1FNHA 1ZWIA 1KOAA 3QNYA 3KPRA 1MWAL 3L3IA 3MRRB 5JW4M 3X11B 2Z91B 2E7LA 4XXDA 2R2CA 5IW6B 4M62L 1OGAE 4OCSH 3PHQB 4LSPL 4NKOB 1IC5H 2IAMC 3HB3C 3ZO0A 4MX7A 3FRUB 5IK3B 4HXAL 5GPRA 4X4XA 3U4EB 2GYSA 4R2GB 3FQWA 4EI6B 5I1LB 3IAPA 4ZPTB 3V5HA 4NO0A 3JV6B 5C2BL 5L2JB 4GKZB 1MF2H 3S88H 3ZYZA 2DI9A 4LKXB 4L9LC 3TN0B 1A7PL 4U1JB 4LK4A 2DQIL 5FB8A 2XNAB 2C3GA 1R5WB 5E24E 5MEPB 4FABH 3SQOH 1MUJA 2E9JA 3B9EA 4N5UA 4PJAB 5ILTH 1YMME 1FLRL 1YPZA 3O6KL 5CFHA 5T3ZE 3BMVA 2W60A 1N4XH 2DLFH 3AVEA 3Q1SH 1FCCA 4XP9H 2NY3C 4OTXH 4MAYA 3U9PL 5HHVH 4CMMB 4Y4KA 1AE6H 1RZFH 3EDFA 4FZEL 4HKZB 4OV5A 1D5XA 3KG5A 3O3DA 3ORJA 3GM0A 5IVZB 1K9TA 3I75B 2VJXA 4I5BB 3M1BA 3CZFA 1FAIH 3BT2H 2ILLA 4PJ7A 1U91A 3PGCA 3BPNB 3PP4H 2AJ3B 1DUZA 1LO0L 5IHBA 3MLYL 1X5LA 3U0PB 3MRHA 1ADQL 3OTTA 2YZ8A 4WO4A 1Y6NR 4FQIL 3KPLA 3KYOA 3MLZL 4PYHA 1BFVH 1MCHA 1S7WB 3JWDH 3TCXA 4UOW1 4Q74A 1EMTL 5CMAB 3WDJA 4RSVA 2Z9TA 4P5KA 3EYVB 5LGKA 4JO3H 3UTTB 3H3KA 2A77L 2WUCH 1WIUA 5L9DL 2X6MA 4FTVB 2D4DA 3CH8A 1HEZA 5JXAL 2C3HA 4OLZL 3DO7B 4CUCA 4K94C 43CAB 2GJ6A 1IVLA 5C71A 3OHXA 2QQNH 2VDNH 3JWNC 2OM5A 4NO5B 4WUKH 3N1MC 5DRXB 2YD8A 4NQXB 2BHUA 3GSRB 1QFHA 4OIBA 3DLQR 3AB0C 3IAQA 3O4LB 5TQ0H 3N06B 2I5YL 5T3ZH 4J1UA 5E2VH 1FZJB 4Y7MA 4G8FB 1GAFL 3RWHA 1KJ3L 2BNQD 1F90H 4PTUB 2HMID 1FZKA 2FJFB 2VITA 2VWEC 2IGFH 3S4SG 2CD0A 2C7UA 3DBXA 4XXCC 1Q0YH 4F9PA 3O8XD 1X6LA 5CJXC 5JQ6H 3UTQB 1EK3A 2VB5A 3EO9L 4U6VL 4IMLB 1MQ8A 4Y19E 1MFEH 2XQYG 2OXGA 4K94L 1JGUL 1MHPL 3D0VB 4P4KD 4LCIL 1W72B 4OIIL 4H1LB 2XN9A 3LPGA 4W6YB 3ECBA 2DOCA 3FQTB 4L8SA 5JOFB 1Q38A 3R1GH 4KMTH 5E4EC 4ISVB 3QUYB 4LSUL 4ETQB 1QFWL 2EECA 3L6FA 5DJ6A 2HFEA 1YC7A 1CD1B 1RZ8B 2Y5EA 2HMIC 3D1MC 2NYYD 5KSAD 3ZDXF 4XVTH 4N0YL 5EZIH 3GI8H 5IIEA 1EUTA 1N6UA 3TIDA 4PRHE 4U1IA 1FNAA 1XR9A 3LRSB 3O8XC 4MA3B 5GGVL 4M7KH 4Z77B 1UXWA 2VZUA 3HPJA 1S5IH 3SY0B 2YMXH 2PYFB 4HT1H 5FYJD 3G08A 4XI5D 4BH7B 4ZUSB 2JTDA 4AENB 4LNRA 3WEXA 3IFPA 5IMOB 5F8QC 4WW2F 1FFPB 2HAZA 4GQPH 4JGJA 4PJGA 4P4KC 1DBKL 2IG2H 2XKSA 1OAXH 2OR7A 1ZA3A 3ARDD 3D2UA 4UDUB 5JIHA 3D0LA 4PBVC 2OZ4A 2OYPA 3I3DA 5EG6C 4BUHA 5HYSA 4G3YH 4DK3A 5FIEA 3JWOC 1INDL 4Z7UF 1HSBA 1ZT7A 3L3OA 2FECL 2DN7A 2EEBA 5D5MF 3VI4F 1VEPA 2ED8A 4PG9A 4P2CG 3W0WB 1T7XA 3MLVL 3HR5A 4LLVB 2OJEB 4ONHA 4N8PA 3CC5A 4HV8B 4O51A 1R5VB 4PJBE 2EIZB 2YK1L 1KENH 3UJIL 5DJDB 2Q3AA 3VFOB 2GK0B 1EXUB 4P9HC 3O6ML 2F8OA 1LO2L 5DD6B 3X14B 4WFHE 3B2VL 3BO8A 3WIFB 4XI5C 2JLLA 1RJCA 3PGFH 1YN7A 2NTSP 1XIWA 1FRGL 1QD0A 1QSFB 3ARDC 4R3SB 4RFNB 2APTA 4QLRA 4MJIB 4D0BB 4XCCH 5FCSH 4PJHE 3MV9E 3JWOL 1WFNA 2D03H 2CLVA 4MB4A 4RGNC 4GS7B 2FH6A 4PJ5D 5MENE 4H8WH 5IMLA 4D8PB 5IM7A 4YHOL 5FCUH 4JDZA 5CJ5A 4JPWH 4MXVF 1GIGH 4AYFA 4F7CB 1MAKA 1MI5A 3FB7B 2D0FA 1RZKC 3GMOA 1GGBH 4L8CA 3QIBA 2NXZD 3L1OL 1XR8B 1OGTA 5IHZA 3HZMB 4R8WL 5IWLC 4P9HL 5E56A 3ARVA 4OLWL 4X6DB 2AXGA 3AM8A 2AGJH 5T1LD 3K2UL 4P2QE 4I18C 5JIIA 2Z35B 3QUMB 5FYJL 1NC4D 4JVWA 3EFFA 1CCZA 3VMOA 1B0WA 2DKSA 4ZUWA 3HI5H 5JHDE 3IFLH 1RUAL 1SEBA 2IPKA 3O9WD 4OZIE 1DBML 2YWZA 2R69H 2HWZL 5DGRA 4S10A 1JCKA 4CDHA 3H2WA 2Q8BH 3V6OA 1DEDA 1P4BL 4H0IA 4ODXA 4BZ1L 4FQJL 2OR8A 3UZVB 5DJAB 1A1OB 5E03A 3DRQA 4QRSB 4KH2A 2F53B 3MLTB 4RMUA 4HK3N 1AC0A 1HQ4B 1M7DB 4X6CF 3RIFF 3DJ9A 3PUCA 2PF6A 3WJLC 5HD8D 1RZKL 3RRQA 3FQRB 2IF7A 4JDTH 2VDLL 2LTQC 2VDQL 2CO6B 5CP3H 5IFAH 1M7XA 1YDPB 2NXZC 3HE6A 1B0GA 1EFXA 2AXFB 4A2LA 5IUSA 1UH3A 2DKMA 5ISZB 2Y7QB 2E8YA 1OP3H 3WSQL 4G9FE 4XP4L 4RAVA 1NFDF 2VLKD 4LNVA 1J1PL 5JNYB 2APXA 4F7TA 5J11C 3DSNA 5EUOE 3O9WC 3RY4A 5I75B 2VNCA 5E6IA 3VXSB 3G9VA 4PJDB 3JV4B 2XA8L 3ZLQC 4FFWD 1U6AH 4FFYH 4ZFZA 2I9LB 4WIQA 1RZJC 3NCFB 3SKOB 2XZAL 3OWEA 1G7JA 1K8DB 3WYRA 5I8OH 3QDJB 1JK8A 1KN2L 1I85A 1I3UA 4LSVH 1MVFA 3PQYE 4PGBA 5HD8C 1UJTA 1IKNA 4KRNA 5DMGD 4Y2DA 1UWXH 3V7AE 4N0UE 5L7XL 3I6GB 1PKQB 1CE1H 3ZTNH 4X6FB 4P57A 5AG8A 5ICYB 3BRGC 3LH2H 4S1DD 3O6LL 4K55A 5H35A 4PG2A 1TVBB 2QKIB 3GMRA 2Z31D 4URTB 5DGQA 3DNKA 4PGEA 2VLRD 3O3AA 5A16B 1P7KA 3X13B 3STZB 3ZHDA 5D71L 1LO3L 3RWFB 2DDQH 2EZ0D 1P53A 3P77A 2R0ZH 1QG3A 4LHUD 1KB5A 4N8CL 2ICEA 4UOW0 3D3VD 5T1KA 1CGVA 3OXRA 1MCPH 4JZJA 1BJ8A 5LAXB 2ZP0T 4NRXB 2FX7L 5I8CB 3IJHB 3GBML 4FFWC 1RZJL 1IGTB 2NW2B 3RWGA 3C09C 1NDMB 2A73A 1DN0B 3T3PF 4JG1H 5I76B 4CVXB 5MHSD 4ZXBB 3VGGA 4ZQKA 2ESVE 3HPLA 5DMGC 4RFEB 1QLEH 4JGUA 4K9EH 1I9EA 5HYQB 3CVIH 4YHYC 1BQUA 2IMNA 3UJTH 4L3EA 4S1DC 2GEEA 1IC1A 8FABA 3NIGE 4BFGA 2Z31C 4LSRL 4PIRF 3KYKH 2V7NB 1C12A 5CJ8A 1QUNA 5CEZE 2WM0A 3Q2CA 5BZWA 4S1QH 2FWOA 3V9FA 4KFZC 4LCCB 1KPUB 3A6BH 1P4IH 1X4YA 3LEVH 3OZ9L 4KJWD 1Q9OA 5DQ9A 5HYJD 4OD3H 1QO3A 1SEQL 2RAMA 1XF3A 2CRIA 4PY8J 3N1FC 2C3VB 4X9IA 1SY6A 4X4ME 2QR0B 3C5ZD 4R4BA 5ENWB 1S7SA 1S7QA 2RFXB 5H94B 1ZT4B 1W0VA 4HGKC 1AD9A 3KXFB 4H0HB 3TIEB 4R7DB 3GFUA 4G6AC 4L29B 1E28A 32C2A 3KWWB 1Z5LB 1AJ7L 4QRTA 5GS2D 4RIRA 1J1OL 1EEZA 4E5XB 5DMKA 3E6FB 3NGBB 4MXWL 4QRPA 2ZCKL 3VG9B 3QNZA 4EJ1C 4OD1H 5C0BB 4R9HA 4OGXH 1ORSA 5HYIA 2H3NB 1PY9A 2KUTA 5GS1B 2EKSA 4KHXL 4QF1B 3GK8H 4Q58C 2A6KB 5IHUL 2ORBH 2DLIA 4ORGA 2EDLA 4D9RD 3QQNA 3CXDH 2QQLL 1I3RA 1YYLL 5EU3B 3WFEH 2IEPA 3OKOA 5EC2A 3S34L 1U3ZA 3HLAB 4JFDA 4KJWC 4NHUB 3ROLB 3NAAH 3RL1B 2AK1H 1GC1C 1GZPA 2QSCH 1YEJL 1JYNA 4XGZB 1J18A 5EZOH 4GG6B 4HHAA 5CEYA 1CDYA 3FL7A 2Q8AL 4NQDE 4GBXD 5ITFB 4PRDB 2OTUA 5KVDH 4KY1L 3FFDA 1ETZB 4LLYB 1CXEA 5HHQA 1UACH 2GK2A 2H32H 1LEKB 2AK4D 2FHFA 4JFED 5CEZH 2JIXD 1S9XB 3PWLA 4QHUB 3BAEL 3AU1B 3TESA 4HKJA 4EQ3A 4XMKH 4QTIL 1MFDH 3MV7E 4QHNB 5CGMA 4A6YA 1WISA 3P4LA 4LP5A 2YC1A 1EJ6A 1RZ7H 2N7AA 4Q6YA 1CXHA 15C8H 5FGCB 3IDGB 1UXSB 5BS0A 1GC1L 3KNBB 1CBVH 4NT6A 4ZUTA 1CK0L 1NBZB 3LV3B 3HA0A 1QBLH 1RQ5A 4AIOA 1G7HA 3OJ2C 4AQOA 2FEDD 3MACL 4RGMB 4IMKC 1UJ3B 1UWEH 4WRLA 4HXBH 1TJIL 4GBXC 4G8IA 4JQXA 1CLOL 1CGSH 3FQNA 1FCGA 5EO0B 2Y5TA 3C5JA 3WN5A 3QEHB 3IDMA 1OP3K 1FSKC 2F54B 5KW9L 2ICWB 2QSVA 2A0LD 3DSFL 4LGPB 3PV6B 1RZIB 1UEMA 4POUB 1TDQA 1LO4H 5BXFB 3DYPA 4RMRA 3U83A 1I7ZB 1PEWA 2D3VA 4PJAE 3TA3B 5J6GA 1CF8L 4YDLC 4D0DA 5HYEA 5I71C 3T09A 3GJFA 3MLWL 4NM4L 1DBJH 2VAAB 2R23A 4JY5L 1ONQB 4OCMC 1UWXK 3FO9A 3V4UH 1BAFH 4FQQA 1SM3H 4PJCF 3IGAA 1V05A 4NSKB 4Q6IC 5DZLA 3VFRB 3F7VA 3DUUB 5ESQB 1ZT1B 5DK3A 1OAUH 5IEKA 5DQDH 4NPYA 3G5YA 1R3LB 4M3JA 3SO5A 4XP5L 3LEXA 2C1PB 3L5XL 4PREA 1UFUA 1QBML 1NGQH 1A9BA 4PD4J 4X8JA 4XAKD 1JF6A 5DHXB 3R8QA 2BNRA 4LKCB 1KJ2L 1HQRA 3KHOA 2A0LC 5TE4L 4Y4FD 1GYAA 2OI9B 2DIBA 4UIKL 1BECA 3M07A 5C07A 2B4CC 3EYOA 3NZ8A 1KJVA 2VC2H 4NHCH 2AJSH 4EXPX 4NM8H 5I1CH 3MNZB 3HZKB 1FC1A 2G9HA 4EKXA 3F5WA 4LCUB 5HHMB 5FHAL 1ZHBA 1CXLA 2X4OA 5DA4A 4J3WA 3UTTE 5B39B 1NKOA 1UCBL 1JPTH 3QULB 4JN2B 3T8XB 2EH7L 2GUOB 2VXSL 5DVNA 1WAAE 4FTVE 4ZUUA 2R9HC 2P5WB 4U1HA 3DHJA 4DKEH 1FHGA 3X3FL 2PCPB 2V2XB 4PUBH 3E0GA 4BYHA 4FOMA 4PRPA 5EUKB 3C2SA 3QUKB 3CFJB 3ZYOA 4S2SB 4RDQG 3QQ3A 5AYUL 3HCVB 1P7QD 1NBYB 2DF3A 3O4LE 3H0TA 5GRXG 3CFDB 4HWBL 3BIAX 4Z78A 4Y4FC 1R0AL 2B4CL 5HGDA 2A6IA 4YDJB 4UU9B 2EXYD 1IGYB 2V5YA 1JPGB 1KCSL 4M9PA 4NQCD 1MHCA 5D70H 1ZWIB 3QNYB 2R1YB 5HGAB 1A1NA 3L3IB 2DQDH 5E2JA 3QDGA 2OLDA 1I9IL 3HZVA 2YPKA 5GJTL 2Y07H 4OQTL 4RBPH 4P3CL 4J3SA 4NN7C 2CK0L 4NQEB 3LN9A 1B9ZA 3CPLB 3BZFB 1KULA 4ZFOL 3E8UL 5K9QG 4W4OA 4Y1AA 3T1WA 4OSUH 4OZGB 4PPTA 3LEYL 2CXGA 4KZEL 3B5TA 2W59A 3WS6A 3GJEB 1T89A 3G6JA 1OWRM 3BP7A 3ILPA 1H3PH 2PTTB 3HE7B 3OKNA 4NO0B 3QFDB 4JPIA 1U3JA 3INUL 4XZUB 3DXAA 1BIHA 1YEEL 2VDRH 1DQTA 3VE0A 1UM5H 2B5IC 4HIIB 4NQSB 4ZAKD 3SE8L 4LGRB 4JFXB 4YGVA 4XMLH 3RJDA 5DEGB 4JM4L 4G6JL 2K3TA 2AVGA 1QYGH 3E2HC 4R0LA 3HRPA 1HE7A 2JCCF 2RR3A 1RULH 2VN4A 4UUJA 5C9JB 1SY6H 3EBAA 1JGDB 3IRPX 1XF4B 3QNXB 3W11C 3AS2A 4NDMB 2GIYA 4Z7WF 5E5MB 3REWA 5D1XB 3QCTL 4QHMB 4WI2A 1INEH 4JVUA 3QDMA 4YHPA 4YJZL 1T1ZB 3VU2A 3EO0B 2B2XH 5E8DH 3DV4A 3OF6D 3RU8H 3M1BB 1S7RB 5HVWA 3LQMA 2NX5A 3MNVA 4QXUL 4N5ED 1FVCA 4YDKL 2Z8RA 1J5OL 1JZ6A 4PY8I 4ZAKC 3SPVB 4G7YL 4DN3L 5JPMA 3LKRA 4MQ7B 5IB3B 4YLQT 1B0RA 1YC8A