2XXFA

Cu metallated h254f mutant of nitrite reductase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGFGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 95
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xxfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xxfA02
1ZV2A 1E30A 4KOCA 1E5YA 5B7FA 3EHBB 3IEAA 1BQRA 1W6LA 2FQEA 2XU9A 3IN0A 2AZAA 4AZUA 4N4YB 2BHFA 3QJQB 5D4HA 2UXFA 1M56B 1OE1A 3WIAA 4UANA 2WO3B 1GR7A 2PP9A 3FU7B 2HX8A 2IDUA 1XB8A 2R7EB 2WSDA 2BZCA 2HX9A 4G71B 9PCYA 1MZZA 4JHUA 4BK5C 4A2EA 2TSAA 3FSZA 2WO2B 1JZJA 4BWTA 4A2GA 2TSBA 5TK4A 2ZOOA 1W8EA 2PP8A 3ASNB 3QJRB 2XV0A 3NJLA 1L9RA 2XV3A 2IDSA 4FAAB 5I6LA 1N70A 2BW5A 1SFDA 2GHZA 4NAJA 4HHGA 3TU6A 4A2FA 4E9TA 1GY1A 2FT8A 5I6OA 3IBOA 1E67A 4YVNA 2HRHA 2PPDA 2XX1A 3QQXA 4G72B 5PCYA 1SF5A 1JZFA 1WA0X 3V9EA 2XXFA 3T9WA 3SBQA 3NJHA 4L0PB 1HAUA 3QJUB 1AS6A 1PLAA 2XV2A 2YQBA 4UAHA 4NB7A 2DWSA 3ZBMA 3T6WA 2VM4A 3FSVA 1GY2A 2GC7C 1ETJA 1NWPA 1PMYA 2BWIA 1F56A 1MG2C 3WNJA 4AKPA 1A3ZA 2UXTA 1OF0A 3OQRA 2E86A 2GSMB 1SHXA 4Q8BA 5I28A 4QKTA 1NINA 1ET5A 3S8FB 3FT0A 5I6NA 3FPYA 1M57B 2OV0A 5B1JC 2AVFA 1A65A 2W8CA 1SFHA 3PAZA 1TU2A 4ZK8A 2QDWA 1JXFA 5D4JA 4DP1X 4JKNA 4G7QB 3N55A 3NJJA 1IUZA 3SQRA 3DIVA 1AZCA 3EF4A 3QJTB 2R7EA 2I7SA 2IH9A 3S3BB 1MDAA 4CSPA 1OCCB 4KO7A 2BWDA 1ILUA 1PZAA 2PCFA 1OCOB 1BXAA 2X88A 1OE3A 3T6ZA 6PAZA 2YARA 2DWTA 2FJSA 3AG1B 5TK2A 4E9WA 3D12B 1NZRA 2FNWA 3CVCA 1L9QA 2PP7A 2JKWA 2GIMA 2MTAA 2YXWA 2IDFA 3NSYA 2ZONA 1ZIBA 2EIKB 3CVDA 3NJIA 3PXLA 3AG3B 2FQDA 2J5WA 1NPJA 2IDTA 3FU7A 2YAMA 3WKQA 1AG0A 1ZDQA 1GS7A 1NICA 2FQGA 1WS8A 1GS8A 2EIJB 3C75A 1IBZA 1NPNA 3GDCA 1IC0A 3NJGA 1TEGA 3WKPA 1FWXA 1NIDA 2BO0A 2CALA 2J56A 3FS9A 5A7EA 1L9TA 1OCRB 2PPCA 2HXAA 4HALA 1V55B 4W9ZA 3FU9A 1BQ5A 3FYEB 4GYBA 5AFAA 1L9SA 2MRYA 2DV6A 2JXMA 1BXVA 2HLEB 3FSWA 1AG6A 4F2FA 1KCWA 2UX7A 1KYAA 2EINB 4YSQA 2QPEB 4M3HA 1ZPUA 4N8UA 4YSPA 4E9XA 1SJMA 3UGEA 2CUAA 4HHWA 1WS7A 1PLCA 2P80A 2OCCB 4HCGA 4F7KA 1IKOP 3QJVB 2N0MA 1JXGA 3S3CB 2HZHA 4A2HA 5I5IA 3EH3B 4GXFA 1SDDA 4YSCA 5F7AA 1NIFA 4K9JA 2PCYA 2HX7A 4KOBA 3ABGA 4F2EA 2PPEA 1E5ZA 3WNIA 1NIBA 1A4CA 3ABMB 1AS8A 2VW6A 2B3IA 4AKOA 4JHVA 1UATA 1VLXA 3NJNA 3AZUA 1CUOA 4TXVB 1A4BA 2X87A 2B08A 5I5JA 5AZUA 3H56A 2BP0B 3KW7A 3H4HA 1YLBB 4KNTA 1NDTA 1KGYE 2QDVA 3NJFA 2IDQA 2FWLB 4KO5A 3ZIYA 3DTUB 4RH4A 3SBPA 1A8ZA 3FQYA 2Q9OA 1ET7A 3FQ1A 5B3SB 3CDZB 3PCYA 4BDVB 1SDDB 2BP8A 1OV8A 5D4IA 5PAZA 3FPXA 4UF7C 2YAHA 5F7BA 3UADA 1GS6X 2YXVA 2Q5BA 1JZEA 3S3DB 2ZWNA 1CURA 1QHQA 1ADWA 1EHKB 3NJMA 1FFTB 4DP0X 4NERA 4KNUA 3TBBA 1V10A 1J9TA 3TA4D 3WI9A 3BQVA 4FA7B 3X1NA 2EILB 1RKRA 3AG4B 1KDJA 3KW8A 5I6KA 1J9QA 3L45A 2QPDB 3PAUA 2PPAA 4HIPA 2AZUA 4A68A 2A3TA 1HAWA 1JZIA 1KBWA 1RCYA 3ASOB 2XX0A 1OOWA 3ZDWA 3ABKB 2GBAA 1PAZA 2IWKA 1ZDSA 3CG8A 3FYIB 1KV7A 2Y69B 4KNSA 1W6WA 4PCYA 4E9QA 2XXGA 4P5SA 5I5MA 2GI0A 3CDZA 2HRGA 4BDVA 1E65A 3V9CA 4GP4B 4M4RB 1CYXA 3HB3B 4DPCX 1PNCA 2DYSB 1AR1B 1DYZA 1J9SA 3CZUB 4DP9X 4YSEA 3X1FA 3UACA 1PCSA 1X9UA 1J9RA 2FTAA 2YAEA 2XUWA 1AZNA 1ID2A 3NSCA 3X1BA 1V54B 3GXUB 3AY2A 1AIZA 4A66A 2H3XC 1SHWA 4KO6A 5B1JA 1BQKA 1XMEB 3FQ2A 2J55A 5IY5B 3EH4B 3BVDB 2I85A 4DP8X 1NWOA 3FSAA 2I7OA 1AANA 2CAKA 3X1EA 4BXSV 4G70B 4DPAX 4KO9A 1JVLA 1TEFA 5E9NA 1DZ0A 4W1TA 4GP8B 1PZBA 2IH8A 2BP0A 2OJ1A 4BXVA 3U25A 2VMJA 4HZ1A 4AX3A 4YSDA 1EZLA 1XB6A 1MZYA 2ZXWB 4E9RA 1M9WA 1JOIA 1JVOA 2RACA 2VN3A 4YSOA 4HCFA 3ERXA 3WG7B 1WA1X 1AQ8A 4EF3A 4G7SB 1L9OA 2Y1AA 2VW4A 4E9YA 5FC9A 1ASPA 4G7RB 3AW5A 1ET8A 1CYWA 4E9VA 4DP6X 2BZ7A 1X9RA 1JERA 4WKXA 2PLTA 4AKQA 3G5WA 4CSZA 1KDIA 3IN2A 3X2QB 3ZX1A 1BYOA 1AOZA 3ABLB 1URIA 4P5RA 1PNDA 3GYRA 3MX0B 5AKRA 1OCZB 7PAZA 3HEIB 4YSRA 1JZHA 1PLBA 3QJSB 1BEXA 1IBYA 1FA4A 2P80D 4MFHA 2IAAC 1KCBA 2CCWA 3IE9A 1SNRA 2NRDA 2YAFA 1ZIAA 2YAPA 3OM3B 1AAJA 1KBVA 1AS7A 2YAQA 3NSFA 1L9PA 4WTQA 2FQFA 3OMAB 2PPFA 8PAZA 1BAWA 1AACA 2W88A 3SBRA 2DY2A 2CJ3A 1GW0A 4DP7X 1ASOA 4DPBX 3H4FA 1PF3A 4YSTA 1RZQA 1J5DA 3X1GA 3OD3A 1PZCA 4YSAA 3NP4A 3T71A 5B1AB 3RYMA 2GB2A 3PPSA 2XYBA 2AANA 1QLEB 1OE2A 2IWEA 1A4AA 2EIMB 2LLNA 1NIEA 5ANHA 1BYPA 1RZPA 2UXGA 5B1KA 1TKWA 1QNIA 3JTBA 3PLYA 1J5CA 4GP5B 2XWZA 3UAEA 1CC3A 2GC4C 3EH5B 5B1BB 4DP5X 1ILSA 4YVUA 3AG2B 4YSUA 1B3IA 2UXVA 3QPKA 1JXDA 2FT6A 4HAKA 1N68A 4ENZA 5EHFA 3NSDA 2H47C 3JT2A 3NP3A 4PAZA 5I6PA 2VSMB 1BXUA 3PAVA 1MG3C 1HFUA 1ASQA 1AZBA 1GYCA 3FU8A 3OMNB 2VW7A 4AI7A 4QLWA 1AZRA 1XB3A 7PCYA 6PCYA 1T5KA 1JZGA 5B7EA 2IWFA 3UABA 2UX6A 2H5UA 1NIAA 3NYKA 3DKHA 3TBCA 2CBPA 4A2DA 3NJKA 1AZUA 2XLLA 3N2JA 2FT7A 1NTDA 2BP8B 2DYRB 4HCIA 5LDUA 3T6VA 3MBWB 4YSSA 2J57A 5I26A 1SF3A 2XVBA 3OMIB 4BWWA 4Q89A 3S8GB 2QT6A 3NT0A 4E9SA 1I53A 4BWUA 2VSKB 4GY4A 4X4KA 4YL4A 2BW4A 2YAOA 1WAEA 2JFCA 2AFNA 3T6XA 1PY0A 1R1CA 3CVBA 3UAAA 4A67A 3TASA 2VM3A 1WA2X 4DP2X 5I6MA 4DP4X 1GSKA 5B7MA
chains in the Genus database with same CATH superfamily
2VT0A 1L6XA 5AW9B 1FFPB 2F15A 2DQTH 4ZRGA 4CADA 4NCC1 4DTGL 2ZOLA 3RJDA 1OW0C 1A3RH 3VQ2C 3ALPA 3B9KC 3HNVL 5DRNA 5IW3A 5E6ZA 4A7GA 2HTLD 1FI8C 3SDCB 1NC2A 3IDJB 4KHTH 5EC1B 1OTUC 3MTRA 5KSUA 2GY7B 1KXQA 2WSDA 1N2RB 3QIBC 3S3JA 1SXAA 2WV3A 3QUZA 1AH1A 1MZZA 1YG9A 1J8HB 1SXNA 3JV4A 3R8BB 2XVGA 4MCYA 3M6DA 4P23A 2YOCA 3WSQL 1RZJH 3KPSB 4A2GA 3CU1A 3SBWC 1T89A 2HJLA 4Z0XA 5HHXL 3QRGL 2GJJA 4GLRI 1UWEL 2JKRM 3K8KA 5IB2A 4NAJA 1F41A 2ZWKA 1XDTT 2EXWD 2KT6A 4A2FA 1M7UA 1LK2B 1W2KT 2VRAA 1MCPH 4YOKA 4E9TA 4LSUH 3QZMA 4N6RB 3BIKA 3VFRA 4A2LA 2XQBH 3OKNA 4LASL 3VQMA 1WFIA 1FPTL 3F7LA 1JZFA 2JV6A 3WTXA 4AL8H 1YN6A 2ZUSA 3GIVA 3VGBA 2VXUL 2E56A 3L16A 2K3HA 1XTMA 4ABWA 2O26U 5IIEB 4E9LA 4MBRA 1PZSA 2WMPB 2BWIA 1O0VA 2B39A 3D34A 3ARBC 3TIDA 1OW0A 3PFUA 1T21B 3FU5A 1J5HA 5IFHL 2ROYA 5LXVA 1MF2H 1N18A 4KKAD 1PQZB 4QKTA 5DFWH 5I28A 2BFVL 4OKVB 2AXGB 5T1JA 3FFDB 3NCYP 4X5WB 4Y7MA 3U4EB 2P28B 5HDBF 3MRCB 3A67L 3BX7C 1LO5A 4PJCE 4ZODA 5FUOH 1X5HA 2B1OA 2DQUH 3BRFA 2DQHH 3MOQA 1YRKA 1OZUA 4YXLL 5CZKA 3SQRA 2BWQA 2BIIA 3CNKA 3CSFA 2QADC 4WY7H 1NUFA 3VSUA 3V0GA 1IC4L 2IQ9L 3ULAB 2Y7MA 4H5SA 2BWDA 4N5UA 4ODWA 2PCFA 2R29L 2V0AA 4AYBA 3I74A 1UM6L 6PAZA 5K9QG 3CDYA 5ACZB 2BSEA 3FT2B 3H53A 2X9WA 3MODL 4ESKA 5DK0B 4K15A 1U3ZA 1IT9L 2NUPB 3NSYA 4AIOA 2ZONA 3AQYA 3CVDA 3MC0A 5IB3B 5EC1A 4ANXA 1S2EA 4YHNA 5FCUH 2I9LB 1OTSC 4X7SH 2EADA 3NZ8B 1INDH 2F8VA 5K1VA 1N2RA 4GRWB 4JANB 4NBZB 3NZHL 3WKPA 3AQDA 3TC9A 1V5JA 1E6JH 3QS2A 4L4VE 2J44A 3V0DA 4P23B 3DI2B 5AB9A 4PP1C 3O9WA 3QFJA 5FDWA 1IAOB 4L4TA 1DJIA 1FVDB 3QCTH 4FP8L 3KD4A 5FR3A 5KANG 5AYTA 4Z7WF 4JPIA 1BGXH 3N0AA 4J3WA 1L9SA 4MHHG 5BVJA 3BN3B 2CCVA 3MLYL 4DGIH 5IESH 1TZHB 1ETB1 4ADGA 3CX5J 1L0PA 2YZ8A 2W0LA 3V0FA 2E8ZA 4HC1A 2KMWA 3MOAL 3BZ5A 3FB6B 1OAXL 2LU3A 3RTQC 2N7AA 3P9MA 4B5ZA 1SHSA 1UGNA 4AC4A 4IW4C 4KK9D 3OB0K 4D8PA 2BSBA 5I1AB 4FXKB 1RIUL 4HBQA 4HEPA 4OB5L 5DQDL 2W95A 2E5EA 3QAZB 4YDMA 2B4CL 3EGSA 3K3QA 1JXGA 1ZT7B 4X5LA 5IB5B 5BXFB 1UEMA 1MREL 4JGNA 3DUUB 1OCWH 4TNWF 4UBDD 4Q9RL 1J88A 3B9EA 4XRCB 3W9EA 1RUAH 1IFRA 4LQFL 4XB7A 4F15C 4ZTPL 4I85A 5F6HJ 3FO0H 4F2MA 4TPRH 5CD5D 4RFOL 3MXVH 1WP6A 1TCMA 1UD5A 5L88H 1MRCH 1PDKB 4Q6KA 4PI0A 1KPVB 2WLJA 1UKSA 4K8RH 1V7NH 5AL0A 2ARWA 1HHJA 5DHYB 4NQTA 1ZS8A 4WU7A 2NY5L 5K59E 3DETC 4BZ2A 1RZKC 5HHPB 3ZE2F 3OAZK 4FEIA 4V1DB 1QSZA 1YUHB 2VUYA 4AEHL 3GSQB 4I3SH 2XZAL 5A7BA 1N0XH 4MMZB 1RFDL 1L7TL 4NUGL 5DK0A 1N6QH 1KTBA 1M4KA 2PCXA 3C5JA 3CFBA 2YA2A 4K2UL 4KPHH 2TAAA 3M8OH 2NY6C 1I7TB 2QGBA 3NCYS 4TMPA 5IBLD 1I82A 2I9LA 1E6OL 3MVSA 4LL9A 1ADQL 4G9DA 1E4JA 4JO4L 3P1VA 3L3GB 4K7PL 1CURA 1JBJA 2NY2B 3BZFA 4N1CA 3QGVA 3N40P 4PGDA 4PR5B 4ELMF 4DP0X 4QRTA 4OBRA 2AJSL 5FYKL 3D2UB 4JG9A 4NUJA 1JYVA 1UWXH 1GPOH 4UQ3B 2EZ0D 4PS4H 3ZMEA 4HS8L 4XNZB 2CA3A 5E2TH 3W38A 1WFMA 5D6DC 3S5LG 1M1SA 1TJHL 3EFFB 1TG8A 3ETBJ 5DZLA 1JMXA 3OHMB 2CU9A 3AS0A 4U6XA 3CG8A 1UACL 2H1PL 4XVUC 4HKJA 3QH3B 3HI6L 4ZUWB 1Z3GL 4M93C 3QDMA 1DHKA 5FGBA 4G9FE 4M62L 1WIUA 3QULB 4NO5B 3RRQA 4U1LB 3THML 4JFFA 3ZHDA 4NS0A 3HC0B 4BV1A 3SY0B 4XPBH 4X5RA 3WJLC 1YC7A 2BIQA 4OCXL 1LO0H 3TT1H 2VDOB 1Q0XL 4KTEH 1GYAA 1Z9NA 3II3A 3INOA 4AEIL 2XV6B 3HMXL 3QEHA 3UGUA 4KO6A 3VI4B 2ZUWA 2JB5H 1RJLA 1S7VA 2P52A 3Q01A 5IY5B 3EH4B 4XMLL 3EUDA 1TTRA 2FATL 1NWOA 2PTTB 4MA8L 5FO9A 3KXFD 4NOFA 3FSAA 4PLJD 4IU2B 1MWAH 4N0UA 3IJHB 2WZPD 3T0VA 4RRPA 2KPWA 1EBPA 2F1AA 3SN6N 1A1MA 5IKCA 4W1TA 4UTCA 3NK4A 4KKBC 3MLUH 4AGLA 3SDDA 2VC2B 3K7UA 2XXMB 1EVTC 3HCVA 2BP0A 1P5UC 5D1ZC 2K7PA 4RMVA 1RSFA 2NXZD 3GXFA 1Q9LA 2HT2D 2IQAA 4M7LL 3NZUA 4PM1A 4J12A 2QQLL 1OP5H 4R3SB 3SQOH 3IAPA 2VDLB 3QZOA 4JR9L 4ERSH 1KJ2H 3H7BA 2YRLA 3HFMH 4GFXA 1FH2A 4HGWB 4IMLA 3AW5A 3OTTA 4URTB 3HUJB 2XWTA 2OZNA 3GS4A 1OP9A 4L8DB 3RTQB 4E9VA 1NBYB 4Z1PA 2NZIA 1E28A 4FADA 1YZZA 3KPRA 4XP4H 1H15B 3VFOB 1QR1B 2CJUH 3X2QB 3E2HB 5DU7A 3TA3A 2I07A 1PLGL 1DO5A 2Z7WA 4UTBA 2VDOL 5BQDA 4XP5H 2C9RA 4MMXA 3MV7A 2YPVL 4ZMQA 2Z3FA 1ZHKA 2VLKD 5ID1A 3QNZB 3VG0L 2IAAC 3QNFA 4KKPA 4RZKA 1R24B 1REIA 1WZLA 4DETA 4JRXD 4FLSA 4GBXB 2JK5A 4PJXA 2VDQL 1I7UA 3RWGA 3FN0H 5FYLH 1BD2A 1S8DB 4LP8A 4U1KB 4B9IA 5H94B 1AO7A 1AGBB 3J07A 3QIUD 4JN1L 2C9QA 2JTDA 2KDGA 2WLYA 5DJ6A 1V3MA 1HDMB 4JFFB 1E27A 2WVSA 3A24A 3UYOD 4F7EB 1ZY9A 4GMSH 1EJ6A 4OLXL 1I7ZB 1N64H 1QTSA 2PWDA 4I0PA 2Z4QA 5DCCA 3US9A 4OD2B 4QRFA 3KAAA 4XMZA 4EBQH 1VAHA 5LAXB 4XPHL 3NCCB 5B8CB 2A77H 4NQEE 2IFFL 5LGYA 3MFFA 4UI2A 5CUSH 3Q1SH 2D4DA 3G6JB 3V6OC 3EDJA 4ADJA 4QO1A 1NBVL 5E8PB 5ABAA 5HYSG 1G7HB 3EDFA 4NM4L 3VWKD 1MF2L 4JFZH 4LLAA 2BSTA 4X6CF 1RPKA 4UTAH 4HZLB 5EORH 1CK0L 2G9HA 1GAFL 1NCTA 2ZUXA 4TVSa 4RDQG 1AHWB 4YR6A 1ED3B 3SDAD 1FLTX 4GRLA 3WIIL 1MLCB 2XC8A 2AGJL 1NEZB 2C7UA 5D70H 4D9RE 3HOGA 4RDBA 5GS0L 2E3VA 1R3KB 5FLUA 1GGIH 3AGWA 3Q8AA 3KYKH 1U8LA 3QUZB 4JJHA 4PS7A 5CILL 2Q86B 5A2KH 3JV4B 5FUCC 5ICZA 1JPST 5EA0H 1XFPA 5IMMB 4AI7A 4R83A 3RTQA 4L8DA 4AT6A 4R90H 1LQSR 3QZWG 2WQVA 4HWUA 4K8RD 3VB8A 4B7IA 4S0HA 3KYOB 5CP7B 5JW3L 3KPRB 1HK6A 5IB1A 3ARFB 4FQXD 4HCIA 2ZTBA 2XACC 4N6RA 5I26A 4U0QB 4I1NB 4GAAA 4PJEE 3GSWA 5JNYA 1JZ2A 3TH4T 1NL0L 3S8GB 2JH2A 4BCZA 3MKGA 5HYFA 4YQXL 4GI9A 4NNXB 3P4MA 2QKSA 2QTVA 1Y0LA 3E1F1 1UEYA 1WAEA 2JFCA 2PO6C 3OXRB 1KTDB 4UCFA 2LE9A 5CBEB 3FMGH 1HXYB 1S7WB 4MLIA 3CZFA 1CF8L 3NOIA 4WSGA 1U2CA 2XQYG 1KB5B 4X98A 3G5ZA 4YIQA 4IKIA 4ZFGH 1EAPA 4NN6C 1VADB 4MJ5A 1K6QH 1ESOA 4YXLH 4X4YB 5IV2A 3EO9L 3KM2A 3OPZH 5J3HD 1IKNA 2WWNA 3JTSB 1Z9OA 4O02A 5AKTA 5KOMC 1BDYA 2BMKA 3QJQB 4IOSA 4LCWB 1H5BA 3X14B 2LVEA 4ZFOL 2ZT9C 1HHKB 1I4FA 3OLDA 4K0OA 5F1NA 4KFMA 4XI5D 1I9JH 5GRVL 5T5FL 3ARGD 3HE7B 2ZWZA 5SWQA 1SVBA 3FSZA 5E08H 1UJTA 4MSWB 4BWTA 1EZVX 5ILTL 2C3XA 1VJSA 2XN9B 3PL6B 4UOZA 2Y1ZA 3VFWA 3KMDA 3RY6C 3IXTB 1CL7L 1JAEA 3LMJL 2CO2A 3Q06A 3R1GL 5GRVK 1GY1A 1AFVH 5ECJE 1PEZA 4HXAH 4YVNA 2NW3A 5IF0A 5I23A 3UYRL 5FK9A 1OSZA 1SF5A 3KL3A 1CE1H 1RJYB 2X4SA 3TYGL 5KBMA 4JFDE 2X4TB 2EO9A 5HXMA 3VXRA 3UMNA 3RILA 2NUTB 4UT9L 2WZ5A 1TNNA 1BZEA 3ARGB 3HE7D 2R51A 4KFZC 5F8RC 1XGRA 1NM9A 5IBLC 2V7NA 3TN0B 1BG9A 1JZ5A 3VWJA 1MG2C 4OZGB 5I15H 2XCMC 3MRQA 2BK8A 5IVXF 3RHWF 1NM4A 1OF0A 1M7IB 1OK0A 3PIQB 5LAPA 1E6OH 2XG5B 2EYTB 1EVUA 3Q8FA 4HPYL 4K71C 5KSBF 5EMYA 2BOBA 4ZFQA 5CKAA 1YEWA 2H0PA 2R2CA 3OR6B 4PWFA 3S8FB 2OK0L 1FO0B 1WWCA 2DZEA 4FQXA 5ACMA 4L8BA 1H8SA 3BVVA 2EQDA 43C9A 4YHML 4TSCH 1I9RL 2XVKA 2XZCH 5ICYB 3GLEA 4W9EC 4DGVH 2VZ1A 1F6AB 4XOCA 3C8KA 3UP1A 1MFEL 2NLJB 2NZ1A 2VMDA 4G1EA 3HBZA 3FRUB 4Q9RH 4RAUB 3LSOA 3F7QA 3EF4A 5DJ8A 5CBEA 1IBBA 2DWXA 3MZTA 4LOVA 3BJLA 4MS8C 1JGEB 1S9XB 1U95B 5IJBC 3AB0C 5D1QA 3UXFA 3ZHLA 1T03L 4E41E 5I2IA 4NI6A 4FOMA 2XRAL 4NQDE 4OLVH 1OCOB 3MXVL 4E36A 3N1FC 4LVOB 1QHPA 1QYGH 1TPXC 3JV5A 1O6SA 2JI3A 4O02B 5H37A 3GSUB 4X6EB 1ZVYA 2CCLA 1PDKA 4G6MH 5KVEL 3T2NH 3LCYA 1HSAA 5AL8A 4S2SA 3U46A 3QUZC 3WKQA 1I4FB 1AG0A 1HHKA 1EXUB 5F1NB 1N0XL 5IUCA 1W8NA 4MHHI 4G1MB 2JB6A 1UA6L 2C9VA 5E2JA 1ACYL 3VXOB 5AVVB 3ZKMD 2K6YA 4B0MM 2IH3A 3P30L 4YGVB 2ICWI 2XA3A 5FYJL 4QGYA 2WZ0A 2CDGA 1KFGA 3AROA 3N1MC 4X42A 2C1OA 4WAFA 1F2QA 1DLHB 2APVA 1OT4A 1TVHB 4GAJH 4AEEA 2C9SA 2VDQB 4GI8A 4PU2A 3GJEB 3VUAA 4DVRL 3V6FA 3TZVD 3HRZB 3EJZD 1O75A 2VZOA 4AM0Q 3CFCL 2XWJA 2LAGB 5D1ZI 4LSDA 3A6CL 1M1XB 4TOYL 1KWKA 3HS8A 4N90D 2JVUA 2F5BH 2GTZA 2HLEB 4U6YA 2OX5B 1J1OH 2I5YH 3JBG7 4BUGA 3VD4A 5E03A 5FYKE 4MJIA 2FYYA 4XNBA 5KVDL 2O6CA 4X6CB 2APXA 2VDRH 3RIAK 1XX9C 5I0WA 1X7TA 3WNOA 3KYNB 5EEZA 4IBWA 1UXSB 3DSFL 3RWCA 3WHE0 4P4KC 4PS8A 5GQBA 2EE2A 4FG2A 4IJ3B 5EBMB 2MTPA 4PV8A 5IEHB 1CDGA 3BKCH 3POCA 4CMHB 4CW1B 3KPTA 1ID5I 4FKHA 3TO4D 3EO1B 4J28A 4Z5RA 1R6VA 4J8QA 3ZE2E 4R7NB 1MEXH 4U1HB 5C7ZA 1VSCA 2PWEA 3MJ9H 3QI9D 1JHTA 3PNWB 3RGVA 4TF4A 1GKEA 1LO0L 3EYSL 1UT1A 3DJ9A 1JGUL 4LVHC 4B96A 1IARB 4HWNA 2NZ9C 1O6VA 2BVTA 3V5HB 3TURA 1G9ML 4OLZL 4NCDA 3QUKB 3FQWA 3D39A 1PZ5A 3Q8CA 1R19A 1KYOJ 4X6BA 4C56A 4P3DB 3VXMA 4PRIB 1KGYE 2WVVA 4MBOA 3UIYA 5H4YA 4YLCA 5HHOB 2OULB 3K71A 2IGFH 5HHQB 3A47A 5HBBA 3D4YA 1FYTA 4M48H 4DCQB 1NCWH 4OGYH 3IGLA 3MRPB 3PGFH 4PRPD 4HG4J 5ADOL 2JIXB 2W0KA 3PCYA 1QNZH 5FA3A 1OV8A 5BNXD 1W0WB 3IFOA 2MOQA 2XTJB 2CLZB 4G8IA 1K8DB 2Q5BA 1BYNA 1YMHA 2BNUB 3RHWK 2NQDA 1DQLL 1TYRA 3GGWB 1CICC 5DRNB 3KPSD 2WSPA 2PF6A 1U42A 1RUPH 1EEUA 1IILE 4GKSA 3VXTA 3IB4A 4DN4H 5D1XE 4X7DC 1JCVA 2C1OB 3INUH 5F7KC 3TA4D 4HULB 5IP4A 1SXSA 4ZS6C 1I8AA 5T1KA 2X2YA 4NM4H 3FT3A 3OKKB 3TPKA 4NAMA 4HEME 5J12C 3QIWA 5JQIB 2A6IB 3D87B 1CYGA 1J7VR 5F7MC 1E5CA 4PCKA 4NN7B 3IWUA 5JXED 1WZKA 1M1XA 3I75A 3HNTL 1UWYA 4U6YB 4PJ5A 2QSQA 5I1EH 5M7QA 1FNEB 2ZOLB 4X8CA 2JELH 1M7XA 2W81C 4PJDE 3S37H 5IZ7A 2GI0A 2W94A 1E65A 4DPCX 3D85D 2FLRT 5HJGA 1JG9A 2DH3A 2GEQA 3A23A 5JHDB 3HG1A 4OD1H 4RFEA 5KSUB 3H9SA 4IRSB 5LCVH 5CEZE 3C6LD 4HK3N 1RY7B 1ZXKA 5DD1L 1QWHA 2VZUA 2DIBA 3CXDH 1TQBB 4LK4A 4GAYA 2V2WA 1SHWA 3ZKXB 2C34A 3RZCC 3LV3A 1A8JH 2J55A 1FE8H 2E74C 2CA4A 3NQKA 1ZWIB 3CQQA 1ETA1 2D3NA 4Z0BH 3IDYB 1C5DA 4HQQH 3N9GH 4XNYL 1DVFB 4KO9A 2HMID 4Y4HC 3FFCB 5JDJA 4N3TA 2Y36L 4F1ZA 1AQKL 1D6VL 2KDYA 1SLVA 5JYLA 2G75B 4L8CA 1HKLH 2F9BT 5HJ3A 1A22B 4UQBA 1KC5L 5C70A 3GXDA 1QUNA 4QUOA 3SOTA 5M94B 1OAKL 1IEBB 3DRQA 4UNIA 2WTRB 1FO0L 1PKQB 4LU5L 1Z1WA 4L3EE 3QA3A 4UQAA 1FG2A 2V3FA 2D7TH 1G7HA 4L2LA 5KSAD 5G4OA 3CSYB 1AMYA 3WIIH 2P5EB 5SWSB 1MCLA 1GMIA 32C2A 5F6HI 5I73B 1LE5A 4A7SA 4Y5XA 1AIFB 2NXZC 3PY9A 2PWGA 4OZ4B 4ABQA 4F8NA 1TT6A 2FYVA 2DTSA 4NP4H 3WNNA 3QDGD 3IN2A 4FXLA 3ZX1A 4N2HA 4TQIA 2JJTA 2YD5A 3N04A 4LRNH 3VFVA 4XCYB 1LVEA 5B21A 4Z7UF 4Y88A 4AE1A 1TO4A 1ZLEA 4HJ0C 1XL4A 2J43A 2YMOA 4H5SB 5EN2B 2K6WA 1K2DB 2EZ0C 5I74B 1FF5A 3UZQB 5CLZA 3SQBA 3FQTB 5E6IC 3RI5K 3WEXB 3O8XA 4X4ZA 1N7ML 1VGKA 3F7PC 3N85H 1EAJA 3UAJD 3PDOB 2OMXB 1P5UB 3W81A 4Z7QB 4JCMA 2WNXA 2D4FA 3T2PA 3V10A 2FWOA 3H4FA 4ES9A 1DBAL 4QOKD 5HYSB 4NQVA 3AITA 4AQ8C 5IM7A 5I0YA 4FTVD 2AQ1A 3IDGA 1RP9A 4BSWA 1RZIB 1CF8H 2ESVE 3X11A 1EX0A 3QFJD 5J3HC 5IROD 3TCXA 3WAKA 3VWKA 5TE4L 3T4YA 5H4ZA 2DQ6A 2OSYA 1E4XL 5C07A 1TO5A 3QB7C 1SLXA 1ZT7A 1C5DB 5JHDE 3JTBA 1P7HL 2XPGA 2BOCA 2EH8L 1NGYB 1AXSA 1GZQA 4PJDB 1TZHA 2X4RA 4TKWA 4F2MB 2FR4B 1LWJA 2FX8H 1CD9B 3O6KH 4JM4H 2P3YA 4I5BB 4XPGH 4JKMA 3RAJL 3H8NA 1I3RA 1FVCA 1KXTB 3LKRA 4PG9B 5BMFH 2WO4A 4FQCL 1I8KA 5LGJB 1HHGB 3O8XD 1AO7D 5I1AA 4KDVA 3MRGA 4L3CA 2P5ED 4LPTA 5SWSD 5EIIA 5E8NB 5GS1A 5D1ZD 4KC3B 2KKQA 2YD6A 3VGDA 2HUEA 4RMBA 5I6PA 4KDTA 3KBFA 1XGUB 3IJ8A 4HH9A 4Z76B 5F7EH 1AFVL 1H6FA 3PWPE 3TEZA 1AZRA 1QYGL 4XXCC 1T5KA 4XZUB 5LNGA 3FCGA 3U9UB 1KTRL 4DVBA 3RWJA 3OGOE 1MCEA 4IGBC 4W9KC 3ZTDC 4A2DA 4D0CB 1FIGL 2FECI 3BH4A 5ES4B 3W0WA 4KROC 4Q4IA 5F7LB 4K7FB 4WLCA 4WWPA 1T04B 4NPJA 4FD0A 1JD7A 1KV3A 4AMWA 4X9YA 4ZW7A 1GW6A 5K9KB 2Z35A 1U93B 4LVNB 4ZZFA 2CR3A 1Q94B 3JYBA 4XMPH 1QSVA 1X6LA 3MACL 2CHNA 4XNQA 5F7WC 2ZIDA 4B41A 1GXEA 4NUJB 3DGGB 2V7NB 3WTSA 4R4BA 5C3IA 3VWJB 4TUOA 1IAKA 4LEBA 3HVNA 3QFGA 4X2UA 3G5VA 3WEXA 1SYVB 4XNUL 1G6RB 4PTUB 2XOTA 4F57H 3ZKXC 2R2HB 3QCUL 2X12A 5F7YC 1NC4D 4PJAE 2OYMA 2VJ0A 1MJJA 4J3OG 5BO1H 5CWSA 2QHRL 1JV2B 4ZUWA 3SE4C 3WNLA 3D50A 1LL1A 1A9VA 3D3VB 1K72A 3VXUA 5IHLB 2FEDD 2WO3B 4DZ8A 4HUXB 2IDUA 2C7FA 2M8XA 3GIZL 4WI0A 2WBJD 3MV8B 4RMTA 4G71B 5IWLC 2HH0L 4CC4C 1HCVA 4XAWH 2OYKA 2UVFA 4KI5E 2IEPA 1PSKH 5ESAB 1EJFA 5TDPA 5I71B 2TSBA 3H9SD 3C60A 3D5OF 1WUZA 1TNMA 5DTFA 5K93A 1QLFB 1INDL 1DQJA 4I9WE 3GRWL 4PJBA 4UILH 5E9DA 4K3EL 1MH5A 1YYMH 4LBAA 3FF7A 2OMTB 1HSBA 1I31A 3OAYH 3RWFA 2GT9A 4OLZH 3V8CA 1TIUA 2PPDA 5E2WH 5I8EA 5EOCJ 1XGYH 2QQNH 4H8WL 4P2QB 1KENL 1FORH 4A2MA 3T9WA 3FTYA 1XT5A 2BVOA 3ZQXA 3QUXC 3ROLA 3SDCA 3ZT5A 1LDPL 3P9WB 1RSYA 2A9BA 4WO4B 3QUMA 3LZQA 3CFCH 3L2MA 4F37K 1NBQA 2WXPA 3WD5H 3VSQA 3BKMH 2L7EA 2R4RH 3QIBB 3SDCD 4DVBB 5F7NC 4PV9B 4FLOA 3IFPA 2H32B 4KQ4H 5AVWB 4ZUSA 1I8MB 3MRIA 1KYDA 4PVMA 2NY4B 1F86A 2PCPB 3DSFH 3VRJA 1M57B 2KQMA 3NQIA 2XJKA 4X7CC 1EQWA 1BREA 1X7QA 1CQKA 2AVFA 4AYFB 5MENB 1A14L 4AWJC 1JRHH 3NCEB 1TU2A 1VGEL 2WN2A 4OGXH 1RP8A 3ZL4L 5KSAB 1SOKA 3OAYK 5AUMA 1EO8H 5AD0B 1IUZA 4KJPC 4BK4A 2HJKB 1NBZB 3CPLA 4BFKA 2ZAIA 3S3BB 2P9RA 3S96B 3EXLA 3OG6B 3WFZA 1U3HB 4WFGD 3G5XB 2DLGA 3ARED 3JWNG 3NDYE 3H9YA 2Z34A 1JF5A 2VZVA 2DWTA 5IQ9A 4UAOB 1G4MA 3ARZA 5I9QC 2HN7A 3KPMA 1U3YA 3E38A 3W1ZA 3L4TA 4HJUA 1JWSA 1NA8A 1UXMA 4PJ5E 3VRLF 2IDTA 3RGVD 5BRPA 4LNRA 2JI1A 5F8QC 1Y6MR 2EIJB 1MNUL 1ETZB 5LWYL 1TEGA 2V7HA 4PW4A 5MHSE 1MI5E 3LB6D 4PJBF 2ZCKH 2CALA 4XE5B 4UM9B 3K71B 3C60B 2YD7A 4H4NA 4U1GC 1FYTB 3DIFA 1EHXA 2IPTH 1BD2B 3SOBL 1JHLH 3ZE1E 2WJ5A 3BUDA 1NQBA 1PZ2A 3CHXA 1N8ZA 3NPSC 1R0AL 3VW3L 1M7DB 3HG5A 4PREB 1SEQH 3GT6A 2AEOA 1UYWH 4HJ1A 1JPGA 1W0VB 4PLOB 1AHWA 4WW2A 4E68A 4QWWC 3FFDA 3QQ9D 4IK6A 3VRIB 4PH8A 3WIFB 1FAIL 4HOMA 3S2CA 2EINB 5DLMH 3SPHA 5AVXB 4AMKH 4MZIA 3WS6A 2OTUB 3I84A 4XBPA 4LLMA 5BZWB 5T1DL 2HT3C 1FV1B 3WDJA 4IDJH 2P80A 4I4WA 1MKFA 4H88H 4LSVL 1DBBL 2KQNA 4AYSA 2P8MB 3HC3H 3SE3C 2DQCH 5MEND 5I1GL 1KLUA 2COQA 3AXIA 4GRWF 4UMSA 4N0FA 1CFNB 3LTVA 4HUWB 5CZVH 1FZKA 2F1BA 4MD4B 4NI3A 4D7PA 5EOCH 3D9AL 3LXCA 2R29H 2VW6A 1IGTB 1M6UA 1WHPA 3MRHB 3TEWA 2O72A 2QVMA 1WC7A 2F53B 3KGUA 4R2GC 4GO6B 1J8KA 4TUUA 5HSFA 2BSED 2E7DA 1E90A 2KL6A 3UX9B 4M7ZC 2A4CA 1YLBB 3PL6D 3RA7L 5I8OL 4R96A 1ACZA 3DX7A 1YEJH 4H25B 2IANB 2O6DA 1NGPL 1XAUA 3D4ZA 4GO8A 1KTDA 1AHWC 3U1PA 3QQNA 1OWRM 3IETB 4XX1E 5TQ0L 4RWYL 2OMVA 4AV5A 4OZHB 5T1LD 1KB5A 3BLBA 4EZJA 5HY9B 3CDZB 1I3VA 2J2ZA 4YDKH 2QGCA 2J8UF 1WAAA 3MJ6A 1UJ3B 4UF7C 5E6RB 1DR9A 3LQZA 2Y7SA 3UADA 4LE8A 1D7BA 1OALA 3L3KB 3FOMB 2AJXH 3FCBA 2AJYH 3DUSA 1HZHH 3UAJA 5DJCA 4OF8A 2B8OT 3Q2WA 3L3HB 1JTTA 3O3DA 4YK4B 4NFCA 1UFUA 2PXYB 3UO8B 2EDWA 2CMRL 4FQ2L 5C0GB 3L1OL 1PPIA 3ARSA 4XMVA 3B9KD 3UBXB 5I6KA 5KYWA 1OAXH 1U4FA 1E4HA 1HQRB 1NAKH 3MBEB 3V5KA 2BY3A 4JHZA 5CKGA 4A7GF 1KBGL 3SGEH 1Z5HA 2XA8L 3ABKB 1KIPB 4BSVB 1CMOA 1UTDA 4EI0A 5JZ7C 1KPRB 3TS8A 3EYUL 2WC7A 3TZVC 1ZHBB 2H9GB 3FO2B 4UYPA 4Q97A 1JV5A 3QUHA 4L2YA 5I5MA 4FQCH 2K8QA 4MD5B 5I73C 3V9CA 3TBSB 1DVSA 1FFNB 3ISWA 2E6QA 1CLYL 2ZPKL 4JO2L 1IE5A 1FV1A 3TV3L 1VENA 2AMUA 3D09A 3NAAH 2R0ZH 4P3CH 1UT9A 3DETD 4Y4FD 4ANUA 4MNGE 2VH5H 2P8MA 1SRDA 4ZUUA 4QRTB 4A66A 5L88L 4P2OB 1K2DA 1MQKL 4IS6B 1QSEA 4NN6B 3QUZD 1N3NB 1VB9A 2IPKB 3GSXA 1RVFH 2Z64C 1U8MB 4HIEA 2K9FB 3BWAB 1A4JA 2JLPA 4OQTH 5LBSA 2O1AA 3MRQB 2D03L 5J8OA 4MD4A 5CD5C 4P9MH 2WD0A 1AANA 1ZANH 2AK1L 3PHOA 4X0KB 2NOYA 4NNYA 3X12A 3BUTA 3OAWA 4N2EA 1IGTA 4AUUA 2XG5A 4FP8H 3QARA 1OHZA 3V55A 1RFDH 2O5YL 2ZWSA 1GTNA 5BZZA 4Z7NE 1KGCE 5D96C 2YD8A 1AZZC 1T83A 4HC1L 4FQXB 2IH8A 1CDHA 3CVHB 3DX0A 5GGVL 3SGDI 4DEPC 3GMRA 3JV6B 3BZFB 5BW7A 3L1EA 3MGOB 3E8VA 3SPVA 1CLOH 3CC5B 3U1QA 3WN5B 3ZE1B 2RACA 1YEIL 5DR5H 5D1QE 1GAFH 2ARJB 5GGRA 3QFDB 5AG9A 3K0YA 1P7KA 4LLDA 1X3DA 3V0IA 1KEMH 5DVMA 3NTCH 5TTRA 3RDJA 3Q2NA 1AQ8A 5BJTB 2J20A 1YY9C 2WQAA 4G7SB 4LFHD 4E9YA 5B4MC 3HG1D 4L1BA 1UXWB 1XAKA 3ZY7A 1J8SA 3W9DA 2NNFA 3C60C 3U79A 2P5WB 1OAZH 1X5GA 2A73B 1OP3K 5B38G 1RZ7H 3AU0A 1GGIL 3O6ML 4XI5C 5A6IA 4Z78A 1BLNB 4HUVB 4RGMC 2VL5A 4P9HC 1QFUL 3D48R 1BYOA 4EAEA 2OQJA 3ABLB 1INEH 3D69A 3WMPA 1VFBA 5TFSH 3KM1A 3F62A 4JDTH 1P4IL 4UDUA 2ADYA 1K85A 1OTUD 1QO3A 1F90H 1OY3B 1X5AA 3QYCA 4AQEB 3LZNA 1SY6H 1SUHA 1KGIA 4H40A 5H8DA 3RJQB 1KIPA 3OV6A 3DJTA 4XX5A 1YMMD 4HUNB 5HHNB 2QFPA 3MJ9A 1XF2A 3V6FB 4TNVF 5AG8A 5CLTA 3V95A 4I3RL 4Y5YC 5AAMC 4R2GB 3CSGA 3TJHD 5CZXD 3KE0A 3JWNH 4JDVB 4XMPL 2W88A 1WO2A 4IMLB 4HX1A 2NY5C 3VXPA 5L2JA 3HZYB 2YXFA 1RZQA 4G1MA 3OD3A 4HISA 4PTTA 5K33A 1TZIB 1ZGLB 5IFJA 4CVWA 4YSAA 2VLRD 2CRIA 5CSBA 1CF1A 2WNWA 3IDNB 3F12A 4U2ZA 3CCHA 3BLKA 1DQQB 4I13B 3V4PA 4B97A 1FN4A 4Z23A 2MH4A 3NCXA 4ZDHB 4AXWB 4L0ZA 3EO9H 4X4XA 4KUCF 3OJMB 5KVEE 2YLHA 5DVOA 4YNYB 1KJ3H 3CFTA 1SM3L 3D25A 3II2A 5F89B 2VR7A 4D94A 4W9LC 2B4CC 4LLVB 5K9JL 4JFPA 1ILSA 2X2UA 4CC0A 1AI1H 5C0AB 4YHKH 2PNDA 3QHFL 4ZOEA 2JCWA 1GYUA 2ZKYA 4NZUL 3TTYA 2MHAA 2VTFA 3LX9A 2OZ4A 4AW7A 4LOUD 5JIIA 5JW4R 4IBSA 1MCHA 3QWNA 1YAIA 4A1RA 4M6MH 5JHAA 2BC4B 1JWUB 2WVVB 3EJPA 4OLEA 1I8LC 1OT2A 5TDPB 1YYML 3OR7A 4Z7QF 2AKRA 4QLWA 3MV7D 2JB5L 1FZOB 4GBXA 5E99H 5C0FA 6PCYA 5JW4N 2ZKWA 3TIDB 2D7QA 5DQJB 2ZUTA 1X6NA 3LD8B 4Z78B 2KC0A 1CE1L 2XLLA 2LU7A 1M6OA 2YD3A 4U3SA 1IEHA 1HDMA 2LU5A 3I6GA 5CJOH 2XHNA 5AW4B 3CWGA 1AQMA 3MX0A 5SV3A 3V5HA 4BFFA 1NFDA 3VXNA 4MCZA 4I0PB 4QKXB 4CVXB 2BVOB 4OZHF 3N42F 3TO2A 4HMCA 1I53A 1EA9C 1T2QH 3IFLL 3MNMA 3W37A 3RVWD 3C6LB 4EQ3A 3RWHA 2YAOA 1XH3B 2AFNA 2YA0A 3WFBH 3REVB 3G6JA 3S37X 3ALXA 4PJDF 2L7JA 4MRCA 1EEYB 5LO7A 4EBQL 2XWBA 4WO4C 5KJ7E 1WCQA 3D85B 2WXRA 1F4XH 1HCFX 2APTA 4J6IA 4TSCL 3ZKSD 1R0AH 3SKMB 2JIXA 1J48A 3MRKA 4Y2DC 4DP4X 1U8QA 5FO2A 3ULUC 2P8LB 2XG4B 3G04A 3HFML 4OCXH 4JN2A 3SHSA 3SDDD 5FGRA 2UZYB 2BH0A 3OKOA 5EO9B 4PJ7F 1W6LA 4FN0A 2FQEA 4IEFB 5I0VA 3R19A 3LKOB 4GO9A 4N4YB 4YFLI 3FHEA 2ZWYA 4YDLB 2JLLA 4NO3A 2YPVA 3F5WA 3MA7A 5F9OH 1AE6L 2EIDA 4AE0A 4X4XB 2ZX7A 4M6OH 1FGVL 2V2WB 1JZJA 3D25B 2DQIL 2QADB 2DMKA 3K8MA 5C09D 4MGXA 4UQ2A 1PZDA 1ADQA 3KYKL 3PWUB 4Z7AA 4GW1B 5AEAA 5KZCB 1HU8A 3CZFB 4NQCE 4GOSA 4L4TB 2GHZA 3GSRB 3MJWA 3OKDA 1YA5A 4WFHE 3PUCA 1DVFA 4JO3L 5IB1B 1HNFA 4F2ME 1B4JL 1E67A 5JW4Q 1U30A 2WLNA 2X6CA 2XX1A 1EDHA 1Z6JT 4PJCF 4XOBA 3B37A 3F6IA 3HG1B 4RFEB 3S0PA 4B27A 4BE6A 2OXGB 3PGDB 4IRJD 1QSFE 4MA3B 5KJRH 3BGMA 5A1AA 2XV2A 2VDPH 1TJXA 1KJVA 3T3MF 4FERA 1ETJA 1PMYA 1Z0MA 2P8PA 1XMWA 2X40A 3DVIA 5C0CE 4K3HA 4XPTH 4YQXH 4OUUA 4UMGA 4BFBD 1BFOB 1WD9A 3REWA 4EQ2A 4QTIL 4ZTOH 3LDBB 4RIRB 4PGCB 1JF1A 3F7KA 2CWRA 3L3JA 1QRNA 4PRPB 1MCFA 2NT1A 3FT0A 1FQ9C 3QQ3A 5D55A 2H6UA 2EDXA 3P0VH 4ICWA 3D0LA 4TTDD 4WEEA 1BBJB 3O4LB 5C0CA 3V0WH 4EDWL 3ILQC 4GQZA 4U1JA 4B9KC 3TIEA 5FOBB 3KL0A 4XCYA 3ZZLA 5IBUB 4BH8A 3MOBL 3D7PA 4RGOL 3UO1L 2BSRA 3OC5A 2IV8A 3ZTJG 1UD3A 2P5EA 3IPEA 5SWSA 5AQ0A 7TAAA 2P8LA 5B8CC 3C5ZC 3FTGB 3H2PA 1TZGH 2YJLA 3PPEA 2B16A 1I9JL 1NZRA 3O8XB 3QW9A 2PP7A 4Z7WE 1K3IA 1MFAH 4HK3J 2DLHA 4AVIA 2EEXA 1CG9A 4XMXA 4U6TA 1HN1A 1MAML 2YK1H 3QORD 4KHXH 5DHDA 2J5WA 4JFQA 4ZW3A 1HVXA 3DIDA 1DVFC 1NLDH 5IF0B 1BMZA 3CBJB 2OSLB 1WS8A 2GQHA 3GI8H 1VF5C 4HH8A 1NFKA 4BSWB 3LN4A 4ONGH 1CK0H 5BZDB 2GAZB 1CXIA 3BD5A 4WI4A 4PFEA 3MLTB 2J56A 4ZMVA 4UV7L 3WL9A 2G30A 1II4E 4U1MB 1E3FA 3K6FA 5KBDA 1LYQA 3RDTA 4IU3A 5IQLA 2VDMB 3F7YB 1R3JA 1J12A 4OZIA 5TGBB 1RIVL 3B8YA 3DMMC 3MPCA 4GUOA 4X6DF 1F02I 1YSOA 5JHDD 3X3GH 2AERT 3T4AA 3MJ7A 5FW6A 1SBSL 3NEXA 4J1UB 4O2FB 3WNPA 2X44D 2EICA 4CDGC 4MB3A 3EO0A 3FFCE 4FKEA 1Q9KA 3UCRA 1ZLSL 1OQOA 1LWHA 4P4RA 4GG6E 3CE1A 1H6UA 3CFDB 4MA7L 3ARQA 1A21A 4L9LC 3ZGHA 3WEMA 2SEBA 3MXWL 4FZEL 4LHUD 2FLMA 4PGEA 1PLCA 2MCMA 3P73B 2AJ3B 1HQRA 5GGSY 5IVZA 3TV8A 2VXQH 4RIRA 3QNXB 5C6WH 2HG5B 3G6DL 3EH3B 4R6UA 3S37L 3ZDXF 5E08L 3ESPA 2XPGB 4ONFL 1MRFH 4X83A 1EMTH 2WPGA 3NFPA 4BSJA 1NGQL 2PCYA 3BVWA 1KY6A 1D7FA 1P4UA 3RWJB 4OJYA 3G7TA 3WNIA 3CLEL 4MD5A 3SDXF 1QFUH 4HJ0D 3QCVH 3STZB 3IJHA 4HW6A 3RFZB 5KS9B 4JZOB 5HDQH 3CXDL 4DNLA 3NJNA 5IKCB 1HHGA 1F90L 4ZG1A 5CJXA 5AW1B 3A6BH 1E5AA 2HA1A 3QISA 4G6ML 2IH3B 3LQAC 35C8L 1DVZA 1ZD6A 2J8UB 3BQUB 3BVNB 4LLWA 5E5MB 4G6AC 4QGTA 3FQYA 5C0JA 2FL5A 3AABA 4KZEL 5GGVH 1TOXA 4LL4A 5CEXB 1D6EB 1QRNE 5INDB 1AMXA 1CU4L 1IGJA 4BDVB 2Y7LA 1ZTMA 4JPWL 4FXGC 1GS6X 5DD3H 3MSPA 4ODHL 3MLPA 2A6JB 4J2XA 4WQOA 2EDOA 3VI3B 3VFSB 3SKNA 2EEBA 2MMXA 4N0YH 3NTCL 2H6OA 1J87A 3QI9B 4MNQD 1XWVA 3SYAA 5JA9A 2WHVA 2NQ3A 3QFDA 3QXTA 2VDKH 3OHXB 2VO8A 2QPDB 4G7YH 2VE6B 5KVDH 3TFKD 4DUVA 3Q43A 3R1GH 1DEEA 2AJVL 1G6RA 4NJAL 4GUCA 3DHJA 3K2UH 1JZIA 4F7CB 3BD3A 5C0CD 4RCAA 3E3QE 4O2FA 1F4YL 1I85A 1M53A 5DZNA 4HP5A 4OGZA 1MJJB 5C08E 4PJXF 1JV2A 2CHXA 3QHFH 5GHWL 3BKCL 4PEEA 5E9DB 3NCMA 2HRGA 1OAQL 1W0WA 1OTSD 4TNVK 4J4PA 1V3LA 3RWFB 2C8NA 4ZPTA 2HT3D 1DCEA 3S6CA 4TSAH 1GGYA 3MLWH 5D7JD 3CZUB 1Z7JA 3HS9A 4HUXA 3KVQA 4EEEA 4M6ML 1QSFD 3FQWB 2XUWA 3TGXA 3VGHA 1X4YA 2YMTA 4IK7A 4GG8B 1DQIA 3CHSA 4TULH 3SYOA 3P30H 4PW9A 3RUGF 4IKNA 4QXVA 4M7JH 2HKHL 1EAQA 1NSNH 4A6YL 2R23A 1ITBB 2QEJA 4EE2A 1YNKH 2B77A 3DHUA 4XWOC 1F3JB 4OLUL 1WFUA 4W9HC 1EZUA 1I1AC 1IQDB 1NCBL 4RFNB 3ZT6A 1DZ0A 2EUZA 2EVJA 1NLBH 1ZLWH 2WKOF 4QRUB 1A9BB 4UIKH 5TE4H 3BHBB 4FNRA 4X7EC 4OFVA 5F88B 4M5TA 4WNQA 5F7DA 2DJ4A 3KXFA 3BVNA 1CLZL 1JVOA 2CO6B 1FYTE 1ONQA 3PNRB 1AVAA 3OG4B 3LHPH 3VGFA 5JDSB 5MEOA 1OIOA 4HV8B 3ERXA 4WW2F 3KPLA 4PJ7B 4EUPG 5KVFH 2DQDL 4DO6A 4B53A 3C8DA 3DXAB 4YS4A 5HVWA 2HFEA 4KK8D 2PYEB 4FQHB 4K55A 3B3IB 5KVGL 3B2VH 4E0RB 4LAQH 2ITFA 5AB2A 3TP4A 3F8UB 1T2XA 4PJ5B 5T1MA 3HNSL 4XAKE 4WKXA 4P46C 3QI9A 2DAVA 2E8YA 3DMMB 5H37H 2XZQL 2B1AH 4UQIM 2E27H 4X9HA 3DXAE 1PNDA 5A2LH 1D5BA 1NMAL 3GSWB 5JNYB 4NQDB 4P99A 3PP3H 2C3VA 2N59A 3IXAA 1YNTB 4CNIA 4N8CH 5KN5A 2YAFA 1NPUA 3P3RA 1ZT4B 1T1WB 1WBZB 2NY7H 3HG4A 4WHCA 5F93C 4PBXA 2A2QT 4PG2A 5HGBB 3V0EA 5CEYB 2FD6L 1R9FA 4YHZH 4LCIH 4G6JH 4F8QA 4UTBL 2O6PA 1FHNA 1MHHA 1FH5H 2GJ6B 3UIZA 4EZLA 4DPBX 3BPNB 1ULVA 3DX6A 4PJGE 4YSTA 3TZVA 4BK8A 4ENEC 3TVMB 1HJBC 3ZYOA 4F92B 1NCCL 2K4WA 3F05A 2F58H 3H3KA 4JPKH 4PJ9A 1R5IA 5DEJA 3BT0A 1A0QL 2ROXA 4GRMB 1A7NL 1XH3A 5D7LE 1QLEB 1XGPA 2EXTA 3ZE0F 3ULVH 5CP3A 2AJUL 4EUPB 4G6KL 1EEYA 3FB8B 5F71A 1MWAB 1RZPA 4W4NA 3RKPA 4YBQD 3VH8B 1F4WH 2AK4A 1WF5A 5EN2A 4Y16B 3KLAA 5IG7A 3LRMA 2J21A 1KLUB 2XWZA 2VITB 2EDMA 4U3HA 5C92A 1F2XK 2LVCA 2X3CA 2XN9A 4JCLA 3E8UH 4OW6A 4CBPA 5JOPE 4QT5B 1MPAH 2ITEA 2P49B 3QEGL 3WLBA 4PQXA 5F7HA 3E80A 2A74C 3M1BB 3WIFA 3DI3B 2A9ML 1A6UL 1BZ7B 4GLRH 4K5MA 3VFMB 3LB6C 2IG2H 3VFVB 5HYQA 5IM7B 5F3FA 3JT2A 5IREA 1F8TH 3GZPA 2VAAA 3BP5A 2WKGA 2NUTA 1A7QL 2O5NA 1TZGL 4L8SA 4F5CA 4TV3A 3QT2A 4TUKH 3ZPDA 2IIJA 3T0WA 3SDCC 1XGRB 3TN0A 3ZL2A 1E9QB 1IAIL 3L4UA 3OKEB 1UB6A 2X42A 3L7EB 3TBCA 2EUVA 4XVTH 2CDFB 2A0LD 1LK2A 2MFNA 1H3UA 2DMGA 1BECA 1TSRA 1LEGA 2DLTA 4QRBA 4FL4B 5K59F 1UZ8A 4P59L 3V6OA 4MB1A 3B7UX 3AU1B 1IVLA 2QT6A 1Z0NA 1OB1A 1Y1DA 2AK4E 5DZ9A 5B1CA 2GBUA 4UV7H 2DS4A 4BWUA 3SGDH 5IIEA 3RVVC 3HVDA 3QJFB 3HNTH 2N01B 4EKJA 5EB9A 2X09A 3WY4A 4R5TA 5KYWB 3CU7A 1ORQA 1R75A 1PD0A 1CDJA 2O30A 3ZOAA 2A5UA 2OMVB 4IOFC 1AYOA 1MSPA 4OV5B 2ZYIA 5E2UH 3T4AC 4AENB 2VM3A 2OCJA 1KJ2L 4FG6D 5IWLA 3H7LA 2WXGA 4EI5D 1FJ1B 4GI6A 2VDNH 1DQML 4GB9A 1KSRA 2X4NA 3FO2A 1USQA 3IDIA 3ME0B 1DFBL 3RG1C 5DQ9B 4FFZH 4WJG3 3B2MA 4XBMA 6FABH 3L3HA 1FFNA 2M2DA 4PWHA 4WTZA 1UVQA 4XN8A 3PV6B 2UXFA 2GW5A 1IGYA 3Q6GL 1HSAB 3U46B 3VX1A 4G8EB 5EUOE 4AMXA 1Z5YD 3DO4A 5FA4A 2VDKB 3SDXB 5GGTA 4GSUA 1WIOA 2JB6B 5DUMH 3WIHA 4BZ2H 1OSPL 2TSAA 3BAXA 4M29A 2WO2B 4WI3A 3OJVC 4KWUA 1Y07A 3IPBA 1JGIA 4GG6B 2MSPA 4KHXL 4CRPA 3LN5B 1FVEA 1QFOA 1G1YA 3L9RB 3P3UA 3TL5A 4PJIA 3U36A 2XV3A 5EOTA 3EYOB 3ZDYB 2ZKXA 4WSKA 4HHGA 3T3PB 5IB3A 2GTQA 1MHPH 4KK5D 1JE6A 2IXQA 1S4IA 3NZ8A 3QQXA 4ZYKA 2JJWA 4GRWH 4OT1H 4CC4A 1XBDA 3H1ZA 3VFGH 3TESA 3DX8A 4X9IA 1MIML 3SBQA 3T8XB 1AS6A 1PLAA 4UAHA 2R69A 4IGBA 2DWSA 3O41B 4FNPA 1VDGA 5GIRB 2D0FA 3P02A 4IGBD 1EZVY 5ESVA 5I1HH 3L7EA 2K9UA 2DIEA 3LKPA 2UXTA 1IFGA 2AABH 2E86A 2GSMB 2HKFL 5JMRA 1D7DA 4WUUE 5D71H 3HHSA 3L81A 2P5WA 5D7KE 2J1WA 3F83A 5EF1A 4LOFA 4PIRF 5B1JC 4IDJL 1MRDH 3P3SA 1WZMA 3FHAA 5D9SA 5FLVA 1JXFA 2AP2A 3BAJA 4JKNA 1S5IL 3MGOA 3SPVB 4I1PA 1AKPA 1CDIA 4NSKA 5HP5A 1INQB 1OGTA 2VDKL 3D3VA 2OR8A 3VXUB 4PRHB 4P23D 2LTQC 1L6PA 1N7MH 2F1EA 4HDIA 5EOQH 2VLRE 2Y7QA 1NCDL 1X5JA 4FQQB 4KO7A 4BQ6A 3IJEB 4XOAA 1OKEA 1BHGA 1XSOA 1DLFH 5FM5O 2GBVA 1BQLL 1DJZA 3KYMB 1NC2D 3SD5A 3N6YA 4E9WA 4PJCB 1L9QA 4BRJA 2YXWA 1U0QA 4O51B 5FKPA 3DX9B 1LWRA 5BRZE 2FO8A 3FU7A 1NAML 1IZJA 4WU7B 5CCGE 1IC7H 2JIXD 3QJHB 5L8JB 1QBBA 2HWZH 3CZNA 2JCCA 2UV3A 2FJGA 4XC3L 4X80L 2D3LA 5FYJU 5AUMB 2B0SL 5AD0A 1YY9D 3HE6B 3V4PB 1TITA 3L8QA 1FVEB 1QUPA 3L9RA 4JPWH 4YDKL 2X0VA 4I88A 1U8CA 3ZUNC 1P4BH 1OLZA 1GJWA 4DOHB 4QLRA 3ECBB 5DMIL 1CL7I 3ECVA 3QHZH 4I0PD 3GC3A 1C7TA 2WLLB 4DUXA 5F89A 2G2PA 3FQNB 1M2OA 3GBEA 3I75B 1BXVA 2ALWA 2F54B 1DQDH 4FNLL 3CHOA 3VFSA 2EXWC 2OTPA 2R2BA 2AV7A 3DJRA 3ZLQC 4L0YA 2C5DC 3AWFA 4IGBB 2BHUA 3VWKC 2IVFC 1O9WA 3DARA 5FGSA 3AFLA 2CUAA 4JFWA 1LO4L 1SHMA 3KWWA 2V9UA 5TDOA 3VI4E 3CUPA 4ZDHA 4B3VA 3ATFA 2YBRB 4KJWD 1FIGH 1U33A 1K8IB 4DO4A 2W9EH 1JTOA 4XAWL 4AVKA 2XI9A 4O5LL 4Y9EA 3ROOB 1SDDA 4JFHE 5TDNA 2D2CC 1O7SA 3QC6X 4NUGH 1EFXB 4K9JA 2W1NA 3HNSH 3TPUA 4KOBA 3ABGA 2ZF9A 3H85A 3HPLA 4U31A 2LABA 3DK0A 1V7ML 4GBXC 4Z7VB 5D7KD 5BS0A 1LK3L 5IVXE 3QO0A 3CZKA 2FJHB 5EU3B 2H45A 3OSKA 4JO4H 5KG9A 1VLXA 5D7IA 2FBJH 3MJ8A 1A6AA 4JPQA 5DHVB 1G4RA 3G5YB 2A38A 3J27A 3B2PA 3H56A 5H35A 4F91B 2Z7ZA 4H8WH 4EI5B 3BZ4A 3U7YL 1JRHI 4ZO9A 2E7CA 4GG8A 1CICD 5C0DB 2VDPB 2OJZL 2C1PB 4M5SA 3RX7A 3VXSA 2FWLB 4IRZH 5IHBA 4PHXA 4PJCA 3G08A 3P54A 4PJ9D 1QSEE 3P2TA 4R84A 4WK4B 3B3BA 3NGBB 5JXAH 2ZUVA 2QGDA 1YEHH 3K1DA 2FHBA 3KJ6L 3U2SA 1M6OB 4U3SB 3CZGA 1M7DA 2XG4A 1WZ1H 1UACH 1UQSB 4FQ1L 4HJGA 2FSEA 4NKDA 1GTFA 4OKDA 2WZPA 2HH0H 2LW3A 3HB3D 1GRWA 1MIEL 3KR3L 1LQBC 3JSSA 4JHWL 3BPCB 2Y3AA 3LKOA 4NERA 4XPFL 2R69H 3TBBA 5TPWH 1NMBL 3GRGA 5D7EA 5DZJA 2ESVA 3ATAA 4LLMB 1IJ9A 4UB0H 2VZSA 3FRPB 4G7VH 2WOBA 4EI5C 2PPAA 4A68A 5AW7B 5L2KB 2ADJA 3SKMA 3GLAA 5T1DH 1DZBA 3FT4B 1SJHA 5ABZA 4FFVC 5D1XC 4XMTA 4AQ8A 4PCYA 5HPMA 1P4IH 2NNRA 3GMOB 4HIHB 3O6FA 5ENWA 3OJ2C 4H0LC 3MRMB 5E1AB 4G3YL 4WFHD 3U6XA 1GKOA 3WD5L 5I17A 2YMXH 1KB3A 3SZKC 4LMQE 4WUUA 1J9RA 4NQDA 4YHYC 3NSCA 2YA1A 1DDHB 2Y9RT 3DX4A 3LNEA 4CNIB 4L1SA 3DJZA 4IJTA 1NCNA 1ZTXL 2V8LA 2EDJA 1XMEB 3AT9A 3AC0A 2BVUA 1S8DA 2FECL 3K2IA 4UQ2B 3SD2A 1U8OA 2MWCA 3GPSA 3VXUD 2B20A 2XN2A 2NYKA 3BUYA 2ZXCA 4IYKA 3S36X 1MLBA 3X1EA 5C0EB 3C87A 1A66A 4G70B 2JJTC 5I6XC 5D2LA 2J71A 3MUGB 5IMKB 3LQZB 4QRSB 2CH8A 1T0PB 3TH2T 3TZVB 5D7HA 1F4AA 4YSDA 1GZHA 5DJCB 4QJ5B 4TLKA 5J6GB 1KTLA 1C9SA 3TOPA 4L05A 2FAUA 3BD4A 5D1QC 1PLGH 3O0LA 1WG3A 3C5SA 3QEUA 2PXYA 1BCIA 1JPSH 1XGZA 2ZAGA 4KITB 1CICA 4PYHA 3UH8A 5L7XH 3WS6C 5IJVA 1M71B 2Q10A 3FQ4A 3D39D 4ZMZA 1QSFA 1Z2KA 2P5PA 4ODTH 4HIJB 5JHLL 1PD6A 1WT5C 3OMZA 5FYLL 3D6GA 4J4PD 1BBDL 1ED3A 1VACA 2A83A 1CXHA 2X10A 4MX7A 4ELKB 2PLTA 1YEDA 4CSZA 5F1IA 4IBLT 4PJFF 1BAFH 1YAZA 1Q4NX 4H8QA 5KBPA 1XF3B 4J3OF 2PYEE 4OTXH 1XZ0A 1A2YA 3ZRCC 1BP3B 1BVNT 3D18A 5C6TH 1R3KA 1E5UI 3UTSB 3QR2A 3HRPA 5CN2A 5ICZB 2VAAB 2J8HA 1PLBA 2R2EA 5MHSD 3WHXB 1IBGH 2YUVA 3CC5A 4NHCL 4B5EA 3B9KA 1CLYH 2ZPKH 3NRQA 2MOGA 1SJHB 3O9WB 1CFQB 3BXNB 2OMBA 4N22A 2E0PA 3FONB 3K91A 5FV2A 3QJOA 5TGBA 3O6FB 2FQFA 1AXIB 1F0LA 5CN3A 3U0WL 2F7PA 4AG4L 2WTPA 4HWBA 4F93B 1OM3L 4ACTA 1T2QL 2R2HA 4WUUB 3OJDA 2VDNB 1JXKA 1PF3A 4D3CL 3WFBL 3OB8A 2CPUA 4UIMB 2AJXL 3RURA 2W60B 3GHPA 4P4RB 2GCYB 1PZCA 3ETTA 2OL3B 3SDYH 1JNHA 4QHUB 2DL2A 3ULVD 3N91A 3HZKB 3CN3A 5C07D 3GLDA 5K39B 2E46A 2WWKO 4Y89A 1ZT1B 5L8LB 2LLNA 3DLQR 3HN5A 1D3CA 2ZOKB 3MBXH 4F24A 1A3RL 2YQ2A 3PJSA 4X98B 5JW5B 2Y22A 4G6AD 4JG0H 4HBCL 4OSUH 5GJTH 2JF1A 1CC3A 5ESAA 1LO2H 1HQ4A 4XAKD 5C9JA 2R1WB 5IUSA 4RISH 2CM6A 2UZIH 1BXXA 1AE6H 2XIDA 3NUKA 4P9HH 3BISA 1S7TB 3BFWA 1NGPH 4OD3H 3GBNH 1MJUL 1UH3A 1NL0H 4G8EA 3I9GL 4BQBA 4JQIL 4IBTA 3NAAL 1KEGH 1TZIA 3TONA 2VSMB 5LCVL 2PTUA 4LLWB 5EIIG 3VTAA 4HIJA 4I8DA 1YUHA 2A99A 3CCHB 4GG6A 1CZ8H 2JKIS 2QSVA 2QELA 3GBMH 4AXWA 3LEYH 4MS6A 3TWCL 3EJRA 3GXPA 3GWJA 2Z1PA 4RBPK 3RU8H 4AYID 2I9TB 2DYRB 1WJ3A 3HAEA 4W81A 5FO7A 1XZ0B 4JDVA 2DQMA 4RETB 5FAAA 3MRIB 1HL9A 1BQHA 4BWWA 1B6UA 3RGVC 1NAKL 1EXHA 2GUOB 5IFAH 4TSBH 5DMYA 3ET9F 2YGQA 5LCVA 1X7QB 4RGNC 1IE4A 3BI9X 5F3BA 1GGCL 4LGPB 1ZEAL 2MHAB 3BQUA 2DEWX 1E2WA 3GXMA 4EIGB 4YXHH 5KSAA 3K81A 3Q9QA 3EYUH 2ATAA 3ISRA 4MAUL 1G5GA 3HZMB 5ISZE 4P4KB 1KB5H 4YHPA 5AAWA 4QRPB 4HJJH 3TASA 3FAXA 3VGAC 5B7MA 4N1HB 1FO0A 1UURA 4JZJA 5FEBA 3QORA 1PL3A 2X70B 4QF1B 4HKJB 4M3KB 3NG5A 4P2AA 4WFEE 1V3JA 2ZSVB 3AS3A 3L9YA 3P4NA 2OL3A 1F97A 3MBWA 4YHIB 3OWEA 4NSKB 4OVVA 4FHKA 3O2DA 5ICUA 5GGSA 1DLFL 4KJQC 4JREB 2Z93B 1AI1L 2DICA 3MLSL 4Z7VF 3HPJA 4Y4KB 3VXNB 2ZOKA 4M43H 4FQQA 4IBQA 1QPXA 3RWHB 5LN8A 3KYMA 4AJYV 1TJIH 2VB5A 2PO6B 5TK4A 1KXQE 1YCSA 25C8L 3U7WH 4KNQA 2QZ5A 2RQ8A 1TENA 4LSPH 2X1XR 1KBKA 4K73A 4GSXA 4X9GA 2XWBB 4DO5A 3QUYC 1KELH 5IEKB 1BSIA 1VERA 4O51A 3EDKA 4PUBH 4KQ3H 3IBOA 3VGGA 4DSYA 3NFNB 4K9EH 4XXCA 2VQ1A 3I6GB 1OAUL 4G72B 2VNCA 3KPOA 4DHLA 1JPGB 4WI6A 5F88A 3QWOB 2KHAA 1B2YA 5FDYA 1IGIL 2IMMA 1RIVH 5KBKA 2YQBA 1H8NA 3W5MA 1GY2A 5FW7A 4OFPA 4MMXC 3WSQH 4XCFH 2CBMA 3CJJA 3MLYH 1GVIA 1F56A 3S7GA 5IHUH 5EEUA 1M42A 1RLBA 5DEGA 5HJDA 2DQJH 1UADC 3CFEB 3D85A 3PWLB 1C5BH 3C6EA 3KPSA 4KUZH 2Y3NA 4HWBH 3BH8A 4PJGB 4YX2L 5TFSL 3UZEC 1PJWA 3HUJA 4FFYA 4B95C 2GTZB 4Z77A 4MQXC 3H54A 5A43C 2VC2H 3KR3H 3FDWA 4ETQB 1NDGA 4AVJA 5CZXC 4CSTA 1A65A 4WDIA 5JXEA 5HHVH 4JFYB 2DIJA 1T4KB 1G7MB 2VRQA 3L1FA 5KJ4A 4ZK8A 3WJJC 4NQUA 2EE6A 2V5SA 3P2DA 4JB9H 4UB0L 1AZCA 4XBGB 5CP3H 1JYNA 3S8WA 5DYOB 1MXGA 2ESVD 3ZHFA 4DGYL 4QRPA 4Y5VA 5DC0A 3IXAB 4ZTPH 4U49A 2Z92A 4CSPA 4YEEA 2WBJA 1GCFA 5I8CB 2CGRL 4S11A 4HEMA 3T6ZA 1U8NB 2HTKD 5BVJB 2BFVH 4X4MA 2CRMA 1FDLL 3QXDA 2B3RA 2XSKA 3CVCA 4RMUA 1ZIBA 2EIKB 4NWUH 2F74A 1HYSD 1A7OH 2QBWA 1NC4A 2J2ZB 4PRPA 1F1GA 2XYCA 3V4VB 4YFEA 3GS7A 2Z93A 2CGYA 3B1TA 3RY6A 4PJFE 5EBWB 4ZW6A 3L3KA 3FOMA 4H20H 2Z7UA 1KJ3L 1IC5L 4KKNA 1TYEB 4MA3A 5IBTL 3TO4A 5JIQA 2GSGB 2C3VB 3W11C 5KN5B 2ODHA 3MACH 5C07E 4MXWL 2PPCA 3WKNA 2EEDA 5D6CA 3NSXA 4C56D 1RL1A 3FB5A 2OR7A 4DH2A 4POYA 4ZS7L 3O3AB 3N44F 2W5PA 4W9ZA 3CPUA 3MODH 2ERJB 3QEQD 3R06B 1MIEH 3MRLB 2Y1YA 5CGTA 4RNRB 1J5OL 1NOAA 4JVPA 3RVWC 1SXBA 3FHQA 1WEJH 4FTVB 1ZVNA 1P2CB 3BWZA 1YMHB 2J25A 3FF8A 2HT2C 2R56L 4N9GA 4KI5F 5D93B 5T3ZE 1VCAA 1M3IA 4YR6B 1TPXB 3SGJA 1RU9L 4WI7A 4J3OD 4C4UA 3EGXA 2UUDK 1J0KA 1MCIA 3NACH 5D6DA 5A6LA 3ZJAA 4E9XA 3ARDA 4GH7B 1QFPA 1G9NL 4LSQL 3FB7A 4YPJA 1T0NA 3BVXA 1WWBX 5F9WC 4ZMPA 1U8LB 2YD1A 2WLIB 4QXWA 3LN4B 2PWFA 3S88L 3NBNA 5GRJH 5I5IA 2AJZB 2EO1A 4HSAC 1FGVH 3P0YH 1T0OA 3LKSA 4MJID 5CR1A 2WQSA 4NFBA 3RDTB 3B56A 3FT2A 1OF2B 3S97C 1GZPB 2PPEA 1E5ZA 1PEWA 3OB0H 1Q0XH 5FO8B 4HKBA 4NENA 3RVUD 2W07B 4E41A 3VCLB 5L4MA 3DHPA 2L3BA 4ISVB 4JRXB 3RZCA 5DFVD 3SPGA 1I8UA 5E2WL 4ZMAT 1F4XL 4LDCA 3CTTA 4WNSA 5BZDA 5D2NA 1Z32X 3FFOA 4NQEA 3CQFA 2Y6SD 4YC2C 1HWHB 4OLUH 3WN5A 2NY3D 4JY6B 4UU9A 3TEYA 3P3YA 1YQVL 3U4BL 4JFOA 2ARJA 4IIQB 1XTLA 3DRTA 5F21B 4DKEL 3BESR 5DFAA 4F33A 3ZO0A 3DDFA 3MAWA 5CMAB 3F7YA 5JIDA 1G6VK 2OMUA 4KY1L 3SO5A 3MUUA 4NGHL 4ZTOL 4O58L 1VADA 1KTCA 2NW2B 1AGFB 1THCA 2G75A 4KKQA 3EYVA 3ECUA 3ZK0A 4W9FC 4NBYB 2C26A 3SQOL 3ZTEA 4P5TA 4JGUA 2VISB 4XN7A 4Z7OB 3RFZA 3C5SB 3QIWC 4I18C 1V10A 1VFAB 1J9TA 1YMMA 3ARWA 1TZOA 1X4XA 3EYQD 3DHMA 4XTRD 5JW4M 2CKNA 3AG4B 3TCTA 2YZ1A 3SDXA 1XL6A 2XVLA 2CO7B 4LEEA 4V1DE 3WN5C 1N6QL 1M3JA 1B4JH 2G2NA 3ASOB 5GJTL 2ICEB 4GKZA 4W6WB 5D7JA 2V8MA 5DT1L 4M1CD 4BFIB 1VESA 4HLZG 2E27L 4FFYH 1XR8B 2B9BA 3DTDA 4FYQA 3R4RA 4JY5H 1W6WA 2N0KA 2E9JA 5FX3A 4BDVA 4XO3A 3ESMA 4GP4B 1IBFA 4W9IC 4Y5VC 4X8JB 1I3UA 3FB7B 4DT2A 4JZOA 2UYLB 1YO4A 4YDIL 1A5FH 2AEPH 1U36A 2CUIA 5E8EB 2X2HA 3VXPB 4DP9X 5L2JB 3X1FA 3UACA 1KEGL 2WWMD 4MAZA 2VUKA 3WJLA 5B38A 4Y16D 3E0GA 5HDBB 3E2HC 3X1BA 4KI5D 2R0KH 2ZJSL 2ETWA 2LU4A 2QMKA 3H7BB 4PP2B 4FCHA 1E8ZA 4L3AA 4PMEA 2FEEL 4XNMA 1MN4A 4UINH 2QL1A 3BVDB 4HJTA 3MNZA 1MCRA 1IBDA 1A9EB 2I7OA 2CAKA 3WJMA 4ELMB 1SEBA 2HRLA 1RV6X 1NGXB 4Y9CA 1XH2A 3PQYE 1KLGA 1CLVA 2L8AA 4G5AA 4OCRH 1S3KL 2F7OA 1RIHL 3JWNE 3CFMA 2CBOA 1ZE3C 4FNUA 43C9B 2L7UA 3H0TB 4FLQA 2DWYA 2QLVB 4E9RA 2QPFA 2O5ZL 5E1GA 1FLRH 3R7QA 4R7DB 3DVGA 4KI1A 4AQAA 2P46B 3LSOB 4HCRH 4LLYA 1VFOA 2E4TA 4IIQA 4XN1A 1ZT1A 3KGRA 5GGTH 3PDDA 2HMIC 3KBPA 2DW5A 4H88L 4M8UA 4EF3A 5ALCH 2YK1L 1MAMH 4YFDB 2BOCB 3I9IA 4LBEB 1BZ9B 4BKTC 4NOBA 2E6JA 4PP1D 1BQSA 4JMXA 5GS2H 1JZ8A 3KPQA 2HVKA 4FHBD 1FNSH 5KSVB 3N85L 5DUJA 4IKLA 2L0DA 3EDDA 3UERA 5JIMA 1CGWA 2HFFA 3RUGA 1HEJC 3HRZC 4PJ5D 4WKZA 4ZD3H 5F2FA 4Z7WB 2WBKA 1S5HB 2DKSA 4APQB 4J3VA 3S9DB 2ZX5A 5J1AB 4HGMA 1S7XB 4MZ2A 3JVFC 3L7FB 4LKXA 5GHWH 4JM2F 4HDIB 3QCTL 1G7LA 3CXHJ 1JZHA 4YSRA 4X5PA 5E8PA 3VFUB 5L9DL 1A02N 4K4KA 1IAIH 3K5SA 1IBYA 1IM9D 2DBJA 2OMYB 3PWVA 4TSAL 2QSTA 3ES6A 4TQEH 3B2UD 1OP3H 4OI7A 4PRHE 3FQUB 3W56A 2YGOA 3OMAB 4OFKA 1VZIA 1XF5B 1XH1A 2J6EH 5FHBH 5KEZA 1DE4B 5ECGA 2UY7A 4G59C 1IGCL 3W0WB 5KAQG 3ZDXB 5K1NA 3SDAA 4BQCA 5C2BH 2WXFA 3GFUA 1GGUA 3MNDA 2R0LL 5F96H 4B3EA 3F6LA 4ZX3A 5EU5A 3GBLA 3TN0D 4OZIF 3BQUC 3PU7A 1BPLB 2PYFA 3L4YA 1FYTD 1KB5L 3HMWH 4PP2A 2ICES 1VA9A 2C9AA 4N87A 3T71A 1U9KA 1I9IH 1MJ7H 2IQAB 3HKFA 2JMRA 1NGQH 4R4BB 1F6FB 5D72H 1S9VB 3KWWB 1OE2A 2DD8H 1I3GL 4OY9A 3VXMD 1ZHKB 1GYVA 2VQUA 3QNZA 1C5BL 1AGEA 4MCMA 5ANHA 5FFGA 1T1ZB 3QZLA 4GXUM 3RZCD 4CMMB 3HG1E 1MQ8A 2ZP0T 3B3IA 4M9PA 4JS7A 5JLZA 1GOFA 1HNGA 2G4EA 4HF5L 2EDEA 3LIZL 1IAII 3V0HA 1DL7H 1JXDA 3BSHA 4OJEH 2FT6A 5DUML 2LAAA 4NUQA 4P5KB 3CBRA 1B0RB 3UP6A 2IFFH 4C83A 3CH1B 4HXBL 3OXRA 2BNRD 2DEXX 2BY1A 1C16A 2R0ZL 2ZXDA 3WUWA 3PAVA 1T66D 5CGYC 1MG3C 3BGMB 5CS7A 4UTAL 1X5MA 4LEOB 1U6AL 2XWCA 3LZLA 2CXKA 2VW7A 4KQ3L 1T6BX 4KTDL 1XB3A 2P8PB 2P4AB 3A4EA 2X2JA 1E8WA 5ERWB 2MQ3A 2D03H 4PJBB 4AIZA 2QV4A 1LNUA 2AK1H 3L5JA 5FA3B 3UCQA 4AGPA 5KUKA 1NMCC 2QSCH 2CLZA 3G3LA 4JE4B 1U3JA 2AGJH 3CXHK 1ZE3H 3FO1B 4OBSA 1SF3A 4Y2DD 5J1AA 3GTTA 3WNKA 4CN6A 2E7LC 3IGAB 2QHRH 1M05A 2B2XL 3S34L 1CXEA 5CGYD 4QRAA 2VABB 2Y5QA 3FL7A 1PCXA 3UJIL 2QPUA 3V8OA 4E42A 3QUMB 4RSYA 3DOHA 4PRIE 4PVLA 5HHOE 5T1LB 4IRZA 1CXKA 3IMBA 1HOCB 4RWHA 2OK0H 5KW9H 3JWDL 4RESB 2MKWA 1QPKA 3L5XL 3B2DC 5KVFL 1NGWA 3TA3D 4XP1L 3HMXA 4D0DA 4A67A 2AK4B 1Q1JL 3IGUA 2VXTH 4L8SB 3KPRD 3LS4H 1DVXA 3U2SB 1HL4A 5G5DA 3OBAA 4M6NL 3FUHA 1DVFD 4HIHA 2UUDH 1TTGA 3DTXA 3TJHC 5GRYA 5ENWB 1RJYA 2X4SB 5HI4C 1FSKC 3NEEA 2GHWB 2XU9A 4RA0C 2AZAA 3NIFB 3RWEA 4F7TB 1BZ7A 2R8SH 2B1AL 1GR7A 2PP9A 1Y18A 4U7MA 1XB8A 2R7EB 3AAZA 3APFA 1UA7A 1JP5A 2RR3A 2FX9L 1XSJA 3ZMRA 2VKXA 1TXKA 4OLWH 3B2UC 3P0YL 3GUTB 4OZFH 2H0EA 3VWJC 1TJMA 4X6CE 3T2NL 1OEZW 3VXRE 2CBQA 1AD0B 4P46B 2YFNA 1L9RA 1PYWA 4WZ9A 4YZWA 3VSTA 2IDSA 3GKWL 1N70A 1G1KA 2VMEA 3HHMA 4JVWA 2YUWA 4IIZA 3G5ZB 3VD7A 1BW8A 4W9DC 3MCLL 1MHEA 1T3FA 1RUMH 5AOLA 1HESA 3RNQA 5FYJH 2A6KB 1Y6NR 4XCCH 3DURB 3MN8A 3IAQA 4R2GD 5JR1L 1JRHL 3JTSA 5D2LE 4QAMB 1ZMYA 1CIDA 3VYPA 1U3HC 3CX5K 4U4IA 1TLKA 4ZW8A 4HWZA 1MI5B 4X6DE 3NFSL 4DKEH 1FG2B 1OAYL 5FA4B 1M71A 2WZ6A 4A55A 5I9QB 3CSYA 1P84K 2F5BL 5FHAH 4FNLH 4PN6A 1N8OE 1E4XI 1NKGA 1O9VA 1N8ZB 5BXFA 5IB5A 4KZ0A 5J11C 1CD0A 1EAPB 4N9GB 3O6FD 1G9NH 1FJ1A 2ZQKA 1VACB 2A83B 2RFXA 3N3EA 4L5FE 4ELKA 5I6NA 5DZOA 3VQ1C 1AKJD 4QIRA 3GSOA 1YEDB 3GZOA 4HHAB 4PVBA 1ZHLB 4PWKA 3STZA 3LPFA 4P05A 4APXA 1FNFA 4O5LH 3ZIMA 3VDAA 3PV6A 4CC1A 4PRID 2HYMA 5HHOD 2EYRA 3MTXA 2B15A 4YO0B 4LCIL 4A6YA 5C3LD 4PBDA 2IH9A 5GRUH 2JI2A 4LP4A 3EOTH 2YRBA 4GKNB 2BXYA 2WNGA 2MPAH 3GSVB 3VXQA 2NY3C 2H2PC 4P5MB 2ITDB 4WFED 5E99L 1R33A 4BZ2L 5HGHA 3RLSA 1QWUA 2WXNA 5CJQH 2HLFD 2EYTA 2O5XH 2BOBB 2R1YA 2JKLA 1RK7A 1U8JB 1QASA 3HI1B 3RVUC 4PLNC 4H8PA 2W65B 1IBZA 3V5DB 2CDEB 2FDBP 4FQXC 1FWXA 2NSQA 1NIDA 1JNHB 5KSAC 4O2EA 4PJ7E 1OGTB 2ZKHL 1LO3L 4PJGF 3BQUD 3ARTA 4EMZA 3BIBX 3QEGH 3HC4L 4F33B 1CDBA 3VXSE 4F7MA 1H3WM 1EK3A 1M7IA 3IJYB 1GGBL 2WVUA 3ATEA 5D70L 2A6KA 2MRYA 3LNIA 2R69L 1PY4A 1GH7A 2PW2B 3V4VL 2R1WA 3LEXB 4U6XB 1HE7A 3D0AA 4HKXB 4L8BB 4Y1AB 4UIMA 2SODB 1DFBH 1CFVL 2WOYA 4N28A 1B0WA 1IEAB 4P3DA 4U6VH 3BN9C 3L4VA 5D9SB 5K1JA 3K6NA 4N8UA 4TL5A 4YSPA 3L08A 4ZSOE 1HS6A 1HXKA 3O6LH 3CIAA 4HHWA 5GGTL 2V5TA 5DZVA 3WTWA 1MFBH 3D30A 4F7KA 4OCYL 5ALCL 1P69B 1KB9K 4OM1L 1OXYA 1UD6A 3PJSB 7CGTA 5D1ZA 5KYUB 4R4ND 5AZ2L 3IFOB 1XEUA 1SDYA 2Y5TA 5IOKA 1SN0A 2ZNWA 3P4LA 4N1EA 2E7HA 4HK0A 3PGCB 4N2KA 4E5XG 4F2EA 5EIVA 5BOPA 3FULA 3HRZA 2J6EA 2E7LA 3RJOA 1D5MB 3S3PA 4NC1E 3PWPA 3O6FC 2W9DH 2IADA