2XXFA

Cu metallated h254f mutant of nitrite reductase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGFGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 95
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xxfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xxfA02
2QPEB 2YXVA 2ZONA 4BXSV 2MTAA 4GP5B 4KO6A 2GI0A 2UXTA 1SFDA 3T71A 2PPDA 2HRGA 1IKOP 2UXGA 1JZJA 1NDTA 2J5WA 1AS8A 1A8ZA 3JT2A 3TASA 4A2HA 1RKRA 3IN0A 2VMJA 4KNUA 2AZUA 5E9NA 4Q89A 1AZCA 2ZXWB 1PF3A 2FQGA 8PAZA 1JZFA 2TSAA 2EIMB 3NP4A 1ASOA 2PCYA 1ZIAA 1VLXA 1CUOA 3PAUA 4YSTA 5EHFA 3S8GB 2Y1AA 1N68A 2YAOA 4BWWA 1W8EA 4GP4B 1CYWA 1OCZB 4BDVA 4FA7B 2J55A 1NICA 3V9CA 2OV0A 4G7SB 1E30A 2AANA 2IAAC 2P80A 4KO5A 3GXUB 1UATA 4UF7C 2R7EB 3AW5A 4M3HA 2WO2B 4AKOA 5FC9A 2HZHA 2QT6A 1PCSA 1ET5A 1ZDQA 1NPNA 1KCBA 1ILUA 1SF3A 3NJJA 3UAEA 2AFNA 4DP1X 2IWKA 3UABA 2BP8A 2VN3A 1SHWA 1L9SA 1NWPA 4CSPA 4A66A 1BYOA 2XYBA 5D4HA 4HALA 1WS8A 1N70A 2XVBA 1J9RA 2UXFA 1RZPA 1V54B 4GYBA 5F7BA 5PAZA 4G7RB 2J57A 3OQRA 3UGEA 4ZK8A 2BWDA 3IE9A 4DP0X 3S8FB 4M4RB 3ABKB 3CG8A 3WNJA 4E9WA 4YSQA 1BEXA 2E86A 3NJMA 2W8CA 4KO9A 1MG2C 3AG4B 1SDDB 2PP9A 1NPJA 2N0MA 4KOBA 4N4YB 5D4IA 3SQRA 1OOWA 3NJLA 2HLEB 2VM3A 2PP8A 2EIJB 3TBBA 2EIKB 3NSFA 1ET7A 1PZBA 4W9ZA 1RZQA 2OCCB 1KDIA 2EILB 2JFCA 2YQBA 3QJQB 4DP6X 5B1AB 1BQ5A 1BYPA 3WG7B 4A2EA 5B3SB 1XMEB 3SBRA 3OM3B 4YSSA 1TKWA 2FT7A 1GY2A 3FQ2A 3X1BA 4F7KA 1A4AA 2YAQA 2BZ7A 3FS9A 1PLBA 5D4JA 2YAEA 3CDZA 4NB7A 1ASPA 1OCOB 1BAWA 1J9SA 3FPYA 5TK2A 5LDUA 4YSUA 5I5JA 2GIMA 1ZV2A 1SNRA 4HAKA 1MZYA 2NRDA 1AR1B 1NIDA 3T6ZA 2VSMB 1OE2A 1AZBA 4A68A 2TSBA 2RACA 3ABLB 3PCYA 1JOIA 3PLYA 3PAVA 3FU7A 4DP7X 3QPKA 5PCYA 3ABMB 5I5IA 6PAZA 2FQFA 2YXWA 4CSZA 1GS7A 2UX6A 1DYZA 4BXVA 4EF3A 3TA4D 2ZOOA 3QQXA 1AANA 2AVFA 2GC4C 1YLBB 1NTDA 4GP8B 2Q9OA 2DYRB 3SBPA 1OV8A 1JVOA 2PP7A 3AG1B 3ASOB 2OJ1A 4HHGA 1IBYA 1PLAA 2FT8A 3HB3B 4A2GA 3FSVA 1M9WA 3QJVB 2BP0A 5I28A 3TBCA 2IH8A 5I6PA 1ET8A 3EH3B 2IDTA 1L9OA 1GSKA 1CC3A 3AG3B 1ILSA 2IDSA 4P5SA 3PAZA 4YSRA 1JZGA 4G71B 1PLCA 1OE3A 4KNTA 7PCYA 1X9UA 9PCYA 1MZZA 2FQDA 2YAFA 1PY0A 5B1KA 5F7AA 3QJUB 3QJSB 3WNIA 2FNWA 3IBOA 4DP2X 1CYXA 4JKNA 3OMNB 1PZCA 4HCGA 4GY4A 4DP5X 3TU6A 1GW0A 4MFHA 2XLLA 2H5UA 4RH4A 4YSPA 1URIA 2P80D 4KO7A 1OCRB 2EINB 1JXGA 1J5CA 3ERXA 2FTAA 2B3IA 1AG6A 1WA0X 4BWUA 4N8UA 4JHVA 2WSDA 4W1TA 4DPAX 1AAJA 3IN2A 1PMYA 5B1JA 2X88A 3NSCA 2BW4A 1F56A 4UANA 1NIAA 4ENZA 1W6LA 4YL4A 3X1EA 2IWEA 1FWXA 3ASNB 2CBPA 3FQYA 3UAAA 1XB8A 3X1FA 2BO0A 1WA1X 2QDVA 4K9JA 5TK4A 2PPAA 2Q5BA 2XV0A 5A7EA 3ZX1A 5I6NA 1J5DA 1JXDA 3BQVA 3CZUB 3V9EA 1EZLA 3NJHA 3S3BB 1AOZA 1IBZA 1HAWA 4HZ1A 3FT0A 1E5ZA 3FYIB 2R7EA 1L9RA 2XXGA 3AZUA 3ZBMA 1JZIA 4AKQA 4WKXA 4AZUA 1J9QA 3NJKA 1A65A 1M57B 2FT6A 1GR7A 2BHFA 3GDCA 2PCFA 3KW8A 4HHWA 3X1NA 1I53A 2GC7C 2GBAA 2XV2A 4PCYA 4DP9X 4DPCX 4YVNA 2XV3A 3AY2A 3IEAA 4E9QA 1XB3A 1IUZA 1IC0A 2DV6A 2H3XC 2X87A 3BVDB 5IY5B 3NSYA 1GYCA 3FPXA 3PXLA 1AIZA 2CAKA 1OCCB 3EHBB 4KOCA 5AKRA 1NWOA 1KBVA 5B1BB 1SDDA 1L9TA 3EH4B 4HCIA 3WKPA 4NAJA 1BQRA 2BZCA 1JXFA 5B1JC 3FU8A 1B3IA 3C75A 3MBWB 2QPDB 2Y69B 1L9PA 1FA4A 3HEIB 3EH5B 1BXAA 4AX3A 1A4CA 3U25A 1PNCA 3QJRB 1AACA 1JZHA 4E9SA 2J56A 5I6MA 3MX0B 2CALA 2PPEA 3RYMA 4BDVB 3NP3A 1M56B 1JVLA 2HXAA 2UX7A 5I6KA 1HFUA 1ETJA 1QLEB 1GY1A 1W6WA 1R1CA 1TU2A 2HX8A 5B7MA 4E9XA 1AZUA 1WA2X 4QKTA 4AKPA 2BW5A 1WAEA 3S3CB 3NT0A 3ABGA 1PAZA 2A3TA 3EF4A 4YSEA 2FQEA 4DP8X 3QJTB 4X4KA 2LLNA 3N2JA 4G70B 2IWFA 1HAUA 2BP8B 3NJIA 1A3ZA 2DWTA 5I6OA 3FQ1A 7PAZA 2GB2A 4WTQA 3G5WA 4HIPA 1FFTB 5AZUA 1V55B 3UACA 4NERA 2AZAA 3L45A 1ZPUA 1JERA 1PNDA 5B7EA 4E9RA 3SBQA 1WS7A 2XU9A 1XB6A 4Q8BA 1X9RA 2PLTA 1T5KA 3CVCA 1ZIBA 1GS8A 4HCFA 2CCWA 4YSDA 2FJSA 2JKWA 1ADWA 1NZRA 4F2EA 2IDFA 2GSMB 3ZDWA 2XWZA 3FSZA 3GYRA 4P5RA 2DWSA 1ZDSA 3T6XA 5I26A 4BWTA 2I7OA 1E5YA 1SHXA 2CJ3A 3KW7A 1QNIA 2DY2A 2XX1A 2VW4A 2VSKB 2XUWA 2UXVA 2ZWNA 4E9YA 3FYEB 1KBWA 2PPCA 1E67A 4F2FA 3H4FA 1KYAA 1SJMA 2I85A 3PPSA 1JZEA 3CDZB 3AG2B 3DTUB 2XX0A 2I7SA 1MDAA 3T9WA 2XXFA 4YSCA 5AFAA 1ASQA 2VW6A 2WO3B 1OF0A 3FU9A 1V10A 4FAAB 2VM4A 4E9VA 1SFHA 1OE1A 4TXVB 1KDJA 4AI7A 2HX9A 2H47C 1AZNA 3UADA 3CVBA 3DKHA 1DZ0A 1NINA 1KV7A 2FWLB 3T6VA 3WI9A 1BXUA 1NIEA 3FU7B 3FSAA 1MG3C 2YAHA 3NYKA 4E9TA 3FSWA 2YAMA 4YVUA 2HRHA 3OMIB 4UAHA 2IH9A 4DP4X 2CUAA 1BQKA 5ANHA 2GHZA 4DPBX 3NJGA 1CURA 4YSOA 4L0PB 1QHQA 4QLWA 1KCWA 4GXFA 1PZAA 3WIAA 3X2QB 2JXMA 2MRYA 1ID2A 3N55A 3JTBA 2BWIA 2W88A 2IDUA 3X1GA 2VW7A 3CVDA 4BK5C 3D12B 3NJNA 1NIBA 4A2DA 4KNSA 1E65A 1BXVA 3DIVA 5I5MA 1AQ8A 3S3DB 1EHKB 3T6WA 6PCYA 1NIFA 2BP0B 1RCYA 4G72B 3NJFA 5B7FA 4YSAA 1TEGA 4JHUA 2QDWA 2YAPA 4G7QB 3NSDA 1J9TA 1AS6A 2IDQA 4PAZA 1TEFA 3WKQA 1GS6X 3H4HA 3ZIYA 1L9QA 1KGYE 1A4BA 2YARA 3H56A 1AZRA 2HX7A 5I6LA 2PPFA 2B08A 3OMAB 1AG0A 4A2FA 2DYSB 1SF5A 3OD3A 1AS7A 4A67A
chains in the Genus database with same CATH superfamily
2P48B 3ARBC 2ADGA 5HVHC 3EDEA 3GI9H 4FG4A 4NRYA 2YXMA 3OJVC 1DJSA 1YA5A 3HG2A 4JZNB 1Q9OB 1U58B 4XNXH 3SHSA 5B4MD 4MS8C 4QRSA 4NJ9L 4X5WA 5CUSL 4XVJL 1H6TA 3D1MC 3B2MA 3MO1A 3FQWB 3MFGB 4Q9BA 4POYA 2KQMA 3CHSA 1AR1D 2DQFA 1R17A 2G75A 3FRPB 1Q94B 3UJJH 3B9KA 1Q0XH 2BXYA 5C0CE 2GTQA 3ARGA 4CJ0A 3O3EA 5C2UB 5AVWB 1VLXA 2FLBT 1IC7H 4MJIE 1MFDH 5GS0C 4PJ5E 2DEYX 1QPPA 3PHQB 4HS3A 3PS6A 4NQSA 3I6SA 4HJIA 3SN6N 3VI4B 2W9EH 3RVUD 1PG7X 1KJ2H 2DIJA 3I6GA 4P23D 3BVVA 2ALWA 3RL2B 4PJGF 1KT2B 1HSAB 3FO2B 1NC4A 1JNNL 4H4NA 5HHPA 1XF3A 2GG1A 3L3KB 1PCSA 3PQYB 4MX7B 2Z31D 2E27L 4EN3B 1ML0A 4P2QD 5E6SB 5I1CH 4JM2A 3S4SG 1BIIB 2CPUA 4XCYB 1KFAL 3JV4A 3P9WB 5D2LE 4UQCA 1E40A 3RNKA 1R3KB 4LSQH 4DH2A 3L3IA 3MJ8A 5CMAA 3T0WA 3DYPA 1XGTA 3W0WA 5SWSB 1MCKA 2WIIA 3RTQA 2VLME 2BNQB 2YC1A 1F4WL 2ZCHH 4JL2A 4W9CC 3AQZA 5EU4B 1RZ8A 4M4PA 2XBDA 4NYLB 1FJ1A 4O9HL 2WBJB 4UOJA 3S8FB 2W8CA 3DVNA 3E6HB 3MXWH 3VD4A 1A7NH 1NPJA 4JO5A 4KOBA 3QFJA 3U0WL 4RGOL 3S9DB 1WZ1H 3JWNG 3PWVA 3V6ZA 2C1PA 3EHBC 4YDLB 3CSPA 3TV3L 3LRMA 4DEUA 4KHTL 4IBSA 2B0SL 4RMRA 4ZUVA 4GKNA 1TJIL 3IDNA 3NSFA 4F5CE 1MJ8H 2NY2D 2WZPD 2EILB 4N8VG 1H8SA 1DBML 1DDTA 3HNTL 1OP3H 3WTWA 4RMTA 4XOEA 1BQ5A 1RPKA 2W91A 3UTSD 1MUJB 3KBHE 4NZDA 4PRPA 1UGNA 3SDDC 3VXRA 4Z7WB 3MN8A 3W5MA 3PP4H 4FFTA 5ESQB 1MFEL 3LKOB 5MENB 2YD9A 3GXIA 4P2OB 2DWEB 3O8XC 3UGXA 2ZSVB 4C4KO 5E1AB 1S5HB 3RWGB 2I9TB 1MCPH 4YEEA 5ELIA 2GHWB 3EGDB 5CU9A 3MLXL 1E4JA 2V9UA 2QGEA 4S1DD 4P46A 3FPYA 4LMQI 3JUZA 2CRIA 2VXTH 5LDUA 1O6SA 2EDWA 5I76B 1DLFL 1RU9L 1BA9A 3HC0A 4XC1L 3EDKA 4UV4H 4LHUB 2L8AA 2AF2A 2XWBB 3N41B 4M5YL 2J5LC 5ADOH 2BS9A 3D3VE 4IM8A 1AQKL 5HVGB 3K0WA 1EX0A 5EC1B 4A6YL 4NFCA 3GHEH 3FU7A 4H8WL 1IC4L 1U8OB 4YHNB 5L6YL 1INDH 4GBXA 3T77B 4AW4A 1KIPA 1A7RL 4HLZH 3TNNB 3U4EB 5BZDB 5T3ZD 3B5TA 2WSPA 1I9IL 4JFOB 5EU3B 2DEXX 2HPOA 3VD2A 2APXA 4GJTB 4MCNA 1AMYA 3D05A 2NDFA 4NHCH 1VA9A 4CJ1A 3KZ8A 3D25A 4X8XA 2F58H 2BNRA 3HZVA 2GCYB 5D2NA 4Z8FL 4NN7C 3AAZA 3GBEA 3AG1B 2CIIA 4LCWE 2ZZUT 2AJZB 2RQ8A 5T3ZL 1JZ2A 2IANE 3WY3A 2OMTB 2WTRB 1K85A 5EUKB 5I74C 4PRHE 5C0BA 3BKJL 43CAA 4BKSC 2ZYHA 3BWAA 5CCKL 2BVPA 2GFBB 5GIRB 3AXLB 5TE6L 3EH3B 5AWNH 1TCMA 1QSFA 4AW7A 3VXPA 4RWHA 2FATH 2YD4A 4PJFF 1FFRA 3WJJC 3RE0A 3B9KD 4DVBA 3HPJB 1IAIM 5DMIL 1VFUA 3ARGD 1QEWB 2LAAA 4WK0B 3BSGA 1PZ5B 4EJ1C 2A9DA 4PY8I 2X09A 5D1QA 3FB5A 5AVYB 3G6JB 2ZXCA 3WTYA 1KB5H 3QUZB 3MSPA 2M1KA 3WNOA 4Z78B 4NFDA 1ICTA 5GSRB 4YR6B 2D0HA 4QY8A 4ZNCD 1NC4D 3LPGA 1AZZC 3LHPH 4RBPK 8FABB 2G2PA 4GMSH 2Y36H 4JVPA 4LVNB 3J2PA 3GMLA 1AAJA 1PMYA 3SE9L 4FFYA 4V1DA 3UBGA 4MA8H 4JM2D 3GTVA 3GO1H 3V8CA 1NC2B 4W9HC 5H4YA 1FFOA 5L7XL 4R5VA 1NIAA 4JR9L 1W6LA 4R4FL 5DVOA 3NIFE 3PWPB 5HHOA 4G6JH 2IQ9L 2YWZA 1WD9A 1GCYA 2LFEA 3GSWA 3W0WD 3RTQD 3W81A 2Q5BA 2MCAA 2OI9C 4F92B 5HYEA 5C1MB 5IEKB 3IJYB 3ZE0B 1RUQL 3FFDB 5ADPH 4HWZA 3S2AA 3S3BB 1J1PH 1WFTA 3UTPE 3FU3A 3IAPA 4X6EA 4XNDA 3LRHA 3QFJD 1S9YA 2GSGB 1E5ZA 3G08B 4FL4B 1B0IA 4XB8A 1A6ZB 3D2UD 5IW1A 3DIFB 1OLZA 1T7YA 1JPFA 2QTEA 4WFFD 3IJSA 5DJZB 2J73A 5BZWB 5JTWA 1I53A 1CG9B 4JDZB 4H0LC 5B39G 5HJ3A 4ODHH 3QUXC 1IEBA 4PJBF 4N68A 1BJ8A 1YCSA 1U6AL 1JUFA 4PRPD 1YN6B 3TYGL 3BKMH 2AGJH 2YSTA 2EUVA 5TQ0L 1IC0A 1BFSA 4TNFA 4L4VA 4U7KA 3KPNA 1KEGH 1E27A 5IHUH 5L0QC 1PDKA 4WNQB 5GRVK 4PJ8A 1KXQA 5EB9A 1YAIA 4K9EL 3R8QA 5F0MB 3L9RA 4KOCA 4WUKL 4UT9H 1MJJB 2F7IA 4LVOC 5IB4A 1SHMA 2JIXB 1DP0A 1XXFC 2RFXA 4U0RC 5MI0C 4OI8A 1BQRA 4HU8A 5I17B 2X2YA 1AHWA 5FM5O 5I1LA 1J0IA 1CJYA 5E4EB 3P73B 1UD8A 3SE6A 2DQCH 2VIRB 3S37L 4IKJA 1T1YA 5I6MA 4QO1B 3BH9B 4XO3A 5DU7A 3HE7C 4GBXD 4Z0XB 4NRXA 4M8QB 1JVLA 3GBNL 1GY1A 1RZJH 5EIVA 2WB7A 3MBEA 3DUHA 5ACMA 3RY6C 5LJYH 5BZXA 4Y88A 4KTDL 2AXJA 4KC3B 4R26L 5AW4B 4KI1A 3UP1A 3EF4A 5I1GH 4NN6C 2PXYB 1IGTB 2MNWA 3N2JA 4Z7QB 1GL4B 1ZPLA 3L3OC 3QIWB 2WQXA 4M6ML 4MNHB 4NFBA 5DD0H 5IVZA 2DWTA 1RVFL 3T3PB 2WZAA 1SVCP 1Z5LA 3BPNB 3L9YA 3VFPB 4BH8A 4NNPL 1QSFD 4IOFD 5E99H 2YK1H 2XVLA 2EJ1A 2YGNA 4W9DC 1MEXH 1XCTB 5CEXB 1XGPB 3L45A 2QELA 3KPLB 1ZPUA 4HKZA 3A4EA 3PRZA 4DOHE 5KANI 1UWXK 3WAKA 1URZA 2WUBL 1A02N 4PLOB 4B9KC 5INCB 1Z9NA 1CT8A 1JS4A 5HGHB 1WICA 1AZVA 4KJPC 5I0WA 3WDIA 2P46B 1FO0A 4WFGD 1PX3A 2CJSA 5FA3B 5D1QD 1JYNA 2J12B 2PN5A 4WI4A 2CCWA 5C86A 1KTCA 4PJEA 1WLHA 1W91A 3V4VA 1LO2L 2RCSL 3PWLA 4XX5A 3VXUB 2JQMA 3L1GA 1VZGA 3WE1A 2NY6C 3WTUA 1WC7B 1P2CA 4POZC 4HV8A 1BQHA 3RWHA 4FXTA 2DY2A 2JB6B 4OJFL 4AQAB 5KYWA 3DUSA 4V1DD 4FQXC 5DJYB 3DPDA 2VDOH 3QEHA 4D0CB 2P44B 1B6UA 3LEXB 5C70A 3Q0HA 2YFNA 1KYAA 1NCBH 1SEBA 1QYGH 5HHOD 1FVDB 1TQBB 1G7LA 3CDGA 4JFYA 3KBEA 1WTGT 2FWUA 4FFYL 3FQ4A 4MJ5A 2HTLC 2ZCKL 5SX4H 3H0TB 1KWKA 1JK8A 3O4LA 1CO1A 1RH8A 3BCFA 4MJJA 1JMXA 5EEXA 5D5MF 5IQ7L 2WXFA 3BW9A 3E9TA 4UB0L 3FB8A 3QIUA 1TITA 4W9KC 5E2WH 2DTMH 4LVHC 4WTXA 2V7HB 3RX8A 4OF3A 4YE4L 1ZS2A 3QBTB 5FWRA 4N2MA 2WC7A 2OYMA 1NIEA 2V5RA 3B8YA 2B15A 1DQML 4IRJC 2ENYA 3QDMB 1YN7A 1A7QL 1HL9A 1NFDF 4K3DH 1PFCA 4NZRH 5LCVA 4DPBX 4OD1L 4J8QA 4Y2LA 2AAVA 5FO2A 4YSOA 2DLGA 4L0PB 4G3YL 3A5VA 5IQLA 3KPMA 1PZAA 3MQIA 4GXFA 5HD8D 3VI3E 5FIEA 2MPAL 4M43L 3RWCA 5FKPB 2VDPL 3Q05A 4U1HA 1HYSD 1O0VA 4OVUA 4YDJA 1AGCB 1HILA 1NIBA 3MOAH 4Y8AA 1IO4C 4BFBD 1E65A 2Z34A 4PJ8D 5HYQB 3SD2A 4LCYB 4YQXH 5HDRA 1OB1A 4FZ8L 3NEEA 3B2PA 3DA0A 1UD5A 2H1XA 4ABQA 4Z7OF 5I73C 3BGAA 3R06B 4AQOA 1I85C 3NSDA 1UT9A 1IM3A 4QXGH 1TQVA 3NCCB 1TEFA 2XTJD 4LESA 4XBMA 3H4HA 2X6AA 3QW9A 3QZNA 4JCLA 1D2OA 3DYMA 4YC2C 4CN4A 5JDSB 5EN3A 2W65B 4LGSB 1M9SA 1UKQA 3UXFA 1MVUB 1LP9E 1MLCA 3U30C 2AEQH 1J1OL 4L4TE 4C56A 4NKMA 2VDMB 2HFFB 2VL5A 4AYEC 2BS71 3HS0A 5T1KA 1E8XA 3CFEA 4XCNA 2A77L 1EJOL 3DHPA 3MBED 2C34A 2HRGA 4YHOH 2I07A 1YPZE 2LLLA 1IKOP 5EOTB 3L4ZA 2HT2D 2XN9B 1JZJA 1S7VB 3KL0A 4XN8A 5FUZL 1NDTA 3ARSA 1HNYA 3VFUA 3GZQA 1UYWL 3NIGB 5EU6B 4J3OD 1F3JB 5E5LA 2QZQA 1QUNB 4WEBH 2EE9A 5IHBA 1V7NH 3RWIB 2FBRA 1OHZA 1PF3A 5KUKA 5KVDE 2VN7A 2ITDA 1ZGLM 1GKEA 3GUTA 1A2YB 5L9DH 2EACA 2ESVE 1CUOA 1QZNA 5HGAB 3FAXA 4C4KT 2CG9X 4IMKC 2EKSB 2XSKA 3ULAB 4AK1A 4GP4B 5ICZA 1YECL 1CDGA 2RMNA 1AP2A 2V3EA 5DRZB 4JFSA 2OV0A 3HHRB 5JIMA 2WQSA 4MMXC 3D18B 4DTGL 4M7JH 1OTUC 5JOFB 1OWRM 1F58L 5DFWH 2R7EB 4L9LA 3SE4C 5DRXB 4DW2H 1KV3A 1IZKA 4J1UA 4LOUD 3LPOA 3FFOA 3EW3B 1RSFA 2YR3A 3SDCC 2VR8A 4KY2A 3RVTD 4ZZFA 2G5BB 2JTYA 3QUYC 4MJ2A 3OAZK 5EC2B 5EIQA 1FO0L 2NCEA 1V7ML 5E9DB 2Z8VC 3UABA 3WXWH 5D72L 1I8KA 3GXTA 1MNUL 4Y1AB 4IMLB 2VJXA 3QDHA 3CN3A 3V4VL 1DTUA 1MF2L 1WZMA 5KVEH 3GSVA 3AU1B 3OVUB 3IB4A 5BV7C 5DC0A 1ZHNB 1JFQL 4XRCA 4FNSA 4PGEB 3R7QA 3TH4T 5IF0A 5FGSA 2XNAB 2WQRA 4ZX3A 1UZ8A 2BWDA 2EE6A 2GK0A 5GSVB 1GRWA 4JKMA 1AY1L 3O4LD 3W56A 1OK8A 1MCHA 3C5JB 3KJ4C 1AQDB 5E2TL 1RK0B 1FIGL 2Y6SD 4PS7A 5FV1L 3QQ9C 1ZLSL 3P11L 2WNKA 3QIUD 5K33A 3BUYB 4AEHL 4AVKA 1IGJA 3U36A 5HHME 5EZIL 3GK8H 1KTBA 2GJ6E 4ORGA 1EFXB 5KVFH 2YQBA 1JNLH 5EOQH 4RFNC 3ZMNA 2J6EH 3TPUB 2RH0A 1FNAA 3TH3T 3B5GA 5IB1A 3REWA 5IVXF 2DMCA 3FUHA 4ONHA 3BXNA 1YEFH 3C5ZC 1GTFA 2EDMA 3HC2A 1LWHA 4ALAH 4OT1L 4PMEA 2X4QA 3OKMA 2XV6B 4YXHH 5IESH 3WV0A 1XH1A 1RZKL 4KI5F 3DTDA 5ID1B 1J9SA 5ALBH 5I1EH 1YUHA 5LCVL 4L29A 4QJ3B 2Y24A 1I1AB 3FUFA 4X8CA 1MZYA 5GGRA 1I9JH 4PJIF 3NPSB 2X41A 4O02A 3MLRH 3MV8E 3RVXC 2EABA 1KJ3L 4MBRA 4OF5A 1X9QA 5T5FA 3WUWA 1IM3D 1JOIA 3PAVA 4GW1B 3W2DL 5K9QI 1IM9B 1KGUA 5C0GB 1CLZL 1XDTT 1DJGA 3U0PA 1MCLA 1U8HA 4EPSA 2Y2YA 3P3YA 3GZPA 4EF3A 1L0XA 4HEMA 4L1HA 3DJRA 1M2VA 5GZOA 3ROOA 4OF8A 2VLLA 4H26B 2E9IA 2GC4C 5KSUB 2YQ3A 3PAYA 4LVEA 4QGYA 3AWFA 3DSNB 3WEBA 4EIGB 5T1KD 4JO2L 4IBLT 3JV6B 4EQ3A 5IEHA 4GW5B 4EE2A 2VISB 1U8CB 3GT6A 3F64A 2YSSA 2Z4QA 3FSVA 3GS7A 3ILPB 1L7IH 2XQYK 4KXBA 3Q6FB 2IGTA 1IKFH 4HIHA 4PI2A 2DBLL 1GMIA 3CFJA 1T1XA 1P7KA 3MRKA 4KROB 4YK4B 4PJHB 4XMPH 2H32B 3KCPB 2NPLX 3GFUA 5JMOC 4KV5E 4FEMA 2IEPA 4AT6A 4XOAA 1JRHL 1JF6A 4E42B 4KJQD 3MRIA 1RV6X 2AJUH 2EE0A 3ESOA 4QIRA 5EFIA 3HAEH 4HPHA 3PV7A 5F96H 5IHWA 2Y2TA 1CDJA 1FE8H 3LXAA 1UB6A 3P0VL 1CE6A 3TU6A 5B3NA 1E9QA 5TTRA 3UAJD 5DQDL 2OTWB 4KK8D 4Z3TA 5CZRA 4X9YA 4KMTL 3WEXB 1IAOA 4GW4B 1G6VK 4XPFL 1SVBA 2XN0A 3BVNA 3MXVL 3QQ3B 1MHHA 3II1A 4PLKC 1T83A 5E5RB 4NO2A 4M1GH 4I0PC 3SGKA 2VXVH 2BK8A 3ASNB 3SDXA 2CBPA 4M62L 2AJSH 4JRYE 5EU5A 2FYYB 5D7JB 2BO0A 1G1CA 5TK4A 3QQDA 3HCVB 2XV0A 1Z9PA 4PRIB 4HCRH 5C0CA 1JHKL 1OD7A 1A4KB 5DWUL 2PYEE 2K6YA 3MJ9H 2VLKB 5FKAA 4K8RH 4MJIA 4B41A 2W1NA 2FX8L 4PJ5A 1E8YA 1ZXKA 3HLKA 2EXYC 1LDPL 1FZOA 1L4IA 2E5EA 2QV4A 4N0YH 2YRPA 1GGBH 1KJ2A 2WLMA 4OLVL 3TZVC 2Q20A 1HDMA 3QT2A 4NP4L 3O3AA 2DQHL 4IOIA 4EDWH 3CFDB 2GC7C 1CVSC 1UB5A 3MJ7A 4X6FA 4QHKI 3HUJE 5IJBC 3MFFB 2RTTA 2IBGA 4OJEH 4O4YL 5FYKH 2OX5B 1Z3RA 3ES6A 1XBDA 2XVGA 4XVTL 3LKRA 1LM8V 6FABL 4X80L 1OAZL 3L3JB 1E4KC 2X4RB 3HZYA 5LAXB 4HT1L 4XPTL 3ZTJG 2HFTA 4ONFL 4KJYB 3C6LB 5DJ6B 4F2ME 1MFNA 4HBCH 1E5CA 4TVPH 3HBZA 2PO6D 4HLJA 3NH7L 5LWYL 1GZHA 5FCUL 4HCIA 5BVPH 4JPIA 5EO9B 2WCPA 4MA7H 2ZUXA 1HN1A 4FHKA 5DMKA 5I82A 5LXGH 2Q2LA 1MXGA 2NY3C 1J5IA 3EYOA 1YMME 4GPVA 5I0YA 1USQA 1W15A 2R2HA 3EF7A 2N1TE 3BQUA 4KRPB 1KMGA 5BOZG 1CDHA 3ECBA 1H19A 5IVOA 1FA4A 4Z3HA 1A47A 4PG2A 1G5AA 3RZCC 1R46A 5AB9A 1XSKA 3BP5A 1CI3M 4F5CA 2FCBA 5EZLB 4KMLB 4ZFGL 3UBXI 1BGXH 4U6HB 2X4NB 3UBXA 3OJMB 4O02L 4BSVB 2RB8A 1GYAA 2DJUA 5GZOD 2G3NA 2DQGH 3OHXA 1R5VB 4HX1A 4OJYA 5ESVB 5T5FL 2G9KA 4CVZA 1WT5A 4UNVA 3UMTA 4S0TD 4A55A 1KCUL 2WWNA 4M5SA 1HH9B 1QI5A 1DANT 4NBXB 2J20A 3U0TB 5FF6B 1WAEA 4G8EA 3IMRA 3LCYA 1EIBA 1NEUA 3N85L 2CK2A 2RHEA 4R7LA 5LHDA 5J11B 3IAGC 5FHAH 2WP3O 3IDMA 2DQDH 1ZANH 3O11B 4BQ6A 3LEVL 1MFBL 4Z3JA 4X6BA 1ADQH 3C5SB 4AV4A 4F7PA 2ZF8A 2VITA 3RUGF 3B6SB 2HUEA 2CIKA 2XWXA 4NNXB 4HIPA 1DLHB 3MUJA 2M26A 1VKXA 1N5AA 2X53A 3VMNA 3L5XH 5I16B 4DN4L 5E2UL 3MRJA 3F00A 3GMNA 3JYBA 3MRQA 1KLGB 1AO7D 2DJ4A 3VRJB 1TJHH 1B6DA 4PHZA 3ETBF 3S4SB 3ROLB 4TLKA 3S88L 2APVA 4G8IA 3BN3B 2IDFA 3OKOA 5AZ2H 3QI9C 4JZJA 4LCWA 4BWTA 3QHFL 5JHLH 2IANA 2B2XH 5H35A 5D7HA 3FO1B 4Z7NB 4HHAB 4PRHA 4CC1A 1TKWB 1JCKA 2D7QA 4MNQB 1G7PB 5EO1B 2CO4A 2WYTA 4J3TA 3QYCA 5FW7A 4F37K 3NK3A 4Z7UF 5C3TA 3WJLC 3H4FA 43C9B 1SHSA 1U8MA 3GI9L 3PPSA 4MS6A 1A6PA 2X3CA 4Z0BH 3WELA 3VYPA 1Z32X 5C07B 5C0CD 1PBYA 3O2WH 5E1QA 3DGCR 3SY6A 2JTDA 1OF0A 3FH8A 3IJ9A 3PJLA 2YEZA 4MJID 4PJ5D 3N0AA 5LLIC 1S7UB 4E9VA 3ULUF 3T0EC 3P0YH 2X9YA 3BD4A 1HZKA 1MG3C 5H8DA 2E7LC 4WUUA 4EIUA 2BMKB 3MODL 1IC7L 1MFDL 1O7VA 4CMHB 3UBHA 5DJAA 2IALA 2W9EL 3US1A 4YHPA 1C08B 1XMWA 2Y1VA 3MRDB 1KJ2L 1SGKA 5CZXD 2MH4A 3M88A 1R0AH 4IBQA 1U91B 3CZKA 5MP6H 1JF1A 4L1DA 2TAAA 2PWHA 2DAVA 4LGRB 4BUGA 4WWKB 1NCAH 1BOYA 4MMZA 4KNSA 2VLMD 4PRNB 1BXVA 2IOOA 4XP1H 5DXWA 1BXXA 4EKXA 5L88H 1B0WA 5B7FA 3GSQB 2IAMB 1CFNB 2ED9A 3CMOL 4IYKA 2VL4A 3K1DA 4XMKH 1AXSA 4LSQL 1FL5A 4R7NA 1RD6A 3F7KA 3F84A 4FMVA 5DYOB 2NDGA 4N8VA 3IMWA 1I75A 2ADJB 5GRJL 3D9AH 1EEYB 4OI9A 3LN4B 1S7WA 4XBGA 1S8DB 4LP5A 2B08A 3ZGIA 1KCRH 4M7KL 4OIAA 5K69A 1FBIH 4HUXA 2MTAA 1WZ1L 2HT3C 4KH2A 4Y89A 3SQBA 1UACH 1YO4A 1N6UA 3EYVB 2TRHA 2IV8A 5D1ZA 2NY1C 1C5DA 1OAXH 1P7QB 4Z7VF 2WQUA 1MJ8L 2Z92A 1WEJH 1F90H 5DJCA 2OZ4H 1RKRA 4E5XG 1AKJB 2VQ1A 3QISA 2AZUA 1ZS8A 3BUIA 4WWID 5DD3H 5EORH 3VW3L 1AZCA 2XPGA 4PBWD 2OMVB 4ODWB 2IXQB 3VGAB 4FHBD 2X0VA 1OZUA 4UT9A 4W4OC 3MNZA 4F15B 5KJ7E 5AVZB 2JKRM 1MCPL 3D3VD 4ZODA 1N68A 3Q9QA 1H0DB 1O9WA 4K5MA 4JHWH 4DK3A 1RUKH 2GSIB 2VXTL 2HKFH 3U82B 3CSFA 5IOPA 3OAYH 4H5SB 3RB5A 4Q9CA 4LIQE 1F8TH 4UV4L 5JIHA 1BAFL 3PGCA 1SMAA 4WO0A 5DZPA 2WBWB 1G7MA 5AYQA 4BHUI 1FN4A 1ZVSB 1HHGA 4WW2F 1A1OB 1ET5A 2D4DA 1NPNA 1A6AA 1TTRA 2OR9H 4MXVF 2WVTA 4BEIA 3BZFA 3N44B 1Z5HA 4LCWD 4P3DA 1INDL 4TSBH 2IAND 2A2QT 1KGXA 4N2GA 4PJCB 5KBPA 4PRHD 3GSXA 4GKZA 1DN0A 1NGYA 4JM0A 2X42A 2WXJA 4NHCL 1NGZA 2A6IA 3WN5B 4PJDE 3U7YL 4XZUA 4Z5RB 2EDLA 3V6BR 5DDHB 2B16A 2P24A 3UGEA 2YRBA 1J0YA 1GOFA 5BXFA 3GKZA 1BEXA 5E6IB 2XA8H 1DO5A 1ZK9A 2H3NB 4A7VA 3WFDH 3MRGA 5JZ7C 3DO7A 1VB9A 1MWOA 2IGLA 5D9SA 3C2SA 3VGFA 3L7EB 4U3CA 5D7EA 5EA0H 3VYOA 2VDNL 5HJGA 3GRWH 5KSBE 2FATL 1DQKA 4Y4KC 4AUUA 1VRSA 3ZK0A 1C5CH 1A1NA 1BYPA 1HI6A 5B3SB 5DVLA 2ZKHH 1D6VL 1P5UA 4M8UA 4AC2A 4ZX5A 4GRLA 3V2AR 3EGXA 4J8RB 5IGXL 3FRUB 1SJXA 4BZYA 4JG9A 3KPPA 5IJKA 1U8LA 2EUXA 3OB0K 4QEGA 1A6WH 1IT9H 4QHLA 2F7RA 1WFNA 4QTFA 2B1AH 5C09E 4OZIE 2KERA 4GMSL 2ADFH 2C4XA 2Y36L 3FZUD 4ZW5A 2JKNA 5AB1A 2CA3A 3ENEA 3HRZA 5SX4I 4MA8L 3ZE2F 3GO1L 3FT2A 4PJAB 1QO3A 1OE2A 1IFHL 3ETBJ 1Y1UA 4D0DB 4F9LA 4OGXH 4CMMA 3WO4C 3E1ZA 1NOFA 2BOCB 2DM2A 2K8QA 3E2HC 5AAMA 1T5XA 3HZKB 3UTPD 2VDMH 3PLYA 1CL7H 3AROA 5IROA 1MOEA 5ERWA 2CR3A 4MNGE 3ZO9A 5A2FA 4NQVA 3GJFH 4BXVA 1BWWA 2VSDA 2OXGB 1G1YA 1KELL 1TTGA 2F53B 3IYLW 5CLWA 4X7SH 4BZ1H 5AL0A 4P57B 4WHYH 5E23A 2QADB 1J1PL 4U4BA 3AUVA 2WXOA 2G5RA 5L2JA 1NA8A 3MA9H 5AZEH 4M5ZL 3VI3A 3CN0A 2NY2C 5ENWB 4YNYB 4KDVA 2HN7B 5F9OL 4AV0A 2P47B 2OJ1A 1RJZB 4ZMWA 5D1ZD 4L37B 4P8QA 1FFQA 3BO8A 4JRXA 3UTZA 4PLNC 4NRZA 5JW5A 3EH2A 5DC4B 4MAUH 3HHSA 4PCTA 2HJLB 2Y5EA 3OLGA 4ODHL 4OLWH 4XNUL 1JWMB 2LHAA 3MBXL 3RIAK 3BKML 3UZEA 2A9NH 4IGBC 3P77B 2X4TB 3IGAA 3KR3L 9PCYA 4MDIA 4WGKA 1OY3B 4C54A 1ZGLB 1E9PA 1QHPA 4M7LH 1KEGL 2WUCH 1FAIH 5LGHH 5FEBA 1QSEB 1YYMH 1LEKA 3TT1H 3WNIA 1FZKA 1MH5A 2EC9U 1GC1H 4B6ZA 4HMCA 5CLTA 2IOIA 3WNKA 4JBSA 2ZWYA 1KGCE 4UT9L 2BIOA 2J8UE 4HSQA 4L3EA 1T20B 4A2MA 4P2YA 4XCEA 1LEGB 2Y07H 4FTDA 4PU2A 1Z5YD 5F3HA 5I1AA 3I9PA 1WHOA 4OUUB 4B3VA 2H2SD 2V37A 4S1SH 3WIFA 1PKOA 1MRCH 2FBJH 3ALXA 4P4RB 5FUCC 1WZKA 1YPZA 1A6TB 4RX4A 2PCPA 1EAPA 5GGVL 3SE3C 3BZEA 1OAUH 3F5WB 2EYRA 2ISDA 5B3JF 2BOLA 5DEGA 3X1EA 1DJZA 1P7QD 3BUDA 4HIIA 1UJ3B 5BCAA 3UAAA 2NYYD 2XY1A 5ETUA 1RZJL 3WDJA 4ZUTB 2PPAA 4Q2ZA 4ZDHA 2XA3A 1BSIA 1E9OA 1WUZA 3MA7A 1UXWB 4QJ4B 1Q38A 3RWJA 2ESVA 4XNQB 1LE5A 4PTUA 4FI7A 4M48H 5DUBA 4G43A 3EO1B 4Q6IA 4R90H 3TIEB 2Y3NA 4HZ1A 2WP3T 5AW0B 4AEEA 3CXDH 1NSNL 2O61A 5E8DH 4MZ2A 5DD0L 1WCBA 3OX8B 4FYQA 2L3BA 4ALAC 5HHMB 2A99A 3WMPA 2VABB 2GJ6B 5HSFA 4YBHA 1NFAA 2J8HA 4HHWA 5E99L 5JORA 1QEXA 1ZJBA 3OGOE 2BM3A 2YK1L 3E6FB 4B9IA 1MEXL 4FQJH 4PS8A 5IW3A 3FMGL 3DWTA 5H2BA 1VDGA 3KMDA 1CPUA 1P4UA 3IKCA 1WFMA 4GRLD 1LQSR 2WO4A 1AQHA 1MW3A 4KAQH 4J3XA 4MJHA 4I18A 5CJOL 1PW3A 2CLVA 5F1NB 1HHIB 2Z8SA 4D9LH 1OPGH 4E41E 1H6FA 3AREB 4KHXH 5KS9A 4OZGF 5AKRA 1I1YB 3FW6A 2COVD 4B50A 4OCNC 4KU1A 4OM1H 3ZDXB 4ADIA 5LDSA 4F3FA 3V5DB 2BZCA 5B1JC 2C7UB 2VDOL 1B3IA 1JD7A 4RAUA 5J5EA 1S7RA 4DAGH 1J86A 1JSYA 1FZJB 1LVEA 1NCBL 3KLAB 3R0MA 2DEWX 4MWFA 3SJVB 5BS0A 5IROD 1A7BA 4Q56A 1H3TA 1CXIA 1MCIA 2CALA 3OBAA 1NBCA 4CNIB 2N59A 1ZTXH 4NUQA 1J5OH 3QE5A 3SYPA 3H1ZA 3K71A 4G6FB 4R2GB 4TUOA 4IDJH 2O93L 2E4FA 4P5MA 2FLMA 4XNMA 3QGVA 5E2WL 4NKOA 2H32H 1MCWW 4TQIA 3HBPA 2QKSA 1D5ZB 4ETQA 2I5YL 4N2HA 4FX5A 4QGTA 2F7OA 1AXTH 2ILLA 2QSVA 4FKKA 3PNWB 4Z1PA 1FYTB 3MNVA 1MIEL 1S6NA 4ANXA 4WKZA 4EN3C 2CO3A 1J88A 5KJRH 3VO0A 2H0JA 4XH2A 5AVUB 3B8SA 3SDAB 2MQGA 1AJ7H 4GSXA 4BQ8A 1TMQA 3G5WA 1U4EA 1TQUA 1TXKA 2HJFA 3L4WA 1N8ZA 4JG1L 4PJFE 4LFHG 5HPMB 5ICXA 4F91B 3PUCA 2K4AA 5T1MB 3IWVA 1F97A 3IFLH 5J6HA 1RIUH 4X7CC 4YQXL 2WBJC 3CVCA 2Y72A 3RDTA 3FQUA 1SLVA 2G0KA 2XZCL 3GMPA 4LKXA 3LKNB 1ND0B 4PJ9A 4L3ED 3ARXA 1AOHA 3FQXB 5CIPB 1UD2A 1KJMB 2ZSWA 5K9KB 4L4TD 5CEYA 2DWSA 5KYNA 4LCIH 5IJDC 1OP4A 5GRWA 3ZDZE 3EKCA 1HE8A 3OKDA 4RX4D 5JHAA 4LSUH 3FYEB 4N0UE 4U33A 2UWEF 1SMDA 3CXHK 1BOGA 3VXNB 1E28B 4J23A 2AEQL 1F6AB 1SJMA 1ZLVH 3CTTA 1AE6H 5CGYC 3FFCB 4P2OC 5I8EA 3BEVA 5K1JA 4YHOL 4HD5A 2XXFA 2XG4B 1ASQA 4A04A 4QJ5B 1T22B 1SJVA 5JLZB 1OD9A 2ESVD 1HC1A 4NC2B 5FR3A 4RRPG 5DJXA 4G82A 4JREC 2F5BH 5KVDL 3CHRA 4OSUH 1BX2A 3HAEA 3JWOH 4U1JA 2O6EA 1LO0H 1BXUA 4PVBA 3KGRA 3WD5H 3LQZB 4NZJA 1YMHB 3HN8A 4AYMC 3ATAA 3CSYB 4EDXA 4ZXBB 5EOCH 3BZ4B 4UAHA 1SJEB 5A40E 1QW8A 2FSEA 2BNQA 4FNQA 1CURA 3TO4A 4I8DA 1A7PL 2BX5A 3NCFB 4OCWL 5EU4A 1CTNA 1LO4H 3CFMA 3OAWA 1QWUA 1TZHB 4HUMB 4M7JL 3GB7B 5DD5H 5J3HD 1NKGA 3UCRA 3DX9A 1CTMA 3F58L 1NFIB 5CZKA 3FTWA 1HH6A 2A9AA 2WNWA 2R4SL 1MJ7H 3VTAA 4TQPA 1TQCC 4AE1A 1EXHA 5I5MA 1Y6MR 3PUUA 4PMFA 3WN6A 1I7ZA 5BRPA 3UYRL 3UTTB 4AL8C 2PYEA 4HQQH 4KK5C 1E5BA 2J21A 2YAPA 3WXWL 3VD0A 5GRUH 4UIMB 4Y19E 1U30A 3MJ9A 1J9TA 3BVXA 2B5IB 1S5IH 3FOMB 5DRWA 1NUNB 3FBQA 4N6RB 3OXRB 1L9QA 4QAMB 2YPKA 2NTFB 2B3RA 1X6LA 4X4ZA 3VWJB 2PPFA 3IJ8A 1UZ6E 5A2JH 1DEEB 3JQOB 1NBYB 4GAGH 2ZOLA 4PP1D 4ZUSB 2DYSB 1GPOH 2NUPB 3OD3A 2EZ0D 2GJ6D 4HF5H 1NAMB 4P5TA 4PD4J 3RWGA 5IJVA 4HKBB 3H9ZA 1U92B 1F2XK 3HUJA 4JO3H 4UU9A 3DRTB 2GI0A 3RWEA 1BPVA 4NN5B 2X6UA 4WGWB 4B5EA 4JM2F 4NP9A 1DQTA 2V9RA 1N64L 3EOYG 3VFTB 3HVNA 3QUZC 4P4KB 3E80A 2CPCA 5KVFL 1JNLL 4KKRA 3BFOA 3BT2H 4F2MA 2D3LA 2WN3A 3IN0A 1BZQK 1UXMA 5HD8C 2Z35B 3IMTA 4ZOEA 4LVNC 4Y4FA 1EBAA 1SOKA 3ARED 2VJ8A 1YEFL 4PB9H 1CXLA 1GGCH 4QRTA 2OZNA 2R1WB 5J6GA 1NFKA 1YMMA 5FFOA 1MHEB 1OM3L 3MV8D 4OZFB 5FYJU 3DRQA 1I9RH 4PVLA 3KYOB 2NZ9C 5ALBL 1OCZB 4PWFA 3EYUH 4HWEH 2GQHA 5CN3A 4PGZA 2O6DA 2AJZA 3AXHA 2E8ZA 3MMEA 2IAAC 4U1KA 4NNYB 4LEXL 4ELMA 3RDTD 2CLZB 5J9PA 2EUWA 3CLEL 3MLRL 2VZSA 1B4LA 2X7LB 3EFFA 3IU4L 2QT6A 4PJ7B 1KBBA 3NFPB 4DKEH 3AXLA 5DMGD 1KCBA 5K1VA 2H6UA 1RY7B 3M7FB 4MD0B 4OFQA 5HHXH 4MJ6A 2YQGA 3JWNH 3FT4A 5IB2A 2BVTA 2P28B 3BDYL 1X5MA 3L48A 3FU0A 3MGOB 1L9SA 3OKYA 5G4MA 4XE5B 2D7TH 3ARDA 4FS0A 3BP7B 5DA4A 1ZHKB 2QPSA 2CR6A 1P1VA 5AW2B 3BHBA 1MREH 4RRPM 4IEFB 3MRNA 1MCOH 1L3NA 2DLEA 4FLOA 5F0LB 2JJTC 1ZOXA 4AIOA 3LRGA 3CG8A 3KBPA 1BREA 3STZA 5FB8B 2OK0H 4GRWE 1DCEA 2MOVA 2D8KA 4YDVA 1I82A 4Z78A 3L5JA 3SKUD 3ZKQD 2VUOA 5BRZE 5KEZA 2R4RH 4L18A 3F7VA 5IWLC 1W80A 4D3CH 3L4TA 3APFA 2BVYA 4ZPVA 3DOSB 5EIIA 2RBLA 1AC6A 3JV5A 4JJ5B 1IB5A 4L8CB 3TBWA 2Q86B 3APMA 3WKML 4QXUH 3VH8G 4XR8C 1B2WL 1FC2D 5KG9A 1J10A 3NVQA 2FUTA 1NFDE 1QTSA 1MFAH 5F96L 1FE8L 3B9DA 3MUGB 1PLBA 3TO4D 2H41A 4LOUC 4RBPH 2Z91B 2R15A 4AJYV 4F7PB 5SWZE 4ODXA 1S9VA 3WMQA 2QFRA 5I18L 3A22A 1XGYL 4JRYD 1WP6A 4HW6A 4HIJA 1AGBA 4K55A 2Z7WA 4O5LL 5FYJE 5DHVB 3O81A 3AM8C 4R83A 1COBA 1YEJH 1ETZA 2PUQT 2PYED 4Y2DA 4H0HB 5IHLB 4Z7OE 3KH4A 3QIWC 3PCYA 2VXVL 2X6BA 5HHQB 4P99A 3VXTB 3NCEB 2AJSL 4DP7X 5D1XE 5GGTH 2YXWA 1YN6A 4CSZA 3BPNC 1CZ8H 1GS7A 5I30H 3MROB 2FHBA 4HCRL 3DECA 2WZ0A 1T4KA 3DURB 3QCVH 3MJ9L 2AXGA 3VG9B 4K8RL 5C0IA 3N91A 1HXMB 5MERB 4P5TD 4NLAA 2MHAB 3L3GB 1QWNA 1ROCA 1IQWL 3FN0H 1H8NA 2Q76A 3G9VA 4K5LA 2BSSA 4K7FB 3ZQ9A 3QS2A 4UDTA 5FO8B 4NUMA 5IFAH 4QXVA 2JIXA 5IFJA 1FL6B 3QIBA 4HHGA 1EO8L 1CYGA 1OIOA 3S37X 2YA2A 5F7UA 3FB7B 1BG1A 1I7TB 3ZDYB 1KXTB 5DJ8A 4EDWL 5D6CA 4Q74A 3GSRA 3ZRSA 3Q6GH 1MIMH 3FL7A 3ARPA 3NCWA 5I6PA 1Z0NA 5T3XE 4CC0A 4WU7B 1ILSA 1CCZA 3X13A 1JPGB 2OCJA 1BJ1J 4UT7H 4Y4FD 5FYKL 5B22A 3O41B 5IT2L 4F7EB 4OI7A 4KY1H 3BLBA 3VFOB 2EVIA 4KNTA 2IFGA 3Q2VA 3T8XB 1MZZA 4DKTA 2FQDA 1YMMD 1PJWA 3MLYH 5DEFA 1T04B 1ZSDA 2FNWA 1TQBC 4HBCL 2VLJB 5EBLB 3DV6A 3GXFA 1JWUA 2J1XA 1QBLL 2ZTBA 4PI0A 1U42A 2HCZX 4MA7L 1JTPA 4YSPA 2BY3A 2PXYA 1PSKH 2HFEA 4GXVH 5EPMB 1CGXA 1MY5A 1TNNA 1SLWA 3CQFA 3QJXA 4U2ZA 1I3GH 3OWEA 4ZAKA 3C60A 2O30A 3BSZH 3EO0A 4UANA 3OZKA 1BGXL 2AJ3A 1ZT7A 4Y9GA 4YL4A 2IWEA 3EBIA 1R6VA 3UZVB 5F7DB 2DQGL 3ARDD 2DZEA 2OZ4A 3TBTB 5FW6A 4ONGL 1NGXB 4G8GB 2BIQA 2B77A 2ZXDA 2C26A 4GEIA 3NAAH 3BYTA 4PBXA 3RIFF 1FLRH 4NO0A 3MRCB 1UUSA 2I9LB 3R18A 2YGVA 5LB1A 2JJUA 3RX9A 2H9GA 4AVJA 5H37H 1ZT4B 3EADA 4YDKH 4YAQB 2APBA 4X8GA 3H54A 3ULSA 1TO4A 2DQDL 4FD0A 1ZANL 1QLRB 2K0RA 1EDYA 3FYIB 3GLEA 5CP7A 1G1KA 4HGWA 4AKQA 3MUHL 4ZMZA 4GT0A 1KIUB 3T8VA 3ZKMD 4AQAA 4XBEH 4IKKA 4PWKA 4YHZL 5KSBB 1A65A 1UWXH 3KL3A 1EAQA 5IV2B 3KW8A 2PCFA 1Y0LB 5CFHA 1GGIL 2H0FA 3B2VH 3PU7A 4QRPE 2HH0H 4H1LG 5E7FA 4D0CA 5AD0A 3H7BB 3ZT6A 1FNEA 4XN1A 2BVQA 1ZLEA 4KBPA 2L04A 4ZW7A 1R3IL 3UAJC 3CLWA 4NXKA 4PYHA 5IVXE 4L3CA 4QNPF 3WLBA 4L8SB 3NMEA 2BFVH 3I74A 2Q7YA 2YA1A 3DETD 3N50A 4J3OF 4OKVB 4PJDA 4OZHB 2XFXB 3MRMB 4HH9A 1C16B 1I1RA 3QXWA 4Z95H 1TETL 3RX5A 1VEOA 4H0GA 3G5VB 3D87B 2XN2A 3BUPA 4NQDE 1HQRB 1I7UB 5AB0A 1VIWA 4Y2DD 4G6AC 2FO4A 3C75A 1U8PA 5F1KC 1JP5A 3QEUB 4WJ5B 4MNGB 5EO0B 3V0HA 1A4CA 4U1SB 3ZZSA 3QCTH 4HA1A 2VZ1A 3QXDA 4JFEE 4DGYH 4HFUL 2DMHA 3EZJB 1G7JB 3GRWA 3NG5A 5GGUA 2P5WE 4FMKA 2JCCE 4AK2A 3O2WL 4U6XA 1CFTA 2J8OA 4QHUB 1R1CA 1BDYA 3T2OA 2X1XR 5A2IH 4Q9QH 4PJEF 1I1FA 1WO2A 5HYQA 3OLDA 1EZUA 3I9GH 4HUWB 2BHUA 4E5XB 1RUAL 3UO1H 1J1XL 2FWOA 3B9EA 1NGPH 1S78C 2BSTA 4CBZA 2VMCA 3QJTB 3FONA 3PGFH 3QIBD 1LTXA 2IFFH 4NJAL 5BW7C 2ZJSL 3O6MH 4JFZL 5C09A 3ILQC 3V6OC 4OZIA 3FUKA 1GC1C 3MRHA 4DKFH 2KI6A 4I5BB 5ITBL 3GSOB 1ZSHA 4X8JB 4OQ1A 4WTQA 1E6OH 1R0AL 3CFBA 1D7CA 2XG5B 3W9EB 4WRLA 2JCWA 1ZD6A 5MP6L 3AS2A 2PO6C 4G80A 4TL4A 3Q1SH 1CL7I 1NCAL 4ZPTB 1W0YT 3U46A 1M05A 2IADA 3K6DA 1DQIA 4GKOA 1EJ8A 2OBGA 1DVZA 4XP1L 3GJFA 5DO2D 4FQQB 3DVFA 4JFUA 1ZIBA 4A63A 1S7VA 5FUOH 1VESA 1GZPA 2KQNA 4YBLB 3WO3B 1J05B 4LEEA 4PJGB 1I3VA 5CAYB 1K3IA 4YSDA 3ETSA 4OAWA 4XMKL 4MAYB 1PIFA 2VB5A 1H8LA 2R69H 5D6DC 3RWIA 4LSSL 2I7OA 5CR1A 3UC2A 1K8DB 3K4ZA 4X4YB 4WV1B 5KWYC 1JN6B 4N2NA 3TTSA 1HOCA 5IQNA 4D7BA 4XXCC 4ZAKD 3C60D 4E9YA 2XWRA 2V2WA 1KCRL 1E67A 2NNAA 4N90E 4EUPG 2EDBA 1V5JA 2EEFA 1FBIL 1OWWA 2E7BA 5E8OA 5DVNA 3WHXA 4KXCA 3U7WL 2HFGL 3RNQB 4BQ9A 4I0KA 2HVKA 4X0NA 1ZK5A 2N1KA 2X4PA 2W0LA 1Q9KA 1G7HB 3H9HB 3T4AB 3M1CA 1L7TH 3WGVB 4PY8J 5JOFA 3T1FA 1XF2A 3LDBB 3EOAB 1OAXL 4NO0D 2WO3B 3VUAA 4NZFA 2ZXBA 2FEJA 3N5AA 1V10A 2FRGP 3L6FA 5F0JB 2OZ4L 4RGNE 3U9PH 2ITCB 2ZE0A 1JE6A 1VENA 3KS0J 4AQ8C 2H47C 5DD3L 1I1AC 2YBRB 5EORL 5KSAB 4I1PA 3W37A 3E0GA 5EC2A 2J8UA 4WWOA 1UM5H 2HVBA 1Z3GH 4Y4HA 2PTTB 1ULVA 1CGYA 4JFFB 3IXTB 3ULVH 4EZJA 3K4DA 2HRHA 1P1ZA 2ZXGA 2IH9A 3WFEH 1TCRB 2GHZA 4JHWL 1RUKL 1HHKB 3NJGA 1ZHNA 4OTXL 2O6PA 1EEQA 2HKFL 4J3SA 2ENSA 1UD3A 2R23B 2OJEA 3STBA 4DGIH 3IVKB 3GPEA 2ZOTA 2GAZB 5C0EB 1J87A 3OAZH 4DN3H 2HP4A 5GS2D 2G3ZA 2WKOA 4L2YA 1X7TA 2OR9L 4OBRA 5BQ7A 4IHOB 2APSA 1NAKL 1P5VB 2NXZB 2ZX7A 3F7RA 1II4E 2QGCA 4I9WE 4U1IA 2YD7A 1HEJC 4LRNL 1FCGA 5F88B 5EBGA 3DGGA 2DKMA 5GISL 1KPRB 4YK4C 1NEZB 1A7OH 2VKWA 4CILA 1DE4B 1VGEL 3FF7A 5GJSH 3MLPA 1C12B 1F00I 3TGXA 4NCC1 2L7QA 5IKCB 5DFTA 3GNMH 2YLHA 4XTRC 5ID1A 3DSFH 3EJSA 1JV2B 2DYPA 1EERB 3VB9A 2MKWA 2JVUA 1YY8B 1KC5L 3LRLA 2PPDA 4P2AA 4IDLA 5DQJA 3GRWL 1BZ9B 2VN4A 3SQOH 2PYFA 4HSCX 4QT5B 1AS8A 3QZLA 1C5CL 4F8TA 4E41A 5DT1H 2FL5B 1ONQA 1SJHB 1Z9LA 1D9KB 5CZXC 2ZKHL 4YHIA 2ZPKH 3MYJB 2AXFB 3QORB 4UYPA 3X14B 1CD1A 5C09D 5CBAB 3I50H 1AD9B 1KCKA 4OCSL 5ICUA 4MTMA 1A5FL 5C0AB 1R3LA 4ZS6D 1JZFA 4XBPA 4PJFB 4EI5B 3MUUA 1CQYA 3RUGE 4H26A 1VFOA 4Y5VA 1IT9L 5CIPH 5D7JC 1MKFA 1RZIA 1FNGA 25C8H 4PY7B 2AJXH 1KBKA 2XKNA 2K9FB 2ADFL 3H9SB 1TFPA 3GZKA 4NC1C 2VDLB 2O5YH 2VOTA 3TVMD 2WO2B 1CXEA 1BLIA 3O9WA 5DI8B 3VXQA 4B5ZA 4JDEB 4MB5A 4QRUB 2VDML 1UQSB 4FDWA 1CL7L 3NA9H 2G5UA 1M2OA 2E7MA 2WW8A 4MKMA 3LMJH 3SKOA 1G7QA 2NR6C 1SHWA 2BC4A 1A4JA 2HUHA 5A3IC 1OCWH 4PLJC 3JYCA 3GMRB 4UINH 3AGWA 1CS6A 1QW9A 3G6DL 4KITB 2OMWA 3QEQE 3S7GA 3QNYA 2J57A 3JWOC 3ME0B 2EXSA 5AZEL 1NPUA 4ZS7H 3ABKB 3WNJA 5D70H 1GYUA 3OKKB 2R2BA 3D69B 4ZUWA 4I7ZC 2OQJA 2N0MA 1AD0A 5DTFB 5CHNA 3R4DA 1HL8A 4OLWL 4GW4A 3K8LA 4N22A 2NT0A 1OOWA 4WWPA 5TD4A 5GZNC 1E4WH 1N6VA 2ITFA 1QBMH 2FNBA 4L48A 3ULUE 4EIZC 1A9EA 1KGCD 3QNXB 1NCOA 4W9ZA 2A9NL 2WXIA 1FHGA 1I8IA 4IU3A 4G1MB 3D0LB 2HMID 4G5AA 3KLHD 4R4ND 4Y4HD 4KRPC 1P9MA 3EFOA 2PNDA 2PR4H 1SY6A 4M7LL 4G42B 1FAIL 5LGHL 1YYML 5ITFA 1W72A 4W93A 3TT1L 4PJBB 4AYFB 3S5LG 3HCVA 1GC1L 2K6ZA 4F9PA 2Y22A 1A4KA 1SPDA 1UC6A 3HKZA 4UV7L 5EZOH 4N0UA 1CBVH 5SWQB 5JW3L 3CFTA 3C6EA 4NB7A 5KVGE 2B14A 3NACH 4H20H 1U8KA 5CD3A 1CQKA 2WLNA 4JHZA 3WE6B 1PFOA 1ZA3B 1U4FA 3D39E 3EJZD 3CGTA 4NZUL 4S1SL 1NCHA 1P69B 2FBJL 3WFHB 2JK5A 1CD8A 4PGDA 1F13A 3LS5L 3FHAA 3HE6A 1C1EL 1NAMH 5IIEA 3O45B 4G8AC 3L1OH 1K6QH 2P8LA 3LSOB 1EUUA 3WFZA 3MFFA 4GQZA 3KBFA 2VRQA 4TOYL 3IPBA 4G7YH 2QPUA 4P9ML 1FFPA 5C0JB 1FLTX 4ODUB 3L95A 2QR0A 4LQ1A 5MEOB 3QQXA 2LE9A 4APQB 2DB8A 4FJ6A 1OALA 2XWJB 3L3JA 4N2DA 3VXSB 2A6KA 1PKQE 4GG8B 2GTZA 3M45A 4YOKA 3QZBA 4Q58C 5AAWC 2FEDD 1T21B 2X9XA 4R90L 3O8XB 5L2KE 3C6LA 4MSWA 4U31A 4WO4B 3CXDL 2DYPD 3M1BA 4GT7A 5E8DL 1DQVA 4LDLB 4N2KA 4PTTA 3DO4A 3DJZA 3UTQB 2G30A 3OG4B 3NCYS 4A2GA 4JLRA 5BJTB 4JFDE 5DLLA 1KEML 4OZFH 3GQFA 2BOBA 1WWWX 4LLAA 2AMUA 4OLYL 2UZYA 3UC0H 5KBDA 4E41D 1DBAH 1FGNL 3SDXF 2X4UB 5FV2A 4U1LB 5I0XA 4FLSA 3J27A 5I8CB 3PAZA 5DD1L 1TTAA 4G7VH 4Y19A 1PLCA 4NSKB 4WAFA 3UYPA 5JW4Q 4ZFZB 1V05A 3A6OA 1PY0A 4X5RA 5B1KA 5IM7A 2F74A 3KVPA 1R5VA 1T89C 1DSFH 5EBMB 3QJSB 1GOGA 1OPGL 2EO7A 3FQNB 1NCTA 4P49A 3B2XA 3TO2B 4O2FA 4P9HC 3JWNC 3OG6B 2JH2A 3NCYP 3C08L 4LPUA 2NY0D 4GKLA 1EQWA 3JSSA 4OM1L 5K5YA 3VJ6B 1PD6A 5C0DB 1JYWA 1EXGA 4IS6B 5TE4H 3NCJH 4XMZA 3LOWA 3B7YA 2EINB 4ETYA 5GGQH 4IU2A 3RPBA 1FUNA 1TVBB 3O9WD 4UM8A 2A38A 1XO8A 3C87A 5IBTH 1DANU 4Z7IA 1DJXA 4OCYH 1XF4B 4ADGA 1UA7A 4NNXA 1P4BH 3LH8A 2KLRA 4CMHC 1ACCA 1X7QB 4IDJL 4WEMB 3ZUCA 2BCKA 2RQEA 1D9KD 3BSHA 4FXKA 4YHYB 1LK3H 5I9QB 3DUUA 4H8QA 1NEPA 3N43F 2F19L 2WINA 1SN2A 4RZCA 2J2ZA 3CIQA 3CZUB 1FVCA 2X2IA 4AMXA 2DQMA 3QHZH 1EZLA 2GITB 4NO5A 1AXTL 3HBGA 4YZFF 4N1CA 3WDHA 4DZBB 1IBZA 3US9A 2JI2A 4IRSA 5D5MB 1IJ9A 5FECB 4LCCB 3WCYA 2X1QA 1CGSH 3ZTJH 5C7XL 4AZUA 1GTNA 3AMLA 2IAMC 1KF9B 3AS1A 1AJ7L 1OTTC 3TN0B 1DVFA 2FH6A 3IT8D 1EXUB 4MNQA 5EO1A 1G7PA 4HWBA 5KJ4A 4ZW3A 2EUZA 4KDTA 1ZVNA 1KGWA 1YEIL 1SM3H 4MZ3A 4DP9X 5DZ9A 1PX8A 1E8WA 1RZ7L 2CWRA 1NFDB 4M5TA 2EECA 4A7QA 5DHVH 3IFLL 1KZYA 1RIUL 4NM8H 1XEUA 2WLIA 5C07A 5MEPB 3NIDE 4H7VA 3NSYA 5DGRA 5GS1A 5IW6B 4AENB 2W60B 1SY6L 4JAMA 3NRPA 5ISZE 3EDJA 2NX5E 2XKSA 4DUXA 5INDA 4FYTA 2JV6A 1P84J 1YJDH 3NOIA 3KPRB 3T65A 2NYYC 4XI5C 4XP5L 1Q0EA 2ARWA 1WBZB 2BP3A 3G5XA 3HE6D 4X0KB 3LH9A 3P4MA 3P0GB 4R0LA 2R1YB 5AAPA 3HEIB 2DH2A 4ABWA 3U25A 4M56A 4PJXA 3VGAC 3RPIB 1HHHB 4PHXA 3MX0B 1Z9SA 4F15C 2AI0H 1A9BB 1WDAA 3ZKND 4FYSA 4P04A 3H3KA 3S5ZA 4OF0A 3T4YB 1MQKH 1XGQA 4OD3H 4WWKA 3NN8B 5I1JH 2HX8A 3WY4A 5IHZB 5A2KH 3H2WA 4ZO7A 4NKIL 2BVOA 3SYCA 4R3SA 1TYRA 2PETA 5L0QB 1LO0L 4OIFA 3S8WA 2CRYA 3CSTA 3GSQA 1FPTH 3SO3B 5SWZA 3HC4H 4DP8X 5F7EH 2VLRE 3NZHH 3SPJA 2IWFA 5EOCL 3U4BL 3QVAA 1X5KA 5I6OA 4I4WB 4U6VH 5GJTH 1WIOA 3DOHA 1F4HA 1J5HA 3CX5J 5DHYA 5DD5L 1LO4L 2OLDA 3SYOA 3BP6B 4Y19D 1KY6A 2A83B 1HQ4A 2H1PH 4YPGA 3WN5C 1DVTA 1EUTA 1Y18A 5D1XA 2ZKYA 5KVMC 4N2EA 1SEQL 4PRAB 5JPMB 2R8SH 1F4YL 5GGTA 4Q8BA 4Y9FA 1JHTB 3G04B 5AUMA 1X9RA 1UHVA 3F83A 1T5KA 1WGVA 1IBBA 1KACB 4QRAA 4JFHE 4HQQL 1X3DA 4XX1E 1U8NA 5E6IC 2W0PA 1S9XB 4AYDC 2JKLA 2Y9RT 3GJEB 3K8MA 4HVBA 2A4EA 4RCAA 2F8IA 3K5RA 1OF2B 2OMYB 3T6XA 2BINA 4LPYA 3B43A 4G1EA 5I26A 4Y5XA 1MHPH 4HYTB 2OMVA 1RHHB 2G3XA 3NTCH 4HOMA 4BKTC 4GAGL 5D93B 3HI5H 4DNLA 3DX8B 2ATKA 4YLQT 3A24A 3FT9A 4HF5L 1NGWA 3WIIH 4TQEH 4ZYKA 2OSLB 3V5KA 1FIEA 3LX9A 5F6IB 1J0KA 3CDZB 3DBSA 2HWZH 1DL7L 3QZWG 3OKEA 5F1IB 1INQA 4LFHD 5EF3A 1G9EA 5ACLA 5B38A 4MYPA 1KLFA 1ORSB 1H3VA 4WU5B 4WTWA 4FTVB 3BIKB 4I3RL 3BT2L 3QCUH 1F1DA 4ZMVA 3HPLA 3PDOA 2AKRB 4IRSD 4NUPA 1PG7H 5F2FA 1KDJA 4LCUA 5E8NA 3BFWA 3VH8B 5BZZA 3HRPA 4ADJA 3MRRB 4DVRL 2XTLA 3LPWA 1T2XA 1J18A 4QRPB 2YAHA 4PJCA 2CDEB 1X5AA 2IBZY 5HGDA 1GYVA 5FGBA 1DVFD 3TYFB 1IGFL 3QO1B 5E2VH 2X4OA 4OGAC 4FQXB 2Q8AH 5BUAA 2BSED 2QQLH 4Z5RA 1FG2A 1T4WA 2YPLB 5DDHA 1P4IH 4QLWA 3WIAA 4FNLL 4L0ZA 5IMMB 3BLKA 4XCFH 1BYNA 1CU4H 4AM0A 4OCXH 4QF1B 1JV5B 1WHPA 3KYMB 3A0OA 4PR5A 2W9LA 2QADC 2FEEI 2IDUA 5I66A 2EDJA 4K7PL 3OGCA 1TVHA 3VXME 1BBDL 3MREB 3UBFA 3PL6A 4DKEL 5IMKB 2P9RA 1NIFA 4OZGE 4YSAA 1L9NA 4ICWA 4G7QB 4NKDB 2YGQA 1NCDL 3A47A 4PJIB 4ZTOH 4DESA 5J1AB 2D7TL 5H37A 4LZKA 5BRZD 1MFVA 1IILE 1GJWA 3ZIYA 2QZ5A 1IVLA 4CL7A 1MREL 4QHKJ 3CPLB 4WLCA 4YGAB 4YXLH 1KUMA 1XX9C 2WVVB 3MLTB 5C2BH 3VFRB 4CVXA 4GQ9L 4Y16B 4LBAA 5JHBA 1U8JB 1OTSD 2YXVA 2ZONA 4FXGA 3ZTEA 1DEDA 5JA9A 1B2YA 2NOYA 3HG4A 2FX9H 1E6JL 1TMCB 3MLUL 3T71A 3A6BH 2IPKB 1FFNA 1M6OA 2B7DT 4O2CB 3TBVB 3RPKA 4YMPA 1CDUA 4NQXA 3MLVL 2UVEA 4RISL 4IHBA 2J5WA 1EZVX 4C83A 3QDGE 1GA2A 4H2AA 5CJXC 5SWZD 3VGHA 4QXUL 4ZBJA 3OKLB 4LOFA 2OTUB 4H8VA 1Q8MA 2DIAA 2I27N 2ADYA 2H2PC 4YN3A 3OB0H 4RFOL 3LPPA 5FYJD 1H5BB 1LL1A 1MFAL 3MBWA 2OXGA 3RWFA 4NQDA 1ZIAA 1OT2A 3L9EA 4P57A 4WW1B 2G2RA 4NQTA 5EF1A 3V4PB 2V5SA 5FYJL 5BNXD 4JFEA 5D1XD 4XXWA 3P3RA 1LE9B 4PYGA 4G11A 5HYJE 4G9FE 2F68X 2P5WA 3H85A 2XBTA 2JCCA 5I15H 3EO9H 3HG1B 4I2XB 3N1PC 3VDBA 5AOKA 3BP4B 4RA3A 1F4XL 3KXFE 4KKZA 1HZHH 1NCGA 2AV7A 1AGEB 3E8VA 3LNIA 4PP1C 5DHDA 5GGTL 3PP3K 1CZ8L 2V9TA 5E03A 4WY7H 5ABAA 2HG0A 3TM6A 1M7DB 1W0VA 3IJHA 1UENA 1I8LC 3V4UH 2KZWA 4HFWA 3TT3L 2XVBA 1NDMA 4N2LA 1V54B 2UWEE 2VUYA 5JQIB 5HDQH 2B1HL 3V5HB 4Z77B 4L3FA 1NQBA 1ZHLB 2JJWA 3SKMB 1DJYA 4E9WA 2E86A 3QEGH 4KO9A 3ULVC 1R34A 3JTTB 1DBBH 2GUOB 3CBRA 4XNBA 4FLQA 2HJKA 1QFWH 4MMXB 2GJRA 2J44A 3AREC 1I4FA 4OUUA 3F7QA 2V4LA 1MCCA 1MIML 1NMBL 4P4RA 5M95B 4H1LB 5K39B 3JUYA 2EIKB 3VQMA 3C6SA 1Z1WA 3BJLA 3H8NA 4UT7L 3QSKB 1HHJA 5GRVL 3BAYA 4KY1L 3U6XS 3Q2WA 3RLSA 4YDIH 4U7MA 1NANH 2R27A 1UJ3A 1XTLA 3Q8CA 3WG7B 3MLYL 5LN8A 1ACYH 4KRLB 4XAWL 5CBEB 3EJYD 3RA7L 1GY2A 1RJYA 5I71C 1A4AA 1T1ZA 1T7VA 1UXWA 3VI3F 3HFMH 1RERA 4HXAH 4R2GC 5DMGC 4Z18A 4FRWA 4DGVL 1PSKL 4GXVL 4FFVC 3K91A 3KWVA 2VH5H 3SPIA 4LLUB 3N40F 4UQ3A 4R9HA 5FHBH 2D03L 3PL6D 3QO0B 4QLRA 4X98B 4CDHA 3ARUA 2CA4A 3JVGA 5GS3A 2VABA 3K6SA 4XVUD 4Y5YB 3FOLB 2TSBA 1CDIA 5D7IE 4X4XB 1U3HD 5GRYA 4LASH 1NGQH 4IQHA 2IG2H 2YJLA 2NTSP 3I6KA 4JW3A 3SDAC 1N26A 3V7AE 1XIWB 3NAAL 1MY7A 4N1EA 3AS3A 3QG6A 1MCFA 1AANA 4ZTPL 3ZYOA 1H3GA 3LKQB 1TSRA 3HI6H 1IKNA 5K9JL 4FNRA 1DBJH 3V52H 4YDKL 1RURH 5DA0B 1G43A 4ZNEE 4GP8B 3BD5A 2CRZA 2MJWA 4E9LA 2X05A 3O2DA 5TDPA 2ZUWA 4LSVH 2VRAA 3Q2LA 2PP7A 3IKKA 4PREA 1TZGL 2DMKA 3G6AB 2EDQA 1BF2A 3BVTA 1YPZF 2EE3A 4XBEL 4R4BB 3M17B 2J1WA 2QTVA 3REVB 1CK0L 1D5XB 4GFXA 1CLCA 1L0PA 1E3XA 2C4FT 3B2VL 3RGVB 3T5WA 1IEHA 4R8WH 1QFUH 1RPUA 1MCWM 4OCRL 1L9OA 2EIBA 2AC0A 1GSKA 3VFWB 1CC3A 4GI6A 1CDYA 4JY5H 3LQAH 1IX2A 1TZ8A 4X4MA 1WD8A 1BFOA 1HSBB 2VDLH 2XKUA 4WHTB 4B9FA 2FHCA 4JQXA 1TJGL 3VM5A 3IRCA 2J43A 4NQDD 4N5EC 5DJ0B 3GIVB 4JPQA 4JKNA 2O5XH 2QKIA 5ECJE 5LXVA 5C6TL 1B3JA 4JFED 3POCA 1GGUA 4XP6L 4F7TA 4N9GB 4RWYL 3E9UA 3P9LB 4QXWA 2AK1H 1PEWA 2P5WD 5FGCB 4KO7A 3NRFA 4Y2NA 4NGHH 3ZGHA 3VFNA 4NENA 4OY9A 3OHMB 1AG6A 4X6CE 4B96A 2HT4C 4IRZA 3LZQA 1DCLA 4EUPB 3QCTL 1HIMH 3TCLB 1WBYA 3ARFA 4JKPL 2QVTA 4AXWA 3VXRE 1XR8B 5C9JA 1JPST 3NEOA 1MCDA 3EYQC 4HDIB 4ZXBC 4N25A 4XMVA 4KDWA 1Q9LA 2JXMB 2WLKA 3FULA 5TE7L 2IH1B 4Z3FA 1UOWA 2NSQA 1F3DH 5FK9A 4NT6A 3F12B 3TA3A 2EADA 1BVKA 4Z7UB 4Q9QL 1K4CA 4AOFA 5KS9F 3I9GL 2C3HA 3QUGA 4M3KB 2AJVH 3V9EA 4LMQE 3RUGA 2YO3A 3C2AH 4AG4H 4HPYH 3V79C 5J4MA 3PIQB 3UDWA 3MLZH 3AT9A 3RDJA 3O3BA 5DS8B 4LOEA 1CICB 4KX7A 4ACPA 3Q5YA 4CW1B 4E68A 2WKGA 2GTWB 1CE1L 3I75B 3UZQB 4DKFL 7CGTA 3W38A 4N20A 5JYLA 1U21A 4QAWA 5F7MC 2B5IC 1IGYA 4Q4IA 3X1NA 4C59B 4J39A 1U3NA 4FQ1H 4UYQA 1QLFA 1VADA 1QHOA 3LZNA 2R0KL 1YY9C 1DHKA 2Z65C 3FCTB 2Q3ZA 3I02A 3VWJC 3WXVL 3R19A 3AY2A 4E9QA 1NCIA 4YGVB 3NJVA 2ENPA 1P53A 2OYLA 4H25B 2FYVA 2VC2B 4F33B 4DUVA 4GRMA 3F7YB 4HUUB 2H3XC 1N8OE 3V6FA 5HYSG 3BVDB 5MEQA 4YIQA 3L3HB 2BNRE 5D2NE 2AP2A 1AIZA 2RD0A 3QEQA 1BM7A 4NN5C 5HY9B 5JA8B 3IS1X 5C0BE 1SDDA 4GO9A 2ZX9A 1E2VA 2XQYA 4J3OG 3VX0A 1JXFA 4W4NA 5L4JA 1UZGA 3HG5A 4F7CB 2XRAH 5CNHA 2WMPA 4GFTB 1E42A 4HKXA 3WS6C 4R7VA 1I8AA 2FECI 1OZTG 4RGND 3K72B 3OMZA 4MBOA 1EBPA 1IAMA 3L3DA 5DFVD 1TZIB 3L7FB 4QD2E 3GD1C 1FG9C 3ZSTA 1JGEB 4TSCH 2GY7B 3WHE0 1J8RA 3HVDA 4IIQB 4WFGE 1C5BL 3LIUA 1QLEB 2D3VA 3W9DA 5LN4A 3ZVVA 1KTDA 4EXKA 2DWXA 3U9PL 4LLMB 1R5IB 3C8KA 4BSJA 4J4PC 4YHKH 5EEYA 2G2NA 1P0SE 3IDIA 1IQDA 3IM1A 3UTTA 4L3AA 1JWSA 1UM5L 1Z3GL 1U93A 2C3VA 3K8KA 4IBUA 4NPYB 3Q5TA 2ZNXA 1WBXA 3WNNA 3FTUA 4Z7VB 4URKA 3V0DA 3TWYA 1JZ6A 1EPFA 3D39A 3WY1A 4FQHA 3MPCA 4MD5B 3O2DL 3VFGL 2NTFA 5I8KL 5SX5K 3ARVA 1BQHG 5H94A 4J6RL 4AQ1A 1LWRA 2JKIS 1BBJA 1Z9MA 3DETC 4HBQA 3VFVB 3L13A 4F1SA 5JPNA 2X2UA 4CSTA 5F0PB 3RZCB 4AIZA 4I9WD 3UACA 1P4LA 4KV5F 3QHTC 4QOKE 1NAMA 1OGTB 2YPVA 3WXVH 3IFPB 3D0VB 1PNDA 1U92A 4JJOA 3E7JA 2K3HA 3DRTA 1RULH 1X5YA 5DZOA 4HUVB 5EUOA 4N2IA 1SOQA 2P5EB 2C9RA 3O0LA 5T1DH 4DQAA 3CAFA 3KPTA 5F7HA 2TRYA 4WI0B 1GS8A 4BK5A 3VFTA 3EXJA 3Q43A 1MFUA 1D5RA 4P4KA 5JW4N 1OXYA 1E3ZA 1PKQA 5LBSH 3DROB 2EYTB 4P2RB 4G9DB 1ADWA 5L2KA 5JHMA 2GSMB 1KPUA 3CE1A 1ECYA 1T66C 1TIUA 3VM7A 1VGKB 1CWVA 1ZDSA 3FF8A 3FO9B 4WW2B 1A7OL 1NOAA 4R96A 4AYBA 4JHAH 4DZ8A 5B8CA 4FABH 3D6GA 3PHOB 4AWJC 3T1WA 2ZWNA 2FZ3A 1NM9A 3ARFD 4N26A 1SYSB 3DVGA 4JVWA 4OV6F 4OKDA 2WCGA 3KYOA 4BH7A 4L4VE 4XPBH 5T1LA 4ENED 1A6VL 2HLFC 4IRZL 4RDQF 1FL3B 2XX0A 3TA3D 2JKJA 4JY4B 1ITCA 1MDAA 3T9WA 1KIRB 5BMFH 1KXQE 3TNMA 5AFAA 5I2IA 1XFPA 1FNSH 1OSZB 2Q6WB 3S48A 3SCMB 5E5MB 2HLAB 2UY6A 5DT1L 1DJWA 2XWDA 1QA9A 1CLOH 3NZ8B 3QG7H 1D5MB 4AI7A 3CVBA 4MD0A 5ICYA 1EA9C 1Q9WB 2FWLB 3QDJB 4Z7WF 2XWEA 2Z7UA 4S2SA 2GABA 3FSAA 1OL0A 5CLXA 1ES0B 1QQDA 3MGOA 3QI9B 4TTDD 3S5LB 4PRDB 4OFVA 2V33A 3VMOA 5ACZB 1BQKA 1BEYL 1AH1A 1W2KT 2GT9B 3HUJF 3X12B 2Y5TA 3L2LA 2AJXL 3EJQA 3OAUH 3GLZA 1J8HB 1MCQA 2FJHA 3Q01A 4KKCD 3VG9C 4R7DA 2JB5H 4M93B 2FD6L 3UAFA 4PP2A 2CBTA 4LP4A 3X1GA 4EN2A 4QNPE 1B4JH 5HI5D 3GXDA 2AEWA 2H26A 4A2DA 2X10A 3LEYH 3QEQD 4EEEA 4S10A 5IK3B 4X7TA 1PZUB 2BP0B 3LMJL 1RIVL 3WL9A 3EBAA 3QNZA 1KYOK 3CJJA 1YEGH 5G2NA 2ZUYA 2F8VA 4GAYA 3BWZA 5DZAA 2AABH 3ZE2B 5D7SH 2WJ5A 4ISVB 4OH2A 4YPJA 3BAJA 4NPKA 5HDBB 2NW3B 2WQAA 5EBWB 5DRNB 1OGAE 4WTZA 4HUNB 1IJNA 4PCKA 1E8ZA 4UQDA 4DGUA 3ULUD 3CFNA 1AG0A 3OXSA 4K5NA 4ZS7L 5IP4A 5D70L 2P8MB 1XAUA 4ELMF 3BZ5A 3STLB 1UXSA 2UZIH 1A3QA 1OANA 2OXHB 4ZQKA 1OW0A 4MQ7B 1LHZA 3BRGC 5DHVA 2UXGA 1QBML 1ACZA 5I1HL 3IFNH 4RZKA 4W9IC 3HZMA 3DK0A 3F6JA 3MZGB 1M7IB 2ICEB 5ISZA 2NXYD 2NX5A 2PR4L 3V0JA 5HHQA 2ROXA 1FH2A 1GZQB 4XPHL 2G4EA 3D39D 2FQGA 4KJWC 1GAFH 1I3RB 3MRBA 3MUZ1 3MROA 2NYZA 3GMQB 5DWPA 4PWGA 1KPVB 3ZMEA 1O9ZA 2FSDA 3G6JF 3FH7A 2HVJB 2NSMA 3BGFB 3PAUA 5EHFA 5EZOL 5DYFA 4FADA 1CBVL 4BGDA 1U95B 4BE5A 2YAOA 3NACL 1N5YH 3K46A 4H0IA 1NICA 3BPCA 2XY2A 5L8LB 5JOEA 3C9NB 1V8HA 2UVFA 1FL6A 1A8JH 2ZOKB 4UF7C 1U2YA 3UIZA 2CKBA 3FB7A 3ZE1E 3A6CH 4A37A 1NAML 4PW3A 5JO5A 4CUCA 2VUKA 2BIPA 1NKRA 5BVJB 2DQIL 4M7LT 2R2EB 1HXYB 3SBWA 3BMVA 1K6QL 1KXVA 5L2KD 3LNGA 4PG9B 4DP1X 4G7YL 1HCYA 2BP8A 4HS6B 1AGDB 3FK3A 3L2MA 1VFAA 4JG0L 4IBVA 2FJGB 5G5DA 4JFDD 3MV11 3KWWB 3RWDA 3K80A 4ATWA 4I3SL 3BAWA 2UXFA 4JM4H 5D7LE 4HG4K 2KYIA 2VR5A 4G6KH 5F89A 3VWKB 3P4LA 1DQLH 2AQ1A 3BZDA 5T1LD 4Q6KA 3PHSA 4M4RB 3DMMB 2E0PA 3G5YB 2GW5A 4L8SC 2VZVA 5KYUB 5F97E 4GKSA 2K4WA 4F58L 3KPQA 4YO0B 3KLLA 5D4IA 1R75A 1IE5A 1DBAL 4KK9C 3CQQA 3TBBA 1OGPA 5JDJA 3IXAB 3BAEL 3CCHA 3Q2CA 3V0WH 3P4OA 3H9YA 1NDGA 3R7RA 1ED3A 1KB9K 4A2EA 5E94B 1UEMA 5K9QG 4QRRB 1MAMH 2WAHA 4N0CD 2J3SA 1RK1B 1XCQB 4LARL 4BFJA 4B60A 4Q0XL 3TVMC 4KX9A 1TU2B 5DHEA 3VQ1C 4C56E 4K3EH 4JE0A 1AGFB 4NIYE 3TEZA 4FP8H 2IMMA 1XGRA 1OAJA 4ZOBA 5TE4L 1ZT4A 1RSYA 1JHLL 2IH3B 4P48A 4L1TA 2FH8A 2V17L 4YL9A 5GGQL 1N59A 4N6QA 3CZFB 3QUMH 1XR9A 1ZV2A 4W9EC 1X5ZA 2WTOA 1D5BB 1AR1B 1BVOA 5TF1H 3QRGH 1RJLA 2VSMB 4TNWK 2VZUA 1Y0LA 4OV5B 2BIIA 3DBXB 4UM9D 5C8JB 1P4BL 2W38A 1A14L 3FCSA 4URTB 3OR7A 4ES9A 1KZQA 4KQ0A 1UT2A 3ABMB 1DVSA 2FQFA 4JFQA 3I2CH 4ZSOB 1NKOA 1DYZA 4MMYA 4MQXD 4JFPB 5E08L 4MXWH 4QRQA 4P23B 3N1QC 3HR5B 4KRNA 4TUJB 3ZY7A 1C7TA 3QHZL 4ZTEA 1YLBB 2W94A 3P9MB 1L6ZA 2GJZB 1YEDB 4OZHA 1MLBA 1QATA 1KYFA 3T2PA 3ZQWA 5FS5A 2WGNB 2DKSA 2Z31B 1HL4A 2C1OA 4P2QB 5FOBB 1CGSL 2HMIC 4YBLC 3G5VA 5DQ9B 3S36L 1E4HA 1MVYA 3KNBB 5FYLH 2CBOA 1I7UA 2OW7A 4MAYC 1K72A 3U4KA 3V4PH 1SM3L 1O7DE 5CJQH 2V8LA 4MA3A 1A3RL 4WJ5A 5ISZD 2NX5D 2F0CA 3IGFA 4JPKH 3CSGA 4WV1C 4UAOB 4OZGA 1OAYH 4NWUL 3VD7A 3GGWA 4FQPA 4NM8L 4G71B 3ECWA 1KCVH 1B