2XXFA

Cu metallated h254f mutant of nitrite reductase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGFGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
total genus 95
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xxfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xxfA02
3EH3B 5AFAA 2JFCA 2XU9A 2VM4A 1PCSA 3GXUB 4AX3A 4HALA 2GIMA 1PZAA 4TXVB 2PPDA 2X88A 2GBAA 2XX0A 2YAHA 1J9QA 4HZ1A 5B1AB 1RZQA 2PP9A 2CJ3A 2GHZA 2BWIA 1SFDA 4W9ZA 1M57B 3QJRB 1AAJA 3DKHA 3FU7B 1J9RA 5TK4A 1ZDSA 2YARA 1SF5A 5I6LA 1OE1A 3FQ1A 3DIVA 1SF3A 1ILSA 2IDTA 1V10A 2W88A 2H5UA 2WO3B 1E5YA 3HB3B 3HEIB 2IH8A 4M3HA 1AS8A 2GI0A 1JZGA 4NB7A 4AZUA 1CURA 4N4YB 1PLBA 2R7EB 2Q9OA 5I5IA 2W8CA 2VM3A 3QPKA 1ZPUA 5D4JA 3UABA 4RH4A 1QNIA 5B1JA 1JZJA 5D4IA 3T6VA 2HX7A 1JXDA 1OCOB 1BYPA 2LLNA 3T9WA 4E9QA 4E9WA 1GS6X 1JERA 5B3SB 1NTDA 1SJMA 1PLCA 3FPXA 1ASQA 1TEFA 3X1EA 1ZIBA 3ABLB 2BP0B 3ZBMA 4W1TA 2EIMB 3AZUA 1OOWA 2YAPA 1ADWA 1ZV2A 2QPEB 1MDAA 3EHBB 4DP8X 2HX9A 2FQFA 1OV8A 1RKRA 1M56B 3FYIB 3FQYA 3EH4B 3NJHA 1IBYA 3PXLA 3FS9A 3NJIA 3RYMA 1PNDA 3OMIB 5I26A 3FU7A 3QJSB 4X4KA 3UGEA 2XXFA 4HHWA 2GC7C 4DPAX 4YVUA 2J5WA 2FT6A 3SBRA 1ASPA 5FC9A 4E9SA 3ZIYA 2R7EA 1CC3A 4KOBA 1DZ0A 3WI9A 4GY4A 1EHKB 1ID2A 1XB8A 1PZCA 4NAJA 2RACA 2PPEA 3NP4A 1B3IA 3EF4A 4YVNA 4HHGA 4WKXA 1N68A 1AZNA 2DWTA 2DV6A 4A66A 1NZRA 3FU8A 1HAUA 3X2QB 1OCCB 2CBPA 2PLTA 3L45A 1A8ZA 1A3ZA 2YAEA 3T71A 1L9QA 4EF3A 4BWTA 4E9TA 1ASOA 2JXMA 4AKPA 1V55B 2PCFA 2VW7A 3X1NA 1E30A 3AG4B 4KO6A 2ZONA 3OMNB 2J57A 2XUWA 1AR1B 1SHXA 3NJKA 4KOCA 1KV7A 2BP8B 2J56A 2WSDA 4Q89A 2HLEB 7PCYA 4DP6X 2DWSA 3NP3A 1IC0A 1AQ8A 2OV0A 2XX1A 4M4RB 2H3XC 3V9EA 1AG0A 5LDUA 5B7EA 3ZX1A 4DP4X 2FJSA 1ET7A 3TBBA 3CZUB 1FWXA 2BWDA 2E86A 2ZOOA 5AKRA 1OE3A 2NRDA 3IEAA 3NSDA 1KCWA 3MBWB 3QJTB 1AANA 5I28A 4E9VA 1NIAA 1KBVA 2YAFA 2IAAC 1OCZB 1A4CA 1SDDB 2XV0A 5I6PA 4HCGA 1J5CA 1KDIA 2CALA 2PPCA 3JTBA 1AZBA 1SNRA 2EIJB 4DPBX 1E5ZA 4BWUA 1XB3A 5B1JC 3FSAA 1SHWA 1X9RA 1BEXA 1GS7A 2PPAA 1E67A 4BXVA 5A7EA 4GP8B 4CSZA 7PAZA 3TA4D 4ZK8A 4GP4B 3PLYA 4A2HA 3NJMA 1GY2A 6PAZA 4AKOA 2BO0A 2CAKA 4YSUA 1BAWA 1JVLA 4Q8BA 4DP5X 3TU6A 3CVCA 1VLXA 2FQDA 2B3IA 3WNIA 2J55A 3OM3B 3PPSA 1TKWA 3AW5A 4HIPA 1CYWA 2XLLA 1PF3A 4YSDA 2OJ1A 3UAAA 2ZWNA 1PNCA 4KO7A 2VSMB 3FQ2A 4DPCX 2VW6A 4KNUA 1YLBB 2AVFA 3NJLA 4GYBA 4BXSV 2XVBA 4YSPA 2XXGA 3V9CA 5I6NA 2OCCB 3NJGA 4A67A 5D4HA 2FT8A 5IY5B 1F56A 4KO9A 4P5SA 4G7SB 2HX8A 4JKNA 4G71B 3EH5B 2Q5BA 1BYOA 1PZBA 3PAVA 4GXFA 2FWLB 4G7QB 5B1BB 3CVDA 8PAZA 3PCYA 3NJFA 1L9PA 3G5WA 2Y1AA 3IBOA 1GY1A 3GDCA 2QPDB 1MG2C 1W6LA 1R1CA 3PAZA 4E9RA 4BDVB 1URIA 1AZUA 3CDZB 3SQRA 1RZPA 2AZAA 1J9TA 1ET8A 5PAZA 1TU2A 1AOZA 3QJQB 2XV3A 4F7KA 2AZUA 1I53A 4JHUA 1KYAA 1AZRA 2UXFA 2VN3A 2QDVA 1JZHA 1BQKA 2GC4C 4YSTA 5I6OA 1E65A 1PLAA 2GB2A 2IWFA 3T6XA 4YSRA 4QLWA 2IDUA 2IDSA 3X1BA 2DY2A 2UXGA 2BP0A 3QJVB 4A2DA 1AIZA 1W8EA 2XWZA 3KW7A 2EILB 2YQBA 1MZYA 2MRYA 5B7MA 1DYZA 1NPJA 3X1GA 6PCYA 4DP0X 4KNTA 1OCRB 2H47C 3ASOB 4MFHA 4A68A 3FYEB 1OE2A 3TASA 2N0MA 1ILUA 2FQEA 4BK5C 2I7SA 3UACA 1NICA 3FU9A 1AS7A 2YXVA 1WS8A 1SFHA 3FSZA 4F2EA 3FSWA 5PCYA 5F7AA 1AS6A 1L9SA 1NDTA 3ERXA 3ZDWA 1PY0A 4G7RB 1KCBA 2PP8A 4BDVA 4QKTA 2VSKB 1W6WA 2CCWA 3ABMB 1ET5A 3CDZA 3QJUB 3IN0A 3WNJA 4FA7B 1HAWA 1IKOP 3OD3A 2JKWA 2UXTA 5B7FA 2P80A 4G70B 4YSOA 1WA2X 4KNSA 5E9NA 1NIEA 2BW5A 2BHFA 1RCYA 5F7BA 2UX7A 3AG3B 3FPYA 2CUAA 3S3BB 4F2FA 3SBQA 1V54B 2IDFA 1L9RA 1HFUA 2Y69B 3IN2A 3ASNB 4E9XA 3NT0A 3TBCA 3S3CB 4YSCA 2XV2A 4DP2X 2IWKA 1JZFA 1ETJA 2QT6A 1AG6A 1J5DA 2PCYA 2I7OA 1FFTB 2WO2B 1IBZA 5TK2A 3UADA 2HRHA 3CVBA 2ZXWB 2EINB 4UANA 2BP8A 3S8GB 1JVOA 2BW4A 1PAZA 3D12B 3OMAB 1GR7A 3FSVA 5I6KA 2YAOA 2GSMB 4A2EA 2YAMA 4UAHA 4A2GA 3OQRA 1FA4A 4N8UA 4KO5A 3QQXA 2XYBA 1WA0X 3AY2A 3T6WA 3WIAA 3MX0B 4YSQA 4DP9X 3AG1B 1XB6A 1NWOA 2FT7A 1SDDA 4JHVA 1BQRA 2HZHA 2P80D 3WKQA 2FNWA 3AG2B 1A4BA 3WG7B 2HXAA 2BZCA 1BQ5A 1L9TA 1NWPA 2HRGA 3H4HA 4L0PB 3X1FA 4YSEA 1WAEA 2PP7A 1X9UA 3C75A 3JT2A 3GYRA 4P5RA 1UATA 4FAAB 1KBWA 1NIBA 1AZCA 2DYSB 2EIKB 3N2JA 4YSAA 3SBPA 1T5KA 3H56A 3N55A 5B1KA 4HCIA 3NYKA 2IDQA 1KGYE 1AACA 1J9SA 1WS7A 2BZ7A 4PAZA 1N70A 5I5JA 4G72B 2DYRB 1BXUA 2IH9A 5AZUA 2UXVA 4K9JA 3S3DB 1ZIAA 3NJJA 4UF7C 1MG3C 3PAUA 1GS8A 2FTAA 1WA1X 2IWEA 1ZDQA 4YL4A 3H4FA 3BVDB 3WKPA 1NIDA 4DP1X 2A3TA 4A2FA 1GSKA 3T6ZA 2FQGA 2MTAA 2QDWA 3S8FB 3NSFA 2YAQA 2I85A 4BWWA 2PPFA 1JZEA 1EZLA 1A4AA 1GYCA 1XMEB 4YSSA 5EHFA 1BXAA 4E9YA 2AFNA 3DTUB 3NSCA 2TSBA 4AI7A 4DP7X 1A65A 3KW8A 1JOIA 2UX6A 3NSYA 1CUOA 5ANHA 1NIFA 3ABGA 4GP5B 1L9OA 1QLEB 2YXWA 1MZZA 3FT0A 4WTQA 3CG8A 1CYXA 1JXFA 1OF0A 9PCYA 2AANA 1KDJA 4HAKA 1NINA 1BXVA 3ABKB 3NJNA 1IUZA 3UAEA 1JXGA 2VMJA 1TEGA 5I5MA 3U25A 4AKQA 1M9WA 2B08A 1GW0A 3IE9A 2TSAA 4HCFA 4ENZA 1QHQA 1PMYA 4PCYA 1NPNA 2X87A 2VW4A 5I6MA 3BQVA 4NERA 4CSPA 1JZIA
chains in the Genus database with same CATH superfamily
4CVZA 2JFCA 2XU9A 2H0FA 3LH2H 4AQ1A 2WQSA 4M48L 4Y4KA 1M42A 4PRDA 4F8NA 3VXOB 2YGVA 1RZQA 1ZGLM 4OB5L 2BWIA 2EIEA 3KYAA 4R2GD 3CFCL 1TF4A 1CTMA 4PPTA 3S37L 3V5HB 4PJ9A 5IMMA 3NA4A 1M57B 2OZ4L 2A9NL 1ZSDA 5AAWA 3WBDA 4OGQC 2EICA 3UBXI 4G11A 1ZHKB 3QPQD 2LV4A 2V2TA 2HB0A 4I88A 2O5XL 3HI5L 1M1XB 1E9OA 3FQXA 2H5UA 3O6KH 1TENA 5ACZA 3L3OB 2R1XA 1S9WA 4FLSA 1CTOA 1MCPH 3ZO0A 3P30H 5JNYA 4P4KA 3TM6A 3O4LA 3CBJB 4YH6A 1SN0A 3MUGB 4IS6A 1PG7H 5D4JA 4GW5B 2H6UA 3TBTB 3GPEA 4F7CA 4LDCA 3SE3C 3EYOB 3T9WA 2A6JA 1G9NH 2A77L 3QFJA 2JJWA 4S1SL 2PW1A 4U1MA 4B9IA 1TR7A 4PYGA 4QTIL 1JF6A 3X1EA 4O9HH 1KNOA 5DD3L 5LLIC 2BP0B 2ZOKB 4OBRA 1S9VB 3ZBMA 2YD3A 1MWAL 2B0SH 1QSED 2V5MA 1GHFL 4H1LG 3EYSH 4J3OD 3MV9B 4KKPA 4XN8A 4KTDL 3BHBA 3CMOL 3EOAB 1UGNA 3Q8CA 2H9GB 3BE1H 4FFVD 3T5WA 2X9YA 4ODVL 1YSOA 5DMJB 1I9RH 2HSIA 4ZBJA 1NBYA 1G6RL 3V0AC 4DFHA 3QNYB 2HUEA 4ZFGL 3EJQA 5IHZA 3AGVA 1E8ZA 2WXFA 1OTSC 4AC2A 4F8PA 2XQBH 1T2QL 5AVTB 1PX3A 2BSSB 3H9SD 4GRWE 4Y5YA 1MRFL 5I18H 4HIHA 2XQYK 3CC1A 3S4SA 3GSNA 3GS4A 1NJ9B 1LD9A 3FQUA 1S7QB 4ILDA 1IC7H 5I1LA 4J8RB 4I85A 1RZFL 2YGOA 2C26A 3ATEA 2QEJA 4N25A 3VFSB 5JR1L 1FSKB 3RTQC 3VFWA 4UM8A 5DHMC 2VDRB 2YPVL 4PGBB 5HDBB 1INDL 2O5YH 4PP2B 3GSUB 1QA9B 3L3JB 4QJ5B 2R4RL 5BRZE 3OPZL 4DTGL 1TTUA 4PM1A 3RDTC 3LKQA 1P9MC 1KYFA 3CN2A 2R0ZH 3M07A 1K3IA 1P4IL 3SOTA 3HAEG 5BW7C 1G0XA 3MNWA 2JE8A 2N1KA 4MYPA 1KJVA 4GKZB 3N1PC 4QRPD 4ZW7A 4NOBA 4XPGH 4AH2A 4Z3HA 4JLRA 2ATPA 4YK4B 2V17L 2VR4A 2OX5A 2O26U 4KROD 5GSVA 3SYOA 2CDEB 2WSDA 1U21A 3Q2VA 4JFFA 1CXHA 4DN3H 5CF3A 3GZPA 3GMNB 2ZXCA 5FYJD 1V05A 5IFHH 3RIFF 1FWXA 4FTVE 1V3LA 1YEGL 1YY8B 4ODTH 2EDFA 2ZF8A 1A47A 2FSDA 3IEAA 3MOBH 4D0BA 1E9QB 3RJQB 4ZQKB 4O2FB 1S7TB 4J3OH 3VXMD 3W2DL 4D3CL 3B43A 2R2BB 2Z35B 1XCXA 3DVNB 4FXKB 5BOJA 1E5ZA 4BWUA 5J56B 4J1UB 1CU4L 1SN2A 1NFKA 3CFEB 4B0MB 3NA9L 2GCYB 5EEXA 1G6VK 5T3XH 1AP2A 3KPLA 2ZCLH 4YGVA 4UV7L 4J6IA 4NQVB 4JRWA 1KIQB 3VXRD 2YD2A 3FTWA 4GP4B 1KV3A 4P3DB 4IU2B 1CLYL 1HSBA 3VFGH 4JFXB 3NK3A 2WWMD 2WLIA 2IEPA 5T1LA 3MJ9A 1EO8H 3WIFA 4U6YB 1X5JA 3P3SA 3WGVB 4LBAA 4C47A 3FQNB 5FECB 4TOYH 5AW6B 3QA3B 3SDXF 1Z3GH 3RZCA 2VITA 4PRBB 4W4OC 4TN9A 1FFPB 1CL7I 3BN9C 4X42A 5AOKA 3U4BL 4ZYKA 3ARDC 1E6OH 2R0WL 2AJSH 2EIZA 4BUHA 2JJUA 5JUEH 1ZK5A 3MRQB 4G43A 5IVXB 3KMDA 3P4OB 2CLZB 1DJSA 3N3EA 2XXGA 3H9HA 3V9CA 1QVOA 1S9YA 1B0RB 1DN0B 2F8OA 5AD0B 3L3OC 3LQMA 3MRIA 5TFSH 5IFAL 4KK9D 4I2XB 1UGKA 5FK9A 4OI9A 4RAUB 3KPOA 4YNYB 1YECH 5DI8A 5LGJA 4DK3A 3D39D 4F91B 4KV5E 3LNIA 3NZHL 5C6TL 5EBLB 4C8XA 4K8RD 2H2SD 2Z7YA 1H8NA 4KXAA 3G5WA 3II1A 3UBFA 1TCMA 1MCKA 1TVBB 3D6GA 5JPMA 5CD5D 3I6LE 1WP6A 1NBVL 1PDKB 1OF2B 4LSSL 5D5MF 5I73B 3HRPA 4EUPG 4X9YA 1A0QH 4BFGA 5DUML 1LP9A 4BZ1A 1YUHA 3AU1A 1RXLA 2ZWSA 3EFFA 4HETA 1TTRA 5AYUH 4OGYH 3HR6A 4JFHE 1GGCL 2WNWA 3BDYL 1ODUA 2C1PB 3RKPA 4JFYB 1RVFL 3KPQB 1QBBA 2Q86A 5BS0A 3ZR5A 4C4UA 3KPNA 1U8LB 2WZ5A 3BXNA 4NUPA 2X89A 2CO6A 3BLPX 3IETA 4QT5B 5JIKA 3RL1A 2C3HA 2X4QA 5TDOB 1DFXA 3C08L 3K72B 3P40A 3V8CA 4LARH 3VRIB 2PYED 1BVLA 2EILB 4FFZH 3SPJA 4PJHA 1CCZA 2GTQA 1NUFA 1GKEA 2W81C 5I1KL 4JFEB 2GJ6E 2CJUH 3ZDXB 3M1BB 4PJIB 1OCRB 1DQLH 2QADC 2NW2A 2D7MA 4Y9FA 2EDYA 3HLAA 4XN1A 4PREA 5E94A 5SWSE 2H7WA 1AS7A 2CPUA 2JQMA 3P2DA 4P9MH 4N20A 4PI2A 2C7UA 3PQYB 1I1AA 3FSZA 1HH6A 5JHDD 1FSKC 4XP6H 1T2JA 4MAYA 3FH7A 5J6GA 4NGHL 2WCGA 4XVTH 1NQBA 3N41B 4KRNA 2C9AA 3UTQB 5BOPA 4RX4D 1UUSA 3L08A 2A4CA 2I26N 3QUKA 1TQCC 4PJEF 2CJSA 3NK4A 3QUYC 4EN3C 2XWCA 1DQML 4Y1SA 1F4WH 3O3UN 4YHYB 2VXQL 3MLRH 3P73B 4MD0B 2E4TA 3P9LB 2C34A 5CZRA 1CB4A 2EDMA 3P77B 3VI3E 4YK4C 1XF2B 1RCYA 2CUIA 2IBZY 1I3VA 2WQRA 5DMIL 4GRLC 1SPDA 2F5AH 4YUEL 2ALWA 5D55A 2NTFB 4L4VB 3N50A 1MHEA 2P5PA 2OMXA 3IS0X 2YR3A 2P5WB 4XN7A 1V54B 4M8VA 5DJXA 3WKMH 2ZPKH 3ZKMC 4N5ED 3S7GA 1EXHA 4PY8I 4LSVH 1YZZA 1K4DA 3DRTB 3MRRB 1YEDB 1NSNL 4YSCA 4HUXA 4QPEA 2H1LM 3HZKA 5HI3C 1YJDL 1CGWA 4LT7A 2J88H 1RK0B 1AG6A 2GI7A 2GY7B 4WKZA 6FABH 5J0BA 3NBNA 2I7OA 2IANB 4NQDA 1BV8A 5HDWA 2YZ1A 3BAJA 4XBGB 3QNFA 2AJXH 3DA0A 5D70H 3BDBA 4Q4EA 2P5EE 1FNLA 2QVTA 3D0LB 3WHE1 2YAOA 1T1ZB 3EOTH 5IEKA 1BD2E 1XH0A 1WLHA 2A0LC 5B38B 4NSKB 2AK4A 5LXGH 4ZMVA 5JHMA 2BFVH 3EH1A 1JF1B 4H26A 5EH1A 3A67L 3WFDH 4Q2ZA 1OANA 2B4CH 4MCZA 3MBWA 3MX0B 3WIAA 4WWKA 4YSQA 4S1RH 3I3BA 2J21A 3ZYOA 4BELD 3GBNH 2BS8A 3MRNB 4M8QB 2B16A 4D8OA 3UAJA 3LEXA 3L3IB 1AZZC 3BP4A 3MLWL 2FNWA 3K91A 5FGCE 3QHZH 1F45A 5FOBB 4GIOA 3N85H 1I1FB 4PGDB 5B3JE 4LLVB 5ICYA 4UTAA 3CZSA 4E41E 2EIKB 1T6VN 3JWNC 2X1QA 4YQXL 4YMPA 1SYSA 5DHEA 2HAZA 1T5KA 3HMXL 3QRLA 5HDRA 3TN0A 4LLWB 3V5DB 1KT2B 1WAAA 1YDPB 1F2XK 1BSIA 4OZ4B 5IW1A 1L7IH 2IH9A 1A9BA 1CLZL 3OHMB 4K9JA 5G5DB 1Z5LB 4MJ6A 3NIGE 1OT2A 5GHWH 4JCMA 2FGWL 5C0DB 4ZMAT 2IWEA 4S1DD 4XCCL 3VYPA 3MJGX 3FRPA 4DP1X 4H0HB 4QXWA 4I5BB 2MTAA 2QDWA 3QC5X 1ML0A 5DRZB 4X4XA 4TQIA 4Y2OB 4YHIA 2O5ZH 3DETC 5E2VH 4RMTA 2PWFA 4FQCH 3N9GL 1MLCA 1GZPA 1N3NB 4AQ8A 4NC2B 1TQBC 4MNGA 2QPFA 2EYRB 2JV6A 4G6FD 4AI7A 4OD3H 2NW3A 3MLUL 2JKTM 2H1XA 3LAFA 4Y2DD 1JOIA 3MV8B 4K07A 3A22A 4F3FA 4OZHF 5ANHA 4AEIL 1DEEB 5FUZH 1NIFA 1A9EB 1J0YA 2GK0B 4JHAH 4FQPA 4GUPA 4IJ3B 4LPTA 2V7NA 5CGYC 4PIRF 3BKJH 1BFSA 2VLKE 1KPUB 5F1NA 4PY7B 3KGTA 4A04A 1EDYA 1KLGB 3S5LA 2XZQL 5KSBB 1NINA 5KSAD 5L2KA 5KVFH 4CGUB 4X7FC 1U8QA 4XNYH 1F02I 4WEEA 5DJCA 4DVRH 4AYGA 2XXMB 1Q0XH 3MNZB 2I60L 3FO2A 4XPHL 1NKOA 4ZW8A 3U9PL 2E9GA 1N64H 5BO1L 1J8HB 5TE4H 2FBJL 1HDMB 1J11A 1GJWA 1AR1C 1QHQA 3WTXA 4OZIA 2BH0A 1UWEL 3BIKB 3C60A 3OAWA 1HEJC 4KTGA 2VW4A 3OWEA 4NQCD 4NERA 3WO3B 1GYUA 3KWWB 4NHUB 25C8L 5H94A 4NQSA 2VM4A 3LNDA 4N2AA 2BSDA 5CN3A 2ILLA 3DMMD 3S88H 3JTTB 3POHA 3QVAA 1UT1A 1MOEA 1JFQL 1YMME 3IJSA 1J9QA 1HOCA 2FEDC 1RUQH 3FC8A 5D7LD 2YRBA 4HIEA 1M05B 5HP5A 3WJJA 1Q9OA 3FBKA 4JHWL 4ZMLA 1QPXA 3EG9B 4OM0L 1FNSH 1KLUA 2F58L 4RBPH 3RWDB 1WFOA 4RMBA 3C2AH 5I6LA 3F64A 3LKSA 3HB3B 4Z23A 3DI3B 2QTEA 3NJXA 3K0WA 3GSOA 1KTCA 3MCLH 1GTNA 2Q9OA 5F89A 2MPAL 3T3PE 3RAJH 5M7QA 1ZPUA 4XC1H 3QIBC 4KJWC 1OQOA 3TBSA 2R4SL 1EV2E 3ZDYE 3H55A 1BYPA 4E9QA 2OK0L 4ZO9A 1FLRH 4V1DA 1UTDA 3QQ3B 4IGBC 4EI5B 3KYOB 1ASQA 4ZSOA 4QR7A 1ZIBA 4PFEA 4ALAH 3M8OH 3ATAA 2YAPA 3CXDL 2X4OB 4E5XA 1RSYA 2F9BT 2VLJA 5IOPA 1U8PA 4FLRA 4NDMA 1XH1A 3GHEH 5IJKA 1CIDA 3KPRE 4MA1C 1RKRA 4AGNA 3N42F 1AGFA 5BZDB 3KJ6L 3IFNL 4U6XB 2DLFH 4HWZA 4X7CC 5DU7A 3SE6A 2VISB 2XV6B 2V33A 2FNBA 2W0LA 3UTSA 4AY0A 3W0WD 3JV6B 4RFEB 4ENED 2E7CA 2P1YA 3QJSB 2Y5TA 4IBZA 2KI6A 2XXFA 4ANUA 3GMQB 1TUPA 2E7LC 2GK2A 3CUPA 5AUMB 3VSVA 4KMTL 4PJCF 3US0A 3TNMB 4HHAB 5IK3B 4D8PA 3SBRA 1E0OB 4E9SA 3BP7A 5FA3B 3V4PA 2J73A 2CHWA 4P07A 1JTOA 4FQXA 3A3YB 4JPSA 1XB8A 1EH9A 3Q5OA 5D7IE 4ZW5A 1LWJA 2BOCB 1XAKA 1VIWA 3OKKA 3SKNB 1R0AL 2APBA 5E1AB 2WYZA 5J3HC 4A7GF 3MYJB 2VUKA 3ULVE 3LZFH 1INQB 1D7DA 5AEAA 3WLWC 4HJUA 4LLDB 4FA6A 1PIGA 1FV1B 4OKVB 1M1SA 1C5DB 1FVCB 4WW1A 5LBSH 3OGCB 5EZIH 3GB7B 4M6NL 4QRQA 4BH8A 5B8CC 2FD6H 3X1NA 2VDLB 1KJ2H 3NAAL 3VCLB 4M6MH 3CSFA 4IW4C 3WL9B 5DJ6A 3EYQC 3KYNA 4DF9A 1F3DH 2JIXB 2F8VA 3IT8D 2ENYA 2AS5M 4Y8DC 1F3DJ 3FZUD 4L3CB 2CU9A 3ZY7A 2J56A 4WI0B 4QYOB 1ZLWK 4RRPG 1I7UA 2HLEB 2VR8A 3THML 3HC3L 1NCGA 2Q3AA 2VDOB 4MTMA 2BVQA 1R46A 2BVUA 1EANA 3VB8A 5CBEA 3IDGA 1P2CA 2Y4SA 3J8F7 4S10A 2ZOOA 3DURA 1CICD 3U36A 2K3HA 5CR8A 4Y89A 2NRDA 3LS4L 5F96L 2GIYA 1T80A 2E47A 4DNLA 2EAEA 4KFZC 5I6PA 4B27A 2CALA 5C0BD 5DFTA 2EIJB 3BVVA 1KXVA 3OJMB 1D6EA 2IXQA 4M48H 5J1TC 4WO0A 3FMGL 4OI8A 2G9HB 3C9NA 1JGEA 4G7VL 4OB5H 4DCQB 3CFCH 3RVVC 5CS7A 3S37H 4Y5XB 3VXQA 1YEKL 2OZ4H 2A9NH 4DEPB 4IKNA 1SHMA 4HJIA 2GITB 4C83A 4OV6F 3TEUA 3CVCA 5INCA 4MJIE 2O5XH 3HI5H 2DQGH 2BSEA 2VQ4A 3QG6A 1JK9B 4PTTA 4R84A 3ORJA 3HC4L 2J55A 1VCBC 3QO1A 3V9FA 4DO6A 2HKHL 3OM3B 1KXTB 3ZDZB 4DERA 4I3GA 4B5ZA 2Q1EA 4HUWB 5JYMA 3PHQB 4YSDA 2CIIA 3QCTL 4HS6A 4P2CG 1UD6A 3QDME 4H8WL 4XHJD 2A77H 1UXLA 4I89A 2Y3NA 4S1SH 3KCPA 3RHWF 2IWGA 3QNZA 2Y6SC 3KLQA 1IEAA 1NA8A 1XAUA 4QTIH 4QRPA 4DH2A 1L7TL 3M7OA 4YLQT 2FH8A 5DD3H 2CDFB 4EPSA 4F8LA 2WXNA 3DXAD 1MWAH 3IJYA 4R4ND 1GHFH 1XGUB 3L3GA 1JV5B 4KTDH 5C07D 3CMOH 3KAAA 1PZBA 4Z7QE 3L5JA 4JFQA 1WHPA 3QR2A 5D1XA 1RUKH 3BD3A 2CBMA 2JF1A 1G6RH 1NM4A 4LHUG 4N90E 4DSYA 2D03L 4MMZA 4UAOC 5KJ4A 1MG2C 2ESVD 4EI5C 3OHXC 4ZFGH 4NC1E 1AZUA 3RBSA 4JDEB 1WT5A 3FT3B 1J18A 1TXKA 2VR6A 2AEQL 2AAAA 5AZEL 1PAMA 2Q3ZA 3VXMA 5CCGE 4ODSL 1U3YA 2XV3A 2YEZB 1MRFH 1FZOA 1RV6X 2EC9T 4DQAA 1YEEL 5JORA 3T04D 3MBXL 1GOGA 4AC4A 1LK2B 2P7TB 4GRMB 2J8OA 1ORQA 1RZFH 3UP1A 3UIZA 1PLAA 5JR1H 5T1KA 2IDSA 3INUL 2YPVH 3WAKA 1INDH 3DROB 1AIZA 3N44F 1VGKB 3VXRA 4DKTA 2R4RH 2YQBA 1MZYA 1AE6L 3OPZH 4G8GD 4DTGH 5B7MA 1NPJA 4ONFL 3X1GA 2HN7B 1QLFA 4KNTA 5HSFA 3TCLA 3WIIL 4NUGL 5A2IH 1G7JA 4HJGA 1P4IH 2I25N 5F9DC 1VKXA 4BZ2A 1DE4A 1Q8MA 4KC3B 5GGRY 2X9XA 3EXLA 2OMTB 3OKEA 4MMYA 4NUJB 2MWCA 1OSPL 2EXYD 4PRIE 5PCYA 4HUNB 2NUPA 4KXZI 1CXLA 2ZUQB 5H37A 2V17H 3DPBA 2UZYA 5IEHB 3EGSB 3OGOE 1MVYA 5AVVB 2DKSA 2CCWA 4HEPA 1KZQA 2ATKB 5HHOB 4ABQA 3MBEA 4H4NA 2WBJD 1HAWA 1LNUB 2XWRA 2OSYA 4M5YL 2EDRA 4EDXB 5E1HB 1RZKC 3RFZC 3QXAA 5E9NA 2BW5A 1KCSL 2WUBL 4HDIA 1LO4L 3W2DH 4D3CH 3MJ7A 4FEIA 3SDXB 2IDFA 3UOAB 5J8OA 5E7BA 2AKRB 4ANXA 1CU4H 2X1OA 2F53D 3EOBB 3NA9H 3QH3A 4UV7H 2CMRL 4WK2B 1J5DA 4YPGA 2DKUA 1QI4A 1FZKB 4KI5C 3UADA 3R8QA 1C08B 1CLYH 3T0EB 3DV4B 4PRAA 4I18B 4TKWA 4OIIL 1EGJL 4WNQB 4OQTA 3WO4B 3FSVA 4FQ2L 2YOCA 1ZHNB 3ARWA 1F13A 3S5YA 1GCFA 1Y6MR 2YAMA 3ARED 2ZXQA 2YD4A 2IPUK 1JWSB 4ODXB 3CPUA 4DGYL 5EZLB 4XN5A 1R33A 1BZ7A 2D3JA 5B21A 5I0WA 4JVWA 3AT0A 3MV9E 3U4BH 3NFPB 1WA0X 4XAWL 4WF7A 1R17A 3HZVB 3VE0B 2R0WH 3SPIA 5CJXA 3VDBA 5SWQA 1D5BA 2K6ZA 5FKPB 3LYRA 3P1VA 4LSPL 5EZPA 3G5ZB 5KZCD 4X98A 4LVHC 5CMAB 1A4BA 2HA1A 3TOPA 3DV6A 2AEWA 1AHWC 5EO0B 5IFAH 1WAEA 2PP7A 4F8TA 2X0UA 4CUCA 3HZYB 8CGTA 1KBWA 2L04A 1G9HA 3ZE0B 3N2JA 1ZLVH 2OPCA 3HLKA 2JKXA 2EEDA 2MQCA 2Y1ZA 3NZHH 5C6TH 5KSUB 5DEJA 2YOAA 4RX4A 3GLDA 2FRGP 1E4HA 4NIYE 4NYLB 3TESA 1NBVH 1YEHL 1FZMA 2N3JA 4LSSH 1B9KA 3DLQR 3EHBC 4XXWA 4DAGL 3HE7A 4ZPVA 1YN7A 2J1WA 4LL4A 5HDBE 5C0EA 3W9DB 5DUMH 1ZA6A 3WTWA 5JW3L 1XF1A 5CIPB 4XXDA 4PJHF 4D9QD 1XT5A 3QWRD 5EDXA 2BY2A 3BT0A 3NRQA 4LPUA 2BLFA 4TTDC 5FDWA 4ZG1A 5JMOC 5IM7A 1GGCH 1P5UB 3BDYH 3FFDA 1AY1L 2VRQA 4APQD 4Z7WA 1IBGL 4LNRB 3SGEI 4YDKL 3U6RA 5HPMA 3QIUB 2XFXB 1U92B 2GSIA 2WVUA 3CN3A 3MDJA 4M3JA 3VMOA 1G7PB 3C08H 1S7VB 4FTDA 3EFOA 4YDJA 3CVHB 4PGEB 5KAQF 1U36A 4HSAC 3CPLA 4K4KA 2AFNA 1TSHA 3MC0A 4OZGB 2K6WA 1A65A 5CLWA 5I1KH 1ETZA 1QRKA 3MZTA 5IW3A 1XH3A 2EDHA 1UJ3B 4PYHA 1ORSA 5EA0L 5L0QB 3MCYA 2HUHA 4BA8A 3ETSA 3Q2NA 5EBMB 1YMHB 2IAMA 3VACA 3FOMA 3PJNA 3OJ2C 2AANA 4PD4J 2PO6B 4K3EL 3JV5A 5KVEE 4ZX6A 3KVPA 2MQ3A 1KY7A 2BNQB 4NGHH 1OAQL 2X7LB 1M7IA 3B9EA 3HS0C 2D31A 3B2UD 5AB1A 3SY0A 2AXHA 3U1QA 2FIRT 4LP8A 3IKCB 3QEQD 1SJEB 5L4MA 1WH0A 1DQMH 5I5RA 3GSWB 3GSVA 5D71L 1JZIA 3GIVA 2Z31C 2CQVA 4AX3A 1R3KA 4V2BA 5D2LA 5GGTL 3VXUB 5DMIH 4ANKA 4FA8A 4YUEH 5KBLA 1W0WA 3IMVA 3EJYD 4HWEL 1KEGH 4HIIA 2KMWA 4KHXL 1KXHA 2BOBA 3CHSA 4JFDD 4RA0C 1SFDA 1NEZG 5IHBA 1ZANL 3FONA 1NSNH 5IF0B 1II4E 1X9QA 2UY7A 5IKCB 3FU7B 4B3EA 1YJDH 3H3BC 3VGAC 3E0GA 2JJSC 3Q48A 4DKDC 1V3MA 1KTLA 4FNPA 2WO3B 5FM8A 2BNUA 5DVOA 4Z0BL 4DFIA 1D9KA 4N0YL 1PLBA 5IVXE 4FN0A 2VM3A 5FGRA 2IG2L 1RK1A 3LXCA 4XZ4A 2PW2A 2ZWKA 3VQMA 4F33A 1E5CA 3O41B 1A7QL 1IIKA 4KJYA 4I2XE 4MCNA 4Y2DA 3ZUCA 3JBG7 1T66C 3A67H 3EGXB 2Q8AL 4P3CL 1AHMA 1PZSA 3GK8L 1K3ZA 1QW8A 3BCFA 3MRGB 4FXTA 2HTKC 3OSKA 4RMQA 3BP5B 4I18C 3MLWH 1KXQE 2EE2A 3GRWL 1MJJA 4K3JL 2OLDA 4NKMA 4EDWL 3VD0A 4F57H 4X8JB 4WFED 3SKOB 3VFNB 3BW9A 2Y7NA 4DUVA 4YQXH 3TTSA 1RUML 3EH4B 2NY6C 3HMXH 3L13A 4E0RA 1IB5A 1KUMA 2VLMD 2WXPA 1MRDL 1TZIA 3HHSA 4RQQA 2JJTA 3EZ8A 3MRKA 4Q7DA 5CBAA 15C8L 1CLZH 1EVUA 3BIBX 1XDTT 3BWAB 5DJYA 4R5VA 2H6PB 3P0YL 3DMMA 5GGSB 2FGWH 3Q1SL 4JY6A 3H53A 4ZX5A 1U3NA 1WWBX 3Q7JA 4WFGE 2F7IA 3D08A 1FDLL 4IQHA 5EC2A 4JFEE 3OKNB 4OUUB 5TF1L 3ZDXE 4N87A 4PJIE 3IFLL 5GS1C 4NN6C 5K9QI 2VXUL 2YC1A 4N8VG 3E38A 1AQKL 4U7SA 5JO5A 4GLRH 3N9GH 5D72L 4YHLL 1KIRA 2AXWA 5E03A 2UVFA 3PQYE 1D5XB 1L0YA 1AH1A 2UUDK 1KJ2A 3ZHLA 2AP2A 3CFUA 5D6DA 1U0QA 3MLUH 5HHQA 2ZYSA 3GM0A 4X6EB 2CO2A 3D50A 3AG4B 3WENA 3NPSC 3VWKA 3BKML 4AEIH 1T1YB 1P5UC 3SGKC 3G6AA 2BRQA 3MGOB 1IJNA 1SHXA 4LVEA 5GXBB 4OZIF 5GGRA 1OTUC 4I1NB 3QIUC 5C70A 1VESA 4OF7A 3WFHB 5EEWA 1FAKT 5FB8A 2QR0B 5IROD 4R97C 4CNIA 4LGPB 4KRPB 4PLJC 4QNPF 3KWUA 5T1MB 2H3XC 1AQHA 5LDUA 1UOKA 4FE9A 1JRHL 4HEME 1RZGA 2I60H 4L4VE 4XPHH 2ADJB 5E5RB 3U9PH 1BIIB 5BO1H 2P5WE 3I6GB 4KDTC 2APVA 4MS8C 2CO4A 2FBJH 4M6OL 1E3FA 2X6BA 3IJHB 4QRAA 2BY0A 2ZKWA 1UWEH 1ZLUK 3GMMB 2X53A 2ZKMX 3AS2A 3ATDA 2X70A 25C8H 4Y4FC 1WO2A 2PO6C 4QMEA 4XGZA 3JTBA 1HHIA 3SSGA 2F7PA 3CFDB 2IANE 3FOLB 3NTCL 4XCNA 2C9PA 2CNZA 3WDJA 3W0WA 2NQ3A 4E42B 5TQ0L 3FCSB 4P46D 3CFKB 4ONGL 4U7MA 1QLEL 2ENJA 4PJDA 1DQQA 3QRGL 4JHWH 1IGYB 2X44D 5DD6B 3QHFL 4OM0H 2ODIA 5E8EB 2F58H 3M1CA 1ERNA 2BERA 3BI9X 2AI0L 3GMLA 3AGWA 3SGJA 2FX9H 1FFQA 2JSFA 3A4AA 2P46B 3LXUX 4TS6A 4L5FE 1ZVHA 2CLRA 1HHKB 3LEYL 4ZUVB 3UMNA 1OK8A 4A6YB 2WM0A 4FFTA 4CU6A 4YDZA 1G1YA 3ZE2B 1YYLL 2MPAH 3MMEB 2ZXDA 1HCVA 4IMLA 3ZTEA 2R4SH 1IQWL 2NY0D 3DGGA 3QUXB 3HZMA 2OK0H 1NC4D 1DJXA 3DJZA 5DK2A 4JGUA 5D1QC 1EEYB 5J57B 4ZNEE 3O3AB 2QLVB 5JZ7D 4UBDC 5I6XC 3B7YA 1MWAA 3B9AA 3MRMB 2Y2WA 3DX9B 1UXSA 4PJBA 1UH3A 2XJKA 1LM8V 2A4EA 2UV3A 5IBUG 3IGFA 5IFJB 3CXDH 4GKSA 5T33L 2VC2B 3EADA 4HSCX 5ID0B 4GXFA 4PCKA 5EWIL 4G7QB 3Q9PA 2A9CA 1XIWD 2V5SA 1QKZL 3KJ6H 5F88A 4Y5VB 2NY1C 3IFNH 1DZBA 1ZAGA 5J12B 4LAJH 3WKYA 1MCRA 1QRNB 4BDVB 2V4LA 1T7XA 3HZ3A 3QGVA 4OCWL 4YR6A 2G5BB 4S11A 2CH8A 1I31A 4J2QA 1TOXA 1UOWA 2WKOA 2FK9A 3QUZC 4KMTH 5JTWA 1QTPA 3KJ4C 3Q6FB 1KYAA 3HG1B 1R3LA 5FXCH 4U0RC 1OP3K 1FNEB 3CLFL 2EKSB 3CHOA 4HUKB 1BQKA 2VQUA 3K6OA 4DEWA 5EIIA 2VR7A 3VI4B 3Q8AA 1UQSA 3SD5A 3SJVD 5EZOL 3MV8E 3DX8B 3IGAB 4H0IA 1BLNB 3WCYA 4CVZB 5TQ2L 1R0AH 4A2DA 2XWZA 5F72S 3M45A 1DYZA 1IAKB 2AJVL 3F12A 4Y4KB 4UDTA 2C1OB 6PCYA 5BQ7B 2WTPA 4A68A 2C9XA 4NQEB 5KSBE 3LB6C 2X42A 3HHRB 3NACL 4JQVC 1FGNL 5ITFB 3NAAH 3GD1C 1WS8A 3HOGA 4H7VA 1J8HE 5I23A 4KFMA 1IGJA 1U3HB 2V2TB 2B7DT 4XVJL 3RGVD 1E2WA 1E9OB 5ACZB 3QUMA 2A6IA 4K9EC 4MMXC 3THMH 3IK2A 3HC3H 2YO3A 3TT3L 5AVSB 3UX9B 1DLFL 1WCBB 1YVLA 2YA1A 4DUXA 5K5YA 2ZSVA 4OIFA 5CINL 3ZOAA 2E7BA 3IMBA 4TQPA 1A5FL 4WAFA 2A6JB 3DXAA 5B7FA 2PW1B 3IXTA 2J2ZA 2YD9A 3Q6GH 1DL7L 4L4TD 5C07A 4Z8FL 1E4WL 5F96H 3LS4H 2YPLD 4HW6A 2APWA 3BPLB 1J88A 2Z8RA 4O02A 5T3ZL 4BFJA 4N8PA 3JTSB 3QHTC 4I0PB 2ESVA 3ASNB 4DESA 1X5HA 3BHBB 4KRPC 4OLYL 3GS0A 2F54D 5JQ6L 5CWSA 5GJTL 3FMGH 5D7HA 1KY6A 4P2QB 4TUJB 3P4NA 4G7VH 4LLUB 1ETJA 5KYXA 3MI6A 1OTSD 2PCYA 1B4JL 5CILL 4MB5A 5BRZA 1YEKH 3SZKC 3LPFA 2WP3T 2ZCKL 3TONA 4UNUA 2OA9A 5IHZB 2BW4A 4R90L 1CO1A 1PAZA 5AW9B 1JZ7A 5CJ5A 2GFBA 1JXKA 3QQNA 3WTVA 2UWEB 3HC4H 4Y5YB 5C3TA 2HKHH 4U1SA 3AXIA 3BGAA 5CSBA 4U6VL 1OLZA 5FV1L 5LWYL 3FQUB 3RTQD 4FKEA 2OR7A 2EDNA 2C3VA 2M1KA 3QCTH 3PG2A 1QZ1A 5JIMA 3OG6B 1J87A 1CXFA 3L4XA 4H8WH 3VFWB 2DJ4A 3KH4A 4UM8B 5MI0B 3RDTD 1IL1A 4HG4K 2CUMA 2WKGA 3A6BL 3NCJL 3HR5A 3MLSL 3RWIA 1DANU 1UD5A 1WC7A 1L7TH 1OZTG 1WISA 3LKQB 4UM9D 4BSVB 4L05A 4XPFL 1LWRA 1L9TA 2DJUA 1KACB 2O6DA 2FECI 2WO4A 4B7LA 4FTVA 5AWNL 3U0PA 5AVQB 3MNWB 5E99L 2E9BA 1NCBL 1OGPA 3ESNA 1FI8C 4L8DB 3GFUA 1YEWA 3DUUA 3UXFA 4BEIA 2LQRA 1KGYE 2WBJA 3TBWA 1WS7A 2B2XL 1S78C 3F7YB 4JLRB 2D03H 1N6VA 3ZL1A 2WJ7A 4N0RA 2OX5B 1SVCP 5CU9A 2BHYA 2CCLA 1ZHBA 4WW2A 2FEEI 5GSVB 4AYID 2WXJA 1DUYA 4HA1A 2F08A 4JFFB 2QVKA 5F6IB 2AEQH 5I8EA 5AZEH 5G4MA 5C0NC 4AOFA 3H4FA 2J72A 1YEEH 2ZKYA 3MBXH 1W0YT 5CJQL 3ECBB 3VG0L 2YAQA 4K23L 4W81A 1LTXA 1O9WA 4M6AA 2F53A 4B9GA 2FR4A 4D0BB 4Y5VC 1RJLA 2NNXA 5A2JH 1AQDA 3INUH 3BUQA 1ED3A 1ZVSA 1NAMA 5J13B 3B8YA 3H2QA 5DA4A 1AE6H 3GEFA 1A21A 1S8DA 3APMA 4Q58C 4ONFH 4GXUM 3F00A 4F9LA 3JV4A 5IESL 5E5UB 1SZNA 4NUGH 2XIBA 3RU8L 3WIIH 2PR4L 4G82A 2YEVB 1JSYA 4JRFA 2WWKO 2ZSWB 5E6YA 1D7FA 3ISWA 4HUCA 2YPKA 1OSPH 3TA3B 3T0AA 4JFZL 5T1LB 2IADB 1P84K 3AAZA 1Z6JT 1RHHA 3IDXL 2DIAA 4R6UA 5D7EA 3BN9D 2Z0BA 3ARDD 4D0CB 3QQDA 5BV7L 2ITDA 3N6YA 5AB2A 2H1PL 1XGZA 2IGFL 2ROXA 2R51A 2A74C 2YJLA 1HSAA 1DJWA 1VPOL 5FYLE 1HK6A 2R29L 4N0FA 1EAJA 4M5YH 2XVKA 4WDIA 4RGOL 4X4YB 4G43B 2KT6A 3TYFA 5EO9A 4XPAL 4N2NA 1RHFA 2XOTA 3KPMB 3U46B 1U3HC 2WUBH 1KCSH 3H9HB 3VFTB 1LO4H 1QVOB 1S9YB 2XX0A 3KDMB 3LRHA 4W9GC 3P4MA 1NANI 1E27A 1VACA 4Y9CA 1ZHLB 5FK9B 3T77B 3W1ZA 3KPOB 3BUDA 4CSSA 5TDPA 5LGJB 5CEYB 5JA8B 5ICXA 3ULUC 4XBPA 3ZHKA 2QMKA 3ECUA 1AAJA 4PU2A 3NFNB 3ZDZE 4GG8B 4FXGC 4XXCA 1BF5A 3OZ9L 3QWRA 1KF9B 4HU8A 2CMRH 4APQA 4PW3A 5A6MA 1RZKL 4IRSC 1OIOA 3WUWA 2VQTA 1LP9B 4QHKJ 2HJFB 1EGJH 2XN9D 3EFFB 4OIIH 5LAXB 4FQ2H 4UT7L 4BQ6A 4I0PC 5SWSA 4UWQB 2DLEA 4M29A 3RY6A 5MHSE 5CKGA 3RJOA 4DGYH 4WTZA 2Q86B 5BS0B 4LCYA 3N5AA 2B1HL 2NZ9C 5DEGA 4XAWH 3H7LA 3RL1B 1THCA 2K70A 5HYJB 2WLNA 5FAAA 1BVLB 5GGUB 1WBYA 4GUQA 2QADD 5MENB 3OB8A 4PJHB 3FJTA 1G7MB 4W9LC 2ZNXA 3U4KA 4FHJA 5JIHA 2OTPA 4U3XA 2FQFA 1BJMA 2CBQA 3HLAB 2ZTBA 1N18A 4O5LL 4PREB 4A1RA 2X28A 3FTGA 1XCTB 3VI3A 5C6WH 4Q9RL 2VZUA 3ALWA 3X12B 5A43C 4KPHL 4RMWA 4Z7WF 2BOLA 1I1AB 1OQXA 1HH6B 1MXDA 4MAYB 1EHLL 2A5UA 1ACYL 1T89C 3QEQA 5J6GB 1YEHH 2OL3L 3S0PA 4HHWA 1CIUA 1BVKB 4HS3B 4DAGH 4BFIA 1EX0A 1LGVA 1NEZB 4XRCA 5I8CB 3C6SA 3QUYD 4EN3D 2IO5A 1ASPA 3CLEL 4Y2NA 2ISDA 5JW3H 5HHPA 3TBYA 4AVIA 1UXWA 5B4MC 4YLBA 3AQDA 4HLJA 1AY1H 4GRLD 3WEOA 4UNIA 3LN4A 1A7RL 1IBGH 2LU3A 3FRUA 1B3IA 4YDKH 5F7YC 1AD9B 2EH8L 4OV5A 1USQA 2O6PA 1A8ZA 5DJXB 1OAXL 1A3ZA 1BM3L 5HDLA 3VFMA 5HI3D 1E6JL 1RP8A 1YNLL 5F6IC 4U31A 5CP7A 1E9PA 5AVWB 4LOUC 2Y2YA 1BQHA 4UOW0 1RIUL 3BIAX 5HHOE 5EA0H 3AQYA 2D9CA 2XDHA 1R3JA 5ISZD 4NQDB 4FS0A 3CFJA 4ODWB 3SDDB 4NZ8A 4YZFF 4F80A 1GL4B 1MCHA 3DO7B 2A0LD 1JTPA 3PWPD 4K3EH 4KH2A 4EIBA 3UH8A 2DWSA 2ALAA 1PZ5A 2I9TA 2G2NA 1IC0A 2H2PC 2NXZB 3C5ZA 4N6QA 5J13C 1QUNB 4ICXA 1E50A 1OAQH 2VOTA 5IEKB 2KKQA 3UC2A 1IVLA 5HDQH 1K2DA 2XVLA 5F8QC 5FDYA 3RPIA 5JOPD 3PWVB 3O0RL 4JO4L 5A6IA 2AK4B 2BWDA 1JN6A 2HJLA 3SDXE 4H26B 1KYOK 3CHRA 3MBWB 4X5XA 1V7NL 3BCDA 2Z8VC 3R4DA 4IOIA 5D71H 4L8SC 1ND0A 5A3IC 3K74B 4MJ5B 1SM3L 5LVEA 1QW9A 5EOCL 3LEXB 5IZ7A 3BP4B 5BZXA 5GGTH 1SDYA 4DO4A 5B1JC 2OMVA 4JJOA 1ZA3A 4DJMA 1JF5A 4XPTL 1XFPA 5ILTH 3T0EE 4HWEH 5E6SB 4CN4A 3LKRB 2XHNA 4BXVA 1IM3B 4KHXH 1MFVA 4F1SA 3OJVC 5B39A 2X4PA 4M4PA 4N8VB 5AB9A 3WAJA 1SYSB 4H8QA 1ZANH 3VFVA 3TN0B 1BMWA 3QORC 4OJDH 3QZBA 1NGYA 1BAWA 1JVLA 2NYKA 5I75B 2AJZA 2BFGA 1WTGT 3BSZL 1R19A 5D7KE 4Z0BH 3WNIA 2WQUA 4MJ6B 4N0YH 5F7DA 4ATWA 2C3WA 4HIPA 4H44C 5AOMA 1JGVH 1U2YA 4PSPA 4D7PA 3DETD 3QW9A 3LNGA 1A7QH 3FRPB 5HYSA 2DL2A 1RZIA 3EJPA 3NJLA 2VLKA 5D93B 4X4XB 4YHIB 3EUDA 2X4SA 4RMSA 2OI9C 4JFPA 4X8XA 3OAZH 2Q8AH 3ZE0E 1WWCA 3VD2A 1MLCB 1WUZA 5LO7A 4P3CH 3GK8H 3KBHE 1V5JA 3K6NA 4MNGB 2HX8A 1G84A 1LE5A 4LEBA 4M9PA 4NAMA 4HZLA 3VRJA 3GRWH 4BCZA 4F3FB 2FWLB 4K3JH 5CGYD 1MLBB 2JELL 4DN4L 3A23A 4EDWH 1WK0A 4FHKA 1QEXA 2R1WA 3IAQA 4WWPA 1LDPL 2DQJL 1RUMH 2K4WA 3W11C 3N0PB 5HGDB 3FUJA 4E9RA 1YMMA 4P4RA 5F1NB 3FK3A 2CRMA 1MRDH 5ADPL 5ICZA 5IBLC 5CFHA 5L2KB 3DYMA 4RGND 1OY3B 2J1KA 5KVGL 1MFAL 2FJFA 15C8H 1AR1D 3H1ZA 5DJCB 4F7KA 3D0AA 3U48A 4HSQA 1I53A 4URTB 3BVWA 4JMNA 3S9DB 3P0YH 1PD6A 4LDLB 5I76B 1OD7A 3Q1SH 4OZGE 4OZIB 4JG9A 2QMJA 4AL8L 4ZFFA 2OR8A 5TF1H 2H45A 4MS6A 3MYZA 3IFLH 4JDTL 4Z7NB 5H94B 2FEDD 2VXUH 1AQKH 4I8DA 5EUOA 1G7LB 5D72H 1GW6A 4YHLH 1SJHA 5AALA 1I8KA 1NPUA 3SBWA 3VQLA 4DP0X 3QNXB 4UIMA 3CFNA 5FCSH 4NM8L 4HZAA 2DQHL 4WSGA 1WZ1L 2BNQE 4N1CA 1NICA 3TO2B 3NRPA 4IIQC 1EXUA 3HN5A 3BKMH 5SV3A 1ANUA 1Z9LA 4TNFA 4NLHA 3LKSB 3QI9D 5I1IL 3ERXA 1TO5A 1NC4A 4HXAL 1E3XA 3QIBD 2EUWA 4KJWD 8FABA 2D7NA 2PWGA 1B0IA 2YK1L 4Z78B 4XOEA 3AQZA 4M5ZL 5F89B 2OAAA 4B9FA 3IPBA 5CSZA 1A6ZB 4PN6A 3WNJA 5L9DL 4ZXBB 3TBSB 3VXUE 1ONQA 4IGBD 3K5RA 3RUGB 1JRHH 3BAIA 3MA7B 4ISVB 1KB5A 2Y7LA 5LAPA 4JKKA 2DI8A 1A14L 2DDQL 2P80A 1PCXA 4M6OH 3CH1A 4N2DA 4P99A 3RBGA 2EDJA 4BKLA 1I3RA 2YUXA 3HI6L 2ADIA 3CE1A 3SDDC 1CDJA 3H7BA 1H5BC 2WXKA 3QZWG 4XBMA 1F11A 2DTSA 3SBQA 3GXTA 3G7TA 4ZI8A 1ZK9A 4G9FB 3IN2A 3NTCH 4E5XB 5DMYA 4KKBC 4KRMB 5IOPB 1U8PB 3V0WL 3NZ8B 5TQ0H 4NCC1 4IOSD 1AXTL 2XV2A 4FQIL 1QLEH 3BWUC 4ONGH 1RU9L 4MDIA 5D7IA 4EO5A 1SMOA 2WNKA 2ZKHL 2MQGA 3QRGH 5ALCL 3QHFH 1RLWA 4HWZB 4OW6A 1X7SA 3FB5A 2IJ0C 3UTSB 2DQFA 3EZJB 2AI0H 2VL5B 3OKMA 1U9KA 5FO8A 1JYXA 4QOKD 3SJVA 3FTYA 2A9AA 3UFIA 3WU1A 2V5RA 5I6KA 5KEZA 3LEYH 4X6BA 4PJBF 4D8PB 1YYLH 3LIUA 3BP7B 2EDBA 4PCTA 2BP5M 2DYPD 1L9NA 1MCWM 1IQWH 2G0LA 1ES0A 3EDEA 3UEZA 5J3HD 4Z3FA 2HCZX 2YQGA 4PJ6A 4R2GB 1SDDA 3OKKB 4LPVA 3FU3A 2EEAA 4X6DA 4F20A 1NEPA 1X5KA 2Q76A 4IRJC 1JTTA 4M02A 2PWEA 4UT6L 4X6CA 4DK5A 4ZX3A 2BIOA 1DCLA 4G1MA 2BZCA 2JCCA 1XEUA 3I3DA 2P48B 1E4JA 1N6QL 1ADQA 2CSPA 1IKFH 4IRZL 2YUWA 2WKOF 3EYQD 4N2EA 5T33H 2BIPA 1SLVA 4QRQB 3F83A 2IALA 3ESMA 3SE3A 1W2KT 5EWIH 5T3ZD 3GJFK 5HI5C 4AITA 2XSKA 3MRFB 1MHHA 1RJZA 1ZGLP 3J7HA 3KYNB 4ZAKA 1QKZH 1N70A 4PWGA 3AACA 4G7YL 4N2OA 1SQMA 4HPYL 3MNDA 4UTCA 4L4TA 4POUB 4OCWH 1I7UB 3EBHA 1BXXA 2VQ1A 4WI3A 2YPLA 1GS8A 2K7PA 5JPNC 2BVQB 2FTAA 2ZKXA 1WA1X 2M26A 2NOYA 3F7VA 4QYAA 2ARWA 3HN8A 4MHHI 4RCAA 1GTFA 4POYA 1KCUL 1P2CB 1QSEB 2F19L 3CLFH 3LIZL 3HE6D 1TO4A 3U36B 4WEBL 1SOKA 4H2AA 4HKXA 3IDYC 2PPFA 3L5WA 5EZOH 4MJIA 2CA4A 5CSGA 4OFVA 1ESOA 1ECZA 1XSJA 5TQ2H 1WFJA 1J48A 2APSA 3C8KA 4L9LC 2TSBA 1D6EB 2AJVH 1F97A 4WO4C 1G1KA 2WXRA 5E8PA 1QFPA 3RVVD 3MCKB 3FO1B 4HISA 3U2IA 1TVHA 1JGEB 4GP5B 2AXGA 3H9SB 1U30A 2R39A 3D1MC 3U1SL 3NACH 1QAWA 5AVUB 1FGNH 4Y7MA 2YMXL 2E8YA 3T0WA 3OX8A 4ERSL 1JNJA 1B0GA 3Q3GA 4XVJH 5INCB 3V6ZA 2IH3A 4TQHA 4PTTB 2Q20A 3POCA 5E2JA 2ZUSA 3RDTA 1P9MA 3QO1B 2G5RA 3KBEA 3WFCL 1B90A 2BIQA 1AOHA 3DSFL 3TT3H 5BW7A 4UM9A 2Y25A 1DLFH 2CIIB 2NY4D 5CINH 2QGDA 3NCFB 1DQDL 1A5FH 1NPNA 3RNQB 3TZVB 1LQBC 1HC1A 1A3LL 3QNZB 2E9WA 1DL7H 4Z8FH 3GSQA 4BE5A 1E4WH 1IEAB 3RLSA 1BQLL 1TJHL 2A38A 4QRPB 5I74B 5L2JA 4ZNCD 1EMTL 4QHUA 4DIXA 4JPIB 1DQJA 5T3ZH 2KPNA 5DZAA 2PWDA 4P2OC 3IJYB 4KROB 3F5WB 1RUAL 1P6AB 1AGEA 1YAZA 4K9EL 4M5SA 4OLYH 5JQ6H 2K8QA 5GJTH 4ZXBC 1QR1B 4HBCL 4GSUA 4OLXL 4KX8A 3DKHA 3ZE2E 1MWOA 1Z0NA 4H20L 5TK4A 4PW4A 4YFEA 2ITFA 4JG1L 5FW8A 3CFTA 4U05A 1B4JH 2HRPL 5CILH 1ROCA 2RB8A 3IPFA 4C4KT 1GGTA 1EGJA 1GGBL 2OJZL 2ZCKH 4NB7A 4R90H 2FJGA 1HI6A 4HWNA 3BUYA 2DWDA 3QPKA 3VXMB 3T6VA 3GT6A 2W80C 5FO2A 5JORB 4U6VH 5LWYH 1GS6X 4XAKD 5DK0A 2BMKA 4PRIA 1ORQB 1SJMA 4FGMA 4LEOB 2AQQA 3F04A 3BWSA 1JFHA 2YSSA 2AMUA 1JUFA 2WOYA 4LOEA 1H9VA 1CBJA 1XR9A 4HCRL 3A6BH 3VXRB 3NCJH 3UZEC 3MLSH 4XE5B 3LQAL 3PNRB 2ZUUA 1ADWA 3L4YA 1SJXA 4WW2F 2H0JA 5LGKA 5GZNC 1LILA 1QRNE 2QKSA 4XPFH 5K33A 3GPSA 2K4AA 4QXVA 2EUVA 4HJGB 5H2BA 4W4OA 5AWNH 5I15L 3GMOB 1VKXB 5E99H 1A25A 3QEGL 3ARDA 3OKEB 4MMYB 3V5HA 3HG1E 1UACL 2ADFL 4AV4A 2SEBA 1YNTF 2B2XH 1B4RA 3NSJA 4R2GC 1S5HB 3VI4E 5DURD 3VTAA 5T1JA 3DPBB 5BPPA 4NJAL 1SMAA 3CX2A 1M1XA 5FM5M 3DK0A 5DLML 5KYYA 3L3OA 4ZDHA 3MKGA 1GCYA 1CC3A 1KELL 4HP5A 1G5GA 4GW5A 4M7LL 3V4VL 1FZJA 3WI9A 5C1MB 3AJ7A 3KNBB 2AJUL 4NAJA 3EYOA 5CJQH 4S0SD 3VG0H 4NQEE 3D39B 3QXAB 4K23H 4PJ5D 1PG7X 1W15A 2GAZB 3C2SA 4FHBD 5CP3H 3C8HA 4HBQA 1UEYA 3PRZA 4PJ7A 1MFDL 4ADIA 3FU8A 2BS71 3A0OA 2PLTA 3EKCA 3MJ7B 1QACA 2ZOKA 4JG5A 1BHGA 4OJCA 4BWTA 4JM2C 3SKOA 4YSUA 4U4BA 3MV9A 4KV5F 4KI5D 3ME0B 3TCXA 5IESH 1FHNA 3EOAA 1O7DE 1JPEA 2XN9A 2PR4H 3RU8H 1D3CA 2IGTA 4YPGB 4W70A 3ULUE 1DSYA 5AVYB 5SWZD 3K8MA 2KLRA 5A2LH 4A55A 4PRAB 3U7AA 4JFZH 3QK0A 3TVMC 2NR6C 4ZUUB 3IDXH 5EN2B 3B83A 1LK3L 2PYEB 3KE0A 3U2JA 1JPFB 3HC0A 3ARGC 3SB3A 1MY5A 3BUPA 5BV7H 4AT6B 1NJ9A 3VSQA 2H1PH 2IGFH 3D0VA 1QYGL 5G55A 2DH3A 1VPOH 1XSOA 2R29H 2G2PA 3SOBL 5BJTB 5CCJA 3VD7A 1E42A 4P2QE 3VFSA 1A02N 5SWQB 1P4BL 1OCZB 1S4IA 3D7PA 4RGOH 2HVKA 1O9ZA 2PTVA 4PGBA 1KDIA 4XPAH 3T0BA 2IMMA 3MTRA 1A9VA 3IRZA 1T3FA 5E4IA 1XD1A 1BVOA 5JHDB 5DZLA 2DM3A 3B5HA 3PXJA 3QDHA 5FFGA 1GAFL 4WV1C 3F65A 1F6AB 3I6KB 1I1YA 3WV0A 3MXVL 2UWEE 4R9HA 1G1CA 1CPUA 4GKNA 3UZVA 4BSWB 3TZVC 4GKZA 3EHBD 2BO0A 4QHMB 3OZ9H 1G9ML 2LT9A 3BVTA 3N1MC 1TZ8A 3D4YA 1FZMB 5ETUB 3QDJD 4GRLA 1JYVA 1URLA 3UTPE 4TTDD 1VCAA 4O2EA 1RZKH 4ZPVB 1YN7B 5C0EB 1ZA6B 2XLLA 1WQVT 4LOFA 3SQBB 4UT7H 4HMCA 4KROC 3MRLB 5F0PB 3O0LA 3GMNA 5IM7B 5L8JB 2VW6A 2UY6B 3FFDB 5EU4A 1MDTA 4APXB 4CJ0A 4Z7WB 1RP9A 1QEWA 5IMKB 4QTHB 3WSQL 5HPMB 1YY8A 2B1HH 2GSIB 3VI3F 1F6FB 1E9QA 2OCCB 4KZ0A 3SY6A 4W6WB 5J1AB 1BVZA 1DBAL 2NDGA 1JV2A 4HV8A 5CGMA 5IY5B 5EN3A 1IBFA 2AQNA 1DVTA 5AKTA 3REVA 5F9AC 1ETZB 1X4ZA 1Y6KR 2X2JA 3D8MA 3PAVA 1BDYA 3PWPA 4PV1C 5F0JB 4DWHA 5JQIB 4JFFE 1XH3B 2AK1L 4KDWA 4M56A 2GCYA 4MVBD 5A6LA 5IUCA 1WRFA 3C09B 1L9PA 1ORSB 5HVHB 1Z5HA 5JQHC 3L48A 3D2UD 4OZFA 2DWXA 4O5LH 4KI1A 4NQVA 4Q9RH 4KPHH 3VSTA 4W6YB 3E80A 4IU2A 4P3DA 3WIHA 1URIA 1UKSA 2Z91A 1HZHL 1EHLH 4OM1L 1ACYH 2YD6A 4JFXA 2OL3H 3IDIA 3U9WA 4KKNA 1M7IB 2OYMA 3C6LC 4U6YA 4R83A 4JHZA 3SY0B 4LSRL 2W92A 3F7LA 3QA3A 1NCIA 1BMZA 2A6KA 2ORBL 4PRBA 1FN4A 2OMUA 2Z31D 3HAEH 1FFPA 2J3SA 5IV2A 4YHMH 3TTYA 2GB2A 3T6XA 3GSVB 1R3IL 3GIVB 1A7RH 4FULA 5HYFA 1DR9A 4KTYA 5D2LB 2EH8H 1NOAA 2YD0A 1A6AB 1HX0A 4KBPA 1W0WB 3LVTA 5E5MB 5B3JF 1BZQK 1DN0A 2ITEA 3CV5A 1OAXH 4HIIB 1NOFA 5GS2H 1E6JH 1YNLH 2BOBB 4I2XA 5H4YA 4ANWA 3PFUA 1WEJL 5T5NF 1IGIL 5EBLA 1RIUH 3CDYA 4XNZB 5ESVA 4JGJA 2VERA 1TVBA 2VXSL 1YAIA 4TV3A 1KTLB 1PY0A 3SPVB 1LL1A 4G6KL 1KXQA 2D2OA 2RHEA 4N8CL 5BZWA 2GVYA 4XMLL 5KVDL 3JVGC 4JFTA 5CD5C 3TC9A 5F7EL 3IN0A 5HD8C 1RK1B 3S96A 4MGXA 1T66D 4F33B 2DRUA 2QGBA 3GUTB 2VDRL 5IOKA 2I69A 3O0RH 2XQYA 2ZOUA 4JO4H 4KJYB 1QATA 4G6FB 1CT8A 2JK5A 4Y2DB 4YSOA 2FO1A 2HTKD 3Q2CA 1V7NH 3QRFM 3W37A 1U8LA 4QT5A 5C0AD 1KCKA 3FPYA 4X99B 4G3YH 3S3BB 1SM3H 4F2FA 4ZO6A 5TDOA 3NABL 4R3SB 5EOQL 5JDSA 1GMIA 5EOCH 3VNYA 4ODUA 1EFXD 4XO9A 1INEL 5EOCJ 1EUUA 4NZDA 1DBJL 3NIFB 1QP1A 1FVEA 2NY6D 1AVAA 5KSAB 3OTTA 5EORL 1LP9E 1LXMA 1NCAL 4PJIA 3TPKA 3BW9B 2QSCL 3BVNA 3QZNA 5CO1A 4MNQD 4FADA 4X83A 3ZYJA 1S9KC 3L5XL 5BMFL 1WE5A 1TZIB 4U2ZA 1W72L 4RQQB 3FF7A 3MRKB 5BS0E 4LO9A 3BSZH 1KB9J 2EZ0C 4NQCB 3UG4A 3PYCA 5CBAB 3EXJA 5HYJE 3NDZE 5GIRB 1J05A 5DJYB 3VA2C 2GBTA 1GKOA 3DMMB 5C7ZA 1E4KC 3NOIA 5DRWB 5MENE 4PJHE 4PRPD 5GGVY 3DJSA 3GZKA 1ZLWH 1FLTX 5EC2B 3VD1A 3AY2A 4PV9A 3WY3A 5D7LB 5FW6A 1GYAA 5DHVH 1XSIA 1OGSA 4MX7B 3P73A 3TEXA 4MD0A 3P9LA 5K9QG 4AEFA 5JO5B 1HU8A 3QJXA 3WN5C 2D2CC 2NTFA 4HEMA 4L4VA 1KJ2B 4NAQA 4EUPH 1FPTL 1GPOL 1AZVA 4JQIL 5AW7B 2DYSB 1IJ9A 4KH9A 4NP4L 2WYHA 4HLEA 3DRTA 4MLSA 4H5SA 2UYLA 4DN4H 1YEDA 2JELH 1T4KA 4X9BA 4A63A 4L1DA 2FZ3A 2OMYB 3G6AB 1J7VR 1LDPH 3QZWB 2DQJH 4IGBA 1XTLA 4W6XB 2ICWJ 2QELA 1RK0A 4XZUB 1HS6A 4FKHA 3ZVVA 4A39A 1JZDC 2KERA 4FL4C 3U4EB 3S3DB 5FB8B 4XBGA 2LFGA 3ZE1F 2LVCA 5ADPH 2CNYA 5EUOF 4MS8D 1HL8A 1A7PL 5KVGH 1MFAH 3APCA 2BS9A 3D0LA 1T1ZA 1RZGB 3VD9A 3B3BA 5D1ZD 2H0EA 1Q1JL 3ESUF 4B9ZA 4BJLA 4H8PA 2WINA 2ZNWA 1JF1A 2PO6D 4Y4FD 3M88A 1AJ7L 3OZLA 2A73A 4R0LC 4AL8H 5AW1B 1BJ8A 3K2MC 2V7HB 3TEZA 2VN7A 2X70B 2DI7A 3MV01 4JDTH 1RIHL 2AW2A 3RX7A 1QSFD 4XGZB 1HHIB 4EEEA 4JBSA 1XGTB 4NQDE 5K1JA 2E7LA 1BZDA 4LU5L 4LIQL 4NUMA 3W0WB 3V6OC 4QO1A 3DHUA 3LPPA 4NM8H 4PJDB 1DQQB 2DQHH 1WZ1H 4ATTA 2HLAB 4ZNEA 1MZZA 2AQ1A 2B1AL 5C86A 2I5YL 1G7IA 2X6CA 3GMLB 2AK4E 1Q1PA 3V5DA 1OAUL 2YD1A 5I1IH 3ETBJ 3OVUB 4D9RD 1HJCA 1AIFA 2CLRB 5F97E 4D0DB 5ICUA 2YK1H 2DB8A 4JKPL 3MHZA 5G5DA 2NY7L 3EJJX 3U25A 3H9YA 4A7UA 2FYVA 1GW0A 5AKSA 5D1QD 4IMLB 2JKNA 3JYBA 1TDQA 5KS9A 3DGGB 4UBDD 1KCVL 1OARH 4PLOB 3HZMB 2MCG1 3I9GL 5CUSL 4K7FA 1A14H 2DDQH 1BBDL 5D7IF 3RHWK 4Y2OA 1PCSA 2OMZB 5AQ0A 2FUQA 5IREA 1MWAB 3C5SA 3HI6H 4P5TD 2Q87A 3ULVF 1E5AA 4WWNA 1UXSB 3GI9L 2JTYA 2XZAL 4PJBB 1WAAE 4ZFOA 2OM5A 4WLCA 1PW3A 3FFOA 2EYRA 5BUGA 1G6RB 3V0WH 1EUTA 2NY1D 2NSXA 1BJ1H 1AXTH 4FQIH 1BBJA 5D2NC 1RU9H 1W9XA 2KH2B 1A9EA 2RCSL 2P28B 1IBBA 2GK0A 2ZKHH 3MRDB 5ALCH 4PRHD 3O6FB 2CXGA 4BUGA 3MU3A 5I19L 1V10A 1CICB 3QUZD 1OW0C 4X6DF 5HYQB 2R7EB 3BZ4A 3MRHB 5F7LB 4ESKA 4X6CF 2Q3XA 2V9UA 4Z77A 5KSBA 4PI0A 4DZBA 2N7SA 4JPQA 3LKNB 2JCCF 1MI5D 4L3ED 5C0BB 3KHOA 4JZOA 1R3LB 4MNGE 1F42A 2P44B 1J8HA 5KSAC 5EIIB 1HDMA 1PLCA 2G3NA 2ED9A 3RRQA 5BVJB 4UYPA 2CRIA 4YBQC 3RVWC 1XBDA 5KSVB 5CN1A 1QO3A 3ABLB 2O4EA 4NHUA 4BHUA 1ZOXA 3R0MA 1ZV2A 2PCFB 4UT6H 4Z3GA 3F12B 4KWUA 4UDTB 3JTTA 1I4FB 3FTZA 2HX9A 3TWCL 4RGMC 1VZGA 4X0KB 1N6QH 2WYIA 4HOZA 4IRZH 1M05A 5L2KE 2XFGB 4ZT1A 2IV9A 3P0VL 3V6BR 3RYMA 1PNDA 5I26A 5TH2B 1XCQB 3AS1A 1GOFA 4X5LA 3UGEA 1D5MA 4JM0A 2F2HA 4OZIE 4Z18A 4K5PA 4HPYH 5I0VA 3CHPA 2YEQA 4AIOA 1KN4L 4Z7NE 5F9WB 4YDIL 3QYNA 2VZ3A 4L5FL 2E75C 1EHKB 3KEDA 2D7OA 2L0DA 2WQXA 3DXAB 1KCUH 2NY3C 2F19H 4FEMA 4LEEA 2O6EA 3IXTB 2J2ZB 4O51A 3LIZH 1TTFA 5C07B 3UMTA 5JDJA 4WEBH 3QQ3A 4M1DL 5F3BB 4HHGA 3BH4A 4EI5A 3KYOA 2ZYRA 3OHXA 3A24A 4KRPD 2BCKA 1A1MB 1NZRA 3OJDA 3PNWA 4QAWA 4IJTA 4E9TA 2ESVB 2N56A 1TTBA 2DBJA 5IQLA 5FYKE 3WFBL 4AK2A 4L2LA 4OCMC 4Z7QF 4PVBA 3KPTA 2WC7A 4JFUA 2DM2A 4UYQA 5DQ9B 3P4NB 5L88L 1DBML 3K71A 5KYXB 4C4BA 3STZA 1RZ7H 4O58L 3U1SH 2DWYA 4TSCL 1Y6NR 1NL0L 2YMXH 1FYHB 2XZZA 4U6XA 3RUGE 5G2NA 1HWWA 4S0HA 1WV7T 4Q89A 4E36A 4ERSH 3JV6A 4RFEA 3DTXA 2HPTA 2GFBB 2DN7A 2IDCA 3B8SA 4K15A 4KX9A 4LCUB 1AG0A 1VFUA 3ULAB 5AUMA 4U1SB 2NUTB 4ENEC 2FJSA 1BF2A 2WTRB 4HMEA 3TNMA 3WFCH 3L9EA 3ZTNL 2J6EA 4G8GB 3DSFH 3CIAA 4G9FE 1UURA 2IBGA 2H0PA 1JHTB 3NSDA 2JNZA 5ENWA 1DQDH 3N0AA 5I28A 1ZLDA 1KBVA 1BG1A 1IL1B 3RNKA 3EYVA 1A3LH 3GXMA 2WLKA 4OLUL 4FJ6A 3HR5B 1LHZA 4HWBA 3RWIB 3MRBB 4PJ8C 1TJHH 1WC7B 4GSQA 5I2IA 5AW5B 4GW1B 4QRTA 3UTSE 1B0WA 3MYJA 3QULA 4U49A 1EMTH 3K0YA 4M03A 1INQA 5D7JC 4GI9A 1RUAH 2RD0A 4L29A 3U0PB 2B14A 3E9UA 4OKVA 4K9EH 4MZIA 5IB2B 4Q97A 3GB7A 4CADA 1QBML 4HBCH 2X1XR 4JW3A 4OLXH 1IO4C 4RISL 4OLWL 3VCLA 2IIJA 4H20H 2WBJB 4AKOA 3TBWB 4JG1H 3RFZA 1T22A 2HRPH 4B0MM 5E9DD 3UERA 1GGBH 1UFUA 2OJZH 3PV7A 3LH8A 4H1LA 5C0ND 3WY2A 1TKWA 2KZ1B 4WI0A 3AW5A 1G4RA 12E8L 1DVQA 2R9HC 3GHBL 1JNHA 4M8UA 1QWNA 3NCMA 4FDWA 2CD0A 3QJZA 3UAAA 1CF8L 3QZMA 4DPCX 2JB5L 4NO0D 2YKKA 4YC2C 3UAFA 3FTUA 1CJYA 2DIJA 4KKQA 1MPAL 4CKQA 1QRND 2XZCL 1GZQA 2F53B 3CSTA 2DPKA 4N26A 2FR4B 5EBWA 3O6FC 1RJLB 3PL6C 5AG8A 1AQDB 5A40E 3NJGA 1ED3B 4WGVB 2O93L 4CMMA 1NAMB 4KO9A 1CICC 5E2TL 5SWZA 3LQAH 4X8GA 1BYOA 5C0GA 2OSWA 3X3GL 3SGDI 5EEYA 5K9KA 3SCMD 1MCOL 1XGQA 5I15H 2Y1AA 4R96B 3AY4C 3AREB 3UL4A 3OR7B 3QEGH 5LDSA 2YJQA 2OL3A 4UQBA 1VFMA 1ZE3H 4Y5XA 3BH9A 2YPKB 1QSEE 1UACH 1UH2A 2ADFH 3GS7A 2DM4A 2Z64C 1TJIL 2ZAHA 3CDZB 3L1OL 3O2DL 4KQ4L 4AGOA 2NMSA 1PX8A 5HTSA 4GQ9L 1J9TA 4NJAH 4URKA 4QHKI 2QQKL 4TLSA 2K6YA 2GHWB 4JN2B 4LPYA 3HAEA 3S37X 2A83A 5DLMH 2X1WL 3W81A 1AHWA 3WN6A 3NFSL 2A6DA 3QQDB 2ITDB 1W0VA 3X13B 1KXTA 2XWXA 5KZCB 3M17B 4P8QA 2DI9A 1HSAB 3PHQA 4M7LH 3V4VH 1NM9A 4RWYL 2AJUH 4N0FB 2W0KA 2WXOA 2Y7SA 3B4NA 3P2TA 3B9KC 2N0KA 4WGKA 4ZMXA 1OVZA 3TYFB 2UXGA 5EO9B 4NKDB 3H9SE 1AGDB 3FUKA 5IJVB 3O2WL 4GEJA 3VXTB 1MFDH 2LR4A 2B59B 4LHUD 1E27B 1S7SB 1VACB 2CDFA 4PMEA 5IMOB 2H47C 3QDJA 3DGDA 1H6FA 4AQ1C 5GRYA 1JV5A 2EDXA 5ICXB 4QRSA 4XBPB 4KTEL 1UZ8A 4FCHA 5HHNA 1QFUL 2E7DA 4GAYB 4RESB 3BT2L 1K9TA 5HVWA 4IRSD 4L37B 1H3TA 1L9SA 1NDTA 3MGAA 4APQB 5E1IA 2V8LA 5AL8A 1KCBA 5ANMB 3MROA 5HDBF 1ET5A 3R0NA 3QAZB 3QJUB 4JDEA 3FT3A 1QFWM 1J1XL 4NIKB 1Q0YL 5GGSY 4QRPE 4RMVA 5A2AA 2VUOA 1JZ2A 5K39B 2NZ9D 1LK3H 5GS0L 5E95B 5IR1B 5I16A 4LK4A 4P4KC 1TLKA 4L3AA 2W95A 5FM4A 4HJSA 1GJUA 1QYGH 2NX5B 2P7TA 2Q0ZX 1AYRA 4LCYB 5DEGB 3FUHA 1BZOA 3PUCA 3V79C 3SOBH 1HE7A 4MQTB 1P4BH 2H3NB 5C0CD 3D2UA 1HKFA 2IF7A 1XXFC 4V11A 2AEIT 2FBRA 1WBYB 2Y69B 3DX3A 5FYJE 2VDLL 1MCQA 3HS0A 2Q7YA 3I02B 1P69B 1JHLL 1UWFA 2HN7A 1MW2A 4NO3A 3D48R 1YA5A 3IJ8A 2IWKA 4MKTA 1GAFH 5AOZA 4BK8A 3VXME 3PWUA 3FTGB 3MXVH 3ZKXC 2UUDH 3RG1C 4H13C 1EJ8A 1DP0A 2BP8A 3IS1X 3O81A 4J4PC 3BGFB 2VDOL 1G9MH 1P7QD 2Z31A 5IW6A 3QEQB 4R7LA 4AWJC 2O61A 2IVFC 4YFDB 3FB7A 5B4MD 2GBUA 4XRCB 1OT4A 4LRIA 1FA4A 3VXRE 3TBYB 4A7TA 1UXWB 1XX9C 5J11B 2PNDA 2QVIA 1USZA 1MEXL 3F7KA 2XACC 3G6JA 4DKAA 3H2WA 3MZGB 3DSNA 1NWOA 5IMLB 1CFNA 4JFDB 1JL8A 4G8EB 4U1JB 1THAA 2JJSA 2R15A 4H8VA 4EUPA 3QR1A 3WKQA 1U8IA 2WSPA 4P3WA 1R47A 1NAKL 4KVCL 3OZKA 1HE8A 1XGYL 2HRGA 4LOUD 3V8OA 3ZT7A 3GMRB 1ZLUH 2ICWA 1QG3A 1AZCA 2OS7A 2WXLA 4Q74A 4GQQA 4GSXA 1BQHB 1CXEA 1I9EA 2AK1H 3EOBA 4PBVC 2GJRA 2Z6FA 5ES4B 5EEZA 5ADOL 1T7WA 2MSPA 3BZFA 3FQRB 3LRGA 1BX2B 3ZSSA 4KZDL 5ACLA 1FZKA 5DUJA 2QSTA 3DIDA 4F93B 3C8DA 1C08A 4B9JA 4XE0A 1HZHH 4OM1H 4L2YA 1PZ5B 3D39E 4LVOB 3DV4A 3V2AR 3T0EA 2I9TB 4I18A 4WNQA 1RPQA 1YRKA 1ZHNA 4N86A 5DEZA 3RPIB 3K46A 4CC4A 4HC1L 4LSRH 4XX1G 3LKOA 3W39B 4IM8A 4M7ZB 2ORBH 4OIAA 5EZLA 1PD1A 3AREC 5BO0D 1C9SA 3NFPA 1XMEB 4IOIB 1JIBA 4UT9L 1ND0B 3HZVA 1R3IH 3NESA 4OGXL 2JI3A 3W38A 4MNQA 3TV3L 4GKLA 3G5ZA 3UTTD 4TNWK 4JE4B 5J4MA 1ZA3B 3BQUC 1LMIA 1U91B 4L1HA 5T1DL 3ATBA 3QORD 1Q9LA 5EO0A 5B39B 1F8TL 4EQ3A 3HZYA 3WMQA 1WEJH 2PYEE 1JPSL 1BLIA 1CL7L 1IGIH 5KSUA 5JIPA 1KDJA 4KKZA 5GS1A 2X6AA 4PRPA 2OULB 1HYSC 2AJZB 2XCMC 3B6SA 2VXSH 4WGWB 4I0KA 2G60L 2GG1A 4G6KH 1U8OA 2J8HA 1BMGA 4N8CH 4RVBA 2WGNB 4XMLH 5F7DB 5HBBA 5KVDH 3EJRA 3HNTL 1MCWW 4EI6B 2PYFA 4FKKA 1CD1A 1YJDC 2QVMA 3QXTA 5JHDE 2V2XA 1ETA1 2VDRH 5HYSB 5KYWA 1P5UA 4NWUL 3SGKA 3ZDXF 3ILPA 4MDJB 4PJIF 4YVUA 3W5NA 3AC0A 4JZJC 3BZEB 4QGYA 3RZCC 4PIBA 3QIUA 5AVRB 5CU5A 3GLZA 4G1EB 1J12A 2GBAA 2NY2C 4PG9B 1OP3H 3P9MB 4WUUD 3TV8A 1G7PA 3NABH 5EOQH 1A1NB 2OSXA 3CVHA 4PGCA 1Y07A 3WFEL 1INEH 4BH7B 5EDSA 3TGXA 4OZGA 3ROLA 1XEDA 3BX7C 2DMCA 1DBJH 4XNBA 2OJEB 2WZAA 3FB6A 2ZUTA 3TXAA 5EORH 1NCAH 2R1WB 2W9DL 3UIYA 3ZYZA 1BOGA 2IQ9L 2QSCH 1CFSA 2ZXBA 1KIPB 4DGWC 3BLBA 2CDGA 5AL0A 5IBLD 1YMHA 3ZQXA 3SPHA 2P42B 3E1F1 3L5XH 4X2UA 1K5WA 5BMFH 1VGEL 4Z7WE 2XTJD 1CURA 4Y4FA 2PO6A 2QV2A 4N24A 1W72H 5E4AA 4GKOA 5IQNA 2W8CA 4YZWA 4Q14A 5FM5O 1E5UI 1PY4A 1CFTA 1NOLA 3DYOA 4MD4B 2GT9A 4TLUA 2BVTA 1QSFA 4Y1TA 3EYFA 1WJ3A 4NCC2 2XBDA 1DUZB 4QRRD 2O30A 1H3PL 4MWFB 4P46B 1UUNA 4EVNA 1R75A 3RKDC 3B1UA 4UT6A 4YXKL 3PDGA 2DLIA 3CJJA 4R26L 4BBWA 2ZJSL 3L17A 5GISL 3ZE1B 3GLEA 3BSHA 1OOWA 1YC7A 1VA9A 5EUOB 4CBZA 4IRZA 4EE2A 5KVFE 1KGXA 1I8KB 1TLMA 3EW3B 4Q0XL 1FPTH 1GPOH 4EI0A 3QS2A 4JQIH 3V0JA 4K7PL 1F0LA 4NP4H 5AENA 1NBCA 1SXZA 1L0PA 5GZOC 4Q9QL 1X3DA 5J11C 1UZ6E 3ZHDA 4FNQA 4CMHC 2OMWB 4M1GL 5D1QA 5IF0A 1MCNA 3FU7A 4GBXD 2L4OA 1J1OL 1QI5A 1D7CA 2NY0B 2YXFA 1XF5A 4PTUA 3VH8G 2G3XA 3FKUS 1NC4B 4H8HA 1L5GB 3ZZSA 3GTVA 1JI2A 2AJ3A 4NZRH 5GS3A 5E2WL 1PKOA 2I9LA 2FT6A 1F18A 1QFWI 3V52L 4J7RA 3ZIYA 5EF2A 3IU4L 1A6WL 5E23A 4K94C 5D2LE 3LIZA 2DLHA 4FFYA 3O41A 5DJ0A 1Q1JH 1OL0A 2RACA 3BFQG 4OU3A 2ZOTA 3EF4A 3CH1B 1U33A 2EDLA 1DJZA 1I3RB 4BKLB 2OQJA 1AJ7H 5F71A 1JNLL 4XH2A 2ADIB 1XIWB 2DQUL 2KL6A 2N7AA 3H7BB 4KKBD 3LNHA 5KYUA 4A66A 3EO0B 4IHOA 1FUNA 2E5EA 4IBQA 1RIHH 4NKOB 4NOFA 5MERA 4J2XA 3MRGA 3FT1A 1ASOA 2CHXA 4ZMYA 4LU5H 4LIQH 4UOJA 3QUZA 3V4LA 1PZUB 3KLAA 2W0PA 3CX5K 3L2LA 3NH7L 4MDIB 2BDNL 4HG4J 2Q8BL 3NMEA 2VWEE 1MI5A 1WD9A 3FB5B 4M7ZC 4MXVE 3UYOD 2I5YH 3HKZA 3OKMB 4FQJL 1LE9B 5FO8B 1OAUH 4XX5A 2MNUA 4XNUL 1H6TA 4DQOL 1AQ8A 1N59A 2JKSA 2IBBA 3ZX1A 2OXGB 3L1FA 3MGTA 2NY7H 1S7RA 2VKWA 3BWAA 5F7MC 3NEXA 2H6PA 3WNOA 3CD4A 2E86A 2EIBA 1I8MA 1AMXA 3WEXA 4TUOB 3CZGA 3UROR 4IRJD 1KCVH 3NIFE 4Z7VA 1LO3L 3I9GH 2IAAC 4OUUA 3VFOA 1BBDH 1SDDB 1WHOA 2KHAA 1OWRM 4ELKA 2XTSA 4NEHB 5IB4B 4X6CB 2FLRT 4RETB 3C5XA 4G1MB 3GI9H 1RZJC 2JCCB 2XT1B 2XZAH 2YGPA 1K4CA 4MMXA 2YD8A 3RGVB 3S97C 4X0NA 2ERJC 4X9IA 5F7UA 5KSBF 4NQCE 4G2AA 7PAZA 5I17B 4X6EA 3S3JA 3BP6B 4TQ8A 1MHHB 1T1YA 2RCSH 3GTNA 3ALPA 3KR3H 1LMKA 3QEHA 3MGOA 4MCYB 5I19H 3RVUC 1P7BA 2WXIA