2XXFA

Cu metallated h254f mutant of nitrite reductase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
335
structure length
335
Chain Sequence
b'DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGFGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 95
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xxfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xxfA02
1PNCA 5FC9A 2BWDA 4HHGA 4GP4B 1OCRB 2PP7A 4YSTA 2X88A 4YL4A 2DYRB 4YVUA 5B1JA 5LDUA 3EHBB 1GS8A 1MG3C 1WA0X 1NIBA 3WKQA 1URIA 1J9RA 1SHXA 5B1AB 1GW0A 2DY2A 1DZ0A 2PPCA 3NJIA 3OMIB 2QPDB 2QDWA 4PAZA 4HIPA 2Y69B 5AKRA 3V9CA 3ASNB 3IN0A 2WO3B 4UAHA 4G70B 3T6VA 4X4KA 4HZ1A 2AZUA 3CG8A 2FT7A 5A7EA 1FA4A 3AG3B 3BVDB 3FS9A 2FT6A 2IDFA 5B7MA 7PCYA 1KCBA 1CYWA 4A2EA 1A3ZA 5I6NA 2YAQA 2YXVA 1SHWA 1NPNA 3UADA 4BXSV 3L45A 3X1BA 1JXGA 1L9RA 2XV3A 3UAAA 2HX7A 3U25A 1GYCA 5E9NA 5I6KA 3FYIB 5I6LA 1ILSA 1MDAA 4AKOA 3HEIB 1ZIAA 3AG4B 1WA1X 3TA4D 2DYSB 3MX0B 2UXVA 3CVBA 4E9WA 3SQRA 1GSKA 1ASPA 2TSAA 3FQ1A 7PAZA 3AG2B 1EZLA 1BQKA 3N2JA 9PCYA 4ENZA 2AVFA 2VW6A 3SBPA 1F56A 4WKXA 3S3CB 3OMNB 1HFUA 2XXFA 2PPAA 2I7OA 3JTBA 1JVOA 1BQ5A 1NINA 2IAAC 2IDTA 3DIVA 3NSCA 3FT0A 1HAUA 2GI0A 1WAEA 1GS6X 1YLBB 1JZEA 2CJ3A 1JZHA 1NPJA 1SFDA 1NDTA 5F7AA 2HLEB 3FQYA 1AG6A 1QLEB 1ILUA 1KV7A 3TBCA 4YSPA 2UX7A 1BAWA 1ID2A 3X1NA 4CSPA 3EH4B 2H47C 3EF4A 1NZRA 5B1JC 2ZXWB 2PCYA 3ABLB 3HB3B 3T6ZA 1OCZB 3UGEA 1N68A 2E86A 2NRDA 2VSKB 2HXAA 1ZV2A 4UF7C 1OE1A 2Y1AA 1SFHA 1AS7A 3V9EA 2GIMA 2JXMA 3NJLA 2XXGA 3PXLA 2FQEA 2FTAA 4GXFA 3ERXA 2IDSA 5B7EA 3FSVA 2EIJB 1IBYA 2I7SA 2GHZA 2YAHA 3FU9A 2BW5A 3GDCA 2Q5BA 3EH3B 5B1BB 1PZBA 2P80D 4GP8B 2ZWNA 2GC7C 4G72B 1SDDB 3QJVB 2UXFA 2XV0A 5B1KA 1IC0A 2HRHA 3FSAA 3NSYA 4M4RB 5ANHA 4DP5X 4DPBX 1J9TA 4HHWA 1GY2A 1PZCA 3WNJA 3H56A 4DPCX 1FWXA 2XX0A 4YSAA 3NJJA 1WS7A 2Q9OA 2YAMA 5PAZA 4DP9X 2J55A 3X1GA 1KDIA 2DWSA 1AZUA 2BWIA 4G71B 1AR1B 4A2DA 4BWWA 4E9RA 1OCCB 1BXUA 5I6OA 1JZJA 3NYKA 4A66A 4E9VA 3AW5A 1M57B 2B3IA 1AS6A 2J5WA 2PPFA 3FPXA 4A2HA 2P80A 3DTUB 3TU6A 1SF3A 2YAEA 3AY2A 2XVBA 4HCGA 4A68A 2XYBA 1XB3A 2FT8A 4DP2X 4F7KA 1MZYA 3EH5B 3AG1B 3WG7B 4BK5C 2ZOOA 1KDJA 4QKTA 4F2FA 1T5KA 3NSDA 3IBOA 3X2QB 4GYBA 4QLWA 1A8ZA 1RKRA 3NJGA 3S3BB 1PCSA 1PLBA 2GSMB 2QDVA 4A67A 1JERA 1B3IA 1RCYA 2IWKA 5D4HA 4A2GA 2FNWA 2BP8A 3NJHA 5I28A 3FQ2A 2EINB 4GY4A 2HZHA 3QPKA 1W6LA 3FYEB 1V10A 2QT6A 1SDDA 1DYZA 4YSOA 1ET7A 2DV6A 4ZK8A 2FJSA 4AX3A 4RH4A 3RYMA 2GBAA 2FQDA 1AACA 2CUAA 5I26A 1QNIA 2OJ1A 4NAJA 2WSDA 3QQXA 5F7BA 4E9YA 1E67A 1NIAA 2OCCB 1X9RA 3NP3A 2VN3A 1R1CA 1MG2C 3FSZA 3NT0A 1KBWA 1ADWA 1AZBA 4Q89A 1M9WA 3ZDWA 2EIMB 2VM4A 4HCIA 4N8UA 4W9ZA 1AZCA 2XX1A 5D4IA 3UAEA 1PLAA 1ASOA 1OF0A 4JHUA 1X9UA 2BHFA 5TK4A 3WI9A 2PP9A 1CYXA 1IUZA 3H4HA 1XB8A 2W8CA 4JHVA 4W1TA 3T6XA 4E9SA 1WS8A 3NSFA 2N0MA 1J5DA 1ETJA 1BEXA 4NERA 1ZPUA 1NWOA 3X1EA 5AZUA 4YSDA 1FFTB 4G7RB 3NP4A 4HAKA 4DP4X 2HX8A 2FWLB 5B7FA 3JT2A 2X87A 3QJRB 4KO6A 8PAZA 1N70A 2TSBA 4M3HA 1RZPA 2IWFA 1NWPA 3C75A 3IEAA 1E5YA 3X1FA 1W6WA 3ZX1A 1SF5A 2LLNA 1A65A 4KOCA 2XU9A 2JFCA 3IE9A 4YSRA 2BP0B 4DPAX 2GC4C 4YSCA 1I53A 4N4YB 5I5IA 2IH9A 2PPDA 3CVCA 3S3DB 5TK2A 3IN2A 3KW8A 4L0PB 1KBVA 3PAUA 2BP8B 1AAJA 1L9OA 4BXVA 1QHQA 2J57A 2YARA 5I5JA 4DP6X 4DP0X 5I6PA 3UACA 1TEFA 4HCFA 1OV8A 2H5UA 3FSWA 2JKWA 1ET8A 3CZUB 3NJKA 2IH8A 4F2EA 5AFAA 1VLXA 2YXWA 4K9JA 2VM3A 1J9SA 3FU7B 3WKPA 2OV0A 4HALA 2XV2A 1OE3A 1WA2X 3ZBMA 1J5CA 2HRGA 2IDUA 2CCWA 3AZUA 1JVLA 2WO2B 1ZDQA 2UXGA 1SJMA 1UATA 4BWTA 4YSQA 3T9WA 1PY0A 4KNUA 3FU8A 1V54B 2AANA 2XLLA 4YSEA 1OE2A 1CUOA 3QJQB 1EHKB 1PLCA 3OD3A 3MBWB 3WIAA 3QJUB 2ZONA 3BQVA 2A3TA 3UABA 2W88A 2FQFA 4KO7A 3OQRA 3H4FA 1NIDA 4P5SA 1GY1A 3SBRA 4EF3A 4TXVB 1A4AA 1CC3A 2CBPA 2R7EB 1BYPA 4KOBA 4YVNA 2DWTA 1PMYA 2AFNA 2BP0A 1JZIA 3ASOB 4FAAB 6PAZA 5B3SB 3ZIYA 2XUWA 2MRYA 1XB6A 2YAFA 2PLTA 4AKQA 1L9PA 2PPEA 1HAWA 4JKNA 4E9XA 3TBBA 2QPEB 2VW7A 1NIFA 1M56B 4P5RA 4BWUA 1BQRA 3T71A 4PCYA 3WNIA 1JXFA 1ASQA 1JZFA 2IDQA 3T6WA 3FU7A 3PPSA 1AG0A 3S8FB 4YSSA 1XMEB 3OMAB 2BW4A 1PAZA 2BZCA 3OM3B 3PLYA 1W8EA 1RZQA 2J56A 5I5MA 3CDZB 3KW7A 3G5WA 4G7SB 1JXDA 3ABGA 2XWZA 2EIKB 2VW4A 4BDVB 4DP7X 1BXVA 1KYAA 1TU2A 2B08A 3GYRA 4GP5B 4UANA 4AZUA 1CURA 3TASA 1NIEA 3N55A 4KO5A 5D4JA 1AZNA 1IBZA 4Q8BA 1NICA 3NJFA 1J9QA 2FQGA 2R7EA 3QJTB 4AKPA 4FA7B 1PNDA 2AZAA 1ZDSA 1GS7A 1SNRA 4G7QB 3PCYA 3CVDA 1PZAA 1ZIBA 1AS8A 2IWEA 4CSZA 1A4CA 6PCYA 1PF3A 2YAPA 2YQBA 4MFHA 3SBQA 4KO9A 1A4BA 1E65A 2BZ7A 4AI7A 1BYOA 5IY5B 2CALA 3PAVA 4KNTA 4A2FA 1BXAA 3GXUB 4E9QA 2PCFA 1ET5A 1KGYE 1TKWA 2BO0A 3NJMA 1L9SA 2UXTA 4E9TA 1AOZA 3D12B 3DKHA 2CAKA 2UX6A 5EHFA 3ABMB 3FPYA 2GB2A 2EILB 2VSMB 1E30A 1L9TA 2PP8A 1JZGA 1AQ8A 1GR7A 4DP1X 4YSUA 2MTAA 3S8GB 1AIZA 1IKOP 3PAZA 1V55B 3ABKB 2H3XC 1E5ZA 1AZRA 1MZZA 4KNSA 4DP8X 3CDZA 3QJSB 1TEGA 5PCYA 1JOIA 2VMJA 1L9QA 1NTDA 1OOWA 1OCOB 2RACA 4NB7A 4BDVA 5I6MA 1KCWA 3NJNA 2HX9A 4WTQA 2I85A 2YAOA 1AANA
chains in the Genus database with same CATH superfamily
2P3YA 1ZA6A 2AJYH 4OQTL 2AQRA 3TFKC 1XCXA 2L7QA 2D7TL 4UU9B 4DO4A 5BUGA 3QJHB 2AP2A 2E27H 1MLBB 2ZOLA 2BOBB 4LSUL 3VGFA 3KPSD 4C4BA 4X4YA 2CO7B 4ZFGH 3UTPE 3VYPA 3S9DB 2O30A 4OZFG 4W9DC 5CUSL 5HVGB 3ZRFC 4FXKC 2YMTA 5DUBA 1IO4C 2ICES 1OKEA 3SYAA 1UTDA 1GS8A 1E9PB 1TVHA 5DEFA 1M2OA 5A2JH 5EO9B 2JELL 3GLEA 4CC4C 4AIEA 5E8OB 2C9UA 5MEOB 1LWRA 3UZVA 4TUJB 2LLGA 5D7IB 3GXPA 4ODVL 2UYLB 3B3BA 4P2OA 2O1AA 2Q3ZA 3I9IA 1BYNA 3T0DA 1E5AA 1K4CA 3CFKA 4X4KA 4V1DD 3QORC 3ROOA 3O0RL 3M7OA 3DTXB 3VXRB 3VXNB 1S3KH 3V0VA 1NMCB 2IDFA 5T3XD 3J8F7 3L5XH 1PZUB 4P4KA 3DPBB 3LS4H 4DAGL 7PCYA 4A2EA 4B97A 5TE7H 2E9IA 2V9RA 3KLAB 2X4NA 3JTTA 4BFGA 5F93C 3ZR6A 4IIZA 4XPGL 1JI2A 1KIRB 4AIXA 3S37H 1HL5A 1UA3A 4YHLH 3MV9A 3R8BB 3DJTA 3V4VB 1PZ5A 3V4VL 1JDDA 3QDHA 3QEUB 3RL2A 3VTMA 4I9XA 1RPQA 3AM8A 1XEDA 3QNYB 1X6NA 2A9DA 5BZDB 4QXGH 4Y5YB 4JY4B 3FMGL 1EGJA 4B3VA 2P7TB 3M45A 3DX1A 4OZGB 3T3MB 4WIQA 4L9DA 4ETQA 1MCJA 3BUDA 2CDEA 5FUCE 1KBKA 4XMXA 3ZKND 1RMFL 4XN2A 2NQCA 1H6UA 2RMNA 5E1AA 4X5LA 5DQJB 1HHKA 4PR5A 2FIRT 1KCUL 2MOGA 3GSXB 4IHOA 2FGZA 2AERT 4X6DA 4XP4H 4KK8D 3NVQA 3VD5A 3MRJB 3MV8B 1JPGA 4U6HA 2B1HH 3NEOA 4P2QE 5CZKA 2A6IA 4O9HL 3PWLA 4OFYD 4ORGA 1UACH 2JLPA 3SSGA 2CKBH 5SWSB 4C56A 4YC2B 5I16A 3QI9B 1YLBB 4HJGB 2J4WH 2WQRA 2P8PB 2XKNB 3B56A 1M1XA 1OF2A 3D0AA 3WL9A 3WFDL 2FGWH 1KV7A 3PV6A 4JFDA 1S7SB 3MRKB 3WYRA 1DUZA 1K6QL 1CWVA 5FFGA 2ZWLT 3QSKB 3IBEA 4JG1L 1IM9D 3DV6A 5F7FA 2WSKA 2RCSL 3BAXA 4JDEB 1AO7E 2FEEI 2A1WH 3LKNB 2K1MA 1LGVA 2E86A 4G11A 4AQEA 2AQPA 4WEEA 5DFAA 3V9EA 2XN9A 4PJBF 4PV1C 1HL9A 5TH2A 2YHGA 2YPVA 5AAWC 1K4DB 2VR3A 4MNHB 1X5ZA 3DARA 5MEPB 3RX7A 4XWGH 2DM7A 1IBYA 2APTA 2P47B 3FU9A 1PZ3A 1TOXA 5DS1A 1DR9A 3VWJA 1KN4H 4DEPC 3U9PL 4DGYH 1QEWB 1JK8B 2IV9A 1S7VB 5AVQB 5DJCB 5IOPB 1W8OA 2GJ6A 4G72B 1IEHA 5TPWL 5BUAA 3CH8A 1K85A 1FVCB 4ZOAA 4KPHL 4Z8FL 5E9DD 1P4UA 3PWPB 5F9OL 4K5MA 3TJEL 3H56A 3KS0H 2RFXA 4POYA 5C2BL 4QHMA 4LARL 3T4YA 2FSDA 3NCFB 1KIQA 2DL9A 3HZVB 1KDIA 4GAAA 3TEZA 3B1TA 4MZRA 1A6WL 1U8NB 3D39A 3U6RB 5ESAB 4JKMA 1E28A 5HDBF 2DQUH 3CN1A 2ICEA 4LVHC 5IIEB 4J6RL 4M1GL 1JZJA 2KBGA 3HZMA 4H5SB 3L3HB 3P02A 3RNKA 1JN6A 1FSKC 3P3SA 1Q0YH 3VD0A 1PG7W 3QJXA 5C1MB 2QVTA 5TJWK 5GS0H 2MNJB 4NFCA 4E41A 2HFFB 2FT8A 4FEMA 5FV1L 3AG1B 5D70H 1IVLA 1U8KA 1FZOB 3K7UA 1S7WA 3PL6A 1BVNP 3VYNA 5D93C 2X3AA 1RL1A 1KC5L 5F9JB 1V3MA 3WFZA 3IBOA 3MRIA 4NZUH 3TA3D 3ZDXF 1IKFH 4XVUD 1ZS8A 4R0LC 5GS0C 3UERA 3MLYL 2GSGB 1QSED 3NJGA 1D5MB 4RFOL 3S36X 4B0MM 5L2KB 5K39B 3REVB 4XXWC 3KGSA 1CDGA 2ATKA 2OKMA 4I18A 4KK6C 4ODWB 2HRPL 4KJQC 1KBPA 4ZODA 1BQSA 3UH8A 2ZX7A 3CLFH 2APWA 4LFHG 4U6VL 4XGZA 1A4KB 4AGOA 3RPIB 2WO4A 1SDDA 1MWAA 4Z6AT 2C9RA 2EADA 4WI4A 3QA3B 2R4SH 2MQ0A 5FUZL 1M7UA 5HJ3B 1BJ1H 1XAUA 1XGRA 2O5XH 4W4OA 3HG1A 4OZFH 1AXSA 1EEQA 1YEGH 1RHHA 5ALBL 4GEIA 3ZKSD 5KZCB 3CGTA 2ED6A 3S34L 5C07A 1XGPB 3DLQR 1QQDA 2MIZA 4MAUH 3ZDWA 3D85A 4KMTL 1E2WA 4ZUWB 4HCIA 2BIQA 3DETC 1ZLWH 1VFAB 2YQ3A 4X0KA 3RAJL 1UM4H 2Y7LA 3UTQB 5FYLL 2ERJC 1GZHC 5IW1B 2PXYD 1CJYA 2CG9X 3KPRD 2H1PH 5IMLB 1MCSA 4R4ND 3QWOA 3WHE0 2HVKB 5IB2A 3WNMA 1QR1B 5KVFH 2P8LA 3L54A 1IM3B 4IMLB 3C09C 1B4TA 1YNTF 1QA9A 2X28A 2BNQA 3R7RA 2Q86A 3OBAA 3Q2CA 3MO1B 3AS3A 4PRBB 4X6CB 5HGGS 2X4QA 3CZEA 1NAKH 1BM7A 2VQTA 4OUUA 4PCSA 2J8UA 1UADC 3QUMA 4KKLC 2YD3A 4D9QD 3CSGA 3FQRA 1KTDA 4MJ6B 3ZW3A 4UIMA 5C08E 4TKWA 1HHJA 3MLWL 1E6OH 3MBED 4X9HA 3ARSA 1JWMA 3CC5A 3N9GH 5EBLA 5AVUB 4R2GB 3PWJA 2DL2A 3CVCA 4JFYA 4GSQA 1MF2H 3SOBH 1N6VA 4LP8A 4CU7A 1KBVA 2F54B 4RA3A 2V17H 1IQWL 2BLFA 1J8HB 2YK1L 1QBLH 2XA3A 3TZVB 1YJDL 4XCEA 3QQ9C 4PJAF 1ZVSA 5C0BB 3B7UX 3KBEA 4HJ1A 2Z93A 4IU2B 4GI8A 3NCJH 4P5KA 5TDPA 3IXAA 4I0CC 4YDKL 4HULB 2JKWA 4D3CH 4ZSOA 4KTEL 3RWFB 4ZMXA 1G7LB 2BP5M 4JANB 2VN6A 1DBML 3M1BA 5DJXB 3BIAX 3UGXA 2H45A 5EWIH 3CFEA 2HKFL 4I1PA 1OE3A 2GJJA 2CCWA 3QHZH 5EIIG 1TQCC 4AYSA 2J21A 3IFPA 1ZDQA 3TZVC 5KVDH 2YKKA 3NFNA 1FC2D 2FRGP 1P4LB 3RDTB 3EDEA 3F5WA 4JS7A 1S9KC 3SE6A 4GG8B 3RTQD 3WIAA 4BFIB 3FFOA 1ZRUA 4YPJA 4OFVA 5ACZB 3MREA 3QCUH 2Z1PA 2D3LA 4HV8B 2NY3B 2C3VA 3U1PA 3H4FA 4P5SA 5AW2B 5I30H 43CAA 5IMKB 1U8MA 3FB6B 4N2BA 3D33A 4PU2A 3ZZ1A 4JPVL 5G5DB 2A9ML 3DVNB 3DX9B 4ATWA 4QUOA 1I3RB 3LHPH 1HQ4B 4K5NA 4ZUUB 3QUYB 3RDTC 5JHLL 3ZPDA 4IJ3B 3ASOB 4ZFOA 1XD0A 4W6XB 4U0RC 2ZWYA 1FG2B 1EAPA 1HXYB 3LNGA 1UWEH 1FHNA 1Z5LA 3UL4A 4BYHA 4X8CA 4JM2D 1BZOA 4HKXB 4Z23A 1VFBB 2PPEA 3OKNB 2NY3C 4Z3GA 2HCZX 2YEZB 4LSPL 4CVUA 1J1PH 1BSIA 1KGCD 1Z5YD 2WLHA 5CP3H 5HDWA 1HEJC 1MRCL 1GGCL 2MTPA 3EHBD 2DI9A 3GMPB 3FT3B 5JZ7D 6FABH 3QUYC 3WN6A 5DURB 4LESA 1QPPA 4KQ3L 4OZHF 3ZUNC 2R23A 2LT9A 2AJZA 1CG9B 2PO6B 4FQLH 2QGBA 4LEXL 4CW1B 2D31B 2DWEB 3IETB 4OCSL 1G1OA 3STBA 4DH2A 4RISH 5GRJH 2X4RA 3C5SA 4NKIH 4P23B 3FXIC 1UVQA 4F92B 4Z3JA 3CDGA 4GKZB 4HMEA 3MCKB 4JFTA 4XXCC 1XZ0B 3BDYH 3OX8A 5J06A 1GRWA 4PJ8C 2WSPA 3LHAA 4DQOL 4PBVC 4QHKJ 3G5YB 4J3SA 4ZOCA 3I2CH 4FXGC 1I4FB 3GI9H 5DDHB 4MS8D 1S7RA 4JPWL 3CFCH 3SGJC 3VQMA 4ELDA 2PO6C 3RX8A 3VU2A 3U1SH 2NXYB 3WHXA 1V7MH 4JFUA 5D4JA 5DJAA 1XD1A 3MRFB 32C2A 5B39B 2Z92B 5IFAH 3ZTEA 4P23C 5D1XD 5IQ7H 4UQ2B 5KS9F 4JE4B 4YUEL 1NC4D 2CMRL 1KEGH 3CVHH 2X12A 1NCAH 3CZNA 4LCCB 4PY7B 2R1WA 4WUUD 5EDXA 5EOCJ 4G8IA 1KJ2H 4F5CE 3QIBA 4BJLA 1CFBA 1PYWB 1XAKA 4YGAB 1U36A 1N8OE 4NN7B 1DEEA 4KJYA 2XQYK 3ZU8A 3V5KB 4Q4IA 2RHEA 1Y1UA 2LLLA 3K4ZA 4YMPA 2YC1A 2EZ0D 3HJ0A 3B3IA 2AMGA 4N6RA 1EV2E 1LO4H 3W2DH 4X6FB 4M1DH 1AOZA 1EPFA 3P9LA 1ZT4A 4LCCC 4G6MH 5ADOL 4PLJC 1WBZA 5I19L 3BT2L 2ESVA 4RFEB 5IHUH 3MV01 4OD3L 3KPSB 1TQBB 2ZOKA 2WXGA 3KR3L 3MA7A 5G55A 3WY4A 4DUVA 4KH9A 3ZKMC 4IRSC 1BW8A 1HI6A 1QSZA 3F12A 3GNML 3HVDA 4ZS7L 5EZJB 1SJXA 4KNSA 4N8PA 5AYUL 4TRPH 1ED3B 5EN2A 5EV7A 4ZYKA 2YGPA 3ILPB 3EYUL 1YN7B 4NO3B 3QYNA 5J8OA 2EDOA 2XG5B 3Q6GH 4A37A 4JRXE 2WYTA 4NQVB 1IQDB 1LO5B 4LASL 4PJCB 1BBDL 4WLCA 2JCCB 4P5TA 4EMZA 4OZIA 2NW2B 1GW6A 2MEJB 2X4PB 3IDNA 4V1DB 1A7NL 1GZQA 5FCUH 4EI6B 1WICA 1P7KA 3PGCB 2OI9B 2ADGA 3QJOA 5CGBA 5CCJA 2VO5A 2P8MA 1CDHA 1O9WA 1BAGA 1OY3B 2OL3A 3FCSB 5DMYA 5T3XL 5F1KC 5C0DA 3UO8B 4ABUA 1FE8H 3LMJH 4FFYL 1EUTA 1VESA 2R2CA 3D0LA 4Z7UE 3BFQG 5AENA 3LN4B 2FEDD 3SDAD 1ZK5A 2DI8A 4FCAA 1H15A 2DTMH 1T5XA 4PTTA 4HKZA 3U36A 5JW3L 1UM6H 4JW3A 5DYFA 3NTCH 5INDA 3OXRA 2R0KH 3ASNB 3QHFL 2KZBA 1W0VB 2G30A 4IBYA 3GMRA 2MPAH 1VENA 2J1KA 3SE8L 2DLHA 4CU6A 1HK6A 4HS8H 1U8PB 2VDQL 3EJYC 4N86A 3O6MH 1J0IA 3O4OB 2X6UA 4YFLF 3BUYA 3E3QE 5B7MA 1UOWA 1MEXL 1A3LL 5EIIB 3TBYB 4WI9A 2CGZA 3UEZA 5ABDE 3VI4E 3MRPB 3JV4A 4NQDD 1U8QA 2DKSA 4U1IB 4Q52A 5AW6B 3U7WH 2WQWA 3L45A 3B9VA 4KKBD 5I8CB 3AU1A 2X5PA 4PJ5A 3O2DH 1KTLB 4ZTOL 2JB6B 3L7FB 3ZQXA 3HUJB 1JZ6A 3FYIB 1P4IL 3N50A 1GTNA 2BFVH 3BW9B 3H9SB 2DN7A 4WJ5B 1MHPH 3UAJC 4DTGH 5E4IA 2X7LB 3IYLW 2GW5A 4LOFA 2DQFB 4YPGB 3QEQE 2GKIA 4RCAA 1UYWL 2YPLD 1WT5C 3LRLA 4FL4C 1UWFA 3DMMD 3J7HA 5AOLA 4ANVA 3L1FA 4ELMF 1BQKA 1WD8A 1OAKL 4G82A 2VXTL 3OGOE 3A4EA 5E5MB 5KOMC 2HTKD 1JPSH 2AEPL 3BAYA 4XODA 4WFGE 2WN2A 5H2BA 3PY9A 4KRNA 1M05B 1OK8A 2CO4A 2ZOLB 3CHRA 2V9TA 5KAQG 2PPAA 1IM9B 3VXME 4GXVL 3A47A 3UBGA 2MMXA 4OD1H 1CE1L 1IFRA 3BPCB 4HBCH 1GOGA 1WAEA 2NY6B 3O6FD 2YBGA 2VDLH 3DXAA 3EJPA 1DUYA 5LVEA 2VNCA 1G6RH 1NJ9B 1FFRA 4F37K 2H6PA 1AXIB 5DFWH 5AL8A 5CEZD 1QLEB 1C16A 2KLTA 3K6DA 3ROOB 3PHOB 4A39A 4P9HL 3L5JA 5D8JL 5T8IA 2OXGA 2D8KA 3V0VB 4ECNA 4HXAL 2A9AA 1WZMA 1QLEH 3JQOB 3DVFA 2PR4L 2WLIB 4ABVA 5E9DB 1YECH 2L4OA 2BPBA 2NY6C 4MNQD 2BIHA 2X4NB 3JTTB 2GEQA 2V7HB 3HS8A 4QT5B 4WWID 1XH1A 1W8NA 2B1AL 5DHXB 2CIIA 4LVOB 1GPOH 1IGFH 4LQ1A 4P2OC 3ULVE 2ZOTA 2NLJB 3A24A 1RZKH 2X2UA 3BVUA 5JUEH 3W0WE 1KACB 1OVZA 1YNLL 4GP8B 4NSKB 1DVYA 1NCWL 3E6FB 3FKUS 2H2SC 4EI0A 4P4KC 4QAWA 5I6XC 3TJHD 2X6MA 4BFEA 4X5QA 3P9MB 5ANHA 2C9PA 1EGJH 3BX7C 1D7FA 3N40P 1RZKC 5SWZE 5CBEA 1VKXB 4KROD 2OK0L 4N68A 1TQTA 2WB7A 4LVOC 4EI5A 1HHKB 1I3GH 2H32A 1SUHA 1SOKA 5CNHA 3HG5A 4X6DB 2CJUL 1AZUA 3AM8C 1ZXKA 4GW1B 4ZRGA 3MSPA 3RWDB 3VFNA 4GSRA 4BWWA 4AVKA 1QSEB 3KJ6H 3U83A 4U6HB 2EC8A 3DVIA 5FA4B 5CZRA 2JI1A 5D7IF 4JFFA 4M00A 2DTSA 4M8QA 3PQYD 4EXKA 1BLNA 2PPFA 5FB8B 4TL5A 4DN4L 3ES6A 4WV1A 5C0AE 2BSED 2XJKA 4OBSA 4DP2X 2R4RL 5FYKD 3ALPA 1M1XB 5DCCA 3SKJH 3OZLA 2Z8WC 3BAEH 4PB9H 2I5YH 4GMSL 4XOBA 4JN2A 5DUPH 2GT9A 4HISA 2F53E 2NUPB 2OCFD 1PVHA 2OMVA 3MACH 3QPXH 1RZ8A 3VMNA 3X13B 4NIYE 3R1GH 2HVJA 3NABL 2FWSA 3NJHA 2Y72A 3L7EA 1D5ZB 1YEKL 4DHLA 1FAIH 2PXYB 1BMZA 1G1CA 3CZGA 4PJEE 1BD2D 3W9EB 4NKMA 1V10A 3ECVA 3SQBB 1DYZA 2VDOB 4OZGF 5AW3B 3T3MF 4DGVH 2VDOL 1NFIA 25C8L 1GOHA 4OGQC 2COVD 3WIFB 4NWTL 4PWJA 2FBJH 5HDQL 4AH2A 5HYJE 5F3FA 1VADB 2JLLA 4P2QA 2GJRA 3NRQA 3VWJB 1G9ML 4NC1C 1AJ7H 2YPVH 1EERB 2EYSA 4IBLT 1OZTG 3NT0A 4LLDA 2F08A 4EQ2A 1JHLH 4Y5XB 3FTGB 4J3OF 1J5OH 3BE1L 2OZ4A 2NYYC 2EE6A 2HKHL 5C0RH 4AE1A 2O5YH 5IT2L 1FLTX 1DJWA 1NL0H 2AEWA 4ZO7A 3OR6B 5F7DA 4X8GA 3C60D 1CYXA 4TLKA 4J1UA 3TIEA 1YZZA 1QSVA 4JJ5B 1KIQB 2MSPA 3VWJC 4XNZB 2N0MA 1GC1C 3O3BB 4RGMB 5ACLA 1AO7A 2ICEB 4L9LA 3GT6A 4HUVB 5E2WL 3PWNA 3LEXA 4FQ1L 4KDTA 3U0TA 4DP4X 1JN6B 3TV3L 1I9JL 3W5NA 1YY9C 3ZGHA 4RMWA 1Z9SB 3QEHA 3QJRB 2EDQA 2Y6TE 4FQCH 5E8NB 1NC2A 1ZMYA 2A74B 2GPZA 1G4MA 3G5ZB 1OLZA 1U8KB 3PL6B 3F2LA 1S7WB 2WM0A 3LCYA 5E6RB 4ZMOA 3I6KB 2Y3AA 1I9RL 1AHWA 4OAWA 2EH7L 1A3RL 3ZTNL 1AR2A 2ICEC 3MRIB 3UG4A 3QXVA 4MA1B 4DKFL 4X6EA 3GLZA 5I5IA 2VXVL 1CLZL 2XQBH 3WFBH 4CL7A 5L7XH 2DQ6A 1JGVH 1E90A 1UXWB 4AEIH 3FK3A 4OCWH 4UM9D 1FFOA 1YMHA 4OM0H 4XGZB 3RTQB 4DP0X 4PJ9A 2D73A 1NUDA 4HYTB 3ARDD 4BKTC 1QFWL 1P6FA 3PL6C 4IKJA 1FIEA 5T5FL 4Y2OA 3CDCA 5LGHL 3CZUB 1D5IH 3NZSA 2VLKB 4X2UA 3NJKA 1ZHLA 4LLYA 4GO9A 1MWAH 5TDNB 4CBPA 5KYUB 4NQCD 4J3WA 5F88B 4XNDA 3ZBMA 3QDME 4HIXH 2EO9A 2B4CH 1JVLA 1QQDB 1BGXH 2GY5A 3QRGH 4ZFZA 3IS0X 4I18C 2WINA 4PYHA 2VGLM 4YDIL 2X42A 2Y6SC 4JEGB 5J89A 4JFQA 3H9ZA 4UDTA 4FX5A 3V2AR 4ZMVA 3PJNA 3QWOB 2B4CC 3KVQA 4GXUN 2EH8L 1R34A 4IRJA 3BQVA 4N8CL 4W4OC 4G6KL 2V5RA 5FOBB 4KI5D 1AD0A 3GB7A 4G5ZL 4NXSA 4EDWH 4NUMA 1QA9B 3SKMB 3SBRA 1I1CA 3V7AG 3EJCA 4J6IA 5FR3A 2Q86B 3FO0L 3TT1L 4F2MA 1HZHH 4HWEL 1RUAL 5ECGA 4HSQA 2Z3FA 3QNZB 1Q72L 4YVNA 4EKXA 2X4QB 3MRGA 4JLRB 4Q9QL 1MCWM 3LQZA 2FHBA 4MAZA 4DFIA 2J8UB 6PAZA 5IVXE 4FG6C 1KTDB 1FHGA 2XPGB 4UIMB 3BHBB 1B4JH 2ZP9A 4JO2L 5JIHA 2WXRA 3ZYZA 3QUMH 4NCC1 3V4UL 2O5ZL 1JWMB 2CHXA 1KTRL 1FYTE 1JFHA 1OWWA 4DERA 5FYJU 1AD9B 4MMXA 2B3RA 3MLSL 1F1GA 4AXWB 3Q8FA 1OAZL 2M83A 3ULSA 4ZQKA 5B3JF 3MOQA 2VE6A 4R4FL 1ZVSB 5EORH 3RVXD 1EHLH 4KUCF 1P7BA 2CBOA 4XHJD 4TTDD 3F7YB 3IXAB 3JBG7 5IVZB 2BVTA 1BHGA 1WIUA 3L3OA 3AB0B 3QXAA 1CR9H 1OSEA 3N44B 5G4MA 3GUTB 1LMIA 4JG5A 3TPKA 4ATTA 5I5MA 1T6WA 5EF0A 2Y1ZA 3K4DA 5KVGL 1RZ7H 4DP7X 1IE5A 4TUKH 1LK3L 2XJLA 3NFNB 1A9BB 1NGYB 3QQ4A 1SPDA 5C08A 5FK9B 1SVBA 4X6CF 3ZO0A 1AZNA 4RSVA 2QL1A 4FS0A 4WI0A 4DN3L 4PS7A 1NDMB 4IEFB 1OLLA 4JQXA 3FULA 4QRRB 3SHSA 3N85L 3KLHD 3MOBH 4OZ4B 2BINA 3II2A 2O6DA 3LRKA 4PGDA 2CHDA 1LO3L 1UB5B 3AWGA 1U8MB 3BD5A 5JPMA 1FBIL 3BKJH 1A4CA 2X3BA 4MFHA 3K2UH 3HZYA 3OHMB 3HNVH 4S0TD 1EEUA 1QBBA 3NCEB 3A67L 4XCFH 5EZOH 4TUOB 4B50A 4WI2A 4PJGB 3O8XD 1CFVL 4GOSA 4UINL 1BYOA 3VXSD 3D06A 2ADIA 5JDSA 3RJQB 2J1XA 5ICZB 1NBCA 4MB1A 4YXLL 2WJ7A 1DQMH 1EAPB 1TJHL 1TVBB 3LD8C 4UT6L 2DMBA 4OLUL 1TKWA 5JDJA 5D2LA 1E2ZA 3CMOH 1EJ6A 2KT6A 3AWEA 3D12B 1P5VA 3DHJA 2OW6A 4HGKC 1JD7A 2FLBT 4K7FA 1G84A 3FN0H 3LNDA 3NIDB 3KCPA 2MQGA 1K8IA 3H1ZA 4YSUA 3NA9L 4PV9B 1DLFL 2AAVA 2WYHA 1V55B 3BT0A 4DO6A 5I1GL 1AZRA 4OCYL 4L8SA 5IESH 2Y24A 3FNKA 4NWUH 3FRUB 2BDNH 2QSTA 3SDAB 2NX5E 2WQAA 3AQXA 4F15B 3QJFA 4N90E 1DL7L 4KKCD 2X4RB 1E0OB 2EVIA 1RUQL 1AP2A 2MQ3A 4HXBH 2YAOA 5J6SA 1VA9A 2XOTA 2EEXA 1IEAB 1JV5A 5BOZG 3F3HA 1C12A 4BBWA 2FR4A 5CSZA 2ZXBA 1UENA 3PDOA 1FLRL 3N91A 1E7UA 1J7VR 1KCVH 1X44A 2B14A 4L1LA 4PGCA 5INCA 2Y7NA 3W1ZA 5A3IC 3RGVD 1F45A 1XMWA 5LDUA 5DJAB 3MV7E 2ZKWA 32C2B 4GKLA 2WWMC 4G1MA 1IC5H 2XZZA 4DFHA 4DPRA 4NQDB 3GJFA 2XT1B 5L2JA 3CSFA 3LPOA 4JHBA 4OLZH 1LJMA 1RIHH 4FZEL 3T04D 4A2LA 1XBRA 2WNKA 2QPDB 5DK0A 1PKQB 2R1WB 2QSVA 1FNGA 3QIBB 5AKRA 4ZX4A 2DMCA 4Q14A 5E8DH 4UAHA 2EECA 3ZE0B 2WUCH 2BJML 3MPCA 4G70B 4PCTA 1SN0A 4WNQB 1KMGA 1G9HA 1NGZB 2FJHB 3MLXL 5IHZB 4KJYB 4JO4L 3EBGA 4L8BA 2VABA 3TESA 4AL8H 1I1YA 3SKUD 3ZZLA 3KYKH 5E4AA 1JP5A 3BRGC 4L18A 2YPLB 4ODHL 3L2NA 3DMMB 2ZAIA 1CYWA 3W11D 1T7XA 3B3IB 4IBSA 4NP4H 5IZ7A 4Y4KA 2D3VA 5T3ZD 4I13B 1XX9C 4WENB 5DQ9A 1SN5A 3QIBC 4AIZB 4MRBA 1I8MA 4AL8C 4P2RE 3GEFA 5F96L 4HS6B 4G8FA 4HJJL 4IHBA 5AB2A 2ZOKB 3MA7B 1CGUA 4JREC 5EU3A 1KTBA 3MNVB 3G6JE 2R15A 3K8LA 4RWHA 3F12B 5IB5B 2XY2A 5JIMA 3WO4B 3O2WL 1JWUA 1YEIL 4H88L 5DWUH 4OD2A 4S2SB 4Y0GA 4F33A 4D8PA 2G2RA 1HX0A 2F8VA 5F1SA 4UZGA 3ZSSA 3O6FB 5IW6A 2HT4C 5I0WA 1BM3L 4LLUA 5C7XH 3WTXA 3ZIMA 2PW1A 1M4KA 3CXFA 4N3TA 4EN3A 5KYWA 4CVWA 4R8WH 2X2IA 5BVPH 5CEZL 4OZIB 1DQLL 2CLRB 2WP3T 3IJ8A 4AV5A 1TTBA 4LCUA 4N0CD 2EVFA 1ZV5A 5DI8B 4OH2A 1ZJAA 2P5WE 2YUWA 2YXMA 1R75A 1SBSL 2P8MB 3WO4C 3T09A 4WHDA 4XB7A 4TQ8A 5DD5L 3HZKA 3OKMA 5C0DB 1C7TA 3PWUB 4U1JB 2IAAC 4MNQB 5DRWA 1UQSB 2OL3H 3AT0A 3NSCA 3O4LD 3S88H 2R51A 3EF7A 1JFQL 2ROYA 3ZMNA 1J18A 1MI5D 1H15B 4FG4A 3O3AA 4A7GA 4PTTB 4P5TC 3B2UD 4JRYD 4DK6A 4F3FB 2HLEB 1ACCA 3EO0B 5DJYB 5KSBB 4YSPA 5HHQA 3QGVA 2JQZA 2UX7A 1BAWA 4F91B 2YOCA 3HPJA 4UTAA 2K78A 1XGTA 3EH4B 3L6FA 1MW2A 4LF3B 3DOSA 4OLYL 3BUYB 3GHBH 4JPKL 4R5XA 4H25A 5CJQH 5C09D 3WN5B 1FV1B 4J28A 2PMZA 4JRXA 1IVTA 1NCTA 2ORBH 5LNEA 4PWEA 3QXUA 2ZWZA 1N68A 4UF7C 3VDCA 4N2CA 5FYJD 3LN9A 4MB5A 1U8QB 4LLMA 3VH8A 1A6UH 1RZGB 5TD4A 3F65A 4YDZA 5D1QB 2V2TA 1CGSL 2QQNH 4JDTL 3FSVA 3G9VA 4I89A 4C4KO 2V7NB 2P5ED 4S10A 4APQD 3VD3A 3KGRA 4Z7UA 2JCCF 4POZD 2FD6L 3VA6A 1OHZA 2QMKA 3PQYB 1JVKA 3LB6C 4KX9A 4DUXA 1FZMA 5LBSA 1S78D 1CD8A 5D1ZD 1MCBA 1N2RB 1QNZH 3IDUA 3D3VD 3S48A 3IKCB 3ATAA 2BSCA 1BIIA 2XXCB 3OC5A 1PZCA 5J56B 4R97B 5F9AC 4NO0D 5FYKL 5IHBA 3L4CA 2IXQA 2J7LA 2MPVA 4BINA 1CB4A 4YHOL 1KB5A 5TQ0H 4Z3TA 4Z7QE 3FUKA 3UX9B 3K6SB 3MRCA 1OCCB 2Q6WB 3TPUB 3ZDYB 5BCAA 4JHWH 3M1CA 3VI4A 3B7SA 4F9LA 3GTVA 3U4EA 3VGEA 4R97C 4O2FA 2WIMA 4M6OH 4EZLA 1UUNA 3EH5B 1SQ2N 3U7YH 3UTTD 3LKPA 3VUAA 1OAUH 3U4KA 4N2AA 5KBKA 5DHEA 1TJMA 2IOMA 4UV4L 4GYBA 1T89A 1RKRA 3QEQA 3BP6A 1PTZA 4WFHE 1A7QL 4EVNA 3GJEB 1WG3A 3HUJF 4YAQB 3MU3A 4QOKD 2V5SA 3FQ2A 3NSJA 3C60B 1A6AB 3AACA 2J2ZB 5F9DC 4XP9L 1ET7A 1KJMA 4GRLA 3MLVL 1OTSC 1ZSHA 5BS0E 3EFDL 1JWSB 4HJ0C 5BZXA 2LHAA 2RJMA 1PEZA 5C0GB 1LO2L 4S0HA 4FDWA 2EYTA 1R3JB 5A2BA 3OF6D 3FT2A 4N1HB 4FFYA 2WXKA 1N64H 4PRDB 5KYYB 2EIMB 3GGWB 1KXTA 4WWPA 3D07A 4TSBH 2FJFA 1WWCA 3UAEA 3QEGH 3ZE2E 1EFXD 1SM3H 2DKMA 3DYOA 1U9KA 4I1RA 2PP9A 2Q7YA 3V0JA 2MNUA 3J27A 5EBWA 3T77B 4EI5B 4NKDB 5GRXG 4HD5A 5C0ND 5BV7H 3APDA 1A22B 2YMXH 3GBDA 3LEYH 4X7TA 1R9FA 2Q1EA 4LQFH 4WUKH 2BERA 2CWRA 2JJUA 5IFHH 1OARL 5A16A 2H32H 1T03H 1L0XA 1N0XH 4JFWA 2P52A 3QXWA 4L4VD 4FI8A 3TTSA 3FFDA 4UM9B 5SV3A 1BLNB 1DE4A 2YRLA 3ILQD 5BV7C 3ARDB 3IPEA 1R6VA 2FK9A 1ZTMA 4EI5C 4TV3A 3FRPB 4QTFA 1QBMH 3PUUA 1BBJB 3W0WA 3QZPA 4N6QA 4IDJH 3ZL4L 3P2DA 4MNGE 4TOYL 5CKAA 4IRZL 1XZWA 4JN2B 1A7PL 1AIFA 1P9MA 1ZJBA 3U2SB 3L5WA 2VCOA 2WTRA 4NZFA 4WHCA 4UV7H 1TCRA 2P42B 4H44C 2HVJB 3INUL 3IJEB 5SWZA 4LMQE 2AKRB 3K8MA 4WV1C 5LAPA 1TUPA 4NN5B 1BZQK 4ELKB 4UOQA 4NKMB 3RI5K 3TBSB 4Z7WA 1OV8A 3CXHJ 4HHAB 5AVSB 4L3EE 4MCZA 3R0NA 1QRNE 2M2DA 3ULUD 4AH2B 4G9DB 5JORA 4MXQD 4P2QB 5HJGA 5F3BA 2YXWA 2HTLD 1C5BL 1UFGA 4IIQA 2EYSB 2I69A 2D7TH 5FUCC 2HRGA 5BZWA 1EAJA 4KWUA 3VMOA 4EDXA 3VDAA 4X6DF 2R29L 1DQTA 2DYPA 1CIUA 3F05A 3WU1A 2CO6A 1Y6NR 3T9WA 5F7DB 1A1OA 2DEXX 4NBXB 3JT0A 2YUVA 3TIEB 2OZ4H 4J1UB 3OD3A 2CGYA 4RAUA 1FL6A 1MCQA 2JELH 3KYNB 3KHOA 3KG5A 1XCTA 4NPJA 3V0AC 2DQDH 3RX5A 3P4MB 4L9LB 4LSQH 5DC4B 5E5LA 3VI3E 1F4YL 1JNLL 1Z2KA 3PWNB 2IOIA 3ECBA 4IBZA 1UZGA 4PJEA 2WLJA 1CFQA 1MFEH 5JPNA 2RIKA 3SDDD 3TIDB 4L4JA 5EUOE 4LLVA 5D71H 5FV2A 5B1CA 5TTRA 3BSZA 3ZLQC 3MZTA 1KN2H 4XO8A 1R3IH 3QXTA 5E6SB 3P3YA 4XPGH 3RILA 5I1AB 2BY1A 1HWGB 3HBZA 1AHWB 3EFFB 4OJEH 2WW8A 2WMPA 2G2PA 5JNYB 4LLQA 4L9LC 2CHWA 1IC4L 1WITA 4JDZA 2PWDA 4PJIE 5HGAB 5D9SB 2V37A 4L29A 2VW7A 1EHXA 4H8QA 4KDTC 3JTSA 4XBPA 4N5ED 2B77A 4NPYA 4FF9A 4RESB 1MVYA 1FFOB 4WW1A 1CLOL 1K3ZA 3KXFE 5ISZE 3EOBB 4PJ9B 3H42H 4RMSA 4U1NA 1TIUA 1XMEB 5D6CA 3OZ9H 1KLUA 1RMFH 3NK4A 2H1LM 3APCA 1AHWC 5K1NA 1J1OH 4JPIB 1LEIA 4NN6B 1ZHLB 5GSVA 4ORZC 1D5BB 2VAAA 4LDOB 5CEXA 5EEYA 4MX7A 4O02B 4EZJA 1EEZA 1H6FA 3GIVB 3VMPA 4O02L 3VCLB 1UC6A 4ZOEA 2WOBA 1R5WA 4MS6A 1YEEL 2WXQA 4HW6A 5AKTA 2XSKA 3KBFA 1DQDH 3VXSB 3MRDA 2CGRL 2WQ8A 1J87A 2IG2H 3CZKA 5EOTB 4PJ9C 4AMWA 2ICWI 2A9NL 4WDIA 5JYLA 1K3IA 1U6AL 3MLZH 3OG6B 4AQOA 3ATEA 1LO0L 1LK2B 3HI6H 4N28A 3RJOA 1NICA 1XR8A 2AK1L 2C3HA 5I0YA 4MQXC 1T22A 4IRJB 3CFDA 4NBYB 3MHZA 1UZ8A 3LRGA 1HNFA 5AVXB 2AXJA 3GS4A 5D96C 3SBQA 1QOKA 3VD1A 2WKLA 2YS4A 1VZIA 2RCSH 1E5CA 3IRZA 1A25A 4K7PH 1UJ3A 4XNAA 1IGYA 5A1AA 5CD3A 2WXNA 1A8JH 4YBQD 4IRJC 1XCWA 1A6TA 5EPMA 3V7MA 3GMMA 4ES9A 3BD3A 3L08A 5E2VL 3EJZD 5FXCH 1H3GA 2YMOA 4DWHA 3U0WL 2Q8AL 3LKQA 3ULSB 4ZQKB 3TNNB 3VFTB 2AEQL 2VE6B 2XETA 1FH2A 1MFVA 3BKYL 1VJSA 5J6HA 1WF5A 2UY7B 2EE0A 1T1XA 3MBEA 5KANG 3ARGD 3BGMA 3QFJD 4X5WA 5GGQL 3TJEH 3I3DA 1FZKB 4E9LA 4ZMWA 5ITBH 5FOJA 4PWKA 2DH2A 1SYSA 5C2BH 3L4YA 5I18L 4JFHE 4MMXC 5FC9A 5CGTA 1A6WH 3GLDA 4RX4A 3S2CA 3MLRH 4M1GH 1SJEA 4Z7VE 5IVXA 3GMLB 3VH8G 1VEOA 1KGUA 4XI5D 2WQSA 3OPZH 5C08B 3RFRA 5EO1A 3MA9L 5TFSL 4ZS6C 3V0HA 2P1YA 4RFNB 4WI0B 3L3OC 3APMA 4YOKA 3SQOL 1FYTA 3N1QC 3KWWA 3GSNB 4PW4A 5HVHB 3GSNL 4PIBA 5T3ZL 1G7JB 1KFAH 2J8UF 3BZFA 3TWYA 1WAAA 1IILE 2GY7B 3IAQA 5BJTA 3IGAB 3QUXA 4JM4H 1DSFH 1F6AB 1U92A 1WBYB 3LRSB 3HZYB 2HH0L 1A7OL 1OT4A 4M02A 3T6VA 3AXIA 3VU1A 3ARBA 4EEEA 4RFOH 4MLIA 2ENPA 4P2CG 4U6YB 4NQED 5JDSB 2J25A 1I1RA 1UD2A 1IZJA 3C9NA 3AQDA 2XIDA 4Z7IA 4L0ZA 1A3ZA 3QULA 4MJHA 4JQXC 2OSXA 3E9UA 3IGUA 1S7UB 3NMEA 5GISL 5IMMB 2WXJA 4MA7H 5FUZH 3K6OA 3MGTB 5JPMC 1JXKA 4OB5L 2BRRL 1K8IB 4GRWH 4K71C 5AB9A 1R0AH 3N44F 1ILSA 1HH9B 2H0FA 5ENWA 2AXWA 2ZPKH 1OP4A 1X9QA 3BSHA 5I8KH 5J1AB 3E0GA 2HT2D 1UD6A 3O4LB 4L37A 3SQRA 3RAJH 4ESKA 5ADPL 3RFZA 4Y19D 3SE9L 1MI5B 4OJCA 2EKSA 3FQ1A 5FYLH 4EE2A 1BX2A 5IK3B 1AP2B 1ZEAH 4KFZC 2ADJA 1XHHA 3H9HA 4B9FA 3ILDA 3CQQA 2PCXA 1JV5B 3MGOA 1N6QH 3AXLA 3ARWA 3H0TA 4Q56A 1BZEA 3PDOB 3S3CB 3KPQA 5HD8D 4TVPE 4PGCB 4AYFB 2XKSA 4L8SC 1JGDB 4N0RA 5C09B 4JO3L 3RURA 3ULAB 4X80L 2AXFB 2J72A 5JIQA 1R3KB 2HLFC 3DVGA 3MODH 4F8LA 1YYMH 3BXNA 3RI5F 1EFQA 3RNQB 5FYJL 3RWCB 3TURA 3GJFB 3DHPA 3NIFF 4PJGF 4ONFH 2VR9A 1U3ZA 5D7HA 4FP8H 1D9KA 4AEHL 5IWLA 3EYOB 3GJFH 1B90A 3FQYA 5FO8B 1AG6A 4APQB 5IROA 1VGKB 1RV6X 4GNKB 1DBJL 1RK0A 1T66C 3HFML 2VERA 3TEYA 4MYPA 5HHNB 4OTXH 1YQ2A 5DJ8A 3CU7A 1M7DA 3NIDF 3CZFA 4L8BB 3KZ8A 2VABB 2XWJB 5D1ZB 1I1YB 1IQWH 4R7XA 1FNFA 2YK1H 1TJGH 1JZDC 5J9PB 1XH0A 5L4MA 1BJ8A 5FFLA 1DBKH 4NO0B 3E6HA 2JXMA 2VL5A 2FNBA 3PXHA 1H9VA 2QZQA 1I8MB 1UT1A 5J3HD 3HVNA 2BVYA 2E6PA 3QC5X 4G8FB 2HKFH 2LOEA 3BGFC 4U1MB 3QFDA 3VFGL 3QO1B 3MV7A 1NOLA 4OD2B 1T6VN 4F33B 4NCC2 4UOW0 4A04A 4EPSA 4YO0A 2GCYA 5IW6B 1FRGL 3UC0H 4ZTEA 2OMZA 3H3PH 4F7TA 4QRBA 4Y4KC 2OTUB 3EADA 1UUSA 1H6TA 2CHZA 1CDUA 3MRNA 1WS7A 1ZLUK 1IJ9A 4HWNA 1X9LA 3V6ZA 1N9PA 2J55A 1RJCA 4LNRB 2EE2A 4LXFA 3VWKA 4KV5F 1X5XA 1T21B 4UTCA 4AOFA 4Z77A 3T0VA 4RNRA 3GF8A 2EDRA 1LNUB 3KDMB 4HUXA 4NGHL 4Z1PA 3NZHH 5F9WB 3C08L 1JV2A 3IMUA 3ME0B 4HC1A 5E5UB 5D7JA 4TPRL 2A9MH 3RGBA 3ZE0F 4A66A 1BCIA 5JMOC 3TO4B 5DS8B 2GTZB 3P69A 2EUWA 3QE5A 1OSYA 3E1ZA 3B8SA 4P2RA 4EN3C 1AOHA 3IMSA 5D7LA 2OSLA 2E6JA 3M17A 2B16A 3BH4A 2RB8A 2V5MA 3V5DA 3NQKA 3UPAA 3HPJB 5D72H 3X2QB 5JOPE 2BK8A 3DOIA 3G5XA 4Y5VA 1YC7A 3L6FB 3VFUB 1XSIA 4PP1D 4JRXB 4M7KL 4MASA 1G0YR 4YQXL 3BUQA 1MFDL 4UTAH 5JHDA 4G1EA 4B5ZA 3CFMA 4TVUA 3TH3T 1IIKA 3EDJA 3FH5A 4NZDA 2CA4A 5ALCL 1LDSA 2I9LA 5K59F 2AK4E 3UBXA 1CFSA 4LKCA 4MD0A 2GFBA 1VACB 1KBGH 1H3PL 1CZ8L 2CUAA 3ETBF 1G9NL 2O61B 3MJ9A 3D0VA 3KWVA 3DO4A 4L4VB 2CBMA 43C9B 4OZIF 3OSKA 2CCVA 3P30L 1FZMB 4Q89A 5EZLB 4N90D 5G2NA 4JFSA 4JPWH 3DJZA 4F80A 5IREA 2XX1A 1UG9A 5D55A 5E51A 3QH3B 3V0WL 2JTDA 5LBSH 3RZCD 1L0PA 4APXA 1J8KA 5AEAA 1C8PA 2AEOA 4ONOA 1KLGA 4JHVA 3QXDB 4P48A 5DEGB 4E9SA 4FI7A 2VDKB 5CGYD 3U9WA 2VDKL 1J5DA 1NA8A 1QX1A 4NO5B 3MRCB 1MVUB 2EE9A 4PW9A 1FFNA 3Q8BA 5KTEL 3VI4B 1KB5H 3LEVH 4UB0H 5KSBF 1RH8A 3HCVB 1ZGLB 4PRHD 1N0LB 3VAEA 1MHEB 3U4EB 1KCSL 1YEHH 2DS4A 5DZOA 3S35L 4O2FB 4KO6A 3EYSL 4CUCA 5L88L 1TJXA 3RY6A 1RZPA 2VR8A 3HC3H 1G7QA 1UM5H 3ULUL 2XZCL 5KN5A 4I3SH 4U6TA 3WENA 1UT9A 1U8OB 2PYEE 3E3QC 4YLQT 1IGJB 1HQRB 2IPUG 2QQKH 5FGBA 1RZJH 3V4PB 3BP6B 1M1SA 4M9PA 3V4PL 2A9BA 2X4UA 3BAJA 3C5ZD 2MCAA 4IOFC 3V0IA 4EVNB 4F9LC 3VSQA 5DVOA 2AXGA 5CD5D 5GGUA 2GVYA 4ZX6A 5CLWA 4XMPL 1A02N 1U95A 1PKOA 4PS4L 4GG6B 3EYUH 3FAWA 4JHAL 1FL5B 4GRLB 1KJMB 1RZJC 1PY4A 5IKCA 4JN1L 5GS3A 1MW1A 3O3UN 4HUUA 4Q6IA 1O7SA 3BPNC 1H3UA 3UYOD 4L8CA 3GRGA 4LASH 5AFAA 1MNNA 1USZA 2E5EA 4PYGA 3FT2B 1T89C 3WKPA 4ZFFB 3C6LA 5B8CB 3FC8A 4KX7A 4LEEA 4QTIL 5LWYL 4X4XA 4L1SA 1KXTB 4WU7A 1PEWA 2B59A 3X3FH 4QRPD 2NSXA 3P1VA 4G3YH 1IGTA 2BVOA 1FIGH 4TM9A 4FFYH 3TBVA 4K3JH 3ZDYF 4DGIH 3H9YA 5E8PA 4GRLC 1J12A 4HUMB 1OE2A 3QJQB 1EHKB 4YDMA 2JQMA 3FOMA 1WYJA 3GPEA 1OTUD 2AJ3B 2P5WD 5GRVK 5BRPA 3DGGB 1QSFE 3DX3A 4XVJH 4RQQA 4H7VA 3WCYA 3QHFH 1UD8A 3X14A 4EF3A 4JO8A 2CPCA 2R2EA 3WEXB 3L3DB 4FQJH 5DRNA 5C92A 1KG0A 2ARWA 3EG9A 1BYPA 3DK2A 2VDQH 1E4WL 2SEBB 3P77A 1PMYA 1TZ8A 3EJQA 5E7BA 5BS0A 3CBJB 3LKOB 5I8EA 3WFEH 4BZ2A 5AWNH 4M5SA 4AC2A 4QPEA 1X5AA 2VERN 5T1KA 3ULVH 1QWHA 1W0WA 1HEZA 5AZ2H 1H3VA 2WGXA 4BHUA 2VDNH 1PJWA 2QPEB 1ORSA 2X2YA 5DD3H 5B4MC 4CMHB 2AQ1A 1CCZA 1QASA 1TCRB 1M56B 4LGSB 1W2KT 3VXPA 5FM5M 2C4XA 4LBEA 1F8TL 3NJVA 1Y07A 5DJ2B 4HVBA 3ULVC 3MRBA 3ZKQD 2HJKA 2LGNA 4JNXA 2ZUQB 3KYMB 4RZCA 3RWEA 4KK8C 3MJWA 4G5AA 4LKXB 3VRIA 3IDMB 4MCZB 2AV1A 2VMFA 3D4GA 4NUGL 1OAKH 5JORB 1M3IA 1IAIM 1RQ5A 1P9MC 4BRVA 3K1DA 3KW7A 2Z31D 4EOWL 4C58B 4EDXB 2V3FA 5CP7B 5C0AB 4TQHA 5CIPB 5G4NA 3ARUA 2ZF9A 1TU2A 3BIBX 4TSAL 5D7KE 3MBXL 4YN3A 2CO6B 2PTUA 1IIIA 3KPLA 1CE1H 4IBVA 4I7ZC 5FPIA 4MNGA 3UO1L 3N55A 1BMWA 1IBGH 3KM2A 3VXMD 2GQHA 4RZKA 5GS1A 5JMRA 5E08L 2F53B 1EX0A 3ZHKA 1FL6B 2ZZUT 1TYJA 4N2OA 2AZAA 1NGPH 2APBA 5FAAA 3UZEA 1MXDA 1W0YT 4KKAD 4IIQC 3BZDA 3VFMA 1PZAA 1MCRA 2ZYHA 1K2DA 2RAMA 1A5FL 3ECBB 5CJXA 1JYVA 3TVMD 1T3FA 5I8OL 1P7QA 3BVVA 4M6MH 4HXAH 3NRFA 3EYQD 1QRNA 1U8CB 1TZGH 5JW4Q 1RIUH 3NFSH 5HYJB 1A1NA 2Y07L 4YHYB 4LU5H 2A6DB 5FHBH 3D05A 1GJUA 1I7UA 4K3DL 3QVAA 4YDJB 4LLWA 4XPBL 1ZT7B 3VQ1C 4YWGH 2WMPB 1MHHA 3FFCE 4G43B 2IAMA 3PF2A 4WFHD 1P5UA 3FZUC 4LAJH 5JPNC 1YNLH 2JKXA 4JFOB 3KYAA 4X8JA 4G9FE 4NM4H 4WW1B 4HSAC 5CZXC 5TE6H 5D6CB 3VFPA 4PBWD 3O3DA 3IFLL 1PFOA 3FQWB 3VI3A 1LEIB 1M71B 4BEIA 1GAFL 3QR1A 5DTFB 3TWCH 5SX5K 3TN0D 1EEZB 4WHYG 3STZB 3KS0J 2JIXA 3WE1A 3UCRA 5SV4A 4QGYA 5EUOA 3NOIA 3SPIA 3BUTA 3DX0A 3PHQA 4BZ1A 4KVNH 2N4IA 2IMMA 4Y2DB 2F1BA 2V2XB 5AD0A 1QMUA 4BK4A 1DLHA 3L4VA 2JV6A 1ADQA 1H5BA 3KPOA 4YVUA 1JDAA 3BKMH 1XIWA 4DN4H 4AJWA 4MDRA 2BVQB 1AI1L 3NAAL 4LVNB 1G1KA 3Q5YA 3WKQA 1AFVL 5KUKA 1MRDL 4RIRA 2NYZA 5HI3C 3L2MA 2G75A 2DQIL 1G7PB 3MCLH 1I9IL 2J6EL 1ZTXL 3OMIB 4ZX3A 5J6GA 2EO1A 2AMUA 5EH1A 1TTCA 4MDIA 3KXFA 4MMYA 2BVPA 1BZ8A 2DLEA 3KWUA 1OW0A 2X89D 2IBBA 5D2NA 5HI5C 1HHHA 1IE4A 1VSCA 1WWBX 2Z4QA 1QTPA 4HLJA 4Y19B 3NABH 3RWGA 4YHKH 4CKQA 4FJ6A 4KJWC 5CD3B 1IGYB 2G9HA 3IJYA 3X11A 4BSVA 4MA3B 1SY6L 1FGNL 2ZX9A 4U7KA 4YZWA 4GB9A 5C8JA 3T2OA 3QDMB 3GMMB 4TLSA 4HKBA 5DXWA 25C8H 4LOUC 5BRZD 3HBQA 4MVBC 1L9RA 3FW6A 4NWTH 2XIBA 3ARFB 3HS0B 1JTPA 3DSFL 3B34A 5KJ4A 1T1YB 3QIWA 3I3EA 4RAVA 4BUHA 1BJ1J 2ADFH 2ARJB 2NY5L 1WA1X 3TA4D 3BE1H 3F7VA 1OGTA 1UJ3C 3BYTA 5J6HB 3CDFA 4L3ED 2JVUA 5IT2H 5CINH 2Y7SA 4ADGA 4JAMB 1R24B 5LO7A 4GKNA 3GMQB 4PGBA 1KB9J 3BCDA 4P9ML 3T2NH 4X6BB 3CFQA 5TF0A 4CC1A 1VPOL 4KXZH 3F7QA 1UOKA 5LXGL 4Z7NB 3IS1X 3VRJB 2BNRD 2UZIL 3BIKA 2Y5QA 4RGOH 5JW4R 1RVFL 2WPGA 1CFNA 1TG8A 3IU4H 3DROB 4GAJH 5F7NC 3EJRA 1FNLA 1QUNA 4PRNA 3UBXG 3HHMA 2BCMA 2BC4A 3TV3H 1BQ5A 1NINA 3SY0B 4P04A 3MBEC 5DHVA 4JJHA 3CUPB 1FYTB 4M7LL 1HAUA 2GI0A 4MAYA 2C9XA 3PREA 3BZFB 1JZHA 2WBWB 3NZ8B 4OJAA 2IPTH 4X98B 1CYGA 1IMHC 1I9RH 3NN8A 1A3RH 3QUXB 3WMQA 3ZN6A 2F7RA 5HGDA 3JYBA 4W9FC 5KSAD 1WK0A 1CFTB 1HKLH 3FAXA 4OGAD 3MKGA 1ULVA 2YWZA 1AMXA 5LQBL 1T2JA 5F89A 1QRKA 2NY4D 3ARBB 3RVVD 1MREL 1PZ2A 1FNAA 5ID0B 5I1CH 5E95B 4ZNEA 4J39A 4FA6A 5HYSA 4JY5H 5IBUG 1JTOA 2PYFA 2WOYA 2E56A 4XCCL 4XH2B 1OCZB 4FYRA 4PWIA 2NR6D 2HKAA 1I85A 3GZOA 5I71C 4LHJB 1AQDA 5HYQA 5LGHH 4ODSH 3PDDA 4YBLC 4HETA 2M8XA 3ERXA 3QUXC 3LYRA 2VUOA 4PWFA 4PY8J 1QO3B 4Z7VA 2ZICA 4HPYL 1I7ZB 3WHE1 2QVFB 3LKSA 2AC0A 3ARBC 2JWYA 2EVHA 4KZDH 3O8XA 5ENWB 1B3JA 6TAAA 1HNGA 3QDGD 3BFWA 4O2EA 2IH3B 4XPTH 1F86A 1U3HD 3RIFK 1MRFH 3QUHA 2FIKA 2R8SL 2X0VA 2E76C 3VG0L 1CTOA 1K9TA 3QARA 4KXAA 2Z8RA 2EKSB 2ZQKA 1XQ4A 2K3TA 3I6LE 3HHRB 4QEGA 5AZEH 3Q3GA 2HJFB 2QFPA 3LKRB 3NJJA 4OJFL 4QO1A 5GZND 4K8RD 4CADB 2D4FA 3EDKA 3CWGA 4G6KH 3U0PA 1HOEA 2K3HA 3KEDA 4UTBA 3DDFA 2Z34A 3D48R 4J23A 5EU6D 1BZ9A 1F6FB 4GI6A 3TO2A 4HWEH 2AAAA 1DQQB 4FFVD 3BUIA 3WEOA 3RFZC 3MRQA 1Q72H 1CGXA 1J11A 4Q9QH 3HIZA 3O6KL 4KH2A 1IGMH 5KG9A 3P4OB 4Q0XL 4U1KA 1KGJA 5CR8A 2XHNA 4N3UA 5DZVA 1MJUL 3S2AA 3JWOL 4R7DA 1D9KB 3EHBC 1BJMA 3WFCL 3CX5J 2O5ZH 4FYQA 5E8EA 5EZIL 4N2DA 3N6YA 1U8JB 1Z3RA 1A66A 4BK8A 5E2UH 2YBRB 4JFPA 2P45B 4MB3A 4WW2A 1M7DB 1I8UA 4XPAH 4Y4FA 2NX5B 1EZSA 1OAZH 1MUJA 3CH1B 4QTHA 4JFZL 3IGFA 4AV4A 5JO5A 1U42A 1GMIA 1OGAD 2FHCA 4R4FH 2FECL 3MCYA 4NDMB 5F7EL 4FQ2H 4X83A 1QLRA 1D9KC 2WVVB 5IWLC 4AX3A 2OJEA 4GSDL 4EBQL 2GBAA 5IROC 1AACA 2ZE0A 3QQXA 5FW6A 2IBGA 4YHNA 1X9RA 3NP3A 2DBLL 3ESMA 3MV7B 2DLFL 5IQOA 1EH9A 5BOJA 5JOEA 1E42A 4N9GB 3FT4A 4PRHB 4U3SA 4MA8L 4S1SH 2XTJD 1LK3H 3US0A 2E7BA 4W9ZA 4BH8B 2NY1D 2OMZB 1D5RA 4F7TB 3GHEH 3VVWA 4FERA 2RGSA 1NAMB 5DJZA 3NFPA 3VFSB 4L3AA 2DKUA 3MRNB 1DQIA 1GL4B 4FQQB 4FNLL 4KK9D 4F57H 3SDXB 1HC1A 3WSQL 4F20A 5A43C 3BWSA 4Z77B 4H26B 1SXCA 4RNRB 2XBDA 3X1EA 4MKMA 1JHKL 1MAJA 1FBIH 1NANH 3FT1A 1O6VA 2BOCB 4FNSA 5D7JB 5LGJA 2E7DA 3A67H 4HAGA 3LXUX 7FABH 1CFVH 3PJSA 4S1QL 1N8ZA 4HC1H 4O2CB 4P2RB 2BSSB 1KIPB 5FS5A 4OLUH 1GGUA 3IEAA 3M17B 5GJTH 1B0GB 3WD5L 3G6JB 3VWKC 4AM0Q 3F85A 1E9QB 3X3GH 3WTSA 1W6WA 2LLNA 2FO4A 3CFJB 1K5WA 2JFCA 1HHIA 3DYPA 3BUBA 1J5IA 2K8MA 2DICA 4XX5A 3FQTA 3NA9H 5D7JC 3TCTA 1FVEB 1FORL 3V5HA 4YX2H 4W4NA 3WDHA 4TSCH 3FQNA 4RETB 1I3UA 5AVWB 2YARA 1YG9A 2VSCA 4JRYA 1BFVL 1WD9A 5EG6C 2JK5B 1P2CB 1AGCA 3CZSA 2P5WB 4LKCB 2ICWJ 2GFBB 1DL7H 3AAZB 2FZ3B 3QG7L 4QRFA 3SJVD 3TBTA 3WIHL 4ANXA 2F5BL 5DVPA 3FUEA 5DA4A 3VJ6B 5KYXA 1VLXA 1LP9E 3OKDA 3QPQC 4Y5VC 2EIZA 1L6PA 2FH8A 4Q2ZA 2Z91A 1WSST 5IB1A 4M29A 3PGFL 2XV2A 1WA2X 3LIZA 1OHQA 2CLVA 4OI9A 4XOCA 1FLRH 3GSOA 5DUML 3MJ9H 3KPNB 4J4PA 3QR0A 4NHUB 5I1LA 5KSVA 5GRWA 4BSJA 1UATA 4JK0D 5KW9H 12E8L 3QAZB 1BVOA 5GRZA 1R3LB 2XTSA 4G59C 1JYNA 4H8HA 4I9WD 3M86A 5D5ME 2H2PD 2P5EA 4FZEH 2HFEA 1NUGA 4TQIA 4KO7A 3EDFA 3F01A 1NFDB 1NIDA 2E7HA 5AVZB 1E6JL 3UJTL 2FJUB 4Z3EA 3QNXA 4L4TD 4AENB 4TNEA 1OTTC 4QRSA 5KBPA 3DRQA 3T8XB 4KKBC 4KKNA 4L1TA 1I31A 2BP0A 4R7LA 5EA0L 4ODHH 4FAAB 3L95A 1GGTA 3S4SB 3RWIA 2CO2A 5KVFE 3RWJA 1G7QB 4LCYB 5HTSA 1QW9A 4I0KA 1A2YA 1PAMA 2WLZA 3BZ4B 5J12C 4B9GA 4U1LA 3FB8B 1WEJL 2GG1A 3WEMA 5F96H 2R9HD 2QV2A 2A5UA 5I17A 1UD5A 2I9TA 5EC2A 3QJZA 4DEUA 2FWOB 4PCYA 4H88H 1G7IA 1YEIH 5GGUB 1JZFA 4F7EA 3RY6C 2XRAH 3Q8CA 1HHGB 4FQIH 3UTTA 2VZOA 4Z7QB 1BM3H 5IKCB 3VGAB 2ZKMX 5LUMA 1ES0B 1F1AA 2BMKA 1T0OA 2A0LC 5TQ2H 4BSWA 1T1WB 2UZXA 3I9GH 4NQTA 4X4ME 4A55A 4UAOB 5FGBC 1DQLH 2DQMA 4WU5A 4KITB 5MEQB 1BAFH 2ZCHL 1D5XA 3C6LB 3TVMB 1TPXB 5J7CC 2FSEB 2VXSL 3ESVF 2EIKB 4X4XB 4UUJB 1F3DJ 1L9NA 2ED9A 1J1XH 1RJLB 3CFUA 4WGKA 2I60L 3IWUA 4MLSA 2A9CA 1IJNA 4U4IA 4UZUA 3VI4F 2BH0A 4MJIE 4BQBA 2PYEA 4Q6IC 5DQDL 5LGYA 5K9QG 1JFQH 1W72A 5D7EA 4K23L 3L3KB 4XP6H 4ZPVA 1XR9B 5FECA 2V8MA 1U93B 3RX9A 1GS7A 4ZJ9A 4HP5A 4X9YA 3EJUA 3C6LC 3CVDA 3MUGA 1NLBL 1ZWIB 4NOBA 1S9VA 5KVDE 4AM0A 2JB5L 1KG0B 3EG9B 2Y7MA 3SO3C 4IK7A 3GSWB 4OLYH 3KPPA 3P77B 3EFOA 4JPKH 3V52L 1LEKB 3MUUA 3T1FB 2W0PA 3S5YA 2CK2A 1LEGA 4KMLB 3TN0B 3B2VH 1DJZA 2YSSA 3GD1C 1U4FA 4GG6F 4WNSA 4JL2A 4BZ2H 4JDTH 2VMEA 3V0GA 2GB2A 1I8AA 2EILB 5KVEL 1F1DA 1A4JA 2H26A 3BFOA 2MTAA 2Y3NA 3M8OH 3VXPB 4QR7A 4LBEB 4Z5RB 3IDJB 4KROC 2OX5B 3MJ7B 1DVZA 1OAQH 1CICA 3Q8EA 2AK4D 2HJKB 5EU4A 4DP8X 2Y5TA 2GJZA 1TEGA 3O0LA 1QSFA 4OVVA 3EOTL 4HQQL 2BVEA 4BDVA 5I76B 2C1OA 2CH8A 4J2XA 3QCVL 4KFMA 5E2TL 2W0FB 4J5VA 2R2BA 4YHOH 5GHWH 5HYSG 2V8LA 2P43B 1G7MA 2NNAA 5DJ6A 1JAEA 2PW2B 4CVXB 1FCGA 1TU2B 5TDOA 2ENSA 2WLMA 4YSTA 3BPOC 3WNOA 3L3JA 1M7IA 2X88A 4AUUA 2C7UB 5B1JA 1CU4L 2OMTA 1NIBA 5IGXH 2H3KA 1URIA 1ZVHA 2FYVA 3CFBB 3ULVF 1HOCB 2FEEL 5DS2A 4KY2A 1TENA 1DZ0A 2NQDA 3NJIA 1IBBA 4HG4J 3VFMB 2Y69B 2D03L 1K2DB 1PW3A 5MENE 3W56A 3NBNA 3DV4B 2BVUA 2X3CA 4L8DA 5GXBB 1A7QH 2EDHA 2ZSVB 1A7RH 2EYRA 3DJRA 1FA4A 1A1MA 4L3EB 2H3NA 3EYFA 1IBDA 5GS1C 1D7BA 1TO5A 3QDAA 4XVSH 3VX0A 5BMFL 1KCBA 4OIAA 3T2PA 4PREA 2DEWX 2WXIA 4FD0A 4X9IA 5F97E 4C54A 2D7PA 4LLWB 1UOLA 3UZEC 4XP9H 3GXIA 3O9WA 5AW1B 1MHHB 4AMKL 1NM4A 4BXSV 4RLDA 2IAMB 2DDQL 3NJXA 2KQNA 2BNRB 2W95A 2IGTA 1F4WH 2HX7A 5CJXC 2E9BA 4M48L 4DKDC 3ZGIA 1GYCA 1WWAX 4KHXL 4KRPD 2CPUA 3KBHE 1F3RB 1OD7A 3BWAA 4XNXL 1JNNL 3HEIB 4GIOA 4YGVA 5HY9A 4V33A 3AG4B 4ZOBA 5J4MA 1E8YA 2ZIDA 4YFEA 1FUNA 4ZNCD 4ZMNA 4EUPB 3VFPB 3TXAA 3B9AA 1CLVA 4N87A 2X4SB 2FYYA 1ASPA 1ROCA 2EDJA 2J88L 2VITA 2EKJA 4YDVA 4P3CL 1INDH 2IAMC 4XC1L 1F0LA 3BP7B 1P5UC 2AGJL 2EDWA 4JR9L 9PCYA 3BZEA 1CBVL 1NGXB 3UOAB 2AVFA 5KSAB 2NZ9D 4WCYL 3REWA 3TEXA 5EUOB 1VDGA 2NNCA 2NY4B 1SEBA 1OARH 3L3GA 3RE0A 1FPTH 1SQMA 4KRLB 3R8QA 4R83A 4W9HC 1B0RB 1NSNL 1JXJA 5DRZA 1JVOA 2DMKA 2YUZA 3HI5L 3OAWA 1SJVA 1QFHA 2OA9A 4YBHA 1E4KA 1VGEL 5F7LB 4BZ1H 1QFPA 1XIWB 2NZ1A 2XWBB 3FFCA 3A21A 4YR6B 5JA9A 3IFOA 2UZYA 2Z7UA 3GRWA 4PJIB 3VFVA 2IEPA 4V2CB 3VXOA 1F4XL 4UYQA 3SDYL 4Z95H 1QI4A 4G9FA 1FQ9C 1U4EA 2XN2A 2GITA 3VGDA 1KELL 2D2OA 5ISZB 3ZZQA 2XNAB 3EJJX 3K2KA 1JF6A 4QAMB 1U3HB 5EBGA 1WFIA 1HHHB 3LQAL 3S8WA 1LE9A 4PWHA 2X4OA 4PMFA 2Z4QB 3AFLA 3INUH 1H5BC 2MOVA 4JPQA 4K5PA 1AQKH 1XIWC 2ZXWB 3ABLB 1FN4A 2ZJSL 3D6GA 4A1RA 3X11B 1F11A 4HUWB 4B9JA 3B5HA 5ELIA 3ESNA 3BQUA 1NCBL 1OP3K 3S97C 2KL6A 3EXJA 5D4QA 1K5NA 3B9KA 4K8RL 2F68X 1M2VB 1YYLL 3RKPA 5GZOA 3UJIH 1Y0LB 4XNMB 1MCDA 4LRIA 5EU6B 1C5BH 3RL1A 1OW0C 1S8DA 4RAVB 4NRZB 3IDGB 1KENL 2NXZD 5D2NC 1W16A 2P80D 4P5MA 4AG4L 2R29H 5KANI 4P3DB 3WJMB 4ALAH 4Q9BA 5DU7A 4FQXD 3VE0A 4UYPA 4HHWA 1F13A 4P0DA 1FWXA 4F7PB 2Q9OA 3QBTB 3JV6A 3MRHA 3U1QA 4KTYA 1RSYA 3QIWC 3EXLA 4ALAC 2BWIA 5LGKA 1AGBB 3SGEH 1PFCA 3CN4A 3LZLA 3SDCA 3WE6B 1CDYA 1HL8A 3OKKB 4K15A 4E9RA 3D18B 2ITFA 2Q20A 1THCA 4Q74A 2OMWA 3T0AA 1QUNB 3FU3A 4PRNB 3NYKA 1NLDL 2HLAA 4R96B 3U46B 3ARGA 3QFJA 1HYSC 4AQ1A 2OMXB 3CQPA 1KNOA 1LDPH 3CTTA 3WNKA 3SY6A 1KT2A 1UOVA 1MQ8A 3AS0A 4FTDA 5DHVH 4R5TA 4F27A 5A2IH 3VD4A 1KYDA 1JPTH 2XZAH 2N1KA 3OKOA 5HGDB 2X6VA 1IC4H 3EBIA 3D4ZA 2XCMC 4IQHA 2NT0A 4GBXA 5HXMA 5F89B 3HPLA 4TTDC 3SZ6A 1B6UA 1KPRA 1Q4NX 2GSMB 3C2AL 4GUOA 4AGLA 3V8OA 3OB0K 2NY1B 1HCYA 5IEHB 4LE8A 3ESPA 4MAYC 3WLBA 4ABQA 3D34A 5L9DH 2AI0L 1J05A 2VO8A 4NQXA 1MAKA 4MTMA 4ZK8A 4RH4A 3MRLA 1FL3B 4BA0A 5EEVA 1PX3A 1WFTA 3RP1A 2ZCKL 1QNIA 4JZOB 1X3DA 2EDXA 1H8SA 2J12B 2VN3A 4NQEA 3LN5A 4M7LT 2X40A 2HT3C 1YEEH 1KBWA 4FABL 4HDIA 5GGSA 4Z7NF 4YHZL 2FBOJ 3KJ4B 2CGRH 3G9AB 3HC4L 3IU3A 4XZUB 1I85C 5D4IA 1OM9A 2VRQA 4PJDB 5HHPA 4HKJB 4QO1B 2J1WA 1JUFB 3T6XA 3PP3K 3B83A 3WOVA 1HSBA 4XPHL 3EO1A 5A40E 1DBBH 3O8XC 3QO0B 2EXWC 1NCDL 4K55A 4N2NA 3CCHB 1DN0A 1FZJB 1BEXA 2VXUL 4H8WL 3I75B 2V5TA 5DO2C 5DZ9A 1JGEB 5DC9B 3DX7A 3LXBA 2WQVA 3KJ4C 4UTBH 1SUJA 4HAKA 4CMMA 2PWGA 1SY6A 5HJDA 2VISA 1UD3A 4JKPL 3BH9A 3G08B 5CLXA 3RU8H 4YXHL 5KG9B 1N70A 5HDRA 5HHOD 1CD0A 1RU9L 1RULL 3C75A 4M3HA 1N59A 3SJVB 4AYGA 2Y2TA 2GK0B 4G80B 5ESQA 4KY1L 3EH2A 1QFUL 3QB7C 3VM5A 3HE7D 4ZUVA 2GTQA 5K9OB 2GC4C 1MFCH 4N2LA 2IH9A 5FIEA 1ZHNA 1QR4A 2C7FA 1BZ7A 4QTHB 2WN3A 5IMOB 1JNHB 4MJ4A 2OQJA 2AEQH 3FB7B 1XXFC 1ZHKA 4ZXBD 2VC2H 3FHQA 3MNWB 4Y2NA 2L7UA 2YD6A 1YEDA 3AWFA 2B2XL 4KHTL 3WEBA 2OR9L 3BO8A 1MKFA 2DQJH 2OS7A 4GO6B 3T0ED 2OSYA 1C1EH 1CXIA 3LY6A 3RVUC 1MVFA 4KQ0A 5T1DH 5I18H 1MWOA 4HAFA 1QEXA 3SYOA 4WW2C 1ZT1B 4PGEB 4JFEE 4RGND 4Y4FC 4JFDE 3IJHA 4L4TB 1EZUA 2LU3A 4NNXA 5LNDA 1FDLH 2P48B 5IJVA 5E6IA 5LBGA 4ENED 1OSZA 3BP5A 4I3RL 2BS8A 3G6DH 3NK3A 4KNUA 1X5LA 2V9QA 1KJ3H 4UT9L 1AGEB 3SQOH 4OR1A 4G7YH 3EOAA 2XN9E 2J5LB 3FQUA 3DHUA 3MC0A 4I2XE 3TFKD 1KEML 4W6WB 5ITFA 1IL1A 2CKBA 2H9GA 2OP4L 5CEYB 4QCIB 2VLRD 4BFOA 1XF2B 5F3HA 2NCEA 3PFQA 1E7VA 2HH0H 4XO5A 3RA7L 4KU1A 2GJ6E 4HD9A 5L4IA 2NOYA 3CK0L 1FO0A 2XWTA 4B60A 4UM8B 5AYTA 1TDQA 2WXMA 5CJBA 1BQLL 3HBGA 3IMVA 2QQQA 3O41A 3DX6A 3GIZH 3QYCA 4Z0XB 4UIKL 4M62L 3QORD 2F5AL 3OPUA 4JCWA 4X99A 4G42A 3O6LH 4F8TA 3BH8A 4HIEA 3MYJB 3AREA 2EACA 3DUUB 4G6JH 3QDJE 3FTSA 4I0PA 3DA0A 3GPSA 3IAPA 1WHPA 4PW3A 2OAAA 1MPAL 3I50H 3U6XA 3IJSA 3SE9H 3WXVL 4BUGA 1ZV9A 2ISDA 4E41E 1PG7H 2IPKB 4QXVA 3T8VA 3F7KA 3WDJA 4R26L 3IDXL 2A38A 3OKDB 3ZYJA 1Y6MR 3HMXL 4Q2ZB 4Z0BL 3KAAA 3VXRD 1S9WB 1Q0XH 5GRUL 2ZXGA 1NBVL 3SDXF 3Q6FA 3HI1A 2P24B 2J1YA 3GSOB 3UDWA 1A3QA 1I8LA 1NGWA 2QVMA 3T4AA 4PJBE 5KSVB 1H3WM 3FCBA 4QNPF 5I9QB 3HRZB 3LIZH 2CDGA 4U6XA 3IMBA 3A22A 1HDMB 4P46A 5FYJH 4YHMH 3SCMA 3A4FA 3US1A 4TS6A 2ENQA 4NNYA 3PNWA 4N8VB 3VXQA 1EJ8A 2FL5A 2NY0B 3FHAA 1S5HA 1WTLA 3DX2A 2LABA 3HAEA 4R90H 1T20A 3G6JF 1DBJH 1UH4A 2Y7QA 1JYXA 2BWQA 4N0UA 4JUTA 1YN6A 4J4PC 3C5XA 2MCPL 2VRAA 3G6AA 4QRSB 4OM1L 3SBWA 5I9QC 5BQDA 2AK4B 2RR3A 3RZCA 3FTVA 1KOAA 3G5VB 1U21A 3UYRL 5SX5H 4G6FB 1BZDA 5EOQH 2AQQA 3LZPA 1ND0B 3QWQB 4Y9BA 1KGYE 3HLAB 2FX8H 4DW2L 4TYUA 1MW3A 1WE5A 4HPOH 3H3BC 1B2WL 2YGNA 1N5AA 3C8KA 5KJ7E 2H0PA 3MV8D 4E42A 1UXSA 4H1LH 3UCQA 5FUOL 1GR7A 2HPTA 4NHCL 3C5JB 3LOWA 3F7LA 3KD4A 4F8OA 1RLWA 5D5MA 3S8GB 2GUOA 4XX1G 1HSAB 2G60L 2IFFH 2LFEA 3HJEA 4DEWA 5IFJA 1FRGH 1TJIL 2R56L 4X7FC 1FC1A 4M43H 4N20A 2BMKB 3ZDXE 4ADIA 2OXHB 1ORQA 2BSRB 1TLKA 4F58H 3TS8A 4M5TA 1ZAGA 1Z9NA 4WU5B 4G8EA 3D2UA 2DD8H 2BWDA 1XSOA 5C0CE 5T5NG 5ESVA 3P3RA 1QZNA 1JZ7A 3BVXA 4IS6A 4O51A 2CXKA 2BNUB 2E7LA 1NFDF 4TPRH 4GQ9L 2VXQL 3Q9QA 3JWDH 3BVNA 2EABA 3POHA 4QRTA 1OAYL 3V6BR 2N56A 1U58A 2YQGA 4WO4A 3QHTC 5T1LD 3P0YH 1NMBL 1PU0A 4AT6B 4ZSOE 1T04A 1ZLEA 4JQIA 3RJDA 4HWBL 1BEYL 3IXTB 3L9RB 4KXZI 1U91B 1W72H 3H2PA 3MUGB 4KRPB 2V2WA 1S9YB 3LRHA 3JWDC 3GM8A 1NUFA 2I07A 2WO3B 4QRPA 5BVJB 3H7BA 4XPFL 2P4AB 3E8VA 2AF2A 3QUZB 5HHMD 5M95B 5A7EA 3SD5A 4X4ZA 4NPKA 4P57A 4DETA 5IR1A 4X4MA 4MHHI 4E0RA 5I66B 2VYRE 2VKWA 4NLHA 1I1AA 1UEMA 5I6NA 5B22A 1D7DA 2A6KA 1H3TA 5L8KB 2KQMA 4AWJC 2I26N 5IOKA 4Z7QF 1CLYH 2JSFA 2E7MA 1SXBA 3SD2A 4EIZC 5GS0D 4MCYB 3U25A 1DDTA 4WWOA 1Y18B 2VDPH 3OGCA 4MJIA 4ODXB 5CN1A 2VDMH 4LCWE 1ODUA 4KK6D 3P30H 5GJSL 4TTGA 2DYSB 4KJQD 3L9YA 3MRRB 1T0NB 2KS0A 4WEBL 4FG0A 1MJJA 4PLNC 5EBMA 1UWXH 2A4ZA 3GMNA 1EEYB 2I24N 3VFWB 2NY2C 1EANA 3M6DA 3BKCH 3N2JA 1NBZB 4WAFA 2XXMB 3ZTCC 2XZQL 3VTAA 2B0SL 4U1GC 2NNAB 4PJAE 3GO1H 3DIDA 3THML 1WGVA 2NY7L 3IFNH 5ICYA 1IFHL 4N0YH 5GGTL 1CICC 1WPCA 2XN1A 2ZKYA 3DETD 3L3JB 2WLNA 3QWRD 2AJUL 1EMTL 3JTBA 4YK4B 3GDBA 4CGUB 4DQAA 4LPWA 4ISVB 1KCSH 4M7ZB 1CS6A 1TR7A 5DVLA 3S35H 3FT0A 2AJVL 3EYSH 4D94A 2Q3XA 2R83A 1NPJA 3LXAA 3ULUH 1BECA 1N7ML 2G5UA 3KLSA 3GI8H 3L1EA 4KUCD 3QZWB 5HDOA 2NXZB 2JTYA 4HCRL 4TULL 3MUHL 3Q8AA 1B0WA 1WHOA 4K3EH 3VXMA 1AGDB 1A1MB 3X1NA 3EYFB 4ANUA 1AKJA 5AKVA 1RK1B