2XXFA

Cu metallated h254f mutant of nitrite reductase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGFGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
total genus 95
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xxfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xxfA02
1OE1A 2BP0B 2BZ7A 5TK4A 2GI0A 3EH4B 2BWDA 3FU8A 2FT8A 2AFNA 2PCFA 1AAJA 3JTBA 3UACA 3SBPA 1A4CA 4X4KA 4GP4B 3ZX1A 1R1CA 3CZUB 4YSCA 4Q8BA 1N70A 1SDDA 2ZONA 2FQDA 3OMNB 2GC7C 1NWOA 2VW7A 4YL4A 2AZAA 5PCYA 1FA4A 2W8CA 1V10A 2J56A 3MBWB 4A2EA 1KV7A 2VM4A 2W88A 4AKQA 3AZUA 3UGEA 3SBQA 4AKPA 4AZUA 3OM3B 1XB8A 4HCFA 4E9WA 1XB6A 4YSUA 1JOIA 4CSPA 5I6OA 1AZBA 2YAMA 1PNCA 4AX3A 4FA7B 4G71B 2WO3B 2B08A 1OCOB 1FFTB 2XVBA 1URIA 3QJUB 3WIAA 1NIFA 1PCSA 3EF4A 1BYPA 1OCCB 2Q5BA 4UAHA 2WO2B 4HCIA 3X1NA 3GXUB 1W6LA 3KW7A 2BWIA 1RKRA 2CALA 2YAFA 3PAZA 4DP2X 1MDAA 4BXSV 4G70B 2NRDA 2EILB 1PZAA 2BO0A 3IN2A 5B1KA 1GR7A 3CDZA 4BWTA 1RCYA 2PP9A 4NERA 3AG2B 2OV0A 2DV6A 2B3IA 1A8ZA 5I26A 1AS7A 3FSZA 4GYBA 2IDFA 2IDQA 1SHXA 1ASQA 3FU7A 3FQYA 1PLAA 2HRHA 2VSKB 3NJMA 4GP8B 1PZBA 2IAAC 2VSMB 2RACA 3EHBB 3T71A 3V9CA 1ET8A 3S3CB 1BXVA 1JZEA 3PAUA 3ABLB 3ZDWA 3ZIYA 1PAZA 1ET5A 4AI7A 2E86A 1AG0A 4KO9A 3V9EA 2FJSA 1OOWA 4KOBA 1XMEB 4HAKA 1NWPA 5B1BB 2UXFA 1AS8A 2N0MA 3NJGA 4DP6X 1TU2A 3FSWA 2HX8A 1E67A 4NB7A 5B1JA 2FT7A 2JXMA 1NIAA 2UX6A 1AACA 4PAZA 4KNTA 3WI9A 1M57B 1QHQA 2XV3A 2QPDB 4YVUA 1CURA 3ASOB 4HCGA 1IBYA 3GDCA 3QJTB 2UXVA 4YSRA 3EH5B 2J57A 2AANA 1GS6X 2AVFA 3TBCA 3NJJA 1BQ5A 2FQEA 1AZCA 1GS7A 4DP9X 3QJRB 3GYRA 1OF0A 2XXGA 5F7AA 3OMAB 1JXDA 3T6XA 7PCYA 4G7RB 1CYXA 3N2JA 1ZV2A 3X1BA 3HEIB 4YSTA 2QT6A 4M3HA 4DP1X 3WG7B 5FC9A 4F2FA 1ZPUA 1PMYA 2BW4A 4E9TA 1M56B 1SF3A 3ASNB 3IE9A 2XYBA 1GS8A 3X2QB 2EIJB 3RYMA 2FNWA 5B3SB 3NP4A 2QDWA 2HLEB 1E30A 1ZDQA 4KO5A 2DY2A 2IWFA 1IC0A 2BZCA 2GB2A 2HRGA 1ILSA 2TSBA 6PAZA 3NSDA 4YSQA 3UAAA 1EZLA 2IH9A 4HIPA 5I28A 1WA0X 2YAQA 1JVOA 3PPSA 1BEXA 2MTAA 3KW8A 2XX1A 3CVBA 5AZUA 2YAOA 1L9QA 2QPEB 3T6WA 4F2EA 1A4AA 2Y69B 5B7MA 1GYCA 2IH8A 2FT6A 1HAWA 3OD3A 1BQRA 5LDUA 4WKXA 1AIZA 1PF3A 3JT2A 3UADA 5I6MA 2VW4A 1AG6A 1JZJA 2R7EB 2UXGA 3AW5A 1HAUA 2PPEA 2GC4C 1JXGA 3TASA 4BWWA 2GIMA 2XV0A 2CBPA 1ASOA 4TXVB 2BW5A 1QLEB 1KBVA 1KDIA 5ANHA 3CVDA 3T6VA 1CYWA 3NJHA 5A7EA 3FPXA 1M9WA 1HFUA 2Y1AA 2A3TA 1DZ0A 1CC3A 2Q9OA 3AG4B 1QNIA 4JHVA 4DP0X 4UF7C 3EH3B 5D4HA 4E9SA 1AZNA 2FWLB 1JERA 1NPJA 3PAVA 1PZCA 1J9RA 1KCBA 3FYEB 3WKQA 1EHKB 4BWUA 4YSAA 1AOZA 1J5CA 2PCYA 3S3DB 1IKOP 2HX7A 2CAKA 2H3XC 5IY5B 1JZHA 2I7OA 3PXLA 2DYRB 4KO6A 2X87A 5B7EA 3WKPA 2BP8B 2XLLA 3QQXA 4Q89A 4DPCX 5AFAA 4L0PB 4E9YA 4BDVB 3CDZB 3N55A 3OQRA 4W9ZA 3ZBMA 2ZXWB 3C75A 2GBAA 3T9WA 3PCYA 3SBRA 3HB3B 1FWXA 2VMJA 4HALA 1NTDA 2XXFA 3X1EA 1MZZA 3H4HA 4GY4A 4E9XA 2XX0A 3QJVB 1NPNA 4PCYA 5PAZA 3S3BB 4A67A 4YSEA 2PPCA 4A2HA 2I7SA 1GSKA 4HZ1A 1ZIBA 1E65A 3DIVA 3ABKB 1L9OA 1L9SA 5EHFA 3QJSB 2HXAA 2ZWNA 3NJIA 5TK2A 2CJ3A 5I5JA 3MX0B 3NYKA 2H5UA 1GY2A 2FQFA 5B7FA 1J9TA 3FPYA 1V54B 1X9UA 1ZIAA 3AY2A 4YSDA 2UX7A 5I5MA 1RZQA 2I85A 3T6ZA 1W8EA 1MG3C 4E9VA 1AZRA 2OJ1A 1L9RA 1NINA 2CUAA 3TBBA 3NJKA 2P80D 2EIKB 4K9JA 1TKWA 4G72B 4KNSA 1ID2A 3X1GA 3CG8A 2FQGA 1I53A 2JFCA 2OCCB 3FT0A 2CCWA 4JHUA 1RZPA 5B1AB 2P80A 4G7QB 4BXVA 3U25A 6PCYA 4KOCA 4DPBX 3FSVA 1BXAA 1L9TA 4AKOA 1B3IA 4N8UA 3L45A 2DWTA 4A2GA 3FU9A 1KYAA 2YXVA 5I6PA 3FS9A 2YAEA 2VW6A 1A3ZA 4CSZA 2PLTA 4F7KA 1PLCA 2PPAA 1ET7A 3FQ1A 2XU9A 1WAEA 2XWZA 3DTUB 1BQKA 2EINB 4QLWA 1YLBB 2BP0A 4WTQA 2QDVA 3IEAA 1V55B 1NIEA 1PNDA 1AANA 1GW0A 1SHWA 1E5ZA 1OV8A 2PP7A 2AZUA 2BHFA 2MRYA 3ERXA 3NSYA 2JKWA 1VLXA 3ABGA 2EIMB 1JXFA 1NIBA 3WNJA 5I6NA 1SDDB 1ILUA 2GHZA 4DPAX 1WS8A 1KBWA 4P5RA 2YAPA 5F7BA 1ZDSA 2IWEA 4E9RA 4GP5B 1UATA 3NJLA 3X1FA 1AR1B 1ASPA 2ZOOA 1ETJA 3S8GB 1BAWA 1TEFA 2YARA 3G5WA 5D4JA 1KGYE 2R7EA 1SNRA 4E9QA 2PP8A 2YAHA 3D12B 1X9RA 2UXTA 1J9SA 3H4FA 2H47C 3H56A 4N4YB 1IUZA 3WNIA 2YXWA 2YQBA 2DYSB 3TU6A 4YVNA 1SFHA 2WSDA 3NP3A 3PLYA 3SQRA 3FYIB 4KNUA 2VM3A 3BQVA 4M4RB 5I5IA 4ENZA 5D4IA 1SF5A 5AKRA 1JVLA 1A4BA 1NICA 1SFDA 1W6WA 2FTAA 3NJFA 3FQ2A 2J5WA 4HHWA 1JZIA 3OMIB 1A65A 2J55A 1J9QA 2DWSA 3QJQB 1JZFA 2IDUA 4P5SA 3FU7B 2BP8A 8PAZA 1NIDA 1JZGA 4G7SB 4RH4A 1BYOA 4A2FA 4BDVA 4BK5C 1SJMA 4A68A 1MZYA 4EF3A 3CVCA 4DP5X 3IN0A 4YSSA 4QKTA 4A2DA 3DKHA 5I6LA 1AS6A 4DP7X 1J5DA 2VN3A 1ADWA 1KDJA 1BXUA 3NSCA 1L9PA 2LLNA 4DP4X 1GY1A 1OCZB 3ABMB 3BVDB 4JKNA 1OE3A 1KCWA 3TA4D 1AQ8A 1E5YA 1WA2X 2TSAA 3AG1B 7PAZA 2XV2A 3NJNA 4YSOA 3S8FB 2IWKA 2X88A 2HX9A 1NDTA 2IDTA 5I6KA 4HHGA 1CUOA 1PLBA 1WA1X 1PY0A 3NSFA 1N68A 4ZK8A 4A66A 9PCYA 2IDSA 4NAJA 4KO7A 5E9NA 4DP8X 3NT0A 1DYZA 4GXFA 1OE2A 3FSAA 3QPKA 4YSPA 4MFHA 4UANA 1TEGA 5B1JC 2GSMB 1NZRA 2XUWA 3UAEA 1XB3A 3AG3B 1MG2C 1T5KA 1OCRB 3UABA 3IBOA 4FAAB 2PPDA 2HZHA 4W1TA 1WS7A 2PPFA 1F56A 1IBZA 1AZUA
chains in the Genus database with same CATH superfamily
1OSPH 3T0AA 5TK4A 1BEYL 4MZIA 1IAIH 3HG2A 4YXKH 1PG7W 5GGTH 2D7OA 3JV4B 4ZUUB 5HGBB 4EDXA 2VNCA 3JTBA 3TO4D 1U8JB 3FSOA 4WNQA 3SO3B 4NRZA 5LCVL 5G55A 5GS0H 4NN7B 4Y5VC 3TJHD 3L2NA 1H0DB 3DSNB 3E6HA 4ELMB 4OZHB 2VISB 1IAII 3LKNB 5DLMH 4OF5A 2KT6A 2OMUA 1EHXA 2ERJC 1TTFA 4YS4A 1HEHC 3BKJH 2W8CA 3QCUH 2J56A 1TZGL 4IBZA 1NFDA 3QUMB 2YGOA 3GSOA 3L4ZA 2FEDD 1ZVNA 3DXAD 3GTNA 4FXTA 1MFMA 1CE6A 4WEEA 1NMAL 3HC4H 4JKWA 1HL9A 2NUTB 3VFRA 5DI8B 3TCLB 5D1XC 5E8NB 4L37A 2AEPL 4AZUA 1MIMH 2CLVA 4LLWA 4JUTA 3FQTA 1XB6A 3KYNB 3GUTB 1JOIA 1INDH 5ERWA 2RBLA 2WYHA 4XX1E 4ZTEA 1F8TH 1AHWB 4G71B 2WVVA 4ZSOA 2B08A 3OKMB 3FF8A 4WW1B 2IANE 4GQPH 3IF1B 1N0XH 1UZ6E 5C3TA 3G6DH 2ALWA 1OCCB 5J5EA 3OKEB 4UAHA 1F1AA 4F92B 1QNZH 3MXVL 4NP9A 1BZ9B 1L9MA 3O2WH 5DJZB 5AVQB 2IFFH 3B2VH 1RHHA 1BAFH 2WLKA 3IU4L 2NRDA 3P3SA 2R2EA 4TNWK 3EFOA 3UYRH 5DZVA 1UKSA 3L3KA 4UV7L 3KLHC 3IGAA 3Q8BA 2H1PH 2VDKH 5L0QB 3AG2B 3GO1L 1XSJA 3UL4A 1RVFH 4L8SB 1OGTB 3FRUA 2JKJA 2CJTA 3QFDA 1M7IA 5JHDD 4B27A 2WJ5A 2WXQA 5IHZA 3NIGE 1ET8A 2DKUA 4N9GB 1TTCA 4RAUB 3SHSA 3QUZA 1MCIA 5DTFA 4KKBC 4WSKA 4P3CH 4ODVH 3ZQXA 4FQPA 3IS0X 1NGPH 3QGVA 4LSSL 5DJ2A 2EIZB 4GG8B 3DK0A 1A9VA 4HEPA 1B2YA 3DURA 1FUNA 2MWCA 2N7AA 1LO0H 3RE0A 4NO3A 3WTVA 1HEZB 5ACZB 4NZRL 4HKBA 3IJHB 5C0FB 3W3BA 5B1JA 1TIUA 4AYFA 2GT9B 3VU1A 1MIEL 5IROA 2VWEC 2UX6A 3WIIL 5KJ7E 3TFKD 3ATAA 5DK2B 2BCKA 2I5YL 1YYLL 3NCXA 2ZPKH 2FK9A 1F18A 1YNTA 4KK5D 3EH5B 1RURL 1XL6A 1FNLA 2R29L 5E5LA 5EOQL 1FO0L 4X8JA 3BH8A 2F08A 1ZHBA 2Z64C 5BQDA 5CEZL 3GNMH 5EN2A 3PGDB 5B8CB 3QQDB 4ZO6A 4XN8A 2EDDA 4NOBA 3HFML 1UXLA 4Y5VA 3PV6A 2FBJH 3GBML 3MCLL 1P6WA 3S4SB 3ZZ1A 4E9TA 1XH3A 3CDGA 5SWZE 2GJZA 2JH2A 5GGVL 1FNFA 1F3DH 1A7QL 1XIWB 2QQNH 3IETB 2IGFH 4ZX3A 1GGUA 3NP4A 5J3HD 4PJFE 1AO7E 3G5VA 6FABL 1I9IL 1EJOH 1U3HC 4ZMAT 4PLNC 1GW6A 4OVVA 4KH2A 3BD3A 3JSSA 3M17A 1TQTA 2GAZB 3KNBB 1DANT 1TJGL 4JZJC 3P0VH 4YIQA 3EJSA 4L8DA 2AHIA 3CCHA 2IH9A 4F2ME 4FQLL 1MXDA 2MPAH 3SKJH 1U8LA 1BEXA 2MTAA 2GSIA 3ETTA 5H4ZA 3E6HB 1RD6A 1KZQA 2A77L 4NM8L 2BP3A 1E8WA 2OMUB 5KTEH 3QIWA 4MMYB 1A6VL 3BAXA 2VXTL 3IB4A 4JFEA 3CBKB 5T3XH 4ODSH 4QY8A 3GSOB 4TUOB 4UM9A 3ZKSD 2XV0A 3MNWB 3VFRB 1L9NA 4HK0A 4X4YA 5HHOB 2FJHA 2X4OB 1JK8A 4N2IA 3GXDA 2KYIA 4AWJC 2ESVA 4J3BA 2YSSA 2X7LB 2Y1AA 3FQTB 4G6FD 2VIRA 3EUUA 4JANB 1UH2A 3MUJA 2A73A 4NQCB 4F7PA 5DFVD 4ZSOB 4DGVH 3EYUL 3P9LA 2P5WA 1QTPA 3VB9A 2EVIA 1AOZA 2K8MA 1VJSA 3K2KA 3VXTA 1LWJA 3L5XH 3GHBH 4ZTOL 2BRRL 3DUSB 3DO7A 2VN6A 3JV5A 2NSQA 3Q8EA 2J7LA 2XLLA 3EGXA 2R2EB 1W72A 3EFOB 4PRHB 5AFAA 4QD2E 5T5NG 3L3KB 4ZPVB 3D7PA 5MERB 5TDPA 4G7YL 3OKNA 2XJKA 3GD1C 1ZV9A 2YD8A 4WJ5A 5DUPH 5GISL 4G8FB 2EC9U 2QQQA 3FRUB 3SBRA 2WXRA 1YY8B 4XPGH 3RGVD 4QRPD 5IHZB 3WNNA 3GKWH 1UWEL 2YMXH 3VI4A 1P7HL 4A2HA 1LWHA 3MOQA 2YRLA 4QHPA 3QUZB 2HRPL 5DTFB 1CGSL 2OZNA 5D9SA 1ED3A 1E4JA 1MWAL 3VG9B 3BIAX 1J8KA 4RISH 5DJ2B 2FD6L 4HX1A 2RCSH 2ARJA 4K94L 2ZWZA 5MI0C 1G9ML 3D85A 4A6YL 3RTQB 3TJEL 5C08E 3MX0B 4QOKB 4DCQB 1PZ5A 4HKBB 4HUMB 3KVPA 4QGYA 3ARBD 3HG1A 5JNYA 3BEVB 1NGZA 2ZCKH 1YUKB 1LD9B 3OZ9H 5HD8D 4XOCA 3FU6A 5A16B 3F3HA 5L8LB 3RBSA 1JWSB 2F8OA 4HCRH 1PJ9A 1RUPH 2JCCF 5JQ6L 2BCKB 4Z23A 3JTTA 5JQIB 3VGFA 4LCYB 3ETBF 3QORA 1KEML 2P80D 3ECQA 3VXUD 1LP9F 4G72B 2BY1A 4X8JB 1GAFL 5DRXA 3EYOA 4ZXBA 2CCWA 3FRPA 1NKGA 2DM2A 4FG2A 3IJ8A 4IS6B 5EN2B 3RPBA 1QA9B 3WAJA 2CR6A 3W9EB 3HS9A 4MX7B 3TV3L 1KY6A 2EDLA 5G4MA 3WIHA 3W56A 3D3VE 4P5KB 1ZANH 3C12A 3PV6B 2JF1A 1PL3A 3FU9A 1KCSL 1KJ2B 4BRVA 5HI4D 2JCCB 1RLBA 3BEWA 4PRIE 5E0QA 2GJZB 3MLRL 5C6TL 2VN4A 2HLAA 3O3AA 1OK8A 1YVLA 2VRKA 1LP9B 2XU9A 5AB0A 4HLZG 2WZPD 3AT0A 1T03H 3H3BC 4R7VA 1BFVH 2OR9H 3G5VB 2CDGA 2VAAA 4MB3A 3HZKB 2E9GA 4FYQA 3ERXA 3M17B 3WE6A 1FCGA 1RULL 1BGXH 2P5EB 2UUDH 3EOTH 4Z7NF 2WLLA 5K69A 4WNSA 4R7XA 1MFAH 2O72A 5E1GA 1FZKA 2WINA 3B8SA 4BH7A 1ILUA 1U8LB 1QLFB 4ODHH 3BUIA 1JF1B 1TZ8A 4ZAKC 2ALAA 1VESA 4Z1PA 4XPBH 4ISVA 1OY3B 4KJWC 5F7BA 5DHVH 2NW3A 4Z7AA 3A5VA 1N3NB 5KUKA 2VDPL 3DO3A 5IVZB 5I8OL 5KYYB 2GTZA 3AXIA 4U1GC 5DC4B 5KYWA 1KJMA 3D2TA 5JW4Q 2XCMC 3L4XA 2KI6A 3CVHH 1T5WB 1S7VA 1UQSB 2H0JA 3QG6A 4QY8B 5ECGA 1KB9J 4WENB 2UXTA 2BNQA 3C5ZC 4X4YB 4HK0B 2VR5A 1VEPA 4XNQA 4OD2A 3S36H 2FSEA 2IPTH 4QEGA 1TYJA 5CP3H 3KHOA 1A6ZA 4BGDA 5BPPA 1YEFH 2VIRB 2MMXA 5MENE 4PY7B 5C9KA 3E3QC 2I25N 1EBPA 2IF7A 5F7FA 4JQVC 1E27A 3OGCB 5DHXB 3WIFA 2HYMA 3QJFA 1RIUL 3VXTB 1FGVH 1OHQA 1JZIA 4C56B 3QQNA 5IW6A 4FFYL 4UV4H 4HOMA 4HC1A 5JR1L 4A7GF 1W72B 2P9RA 4BUHA 4AYGA 1GMIA 3W11C 5KSUB 2J8HA 2LAGB 4A2FA 1AR2A 4WJ5B 4YDJB 3QXUA 1FL5A 4M61B 2YD2A 5HYSA 3HUJE 4YLQT 4CILA 1CFTB 1JPFB 5CJ8A 2ZUUA 4WNJA 5GS2H 1CXEA 2YKLL 2CWRA 2OYLA 1YQ2A 5EN3A 1RZJH 4JHWL 5D9SB 1ED3B 1WZ1L 5DO2C 2QBWA 4A2LA 2DMBA 5FUZH 5F71A 3FU3A 5ELIA 4HX1B 3VMNA 2Q6WB 5C09B 3AS3A 3U2SA 1M6OA 1PZ5B 2BERA 3DBSA 4K8RL 3NRQA 5EBMA 5EC2A 2K9FB 4R7NB 4PJCF 3DV4B 4H20H 4XC1L 2V5TA 2EXTA 2X2YA 3Q43A 3EZJB 4J3TA 1GGIH 4OBSA 3KPLA 1B4JL 3S8FB 4FQXC 4CKQA 1FNGA 4M1GH 4LXFA 4P4RA 4IMKC 4E5XB 3QORB 1PLBA 3BGFB 4TV3A 1TENA 4ZUVB 2ZSVB 2CJUL 4FI6A 1N7MH 3P9MB 3H9SD 2X0VA 4A7TA 3FRPB 3J27A 4DP8X 1NGWB 4GXFA 4LLMA 4DEUA 2BOBB 1D7CA 2J20A 1D5ZA 4NNYA 4XWGL 2ZKYA 4MDIB 4ZAKA 4PBXA 5F8RC 4YXLH 3N04A 4U1SA 4UZUA 3WGUB 3FXIC 3BEWB 4NQVA 1CLVA 3A4EA 1JMZA 4ZTPL 4QHUA 2FLRT 2Y06L 3MJ9H 2IBZX 3BO8A 4NRXB 1JNJA 1S2EA 2DM4A 2F68X 3QZLA 1ZGLM 1YY9C 3ZE1F 3ILPB 1CDIA 2FJFA 3L9EA 5L9DH 2WLLB 1A4CA 3LNHA 5L4FA 4HOWA 5I1AA 3FO0H 2J8UF 1T4KA 4AVKA 2P48B 5I6XC 1XL4A 2PABA 3N40F 3QJHB 4WGKA 4ZJ9A 2J44A 4ZUTB 3M86A 4V2BA 4YZFF 4JQVA 3LX9A 1HINL 1WFNA 5DU7A 3CSFA 4JX0A 2DYPB 4ORGA 2F9BT 3CFJA 4P2AA 4HS3A 4XVTH 2VN7A 2BSRB 3NFSH 4N6QA 3BQUC 3ZE1B 1G7QA 1P5VA 3ARQA 5GHWH 4JRFA 2SEBB 3QG6B 4KDTC 3KJ4B 2JB5H 3OM3B 4KTEH 3RPIB 3UEZA 3MLSL 1EAQA 3EFFB 3NK3A 4CSPA 2EUVA 3GFUA 1ML0A 2HVKA 3CZGA 5FLUA 3RNQA 4PN6A 2WSPA 1A6ZB 5DHYB 3ATDA 4B7LA 5E8EA 2VC2B 4PIRF 4DUVA 2Q8AH 4MXQD 1MEXH 1OM3H 3SKOA 2WO2B 4KY1H 4LEXH 1MCFA 3L3DB 2HG5B 3MRLB 2YAFA 3BAJA 1THAA 3GSQA 4BXSV 3STLA 3PREA 5AW8B 5HYJA 1UXSA 4NLHA 1BM3H 2WHVA 3D87B 4GKZB 3QDMA 4PUBH 1EVUA 1X3DA 5BS0E 2GUOA 4MVBD 4GLRH 5CINL 5DZLA 5DJ8B 2LT9A 1ETA1 4I3RH 2CE6A 3EHBB 4JRYB 5IVOA 3V9CA 1F1DA 5E08H 2Z1PA 5HYSB 1XF2A 1YEEH 3H42L 3RWGB 4RETB 1S7WA 4BZ2L 4IMKA 4XNZC 4GLRI 1FV1B 1CZ8L 3BP6A 3V9EA 1KT2B 1U8OB 4R3SA 4PV9A 1U3NA 4JK0D 3R8BB 1OOWA 2F6AA 1FPTL 3MODH 1GRWA 2P49B 2UXFA 3Q7JA 3LZLA 4IU2A 3DECA 1SYVA 1WFJA 3LEYL 4WHCA 3F6JA 1ZLSL 3UYPA 4DP6X 1YMME 1WHPA 3MACH 5EBWA 3L3GA 2E5EA 3KGRA 4XAWL 3S37L 4PIBA 3EXJA 2V8MA 3MCKA 1XQ4A 2WCSA 4K55A 1RJLA 3O3UN 4LESA 1ZLUK 3DMMC 1RZKH 4KI5F 3COOA 3QUXA 4NENA 2H6PA 3T3MB 2XV3A 3KGUA 2MOGA 1L0YA 3AY4C 3WFEL 4M43L 1Q9LB 3HHSB 4M1CC 5BO1L 4EXPX 2J6EH 3ET9F 3KPLB 2J57A 4O5LL 4N8VG 4P4RB 1FORL 3DYMA 2NZ9C 1A9BB 3QJRB 3NIFF 3ARED 4Y4HD 4QTFA 5DEZA 3UBXA 3ZDZB 2CZNA 4R0LB 2R69H 2EXWC 4H25A 5EO1A 3DETC 5IBTL 1NCDH 1CDJA 3ULUL 4O58L 4M3KB 3KM2A 2Z3FA 3KJ6H 5I1CH 5F1KC 3T2LA 1HKLH 4RNRB 1MI5E 1T2JA 5C92A 1QSZA 2XYBA 1UKTA 2XQYK 3L1FA 1A5FL 3RYMA 1UADC 5FM4A 2EE6A 3PJLA 1AGDA 5C70A 3DV6A 2B15A 3NZHH 1CBVH 3BAWA 2CJSA 3GF8A 1IC0A 4ZMVA 2Y7QA 3BQUA 3QIBB 4OT1L 4DKAA 1ZV5A 1KIQA 2FL5A 3BH9A 1IE4A 4AVHA 3MI6A 3D3VD 3QDGB 1I8IA 4KDTA 4PJXA 4ZUSB 2R0LL 4TLTA 3O2DH 3GRWA 1CVSC 3F58L 3D69A 3MPCA 2FJFB 2IOOA 4PRID 3ZYJA 3REWA 2FBOJ 5IHUL 5BMFL 2BLFA 3B9KD 3OJVC 1TPXB 2OLDA 2VO5A 3INUH 4IRJA 4PW4A 2BINA 5GSVA 3CMOH 1TJIL 2Y07H 1PU0A 2AJYL 2BXZA 2FO4A 4O02A 2FGZA 1UKQA 2AQRA 1XR8A 4CRPA 5D1QB 1R3LA 2XG4A 1U8PA 1HAUA 4K9EL 2LFGA 4GINA 2DPKA 3BFOA 4FFVC 2R4RH 1HSAA 1NFAA 4OIAA 1NC2A 1G7QB 1P5VB 5L6YH 3QW9A 3BZ4A 2C3WA 4I0PC 4IK7A 4MMZC 5F7DA 4TYUA 3ORJA 1DQLL 5HI5D 2VDQH 5EU7E 3JV0A 1CL7L 1DZ0A 3AG4B 4JPIA 4JHVA 2PMZA 1QSFE 2HVKB 2NY7H 2FWLB 4AGNA 4XNYH 2A9NL 2OSLA 4PB9L 4XBPB 4HUXA 1DJYA 4JZOB 5TE4L 4LCIH 3SKOB 2IWGA 4K3DL 4XI5D 1A7RL 1LK2B 2AJVL 2NXZC 4E68A 4LHJB 1NLBL 5B7EA 3IJSA 3STLB 3QQXA 3UH8A 4Y2NA 1FO0B 3MNMA 3QDMB 4A7SA 1AQDB 2GJJA 5MEND 1VACA 3HB3B 5IFAL 2WNKA 1A25A 1QHOA 4HLZH 1Z0MA 5I8KH 4QXUL 3QZNA 2YBRA 3DARA 3P69A 5JDSA 1DVYA 3BGMA 1ZIBA 1E65A 3O6LL 3U7YL 3ABKB 3UYOD 4DGYH 5I82A 3BP4A 1WFIA 1KJVA 4KU1A 3NJIA 1KN4L 5C6WH 4IU2B 2V7HA 5E2WH 4DEPC 4L4VD 5D6CB 4CSSA 1XMWA 2E9BA 3UYPB 3PUUA 1R4XA 2WSKA 3EGDA 3MCKB 12E8L 3CSBA 5C3LD 1RJLB 2AXFB 2R4SL 1SZNA 1RHFA 3QUXB 4NENB 5D8JH 4GNKB 3BRGC 5GPRA 4GOSA 2ZIDA 2VDOL 5DVMA 4QNPF 4LOFA 3WFBH 4TUKH 5AYQA 3VX0A 5TDNB 4ABUA 1D9KA 4K9JA 5T1LA 1Q0XH 4CA4A 2YD1A 9CGTA 3BZFB 3C6LD 3TEZA 4HJJL 3MFFA 1D5XA 2FEEI 3QWRA 5CSZA 1MHEA 1VGEL 3NIFE 2VR4A 4H25B 2V37A 4HXBL 3U9PH 1DQQA 1J1PH 5TFSL 3TA3C 4FQ2L 1ETB1 4FMKA 3MZTA 1MREL 1U8NB 4MXVF 4UOJA 2BVQA 1CTOA 1I3RB 3KVQA 1H3PL 4AUUA 1V7NH 4OZGE 5J6HA 4B0MB 3QEGH 5FDYA 4CSZA 1JYXA 4AEIL 2AK1L 1MUJB 2OSXA 4FFZH 1FC2D 4TNGA 1BD2E 5DXWA 1RP9A 5D6DC 4W9CC 4XP6L 1N64L 2N56A 2P7TB 3TP4A 3HBGA 2FH8A 4A7QA 1CCZA 5ALBL 2NLJA 3V0EA 2V17L 1ID5I 1D5IL 2C1PB 1LE5B 1KIQB 3BH9B 1VLXA 3ARYA 3BZEA 5IHLB 3BWAB 1KYOJ 2VR7A 2IV9A 4PJXB 2VLJE 2VLRB 3D69B 2GHZA 2WN3A 1WS8A 4KQ4H 1E28A 3REWB 1FH2A 1HL4A 2G2NA 5GSVB 4UAOC 4F1ZA 3CXFA 4NZFA 2YGQA 4GMTL 1SEBB 4MA1B 4W9GC 3RVXC 1DTUA 2XFGB 5BV7L 3SDDD 1MJ8H 2ZOOA 5DJ0B 5J1AB 2Z93A 2FO4B 1ZXQA 3PV7A 1F4YH 4HGWA 3LQMA 4M8RA 3RHWF 2OQJB 4K3JL 1OT1A 1PG7H 4JM2C 1MRCH 1U8PB 4F37F 3NA9L 1MCKA 3EADA 4JHBA 3SDAD 1HSAB 3V8OA 1NC2B 4YPJA 3OGOE 4X7SH 1HI6B 3WNIA 1JGDA 3T0DA 4XT1C 3BZ4B 3LQAL 4XVJH 5J4MA 2E0PA 4ZW6A 3OR7B 3X3FH 1CLZH 1ORSA 5KAQG 1E4XH 2VGLM 4JHZA 2A0LC 3LRSB 4KKPA 5F3HB 2HN7A 2OSLB 1PSKH 1JVLA 1U95A 1NJ9B 4HUXB 2DLGA 2DOCA 1PDKB 3QHFH 2XQ0A 3WXVL 1HL5A 2ODIA 3S36X 2UZXA 3Q5OA 1E7UA 3AWFA 1F42A 3FNKA 1F4HA 3HHRB 4KWUA 5F1NA 4ZW7A 1T89C 4N68A 4MAUL 4FJZA 3NEXA 1H3UA 4ZMZA 2BFVH 4DK3A 4H88L 1JZ5A 5BZDB 2CXKA 1L6XA 3ARDC 5GXBB 4GG6A 2ZAIA 3P4NA 1SJMA 3G6JA 1WDAA 4HKJB 1QUPA 1U6AH 3VSVA 5I1LB 5AVYB 4HPOL 3FT2A 5GRVL 2QGDA 1IBGH 3ARGB 4JVWA 3Q6GL 2V7NA 4OLUH 2RH0A 4RZKA 3V7MA 3BGMB 4GKNB 5T5FL 1XTLA 3FQWB 1FVCB 1KDJA 4YEEA 2W80C 1YJDL 5BS0D 1KJVB 1ZA3B 5E2TH 4WAFA 1Q9OA 5HHVL 4JGUA 2V7HB 4JDZA 4RGMC 2IPUG 3HC0A 4UZGA 2WBJD 2VYRE 2O5YL 1JV2A 3N44F 4UYPA 3K2MC 3FZUC 4P59L 1AQ8A 2EVHA 1E42A 1BZEA 4O4YH 3WEAA 1UH3A 5FO8A 4FNPA 4P2RD 1RZGA 2FGWH 1XAKA 4ODWB 3ZE2B 5TGBA 4MQSB 4MJIE 5SWSE 5D6DA 2JVUA 3S35H 2DQDL 5DZJA 2NY6C 2JKRM 5JUEL 1TQUA 1YMMD 4KQ3L 1D9KB 2G4EA 2H2SC 3FTYA 1DVQA 1JNHB 3SDXA 5GJSH 9PCYA 2VDPB 2BIMA 5TQ2H 3CPUA 1INQA 5E9DA 4ADJA 3N44B 1TCRA 1D5XB 5CSZB 1VFUA 2A6IA 3OX8A 4IJ3B 4F9PA 5JHLA 3F64A 1TF4A 4PMEA 4K7PY 3RNKA 3B5HA 3RAJL 2VLKA 3WEXB 2HKFH 2R0WL 3ZW3A 4AYDC 1UXMA 1LEGA 3I6KA 4PJ7F 4FNLH 5CGBA 1BQLL 1YQVL 4FFTA 2C4FU 5I1EL 2PPDA 2PW2A 4NXSA 2WANA 3NSXA 4JG5A 1KC5L 5DMYA 4X7FC 5IKCA 4JM2A 3VGHA 2I9LA 1BPLB 5HHNA 3ZKXC 1T6VN 2BWDA 1XT5A 4DZBA 2QSCL 3GHEH 2PCFA 3QE5A 2PWHA 1X5YA 2XA3A 3GSNL 1MI5D 4M00A 4N2OA 1AAJA 4Y19E 5FO7A 3UTSE 1DVFD 4BH8A 3BZEB 4OV5A 1YN7B 4N2FA 3GI9L 5KSVA 1URLA 2OTWB 4PJ7B 4RAVA 2UVEA 2AEOA 1SDDA 4OFPA 1E28B 2WXFA 4YX2L 3KWVA 4QIRA 3L3HB 2JJSA 3FU5A 1GC1H 4CVUA 1BFTA 2YA0A 5GGRA 1EEQA 3RB7A 2B9BA 3QK0A 4JHAH 4KROB 3TM6A 1D5MB 3HKZA 1TMQA 4AM0Q 2DQJH 4PFEA 1IEAA 3MUUA 2Z93B 3UC0H 2W88A 2XWBB 2PETA 1TQVA 3T8XA 5CGTA 3VB8A 3IDYC 1T89A 2XQYA 4TUJA 4KTGA 3K46A 1HQRA 1WG3A 3C2SA 4CN6A 3IFLH 5A3ID 3ARDA 2VZUA 1XH2A 2CDFB 3E0GA 2D7TH 1JGDB 1X44A 3FK3A 1EO8L 5EIIB 3C8HA 1KB5A 4XCCH 2NY5C 5CGYC 4FKKA 4PI0A 3OKDB 3FCBA 1A6WH 3ZZLA 1WCBA 1OW0C 3BKCH 1X6NA 5KBPA 4XP9H 2G2PA 4JFFA 1JTOA 4OBRA 1BMGA 1U95B 4AYMC 1F90L 2BWIA 3HPLB 2IOIA 5FKPB 2H7WA 4ZX6A 1BWMA 1G1YA 2AXGB 4UQDA 1MFCH 1U30A 3ZHNA 2UZXB 5EU4B 4P46C 3FOMA 3D4GA 3RJOA 1RCYA 3FQXB 2KH2B 3MU3A 4HPYH 5JPMC 1QSFD 2QVKA 1HOCA 4Z0BH 4KTDL 1QBML 3L1OL 4LSRL 1A66A 1F0LA 1EAOA 4MA8L 1WP6A 2HPOA 1BVNP 2C9SA 4NJAH 4MS6A 5F96L 5IEHA 1W9XA 2EYSA 4N9OB 3X13B 4K5PA 3S4SG 3EJUA 3VFTA 1N8OE 4ELKB 2D4FA 2NY3D 5HDRA 3IAGC 1YHPA 1DQMH 5F3BA 2I69A 4OCLC 5BNXD 3LYRA 4H8QA 4FLOA 3RVTD 4B9IA 5AG9A 1O9ZA 5K9JL 3LDBB 2IMNA 4ZBJA 5ADOH 3S88L 2WWNA 4PJEF 4ZRGA 3HC0B 4LSUH 5KJ4A 4R90L 3TNMB 5FYLL 5EA0H 2XTLA 1QHQA 2X6CA 5IB3A 1JVKA 3QNYB 2WVTA 1BLIA 1X7QB 2CK2A 5LO7A 2GKIA 2OL3H 5HI3D 4GW4B 2ZJSH 3S34H 4PWJA 3NFPB 3G5ZA 3R06A 4FKHA 4W6WB 2BNRA 3RWFA 5TGBB 2EAEA 3ZN6A 1U9KA 5CO1A 4MNGB 1UUNA 1J0ZA 1K85A 4WI2A 1LQSR 1N6QH 1Q9KA 3CN3A 3L48A 3T4AA 2Z92B 1QUNB 4KK6D 5IESL 4K23L 4PJEB 2YC1B 3W38A 1JGEA 1KBPA 5EZOH 3V6BR 3WG7B 3QQ3A 3RFZC 1GOHA 2VDRL 4IU3A 4KI5D 1JL8A 2VLKB 3HN5A 1BV8A 1CK0H 4MCMA 5CZRA 1LEGB 2BS8A 2EIEA 1J1OL 3TCTA 3WMSA 3PDDA 1UD4A 3BZDA 3PHSA 5DO8A 2IWFA 4X6DA 1P69B 3VGAB 1MRDL 3PP3H 1SXNA 2C9VA 4KXAA 2WIIB 4S1DD 3WKNA 1OWWA 8FABA 4Y16D 5HGDB 4DZBB 5I28A 5KW9H 1NGXB 5FO7B 2VN5A 3MRBA 4LEBA 4BH8B 1DEEA 3GS0A 1W0VA 3L3IB 3UZEC 4B97A 4ZNEA 3CVBA 3T6WA 2V9RA 1L9QA 2QPEB 4G1EA 4GRMA 5KSVB 1PY9A 2HKHH 3NCBB 2ZF9A 4R2GB 5D1ZC 3L13A 4G8AC 5ADPH 5JW5A 4G82A 4ZG1A 3CV5A 2GHWB 1OPOA 1QEWB 3WJLC 4JO4L 2YUWA 3C8DA 5JHAA 4YE4L 2NY2C 1U3ZA 5A2BA 4V33A 2DKSA 4WEBH 2XTJB 5K93A 1V05A 1IEAB 2VLJD 4BELD 3K1DA 1KF9B 2GW5A 4WSJA 4HIEA 3LS4H 4N2BA 4WI0B 2E6PA 2NY4C 3DHMA 1MHCA 4Z7OE 1OAYH 4N90E 4GFTB 3U0PA 3QR0A 1A6AB 2P4AB 4DP0X 3VH8A 2O5ZL 4ZO8A 1VCAA 3Q6FA 4H2AA 4PJAE 1CTMA 1EIBA 4EZLA 5JW4R 3VDBA 1UTDA 3BUQA 2DB8A 3D39A 1OP3H 1B0IA 1SQ2N 1U8MA 3V0HA 4H7VA 3ULUF 1U8HA 2C9XA 1KTBA 3KH4A 1QO3B 2DAVA 2M1KA 3SCMD 4X5WA 1NBVH 1HXYA 2CAKA 3WHE0 2BSEA 1JCKA 4AENB 1JZHA 1NGYB 5IWLC 2FEJA 3ARZA 3AS1A 2XZQH 1HH6A 1BOGA 1T6WA 1UD5A 3TEUA 4P8QA 1DHKA 5GGVY 3FOMB 2N7SA 4ODXB 3JWDC 4PJIF 4L1HA 3AABA 2NCMA 2Y6SC 1NL0H 4PV8B 2BVTA 4LBAA 2EE2A 3IDNB 4BK4A 5K9OB 3QARA 1IB5A 1MZZA 1RERA 4MD0B 5C0AE 4F7TB 5IEHB 3QJVB 1L7TH 35C8L 2PTUA 4IHBA 5JW3L 2KDYA 3LN5A 3PWVA 5A1AA 3TEYA 4OTXL 3F7RA 1CFSA 3CH8A 4UOW0 4OGXL 1LL1A 3VFTB 2EEXA 4LARL 1CE1H 1OTTD 3AUWB 3NTCL 3SKNA 3C5SA 4PJIB 1R3IH 1L7IL 3PL6C 5AB2A 1AIFB 4KAQL 2R51A 3RFZA 3U46B 1NFKA 4RMQA 5K39A 2CU9A 4K4KA 5FW7A 4Q97A 3H3PH 2Q10A 1OAXL 4JBSA 1OVZA 2ITCA 2JKLA 3BUTA 5KVDL 5I1IH 3U30B 3V5DA 3S6CA 1BREA 4R7DA 2FECL 4GXVL 4HWEL 2ZT9C 4HBQA 4NWUL 4OM0L 3ZE0E 1G7PB 1CS6A 1MFBL 1NFIA 3L5WA 3RDTC 1CFNA 3OPZH 1EGJA 1KJ3H 2O6PA 2QV4A 3R06B 3WJMA 2BNRB 3TT1L 4BHUI 4YWGH 2H8PA 3X1GA 4EMZA 4GO8A 3FB8B 1I53A 1XR9A 2JFCA 2XVGA 3FT0A 4UILL 3DTXB 1H6TA 3T4AB 4Y89A 4KK8D 1CICC 1FIGH 2XZZA 4TLUA 3UZEA 1EXUA 2OP4L 4IKNA 1G7IA 4UBDD 3WXWL 2XRAH 4S1QL 5FYKH 1FFQA 3QQ3B 5D1ZA 4MJID 5SWSD 1A7PL 4FL4C 4IU3B 3IAQA 2WVSA 4AK1A 4KI1A 3EOAA 4JS7A 1PPIA 4AGMA 4UTAL 4NKIL 5FFLA 2F7QA 4O2EA 4JQXA 4L1SA 2CGRL 1ULVA 2XWJA 4NHUB 4XODA 2WLJA 2D7MA 1VKXA 1FZMA 2BDNH 2WMPA 1OV8A 1QFHA 4X6DB 4F8LA 3B3IA 3NSYA 2YSTA 3LHAA 3A24A 3D4CA 4LAQH 3TFKC 3BRDA 1U3JA 2A6KA 1Z66A 4CVXB 3WMQA 3CHRA 3U82B 4XNXL 3UJIH 2SODB 4KK5C 2OZ4H 4GXUM 3MRBB 1B6UA 3EYSL 1DEEB 2ADIB 1R3HA 1IRAY 1W0VB 4UINL 5A7BA 4P5RA 3V4UH 4L4JA 5TQ0L 4HULB 5I0YA 3RX9A 2HT2C 3MRIA 1C5CH 3B43A 4DO4A 4EI5C 4QAWA 1KCUL 3F62A 3VXPA 1ZLWH 2QKIA 3MBWA 5J06A 4J6RL 5E2VL 4HKZB 1IT9H 2F19L 5IWLA 4Y19D 3UTSD 1T0MA 3BWUF 1GVIA 4HK3N 5F9JA 5FFGA 5I8EA 2F8VA 4QWWD 1IGJB 2BX5A 4E9QA 2GJ6E 3IKKA 5EU6A 1J1XH 1I9RH 2EECA 3EDKA 1ZTXH 2EQDA 4UUJA 5E8DL 4P9HC 3WNKA 4BE6A 2WIMA 1MHCB 1KY7A 2DQFA 4HIJA 3KPRB 1IBFA 2CDEB 3ME0A 4G8GA 4YBQD 3IPFA 3U0PB 2PTTA 2JKNA 3ULSA 3U2IA 5IIEA 2K3HA 1PG7X 4L4TE 2NR6D 1T20A 1TXKA 5E8OA 3VH8B 4TTDC 4JFDE 3H2QA 3M7FB 3MO1A 4M4RB 1N5AA 1XCWA 1AD9A 1JWMA 3CLWA 1FI8C 3ROOA 1KACB 1U8MB 5B3NA 1U8HB 3P4LA 4KDVA 5DCCA 5C0CE 2YD9A 5L8KB 4X5WB 2NXYB 5C0ND 2AXJA 4GAGH 1JYVA 4ADGA 2JKTM 2VDOB 3PL6A 3V4PH 1HH6B 4OR1A 4FXLA 1BFSA 1FFOA 2E75C 1FRGL 4E5XG 4RFEB 1LDPH 4OJFH 2J1YA 4HS6B 4TPRH 4NO5B 1NAKL 4M7JL 3VFGL 4YHZL 3FRPG 5BCAA 4DEWA 4I2XB 2GBVA 5A2KH 2A4CA 3GK8L 3RDTA 2HTKD 2QMJA 2YMTA 2AITA 1H8SA 2JLLA 3LN5B 5IV2A 2J21A 1ZEAH 2DTML 4KRMB 4U7MA 4P5TC 5KYXA 1XZ0A 4IOIA 5I1HL 1ADWA 4KZEL 2W5PA 2EE9A 3P0GB 4NN5B 3MBEC 2KZBA 2O1AA 2UWEE 1FYTA 2D0GA 3SKNB 1FZJB 2JXMB 1UHVA 1B2WH 4L5FL 5DMKA 2DJ4A 3K74B 3PHQA 5EBLA 4D9LL 2GJRA 5D70H 43CAB 4JRXD 5DJ6B 1JNNH 3TA4D 3MQIA 2B4CH 1NCCH 2XV2A 5ESQA 3HR6A 4S0SD 4W9FC 5TE6H 3L5WB 2M8XA 2X88A 1UCBL 4R5VA 1CFNB 4XPTL 4M93B 2RAMA 2X3CA 3OKKB 5F1OB 5BV7B 3CC5B 5E9NA 3RGVC 4Y9BA 2X4QA 3VNYA 1XSIA 4PRPB 1WC7B 4XN7A 4M9PA 2GFBA 1EPFA 3KLSA 4DQAA 2XUWA 5E8PB 4LPVA 1EXUB 1TQBB 5D7SL 1C08B 4S1SH 5CJQH 3VGBA 1MXGA 5FS5A 5F0PB 1Q0YH 1P7KA 3IDJA 4KDWA 2DLEA 1F45A 3OB0H 5FGCE 2QVIA 4D0BB 32C2A 3EGSA 1CXHA 5L2KB 3F65A 2FIKA 3VQ2C 1F56A 1CGXA 4N0UA 4MTMA 4F58L 3ULVL 3IYLW 3P4OB 3PQYE 3T0EA 5FCUH 1TSHA 5HD8C 3OXRA 4ZZKA 4XMVA 2XY1A 5EO0B 1KYUA 1IM9D 2PCPA 3GMPA 5HGAB 3RKPA 5CAYB 2CBQA 2BJMH 1A1OB 5ICUA 5GIRA 1YNLL 1BF8A 3SPVA 3JBG7 4MB5A 2RIKA 4ZS6C 2ISDA 1MSPA 1R3HB 3IJYA 2R2CA 5B38A 1T7YA 3U0TB 2OK0H 5EF0A 1TOXA 5PCYA 4WTZA 2VXQH 1PBYA 1T80A 2QKIB 1OCWL 3ALPA 3MLYL 3NZUA 3MBWB 2NDGA 3MHZA 4JGJA 3LZFH 4DGUA 3ILQD 3DPDA 1S7QB 1MFEH 5HYSG 2QQLH 1B3JA 5HI4C 1XCXA 2E9WA 4Z3EA 3RWEB 5J11C 3VO0A 1UA3A 1T21A 2YPLE 2VM9A 1S9WB 5E2UL 1IFHH 1SVBA 1AE6H 3Q05A 5E5MA 2NQDA 4E9WA 4PGJA 1NEZA 2DWDA 2ICEA 4K2UH 1JGLL 3HN3A 2WBWB 1U8CA 1QI3A 1Z9SB 1T20B 1PCSA 3EF4A 2RJMA 3MO1B 4LRNL 4R83A 1N5AB 4P49A 1E3ZA 4KX9A 2CIKA 3ROOB 3TYGL 4L9DA 4P5TA 2UZYA 4LHUB 2K4AA 4KMLB 5K1VA 4D3CH 3MBEA 4N90D 3VYOA 1NDMA 3VXQA 3WD5H 4UQ3A 2BVYA 3GIZL 3BN3B 4L3CB 4NERA 2XN9E 2FWUA 3GSWA 4OCSL 5G4NA 2B3IA 5AG8A 2EH7L 3SDCD 1VPOL 2CGYA 4ZODA 2B0SL 2MSPA 5I26A 2BVUA 2IDQA 3QEUB 5ABDE 3M45A 4NKMA 1NC4A 4KKCD 1C1EH 2O6CA 4JEGB 3C5JB 3NCEB 5AVXB 3SYCA 4MZ3A 2WUCL 3BSZA 5IOPB 2VJ8A 2ADJB 5I1GH 2Y36H 1VFMA 4L8CB 1A7BA 1X5LA 2FHCA 4IOSA 2AXWA 3BVTA 4HWZA 1CD1A 3T65B 4ZFGL 4P23B 5C07E 4JPKL 2HSIA 4RMUA 2XDHA 5C0AD 5E4AA 4PJ8B 1OF2A 4FTVA 4X9HA 3U6XA 5EBLB 4JFVA 3GSNB 2OTUA 1Z5LA 3MSPA 1OZTG 2O5NA 1QPXA 2DDQL 4D7PA 3RWCA 2ICWA 3NAAL 2D3JA 1O7SA 4XP5L 1YEKL 4IRZL 4NO2B 4MJ5A 5F7AA 3OMAB 5EPMA 4FCAA 5E1HB 2ZCHL 5K59F 1JZ3A 3CH1A 4G9FB 1T0OA 1ZV2A 2XI9A 3U36A 3SGDH 5BRZB 5DK3A 2EABA 4TQEH 3ECVA 1IILE 4NPKA 2EDTA 1DJGA 3ZDXF 5ALCL 4B5EA 1HHIA 2YFOA 4UOQA 3CN0A 4P57B 4NFDA 5EF3A 3VJ6A 1SOKA 3FUNA 3QHZL 3X2QB 3GBNL 1P7KB 3TF7C 3MA7A 2D8KA 2QDWA 3IDJB 4FQIL 3SE3A 4YK4C 5IB2A 2NY1D 2Z31C 3CFKB 1KTLA 4OFDA 1C7SA 1TZAA 5IEKA 1NFDE 2IBBA 3QEQB 1XXDC 1Z5HA 4JN1H 4N0UB 2O61A 1UACL 2IQAA 4JO2H 4HFWB 4BQ9A 2AABH 3WV0A 3T0EB 5D2LA 3ZDXB 3HA0A 2WWMD 1GCYA 5FB8A 5IW1A 4M48L 3QZBA 5GS0C 5D7LB 2YAOA 1SN0A 1K4DA 1T7ZA 5B7MA 3SPVB 3LNEA 4ZSOE 3QAZB 4HH9A 3PF2A 2FT6A 3QS3A 3W2DL 5B38B 3DDGA 1HCZA 3GM0A 3UAJA 3WTUA 1KJ2H 2OXGA 4PG2A 2XVKA 3EJCA 2VLLA 2ZTBA 4YQXH 5DC0A 4DOHE 1A6UL 4HMEA 1T2QL 1DANU 3FO9A 4NC2B 3NPSB 1XF1A 4HHAA 3GI8L 4Y1AD 3BDYH 1CF8H 5E6YA 1UJTA 1T21B 3HZVA 1M53A 3QXDA 4Z7VA 1KV3A 4N5ED 4PTUB 1NEZB 1QZNA 3MRKA 4APQD 5CILL 4E9SA 3IDIA 2ICEB 4DKFL 3SYOA 2YJQA 2LTQC 5IQOA 1C12A 1R5WA 1U8CB 3WS3A 4BWUA 3AU1B 2COQA 4BQ8A 2GJ6D 2VRAA 2E8YA 3S3DB 3KPQA 2BPBA 3DIFA 1CGWA 1HNYA 1UWYA 2NY0C 4FQJL 4GSUA 5KG9B 3PXLA 3WE1A 4F1SA 4OJCA 2UZYB 2CXGA 4PWHA 4QRSB 5DZAA 2R0ZH 1RFDL 4LSPH 2EYTB 3G9AB 5IJVA 1Z9NA 2QGEA 2G3MA 4U6XA 3VXQB 2EVGA 3H6JA 4UQ3B 1L0PA 4ADIA 4N6RA 4L4TD 1H8OA 4W9ZA 5AZ2H 4Z7UF 4OLXH 2UUDK 5T33L 1JHLH 2W60B 4C55A 4MD4A 1QKZL 4CUCA 1FC1A 1LDSA 1OAUH 4LSQH 5C0CD 3GZPA 3ZTDC 2YUVA 4YSEA 1GGBH 2VDRB 4HZ1A 1ZS2A 3NCJL 5SWQB 3KYOB 2K7QA 4X5XA 4J39A 5J13C 1L9SA 4GQ9L 1DBKL 5ESVA 4RGOH 4PYHA 2R8SH 2HXAA 5I66A 3HAEB 5IM7B 2NNRA 1RUAL 3FT9A 3SJVA 4EN3D 5F9OL 2O5XH 4HWZB 4Z7UB 1CFQA 2H5UA 2XV6B 5FPIA 1AP2B 2YRZA 1I4FB 2YR3A 4JFUA 1I1AC 4FTVB 1OSEA 4CNIB 4HJIA 1CDHA 1W72H 5CP7B 1QRKA 2CPUA 3RQ3A 1MAKA 1Z5LB 2PWDA 2Z31A 4UTCA 3K5RA 3FFCB 3VRLF 2W38A 4KNSA 4MAYD 4QRRA 2MCAA 2J88H 2EYRB 3MDJA 1ZOXA 1TJMA 4MJ5B 5GGTA 5EPMB 2XWRA 4GW1B 4KXDA 1C8QA 3PDGA 5D1XE 4A55A 1BZOA 1OZUA 4Y2DD 3TPUB 3U36B 4L3EA 4J3XA 2V2WB 1L9TA 3BYYA 1XF3B 1UXWB 2ZUSA 5ANMB 1QFWI 5KYUB 2JIXA 5ESAA 5I6PA 3TGXA 2BWQA 5CBEA 3NABH 4EN2A 5A43C 1WAAA 4J6IA 5I74C 3DTUB 1UB6B 2UY6B 2VDNL 4R5XA 2EINB 1Z0NA 5JA8B 4IRSA 3O11A 3P3YA 4GBXC 5IB2B 1YLBB 4WTQA 3KCWA 4JFEE 4L18A 3GMOB 2YWZA 1IC7H 5IEKB 3QDJB 2O61B 5AYUH 3MGAA 1CYGA 2QSTA 1W16A 4GFXA 3DJRA 1ZVHA 4XH2A 5D2LB 5T1JA 5CFAA 2ETWA 3F6IA 4WDIA 1JXFA 3QIUB 3BT2L 2ESVE 4NQDD 3PWUA 1RUKH 2OI9B 3HS8A 5ID0B 1PQZA 3HZYA 3CX2A 2CNYA 5F6IB 5FYJL 4RGND 1P7QB 3NEEA 5D5MA 2HFEA 2NYYD 3VTAA 5H35A 1MPAL 1XGYL 2P8MB 1T7WA 4HH9B 3WIHH 3W37A 3TPKA 2P5WE 3MRCA 5CCHE 2PKDA 3PQYD 5AUMB 4OSUL 2Y3AA 1UWFA 1SBBA 5BVJA 4LCWA 4B0MM 1SY6L 2XZCL 3MOAH 4G6ML 5L8JB 1BAWA 4JPWH 5CLTA 4PREB 3BH4A 1K8IB 2G0LA 4HUKB 1HC1A 4MS8D 2YAHA 1OT4A 1QBBA 3D12B 4MQTB 1IARB 1H5BC 3H2PA 4ICXA 2OXHA 3TO2A 4HHAB 3HC3H 1DDHA 1BVLA 3KPSA 4K7PH 2VWEE 4MRCA 4UCFA 2A74C 3TZVD 3ZTNL 3T2QA 4WHTA 1EEYA 2W91A 4DK6A 4Z7VB 1RJZA 4XN2A 4LOVA 4YFDB 5D7JA 5C8JA 3C09C 4X80H 4EDWH 3VI4E 4P2QB 3IDIB 3VM7A 3WLBA 2X4TA 4ENZA 3VXMB 5IVXA 2H0EA 1GZHC 1C12B 4HIXH 5DEGB 2DN7A 1EFXD 1PIFA 3HE6D 1NICA 2OW6A 3MJ8A 4BSWA 2YPLD 3FQ2A 1TZIB 4P48A 3LZNA 1NCTA 3KPQB 4AEEA 3OLEA 5B3JE 4HOXA 1EZVY 1AR1C 3QYNA 5IK3A 4U05A 2VXSH 4HV8A 2DWSA 4J1UA 3ZGIA 5EUOF 2QTVA 4U6XB 3HG1E 4YHLL 1IAOA 1BF5A 1IZJA 3BAEH 1LK3L 4TNWF 4E36A 4C47A 5C0EB 4RWYL 3DPBA 4LB8A 4JDVB 5BJTA 2HMIC 5CJXC 1WH0A 2IOMA 2R56L 3POCA 4LRIA 3U6RB 3TXAA 3O41B 4ZYKA 1E8ZA 3BUBA 1LWRA 5KANG 3I75A 5KWYC 4CADA 3QI9D 2XN9D 1MFDL 1HNFA 4ZW5A 3WY4A 5EUOB 1XGPA 4R6UA 3B37A 4Z7WA 4N2MA 2EH8L 3GRGA 4JFPA 5ENWB 3TN0A 1OE3A 2Z7WA 1KCWA 5FDWA 4NBYB 1INEH 1JGVH 2W07A 3VFWB 1TVBA 1M1XA 5C9JA 2X4UA 1IL1A 4XCFL 4GRLD 5FF6A 2XWDA 4JB9H 3II1A 4YAQA 2F5BH 5EEWA 3I85A 4WHYG 3RX5A 1T22A 1IFRA 2BSSB 4ONFH 3PFQA 3UERA 2VUKA 4R4FL 1QRNA 1K4CB 1USQA 4PJHA 3HG5A 5C07D 4QRRB 4YOKA 1EH9A 4AQAA 5HVFB 2HWZH 4QI3A 2IDSA 4XO8A 4YO0A 1WZLA 2A38A 3BVWA 2FECI 3OAUH 2A4ZA 5JORA 3B2PA 2FX8L 2OPCA 3OTTA 1ZCRA 1HT6A 4Y4KB 1Q1JL 3BLBA 4ERSH 2R2HA 3K2UL 5GGSB 4G7VH 5ESAB 4BSVB 1BEYH 4HETA 3RJDA 4PGDA 5FA3A 15C8L 3KDMB 1WVZA 4HIIB 3X3GL 4PLKD 2DQCL 4MSWA 1WYJA 1ROWA 2PPFA 5EIIG 2X6VA 3T09A 3BE1L 3DX6B 4IOFD 1OAZL 2G60H 2F2HA 3WS6C 3PGFL 1B0GA 4RBPH 5D2NC 2BNQE 4Y4FB 5KSAB 4LZKA 2DQEL 4NKOA 4GI9A 4XH2B 4WDIB 4DAGL 1AHMA 2F53B 2R1XA 2KLTA 4Q9BA 3FFDA 4KKAD 1TZGH 1PQZB 2Z4TA 4WFEE 1O7DC 5F97E 1FE8L 5D5MB 1NMAH 1WZMA 4XE0A 4WW2A 1OGAA 1S7XA 4U6TA 4OKVA 2A6DB 4A2EA 1RJYA 3NGBC 2E9JA 4PS8A 3Q2VA 2MQCA 3DX3A 2KQMA 1WPCA 2WGXA 5LN4A 5FWRA 2VXVL 4K5NA 1KPVA 2KC0A 1VZHA 3G3LA 5JW4M 4KJPC 2ZX5A 4D8PA 3F12A 1SM3H 4NSKB 3FTGB 3RIAK 4Q9RH 3FB6B 1W0YT 1BVLB 3BDXA 3ISYA 3NZ8A 4H8VA 1CIUA 1AZZC 4MLIA 4NP4L 5I6OA 1SVCP 2AJSL 1MHHA 2NTFB 4FA7B 4Y5XC 3MRRA 4FE9A 4XN4A 5CJXA 4DUXA 3KPPA 1T1YA 3AXLA 1AGCB 1DFXA 4JFQB 4QHNA 5DD0L 2P24B 3K6DA 2NZ1A 4ODBD 2X4TB 3JZYA 4H8WL 5HSFA 4O2FA 4BSWB 3JV6A 3CUPA 2NX5A 4JMNA 2HJLB 1SXBA 1DEDA 4E42A 1PEZA 4A63A 5D4QA 4Z76A 4W9HC 5CMAA 1KCLA 5F0JB 5JYMA 1H19A 2BRQA 4RWHA 1BVKA 2A9CA 2E7CA 4H0GA 3BPLC 1AS7A 5J1SC 1JXJA 2QPSA 2IDFA 3MV9B 3QUZD 1SHXA 2X44D 4LSSH 3FQYA 4GP8B 5I75B 5KVGL 3ULVF 1IGTB 3V4VL 2EIBA 3MLXH 1OB1B 5BUPA 1P1ZA 4RRPA 1WK0A 2WPGA 5BJTB 2IH3A 2AJZA 1QLEL 3CN2A 4AVIA 3E80A 4ZYKB 1XMEB 4HAKA 1FNEB 3CFBA 4CADB 4E0RA 5IROD 1XGUA 4R4NC 2Z7YA 4JRWA 4U31A 3NJGA 4X42A 5EZIL 1CF1A 3WENA 4EOWL 4Y9GA 1LLAA 1P4LB 2NNAA 1I3GL 2I5YH 5HJDA 1MJUH 3CBJB 2X9WA 3LOWA 5EMYA 5CD3B 3T4YA 4G5AA 2R29H 1NPUA 4JFPB 3FHAA 1FO0H 5FDWB 2ZXBA 3QUYB 4GMSL 3O3DB 4NWTL 2ADGA 4UT9L 3GDCA 1U2CA 5FF6B 4D9QE 4EIZC 2F54A 3VFOB 4X6FA 5B22A 4OFYA 1N8ZA 3TBCA 1LEIA 2MH4A 4OLZL 2XFXA 3OBAA 4CU6A 3HFMH 1QEXA 5B1CA 1KNOA 3ZL4L 3O0RL 3GBMH 3TLRA 4B3VA 3UO1L 1CR9H 3B2UC 5D7IF 3VXRA 5GGVH 5D2NA 2W95A 1A7QH 2XWCA 2EDNA 3E6FA 3VM5A 5C97A 1TQCB 5T1MA 3O6ML 4CGTA 1JGUL 4LIQL 5JORB 5SX4H 4Q9QL 1I9IH 3W9DA 3HNSL 4JJ5B 5D93C 2BHZA 1YSOA 3K71A 4M03A 4LEEA 4OI8A 1XO8A 1TJGH 5DGRA 4HD5A 2IAMC 4HBCH 5FA3B 2BIIA 1S3KH 2G5BA 3C6SA 5D1XD 1F3JA 4FQLH 1E4HA 4XO5A 3FO2B 5I18L 4MSWB 1YRKA 5D7IB 3LQZB 2YA2A 3PABA 3S9DB 4IBLT 2WBXA 4JCWA 3NK4A 4G8EB 4WF7A 2DIEA 3U4EA 2X9YA 1E4WL 5ICXA 2W0FA 3LXUX 5KVEH 1CU4L 4AQ1A 5J8OA 4LT7A 4AJYV 4TVPH 3QO1B 5G2NA 2R1XB 1RPUA 2DMHA 3B4NA 1A6VH 5HY9A 2VXTH 3KGTA 4FQHA 2I60L 1MW2A 1S9YA 3QIWD 2OMTA 3HMXL 3IDXL 4JFED 3ZHLA 3L9BA 1DFBH 3UBXI 2V2TB 1RIHL 3CZNA 3QT2A 5CLXA 3RZWA 5E6IB 4UM9D 3KLHD 5IP4A 1NOFA 3GMQB 1MAMH 1RJYB 3I2CL 5E00B 2ESVD 5IT2H 5HYJE 2K7PA 4HWBL 1R34A 3T6VA 1KDIA 5AVZB 2MIZA 1ZAGA 3N9GL 3QDME 4YXHL 4D8PB 1ES0B 3F12B 3EYUH 3FUKA 3L9RA 4KKBD 1RMFH 3VVVA 2W9EH 2DW5A 2P5WD 3DVFA 2J5LB 5T1KD 3GRWH 3MRRB 1SMOA 3EZ8A 1NLDL 1T1YB 3AXLB 1U2HA 3V95A 3Q0HA 3WKQA 4YSAA 5C0GA 5AD0A 1KENL 4G7YH 5IY5B 3VFMA 1OSZA 4N0FA 1MH5A 5IMMA 4JY4B 5T3ZH 5EZLA 2HRLA 2NX5B 3AM8C 1KGWA 4GS7C 4IIZA 4L0PB 3ZRSA 1MLCA 3FTWA 4ACTA 1TJHL 4Y2OA 3GTVA 1AC0A 1G7LB 2HRPH 1BBJB 1CGSH 2JTDA 1U0QA 3IAPA 3O9WC 3K8LA 4FABH 5I9QC 1FWXA 4HALA 1NTDA 1FLTX 4WWOA 2FD6H 2L4OA 1UWXH 1H9DA 3BZ5A 1G9MH 3T5WA 4OZ4A 3LIUA 3L4CA 3TJEH 3D85D 4N85A 2FYYB 1AKJA 4P2OB 1LO4H 4YGAB 4PLJC 2IH3B 5KVEE 5LNGA 3C60B 4TVPE 4I18C 4AEHH 3HG1D 5IQNA 3L1EA 4U0QB 2VMEA 3D25B 1R3JA 1P5UC 4FJ6A 3WY1A 3OMZA 3L4WA 3MRJA 4XXCC 4YBLB 2UX7A 1RZKC 4AC4A 5F1IB 5D7EA 1KEMH 5HYIA 4NNPL 1U3HD 3LY6A 2CPCA 3JWNG 1GAFH 4FADA 2EP6A 5GZNC 3IMWA 5ICYB 2ADGB 4ZXBD 1G0YR 2CUAA 5L2JB 2F54B 1TG8A 5FO2A 4CKVX 1ITBB 3V0GA 4X6FB 4IBUA 4F3FA 3MMEA 4JO1L 4O00A 2C4XA 1YUHA 2VQTA 3QEHB 1FSKB 2CRZA 2BOCA 1KCSH 3O4OB 2XETA 1SY6A 4PJXE 2C9AA 4TSAH 4Q4IA 5FHBL 3MLRH 5C6TH 1KCVH 4WKZB 5J57B 2GBUA 5A2FA 4CU8A 1DLFL 2Y7OA 3IXTA 1Q90A 2E7HA 2RALA 1S6NA 1GYWA 3W9DB 5AB9A 1BLNA 3LCYA 3P54A 1URZA 1EJFA 5EZJA 5T3ZE 3QCVH 3PUCA 3EOBA 3H6AA 1BMWA 1RI8A 3HLAB 2GY7B 4MMZB 1RSFA 1DUZB 4A2MA 5D96B 3V5KA 4OZFB 1DSYA 2ZAGA 3MLWL 2G5BB 3AMLA 3FBQA 1F3JB 3VH8G 2ENJA 1WZKA 1AANA 1IIIA 1EERB 3LEVH 5FV1L 2ED8A 4PJ9A 1SXSA 1QSEA 1KLFA 2IDCA 1PS3A 5IJDC 2EIMB 3P2BA 1IGYB 4GRWF 5F6HI 5FYJU 3STZA 2AQPA 2W0FB 4KKQA 5I8OH 1SYSB 1QASA 3C8KA 2OMVA 1JHTA 2NXZB 3S7GA 2MFNA 5I8CB 2APXA 1E4KC 3D18A 3QG7L 2OMWB 2YIHA 4LASL 4TULH 5F7KC 2IWEA 2OMTB 3LIZA 4OZIA 1OQOA 5K9QG 2ZOLA 1K3IA 2AJ3B 3JYBA 3S8GB 2BNQD 5IQLA 2P8PB 3AM8A 4ODTH 4GRWB 3ZKMC 1JNLL 2WLIB 5JHBA 1Q1PA 1X5IA 5GS3A 2ITEA 2R1YA 4MNQA 3D9AL 4N4YB 3EYVB 5DJYA 2Q1EA 4WFED 2AJUL 3O9WA 1IMHC 3KDPB 4N3TA 4I9WE 5DZPA 3ZTEA 3CAFA 3B2MA 4BFIB 5C0JA 4UTBA 1CG9B 3QC6X 3FYIB 4WHYH 3O45A 1DQTA 4Q9CA 2BVPB 2KS0A 1EUUA 3KZ8A 4J12A 1A3RH 3OR6A 5GGQH 3ZDYE 4FMVA 4MDRA 3RVVC 1Q9WA 4DVBB 2MOVA 4K7PX 5HBBA 3QPXH 5AD0B 4I18A 4L2LA 4N0FB 1MH5B 1P5UA 1ADQA 4KFZC 1R75A 2H3NB 5EOTB 4AXWB 1AJ7L 4P5SA 1BVZA 1HHGA 4DN3L 4LBEA 4MNHA 4NQTA 4TL4A 2YKLH 4ZPTB 4URKA 1T1XB 5HDLA 1CLYL 4JHWH 2DWEA 4MA3A 1WGVA 4PTTA 1WZ1H 2EJ1A 5GZNA 4EF3A 3ZE2E 3BPCA 4B7IA 4UWQB 2J6EA 4YSSA 3EO9H 3BMVA 4CGUB 1BVOA 4WUUA 1QWNA 3FQUA 4OW6A 1A6TA 4YC2B 4QYOA 3HCVB 4W4NA 3WAKA 2PXYA 4XC1H 3LH2L 4ZX5A 4QJ3B 2VDNB 4S1RL 5IBUB 3SPIA 2ZWKA 4K15A 4LVNC 4QXTB 1I8MB 4CAGA 2K6YA 3H2WA 3P30L 4XBGB 3GJFA 4ONGH 3GHPA 4N2HA 4Z78A 4NZTL 3MRFB 3V55A 3APMA 5IQ7L 3SY0A 5HYFA 1YECL 3UTTB 1I7ZA 3MXWH 2D3NA 3KYKH 3MLTA 4RMTA 3LAFA 4BM7A 1I9EA 1NUNB 1PY0A 4XBEH 5DK0A 4KVNL 4XWGH 2VR8A 3CTTA 4Q0XL 4ZAKD 5IB1B 4LMQI 1WWBX 1J05A 3OKOA 1B6DA 3QPKA 2IALA 2VR9A 4KHTL 1KCRH 4QHLB 4YSPA 4QTIL 4KJWD 3ZTJG 2OMYA 4ZTPH 4D9QD 4QXGL 4FP8L 1E4KA 1F3DJ 3IXTB 4P3DA 1OCRB 4UQBA 3K81A 1R9FA 1BLNB 5EWIH 5EZJB 3WHXA 1CVRA 3ATEA 4JGMA 3V5KB 1RU9L 1KUMA 2WXGA 4KXZH 1F4AA 1ECYA 5I30L 5ISZA 4JFZH 2AFNA 3LRKA 1UD2A 4DKEL 5EH1A 2AMUA 4PJ9B 5IF0A 1OD9A 4ANKA 4PRDA 4G43A 1LJMA 1ODUA 1B88A 4LHUG 4U3SA 3F2LA 4CDGC 4PP2B 4JQIA 4KXZI 2GUYA 4X7TB 4DTGL 1MF2L 3Q8FA 3C8KB 3LZOA 3BHBA 4TSBL 2OMVB 5TE7L 5LG6A 2FQDA 4IGBB 5JHLH 5IMOB 3WSQL 4AIEA 4Y5YB 3TBYB 3HE7C 4BQBA 3DX8A 1V10A 2Z35A 4G8IA 5DQ9B 3ECBA 4F7MA 3M8OL 4WV1C 5AVUB 4OZIB 2ZOLB 2X3BA 5IREA 3NFNA 3TH4T 1T04A 3W11D 5AKSA 2IG2L 4J3SA 1IM3A 4NM4L 4BFRA 4DVRL 3IWUA 1YEJL 3M1CA 4HVBA 4G3YH 3SZKC 1G0XA 4ZFQA 2OSYA 1NBZA 1YN6A 3CFDA 1SOXA 1HXMB 3GZKA 5DJYB 3O6FB 4MJ6B 3C9NB 4BUGA 4GG6E 1VEOA 1BWWA 2QVMA 3GMMA 3G6JE 2Z8SA 4F57L 1MQKL 3K6NA 3A4AA 1D6EA 5DO2D 2CO6B 5C0JB 1OAKL 1DVTA 4KRNA 3RZCA 1S3RA 3EOYG 3TT3L 2FJGA 4QYAA 4HCIA 3R7QA 1CPUA 2AV7A 3S5ZA 1S7TB 1WE5A 5HYJD 4EZKA 2HH0L 1Q9WB 3QWNA 5LJYH 4DQOL 5DEFA 2V5RA 2KHAA 3QDMD 3ESVF 4XNDA 1R3KA 2BO0A 4BQCA 3HB3D 1V7ML 2EZ0C 1QTYT 1I7TB 4FERA 4W81A 2APVA 3V7AG 3QH3A 4X6BA 2OV0A 3E8UH 3PP3K 4K73A 4UDUA 1NCUA 3H42H 4OIIL 4V1DA 1SXCA 1HHGB 4FQXD 4MNHB 3SYAA 2IO5A 4JFOB 3ARFB 2V8LA 1CZ8H 2FDBP 3G9VA 4HUWB 2X2JA 1MCCA 1YC7A 3T71A 4MA3B 2WD0A 3BLKA 3GMNA 1FPTH 3VWJB 5EEUA 2EKJA 5DF0A 4QWWC 5JPNA 4KZDL 3LEYH 3BPCB 3LZRA 5I0WA 3VD9A 4J23A 2EC8A 2JB6B 3UROR 3V6OA 4HJ1A 4LLAA 3S37H 1DSFH 3FQUB 3FT3A 3W0WB 2FJSA 2JLPA 5DRWA 4JR9L 4QYOB 1KELH 3RUGF 5E03A 3IMUA 1D2PA 3SDXE 4L1DA 2PXYB 1TU2A 2I27N 5E9DE 2GCYA 1QFUH 4FXKA 3WFEH 4M43H 4F80A 2EDOA 4JRLA 1AACA 3MREB 3AU0A 4O5LH 5IJKC 4K7FA 4E41B 4OB5L 4BZ1L 3Q5YA 3ZQWA 3F84A 3T2PA 1P7BA 3GJFB 4FFZA 1IBYA 2H0PA 2KUTA 1GZPA 4NBXB 3QVAA 4TVPD 4A04A 2ATKA 2GY5A 2VABA 5HJGA 1YY9D 2W1NA 2VL4A 4XB7A 3AC0A 1LO5B 3CN1A 3ATFA 3MLTB 1OP3K 3G6AA 5B38G 1ZGLA 4YUEL 2OKMA 1PX3A 5DFAA 4U1HB 3C87A 3T6QC 4WTZG 1A5FH 2QT6A 1J05B 1R46A 4HJGB 3OKOB 4J3WA 4XZUA 3RVWC 2IALB 5FC9A 4DP1X 5MEQB 3B6SB 1PMYA 1WIUA 3DTDA 4WWNA 1YEHL 3G7TA 4HIHB 4NQEB 5HHME 2MCPH 3AROA 4P3DB 3HE7A 3BQUD 3MV8A 4WWKB 5C71A 1QWHA 1BZ7A 4WV1A 1NEZG 2R0LH 4IMLA 4PHXA 2V5MA 3LPGA 2HRGA 4AEFA 5IHUH 4F9LC 5BMFH 1F11A 5KYNA 3EH1A 1QPKA 5HHXL 4K5OA 1UOVA 4IRJD 1IAIL 4YXKL 1P2CA 2BFGA 3ARTA 3VI3A 2ZX6A 1TJIH 5DS2A 3TO4A 1JN6A 3I50L 3WTWA 4QRTB 2WUBL 2AJYH 4OLYH 4PRDB 3NN8B 5JOFA 2I32A 4U6YB 4F2EA 5T3ZD 4U3SB 2Q20A 5L4JA 1BZQK 4WO4A 5DLML 1GC1C 1JPSH 2JMRA 4I1PA 1DQJB 5AW2B 1XXFC 5HDBF 3DX8B 4JFFE 1G9NL 4F7MB 4I85A 3V4VB 4R26H 4HEMA 3BVUA 1A7NL 1JXGA 3IWVA 2VOTA 3EO0A 3HC4L 4TXVB 1QLEB 1ODAA 1OP5H 3R7RA 2RR3A 3JVGC 5A7EA 1M9WA 1T1ZA 2A9AA 3RILA 3WN5C 3IMRA 3CFDB 4G1MA 2XY2A 1JGIA 4L8BB 1INDL 3JWNH 4K3DH 1A7RH 2DQIH 3IDGA 4PP1C 1H3TA 1KTCA 1RZ8B 2AJVH 1MWOA 3HRZB 5HDBB 3BMWA 3QWOA 1F8TL 2D9CA 4KX7A 1FDLL 1NLBH 3WY3A 4P4KC 3RZCB 1N0XL 2J43A 1N4XH 2FJGB 2NY5H 2HX7A 4J8RA 1QNZL 1NBCA 4HDIA 1CDGA 3O2WL 1JPGB 2IFFL 3LVEA 3DMMD 5E2JA 3B2VL 1BAFL 3LN9A 5IFAH 1OEZW 4OLVL 5EEZA 1YEWA 4DPCX 3KLAA 3OKLA 4I9WD 3UYRL 4RAHA 4Z5RB 2K78A 3V0VB 2H1PL 4M1CD 1E8YA 2QJDA 2VDKL 2NNXA 1C8PA 1U92B 1RVFL 2L3BA 4V1DB 2ENQA 5FGBC 3O6LH 2ATPA 3ILQC 1TCMA 3ZO9A 1NGQH 3CZKA 3KHQA 5I1JH 1NPNA 3B7SA 2D7QA 4A67A 2J1WA 4LVOC 1P4IL 4XOBA 1GSKA 2EXWD 5JPNB 3DETD 4P3CL 4ODVL 1NGPL 3N0PB 1UA6H 2JI3A 4JFXA 3CSPA 2FWOB 3A67H 5DRWB 1MCLA 5I5JA 1LO0L 2R4SH 3RWHB 2GTWA 1TU2B 5FFOA 1ZIAA 2XC8A 2VDOH 4FXKB 2VQ1A 3IRCA 5I5MA 1TLKA 3IKCA 3FUDA 1XVSA 2IPUK 1HILB 2FO8A 2DM7A 2YRBA 4PW3A 4K7FB 1BAGA 5T1LD 3O4LB 4CMHB 1M9SA 1FL6B 2P26A 4HJJH 4GKSA 3KXFB 1DO5A 4N2CA 1GZPB 1VGEH 3O6KL 1UJ3C 1NAMA 3BXNB 2JJTA 2VABB 3QWRD 1UENA 3MGOA 5TFSH 3ES6A 3SDCC 4FQ2H 3P77A 3V0IA 2NYKA 5JIIA 3DUUA 4XMUA 1MREH 1D7FA 3GNML 1T3FA 2X6UA 4JCMA 3G6AB 4Q56A 3JWNE 4JG0L 3DX7B 4APXA 4FI8A 1H3PH 1J8HB 4KOCA 1PFOA 2EXYC 4AEIH 2KZKA 2AK1H 5EDXA 4ZNEE 2WWKO 4XB8A 2FBJL 4FGMA 4OJYA 4HAFA 2O26U 1BIIA 2VW6A 5ALBH 3QXAA 1NCOA 2V17H 3FN0H 1NM9A 1PLCA 4PJGA 3T3PF 3QXWA 1KZYA 1BQKA 4FFVD 4IDJH 2MNUA 3UPAA 2E3VA 4IMLB 2YS4A 3JTSA 2Y1ZA 4I0PD 4YDVA 4JKKA 3FO1A 2J72A 1EJOL 1FVEA 4CU7A 4HQQH 1K2DA 4YDLC 5I0DA 4ONHA 1HHJB 3FOLA 2ITDA 4TVUA 1EGJH 1IGFL 2X4RA 3P0VL 1PZSA 4KK9C 3JVGA 3NMEA 1NIBA 3D1MC 1P2CB 3WN5A 4GMTH 3TO4B 1RJCA 2MPAL 3SKJL 5M95B 1LE9B 2B7DT 3UP1A 3D51A 3OAZK 3X11B 5F70A 3BDBA 5JOFB 2AQ1A 4NZ8A 3IFOA 2WNXA 3D39E 4P4KA 4B6ZA 4WO4B 4L9LA 4G11A 5HJ3B 1DL7H 4R7LA 3LKQA 3UGXA 3KBPA 3OZLA 4FNQA 3TVMC 5I23A 3VFPB 3OVUB 4WEUD 1RY7B 1DJXA 1UM4H 4AQZA 2V3FA 2R7EA 2C1OB 2CG9X 2NTSP 3DXAB 3ESOA 3RFRA 2JI2A 3AMKA 1JRHH 2EEAA 2D7PA 5D1ZI 3EO0B 4LKXB 3FUJA 1JZ2A 4I8DA 3VWKC 2B5IB 2VKWA 3ZRFC 5FGBA 2O6EA 5HHQA 2DYSB 1F3RB 3K4ZA 3ZT7A 4LLUA 3DRQA 5IJBC 3ARVA 3VXOB 1S9XB 4U33A 3S8WA 1JRHI 3IDGB 1GPOL 4XCNA 1TZHA 3MNVA 2X89D 3QWOB 5HJBA 5C0BD 3RVUC 2Q3AA 4U1MA 5HHPB 4I88A 1ZPLA 4NCDA 2PO6A 2V2XA 4U1IB 4MAUH 4XWOD 3F7PC 1WD8A 3B2DC 4U6HB 4U6VH 4UNIA 3L3JA 3OB0K 4H88H 1XD1A 1KIRB 3B5TA 3GHBL 3LNGA 4J8RB 4ZW8A 3OMIB 3QNXA 1ZT4B 4ICWA 4N2KA 4MA7H 4PWFA 5KS9F 1OTSC 1D2OA 3QJQB 3PY9A 2E8ZA 1JZFA 1LO3H 4RZCA 5CJOH 3ZTJH 4HPOH 3OKLB 4GUOA 2GTQA 3EO1A 5JO5B 5H4YA 4YHYB 1VGKB 2QL1A 1MZYA 1BZ8A 2OMXB 3JWDH 5JHDB 2ATPB 4K5LA 1WFMA 1AXIB 2X4PB 2HFGH 1LGVA 1UJ3A 3DJZA 3GKWL 4A2DA 3MA9L 1P4BH 5HHVH 1N67A 2QZ5A 5J6SA 2NDFA 3MTXA 4RLDA 5DRZA 5BUGA 3D50A 2G0KA 5KS9B 2O5YH 2YGNA 3LKOB 4C4KO 4UM8A 2RCSL 3NSCA 4P59H 4BCXA 3QXVA 1ZRUA 2Y7MA 2GTWB 1SXAA 4JKNA 1ZJAA 1IKFH 4OGAD 2DQDH 2VQ1B 1IGIH 1HH9A 4KRPD 2ZCKL 3GSRB 3VFSB 3MBXL 1DBMH 3HG4A 4MJ4A 1RUPL 3BAIA 2HX9A 1NDTA 3KBFA 3VNZA 5AWNL 5I6KA 1BQUA 4UU9A 3D08A 1FNAA 4YHIA 1XBRA 4JKMA 5E9DD 1Y18A 2VRQA 1FZOA 2WQUA 4UNVA 1SEQH 2VB5A 1ZHNB 3KLDA 4QPEA 2X40A 2R0WH 1XF5B 2A6JB 1U36A 1WWWX 3IFNH 5KSBA 1F6AA 1K8DA 4U4IA 1BQLH 1YQVH 5D55A 5CBAB 2EUXA 1ZLEA 5I0ZA 1NMCC 3MV11 3HS0B 7FABH 3GIVA 3AQDA 4YBHA 3RVXD 1CXFA 4CJ0A 1DN0A 1KC5H 4M1DH 4YDIL 5JTWA 4B9FA 1ZANL 3WEMA 2F58L 3CSYA 5BUAA 4I3SL 1DQKA 1BIIB 3O8XA 4BFJA 4S2SA 1U93A 1M42A 2XZAH 4JM2D 3QXAB 2QSCH 4PJGB 3KPOA 3EXLA 1TTGA 2XKNB 4FQQB 2PF6A 2ZP9A 5HGGS 3TVMA 1T03L 3K80A 3T3PE 1BFVL 3BKYH 3D5OF 3SE8L 2GI0A 3JTSB 3J8F7 5GSRA 3FU8A 2HP4A 1FVEB 3WL9A 3VSTA 4R2GD 4XNUL 5EU6E 4ONHB 4R4BA 3ZMRA 3H85A 4PM1A 5EOCJ 4H8PA 3EOTL 5DUML 3O3EA 2A0LD 3OJDB 5HHMD 3SBPA 3AB0B 3VGEA 1G9HA 5JIKA 1MFAL 3NQIA 3CHXA 1JUFA 1JPTL 4GP4B 1XCQB 1R1CA 4W68A 5FK9B 4D0CA 3CZUB 4G8GE 5E7FA 3GRBA 4Q8BA 3M7OA 4MAYC 4X50A 5GRUH 1QR1A 5AVSB 2DQ6A 1GH7A 4M7ZB 4OLEA 1Z32X 1JFQH 5EF2A 4XPBL 2FATL 5F7UA 3L17A 5F21B 2NNCA 5HXMA 2D03H 3ELAT 4ILDA 4L9LB 2JK5B 4G42B 2VR3A 2YPVL 3GPSA 2B8OT 3ARDD 1EO8H 3AZUA 1HS6A 2R83A 3CVHL 4H8HA 2NSMA 2X2UA 1WBYA 4HCFA 4QR7A 5DJXA 4KV5F 2YAMA 3TEWA 2IPTL 4G6FB 3SO3C 1Y0LA 4AX3A 4DGWC 4A1RA 5HVWA 4X2UA 4JFFD 4NN7C 1GL4B 1URIA 1KXTA 2C3HA 3VXNB 2BZDA 2XWEA 4Z77B 3I6SA 4BZ1A 1WSST 3FT4A 3VU2A 4U1MB 3JYCA 1FVDA 1QR4A 3MRPA 2ZICA 3KW7A 1J48A 2PO6B 3LSOA 5AW6B 5EFIB 4KTDH 4HXAH 1QBMH 3L1OH 4LSRH 4UT7H 3L3JB 1EAPA 1KPUB 3AFLA 4AL8H 5KZCD 5DS8A 1FYTE 1BFOB 1JXKA 3FZUD 5F96H 4KZCA 1AD0A 1YPZA 4XXDB 4HSQA 3CLEL 4UV4L 2XXCB 3TS8A 2BH0A 4RZCB 3GSXA 1HYRC 4LNVA 3L3OB 4PCSA 4LEOB 1CD8A 2NY6D 2IAAC 2WLHA 1MNUL 3HBPA 3HZMA 4QRPB 3C2AH 1KBBA 2Y9RT 4ZMYA 1GCFA 4NI6A 3V7AE 4L29A 1AHWC 3CLFL 3DOSA 3SPGA 3TIDB 3MOBL 1YEIL 1RZJL 1HSBB 3OV6A 1KBGL 4R90H 3RL2B 5C2UB 3M88A 2NOYA 3I9IA 3INOA 1G5GA 4X0NA 4Z3JA 1J86A 2X4SA 3ZYZA 1WIPA 4IBYA 3ARBB 3S37X 2B4CC 5L0QC 4EKJA 1HH9B 3KPNB 4KJYA 4L8SC 2PW1B 5F72S 1CGTA 3LKRB 2FR4A 4K23H 5C0DA 1PCXA 4PJBF 4FULA 1BQHA 4B60A 5LXGH 3WU1A 1BQ5A 4H5SA 4N0UE 2Z91A 4M1GL 4D8OA 4X6EB 4L2YA 3VXUB 2XXGA 3PGCB 1JXDA 3T6XA 1GYUA 4AYID 2CMRH 1F58H 3T0EE 2VDRH 1N7ML 1UB5B 3H9SA 4G80A 43C9A 1I7RA 5GRJH 4AQEB 1FIEA 4N0CC 1KWGA 1MCDA 2WWKT 3GLAA 4JFTA 5AALA 4I48A 5HYQB 4AE0A 1M56B 3ARPA 3GIVB 5CKGA 3QI9C 1PGRB 4YHNA 1GS8A 4MQXC 4PJBB 5J11B 5TH2A 5DMGC 5A40E 1M2OA 3TF4A 1CT8B 1U93B 2N59A 2XPZA 1FFNB 1I8KB 5HVHC 5JOPE 4R97B 2BZCA 1Z6JT 3SGEH 2WQXA 2VH5H 4X6CA 4ZDHA 3ESMA 5GSRB 4GRLC 2QSVA 3OXSB 4P05A 5CGYD 4PCTA 5F88B 5DJDB 1W0WA 2CKNA 2L8AA 4R