2XXFA

Cu metallated h254f mutant of nitrite reductase
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
335
structure length
335
Chain Sequence
DADKLPHTKVTLVAPPQVHPHEQATKSGPKVVEFTMTIEEKKMVIDDKGTTLQAMTFNGSMPGPTLVVHEGDYVQLTLVNPATNAMPHNVDFHGATGALGGAKLTNVNPGEQATLRFKADRSGTFVYHCAPEGMVPWHVVSGMSGTLMVLPRDGLKDPQGKPLHYDRAYTIGEFDLYIPKGPDGKYKDYATLAESYGDTVQVMRTLTPSHIVFNGKVGALTGANALTAKVGETVLLIHSQANRDTRPHLIGGFGDWVWETGKFANPPQRDLETWFIRGGSAGAALYTFKQPGVYAYLNHNLIEAFELGAAGHIKVEGKWNDDLMKQIKAPAPIPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proton-Coupled Electron Transfer in the Catalytic Cycle of Alcaligenes Xylosoxidans Copper-Dependent Nitrite Reductase.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Oxidoreductase
molecule keywords DISSIMILATORY COPPER-CONTAINING NITRITE REDUCTASE
total genus 95
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xxfA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2xxfA02
1ILSA 3T6WA 3MX0B 4Q8BA 2W8CA 2VN3A 3KW8A 2CCWA 5TK4A 1HAWA 1ASQA 4ENZA 4UAHA 2UXGA 3NP4A 2BP0A 3DTUB 3WNJA 3WI9A 1ZIAA 4N8UA 4AKPA 2FQFA 1M9WA 3WKQA 1PF3A 3ZIYA 1EZLA 1OCCB 4Q89A 4DP0X 1JOIA 4W1TA 2YAFA 5D4IA 4DP5X 5IY5B 3UGEA 4DP6X 1IKOP 4EF3A 5B3SB 1JXDA 1AS7A 4E9YA 2QPDB 2QDWA 2ZWNA 4NAJA 1KDJA 1AS6A 2AVFA 2XXGA 2GIMA 1QHQA 4YSRA 1BXVA 1KV7A 3GYRA 2R7EA 2TSAA 2AANA 2RACA 2VW4A 2W88A 3CVBA 1A3ZA 4N4YB 2BZ7A 4WKXA 1RCYA 6PCYA 4K9JA 1MZYA 3BQVA 4KNUA 1CURA 2IAAC 4BXSV 3IN2A 3SBRA 4KOBA 1XMEB 3QQXA 9PCYA 4A2FA 1WA1X 1WS7A 2I85A 2UX6A 2H47C 3HEIB 1PNDA 1J9RA 2DWSA 1V55B 2J57A 2BZCA 5I6OA 5I5JA 2CALA 1N68A 1SF3A 1B3IA 1J9TA 1KDIA 4E9QA 3DIVA 2FT8A 2VM3A 1OCOB 4KNSA 3AW5A 4YSOA 1JZHA 4YL4A 5B1JA 1NIAA 3AY2A 1ET8A 2HXAA 1A8ZA 3AZUA 2B3IA 2WSDA 1X9RA 4G71B 3AG4B 3FU9A 4KO9A 2YXVA 3N2JA 3IEAA 3H56A 3FU7B 1MG2C 3TA4D 1JERA 3EH5B 1L9QA 4HCFA 4TXVB 2IDUA 2FWLB 2FTAA 1NIBA 1AR1B 1HFUA 4E9TA 1AZNA 3NP3A 4BWTA 3NJHA 4CSZA 2UXFA 1SFHA 1IC0A 3CDZB 3NJIA 6PAZA 2EIMB 2PP7A 1KCBA 1DYZA 1ZIBA 3CDZA 3QJUB 5E9NA 1I53A 3EH4B 4WTQA 4GY4A 5D4JA 4HHWA 1L9RA 3X1GA 4BWWA 2A3TA 2PPCA 3WNIA 3SBPA 3OQRA 4DPBX 4A2GA 5B1KA 3X1NA 2HX7A 3ABGA 2HZHA 5I26A 2Y1AA 1PLCA 1ZPUA 1NWOA 5I6PA 1AZCA 1WS8A 5LDUA 1IBYA 2BP0B 3PCYA 2BWIA 4E9XA 1SF5A 2JKWA 3JTBA 2E86A 1J9QA 1RZQA 5B1JC 4YSAA 3L45A 4JKNA 2YAMA 1TU2A 1SDDB 3NT0A 3PPSA 4GP8B 1V10A 1UATA 2PPAA 2QPEB 1XB6A 3MBWB 2FJSA 1M56B 1PCSA 1NPNA 1QLEB 2X88A 2YXWA 3CVDA 4PCYA 1DZ0A 4A2EA 3T6VA 1PLAA 3QJVB 2PP8A 4QKTA 2GB2A 1CYXA 1ASPA 1AZBA 3SBQA 1GS7A 3HB3B 1PAZA 2XLLA 4GXFA 2H3XC 4YSTA 2XV0A 5D4HA 2IDSA 1JVLA 5ANHA 2I7OA 3CZUB 2YQBA 1RKRA 1TEFA 3T71A 1E65A 1SHXA 5B7FA 1CC3A 3ZDWA 3U25A 3PXLA 3S3CB 1TEGA 4HIPA 3FPXA 5F7BA 1W6WA 2VM4A 4G7SB 3ZX1A 1JZIA 4HCIA 4AZUA 4DP9X 3GDCA 4BDVA 5I6NA 1W6LA 2HX8A 2GHZA 4YSQA 3WG7B 4HALA 1AS8A 1ET7A 2JFCA 1BYPA 3QJQB 4CSPA 2FNWA 4P5SA 1BQRA 3FSWA 4YSEA 5TK2A 2XU9A 3NSDA 1NINA 3TBCA 2OJ1A 4HZ1A 1AQ8A 1T5KA 3NJMA 2DYRB 2VMJA 1JXGA 3PAZA 4A2HA 2XXFA 3UAAA 4DPAX 4E9WA 1FA4A 3IE9A 1GSKA 1E5YA 2DV6A 3T6XA 2GSMB 1JXFA 1OE2A 4F2EA 1AZRA 4M4RB 1YLBB 1BYOA 4QLWA 5I5IA 1XB8A 1FFTB 1MZZA 2PCYA 1GW0A 3UACA 4HHGA 3NJNA 1PZAA 4YSUA 3JT2A 2MTAA 4YVNA 1WA0X 2BO0A 4KO5A 3S3BB 4KNTA 4YSCA 1NDTA 1JZGA 1GYCA 4FAAB 1PNCA 1QNIA 1JVOA 4F2FA 2BHFA 3TBBA 5I6KA 4GP5B 2BW4A 1IUZA 2VSKB 5FC9A 4A67A 1KYAA 3WIAA 2IDFA 5AKRA 1FWXA 1E67A 4DP7X 3C75A 4MFHA 1PZBA 4AX3A 2VSMB 1SHWA 3ZBMA 1HAUA 1IBZA 3X1EA 2WO3B 2IDQA 3PAUA 3NJGA 4UANA 2YAHA 2IWFA 3ASNB 1NWPA 3FQ2A 2N0MA 5EHFA 1BAWA 3OD3A 1N70A 2BW5A 2NRDA 4AKQA 2PPFA 2PLTA 3S8GB 4W9ZA 2BWDA 1AANA 1ADWA 4BDVB 1ID2A 4E9SA 5F7AA 2OV0A 2DY2A 1A4BA 3FU7A 1NTDA 1GY2A 4P5RA 4YSDA 5A7EA 2ZONA 3KW7A 4JHVA 3SQRA 1XB3A 1L9PA 2DYSB 2EILB 2IWEA 4DP1X 2YAEA 5B7EA 2FT6A 2YAQA 1ET5A 1PLBA 5B1AB 2XV2A 2XX0A 4HAKA 5I28A 3QJRB 4DP4X 1A4AA 1NZRA 3NSCA 2Y69B 4PAZA 3T6ZA 4AI7A 4BWUA 3OMAB 2CJ3A 1AG0A 2GI0A 2EINB 2YAPA 7PCYA 2UXTA 1AIZA 4DPCX 1CYWA 2GBAA 2HLEB 2PPDA 1BEXA 1A4CA 3DKHA 1OF0A 2PP9A 2J56A 3FT0A 1SDDA 3OMNB 1AG6A 4RH4A 5PCYA 2J55A 2HRHA 2IH9A 2EIKB 4UF7C 3TASA 3X1BA 2YAOA 2CUAA 3TU6A 1E5ZA 2IDTA 1W8EA 2LLNA 1ASOA 1OV8A 3BVDB 2YARA 2BP8A 8PAZA 2OCCB 3NSFA 3T9WA 1WAEA 2FQGA 3NYKA 4YSPA 1J5CA 1KCWA 3IBOA 1F56A 3UABA 3X2QB 4X4KA 3ASOB 1L9OA 1MDAA 1ZV2A 3FSZA 1OE3A 4F7KA 2P80A 2VW6A 3QPKA 3V9CA 4G72B 3FQYA 1GS6X 4BK5C 4GYBA 2XV3A 1VLXA 1SFDA 2GC4C 2XUWA 1AACA 4HCGA 4A68A 2HRGA 4L0PB 1AAJA 2FT7A 3EH3B 1A65A 1NIFA 3ABLB 4E9RA 2UXVA 2XVBA 1R1CA 4KO7A 3FYIB 1NIEA 1ZDQA 2Q9OA 3OMIB 1BQKA 3NJFA 3FQ1A 2I7SA 4E9VA 1TKWA 1JZEA 1E30A 2PPEA 4A2DA 2XWZA 1OOWA 4A66A 2DWTA 3QJSB 5AZUA 1RZPA 3RYMA 5I5MA 1ILUA 3G5WA 4ZK8A 3CG8A 1OCRB 2J5WA 4FA7B 1BXUA 3AG2B 2FQDA 3FSAA 1EHKB 1KBWA 2H5UA 5I6LA 2TSBA 4AKOA 3X1FA 3FU8A 3NJJA 7PAZA 3ABKB 1PY0A 3H4FA 3N55A 4KO6A 3CVCA 1ZDSA 1SNRA 2HX9A 1PZCA 2VW7A 3D12B 3FYEB 3NJLA 2JXMA 2Q5BA 1PMYA 3UADA 4G7RB 2CBPA 3ABMB 2PCFA 3PLYA 4M3HA 3AG1B 3FSVA 1MG3C 3H4HA 1SJMA 2MRYA 1OCZB 2WO2B 2EIJB 3AG3B 3NJKA 2BP8B 1BQ5A 1JZJA 4NERA 3FPYA 1L9SA 2P80D 1JZFA 1J9SA 1M57B 2IH8A 5B7MA 4BXVA 3EF4A 1L9TA 3ERXA 2AZUA 1NICA 3IN0A 3S8FB 2CAKA 2AFNA 5B1BB 4YVUA 1J5DA 4GP4B 1ETJA 2R7EB 2ZXWB 2QDVA 1NPJA 1CUOA 1AOZA 5I6MA 1OE1A 4NB7A 1AZUA 1GY1A 2IWKA 4YSSA 3PAVA 1WA2X 4KOCA 2UX7A 2X87A 3S3DB 3UAEA 3EHBB 3V9EA 3WKPA 4DP2X 5PAZA 1URIA 2QT6A 1KBVA 2B08A 3GXUB 3QJTB 2XX1A 2ZOOA 4G70B 3FS9A 3NSYA 1GR7A 4G7QB 4JHUA 5AFAA 1GS8A 2FQEA 1BXAA 3OM3B 4DP8X 2XYBA 1X9UA 1V54B 2AZAA 2GC7C 1NIDA 1KGYE
chains in the Genus database with same CATH superfamily
3ZLQC 2XN9A 3IDMA 4XI5D 1ZANH 4ALAC 1HCFX 5ICXB 4LCVA 2PETA 1J05A 1TTFA 5DJ8B 1CDHA 2R0ZH 1Q0YH 1QX1A 3ZRCC 2VR7A 3WJJA 1SN2A 1F4AA 1K4DB 1KIUA 5MEOA 4JHZA 4P2CG 2FQFA 4U6VH 3T3ME 4DP0X 3RL2A 2X4RB 1FYTA 1MHHA 5CIPA 2ICEB 3FOLB 2H8PA 5EC2A 4P9HC 3UGEA 3CN3A 2OMXA 2Q7YA 5JW5A 2P5WE 2I07B 1GZQB 4PRHA 4Q6IB 4PEEA 5I1CL 2F54A 3QFJA 3QIBD 4HT1L 1OHZA 1FVCB 3F7QA 2CJUL 1U8IB 4N0CC 4GEIA 5ERWA 3IF1B 4C4KO 2OQJB 1JNLL 4YSRA 5DC4B 3SEPA 5JYMA 4P3DB 5GIRB 3VGAB 2VC2L 4AYDC 1TJIH 1KIPA 2QADB 2EVIA 3D39B 4QRUB 1F2XK 2I25N 4QRRB 3P4OA 2AQSA 2LFEA 1IM9A 2E7HA 4N90E 3G9AB 3V0AC 3DUHA 4EDWH 4X6CB 3CFJA 3HZ3A 2WLJA 4AH2A 4HIQA 4YHNA 4AGNA 1Q0XL 5KYYA 2H6UA 1I1CA 2DWSA 1INDH 1I3GH 1EFXA 4XGZA 2GY7B 4NBZB 3RZCB 3CUPA 3POHA 3VI4A 3ZYZA 3O2VL 5DS2A 4MMZB 1U95A 2ARJA 3FFDA 5E8OB 4X6DA 2V5RA 4N2IA 3DIVA 2A83B 1LMKA 4QI3A 3U2SB 4F7EA 4YSOA 2CO6A 3DRTA 1SEBB 5IBLC 3QI9C 1T2QH 4YBQD 4XC3H 1A22B 3QEGH 4X6EB 4TVUA 3SDDB 3TVMD 3PUUA 1OPGL 2EXYD 5AZ2H 3S96B 4IJ3B 5DJ2B 4GUOA 1MLCA 3WUWG 1YC7A 5F44A 3NSXA 2HA1A 1AGEB 2PP7A 4FQLH 4JRYE 3ZK0A 2XY1A 1YPZA 1ZIBA 1B2WL 2COQA 4F57L 3U0PB 4FQXA 1KBPA 1HX0A 3HOGA 6FABH 4Z3HA 2XRAL 5ITFA 2G3MA 8FABA 1F4YH 2HKAA 2ICWB 4FG4A 2Z1KA 3NA9H 4NN7B 1B3JA 3ABGA 3L3KB 5I9QC 4KH2A 5DU7A 5L8LB 1JWSA 4M7KL 1CLYH 3ZTNH 4X7SL 3VXQB 3FQNA 4EDXA 1HSBA 3MBXL 3THML 3UBXA 1RPUA 3O9WC 4P4KB 3WHXA 1WZLA 3O11A 4JUTA 4K8RC 3ULUD 2GUOB 3CZJA 2JXMB 3BWUC 4EAEA 3U0PA 4GRLD 2RA1A 4YHKL 5FYLL 3MV11 4Y4KD 1JFHA 4KNQA 4Z7WB 8FABB 2PPAA 3U4BH 3AMLA 1NBVL 1PCSA 3RWCA 1JYXA 5ELIA 1DZ0A 4QKTA 3D85B 4DOHE 2OR9L 4O5LL 4M5ZH 5GJSH 4UM9D 2NLJA 2UVEA 3O6FB 3DURB 2WIMA 1CGXA 3F01A 5F70A 3NIGB 2NY3B 3RAJL 5DJAB 2GIXA 2Z64C 2FYYB 4UM8B 4C58B 2C7UA 3KBHE 2VZTA 4J7RA 5D7IF 1J11A 4K4KA 4U1MB 1VKXA 4M4RA 2DMBA 4QYOA 3MLUH 2BS71 4CRPA 3CFDA 1J8HE 3VTMA 2ZKHH 1Z5LA 1AGEA 1IAOA 2IGFL 3H9SE 3MJ7B 3V7AE 2YC1A 5I66B 2WPGA 3GIZH 3M88A 1DVFD 5JZ7C 1JE6A 3H9SD 2VDKB 3GWJA 5F9WC 1JXJA 3EJZD 1NGQH 3FSWA 3LKNA 3MC0A 1OANA 5DHVH 3VAEA 1G5GA 2OMZA 2N4IA 3LZQA 5F7DA 4L5FE 2VC2B 2FEEI 2FHFA 1DFBH 1VFAA 1WBXA 1E4JA 1GPOL 2J7LA 3LV3A 3Q1EA 4M6AA 2XXFA 4YXLL 3GXMA 5AOIA 3QIUD 4IBLT 4JFPB 2XPGB 4OFYD 2ICES 5DRWA 3HS8A 3TNMA 2VISB 3G04A 4PPTA 2Y25A 3HNSH 4P5KB 3MJ9H 4M8UA 3A3YB 4Y8AA 1C5DB 2VL4A 3L9RA 4K2UL 4G6FB 3WDHA 1MZZA 1WICA 3SKMB 4H1LH 3DSNA 3KH4A 5I66A 5I82A 2PYEE 3BYTA 3MRRB 2OSYA 2LABA 4J4PD 1CE6B 5F72S 3HRZB 4JANB 3MFFA 3O6KH 4PRAB 2VDQL 1E5UI 1M7UA 4QTIL 3V0WL 4HGKC 1RMFL 1JD7A 2L7JA 1K5NB 4K71B 3AS0A 2WOBA 4OVUA 1IKNC 4N2LA 2ENPA 3L7FB 4QJ4B 3EYUH 4BCZA 1E9OA 3BKJL 3QDGA 2OL3B 1XD1A 1H8SA 5IVOA 2Q7NA 3S4SA 4ZDHA 1A9EB 3OZKA 3PNWA 2ZKMX 3MBEC 1KY7A 4CGUB 5E9DD 5K1VA 3I50L 4P04A 2X5PA 4OCRL 1GYWA 2Y6SD 3O6FC 1CFNB 1NCBH 2JH2A 4FQCH 4J12A 4XNYH 1BVOA 4I88A 2CMRH 2BW5A 3BN3B 1JK9B 3NIGF 3KDMA 3X12A 1YUHB 2GK2A 1ONQA 2AXGA 2Q76B 1Z5LB 4KK9C 1FZJB 5IBTH 3LRKA 3WOVA 3GI8L 4Y16A 4LCUB 2CXKA 4JKLA 1XL6A 4X2UA 4AYMC 5KYNA 1N59B 4JDTL 3RURA 3BHBB 1RZ8A 4H2CA 1MCQA 4JHVA 4OFDA 4HS3A 5C0CB 5EZOH 1LYQA 4O51B 4HZLA 3OLEA 4U1KB 3FTZA 2EIBA 2VJXA 2VDMH 2QSVA 3JZ7A 1F86A 5ICYB 3DYPA 2AJSL 5IQLA 5D7KE 4LSSL 4A7VA 1SY6A 5J4MA 1NEUA 5HJGA 4BWUA 1CGVA 1QSEA 3MRQB 4KK6C 2E6JA 1PJWA 4NLHA 3ULVE 4YFLF 1A14H 2Y36L 3MLSH 3QO0B 4XMKH 3GMPA 3GDBA 3WMPA 3CWGA 5KW9L 1WIUA 4Z8FL 3ARWA 1RJLA 1SLVA 5I8OL 2DM7A 4YS4A 4ZFOB 4N0UB 1HYRC 2CUAA 4LEXH 3S48A 3U7WL 3EDDA 1ZSDB 4GSRA 4I3RL 1TENA 2NNAA 5A2AA 2CR6A 2L0DA 2E7BA 2EP6A 2MJWA 1IGIH 2ZOUA 3FN0L 5DZLA 4ZO7A 3TNNA 4OF6A 5I0DA 3SJVE 4YSPA 3O3AA 5C08B 1B4TA 4G8EA 1AXSA 1DCEA 2W9DH 2UWEE 4YPGB 4PRIA 4MRBA 1RD6A 3X2QB 3KWTA 5DHVB 3RWJB 4W70A 4G8GA 4WFHD 4OQ1A 4XCCL 5KS9A 4GQZA 2OCJA 1VLXA 3MGTB 3DC0A 5T1KA 1IQDB 1IC7L 1OZTG 2GCYA 3LB6D 4DO5A 1KB5L 4X5PA 3HBZA 4PVBA 5H2BA 2HKHL 4EI6A 4HUWB 2EZ0C 3ABLB 2UY7A 3PWLA 5C07B 3RTQD 1DBBH 3TA3B 5I73C 1FJ1A 3LEVL 4LLQB 3RI5K 4ZFQA 2ZSWB 4ZOCA 5J06A 3OAYK 6TAAA 1GGUA 3L3DB 4UM9A 5EU5B 4P59H 2JKXA 3RDTA 1E30A 2MQ3A 5C0BD 1Y18B 4KKBD 2WMPA 5DFVD 2G60H 1HOCB 1OOWA 5TQ2L 1UEYA 3KJ4B 1HWGB 4Q2ZB 1SLWA 3US0A 3Q3GA 3MRHB 1HILA 4OCYH 2VWEE 4EUPB 4E68A 1LDPL 1I9RH 4G9DB 2Z3FA 2X6AA 4NIKB 4YBLC 4YLBA 5TDPB 1U3NA 2VCOA 1K6QL 3QXAA 4N8CH 4TNWF 3BI9X 5I1KH 3MV9B 4GXUN 4MVBD 2A77H 5I1CH 1BFSA 1SXBA 2EIZB 5DSCB 4YBLB 7PAZA 5MERB 2YMTA 3P9WB 1PZCA 1IE5A 1MWAA 5HYJB 3QDME 1E4XL 4P8QA 2FR4B 3D2UA 1F6FB 3PLYA 2D7QA 1G9MC 3HZKA 4TF4A 3EFOB 5C0ND 5MEQB 1PVHA 2GBTA 2R2HB 4XNXL 3TH3T 3AG1B 5DS8B 1G94A 3BQUA 3CBJB 4ODBD 4FXKB 2APWA 2Y7LA 4Y4HB 1ED3B 4NKOA 4S0TD 4FC3E 5BV7C 2RTTA 1QLFB 2OMWA 1OCZB 2WO2B 2RGSA 2VXUL 4FCAA 5H4ZA 1IT9H 1KLUB 5D9SB 2HFFA 2YA2A 5E23A 4NERA 4ZQKA 2VDRB 3U36A 3IFPB 2IH8A 1UKTA 3T2NH 1HIML 3R4RA 5IHHA 3EF4A 5AOZA 1T03H 4KKQA 4HC1L 1S9WA 1VA9A 3O2VH 4QRQB 1GKEA 2D7NA 1T89A 3B9KD 3U6RB 1KEGL 5BUGA 1CFSA 4H8VA 2R7EB 3DPBB 4UB0L 2DH2A 1CBVL 2WNWA 4HUVA 4U6HA 3PWLB 5F3BB 4JGJA 4Y16C 5DS8A 3SGDI 3OKLA 3B2XA 1LP9A 5D96B 4WLCA 2R1XA 4TQPA 3VGGA 2XIIA 2V2WA 2RH0A 4YSSA 3MCG1 5FB8B 3CC1A 3BLPX 1THAA 4JFFB 1I8MA 1JK8A 2W60B 1URIA 2DYPA 4I8DA 1JCKA 4YHIB 2BNQB 3IU4L 5MEND 4XBGA 4BGLA 4UM9B 3FS9A 3AM8A 3LRSA 3NSYA 5LGYA 3TWCH 2YSTA 2EXWC 4XPHH 4F91B 3OM3B 4DP8X 5DR5H 3HAEH 5I0VA 1AC6A 4NOFA 5AVTB 5EUKB 4AC2A 1KCUL 3V4PL 3MRHA 2X1PA 1G0XA 2W8CA 4CL7A 5JMRA 3KW8A 2GEQA 3A22A 4OD2B 3TVMC 4EQ2A 1A25A 2XKNB 3D0LB 1RFDH 1TZAA 1WD9A 4MJ6B 5DGRA 5GJTH 2X38A 5KANG 3REWA 1MHHB 5JW4N 2OJZL 1F1DA 1ZXKA 2EXYC 5E6ID 4B3EA 3HW7A 2H0EA 3NCBB 1BJMA 3UIZA 3IJYB 3KPPB 4XPTL 5DI8B 5DEGB 1M9WA 1TMQA 5HI4C 5KVFE 5IR1A 2AEWA 3EGXA 1D5BA 4DP5X 2F7RA 3LRSB 3T65A 1FO0H 3BDYL 1CB4A 4DK5A 1CTOA 5FGCE 3LS5L 5DLLA 1YJDC 4RAUB 2EDKA 1AS7A 1YHPA 2OCFD 2ZCHH 1BECA 2PF6A 4HCRH 3VDBA 2QDWA 3RVWC 2EICA 3EJTA 2ZAIA 5EC1A 3EYOA 1URZA 2G9KA 1ZEAL 5F1NA 4Z7AA 3BWAA 3WEXB 2P8LB 4HEMA 5GGTA 4RISL 2IFGA 4HAGA 2BCMA 1BXVA 2E27L 5DQ9B 4E5XG 3K6SB 2OKMA 1DANT 1HSAB 2Z7WA 1H3WM 5IESL 2IBGA 3ELAT 2JCWA 3LCYA 5DJ8A 1PSKL 4JS7A 5C0BB 2FWOA 2VQUA 3RJDA 1W16A 3GXNA 3CX5J 3OKLB 1PCXA 2Y7OA 3HNVH 3BW9A 3LKOB 1XMEB 3PQYE 4UQ2B 5I16B 1BZEA 5F1SA 5IVZA 5KBLA 3HG1D 1KC5L 3AVEA 2XFXA 5CZVL 1BXXA 3FRUB 3JTSA 1G7HA 3U2SA 2NX5A 1CICC 3D9AH 5D55A 3S5LB 3CH1A 1A5FH 1MEXL 2BS9A 1Q90A 3C2AL 3VVVA 2R39A 5FW8A 2G3XA 4LSVL 2GFBA 4RX4A 3FFCE 5FYJH 1G7MA 1E8ZA 4MJIB 5EH1A 1CLOH 2R2BA 5KVGH 4DKFL 3KPLA 4FHKA 5GIRA 3ECBB 3Q5YA 4ZS6D 1CD1A 4OZIA 1TZGL 3HE6D 4OD2A 1V05A 2X4UB 1NFKA 4FNPA 4QXGH 1IM3D 3IEAA 2OX5A 1ITBB 2GBVA 3V6ZA 4D9QE 1DVQA 1OAQH 2OMYA 3NP3A 1QFWL 1PD0A 4UBDD 1TLMA 3RFZC 4HIXL 3D3VA 5GSVB 3CZFB 1E6OL 2ZX7A 4WW1B 1AGFB 3VI4B 5KVFL 1OXYA 4EXPX 2AK1L 5DTFB 2I69A 1QEXA 1F1GA 3X1GA 1D5IL 4CC4C 2DQTL 2A3TA 2EH8H 4X7EC 1DLHB 2X53A 3FDWA 3MODH 5CLTA 5B1KA 4OCWH 2FWSA 1USQA 2K0RA 1KB3A 3D69B 3RVVC 4AIEA 1R3HA 1XCTB 5EORH 5FLUA 4X4YA 4D0CA 1ZLWK 4PJXF 1EEYB 1H9DA 4I4WB 2GJ6B 2VLLB 2VE6B 4E2OA 2IALA 2VZOA 1HZHH 3K6FA 2BP0B 4TNVF 4YL9A 2B59B 2V9TA 4MCMA 5G5DB 3JTBA 3OMZA 2XWBA 4MTMA 3VW3L 4JY6B 2YAMA 3KWUA 1K5WA 4B9ZA 1AQHA 5AAWA 3NSJA 1ACZA 5HI3C 4JPIB 2ZG2A 2FSEA 4F2MB 3BW9B 2WQSA 2BOBA 1ZCRA 1T20A 3ARZA 2WNGA 5F7WC 3CHOA 5KYXB 4ODXA 3VFWB 2P5PA 4APXA 1WTGT 1IX2A 4HJ1A 4MZIA 3KGTA 1T1ZB 2P42B 2KYIA 2A9BA 4MCYB 4PJ8A 5ICXA 1F4WL 4X0KA 5IJVB 4L8BA 3R4DA 5ANHA 3V0GA 4BM7A 4D7PA 4PCKA 4X6BA 3IRZA 2G9HA 4RNRB 4TQ8A 4XPGH 2BNRE 3ZDWA 4N0UE 3U25A 3VA2C 2VDML 3CLWA 3UEQA 3MV7A 3QUYA 4XXWC 3TA3D 4XCNB 2EDBA 1NLBH 2O30A 5E6IB 5ISZB 2FD6L 3QQDA 4KFZC 1KJ2B 1F42A 3UJIL 3WG7B 4BFEA 2RD0A 5F3BA 1BYPA 1VFBB 2Y36H 4N8VA 2IF7A 3AC0A 3HVNA 1NOLA 1OSPL 3ESVF 4I3SL 1R5IB 3AT0A 4HT1H 1U42A 3IJSA 3SE9H 3O3DB 2OJ1A 3LEXA 2W0FA 1AQ8A 4KWUA 2B77A 1H3PL 4OLYH 2XN9D 1R4XA 3CFQA 4E0RA 5I8OH 2QPUA 3TBVA 1FNSH 5A2IH 4EE2A 2VR3A 3O81A 3BWZA 5DRZB 1RZFL 1E5YA 1U8CA 1AH1A 4LEXL 2KZ1B 1IIKA 3DURA 4I3RH 3PFQA 3FN0H 3MLZL 1REIA 5G55A 4HEME 4JY5L 4MNGA 4NC2B 4AJWA 1LQSR 1DBJL 3WSQH 1JPFB 1J1XH 5FYKE 4HUXA 3RDJA 3C6LA 1FAIL 1ZT7B 3NJNA 4JFTA 1SLUA 4QYOB 3RWDA 2Q3ZA 1IB5A 2BP3A 5I75C 2OMBA 5EN3A 1KPRA 1WEJH 2CR0A 1NDGB 2WOYA 4NQTA 3FJTA 2IQ9H 2D9QB 1Y07A 1IGTA 4X6CA 5HYQB 2YEZB 2Z8WC 4NWUH 4XVUC 3US1A 2G2NA 2OYLA 5EF0A 2P46B 5F7YC 3P3RA 3FTYA 2GBUA 2LV4A 3OTTA 5HYSG 1ZHBB 1Q9KA 4ELMB 1NJ9B 1PZBA 4F8NA 3HE6C 3LV3B 1NCAL 1LTXA 1RVFL 4TVPD 4F7CB 4R2GB 1QG3A 3OKYA 3QQNA 1UACL 2N7BA 2NZ1A 4FFWD 2Q86B 1OPGH 3GSNL 1KB5B 1V7NL 3FQ2A 5KSAB 2XWJB 1KT2B 2XBZA 5A3ID 1P5VB 2WCSA 2PLTA 3LMJH 3MNZA 1JN6B 3ZGIA 3L9BA 2VN5A 3UG4A 1IEAB 4QF1A 4Z76B 4E9SA 4FQXB 4R5VA 5KZCD 4JAMB 3QNXA 2NY5H 3CHPA 2I5YH 5TE4L 2GJ6D 2XRAH 4WHTA 2ZCLH 3C6EA 1UGKA 3L3GA 2YAEA 3G5ZA 1MFDL 4M62L 1FG2A 1G9NC 1XH0A 3NJXA 5ECJE 2KPWA 3KL5A 3D33A 3CV5A 1XGUA 3U9UB 2OL3A 2YPLB 1A7OL 5F8QC 5FYJE 3UJJL 1PBYA 4AM0B 3SPIA 1UXLA 4PJFA 4K8RL 5JIPA 3BH8B 3MV9E 3ZTNL 3L81A 1MCJA 3ET9F 3QZOA 2CJ3A 3ESUF 3FB6A 4J3TA 4OR1A 5ETUB 1DVYA 2A83A 2F58H 4YUEL 1JZ7A 1CO1A 4HSAC 4C56D 1WC7A 3WIIH 1YDPA 1L0PA 2IFFL 5K9QI 1J1PH 4ZBJA 3AWFA 2NPLX 1XGQA 3FMGL 1KV3A 2FLBT 2WUCH 4Z7WA 1H3VA 3IFNL 2JB5L 2OW7A 3RJQB 4TVSa 5CFHA 3VWKA 1EZSA 2IH9A 3JBG7 3K0WA 4GXUM 5EZJB 3U4BL 3SCMA 4JZOB 3WMQA 2EE6A 1HIMH 1MIMH 4PRIB 5C97A 1T5XB 3MUGB 1ES0A 4HC1H 4QJ5B 1N4XH 4B97A 2HT3C 4IBZA 3OSKA 2AJXL 3FQUB 4YDZA 3OBAA 4M5ZL 1HWWA 2QVFB 2AV1B 3QAZC 5GJSL 2WXFA 1C16B 4OZGB 1Q0EA 5A7BA 4QWWC 4AT6B 4P9HL 1OGAA 3HMXH 3ALPA 4XNMB 1AZVA 1WC7B 3BVWA 3A6CL 3BE1H 5E2WL 4EN2A 1YECL 1IGJA 5FFLA 1QQDA 3MLVH 1KBKA 4JFDE 1WJ3A 1PEZA 3BUYA 3LN5B 4ZPTB 1O6TA 4RAHA 4UTAH 2AQRA 4LDLB 4NCC2 1QSZA 4NZTL 4YDLC 5J6SA 1HSBB 3QUXC 3IDYC 1A65A 4PBDA 1G9ML 4HFWB 2ADJB 5D7JA 1O5PA 2EDEA 4RDBA 4H1LA 4Z0BH 3RWGB 5FGBC 4HK3J 3TNNB 4I18A 4P2OA 2QQLH 3MA7A 1JZEA 4K94L 4YZFE 2CBTA 3FHEA 2XETA 3NPSB 3QXVA 2H26B 5T1DL 3L2NA 3HA0A 1FGNH 1EPFA 1RHHA 2D7TL 3RYMA 4JE0A 4EZMA 4HDIA 3ARDC 5D70L 1A4JA 1TKWB 5C08A 4B9JA 3SYQA 2XA3A 4Y5YC 1YY9D 4L5FH 2WXKA 3VFPA 4KQ4H 4IIZA 3EOTH 5DFWH 2V3DA 2VDOB 3LN9A 4K2UH 4N6RA 1WIOA 2CHXA 3D08A 2XXCB 4GS7B 2X2YA 2YJLA 2ZCHL 5ETUA 4HCRL 3AY4C 3MRKA 4JCLA 2AITA 4X98B 3RWGA 5FYJU 1CT8A 2E9GA 2PWGA 3FYEB 3P0VL 3LXBA 4FXGB 2VDQH 3SCMB 3F12A 3HZMB 4IJTA 4QTIH 1O7VA 3V0WH 3E6HA 4M3HA 4IM8A 2F9BT 3RVTC 3ULUF 1D5MB 1S5IL 2WBJA 4JHWL 3VACA 5ESAA 4XCFL 1XGRA 3BGFC 1Q4NX 4MS6A 5C0AA 2BY2A 3LXCA 4EI0A 2NY6B 3Q48A 4ORGA 4LSQH 5JA9A 3CIAA 2HH0H 4KVNH 5EU6E 1SXCA 4ZAKC 2Z7YA 3WE1A 3RHWF 1MCPL 3NPSC 4KTGA 4S10A 2M8XA 4UDTA 1R33A 2GPZA 4Y7MA 1GC1L 5J11B 3GNML 3SPJA 1H0DB 4LQFL 1FZJA 1J5DA 2R83A 4H88L 1QFUL 1JK8B 2EYSA 5B8CA 3G04B 5I24A 3X12B 5INDA 3HJ0A 2QQKL 3DXAD 3B7YA 2EIZA 2WBXA 3AABA 1TCMA 4XCEA 5C0DA 3MNMA 3VDCA 3AAZB 1FGVH 2L04A 4P46C 4FMFA 5K93A 4PCSA 3ARBA 4MAYB 2J3SA 4FXKA 4NO2A 4B9IA 5LVEA 2VXSH 4OF3A 1U3YA 1E0OB 2F2HA 3FUHA 5MEQA 5FLVA 3RUGB 1S8DB 3T1FA 3DX0A 4G70B 2WLNA 1FIGH 4D94A 1EBPA 1PIGA 2DKMA 3MRIA 5FOJA 3LZRA 1QSEB 4RQQA 3U36B 3RVUC 1E4WL 5K59F 1MH5B 1E6JH 2VN4A 2XYBA 3HMWH 5D9SA 3CVHB 1XSIA 1ILSA 5KTEL 3P73B 2F53B 4ZS6C 2DQCH 2YN3A 4K3JH 2CCWA 2HRPL 2J6EH 1YN6B 1D5IH 1CFSB 5IB2A 2PABA 3OAYH 1X3DA 4BYHA 4HWBL 2O6EA 4DK3A 5ALBL 4X5WA 5EIVA 3SKNB 3V5KA 1CDBA 3HLAB 4PG9A 1ZJAA 4XPAH 1QEWB 4KROD 1M6UA 4N8UA 4MJ5A 4QRSA 4NQEB 1JOIA 2MCG1 5IY5B 1XIWD 2Y4SA 3EIFA 3KR3L 3OG4B 3PY9A 4OZGF 2CHZA 1PZDA 1RZGA 5F7HA 1FQ9C 1G7PB 1JXDA 4FCHA 1BVLB 2VABA 5FKPB 5D4QA 4G7YH 1KN4L 1YMHA 3G08B 1S7TB 4NHUA 4WW2A 5AW0B 2ZYHA 4OZFH 3UC0H 4W9EC 4MNGE 1GGCH 4HS8L 3GMQB 4FJYA 2HSIA 2FWOB 3OKNA 4UDTB 1BLNA 3VXUB 1IC7H 4U1IB 5DD5L 4XO4A 1ZLSL 4NQED 1N3NB 4JEGB 3MR9B 3T08A 1A6AB 4EI6B 1JPSH 4WFFE 4MD4B 3QORA 4WUKH 2ZSWA 3LEVH 3A6BL 3UG3A 4Q56A 4K3EH 5KJ4A 3DROB 1P4UA 5DEZA 1E4XI 5KSAC 4AQ8C 3QI9B 4PY7B 1BBDL 2W91A 4PD4J 4LP4A 1XTMA 2OFQA 4XVSH 1G7MB 1R3JA 3E8VA 5E4AA 5I19L 5KSBF 4XN7A 5HHMD 1V55B 4ABUA 1NMBL 2BZCA 5C9JA 5I6OA 5AB2A 1CLCA 3BKMH 3QZPA 1RPKA 4N0UA 4NO2B 3U0TA 4E9QA 1B4LA 4GI9A 3MLTA 3VXTA 3WFZA 4C56E 3ABZA 1BVKA 4B3VA 4HC1A 1UWFA 3N1FC 3RTQA 3IDIB 4JM4L 5HVWA 4LOEA 2BIQA 3ATAA 3AREA 1VADB 4OD1H 4P46D 2YXVA 3GKWL 2IPKB 4ISVA 3BQUC 1S9YA 5DHEA 5I1IH 1WFNA 1JV5A 2NW2B 2OTUA 2K6ZA 4JM2D 2QKIA 4XNBA 2NY6D 3NIFB 1AGDB 3WHE0 4U4IA 1FNSL 4JL1A 1A6WH 1LE5B 1YY8B 2WLLA 5EBMB 2DQDH 2YGQA 3PNRB 4FQ2L 5C9JB 4TULH 1GGIL 1MNUH 3WELA 5FO8A 1E43A 1HQ4B 3RGVC 3MNWB 5AW9B 1NKRA 4Y5VA 1AE6H 1JGLH 3DGDA 5EBLA 4PQXA 2E3VA 4AL8H 3ARFC 1OTSC 4BWWA 2VXUH 2HFFB 5E6ZA 4DT2A 3MYZA 1WD8A 1UM4L 3JTTB 1U3ZA 4Z7UF 1LO5A 4DTGL 3KYNB 3HG2A 3L1OL 4Q9BA 4HISA 1IQWL 1YVLA 5ACZB 5IGXH 4DVBA 3DIFB 1QBLH 1VEOA 4TVPE 2NR6C 5CR8A 5TPWH 4K23L 4YBQC 3MR9A 2BWIA 4JMXA 1DZBA 4Z7UE 4LF3A 5E1AA 3OWEA 4PRDA 1U3JA 3SGDH 1BZ9B 2GW5A 4WEMB 5E9DB 3TZVB 4UV7H 3DOHA 3LNHA 3QUZA 3QJXA 3E6FB 5C6PB 3E8UL 1JWMB 1LP9B 3G6JB 3VD5A 3BWSA 5LWYH 3G5VA 1IZKA 3UZVB 1XB6A 4HPYL 2P48B 2APXA 4JFFA 4TRPL 4ODUA 1N0XH 2NUTA 1J5OL 2YXWA 3IU3B 3W2DH 1DN0A 4CADB 3NIDB 4DGIH 4EIGB 2ICWJ 5DD1H 3HI1B 1NC2A 1BMZA 2F8VA 5DTFA 4R5XA 2R8SH 4BK4A 5AZEH 4GXFA 1JNLH 3FRPB 4I5BA 5DMJB 1QBML 4XN1A 4FI6A 5DUBB 3D39A 3MRPA 4LNVA 4KZDL 1C5BL 4I4WA 5TH2B 4W9FC 1CC3A 4WV1B 2I27N 3IDMB 1AYRA 4Q9CA 1OM3H 4G8FB 1S3RA 2NUTB 2FX9L 2G0KA 3NPZB 2WWKO 4AGPA 4R3SA 3KVQA 4AK1A 3CUPB 3ULVH 1UB6B 1F3DH 4NPKA 1TTUA 2FNWA 1FNEA 2CNZA 5L4IA 3T65B 2F8XC 4YSEA 2R1XB 1J1PL 1RZJH 3CZLA 4QLRA 5CIPB 3ZY7A 2YRBA 5F9DC 4X80H 5G2NA 4NSKA 4GRWE 4P2OD 3ZL2A 2RCSL 5CS7A 2VMJA 1LO5B 2ZF9A 3HE6A 5D2NC 4UNIA 1MWAL 1YYMH 4HQQH 1U8MA 1OT2A 1SOSA 5CZXD 4FTVE 2E27H 1GSKA 3QORC 1DQJB 2H2PD 1L0XA 2PWEA 1G7JA 1RI8A 4FFVC 4G7VH 4NEHB 2NZIA 3RWDB 4I3GA 2QTEA 4U4BA 9CGTA 2EECA 5B3JF 5D7LB 3KXFA 4BQ9A 4PP2B 1KGIA 3QUYC 4MAZA 3F04A 3BLBA 2A6JB 4HIHA 1AQDA 4P9HH 3U9WA 3I6SA 3MBEA 3JT2A 4Q9RH 3VB8A 3T4YB 3Q43A 1EAPB 4XNUH 3BSZL 4YSCA 2LT9A 4FAAB 3QUZB 5ANME 2XFXB 5HHVH 2AW2A 5T1JA 1FYTE 3KPTA 1O6VA 4X4XB 1C1EH 4GP5B 1MJ8L 2W0FB 2VDNB 5GPRA 1KSRA 1KYAA 4LL1A 4QXTA 3TTSA 3DOIA 1UA6L 1CFTA 3I6LD 4IGBC 1FWXA 2Y6TE 4DHLA 4G6JL 3QBTB 1UD2A 2GFBB 5LBVA 1MY5A 1OTTC 1PJ9A 4M7KH 4L8DA 2WINA 1DUZB 5INCB 3SQBA 2LGNA 2Q8AL 1K8IA 1FP5A 1GYUA 2BSDA 3BZ4B 2OMTA 4OUUB 1JPFA 5LB1A 4PRBA 3FT2A 4L4TA 3SOBL 1K3IA 1TLKA 1FGNL 4BZ1L 1PFOA 4WU5A 2ICEA 4LLYA 4OZ4A 4W4OC 1UVQA 2Q2LA 2NQCA 4Q14A 2UY6B 4WKZB 2WB7A 2BM3A 2Y72A 2LQRA 4JKMA 3WKML 2ZONA 3O3BA 4FI7A 3CBKB 3APFA 3FUKA 1L9PA 5E1HB 5D6DC 3HZVB 4FNSA 2Y7NA 3LKSB 1PLBA 4ICWA 3VXPB 4OZHA 1SOKA 4O5LH 4BHUI 4ZFGH 5I28A 5GGVH 1IGMH 3NSCA 3QGVA 2DMCA 3ZL1A 1R3KB 5ITFB 1CR9H 3VWJB 4PMFA 1MAJA 3BFOA 5E8EA 2GHWB 1FLTX 4PLOB 3EW3B 4PJXA 1WWAX 4GRLA 4PI0A 2YWZA 1VDGA 4AK2A 3ARVA 2H7WA 4M00A 4Q6IC 5CBAB 1P9MA 3FFCD 1BEXA 1KPVB 2ZKYA 1E90A 2HJLB 2A6JA 4HIHB 4MCZA 2ZKHL 1KLFB 4UTAA 2VZ3A 2J25A 4W68A 4QHKI 4IRJB 3LZFH 3TVMB 1T20B 3U83A 3ZMRA 3OG6B 1TZ8A 1GC1H 4FGMA 4ZO9A 5LBGA 1R19A 4KY1H 2YARA 3AITA 2I9TA 1R3IL 1A3LH 3STLB 3NYKA 1BG9A 1DFXA 4TNFA 3VYNA 1X7QA 3CSPA 2PNDA 2CM6A 4Q6IA 1Y0LA 2BXZA 2NSXA 2OSXA 3K2MC 5JXED 3QPKA 3NIFE 3QEUB 3N0PB 4A63A 3ASWA 4G72B 3K8KA 2CO4A 3MUZ1 4JG1H 1KG0B 2WXPA 2ADJA 2X9WA 4XVJH 4D0CB 5EEXA 1E9PB 2G9HB 3LNGA 4OKVA 1NFDA 2HPTA 4UQBA 1GA2A 1XF3A 5CMAB 5CSGA 1XCQA 3JV4A 1E4WH 2XNAA 3GB7B 4QRUA 3IAPA 4HK0B 2DLTA 3V4VL 3WN5C 4POUB 2O6CA 3UTSE 1INEL 3DYOA 1RMFH 1MFNA 3QCTH 4PJGF 1GOFA 3KLKA 1ADQA 2W38A 5IOPB 5CUSH 4S1QH 5C07E 4F7MB 1JZDC 2PPEA 4GMSH 3MRGA 2ARJB 3FFDB 4UT9A 4LLVB 2FE0A 3IAQA 3QJFA 2FSEB 2R69A 3MJ6A 4F2MA 1ILUA 2E59A 4Y7OC 2AV1A 3EOBA 2P5EB 1NKGA 1RK0A 3DETD 5F1KC 3KLHC 1XAKA 3DX4A 4MD5A 1P53A 2NZ9C 3IXAA 4JZJC 2WWNA 2E9JA 2ZUYA 3W37A 1WBXB 4UQIM 2FQDA 5D93B 1R3KA 5FHAL 3JYBA 3WN5B 5C3LD 5L4MA 4YDVB 5I6LA 4LPCA 3RIFK 3X1FA 1KN4H 2UWEA 1M3IA 4PJXB 3APMA 1T66D 5B8CC 1A3QA 2BP5M 1ZDSA 4DN4H 1T22A 2CM5A 2ADIB 5ESAB 5C0AB 4BA0A 1ZS8A 4BFJA 3VMPA 1T21A 2OMVB 1IMHC 2YEZA 2YD3A 2PR4H 1EHAA 1KGWA 2YQ3A 1OK0A 5GZNC 4JPQA 1NDGA 2ED7A 4NQEE 2XKSA 5JORB 3I6GB 2NLJB 2R0ZL 3QQDB 4DUWA 4Y9BA 4PJEA 5LGJB 3AY4A 4UM8A 4Y5XA 5SWSE 3GMOB 5I1JH 2I9TB 3ZDYE 4LPXA 1F3JB 4GNKB 1NCAH 1RVFH 3BOVA 3QUGA 5E8DH 3BZFA 4BFIB 1AD9A 1UACH 1ZE3C 1AD0B 1A0QH 1H19A 4P2RA 4YHYB 4HJTA 4XVSL 4XXCA 2IH1A 5I19H 4XO5A 1ZV9A 1CFQB 1WF5A 4L3EA 3QEHA 4KVCH 1OAKH 4GLRH 2MNJB 1ZS8B 1XX9C 2KZKA 3FQNB 3LMJL 4EDXB 4DEPC 4NQCD 2V4LA 4QYAA 1IV8A 2WNKA 5IK3B 2BVUA 4OH2A 3UTPE 1P5VA 2KT6A 1LO2H 1NFIA 2YZ8A 3MRKB 3MXVH 1PLGH 1IJ9A 4OF5A 5B39G 5SWZD 3TYFB 1NEPA 2GSGB 1BG1A 5BV7H 2X4NA 3RWCB 4K7PX 2H0JA 5AOMA 1LK3H 4OD1L 3WJMA 5BVJB 5C0EA 4YE4H 1CMOA 2DWDA 3BUBA 3D85A 3IJHB 3R19A 3SJVD 1NM4A 2FUQA 4G7QB 3PAYA 4HWEH 1WBZB 2YFNA 4FQ2H 4FXTA 1MFEH 4ZS7L 4XPBL 4FG0A 1CZ8H 2H45A 1T7VA 3BZ5A 1NIDA 3U2IA 3CHQA 4X5WB 2YBRA 3WIIL 4PWGA 4GKSA 1NFIB 2N59A 1KCSL 2NY3C 4JFYB 4NJAL 1I3RB 3VNYA 4ENZA 1A7PL 4YFEA 2UXGA 2F1BA 3SYPA 4F20A 1T21B 1NCOA 3ZE0E 4AKPA 3SD2A 1EZLA 4WWKC 4AYEC 5L8KB 1W2KT 4QNPE 3LHAA 3I6LE 5EA0L 1QSFE 3T3PF 3ZTDC 1PS3A 2YC1B 5EU7C 4RETB 1KEML 1YEEH 3V0VB 5LLIC 4UT6H 3MO1A 2AVFA 4QOKA 2I9LB 5FYKH 4OCYL 1NMAH 4R97C 1KGJA 2VKWA 3QA3A 5B3NA 3NAAH 2K70A 3G3LA 3ATEA 3VXMD 1YAZA 3A67L 4FLRA 1EANA 5D7LD 2V33A 4HUUB 4UTAL 1JIBA 4JKKA 4DGIL 4NRYA 3AQZA 1P6FA 3VTAA 2H0PA 4QHMA 1QI4A 1LM8V 1U0QA 2WXMA 1GZHC 3D2UB 4MGXA 1FV1B 3ISYA 4H1LG 1U93A 4HYTB 5F96L 3L4XA 4MAUH 5KAQG 2CGRH 3QQXA 4OGZA 1OCWH 1T2JA 5E6IC 2IXQB 4Z0BL 3HG5A 1HL5A 2I85A 4ZSOA 3VFRA 3S34H 1C5BH 3BAJA 1BVLA 2VABB 5FKPA 2LR4A 5K1NA 3G6DL 1S7UB 4AE0A 1RUQH 5FDWA 3FH8A 1BOGB 1RULH 4LRNH 2WN3A 2WIIA 3BSGA 3V2AR 1IAMA 4KK8C 5MHSD 1A9EA 3CU7A 3PNWB 4MA8L 5D1ZI 3Q8FA 1XMWA 1A6UL 4QR7A 3SY0B 3AW5A 1NBVH 2N01B 2XZQL 5B1JA 3B43A 5E5MB 5EDXA 4UQ3B 5GGUA 2A74A 1XBDA 1U93B 2OSWA 3RDTC 4PRID 3WGUB 4EUPA 4ZMLA 2DOCA 3MV8E 2WY3B 3UERA 1CBVH 2WWKT 3DX1A 5AVVB 3L16A 3F8UB 1F41A 1AZNA 1LO3L 1QYGL 4PJGB 2VDOL 1G9HA 3MRJB 4R4BB 3KPSD 3LRHA 2IBZY 5FDWB 2DIBA 2VLKB 2EIMB 3BP7A 5DSCA 3VX1A 1FZKB 3SZKC 3QHFH 4YDNA 4ZUSA 5EIQA 1QOKA 1JUFA 3H9SB 5DVMA 1TZHB 2Q10A 2FATH 2ZXDA 1BZ7B 2G75B 3B2PA 4DNLA 5D4JA 5BV7B 1MY7A 3GBDA 1AYOA 2VDRL 4JE4B 5CWSB 1D9KA 3DIFA 2DDQL 4P0DA 4ORGB 4EN3C 2HX7A 1I8LC 5I2IA 4Q9RL 4I85A 2AXJA 3ALXA 4PMEA 1DQVA 1L6ZA 1LWRA 3WD5L 3RBSA 2J5LC 1NWOA 2E5EA 1I1AC 2R29A 4IMLA 4Z7NE 5IIEB 1ZGLM 3DGGA 1J10A 4LCWD 1KNOA 3BX7C 4BA8A 1AZCA 4FLSA 2VXTH 4TOYH 3IMVA 1UZ6F 2IAND 1DJHA 4E41D 1WQVT 1K8DA 4LU5L 2QQKH 4YXLH 4KMTH 4PRPD 4G6JH 3GZQA 1U6AH 2DW5A 4IHOA 4PFEA 5C0CE 5MI0C 4XPTH 2BVOA 3N3EA 1I9IL 4MNQA 4F7TB 1BF5A 2PYEB 4QHLB 4XCEB 1YPZE 4NZUH 1QTPA 1ZMYA 2ZAGA 4JRYA 1A6TA 3MRCB 3MNVA 1WDAA 2DM4A 3B3BA 4AQEB 3L1EA 1M56B 2AXHA 4OB5L 4KAQH 5GGTH 3I74A 4PGJA 3CVDA 3RVXD 1HI6B 4AJYV 4G1MA 1PYWA 3II2A 4PY8I 4XXWA 4BZ1H 1B88A 1HH9B 1B6UA 3F85A 2FZ3B 5KVDL 2CBOA 3SBQA 4NT6B 4Y1SA 3WYRA 1HSAA 1F90H 2D4FA 2B2XH 4KI5F 4YPGA 4BH8B 2B7DT 4XP9H 2E9IA 1ZE3H 5LXVA 3NRQA 5IQMA 3TBSB 4HLJA 4ETQA 1CI3M 1U8LB 3R06B 2YQBA 3HRPA 4XZUA 1JHLH 1IQDA 1TEFA 3K4ZA 1SHXA 4G3YL 3BJ91 5F7NC 1T1WB 1G7IA 3EYUL 3UZQB 1FCCA 4BZYA 4POZD 1WCQA 1ROCA 1YMMA 2W65B 4JKWA 5JR1L 5F7EH 5MEPB 5TQ0L 4TQHA 4Z3TA 2QLVB 5ACLA 2EUZA 1W6LA 43C9A 5KVMC 2HX8A 3O2WL 2QMKA 4PJDB 43CAA 1H3UA 3KR3H 4OCRH 2X6BA 1S7QB 2GJJA 5J12B 5AAWC 4WFED 3M1CA 2CK2A 2VLRE 3HAEA 4I1PA 3B9KB 5T5NF 2Z8SA 4JKPH 2APTA 2E56A 4HKXA 2KZBA 1WVZA 3K2UH 4RWYL 3P2TA 3RB7A 4HJIA 3ZDXF 1GGCL 4LSVH 1Y18A 2JKTM 3NG5A 2ZG1A 4DPAX 4JM2B 1A3RH 3Q01A 3IE9A 1R5WB 1D9KB 4JHBA 2P28B 3GMQA 5G4OA 3EJRA 3O8XA 4MA1B 1R3LB 4QXGL 2BXYA 5FYKU 1MW1A 3VXUA 4S1DD 2L7UA 1RZJC 3FCBA 3S5YA 1FFTB 4PJEF 1GW0A 3CFEA 3UACA 3QO1A 4J3BA 4PJHB 1NGYA 3K6IA 2DYPB 2A2QT 3O8XD 5D2NE 1FF5A 4YVNA 1GKOA 2F7PA 3DROA 4L3AA 2B14A 1MPAH 4XMXA 1E8XA 3CCHA 1WLHA 1QNIA 4MNQB 1DLHA 4WTXA 3DV6A 3D5OF 3HE7B 4LASL 4BEIA 4OGXH 4P46A 4PBXA 5F6IB 2N1TE 5CIPH 1A1MB 4H26A 2F74B 2L3BA 4AX3A 4CW1B 4ZMAT 2EACA 4B7LA 2XN9E 2WZPA 4WEBH 4WUUB 1YN7A 4G6MH 5DWUL 3QO1B 4PJHA 1JDAA 4M56A 5I1IL 4G1EA 5EHFA 5FXCH 3WTVA 3B34A 2F54D 3QFJD 3BCFA 3QIBA 4OZFG 3VYOA 3QXDA 4OZHE 5AKVA 2HG0A 1SXNA 4W9ZA 1J05B 3PWPE 3B8SA 3F3HA 1MUJA 2JKJA 4RMVA 5F7AA 3ZT6A 1NTDA 3CSGA 3TCTA 2QSCL 4Z95L 4MB3A 5SWSB 1XB3A 3CFCL 4ZFZB 1JF1B 3IK2A 4KKNA 4ZQTA 3EO0A 5LGKA 3WENA 2WKOA 2Z31D 4YR6A 1L0YA 3SE3A 3ILPB 3FSOA 2BY0A 2QADD 3S37L 4DH2A 3C60D 1FFPB 3SGJC 3S8WA 3LZLA 4TQIA 3FQWB 3QIUB 5IGXL 4Y16D 1MFUA 2QGCA 3WEBA 3TZVC 3FCGA 2E74C 1EZVY 2VDLL 2G60L 3HKFA 3H42H 5TQ2H 1BZ9A 2IADB 3GSQA 4KTDH 3HUJA 4JNXA 3IDIA 1KYOJ 2A38A 2J56A 1OSZB 2E46A 1NEZG 3OMNB 3DX9B 3NIDE 4U3HA 4GAJH 4WKZA 5CP3A 3TJHD 4H44C 3UJIH 4A2LA 1NBZB 3TH4T 1XIWC 3VGAC 3NZHH 4HF5H 1EZVX 4N8CL 5C0IB 3RIAF 5DZ9A 5I1KL 1AGDA 5DI8A 3HS0B 4XVOA 2LLNA 4Z7UB 5EU6D 1V7MH 5ISZE 2AMGA 3SPHA 3VXUE 5I15H 5C7ZA 3D4GA 3B2VL 1YEIH 1LO2L 5CGBA 1MFVA 1YRKA 5DT1H 3IFOB 1IC4H 4BH7B 4LLDB 4E42B 2ZUSA 1W72A 1AHWA 4AYSA 5HYSA 1SHSA 1OSZA 5HI4D 2VB5A 1P2CB 4JY5H 1JHTB 3OB0H 4O02A 3K3QA 1FCGA 3FZUC 3QULA 4IGBA 5EWIL 4YDJA 3T0ED 3SDXA 1OM3L 2YD8A 3GS7A 5EUOE 2R23B 5L0QB 2R29H 3VMOA 4ZS7H 5GRYA 1NIFA 4UIKL 4E9RA 2SEBA 1H9VA 4WI8A 4Y9FA 2J1KA 4WK0B 2D0HA 2CQVA 1N6QH 3UIYA 1UFGA 2CG9X 4GW1B 5EFIB 2KUTA 2O6PA 2Z0BA 4V1DD 2V2TA 4GBXC 5A3IC 1A64A 1QFOA 3FUIA 2VQ4A 4NQSA 2FIKB 4UU9B 1ADQH 1JF1A 4FNLL 4M7ZB 4QAWA 2X0VA 5DS1A 1TQBB 3O45B 5J3HC 5IT2H 2PW1A 3CGTA 4JFQA 1DQJA 1CXFA 1NGZB 1CGUA 2UWEB 4B5ZA 5D7IE 4N2KA 3U9PH 4NQXA 3VRJA 1D7DA 3RRQA 1G7JB 3LH8A 3V6BR 4LVOC 3V6ZB 2XWTB 2AGJL 3T0DA 1KEMH 2ZUVA 1UWEH 5D7LA 3DX9A 1MW3A 4WHYH 3BPCB 3MCKB 4XAKE 1H3XA 4XNUL 5AYUL 5GSVA 2PCFA 3KEHA 2OXHB 4YE0A 3GMOA 2UUDK 4UYQA 1MJ8H 3FSVA 5GJTL 1OTSD 3ARFD 1Q9LB 3PDOB 3PABA 3I9GH 5JQ6L 3WMSA 2ZX9A 4B60A 3ZDYF 1FYHB 3C9NB 1AXTL 1A7OH 5KOVC 2OQJA 3JXAA 3QAZB 1S9XB 3V6FA 1FNEB 4QTFA 5IOKA 1BFOA 4H7VA 5HGGS 4GKNA 3Q5TA 4Y4KA 5DUPH 3EO9L 4GI6A 4WTWA 1MELA 1NJ9A 4D9QD 3Q8AA 4KITB 2F5BL 5TF0A 4U6YA 4FYTA 25C8H 4F7CA 3JWDC 4X9HA 1LEGA 2Z35A 5JPMA 4LL9A 4AY0A 4RGOL 3L95B 3MRFB 1OE1A 3NRPA 4ODTH 2WZAA 3CFDB 1UCBL 4LHUA 5AUMA 4G80A 3ETTA 3ILEA 5IESH 1PX3A 2NXZB 1BZ8A 3C6LD 4Q6KA 3WL9B 1NKOA 1EFXB 3QUXD 4QHKJ 4Y19A 3K2KA 3RL1A 1IGML 4XMTA 3ZW3A 3DVFA 4NQUA 4DZ8A 3QXUA 4FHBD 4BCXA 3OKOB 3U46A 3WJLA 3G5ZB 4JHUA 5D1QE 3G7TA 1SMAA 3PIQA 2BNUA 2YZ1A 4M1DH 5KOMC 3APCA 4B9YA 3DI3B 2L7QA 3B1TA 3FAWA 5DJ2A 2QV4A 1HAWA 2FO4B 4XXDA 2K45A 2X10A 1YY9C 1NMCC 1ZY9A 2KS0A 5F0JB 5HTSA 1OGSA 1HEHC 5AYTA 1KLFA 2XYCA 4GW5B 4YJZL 1S3KL 1AXIB 1CL7L 3VD7A 4IDJL 4PLKC 4YHLH 4Q89A 2O5XL 2F5AH 1TZGH 5D4IA 5CJQH 4RMRA 3VGEA 1LD9A 4M9OA 4P9ML 2CWRA 4MNHB 5F1OB 4PUBL 3DMMB 3PGDB 4HJGA 4K5NA 5EU6B 2X1OA 2G5RA 2YEVB 4XP4H 1HNGA 2LTQB 2FH8A 1JTOA 2QGDA 2JIXD 1HYSD 2HTKC 4UT6A 1JZ8A 4KQ4L 1QHQA 1GGYA 5CLXA 4ZOAA 2YPLE 1S7SB 3T0EC 4HXAL 2NQDA 4XVJL 2YQ2A 5HGDA 2VZSA 4HK3N 5DK0A 1NAML 4LOVA 2CO6B 3DRTB 2KKQA 3MODL 2BZ7A 1IAIH 2XY2A 4GKSB 3X17A 4GRLB 4DGUA 2OA9A 3FT4B 1AI1H 2GITA 3LQMA 2B1HL 3SBRA 4KOBA 3M07A 1KTLB 2AXGB 9PCYA 4RMBA 1INEH 1XGRB 4K5LA 4A2FA 1WA1X 3K6NA 3A23A 5KBMA 3PDGA 4CVXB 2UX6A 3ULUE 4LCUA 4NQCE 1E28B 3MQIA 1NC4A 4ZTOH 5DURD 4EN3B 1VEPA 1M9SA 1NA8A 1Q38A 5BS0E 6FABL 5EEYA 2Y07H 3NIGE 5ECGA 1FDLH 4IGBD 4N2HA 1FNGB 2HH0L 3ARBC 2ALAA 2WUBL 2C9PA 2UYLB 4NENA 2P1YA 1ETB1 3RL1B 3GSXA 3EF7A 4X83A 4LAQL 5LCVH 1KF9B 5HY9A 5C8JA 3BVUA 4RDQG 2H32A 3PL6D 4PJCE 4RGNE 4DVRH 5IROA 1A8ZA 1M1SA 1BPVA 2NQ3A 4ENED 4AENA 4ZMZA 1CGSH 4BUQA 1QTYT 2BNUB 3SDAA 1EAOA 2ZCZA 2VDPL 3BAKA 4TXVB 1L9QA 5IVXF 1QFUH 1ODUA 2JJWA 4IMKA 4WW2C 1T5XA 1B0WA 2CIKB 3MUGA 5F6HI 3RKDD 5I1DA 4KRLB 3GSRA 3MNDA 4XBEH 3OGOE 3CDZA 5D1ZA 3WGVB 3KWWA 4KX7A 2ZF8A 3AJ7A 3MRIB 1VENA 3I9IA 3N04A 4L4JA 1C7TA 5I1JL 1S7UA 5AVXB 5BRZD 4AMKH 2EO1A 2FD6H 3K4DA 2HZHA 4MZRA 4KX9A 2O4EA 3BUYB 2H1XA 4ZPTA 2JCCB 4M7JL 4AM0A 1BWWA 4MQSB 1P1VA 1YZZA 1NUFA 3SKMA 4K3JL 4PV9B 3CFKA 2J6EL 1G6VK 1C5DA 3L9RB 4P23D 4W9KC 4OLXH 1NBYA 2OYKA 4NQEA 4XHQA 1MCFA 3DSNB 3FT3B 3RWFB 1UGNA 4IDLA 4U1LA 3VG0L 3MFFB 4MMXC 4OD3H 1ES0B 1OB1A 4S2SA 3ML8A 4UV4L 1BV8A 1XEUA 3MJ8B 4YE4L 3KPNA 3GIZL 4IU2A 3AAZA 4C47A 3K81A 2V9UA 1A2YB 3EOYG 3H9ZA 2EVGA 4J39A 1HOCA 3N43F 2IGTA 3IGAA 3Q5OA 3HB3B 4JY4B 5FWQA 4R96B 2VIRB 5D4HA 4NENB 3SE3C 3NDYE 4WHYG 4IOFC 5TD4A 1SJHB 3CZUB 2XWRA 2OZNA 3TBYB 4JFOB 3ZN6A 3M1OA 1IM3B 1OK8A 2TAAA 3QXAB 5E4IA 5KJRL 3C87A 4GRLC 3HR5A 1HKFA 4GSDL 2UZXA 3K1KC 3S37H 3ZE2E 4OI8A 1SHMA 3QI9A 3ZDZE 3ZZSA 3TGXA 4EJ1C 1M7IB 2ZYRA 1DEEA 1IC5L 3OQ3B 1CK0H 5D1ZB 3QJQB 1PKQE 4ELDA 2JKNA 1ML0A 4YZFF 4G1MB 3OHXA 2C3HA 1JYNA 4LSTL 2ZTBA 3BAIA 5TDOA 3MSPA 4WI0B 5FYKL 5IROC 2IMNA 3V0VA 5JPNC 2I24N 3MRNB 1XGPB 3CLEL 3N41B 2JQZA 2RB8A 4HDIB 3PQYD 4WGKA 5JNYB 4MBOA 4F2EA 3VFVB 3G5YA 3VFPB 5JPNB 5E03A 1S7RA 3ARDA 1SBSL 1D6VL 1FH5H 1X4ZA 2RBLA 3BXNB 3Q2NA 4HWNA 1U8PA 3KLSA 5F96H 5FO8B 5FM5M 7FABH 2ROXA 4LNRA 3GSNB 4NFDA 1IC4L 2Z31B 2V17H 1G7LB 1BX2A 1M2VB 3IDYB 4YX2H 3WS6A 5BPPA 4G5ZL 4J23A 1NSNL 3DUSB 5K39B 2WBJB 3NEOA 1RUQL 1U4FA 4FP8H 5TJWK 4YHIA 2NNAB 2XIDA 3EUDA 3TBBA 4L8CB 2ZNXA 4Z7WE 3HS9A 4IS6A 2B1AH 2PO6C 4XAKD 2B5IC 2ESVA 2BX5A 1GYAA 3SIKA 2R29L 4GKZB 4J27A 4ODSL 4WSJA 4XE5B 3NUKA 4Z1PA 1QNZH 1E9QB 5GGUB 1S7RB 3ARDB 1G87A 1NAMA 4OZGE 1ITCA 2DQMA 5EIIA 1N4XL 4ZUUA 3ME0A 2XKNA 2WLYA 3SBWA 3RBGA 1FLRH 5L7XH 1A14L 1JZ2A 4FNLH 4KQ3H 4R4BA 5CLYA 3AU1B 1CJYA 4CVZA 3ZE2F 2BWDA 3REWB 1TPXB 2LU5A 3WTUA 3ZDZF 1P4BL 4HEPA 3O2DH 4CU6A 2DY2A 3QHFL 2IVFC 1VFMA 1F2QA 3UDWC 5GRVK 4P5RA 1TJGL 2KMWA 3PE9A 4HG4K 1L3WA 1UXWA 1GYVA 3MLYH 4J3OD 5MENB 1DEEB 1T4WA 4XN2A 2AGJH 3ZUNC 1Z0MA 5EBWA 5FKAA 3VWKC 4DUXA 1RIHL 4XRCA 1A1MA 3QARA 4ATTA 3KYKL 3VFRB 1NZRA 3MRNA 3TIEA 5AW3B 5FYLD 4GFXA 2ZD0A 1JHKH 3QORB 2EDTA 5F7KC 4KUCF 1N19A 4U33A 4J2XA 1U30A 2YPVA 3FK3A 4QY8A 2G4GA 3WIFA 5F1IA 2EVFA 2H4EA 3ARPA 1U8HA 2MFNA 3CX5K 5GXBB 4NZUL 7TAAA 4J3OH 2WXGA 5FKAB 4UF7C 1YEWA 2FR4A 1C08B 1DDHB 2C3GA 2OZ4L 2YAOA 1ED3A 4NKOB 4CSSA 1W8EA 3S5LA 4M02A 4Z7QF 2CHDA 3SDDD 4Y4HD 1WSST 3FRUA 2DWEA 1A66A 4OT1L 2CBMA 1QR4A 4HMDA 2VN6A 2ESVB 4OGAC 1RZGB 3B7SA 4M29A 5IJDC 5KVDH 5BZWA 3BMVA 4WWKB 4L8CA 4HIIB 1YYML 4LSPH 5F3HB 1RUPH 1ZTMA 3GI9H 4KRPC 4ZQKB 1X4YA 3HN5A 3OKNB 5KUMA 2WCGA 3RZCD 2JI2A 3VXNB 2VLJE 3SO3B 2FX8L 3D52A 1J0IA 1N2RB 4CKQA 1BD2D 2BSSA 3LSOA 4M61A 1EAQA 4MXWL 3WJLC 1SXSA 1YEKH 2VLRB 3AU1A 4CVZB 2XBDA 3QR0A 5JR1H 3VD1A 2EDNA 5DJ0A 3MTRA 1AZZC 2A77L 3FHQA 5AW1B 4NP9A 5EDSA 1Q9WA 2XWEA 2E8ZA 3H3PH 4AQAA 1TIUA 2NY2D 1XR8A 3L5XH 4XWGL 2YGVA 5F9WB 1ZHNB 4FF9A 5JW4R 1DO6A 3JT0A 5HHVL 1Q1JH 5CSZA 1QKZL 4E9VA 4L1HA 1HXKA 4KY2A 4LCIH 5CZRA 4RFOH 4L8DB 3H7BA 4OI9A 3H53A 2R9HC 1ZA3A 3BT2L 3U0TB 3S3PA 1IL1A 3QZWA 1BJ8A 3T6QC 2XWCA 1JNNH 1T4KA 2DBLH 2ZUQB 3QNZB 2ZXBA 3RTQB 2P5EE 3NJJA 5HYSB 3IMTA 3EHBD 2VGLM 1OM9A 3ABKB 3H4FA 4OM0H 3U1QA 1I4FA 2DQFB 5IWLC 1YY8A 5EBMA 1G0YR 3IETB 5HGBB 4LDOB 1WO2A 3UADA 1V5JA 4ALAL 2IOOA 2EDYA 3LTVA 5LO7A 2FB4H 2CBPA 4PP2A 2W65A 3HUJF 4KKBC 5DFVC 4LASH 3KCWA 3H4HA 3O6LH 1JNJA 3QZWB 1YO4A 3KYAA 1UD8A 4QO1A 4XO3A 2X44D 1KYUA 2JV6A 3T2QA 1WCBB 1JZJA 2F08A 4Z7QB 4PJ8B 4JRYD 3ZOAA 1BF2A 4WEBL 3L5WB 3NN8A 3HI5L 3TWCL 2Z35B 2YSSB 3AQXA 2DQFA 3FF8A 3IGLA 3LPOA 3MDJA 4GMTH 3VI3B 1ZTXE 2V7NA 1YEDA 3ZDZB 1R75A 3EDJA 5HPOA 5BRPA 4JL2A 2B8OT 4LLWB 3JV5A 1O6SB 1OP9A 5D2LE 1EJFA 1OAYH 4GI8A 2MCPL 4QRFA 1CUOA 3F7PC 3TO2A 3MOBH 1T04B 3DOSB 4JFZL 4LE8A 1G6RA 4PIRF 5L9DH 2H3KA 5HYEA 4NUQA 2YA0A 4FL4C 2X89D 1TSRA 1YNTA 1WA2X 2GIYA 3S88H 5HDBE 2BH0A 4JHAH 5IHZB 3UTTA 3S3DB 3PHAA 4F15C 5K9JL 4KY1L 4M4PA 3NCCB 3O0RL 4WY7L 3S0PA 2YWYA 2B08A 4DQAA 2ZOOA 3TO4B 3BJLA 1NCUA 3ORJA 2PTUA 5F93C 1UOLA 2V9RA 3QCUH 3ARBD 4WWOA 1J86A 2QSTA 4O9HH 4LK4A 3RZCA 2FQEA 3IDJB 2A4CA 1A6ZA 3FQWA 1BBDH 1ZEAH 3HFML 2VDLH 1IM9D 3JSSA 2WWMC 1XF5A 4JG1L 5GGRY 2ORBH 3ZKQD 2XVGA 4M7LH 1JPEA 4LGRB 5BJTA 3K80A 3QC6X 1BM3H 1FH2A 2NXZD 4MHHI 4U6YB 3NP4A 3OR6A 2OMXB 1KPRB 3ZIYA 4OV5B 1LGVA 2R9HD 3MRGB 3UTQB 1R5VB 3AGWA 1ESOA 4PYHA 4Y2OA 5IHBA 4R2GD 1IKOP 4EF3A 1R6VA 3KLDA 2Z65C 3IF1A 2B4CH 3GZKA 3EOBB 4FXKC 3LDBC 5I0ZA 5DUMH 2DQDL 1CYGA 4JPVH 2VLJA 4FYQA 1MNUL 3IJ8A 1FPTH 2WYHA 1FL6B 3INUL 4QO1B 1U8JA 4JK0D 3B9EA 1F45A 1ND0B 2C9AA 4DFHA 1KV7A 4NN5B 4CA4A 5E2TL 3TBTB 3CU1A 2RACA 1O0VA 2X9YA 5E8PB 1GOHA 4U3SA 1UM4H 3W0WB 3JVFC 5GZNA 5C0JB 1MZYA 3TT1H 5EPMB 4KJQD 2CKNA 2GAZB 4AEHH 4XC1H 4M3KB 3GBML 1MIEL 3RFZB 2X4UA 2ZIDA 2R1YA 4I0CC 2NMSA 3BFWA 5DRNB 3S36X 2X70B 2VERN 4ZTPH 2AQNA 3GTVA 5JW5B 3F7VA 5IMMA 3SPVB 4U1SA 1J9RA 1X5IA 1FL3A 2NY4B 4MD0A 3O45A 4CAGA 2CALA 2XZCH 2AV7B 2YGOA 3CHXA 3DTXB 4GSDH 5JO5A 4Y19D 3OXRA 4QHUA 5C0IA 1VPOH 4W9GC 2FIKA 5CN2A 4BBWA 3CK0L 4HJGB 3MHZA 3S3JA 2X12A 2CLRA 1OCOB 3T0EE 2XHNA 2GTWB 3MROA 4IKIA 2CUMA 4XZ4A 3DJSA 4CC1A 5EORL 4KXDA 3MUHL 1Z9MA 4HS6A 4BSVB 3PF2A 4KVCL 3X14A 3N2JA 5DD1L 5D8JL 4ZMNA 1C5CL 2BSTB 2JF1A 3A4AA 2X4OA 4XNAA 5FUOH 5JIKA 4CDHA 4JW3A 4KPHL 1UWXH 3WNPA 1M05A 1TTGA 1A7NL 3KS0H 2Y6SC 2GYSA 1VJSA 5DVKA 3RNQA 4U31A 3MZGB 1UH2A 3UO1H 3RWEA 3C9NA 3S36L 4DGYL 4YHYC 3LQZB 4HGWB 4NO5A 5F0LB 3ZE1F 3C5ZC 2J21A 4L2YA 5IQNA 2JLPA 4WO0A 1DQDH 2HLFD 4GS7C 1KXVA 5TGBA 4OZGA 5D6DA 4R7NB 1BGXH 5D1XC 5D72H 5DWPA 2KQNA 1TCRA 3SE4A 4ZI8A 1D7FA 1WFTA 2YHGA 1IGJB 1I75A 5LDUA 4U3XA 3PCYA 4RMSA 5EB9A 3W0WA 1AD0A 2WKGA 3I9AA 4CKVX 3UP6A 3TBTA 3CXHJ 1UH3A 1IBGH 1RZ8B 1RP9A 2V0AA 5IOPA 2X0WA 1TYRA 3UBGA 5LBSL 2X70A 5J1TC 3BUQA 5F0MB 1MLCB 3FL7A 4MQTB 1JSYA 3QUZD 3ZZ1A 3MBWB 3V4LA 1OOAA 2ENSA 1NPUA 4ELME 5L7XL 1HXYA 3FTXA 3MA9H 4JRXE 3N41F 4KQ3L 3OZLA 3RY5A 4D3CL 5BMFL 1H5BA 4Y19B 4Q4EA 2IAMD 4JRXD 4EBQL 5BVJA 2C9UA 5JO5B 3OKOA 4MLSA 3RB5A 3NAAL 3CFTA 2XV0A 3RY4A 2E7LC 2VN7A 4DOHB 2IDSA 3IFLL 3GQFA 3PIQB 4ANXA 3C2SA 5AD0B 4M9PA 1F8TL 3X13A 2EDLA 1XGZA 2Y9RT 4ANUA 1OAUL 3QNXB 4RLDA 5DYFA 5GISH 2VM4A 3Q13A 2P45B 4YHLL 3GDCA 4PVMA 5IMOB 2F5AL 1I7UB 2V7HA 5E2UL 4UILH 2FRGP 1OB1B 3OKKA 5CJQL 5HJDA 2OMZB 4BFGA 4HALA 4IBTA 3RUGF 5JPMB 1RXLA 3EJJX 4P5SA 4PJ5D 1GW6A 2AEIT 4ELKB 1FG2B 1ZS2A 1MI5E 3KXFD 3O4LB 5FK9B 1XO8A 4DZBA 1R46A 1VF5C 4HZ1A 2GTQA 3HCVB 1BIHA 1XCXA 4L29A 1LL1A 5GGRB 5E5MA 4A2HA 1U8KB 4HJJL 3UAJD 4U2ZA 5EF3A 5JOPE 3UMTA 4A39A 1MCNA 1H8NA 1RHFA 2DQUL 4M4RB 5TGBB 3ZHDA 4ACPA 2XXMB 3QK0A 1IAKA 1XB8A 1RJYA 1I7UA 2FYYA 5DURB 4EN3D 3D06A 1R47A 3PWNA 1TTAA 5IWLA 1AI1L 4X6CF 2AF2A 5KS9F 1U8OB 3QJHA 4NAMA 4HUUA 5IW6B 3MJ7A 2EXTA 4Z78A 1FL5B 1I1FB 2GTZB 3ARBB 4PS7A 1KWKA 1NC4B 1BQHB 4FXLA 1M71A 2R1WB 3DETC 4ZTOL 3L17A 1HHKB 4H5SB 3KLHD 3W0WE 3ZZQA 2EEDA 3UP1A 4QF1B 4PJIF 4Z76A 1E3ZA 2X4QB 1ICTA 2G4EA 3A47A 4HSCX 3RNKB 5LHDA 5IVXE 4C4KT 3PG2A 4G9DA 4ZRGA 5TDPA 5GZOD 3LKNB 3WKYA 2K9FB 3QFDB 4KMLB 3WD5H 3HZYA 4U7MA 3MV9A 4LHJB 4NKDA 2EDFA 4GG6E 4B5EA 5ITBL 5D6CA 1CGSL 3QPQD 2WN2A 5DRWB 3SDCA 1FZOA 4AWJC 3QUZC 3RWJA 3QDJA 4RFOL 4P5MA 4WAFA 3TFKC 1FVDB 3EJZC 3MACH 5D7JB 4N5EC 2WC7A 1A6TB 3MRCA 3FMGH 3S98A 4AG4H 3FU7A 2AK4D 2QQNL 3HHRB 3QIUC 3IJEB 3QIWA 4N5UA 2EVHA 4PWEA 5ID1A 1M2VA 4TTDC 3CC5A 5K9OB 2Y5TA 2SODB 1ZVSA 3HZYB 4P3CH 1YUKB 3PJSB 2NXYC 4BH8A 3FOMA 3QWNA 2L8AA 3H6JA 3HNTH 4MMYA 1JP5A 2BLFA 1WBZA 4P05A 5DUJA 1AHWC 3N44F 4NNYA 4L0YA 3JQOB 3NMEA 4X5LA 3V52H 2HFGL 1A6AA 4U6HB 1I7RA 1N8ZA 3QDGE 3M17B 3QUXB 2PPDA 5CO1A 2JELL 5BS0A 5I6XC 4OJFH 4FXGA 2IQAA 1A4CA 2EXWD 4P57A 4QGTA 5IB1A 4AGLA 5E08L 4X6CE 43CAB 1J8RA 4M6NL 1EO8H 2ZOKB 2BIPA 4U3CA 5DVOA 3ARUA 3KDPB 3T04D 1XL4A 1G9MH 2B20A 1U92B 4CMHB 4WWKA 3VXOA 1NGPL 5T3ZD 3TP4A 4HLEA 1MF2H 1OV8A 4I0PA 4MDIB 5L4FA 2PYEA 1MCLA 4OLZL 5GQBA 3ZKXC 3NSFA 1CIDA 3MVSA 3HE7C 3AB0B 2XDHA 4AEIL 2IBZX 4CC0A 3H8NA 2WQ8A 3KL3A 5K9QG 5T3XD 1JRHL 2WLMA 1QI5A 4B53A 5ENWA 4LT7A 5GSRA 3HR5B 4BK5C 3MRBA 4HXBL 5IF0A 5DO8A 4JFOA 1NFAA 1EHLH 1FVDA 4AC4A 1FZKA 5LBSA 4XBPB 4IEFA 4JZJA 4BCYA 5GS0L 4O9HL 4OAWA 3INOA 3MYJB 5DK3A 5IW1B 3DV6B 2VTFA 4NXKA 2UUDH 1NFDF 2HG5B 2RALA 3CC5B 4JFEE 4UBDC 2XG5A 3NEXA 5E4EC 5FA3B 4NZ8A 4KKCC 4LSTH 1ZLVH 3VXRB 1J8HA 3HC0B 3QUHA 1E3XA 1JWUB 1S5IH 4K9EC 4HOZA 1BF8A 3WU1A 4HIIA 4TSAH 1X44A 2D03H 4LMQE 2G5BA 2LTQC 5C2BL 4LSQL 2JK5A 2XJKA 4O2CA 5I1AB 2WIIB 1B4JL 1RL1A 2OTWA 1MRFH 4LXFA 2ZQKA 5DLML 1P4IL 3H54A 5JLZA 5C08D 3FT1A 4ABQA 2WKOF 4OAWB 2B4CL 3P4MB 1R5WA 3IGKA 5J5EA 4K7PL 4NKIL 4ZMQA 3TZVA 2ZOWA 1EO5A 3QR2A 4G8AC 4KI5E 2HX9A 3D12B 5CEZE 4XO9A 1CZ8L 2NXYD 4KHTL 4G5ZH 5L2KB 4XB8A 2CHNA 2P5WD 2QSCH 4NO0D 2QEJA 4X9GA 3IU3A 1RV6X 4BSWA 1SDYA 4FEMA 2WVVB 4EQ3A 3KS0J 3NN8B 5HJ3B 3HNSL 1A7PH 2DTML 3RPBA 3CCHB 1BJ1J 1S9VA 3WFDH 1Q9OA 3VNZA 4U05A 1BQ5A 2DMHA 2ZX6A 4S0HA 3ZHKA 3P3YA 1WK0A 1NGXA 2IWGA 4B9PA 4X8CA 1UURA 2BNQD 2PUQT 1XXDC 2C9SA 1DVUA 1RIUL 2AABL 1ZA3B 2UZIL 4AJ0A 2CKBH 4GJTB 4XN8A 4N5ED 2X1XR 1JD9A 4FTVD 3WEXA 1OW0A 5I8CA 4OLUL 4RFNC 1MHPH 2MQGA 1S7QA 3HN3A 4AZ8B 1P4BH 5F8RC 3FQTA 4L1SA 2KBGA 2PXYC 2WSPA 4TYUA 3W82A 4B9FA 3D3VE 5SWQA 2FLMA 3DX8B 4G6AC 1TJGH 4DIXA 3O4OC 2YKLL 4NB7A 3ZUCA 4XPAL 3R1GL 1N64L 3HG4A 4JJ5B 3FZUD 1QACA 3US9A 2NCEA 5K5YA 2WQRA 2CA4A 5PAZA 1LNUB 2ALWA 3HS0C 4B9GA 1V27A 1HH9A 2W0LA 3TWYA 4E42A 2WQWA 5IG7B 1HI6A 5BO1H 2CGRL 2C3VA 1UT9A 1FFOB 2A9MH 1RZKL 3GZOA 3S34L 3RWIA 1S9KC 1WCBA 2Z7UA 1KGYE 1SUHA 3MUUA 3FU5A 4BE5A 1KTRL 4PTTA 1MVUB 4PW9A 4BZ2A 3DX8A 1NBQA 3C6SB 3DX6A 4OW6A 1B0RA 3O41B 2ZX5A 4LVNC 5IR1B 3D30A 3CXDL 4MA8H 3A24A 3OR7A 1BD2E 3PQYB 1A6UH 1DQDL 3B7TA 5CBEB 3HLKA 1JPSL 4GAGH 1N3NA 4OVVA 3QCVH 1WHPA 2C7FA 3WFBH 4R7DB 2W60A 1C08A 2Q3AA 3OAZH 3FC8A 5E6UB 2BMKB 4MWFA 5E94A 5B3SB 2V5MA 2OI9B 4ACTA 1F6AA 2QPDB 4OFQA 3RWIB 1PG7X 4M8QA 3KPMA 1D2OA 4WCYH 3N44B 1J1OH 1JGIA 2E7DA 2VO8A 5CP7A 5KW9H 5C0JA 4XBMA 1D3CA 4EVNA 3HAEG 4LDEB 3H7LA 4BQBA 3R0NA 2K6WA 2VDRH 2W88A 4Y4FC 4KQ0A 1FO0B 2PO6B 3HBPA 4QRRA 5ISZA 2F54E 1OAJA 1I7TB 3QFJE 2NUPB 1DLFH 3JWDH 2UZYA 4LRIC 4MA1C 2H41A 4KZEH 1KIPB 3D4ZA 1L7TH 3NA4A 5DJ0B 1FBIL 1KGCD 1ZHNA 3EO0B 4N68A 2W9DL 4NUGH 3DTXA 2WCPA 1Q9WB 2KC0A 5JDSB 1WRFA 4RAVA 1RERA 2E4TA 4KTYA 2CLRB 4PLKD 5CP7B 4LU5H 1G6RH 1PEWA 4ODUB 5FUCC 1UENA 1R5VA 4X6DB 1NAKL 5GS1B 3NDZE 3PWVB 3WNMA 1KDIA 5HD8D 4D9RD 2H0FA 1SJVA 3UJTH 4XB7A 2KH2B 1U8JB 1S2EA 4ODXB 1LO0L 5DUPL 2MCAA 2DBLL 4DTGH 2WGNB 4QCIA 4HFUH 2OMYB 4MMZC 3UAJA 1G1OA 3FU9A 3FB5A 4GQQA 1OY3B 3OJVC 2R4RH 1UA7A 1DSFH 1IBDA 4LCCA 2IDUA 2JQAA 4HJJH 5D7JC 1HFUA 4G8GD 1N2RA 3TVMA 5JIIA 4BWTA 4UZUA 1X9QA 4PRPE 5IHUH 2R0LH 4NM4L 4V33A 2E0PA 3F7VB 1CTNA 3ZDXB 1DYZA 3E8UH 5IMMB 4NZDA 1LDPH 1JHLL 4G3YH 4G9FE 2XI9A 5EOCJ 5AWNL 3VWKD 3C08H 5IEHA 1A7QH 4QRBA 2YPVL 3Q2LA 4HBCL 1X7QB 2C9QA 4R8WL 1EXUA 3QJOA 5DMGC 5C3TA 3G5VB 1W72B 3VSQA 4NPYA 1FFPA 4ZXBD 1ZXQA 4Y9GA 3STLA 1J0YA 3GEWB 1O7DE 1KIRB 4X6FB 2AHIA 1PLCA 1ZPUA 5KVEL 2MNUA 3RTLA 4JBSA 5E5UB 1ZV5A 1P4LA 3ZKMD 4JFXB 1QRND 3CPUA 4I5BB 5CJ8A 5T3ZE 2A74C 4Z3FA 2CLZB 4X5RA 1TQSA 2P8PB 4QAMB 3ALWA 1T89C 4P99A 2XBTA 3H2PA 5B1JC 4GW4B 4APQC 5SX4I 3KD4A 4IRJD 1S3KH 1SZNA 3RNQB 3WNLA 2CK0H 1IT9L 4KGJA 3SDCC 2VKXA 5H37H 1OQXA 3PPSA 4GP8B 3NTCL 5E7BA 1UATA 4WY7H 3DK0A 2AXWA 2ZZUT 4P2QD 3SODB 4PUBH 3L4VA 4OSUL 2FVNA 4QRPA 1MW2A 3UZEA 3CMOL 5IQ7L 1AZBA 2MKLC 2X2HA 4X6BB 1CF8L 4R7NA 5CSBA 5H4YA 5CINH 3HFMH 2WLKA 2DWXA 4HQQL 3FO0H 4XCNA 1INQA 3AXLA 5GS0D 3QULB 1RKRA 4P3CL 1P7KA 2WNXA 4YC2B 3LIZA 4XP6H 4XOEA 5B7FA 4URKA 1P2CA 1TEGA 3GIVB 3AUVA 5D93C 2V7NB 5BO0D 3LD8C 3SDXB 1QR1B 2EYTA 2YUWA 1EV2E 2OMUA 3HZVA 1GZHA 1ZK9A 3AQDA 3O3BB 3GO1H 2XC8A 3HG0A 3TJEH 3ECVA 3VFWA 4EOWH 1KXTA 1AMYA 4XNMA 3UYPB 4JPVL 4CGTA 1EIBA 2NTFA 3FTVA 5CU5A 3EG9A 5HDBB 4N2FA 4H40A 1FA4A 1UA3A 5D7JD 2A9DA 4NKQB 4J4PA 4QXTB 3FQXB 4JQIA 2AP2A 4ZAKD 4JDVA 3BD3A 3GBLA 5SX5H 2ZCKH 1I8UA 5KZCB 3N43B 3EBGA 4WNJA 5J12C 4R0LA 3SJVA 1MCOL 2BDNL 3HKZA 2RAMA 4XC1L 4JFXA 4GW4A 3EO1A 4H1LB 3N1PC 5EZIH 1EERB 1TSHA 1JRHH