1ZT1B

Crystal structure of class i mhc h-2kk in complex with an octapeptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
QKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-K alpha chain
publication title The H-2Kk MHC Peptide-Binding Groove Anchors the Backbone of an Octameric Antigenic Peptide in an Unprecedented Mode
pubmed rcsb
source organism Mus musculus
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zt1B00
7CGTA 3BPOB 4PJXF 2B2XH 4Z95H 3QWOB 4XCCL 4JANA 3SQBA 4JM4L 4KI5E 3ZT6A 1NL0H 4NZRH 1NEUA 4L3EE 4LSPH 2MPAH 3IXAA 3TO4B 4CGTA 4D0BB 2X4OA 1FCCA 1YEFL 1DL7H 4HAGA 4YX2L 3U4EA 1A6ZA 2VDOH 2WLYA 4TUOB 1R3IH 3W11D 4C58B 4WWKA 1EO8L 4IHOB 4PJDA 3UJJL 1UKSA 4Z8FL 3MRDB 4JY5H 3CCHA 3MYZA 3ALPA 4OF8A 3D18A 1X6LA 1KJ2B 1RZGA 4L8BB 3BWUC 4HS3B 3NCYP 5CIPB 3H42L 5F1KC 1PY4A 1F58H 3OJDB 5ANMB 5LJYH 3NFSH 2EH8H 3HZKB 5FO8A 3DX6B 5DWUH 1CWVA 2ARJQ 2DLGA 4JFED 4OZFG 4PJIE 3F62A 4B7LA 1ODAA 4KK9C 2FR4A 3MOBH 5CJQH 4YPJA 5GRVL 1YEGH 2NY6D 3E3QE 1U3YA 5EOQH 3TJEH 3CPLB 1T3FB 3ZKMD 1JE6A 2G5BB 1FVCA 3BKJL 3IFLH 5IVZA 1FZJB 2L4OA 3UBXG 3ZHDA 3VFPA 1JZ3A 1NMBL 4OLUH 5C8JB 4M7ZB 2Q3ZA 5EZJB 1HEZB 3W9DB 3K4AA 5ANME 4NQCD 1BQHA 1IAOA 5JORA 4PRIA 5E5UB 5ESAA 5J13C 1GSMA 2XRAL 3WLWD 2DB8A 3MLSL 1FFNA 3HE7A 5D7JD 4BSJA 2OTUA 3SGDI 3JV5A 5T5NF 2BSTB 2E7LC 4YHLH 3UTZA 2HMIC 5D96B 5KSVA 4APQC 3NIDE 1RZJH 5GPRA 4G7YL 1MHEA 1PZ5A 3QZWG 1DVFA 1MFBH 3LEXB 5BV7L 5T1DL 5CJOH 4BK4A 4LKXA 1PDKA 1FRGL 1HINH 1AP2A 1YQ2A 4GBXB 5DJ8B 1S9XA 4WW1A 3IFPB 1AI1L 1PX4A 4LSRH 2DQUL 3OKKA 1U2HA 3GMQA 3B3IA 4MJIA 2XI9A 1U8OA 3FQXA 3D5OF 3KDMB 3IFOA 1NMCC 2C1OA 5B39G 4ODUA 1FL5A 3ARED 4LPVA 2EEBA 4DVBB 2EZ0D 3I75B 3S5LB 3GI8H 2YWZA 3QI9D 2A6JA 4BKLA 4R26L 4LPWA 3MCG1 2CD0A 1DQTA 3QIWD 3BPNC 2FNBA 1IGYB 2V7HA 3RI5K 1N6QL 2R8SH 4JEGB 1H5BB 2R2BB 3SDCD 3RJQB 5L8KB 5TDOA 3ULVF 4IMLB 1YEEL 2Z4QA 4A6YA 3GSWA 3WS3A 3TYFA 1N59A 1B4JL 3EJYC 4QOKD 2OLDA 3LPWA 4LIQE 4ZOAA 2VDQH 4YDVB 4BFGA 3NA9H 1JPTH 3AM8C 1CBVH 1T89A 2FZ3B 4RAUA 4U2YA 1ZK9A 4K71C 3X17A 3NA4A 4U05A 5F96L 1WIUA 1U8QA 4PS4L 4OCRH 4N0YL 2NW3B 4HKBB 1XF1A 5I8CB 3Q5OA 1AIFA 3UTPD 3K2MC 5DVKA 5GZOC 1KJ3L 1QTYT 2BHUA 1U93B 1CGXA 2FLRT 5HY9B 4MDJB 5GIRB 1DN0B 1KBGL 2IPTL 1P7QA 1FVDA 2JIXB 1IM3A 1A7OH 3VGAB 2X4QB 4RRPA 2A6DB 1ZOXA 2BK8A 3PQYA 4MQXD 5D5MF 3ZE1F 1JGDA 2EIZA 1I3GH 1MWAB 1UH4A 3CFBB 2XKUA 2VAJA 3MRFB 1T2JA 2YMXL 4OZHA 4DUVA 3SGEI 3C6LA 5FECB 3QIBA 2V7NA 5JQHC 3AS1A 1Q0YH 4EI6B 1RZ8B 5JDJA 4IRSA 2HJLA 3CZFA 4S0TD 1ULVA 3RIFK 2XXMB 4JO4L 5IG7B 2AJUH 4R90H 3VWKB 3GFUA 4RQQA 4P59L 1WFOA 3KS0J 3DRTB 4PD4J 5E2TH 4NKDA 4U1SA 1DDHB 2VO5A 1MIML 4CN4A 2LU7A 2D0GA 4JM2F 1BD2A 2VMFA 4P9HL 5EO0B 3PWLB 3DYMA 5GQBA 5E1AA 1QLRB 3CDCA 4R4FH 1H3PL 2WSKA 4Y16D 4GRLA 3QCVL 3AAZB 3QDGD 1FDLH 1OARL 3FZUD 3BESR 5BQ7B 3HMWH 1KG0A 4HUNB 5CINH 5GGTH 4X5WA 1J0JA 1YN7A 2A9ML 2AXJA 4HWBH 3KPTA 4M6ML 4RA3A 3S6CA 4KVCH 3ARPA 2HJKA 4P2YA 3MBEB 2Y36H 1JRHL 4PGBA 1AHWB 1J0YA 1QKZH 5EORH 3QR2A 1KN2L 1MI5A 2I27N 3B43A 3W5NA 1BM3H 3MLTA 3QDJE 5FEBA 1AGDB 2V2XA 4PJXA 3IDYC 2APVA 5TE4L 4GUPB 5F7YC 5FA3B 3T77B 2A0LC 5CZXC 1KNOA 2J4WL 3DIFB 3JUYA 3LKPB 4PREA 4DUWA 4YDLB 2FEEI 3HB3C 4Z7NF 3CVIH 1L9MA 4DW2L 3P77B 3ZKND 4TYUA 1AD9A 3DTXB 1YMHB 1OAQH 2A73A 1PW3A 4NZUL 2B0SH 1ZVHA 4JVWA 3RGVB 5LG1A 3C5ZC 1YQVL 4QRRB 3EO0B 2VC2L 1L0QA 1GGCH 2JTDA 3V4VH 1I1YB 1BJ1J 1IC7H 2FBJL 1PSKH 4HKXA 1NUDA 4LFHG 1YEJH 4FP8H 3TBWA 3KLAB 4FFVD 5L2KB 1R24A 2D31A 2X9YA 2CKBB 2XKNA 2IBBA 3FTGB 2W9EH 4PPTA 4GG6B 4XXCA 2IPKB 2VXVH 3NIFF 3STLA 5J1AA 5HJ3B 3QDME 1RUPH 5KANI 2G75A 1UVQB 4PRBB 1T1WA 4QRRE 9CGTA 1D9KA 1F4AA 2D7TL 4WHCA 5EOCH 1RK0B 1F8TL 1S7SB 4PJHB 3JV4A 3RTQD 5C0DB 2IG2H 1J1XH 3GRWH 3OG4B 3E6HB 4ODWB 3LZFH 2VUYA 2OL3H 1S9VB 1A5FL 4GG6E 4K07A 2NY4D 5DMIL 3O9WD 1SHMA 4UV4L 3V4UL 1T7ZA 3AS0A 2XQYK 3ILPA 3NGBB 4Y8AA 3UX9B 3U1SH 5HHPA 4NQED 5DEZA 1QOKA 1A4JA 1NANH 3D2UA 3DVNB 4I4WB 1BGXH 1QFWM 1SJEA 3VDCA 2A74B 2W38A 3GMMA 3UPAA 4HG4K 2GJZB 2H3NA 5C2BH 4P2OD 4PJHE 2VYRE 3FO9A 5DZOA 1LNUB 1QHPA 1JNLL 3TLRA 3BIKB 3S3SA 1PG7W 3M45A 4X4ZA 2GSGB 4PGCA 4MA7L 2ESVD 3CFDA 4DK6A 2NY5L 1IT9H 1JUFA 3GDBA 2HWZL 3GHEL 3NIGF 4UQ2B 1H3WM 4HUWA 3O8XC 2I07A 5FUZH 4XMKH 2APFA 2J88H 3KYOA 5FAAA 1KCSH 1W8OA 3V4PH 3RA7H 2QHRL 4GXVL 4Z7WF 4CNIA 4AQ1B 1A7PH 1U6AH 4O2CB 3ULUF 2QHLA 1ZLWH 3K0WA 1K5NA 1J8HB 2DOCA 5DLMH 1YY8B 3T0EC 4JRXB 3RY5A 5I8KL 2DDQH 2PN5A 5IBTL 2ZG1A 1GXEA 5I1AB 1ES0A 4LSVL 3MUJA 1EHXA 2NTSP 4ZS7L 4H88H 1E6OL 3DX7A 1DQJA 3O2VH 3F7YA 1QBBA 3WE6A 4CMMA 4DN3L 1RIHL 4PRHA 4XPGH 1EO7A 3DBXB 1G7HB 4MA1C 4P57B 1FFQA 5ICZA 3DHJA 3SCMB 3U7YH 2FLBT 4HGWA 4PJCF 3GNML 5MP6H 1JWMA 1I1AB 1FIGH 1KGCE 4Q9CA 1J8HE 2GT9A 1CF8H 3KPPA 3D85B 2BNUB 3IGAB 5IJKC 3WXVL 5D1QD 5FYKH 4K7PY 1NAMB 1DQMH 3OJ2C 4KKLD 1WT5C 4MB4A 5D5MA 4NJ9H 1MAKA 4P5TC 5HYSA 1NCWL 3VGBA 1JF1B 2CRMA 3H3BC 4EDWH 2CDFB 3CMOH 1INDL 3VRJB 4UOJA 4JE4B 3WIIL 2HFGL 4RA0C 2AXFA 3N1MC 3S88H 1RHHB 3F7VA 1FYTD 4H1LA 3U0TA 5FYLL 2H1PL 4X4YB 2C3VB 4O58H 5CJXA 1NDGA 2CLZA 5I1LB 4Q0XL 1K85A 2VQUA 3RWGB 5EU6B 3LV3B 5GGSA 3BZEB 3VGFA 2PO6D 5FUOL 4NFCA 1UGNA 4JM2A 5F3BB 5J06A 4YFEA 3UTTD 4B5EA 2P8PB 1RHFA 1UXSA 5A1AA 4N8VG 3IETB 1YNTA 1F6LL 3T1FA 2UVFA 2CO6B 3EO1A 4FFYH 3IRZA 2NY2D 3IT8D 2XZQL 5DQJA 4XP6L 2AS5M 2WBJA 4M9PA 1LE5B 4LL9A 1V3MA 4F7MA 3M8OL 4ZXBB 5ICYA 5ALBH 1RZFH 2GTWA 1YEKL 3TV3H 2NY4C 1ONQA 3O6MH 1AO7A 1AGCA 1KPRB 5EU6E 3CXHK 5HHVH 1JGEB 2PXYB 1X5LA 1AXSA 2X10A 4K3GA 5CIPH 2H9GB 4LSUH 3EIFA 4AH2A 1RZKC 1A3LH 3V0VA 1ADQL 4OCXH 3OF6A 5EUOA 4JPVL 5CUSL 1T5WB 1JIBA 5E8DH 3MXWL 1FNEB 2B5IC 3PHQA 4YK4C 3LMJH 3DGGA 4HIIA 1JZ2A 1J0ZA 1SYVA 4DAGH 3RL2A 4LHUB 4ETYA 2ZOLA 4K8RD 1IKFH 3QRGH 4NNYB 5C3TA 3GGWA 3RX5A 2HH0H 2ZSWB 5E6ID 2P24A 3WIHH 4OF0A 3MXVH 4YHIA 3L3IB 4NBYB 4KK5C 4X7TB 1FLRH 1YDPB 3PGFH 4H0IA 5T3ZH 4D0DA 3OKNA 3B9DA 4ZAKC 3MRHB 1FG2B 4WUUA 3BIBX 3LKNA 5GS2H 4RGMB 3FB6B 3V7AE 1M05A 3DXAD 4ISVB 4ODHL 2B20A 4HHAB 1W8NA 5IWLC 3P4OB 1S7QB 4WU7A 2P8LB 1JGLL 1U95A 5DSCA 2FJHB 3LDBC 5KSAB 4IOIA 1S78C 4NCDA 1GZQB 1A8JH 1IQDA 2X4PB 3MPCA 2LVCA 3RZWA 3MA9L 3DUHA 4I77L 2P5ED 1B0WA 3MRLA 1TZGL 2DJSA 1VFBB 4G8IA 4M1DH 1MJ7H 2V9QA 3MV9D 4HEPG 2BRQA 2ED7A 4JQVA 3IJSA 3O45A 3E1F1 4QWWD 4Y2DB 2EC9U 2NNAB 4TSCL 5ISZD 3RX7A 5CP7B 2JCCB 7FABH 3LB6D 5C08B 1G84A 1UXWB 3DSFL 5IW3A 4OM0H 5FF6A 1S7VA 3G5ZA 4HJGB 3TBSA 5D2NC 2ZKHH 3IDNB 1PAMA 1WTGT 4M5YH 2CUMA 3ARWA 3L5XL 4X7FC 5FYJU 1FPTH 2X44D 4Z7VE 2FGWH 2GSIA 1H9VA 4LLAA 3DETD 2BNRE 3LD8B 3RVXD 4AL8L 2FB4H 4NO2B 4JFPA 2P44B 3GB7B 3WLBB 5D4QA 5LGHH 4LRNH 2C4FU 4I3RL 4PB9H 1IAIL 25C8L 4ODSH 2L0DA 1RUKL 3VXOB 2JCCE 5D6CB 3V5KA 2I9LB 4R2GD 3QIUC 5C08E 3LQZB 4HUVB 4PTUB 3QXUA 1J1PH 4RGOL 3BEWB 4LPUA 2KQMA 2WINA 3U7WL 1A14H 3VGEA 4TQEL 2DIBA 5L7XH 3SE8L 4ESKA 4LASL 4Z7WA 4OGZA 4L4VD 5F6IC 4CL7A 5I8OL 5FO9B 5J9PA 1FFOB 2EKSA 3QHFH 3FB5B 2H6PA 5HYJA 5I18H 5GRUL 5L88L 3FB8B 1Q72H 1MPAH 3D0VA 3RUGB 2VLKA 3JV6B 3O6LH 3TO2A 1K6QL 1BBDH 3MNWA 4HH9A 4Y19D 5A16A 2FX7H 3ARDB 2ZCHL 1MQKH 5IMOA 1PYWA 1Z3GL 1YECH 5MERA 2A2QT 3VXMA 5CJ8A 5GGSY 5EU4B 5GS1A 1EAJA 1E4XI 1CFNB 4XVJL 2XY2A 3PABA 4FQJL 4E41B 4U0QB 1TQBB 4OLXH 2YSSA 2R0KL 4HIHA 5J6HA 4QEGA 1J05B 1QPXA 1S9WB 4NM8L 4PJCA 2J8OA 2PCPA 4Z0XB 3FFCE 3DVIA 1HHHA 4LP5A 4DKAA 4C56D 5DRWA 1J87A 5I0ZA 2VABA 5FDYA 5FK9B 5GJTL 3QUXC 5CAYB 4CMHC 5FYLD 4BSWB 5AZEL 2PW2B 2WM0A 1VGEL 3RUGE 2NX5B 2JJSC 5IB5A 3Q1SL 4G8EA 2XPGA 4LGPB 1EGJA 3TA3A 3AGVA 1AXTH 1AR1C 3R0MA 3UDWC 5TF1L 1RU9H 2I60L 1A9BA 4LCYB 3LS5H 3ZDZF 2Z31D 1T1XA 4E41E 1FZOA 4JR9H 1P4IL 3HC0B 1AR2A 4KAQL 4YGVB 1R5WA 1AE6H 4QTHA 1NFIA 5DYOB 3GSRA 2IPUG 3BKYL 4ALAL 5IUSA 3KPSD 4H5SA 4XVSL 3IU3B 4NO0D 4JFDB 4H8WH 5F21B 3EYVA 4HZLB 4AT6A 4D9RE 1K8IB 2NX5E 5T1LB 3S37H 4ONOA 5ESQB 1KB5H 2G60L 3L7FA 5B38A 5I74B 2DL2A 3VFOA 3W5MA 1XGQB 5BS0D 3EJZC 2FX9L 5FGCB 1N26A 2EKJA 1P9MA 4Y4HD 1HXYA 4FFWC 1ZLSL 1KJ2L 1S3KL 1UJ3A 5I9QC 1C5DA 4LEXH 1FYHB 2WBWB 1CXLA 4FQLH 2XG4A 3EYFB 3TPUB 3PP3H 1CN4A 1NMAH 4JFDE 1OTSD 1UB5A 4MNHB 1CK0H 1Z2KA 5JPMA 1TZHA 5JOEA 4LQFH 3HZVA 3KYNA 2DM2A 3O4OC 3CSYA 4NPYB 4WY7H 4RMTA 1S7RB 2B4CC 1KTLA 5TE6H 3WKNA 2Q7NA 1HHIB 4G5ZL 3RVVC 4O02L 3GSXB 3BPLC 2C1PB 5CMAB 2DQJL 1JCKA 2XN9A 4Y7MA 5F7WC 1FNSH 3O4LA 4KQ4L 3MLZH 1HQ4A 5HVWA 4ZYKA 4LLQA 5BMFL 1IC1A 4BH7A 3BPCB 5F6HJ 4UDUB 5DA4A 1J8KA 4QGTA 4U6VH 1G7IB 1D5ZA 3BH8B 4L8CA 1YJDH 5DUBB 2Q6WB 5E4EC 1Q9LB 5FB8B 3TN0C 1WBYA 2W0PA 1UZ8A 2ENSA 2AJSH 3GSUB 3HG1A 4N1HB 1CXIA 4DKEL 4NQUA 2R0ZL 1SEQH 2NY7H 4NQSA 3C87A 3WN5B 1DEDA 3CC5B 4N0FB 4F37F 43C9B 1Q9WA 4JO1L 3UZVB 4P3DB 5BXFB 3B2UC 5IBLD 1N4XL 2VDRL 2V9TA 4FQQA 4XP4H 3G5YA 5FOBA 3UAJC 1CT8B 2J6EA 5DO2D 3I9GH 5C6TL 3AMLA 3R4DA 1HHGB 3FMGL 5F1IA 4I0PD 4JM4H 1RK1B 1EFXD 2D7PA 5GGUB 4NKMA 5EA0H 3I3DA 5I2IA 2Z8SA 1CLCA 4O9HL 3PL6B 4YX2H 4RZCB 4YHZL 1UQSB 1Q9KB 3VW3L 1B2WL 5E2JA 4PRNB 3X14B 3DX8B 5DZNA 3ROLA 4N90E 1QSED 1EO8H 1X4YA 4JPWL 5FHBL 3HUJB 3H9SD 1Q0XL 4Z8FH 3GI9H 2XICA 1ZGLA 1A9EB 3OZ9L 3QUKA 2R15A 1M4KA 1TLKA 3U9PL 5IFJA 1UCTA 1T4KA 3H42H 4UI2A 3KJ6L 3NN8A 4HK3N 4PJGB 3O6FD 1IGIL 1OQOA 1NCBH 5C0EB 1G9MC 4U3XA 5H35B 5CJBA 5IBUB 4D0CA 6CGTA 3LRSA 3QO0A 4GLRH 4IRJD 1WZKA 4QT5A 3RRQA 3W9EB 2BVOA 5CSZA 1AQDA 2R1XB 4JRYD 1J0IA 4OD2A 1R3HA 1FFRA 1I7TB 1LO5B 5F1SA 3B5HA 3HUJE 4P3CH 1CDGA 4KI5D 1JV5A 4L3ED 1E28A 3QUYB 3IVKB 4N0CC 4JZNA 5DTFB 1RMFL 1F02I 2GY7B 5ID0B 1RI8A 4XBGA 4PJGE 2FSEB 3TZVD 2VZOA 4OFDA 2DN7A 2AABL 2XRAH 4NDMA 1LK3L 4JJHA 2C7UB 4HGKC 2YOCA 1FC1A 4MLIA 3UZEA 5C0AB 5BOZG 1G7PB 3WHE1 4BFIA 4Z77B 4G7YH 3DUUA 3B5GA 1BWWA 3MLXL 1HOCB 5T1DH 5GXBB 5SWSE 1E4KA 3DV4A 5T3XE 4K94C 1MJJB 3TO4D 4ZS6D 1AI1H 3MLYL 3BOVA 1ZHNB 1W0VA 2DQUH 4JKWA 4X6DB 4F15C 2E7MA 5GGRB 5IJVA 1XF5A 3KPQA 2VL5B 4N0UA 1IKNA 3GK8H 2ZZUT 5DFTA 2AW2A 1FG9C 2RHEA 4XP5H 4YC2B 2A1WL 2R9HD 4QY8A 1KYOJ 3S3PA 5DHVH 4BK5A 4MWFA 4HCRL 4YHPA 5SWZB 1N6QH 3MRQB 1S7WA 4U0RC 4MSWA 1GVIA 3H9HB 4QXUL 3ZLQC 2VDNL 2F54B 1OW0C 5EULV 1GHFL 3T8XA 1NCNA 3PWNA 4MCYB 1AGEB 4WI9A 1UJTA 3OJMB 4ZPTA 5B3JE 3WFBL 3RWIA 4L3CA 2CK2A 1MCNA 4UILH 4X6DE 2DAVA 4OZGF 3GKWL 2K1MA 3ZO0A 3BUYA 4PRDA 1P4BL 2EDBA 2O5YH 3QCUH 2WIMA 1A2YB 2HVJB 3QUML 4PS4H 2VWEC 5EFIA 2CKBL 2IH1B 4NGHL 4X99B 4XWOC 3TNNB 1P2CA 4ORGA 2WIIA 3BZFA 5SWZE 5CD5C 1D5MB 4WRLA 3MNZA 3RY4A 2R4SL 5JOPD 2F54E 1XF2A 3GKZA 3C9NA 1OAKL 5JDSB 1DE4A 3C6SA 32C2B 1T0NA 1HH9B 4RFOL 4RWYH 5DJ0A 5JZ7C 2W92A 1MIEH 4HWZB 1B0RB 3HKFA 2VLME 4UINH 3QI9A 1AY1L 2Q7YB 4XPTL 2XZAH 5D7KE 5DURD 4EVNA 3SDCA 2YMXH 1WF5A 3EYOA 3X12B 4HG4J 3O2DH 2D4FA 3GUTA 3HPJB 5HGDB 2AQ1A 4NOBA 4QOKA 3RVWC 5DMGC 1F90H 5E9DB 5HHME 4P59H 1QR1B 1OAZL 4KPHH 3VD5A 2AEPL 3REWB 1CICB 2HFEA 3MUGB 4TOYL 1MIMH 2DWDB 3C5JB 1WCBA 3WFHB 4P9HH 5J6GA 3KPNB 4PUBH 3P4MA 5B8CB 2X70A 4Q7DA 3VFVA 1SBSL 5T5NG 5HYQA 1VADB 4BZYA 1OARH 1R3KA 2LTQB 5EIIA 2R69L 3OKMB 3DYOA 1FORL 4JFFB 1OTTC 4B7IA 3ZE0E 1TJGL 1WK0A 5E9DE 3HLAB 4N9GB 1JRHH 3MRIA 1EX0A 3WSQL 4YBLB 4NKOB 4S1RL 3ORJA 5CWSB 3BVNB 3K46A 1XF3A 2H32H 1DBKH 5K9KA 3HE6C 4M61B 5TE4H 4K2UL 4FNLH 4NQDD 3HAEH 5FKAB 3BPOC 5E2WL 2NYYC 4X4XA 2ITCA 2NZIA 5ID1B 15C8H 1YYML 1I3RB 3O8XA 4KJYA 2PTVA 4JFFE 4JN2A 4XPBH 1MCEA 2EO1A 2DTML 5JNYA 1HXMA 1YQVH 2VZVA 5L6YL 4RFEA 2JIXD 5MEPB 3UPRB 2L7JA 1Z9OA 3A6CH 3BQUD 3QDGA 4QXTB 2WZPD 2ZUUA 3T0EA 2BDNH 2G9HA 1MF2L 3O81A 3G08A 5F89A 4K3JL 3FN3A 4M4RA 3K8MA 5CHNB 1SVZA 3NCJH 2VLJB 5IVXF 2V5RA 2EO9A 3SKNA 1KIQA 1F2XK 3MJ7A 4AEHL 3QDJD 1NEZB 1WFUA 4EIZC 4K8RH 2VIRA 3U83A 4JY4B 1DQQB 2HKHL 3A0OA 3HMXL 2D7TH 1HN1A 4XAKE 4JFZL 2DQIH 5L9DH 2QKIB 2D9QB 5A2LH 5IR1A 4KQ3L 1MY5A 3LS4H 1L0XA 5CP3H 4C4KO 2DYPD 2VXTL 5IJKA 2IADA 3KYMA 1X3DA 4JY6B 1WT5A 4M7ZC 1UM6L 2NZ9D 2ICWJ 1JK8A 4P5TA 5D1ZB 3OL2A 3EFDH 4TTGA 4F33A 2VLJE 3F5WA 1E0OB 4P5MA 1MAML 3AS2A 1WBXA 3CXHJ 4JDVA 4WFHE 4X4ME 4HS6A 5HHOB 3KWWB 3L3DA 1WZMA 4DCQA 2ZCLL 1U8MA 2X4RB 2GKIA 1FL3A 2R1WA 3MV01 2O5XL 4JG0H 4Y4FD 5D96C 2IAMC 4MA3A 4MNGA 1Q8MA 4TSAL 4M8QA 1KCRL 1ZMYA 3L5WB 2DI9A 3QDMD 1B0GB 4GBXC 1T7WA 2NY5H 4M5ZL 5D8JL 4QRRD 4MXQC 1CFVH 1LD9B 5ENWA 2H26A 1RIUH 1FO0L 1ZHBA 3D87B 2P8MB 1DLHA 5EC2B 2CDGB 3N9GH 4NUGH 2RIKA 4KZDH 4ZNCD 1IVLA 1WBZA 5HHOE 1NDMA 1JVKA 3GSNA 5IB4B 4EUPB 3SDXB 5C70A 2LABA 5FGBC 4HK0B 4MGXA 1EPFA 3O9WA 5F70A 1ZT4B 2CXKA 5AG9A 3IKCB 5ETUB 2OJEB 4D8PA 1H5BC 1XZ0A 5I8KH 5M94B 4U1LB 1JF5A 3T2NL 3D39A 2HT3D 4OZGA 3RWEB 1WAAF 3ZKXB 2J12B 1E6OH 2Q1EA 3RVTD 3ZMRA 4F7EA 1NCUA 4LPYA 2RBLA 3K7UA 1F4YL 4DN3H 5K59E 1RIHH 3HZYB 1AQKL 4PR5A 1MCHA 4X9GA 5JQ6L 5MENA 4HXAL 1NANI 4I5BB 3QHZH 3SDXE 4XCYA 5T5FH 1UM4L 5GRJL 4LPCA 4JQIL 1K4CB 4KY1H 1EEQA 4X0KB 3Q6FB 5CJ5A 4K3EL 1T20B 3G5VB 3SDYH 4NNXB 1UWGH 5IB1A 1RUMH 2JB5L 4Z9KB 3L6FA 4NQVA 3DURB 1HI6A 5ALCL 4MD4A 2XQBH 1RZIA 1NCWH 3QUZC 2Q3AA 4HT1L 4QXGH 4ZFOL 3MGAA 2WBKA 1W2KT 2EXWD 4ZAKA 5CLWA 3RI5F 4KRPB 5F7EL 4C57C 1JZ7A 3JWOL 1INDH 2EDEA 5FM5O 4UOW1 3T2QA 2HFGH 2R2EA 1NC4D 2P43B 3W2DL 4RGNB 1HIML 1ZSDA 4Q0XH 1IAMA 1IGJB 3VWKC 3WJLC 1H3GA 5GISH 3QEGL 4BZ2L 4CVXB 2FL5B 2BXZA 3QAZB 3F58L 1I1FB 4OZFB 1T1ZA 8CGTA 1HNFA 2EYTA 3S96B 2FWOB 2PNDA 1FHGA 4J6RL 5L8LB 3QCTL 1KGCD 2XZQH 2WQ8A 4XP6H 1KIPB 3UBXB 2VLRB 3WNLA 5D1QA 4RGNE 5JIHA 3KG5A 1YEKH 1C16B 3S36X 3MV7B 1G7LB 2NXZB 3UEZA 1SJHA 1UACH 3MBEC 1CU4H 3WHE0 1AHWC 3SPVA 4L8SA 5AZ2H 3MYJB 4LVHC 4OGAD 5E00A 1VFMA 2BOCB 2JK5A 3DYPA 4FQPA 4XNXL 2ZCKL 3RKDD 2EYRB 4ETQB 1RVFH 5HPMA 4NO3B 1FYTA 3VD3A 3TCLB 4H8WC 3SCMD 1NAKL 3RIFF 5D1XC 5LAXB 4HJ0C 1I1AD 3NOIA 5DD0L 1JBJA 1MFCL 3QZWB 1R0AL 3MXWH 2VLRE 2VISA 2YS4A 4W6YB 1KCKA 1LE9B 2O93L 3KPRB 3UTTA 1DFBL 1S7TB 4LLDB 3RGVC 3CDYA 3FQTA 2C4FT 2HFFB 2DQEH 3U4BH 1M7DB 4YJZL 3MJ9L 1F6AA 5GS0L 2WMPA 4HLZH 4QHLA 5BZDB 3R0NA 3IDXH 2UYLB 4MZ2A 5B39B 4O2FA 5ICXA 1RULH 5A2IH 4F9PC 4OI8A 3M1BA 4NT6A 3CIQA 3I2CL 3GJFH 3S34L 2YD8A 2NXYB 3C60B 2PYED 1BZ7B 4NO5A 1CD1A 4OF7A 5IVXA 1NCDL 3MRPA 4LBEA 1P4LA 4D3CL 1MCBA 1IC5H 5EU6D 5ITBH 3KPRE 1JL8A 1JGLH 4JHWH 1YMMB 4I48B 1G6RB 4J23A 4ODBD 3RBSA 1BJ8A 4IS6A 5KTEH 1KLFA 1DJSA 3QUXA 4PB0H 3SDDB 2CRZA 3QJHA 3WDJA 1RUAL 1T7VA 3RNKA 2JJSA 3MJGX 3V5HB 3VI4E 5FO7B 1RY7B 1BVLA 3ARRA 2HT4C 2VH5L 3FAXA 3QO1B 1JNJA 4ZXBD 1YJDC 1J12A 2B8OT 3DSFH 3D25A 5F9JB 1I4FB 2DLIA 5E6IA 3QSKB 1Q38A 4HMDA 1XH3B 3NGBC 4UBDD 3H0TB 5C6WH 5BVJB 4GMTH 3REVB 2JLLA 2IGFH 2DD8H 1LP9B 3ZHLA 2ICWI 2ZNWA 1R5IA 2R0LL 1DQLL 4R96B 4UNVA 2JJTC 4LU5H 4I3RH 1I8KB 2XWBB 35C8L 2MNUA 5DJDB 5KVEH 2XWTA 5TDNB 25C8H 3FT3A 1FCGA 3PJSA 3HNSL 3MRGB 3OB8A 3RBGA 1KJVA 5EUOE 1JJUA 2X5PA 4KKCC 1WGOA 1OD9A 1RJZB 4RGOH 3HR5B 2HYMA 2XKSA 4YPGB 4LHUD 4F9LA 1I9IL 3U7WH 2M8XA 2CIKA 4GKSB 4K55A 3CGTA 4LASH 3MLWL 2P5EA 5IB2A 5IW6A 1FE8L 3MV9A 4JKKA 4ZQKA 3DSNA 5ISZA 1C8PA 1W0WB 3DUSA 1LP9E 1G0XA 4JG1L 5AD0A 1ZA3A 4X7SL 4YHML 4PIRF 5JTWA 3GMOB 5CS7A 1LDSA 3SKMA 1K6QH 2GITA 3SJVD 1WAAA 3TYGH 4XC1L 3KR3L 4NBZB 3NCEB 1Z3GH 4HW6A 2BVQA 2EDRA 4XVJH 1Q1JL 2VITA 4FQJH 5E5MB 4M4PA 4P4KD 5E24E 5IROA 4UDTB 2BNRD 5EDXA 4NM8H 1NSNH 2WWMC 4DGVH 1DTUA 4RIRB 5KSBF 2XYCA 5L8JB 3SCMC 3BT2L 3JV0A 1ZEAL 2FATH 4PV9B 1BFVH 5AZEH 4OUUA 3HN3A 3UTSB 3I02A 4LCCA 5DD6A 4NUJA 3H3PH 3VH8A 4IIQA 3F12A 1XF4B 4MVBD 3KGRA 3QFDB 3TN0A 4L4VA 4U6HB 1Q94B 4MJ5B 3UJIH 4AMKH 3QPQD 3LPGA 2V17L 1X9QA 2VL4A 4KI5F 4XCEA 1P4IH 1NLDH 2A6KB 3K81A 4RWHA 2OZ4L 4JZJB 4KJQD 1A4KA 4X98A 3FO1B 1YEHL 1GAFL 4P2CG 4Y19A 3BKYH 1YEIH 3FONB 4JFXB 2XTJE 5ITFB 3IXTB 3WV0A 4KDVA 3UTSE 2FCBA 4Y1AB 2RJMA 2DIAA 3CSGA 5HHXL 2VNCA 4G6FB 2PTTA 3ARBD 3GIVA 1CD9B 4OI9A 3BP7B 4C83A 2DBJA 2WNGA 3WNNA 4LMQE 3FFCD 2BJML 3IF1A 5C0NC 2FX9H 2OXHA 3BZ4B 4BH8A 3DI2B 1TETL 4HIEA 5ACMA 4L9LA 4R3SB 1EAPA 4P2RA 3KPOB 3CUPB 2ENYA 5J89A 1NGPL 4PJIF 3HZMB 3WFEL 3BGAA 1BAFL 3PV6B 4HC1H 3ZYOA 3K80A 5DJAB 4Y1AE 1MVUA 5IEKA 1YUHA 1BLNA 1F11B 4PRPB 3HI1A 2PXYC 5DJ6A 5GS0D 4LLWA 2MOVA 1T2XA 4I3GA 2K9UA 1OQXA 4NP4L 4P2QB 3RDTB 4JLRB 4G5ZH 1JHKH 3VG9C 5K9JL 5F1OB 1R5VA 1JWUB 3KPSA 4KJPC 5BVPH 1GZPA 4GXUN 2HTKC 5T3XL 1BFOA 4NO0A 1Y0LA 2X4UB 4Q9RL 2EDQA 4OIAA 4DEPB 1U3HB 2B7DT 2NTFB 4G42B 4KQ4H 5DUML 1F13A 1V3LA 5KG9B 5BMFH 1JZ4A 3SDAB 4D9RD 2NX5D 2O26U 1UWEL 2BERA 5E8NB 5IMLA 1U41A 5C9JA 1NH6A 4JGMA 4WIQA 2NR6C 5BS0A 2FD6H 4FXLA 4QTIL 3I84A 3P11H 1OPGH 3FFDB 1A3RH 4WTXA 4LVEA 2DBLL 4F8TA 3NIDF 2MCPH 4Y4HA 3LQAL 1ADQA 4PJ9C 3BGMB 3V52H 1ZLVH 2BVPA 3DARA 4KKAD 2XIDA 2NY1D 4P2QE 4XMLL 3ARQA 4Q97A 1Z5LA 3H9YA 2IAND 2R1YB 5EUKA 2IJ0C 1HHJA 1BX2B 3QXDA 4JFDD 4YDIL 3SKOA 5I6XB 5E99L 3Q5YA 4RGMC 2IQ9L 4JKPH 4AENB 4JO1H 4ZOBA 3V0WL 2MQCA 2EH7L 2XA8L 2NLJA 3PDDA 5F88A 5H2BB 1VB9A 4FZ8L 3VGHA 1J7VR 4ZUVB 5L2JB 5K9OB 5CEXB 5D9SB 5DR5H 3D3VA 5KSAC 1DANU 2VZTA 4LF3A 1E6JH 1F3JA 1KPVB 2P46B 3ISWA 4P9ML 5INDA 4QXWA 4YAQB 1CG9A 3PGDA 3VE0B 5EZIL 2VZUA 4AK1A 3ZDXE 1HZHH 2A77L 1J88A 4NFBA 4TRPL 1N5YH 2AQ3A 1ZTXL 2CLVB 4C54A 4ZUWB 2X4TB 5DGRA 4O9HH 4Y2DC 4ZMAT 3CFEA 3VW3H 1B2WH 1LGVA 2FX8L 4UMGA 5C6PB 2CLRB 2DLFL 4IDJL 4QLRA 2YBRA 2FEDC 4KHXH 5HI4D 4KUZH 3JWNC 3U0WL 3OGCA 2ZUQC 5DS8A 4JPWH 3QEUA 1MRDL 3QNZA 4G9FB 4WHTA 4PJ8C 2X2YA 2OTWB 2DL9A 1FVEB 3U9PH 3TBTB 3MBXL 3QJFA 5K93A 3X13B 3NACH 2DJ4A 4K9EL 3NZ8B 1SY6A 3WBDA 4PGEA 5GGVL 5D7LE 3VXNB 1RZ7L 3THMH 1CDJA 1IEHA 1MCRA 1EBAA 4UT6H 3T4YB 3EAKA 4ZD3L 2OR9L 3G5XB 4JFQB 2N7AA 5F7NC 4GXUM 4PJBB 4APQB 4YBQD 3SQOL 5F9OL 3X3FL 1C5BH 1ROWA 4JDTH 5E5RB 1HQRA 4G8FA 4NM4H 3T65B 1A1OA 4XPFL 4G9FE 2F8OA 2F19H 3JTSA 1PQZA 3S36L 2ZSVA 4N8VB 3QQ9D 1AGFA 2ADJB 5DRXA 1HH6A 3SOBL 5DD5H 1J0HA 1N6VA 3DMMB 4Y4KB 5C0RH 2YC1A 1E27A 2AABH 2BOBB 3ARDC 4Z7UB 3T3ME 4OFKA 4N90D 3H9SA 1OAYH 2EXYD 1WZLA 4IBLT 4J1UA 2VJXA 2K7PA 4OAWA 4PJBE 2ITDA 1EVUA 5HYIA 1TQBC 2C9AA 5KSBA 4G3YL 2DRUA 3LKOB 4R4BB 1VCAA 3MLXH 4HDIA 4U1KA 4M1CD 1EEYA 3HC4H 4WO4D 4KK6D 5HYFA 4L8DB 4FXGB 4HPOL 3MLYH 2OQJA 3WDIA 4EI5C 4K71B 3QDAA 3VFRB 3GBNL 1JGUH 2EE6A 2YPLB 3QYCA 4LCWB 1FNAA 3CVHH 4Z7UE 1D5XA 3EJJX 2AI0L 3TIDB 2Q86A 4GLRI 3INUL 2MSPA 2NW2B 2XT1B 3CLFH 4HFUH 1MSPA 4YNYB 3DV6B 2G2RB 4L3EA 1UM5H 2D3VA 4HCRH 3QG6A 4KRNA 3F65A 2UZIL 1NBZA 2YUXA 5KJRL 1NJ9A 2VDNH 3IRPX 4O5LH 3TZVA 1KENH 5CFHA 3FT4B 1EK3A 2D2OA 5I8EA 4L9DA 4M7KL 3OJVC 1XR9A 4MQ7A 1A7RH 1JFQL 2F58L 2YPLE 2R2HB 4TUJB 3U4AA 4LCWE 1RPQA 4YEEA 1MCQA 4PP1D 5IFAL 3IU4L 3QWOA 4PJAE 1PLGH 3QUMH 5CGTA 3ZTNH 5I74C 1HHKB 4NGHH 3TO4A 1NUFA 5SWSD 5T3XD 4D0BA 5L0QB 1PKOA 4U2ZA 4PJIA 2HKFL 4TUOA 5C3LD 1BF2A 3Q2CA 3KJ4B 4JDZB 5DFVC 3VRLE 5BRZB 4U49A 3VFNB 3PG2A 4IHOA 3KPMB 4YO0B 4BFBD 3B4NA 4X6CB 3MRDA 5HI4C 4M02A 3CXDL 5CEYB 1YC8A 1RJLA 4Q2ZB 2NY3D 4PV8B 1KJ2A 4L8BA 4HIXH 4HS3A 4GRWB 3L1OL 3OJDA 5EIQA 5ANMA 4F7PB 1CZ8L 4QRQB 5JIKA 4GG6F 1FGVL 3HZKA 3DX6A 3RWCB 1G6RH 1OAZH 3I6GB 1NUGA 4NFDA 5ECJE 4XVUC 1ED3B 1XGYL 3ELAT 3BJLA 5BRZE 3P9MB 4JHZA 2FYYA 2UZXB 4LGSB 4F7CB 3CPLA 1T3FA 2G5BA 3U6RB 1CLOL 5HDQL 3QRFM 1FZJA 1JZ8A 4G8GB 4KGLA 2A83B 1SBSH 4PJHF 2V6HA 4XT1C 5JPNB 1PG7H 4YXKL 2QJDA 3K74B 1MCPL 4XPHL 5C8JA 5C71A 5SWZD 4GRWE 2R69H 4L29B 5EZJA 1HEZA 3W9DA 3C5ZB 1TTFA 4WHYH 2F54D 3A67H 1FBIL 2AXHA 5E8PB 1M1SA 2JELH 3WSQH 1IM9D 2IBZX 3WN5C 4YDKL 2VLMD 4KK8D 4PRID 1ZAGA 1TTUA 3HE7D 3BRDA 1WIPA 4OD1L 4XTRD 3ZYIA 3ARGB 4M7LT 1FL6B 4G8GE 4ZNEE 1ORSB 5DJZB 2BNQB 4UNUA 4XCFH 4M7JL 3VFSB 4GBXA 5DJ8A 3IFPA 1DVFD 5HHMD 1IGML 4QRPB 4M1CC 5DDHB 1T66D 5IQ7L 1MCIA 3KDMA 3VXQB 3WUWG 1OP5K 4GW4B 3PL6C 2DQGL 4OV5B 4MJID 4PJ5E 4RCAA 4DVBA 3G04B 3I75A 4TPRL 3G6DH 4KMLB 2AGJL 3F7QA 4GRMB 3S5LA 5FGBA 2I5YL 5DEFB 4POZC 3GSQB 5KBNC 1IGYA 1H5BA 2R2BA 2X4SB 4J4PD 5FXCH 1ZT1B 5IW1B 4AM0B 2BRRL 4IMLA 3MROB 1P7KB 2BNQE 1JYXA 3FHQA 4IDLA 2VAAB 1ZT7B 2OX5A 1BREA 4HXBL 1QD0A 4MS8C 5E9DD 1I7UB 2VXUL 4YDVA 4QRPE 1CR9L 3BD3A 1DUYB 5DJYB 1CICD 4AEHH 2O61B 4YR6B 4O00A 1A6TB 3HMXH 1JRHI 4AQOA 2J5LB 5AG8A 4HKBA 3MGOB 5I8CA 2VZ1A 4YXHH 4W68A 4XNZC 4P5KB 4CBPA 4U6YB 4KQ3H 4HJJH 1U93A 4WDIB 3JXAA 4WWKB 5HY9A 4MDJA 5GIRA 1DN0A 3CSPA 2FH8A 1WFNA 4JFFD 5TGBB 2IWGA 2NY0B 3MUY1 3QUYC 4PP2B 2EYSA 4OIIL 1UM6H 2VQ1B 2JIXA 1VPOL 1CGSL 2X4QA 4HUUB 1MAMH 2A6DA 1XGUB 1P7QD 3RNQB 4LSSL 1Y6KR 5C0GB 1MWAA 5IIEB 2Y25A 3OSKA 3MRFA 3LHPH 5SV4A 4F3FB 3ESVF 4QO1A 5FECA 1M71B 1QBLL 3PQYD 1RZ8A 2O5XH 5KW9H 1OD7A 1NGYA 3VWKA 3C8DA 1KCRH 1CGVA 1OGAB 3DRTA 4IRSD 1DDHA 1KXQE 3QDJA 4OTXH 3DVGB 3TT1L 1FNFA 4Y5XB 3WFDH 4M5ZH 4WFGE 5EO0A 1XFPA 1FO0H 1YY9C 3VGDA 5HVGB 4MA1B 1QLRA 3GM8A 1MFAL 4KJWC 1Y18B 1I1RA 2COQA 1BD2D 2ICEB 1C12B 3AAZA 2DYPA 3V6FB 5BQ7A 2RQ8A 4PLOB 2DKUA 4R0LC 1L6XA 3WO3B 3EDKA 5CEZH 3RWFB 1OGAE 3N1FC 1AHWA 2E7HA 2VLJD 5I66A 2VDML 5LWYH 1AGDA 3ZYJA 1SM3H 5F9WB 4WFHD 1MI5D 3OAZK 5FA3A 1W72B 4LKXB 3T77A 3DIFA 1F4YH 1WV7T 4KKBC 4PLKD 3LKPA 1AQKH 3AXLA 4ENEC 5DUPL 2AV7B 2WANA 3FAWA 2Q8BH 3P77A 5JQ6H 3FQUB 3HAEG 5D71L 3FQXB 3IFOB 2C1OB 2QADD 5GRJH 3B2VL 4JQIH 3RGVA 3L3KB 4QRRA 3EO0A 3MCKB 4K3EH 5D1ZD 2JB5H 2Q87A 2VUOA 4ORZC 1I1YA 4HX1B 3EYUH 4L4TB 2JF1A 1F97A 4PBXA 4F9PA 4PYGA 3MSPA 4M43L 3IFNH 3KLAA 4JAMB 3GSWB 1MLCB 2CKBA 1S8DB 1V7ML 2ED8A 3FTGA 1MRFL 4CJ1A 3UXFA 4GG6A 1SBBA 1QUNA 2XWJB 1UWXK 1FFPB 1HIMH 3MACL 1FP5A 3DVFA 3NCYS 1UVQA 1OM3L 4PRBA 1BQLL 2QSCH 3PXJA 5CBAB 4X80L 2N56A 1KCVH 3QEGH 3IYLW 3BYYA 4IEFB 1CICC 1DSFL 2OJZL 4Z7VF 1RK0A 3F58H 5EU7C 4L4TE 1S7SA 1X5GA 2QQNL 4PJHA 5C0DA 1D9KD 2F5BL 5C86A 1OL0A 4F8QA 3E6HA 1HDMA 5B8CC 4ODWA 1OY3B 5I1EH 3HCVA 2WAHA 1S9VA 4YK4B 3JVGA 1W0YT 1GC1H 2LTQC 2JCCF 2EIZB 5IF0B 1VFAB 2X41A 3V8OA 3C6LB 5JA9A 5JR1L 3PWPB 2V7NB 5JHDB 1U8JB 4XGZB 4YBLC 3DVNA 3F8UB 4I4WA 1K2DA 5E8OB 2A74A 1UG9A 4QRUB 2ZCKH 1UH3A 1QFOA 2BFVL 2GJZA 2JJTA 3B6SB 4W6XB 3VXUB 4HMCA 1NC4A 1LNUA 5HI5D 4NJAH 3TF7C 3BIKA 3AU1A 4HF5L 1A02N 2GSGA 3GMLB 3AUVA 2DQHL 1TJHH 3QFJE 1MFCH 5F7KC 1I7ZA 1R0AH 2YKLH 2VXSL 3SBWC 3VXSE 3W39B 1JN6B 3B83A 4UQ2A 3KLHC 1NGXB 4B53A 4OQ1A 2ZJSL 4EEEA 3LDBB 2BVUA 4G6JL 4GO6B 4GRLB 1JPST 4OBRA 3CFJA 4X8JB 4I2XE 5IGXL 3PWPE 4E5XB 5JHDE 4HSQA 3MJ9H 5SWQA 4J2XA 5BCAA 3V79C 4OIBA 4OI7A 4O2CA 3VXUE 3QWQB 4W4NA 4MXWL 1J8HA 1NBYA 1YY8A 3S34H 4JRXA 4MJ6B 2DQTL 3RUGF 1P5UA 3P0VL 4UIKL 2V2XB 4WV1C 4PJXB 1NCDH 5I1AA 5D2NB 2MMXA 4OQTL 2AJVL 1VESA 4BA8A 1RV6X 2X09A 1AC6A 5F7LB 3JZ7A 3DBXA 1G7HA 4R7DB 4P57A 3UZQA 3SCMA 2MKWA 4XVTL 1D7FA 1L4IA 3FHAA 1I1AA 1RUAH 4LPTA 1JYVA 4EJ1C 4G7VL 2Z91B 1UYWL 1CXEA 4U33A 2VSCA 3D85A 2BNUA 3QIUB 3IGAA 4PD4K 1KCLA 1BOGB 1NAMA 3EHBD 4AEIH 5D2NE 1R24B 1UA6L 2NXZD 1JF1A 1KPUB 4POUB 2CDFA 3VRJA 3STLB 1LEGA 2AJYL 2DLTA 3VG0L 1RHHA 2G75B 4XCNA 1MREL 3FN0L 5HI3C 1YYLL 3ETBF 2R0LH 2C3VA 2Y7QB 35C8H 5I1LA 3F7PC 3MRKB 3RWGA 5EU6A 3LV3A 3BZEA 3ZKSD 1AKJB 1DUZA 4OKDA 4CRPA 5F3BA 1OSZB 5CILH 3KPRD 3WIFB 4OM1L 2P8PA 2LU3A 4JM2D 4I18C 3IETA 1ZXQA 4LLYB 5IKCB 4RMWA 1RQ5A 2C4XA 1UEMA 1FE8H 5JLZA 2VE6B 1LE5A 2AJ3B 3I6KB 1Y6NR 4ZXBA 4X7SH 4YHMH 3C60D 5HHPB 3TVMC 2EIDA 5ABDE 1BHGA 3R8QA 3MO1B 2Z8VC 4BQCA 2D7QA 1KPRA 4KFZC 2PXYA 3GMMB 3KR3H 5H94A 3RWHB 3TIEA 2H9GA 5GJSL 4OCYH 5JXAL 4YE4H 2QQKL 2R39A 2CUHA 2PUQT 3T0XA 1MCKA 1OLZA 1U8NB 4YFLF 1T5WA 1OAUH 5JXED 4TTDC 1F6FB 1FNEA 4LNRB 3V6OE 5MI0B 5FM8A 4LHUA 1IAII 3KNBB 1BOYA 4NNYA 3EOTH 4U1GB 2ZSWA 4OF5A 4MMXC 3HI6L 3T04D 2L7UA 3K4DA 3L3IA 3BXNB 4NWUL 4X7TA 1YDPA 4HLZG 3N1GC 3BDYL 2OZ4H 1FG2A 3MRHA 4KRPC 4WCYL 2MHAB 1YEHH 1GAFH 2KL6A 4RAHA 3FB6A 2B1HH 4ISVA 1HSAB 5BJTB 4CMMB 1CCZA 4PY7B 4HHAA 3QEQE 3P4OA 5CGYD 1S7QA 5AYUH 4RGNC 2DQCL 2P8LA 1HK6A 4ODVL 2FJHA 2IPUK 5KSAA 3TPKA 4Z7VA 1GZQA 1JWMB 2X4PA 4ZFOA 3QB7C 1EO5A 2BNRA 4W81A 2GUOB 1BVZA 5GSVB 4LARL 3C8HA 1A6UL 3ULSB 1VFBA 4EN3B 5E6ZA 3VU2A 2R0WH 2M2DA 1IFHH 2NNAA 3TGXA 5CP7A 2JCCA 5FHAH 4F57L 5A3IC 4U1JB 5C08A 1AGBA 3TCXA 2VR4A 3QNYB 3U9UB 4HJGA 3WFEH 6FABL 3GSOA 4Q9QL 1WUNT 4KHTL 4PRAB 2NXZC 1B6UA 4L5FH 3HUJF 4OGXH 1N2RB 1NDGB 4NO2A 3GB7A 3WLBA 3CMGA 5JOFB 5K9JH 2YD1A 4M6OH 2J6EL 5J3HC 2CGRH 2W91A 3MRRB 2EECA 3ZE2E 4Q9RH 4PJGF 3VXOA 2XTJD 1XCQB 5D6CA 3IKKA 3UTSD 1NCTA 4PTUA 1MEXL 3BEWA 1UWEH 4DGYL 1ZE3C 4Z5RB 4OLWL 3NH7H 3MOAH 3EOBB 2EDYA 3ARFB 4H20L 2HLAB 3T1WA 4QTIH 3FFCA 3T4AB 3MCLL 4DZ8B 5FO9A 3LQAH 3DI3B 1FFOA 4I1NB 3FB5A 4R97B 4MAUH 1ONQB 3FB8A 4GJTB 4Z0BL 3EDEA 3RUGA 3JV6A 4NKIH 2R29H 4YEFA 5KSUB 1TVHB 4JZOB 4H25B 3ARDA 3E8UL 2NXYC 1MJUL 3C60C 4XNQB 4YDIH 5EU4A 4AH2B 3P0YL 5EWIH 1CLZH 4Y1AD 5E99H 3T0AA 1CFNA 5DVOA 4E41A 2APXA 5D72L 2EIEA 3JWDH 3V0WH 2EH7H 3HNTH 2FJFB 3BH9B 1J05A 1S9WA 4Z0XA 3VA6A 3DROB 4JFHD 4PJFB 3MQIA 5FK9A 5I1DA 2OMNA 3VJ6B 4XAWL 4R8WL 4BSWA 2PW2A 1GIGL 1XEDA 3SDDC 1IEAA 2ZOLB 1LEIB 5EZIH 3RZCB 3MRBB 2NX5A 5B3JF 4TRPH 1D5IH 4KU1A 4Q6IB 4X6DF 5HPOA 4O51A 1JNNL 1NUNB 1LDPL 5C07B 2FX8H 1IC4L 3CFCL 5IM7B 1C5CL 2DLFH 4LCYA 1UB6B 5DVLA 3TA3D 3OKNB 2DQFB 5EH1A 1KIRB 5DI8B 1QBML 2QSVA 3HC0A 3PP4L 5BO1H 4YGVA 3B8YA 4M7LL 3RDTD 2C3HA 4GAYB 4PJFE 5AWNH 3C5SB 2MKLC 3BE1L 5DSCB 3IU3A 1IRAY 3N85L 4JFDA 4J3UA 3V5DB 4HZLA 1U3HD 1IQDB 1K8IA 5T1LA 3SDAD 2B39A 5ESQA 4ZOCA 3GO1L 2VXQL 3E2HB 4IOFD 1CDIA 5C07E 3HRPA 1XGQA 4AIZB 2XY1A 5F9OH 3LIZH 2UY7A 4XB7A 3X3FH 2OYPA 2ORBL 3CFIC 2C26A 4KVNH 3OB0H 4KXZH 4R4NC 5FF6B 5LVEA 1S7VB 3G5ZB 4DUXA 4QHNB 4GH7B 4OCLC 3EYFA 3TPUA 2W0KA 3OPZL 4A6YH 4MNHA 2UZYB 1G9NH 1T1YB 3O3EB 3BN3B 4NPYA 4U1HB 1U0QA 1MFDL 2OL3B 3LOWA 4HQQL 5F93C 3FOMA 1S7RA 5I1JL 4RMVA 3P30H 4LPXA 1HHIA 2C3WA 4NYLB 4NWTL 2C1PA 5CMAA 3B9AA 3V2AR 4UQ3A 3IDMB 4GQPH 3ZE0F 4DVRL 1DBJL 3BPCA 3OAYK 4UDUA 1FV1B 5D7LD 4KK9D 3BDBA 4MHHI 5GRXG 5KOMC 2Y6SC 1G7IA 4KTYA 1I7RB 3GBNH 4YHOH 3B9KC 5HYJB 5D2LB 3IJHB 5DUBA 2Q6WA 1Q9LA 5FB8A 2VLKB 3TBYB 4KROB 1U8IA 1MFNA 4ODTL 2YWYA 3MNWB 1RFDL 1YNLH 3VFWB 1H8NA 1OHQA 3GSUA 4DN4L 3WNPA 3H7BA 3WN5A 4JZJC 2X9WA 3CC5A 4L3AA 4N0FA 4NNPL 4HIHB 4G6ML 1ZHLB 3OKOB 2C3GA 2VOTA 4P3DA 4TULL 1JFQH 5IB3B 2ZPKL 1BEYL 2HMID 4APQD 2BHZA 5D2LE 3CH1B 1CT8A 2WUCH 3IU4H 4M3JA 4ELKB 2VWEE 1JZ5A 1HHGA 4LSQL 3WJJA 5KN5B 1RK1A 2P48B 5GGUA 4K23H 4WO4A 4WW2F 4P23B 2VERN 3BWAA 3SGJA 4MQTB 1H3TA 3PL6A 4RZCA 5F44A 1TJIL 1Q9KA 1T1XB 4PRNA 3WNMA 3KXFB 3X14A 3DMMD 3DX8A 1OP3H 1LO0H 3FO2A 4K7PH 4QTHB 1T21A 3GM0A 3HUJA 2BSSA 3S35H 3FRUB 1A9EA 4BQ6A 4NC2B 4OFPA 1UADC 3BSZL 3EYVB 4XC3L 3C2AL 3L1OH 4WTZG 5DJ2B 2CK0H 4XHJC 5SX5H 4PJGA 2AEIT 3EJYD 4D94A 3LN9A 1JPGB 2ADIB 1A6VL 2CPCA 3L7FB 3GBMH 3Q6GH 3NFNB 3VFOB 2ERJB 4MHHG 4RISL 4MAYB 3C08L 3ZDYE 3RU8L 5F7HA 1T03L 2R1XA 3KXFE 1T2QL 2UWEB 3HE6B 1EMTL 1N7ML 2YPLD 1I7TA 3BISA 1LO5A 3BEVA 2Y07L 5C0CB 3D1MC 2J8UB 1CXHA 5GZOD 1KTDB 3JBG7 5SWSA 3ILQC 3QUYA 1CFQB 5FYKE 3TEUA 5DTFA 4FQCH 1R3JA 5ID0A 3CSYB 1DBAL 2FO4B 5JHLH 2FSEA 3NZHH 1K3IA 2N7BA 5CLTA 3RX8A 1JNHB 1F4XL 4NZJA 2C7UA 5I6XC 5H37H 3QDHA 2XN9B 2UWEE 4YIQB 3LEVH 5I1GL 5C0AA 1LO3L 1G7PA 1N5AB 3O4LB 4Z77A 5HGGS 1UCBL 2Y72A 1SMAA 4JPIA 5C0CE 1HOCA 2J8UE 1X5AA 1I9JL 4E0RB 1A64A 1MJJA 5C0BB 2UUDH 4ELMB 4HS8H 3VDAA 4EKXA 1ZHNA 2YD5A 1IGMH 4X6DA 3KLDA 5T33L 5GGRA 3VGGA 5IQ7H 3EOYG 2CR6A 2VL5A 1QSFB 2DIJA 2DQGH 5K59F 4GKZB 3HNVL 2AGJH 1I9RH 3HC3H 1W72L 3VWJC 5C09B 3WL9A 4OGYH 1GC1C 4NKQB 5J12C 5SWZA 5TH2B 1X5JA 3SDXF 2X4NB 5LXGH 3TC9A 3H9HA 3QXAB 2F54A 3OXSB 1CGUA 2ICWB 4MCYA 1AGEA 2CH8A 5C0BE 2WWKO 4ELME 5I30L 1IM9A 5FYJH 5FGRA 2CIIB 4FTVB 1DBMH 3D69B 1CR9H 4JO3L 5FOBB 1INEH 1JPSL 1QSFE 1A2YA 2A0LD 5CZXD 2HVJA 1AFVL 4UT9H 2ADFL 5T1KB 3HB3D 5BW7A 5KOVC 2OK0L 2IAMB 4G8GD 2IH1A 3TNNA 5C09E 4X99A 4DGIL 1U8HB 2Z35B 3PE9A 1OCWL 3GSNL 1JPFB 3EDDA 1O5DT 1D5MA 3H6JA 4XXDB 5FA4B 5IMMB 1S9YB 3ROLB 3ULVH 3MFFB 1ZHKB 2EE9A 4Q6YA 5JDSA 3C5ZD 3Q0HA 4HUXB 1HH9A 1OF2B 1K4DB 3R06B 4HWZA 1B0RA 4FTVE 1CGSH 3DMMC 4PJ5D 5T3ZE 4Y4KC 4ZFZB 2Q7YA 3VMNA 4LSSH 5JW4Q 1RZKL 3P40A 1MJ8L 3MRCB 4J4PA 4D9QE 4DKFL 4LAJH 4P46B 3G6AB 4URTB 4S2SB 3X12A 2YD4A 3TNMB 5CZVL 1IMHC 5I1CL 3HPJA 5HGDA 1DQDH 2DKMA 3VFTB 1KFAH 4ACPA 1IQWH 4ZTOH 2F5AH 3OXRB 5CSZB 5E9DA 2X1WL 4JN1L 1QR1A 3BAEH 4GQ9H 4ONHB 3REWA 4MMZC 1CICA 3MUGA 3WKML 3VFUB 2MQ3A 2DWDA 3TJHC 3C5JA 5EG6C 3RVUD 4QCIA 1KCUL 3WFHA 4TN9A 5F3HB 4AY0A 1ND0B 1J5OH 1XIWC 2HVKB 1FJ1A 3RAJH 1MFAH 1T5XB 3PGCB 1VADA 3VMPA 4Z7QE 4CU7A 4WEBH 2IEPA 2IALA 3X3GL 3OKMA 3RKPA 4JFFA 5ACZB 1IARB 3BFOA 4UTBL 3P4NB 4H1LH 1I8IB 3MLVH 3HLAA 3GMPB 4N9GA 5GRYA 5MEOB 4NKOA 1N64L 2QQQA 4WHYG 5ERWB 3MZGB 5CWSA 3QUZB 4LSTH 1MQ8A 4K7FB 3D9AH 4M61A 5TDPB 3ECBB 2RGSA 3AY4C 2DJUA 5FKAA 1LO2L 4JFEB 1PZUB 4LLVB 1QSVA 1AJ7H 1PD6A 4HFWB 4FQXB 4YWGH 2VDKL 4WW2A 5ID1A 3SBWA 5ILTL 1I3RA 2NY6B 5C0IB 3KPQB 5EN2B 3B2VH 2X6MA 5L0QC 2XZCH 1ERNA 3L7EB 3O8XD 3RPIA 4QY8B 1OVZA 1JI1A 4WFGD 2OBGA 3BKMH 5C0JB 5MEPA 3UPRA 5HGBA 1NLBL 4X7DC 2I24N 4XNYH 5HSFA 3KJ4C 4QXTA 1A7QL 4NQCB 2AEQL 43CAB 3LCYA 5D7JB 4JFEE 1MRFH 1MELA 5C9KA 5DA0B 3UYPA 3VI4F 2AJXL 1C7SA 3T0ED 5CHNA 2Y5EA 3PIQB 3N06B 1LEKA 2VLJA 4FFZH 4ZUTB 3MACH 4Z95L 4LVOC 1BQLH 4BYHA 2RFXB 1NEZA 3IDIB 5GGRY 4LVHB 4X4MA 3T0DA 3LKSA 1DQQA 4NZRL 1P2CB 4LSPL 2MPAL 1KC5H 1X4ZA 1I8LA 1MRCL 1INQA 2OJZH 2QKIA 1FZKB 2YXFA 4P4RB 1QLEH 2QQNH 2VDOL 2ID5A 5D1XB 4NQCE 5F7DB 3C9NB 1R3IL 2AK1H 1KB5B 3BO8B 3AREB 4JY6A 1CS6A 2XACC 3QI9B 5D1ZA 1A6WH 1NKOA 5EUOF 2PKDA 3UMTA 3QIWB 2HAZA 1B88A 3MLUH 3SGKC 3DPBA 1IEBB 3W0WB 5I71B 4P5TD 4EDXB 5JR1H 5HHOA 2KPNA 3A6BH 1F58L 4X6EB 3KWWA 1TFHA 3P73B 5I76B 4QOKB 4DQOL 3NFSL 2EH8L 2BFVH 1KYOK 1OT1A 3AB0C 2Q20A 4ZFGH 1LP9F 3MOBL 3ARGC 4PGDB 4OT1L 1YEGL 3IDUA 3TJEL 1UKQA 2H2PC 5IOPB 1B0GA 1ZGLP 3P4MB 2X70B 2JJVA 2LVEA 5GGVY 1LD9A 3Q48A 4JHAL 2ZJSH 3QG7L 2P8MA 4OLUL 5EC2A 3HI5H 4CN1A 2CDGA 1KEGL 3W0WE 3RIAK 3RVUC 3K8KA 5IB4A 4EUPA 3CAFA 1YEDB 4GW5B 3SDXA 1ZKAA 4OZ4B 1QNZL 1WLHA 2FJGB 4N5EC 5KAQF 4HK0A 1KLGB 4W4OC 5L2KE 3IKCA 5ETUA 2OJEA 2H2SC 4HK3J 4YHLL 4NHUB 3P0VH 3J8F7 2IMMA 3RWEA 3BN9C 1RURH 2AJVH 3ZSTA 1F3DJ 3VD9A 3P9LB 5CJOL 3WNKA 1C1EL 1CE6A 2E8ZA 3D39D 1QO3B 4NN7B 4X4XB 1ZLWK 3MLRH 3O3DB 3HZYA 2EICA 2IFFH 4LSRL 3ZL4H 1T7YA 3BKCL 2XFXB 1U9KA 2J5LC 4I5BA 4XVTH 2A9NH 1A6PA 3UROR 2E6JA 1WVZA 3ULUH 1K4CA 4OSUL 5MEND 4X0KA 3Q6FA 1UYWH 3QFJD 2P42B 3GI8L 1T20A 4Y16B 3VXSD 3G5VA 4NNXA 2HT2D 1X5KA 4WWKC 1BZ9B 1T22B 2R8SL 4NC1C 2E27H 5HXMA 3DURA 2NY0C 3CK0L 4TSBH 1UA6H 4UTAH 4X5XB 1V7NH 3FCTB 5JHDD 2B4CL 4HUMB 1X7QB 5DHXB 5TQ2H 4KK5D 3VXUD 2AJYH 3VG0H 3NA9L 2GJJA 2GCYB 4QNPE 4ZAKD 1CBVL 2MJWA 3FN0H 1YYLH 1LVEA 1F45A 1H8SA 5EBWA 4XI5C 3JWDC 3UC0H 1HSBB 1IGJA 4OCRL 1ETZB 5LGJB 4CVXA 3H9ZA 3BP6B 4V2BA 3S4SG 4YDJB 1I1FA 1S78D 4OZFA 4Y5XC 3TM6A 1EGJH 1FZMB 2VZ3A 1OT2A 4GAJH 4IJ3B 4RDQG 2E6PA 4U6XB 2CMRL 1DZBA 3P9WB 2F8VA 1KIPA 3UBXA 2VLRA 4U1MA 1I3GL 4JDVB 4HS6B 1C16A 4JRXE 1G7LA 3ESUF 1U8MB 2IH3A 4X8XA 1Q0YL 3MYJA 4I8DA 2P4AB 2BOCA 1IZJA 1HYSC 2AJUL 5M95B 2EYRA 1CL7H 5IQ9A 4ETQA 3OKEB 4NO3A 5F9WC 4WNQB 4G80B 5JXAH 3TCLA 1EEZB 5E2TL 4TUKL 5FDWB 2DTSA 5IV2B 2GI7A 4LSDA 1ZHBB 3QZWA 1U8PA 4HH8A 3PHSA 1N3NB 3KHQA 5DRNB 1LE9A 4OB5H 3RTQB 3QIUD 3KPRA 1WBZB 1JHTB 3AFLA 4LLDA 1S7TA 5HD8C 1NDMB 3KAAA 1FDLL 1TDQA 2HFFA 3HMWL 5CINL 1M7DA 3UJTH 2K7QA 1QHOA 5BZDA 1SYSB 3WUWB 4NSKB 2FGZA 4KVCL 2UYLA 3HI6H 1J18A 4OLYH 2V5MA 1QKZL 5EORL 3EOAB 3PDOB 5SX4I 1BM3L 3C60A 3ZDXF 4RX4D 4NQEB 3FQWB 1G9NC 2D0HA 1BZ7A 4WCYH 4H0HB 4M48H 1CTOA 1PFCA 1F42A 1ACYH 1G9ML 3LSOB 2QV2A 1T89C 3HS0A 4WEMB 5DHVB 4P2OB 3CVIL 3NCBB 1AKJD 4PR5B 4ODVH 1XR8B 4I48A 5IFHH 1FN4B 2JE8A 1LWRA 5HVHB 3VG9B 2ESVB 3I3EA 3MC0A 2FIRT 2IBGA 4LARH 4NRXB 5DC0A 3IDJB 1A6UH 1GGCL 5JXEA 3V5HA 4OFVA 3QUXD 5FO7A 1EERB 3L6FB 3V4VL 3F6IA 1IC7L 3K4ZA 1PSKL 3ABZA 4NQEE 3QO1A 4MD4B 1YEJL 4FP8L 5C1MB 4RSVA 5F9JA 1I4FA 1AR1D 2HT2C 1GPOH 4F7TB 6FABH 2Y4SA 1KOAA 1GGUA 1XH3A 4Q9QH 4IMKA 3QXVA 4KHTH 4C4KT 4XX1G 2VXVL 1BMGA 4Z7OE 3C6LC 4PJ9B 3H0TA 5DMYA 5BVJA 3QIBC 1NGQH 1PEWA 3REVA 1RUPL 3MR9B 4Z78A 1X5FA 1LP9A 2GK0B 2ESVE 1OTUC 2QQLH 4FRWA 1H3XA 1I8KA 1R3LB 2XWBA 1BECA 4K94L 3WD5H 2J6EH 2BSRB 5TDNA 3MRGA 1G1CA 3QEQD 1T1ZB 3TFKC 2IC2A 4B50A 1QG3A 1U8KA 3S37X 2IG2L 1J1XL 1RJZA 3T3MF 3HR5A 4S1DC 3FOLB 4YPGA 4DGYH 3SN6N 3FRPA 3MRNB 3LZFL 3ME0A 4GKSA 3LEYH 4PJBF 2OL3L 4GRLC 5EU3B 3EJZD 4X9HA 4YZFE 4FFWD 4QKXB 2ED9A 5D1QB 1SMOA 4YXLL 3U1SL 2F53B 3GMOA 4KMTL 3F6LA 1BGXL 2JK5B 5EBLA 1G9EA 2CJUL 1SY6L 2EDHA 5C2BL 1MNUL 3P0YH 5E03A 5E7BA 2ZUQB 4Z7UF 1C08A 4NC0B 3CH8A 5E5MA 3U0PA 4NIKB 1KN4H 4PJ8B 4UDTA 3NTCH 3RVVD 2ICCA 2PO6B 4RIRA 3MREB 5FUZL 4XMKL 4ZTPH 4PV9A 2HJFB 4LCIH 1KCSL 4Y2OA 2H32B 4QRSB 3V4PL 5D7IB 1RIVH 3RA7L 3UTSA 1FNGB 2F53E 4OQTA 3OR6A 4NZTH 3HAEB 1F6AB 1XF4A 4QHLB 4KWUA 1A7PL 1U6AL 3QFDA 2NY2B 4XNUL 4M93C 1IC4H 5DLML 4U6HA 1Q94A 1C5CH 3TWCL 4PJAF 1VACB 1NCCL 4O2EA 3TN0D 5DD1L 1R6VA 2DDQL 1LO4H 4HWEH 3PP4H 5DQDH 2A6KA 3MRPB 5B4MC 1IBGL 1WZ1H 1KELH 2ZWLT 3FO1A 3CLEL 3MJ8B 3VFGH 1RUQH 3FONA 4JFXA 3ARTA 5ITFA 3IXTA 5C7XH 3H3KA 1WWAX 5D7IE 3K8LA 2QLVB 4Y1AA 3U7YL 3VRLF 1B90A 2YPVH 5F1NA 4KTEH 2YZ8A 5MP6L 4I13B 3GO1H 1FIGL 3BP7A 1NGZB 2ATPB 3B2UD 3U36A 5BZWB 3UAJD 1KSRA 4HUKB 3JSSA 3QEHA 1TCRA 1S7UB 3VMOA 1IGCH 1U91B 2ORBH 5FYKL 1DQML 4R3SA 2R23B 4KI1A 4NJ9L 2Z92B 4O4YH 3KPOA 3BRFA 3CUPA 1AH1A 4D9LL 1A1MA 3HZMA 5EC1A 5JMOC 1N8ZB 4EI5B 4EDWL 3PV6A 1EJOL 4P2RD 3V6OC 1X5ZA 3OPZH 3UTQB 3AMKA 4FXKB 3S88L 3P3YA 1F11A 2R4RH 5E8EB 4O58L 1MFDH 5IHBA 4HQQH 5I1JH 1F3RB 3DXAB 4P2QA 3RDTA 4JLRA 3MRMB 2P49B 1DLFL 1MCFA 2VDLH 5E2UH 3PP3K 1MHCA 1JWUA 3EGSB 1O7VA 4GRWF 1MUJA 1DN2A 2X4UA 1U3HA 4G42A 3Q3GB 1T0PB 1FAIL 5CBEB 5KG9A 5ADOH 3SDAA 1M6OB 4RMQA 2DMBA 2P5EB 1CDHA 4WI7A 5IW6B 2P45B 4I3SL 3CZJA 4LDLB 1RZJC 4FFYL 5KVDH 5MI0C 1BJ1H 3ET9F 5KZCD 4Y88A 1BIHA 5C07D 3OV6A 3FFDA 5ISZB 3T08A 2EC8A 2EDNA 2J1KA 2PR4H 4YGAB 5DMJB 3BGMA 4U1GC 1TQCB 3ULVC 2CR3A 3DXAE 3LAFA 3O6ML 1RFDH 3OAUH 5HHVL 1MCWW 5IMKB 4N0CD 3PWVA 3T2OA 3WDHA 4DN4H 2R1YA 4NRZA 5T1MB 2SEBB 1BX2A 4KXZI 4C59B 3VXTB 4NNPH 4AENA 4X9BA 1QA9B 4OCXL 5B21A 2X1XR 5H2BA 5EBMB 2ZPKH 2E9IA 4ZUVA 3N50A 5L2JA 5K9OA 5CEXA 5E8DL 5D9SA 4P0DA 1EZVX 1MHPH 1B9ZA 4R2GB 3LMJL 1KPVA 3I02B 2VQTA 4NUJB 4DAGL 4YAQA 1YC7A 3D3VD 5FGCE 3VE0A 4YHKH 3QRGL 1YNKH 3BUTA 5KVMC 2CLVA 4EN3C 1L0YA 4ZUWA 2HH0L 2X4TA 5D7LA 3WIHL 5F9DC 3MXVL 1TJIH 3STZB 2VSDA 2CLRA 1X4XA 5T3ZL 5J1TC 5HHQB 1BQHG 3O11A 2W07A 4Y19B 3SY0B 1EFQA 1RSFA 4G9FA 2V2TB 1GJIA 2OTWA 4P48A 5C2UB 1FVEA 2KDGA 3TBTA 4U7KA 5JW4N 3X13A 3C2AH 2PTTB 2PW1B 4PLJC 4C83B 4MJ4A 1A6VH 4LIQL 3VXNA 4RISH 5TE7L 3C08H 2E7LA 3T4YA 3RU8H 4C56B 4JVUA 1NCAH 3G5XA 4JFQA 4BH8B 4PJBA 4APQA 1EMTH 3QP3A 3FO0L 1IGFL 7FABL 2Y07H 3ARFC 5A43C 4L1DA 3T65A 5I15L 4XWOD 2WBJC 4OM0L 1KV3A 4XCCH 5AUMB 4N8VA 5CD5D 2ADJA 2ZKHL 3OHXA 5KVFL 1SEBB 4M5YL 4R97C 2FECL 2Z31B 2BVEA 1FPTL 5GRVK 5IEKB 3DMMA 4NHCL 4Y4KA 3RPKA 5HVFB 1YEFH 3HI1B 5DJ6B 4LLWB 2BOBA 4X7EC 2FB4L 1V3JA 5JZ7D 5M7QA 4Z7UA 3MA7B 5LGHL 1CIUA 1TPXB 4C56E 3KPSB 4OCWL 4ODSL 4G43B 2ZUSA 1I3UA 4NO0B 1GYAA 2XG5A 3UJJH 4GW1B 4Z76B 4JJ5B 2FHBA 5E94B 4P99A 5IK3A 3LKOA 4R4BA 2OI9B 3RVWD 5IMLB 1A14L 5DMGD 1J0KA 1QR4A 4P23D 4L8DA 4FXGA 1VGKB 3AM8A 2ATKB 3RWJA 2Z93B 4Y4HB 3RZCC 3VFRA 2YPLA 3QHFL 4LCWA 4HBQA 1JHLL 4OLZL 3B5TA 4Q6IC 2DI8A 4M6AA 1Q72L 1MPAL 4PJAA 3TIDA 3O6LL 4HIJB 4HKJB 2NW2A 4XNZB 2VR5A 1BBDL 1Z5LB 2WV3A 3DV6A 2FX7L 1P1ZA 1MWAL 2G2RA 4UU9A 3W82A 2E5EA 3BKJH 1YECL 5FYKD 5DMKA 3SKOB 4RRPG 1NMBH 2IBZY 2AXGB 1OTTD 4OLXL 5F88B 1QACA 3H8NA 5F97E 3GJFB 4JREB 4JO3H 4PYHA 4TNWK 1JPSH 3MLSH 2R2HA 4TUJA 3HE6D 2OP4L 3NBNA 4JPKL 3PGDB 3K3QA 2YRLA 3E2HC 1HHKA 2OK0H 2NYYD 1PEZA 1DEEB 4DGIH 2ADGB 4JQVC 5C0CD 1AXTL 1OCWH 5J57B 4PY8J 3GSNH 3CFEB 1CGTA 3VCLB 5BV7H 4LRIC 3MV8B 4Q58C 1FRGH 2GAZA 2P1YA 4G6AC 4ZDHA 3SO5A 3LY6A 1OP9A 4JR9L 3EYQC 5EOCJ 5AAMA 2V2WB 5BRZA 5EB9A 4JDZA 1AE6L 1ZANL 3KPMA 4WHTB 1HYRC 4YO0A 1NC2B 4X6CA 2LU4A 3SEPA 3WFCL 5CEYA 2G5RA 1U2CA 1TXKA 5EU5A 1SJVA 4PV8A 1MJ8H 4X6FB 1CXKA 4H8WL 5DHYB 4DKFH 4R26H 4R0LB 2LFGA 5CZVH 4F7PA 5C0AE 3S37L 4QRQA 2YPKB 5I1CH 3RQ3A 3RWCA 5TPWL 5C0BD 1HILB 1YEEH 3Q5TA 3MV8E 4G9DA 4LOUC 3I6GA 1B4JH 2O5ZL 4U1NB 1ED3A 1HCVA 1TVBA 3WKMH 4I0PB 2P7TB 1QQDA 2YRZA 3P9MA 1EFXB 4F7CA 1QSFD 1RJYB 2IFGA 3U6RA 4NN6B 2WUBL 3ULUC 4G8GA 5INCB 4ZNEA 4FQLL 1NGWB 2Y5TB 4LVNB 5F96H 5JPNA 2Q8AL 2YD9A 2EIBA 4N0YH 4U3CA 1NMAL 1EXUB 4KROC 1CK0L 3EZJB 3T0WA 5DC4B 1E27B 4L4JA 4L29A 1QSEB 4LQFL 1KJ3H 3C5ZA 4FQHB 4PJ7B 5I16B 3SGKA 4WY7L 3H9SB 4LK4A 1G6VK 4UTBH 4NOFA 5E8PA 5TE6L 3F7RA 1P84J 4PJ5A 1KBGH 2DMKA 4BSVB 4FTVD 3BP4B 1KIUA 4KMQA 2IPTH 1CQKA 1IL1B 3CDGB 5FM4A 3O6FB 4HDIB 2E3VA 3MLZL 1ZLUH 4D9QD 3ARGA 1K8DA 2XV6B 4V1DB 5H37G 1FL6A 1U58B 1LO2H 5BOPA 1ORSA 5DJZA 1WISA 2BNQA 3UYRL 2IAMD 4IRJB 3VFSA 3U82B 2DICA 4JRYB 4U6VL 4XRCB 5E95B 1MLBB 5F8RC 4QRPA 1QSEE 1YJDL 4JO4H 1U92A 4PJ7E 3VXQA 4GBXD 4Y89A 1WSST 4P23C 4MXQD 1XGPB 1MCLA 1TNMA 3NAAL 5D6DC 4OV5A 4L3EB 1YPZB 4DKDC 2AJSL 4WJ5B 1CYGA 3MGTB 3QG6B 3DJ9A 5DEFA 4N5UA 1PKQB 1WICA 2NY7L 3GSQA 4W4OA 2QTEA 3TZVB 2X4SA 5I0DA 1H3PH 4CU6A 5AAWA 1ZT1A 4V1DE 5IW1A 4AM0A 1XCTB 3MROA 3QCVH 1P7KA 1XR9B 3CFKB 1K9TA 3G6JB 2VAAA 4JRYE 3HA0A 4UUJB 2A9MH 1VEOA 4M6MH 4XP4L 1I7UA 2VLLA 3PNWB 1DUYA 5DJYA 5EOTA 5GS3A 3I9GL 4UAOB 5JW5B 2O61A 1O0VA 3QQ3B 2H41A 1KN2H 4YR6A 3S98A 1A6TA 2ERJC 4YFDB 4MAYC 3JUZA 4LCUB 5E0QA 1YPZE 5EU7E 2W65B 3KYKL 1MRCH 1P9MC 3MGOA 4OJFL 5EA0L 4P5KA 4PJIB 1PKQE 4U6YA 2J4WH 5HHNA 1UJ3C 4RMUA 2D7MA 4MDIB 4Y5YB 1OSPL 4DW2H 4WDIA 5TGBA 2XTLA 3OG6B 1JWSB 4E42A 4PP2A 3G6JE 1G1YA 3GI9L 4NZUH 2VQ1A 5FFLA 1RJLB 4ZUSB 4HUUA 4KV5E 1N6UA 2X7LB 1XGUA 1KACB 1ZWIB 5DC9B 2VC2H 3RNQA 3QH3B 5C0GA 3QUZD 5IIEA 3DX9B 5JO5B 3ARZA 4RBPH 4F3FA 2FBJH 1M71A 2EDXA 4DQOH 2HFTA 1NCBL 2X40A 5LGKA 4S11A 1KT2B 4CDGC 4FQXD 1OGAA 4U6TA 4OT1H 4WV1B 4MD5A 4NQXA 4JFYA 2FYYB 4J8RB 3L3JB 3DVGA 4M62L 3VWKD 1MH5B 3OKDB 4P3CL 4Y5XA 3SE4C 4JHAH 3QG7H 1NAML 3N0PB 3QNXB 1EUUA 1KEGH 1D5BB 3QQ4B 1Y18A 3FQRB 4DZBB 5IHUL 2ICEA 1C12A 1OB1B 1QSZA 4FA8A 3V6FA 3SHSA 4RAVB 1F8TH 2A6IB 3MNVB 1QNZH 3TT3L 4AIXA 5HYSG 1I3VA 4HULB 2HTLC 4QHUB 1NFDB 3RWFA 2CUIA 5DURB 1A5FH 5DMIH 4ERSL 3ROOA 4H1LG 4UV4H 3MBED 3V4UH 1T04B 1ZVSB 3CSBA 1X5YA 3PF2A 1C1EH 1W72A 4FG6C 3EDJA 2AV7A 5GGQL 3RL1A 5EZOL 5JOPE 3EZ8A 4MXVE 3BKCH 5J56B 4HEME 3FQUA 5D1XD 1KJMA 5DJCB 4HJ0D 5CKGA 1JNLH 4OSUH 3GK8L 3L3KA 3MCKA 1NFDE 2BVTA 4N9OB 4XP5L 3UYOD 4F2MB 3L95A 1GGYA 4MA7H 4XZUB 3RGVD 2NCMA 2HWZH 3GHEH 4HX1A 4L4TA 1XAUA 3CK0H 3W0WD 2XZZA 4I18B 1I75A 4PY8I 3FQNB 2B4CH 1ORQB 4PTTA 4JAMA 1MLCA 1S8DA 2QHRH 4GXVH 1JYWA 1M7IB 4UILL 5L2KD 4P46C 2XWJA 3TVMB 1FFPA 5FV2A 1CDUA 3QCUL 2O5YL 2OM5A 4NQDB 4NRYB 3T3PE 2BX5A 4B0MM 5CBAA 1MOEA 5IBTH 4DFIA 3VXRB 4QYOB 4XNMB 4LSVH 4ZS7H 3IS1X 1UH2A 3TESA 5A2FA 1H15B 3QWRA 5HGHA 2EYSB 2CMRH 4RWYL 3GNMH 3QFJA 1MIEL 4GAFB 4LMQI 4EXKA 1S9KC 4UINL 4X5LA 4M8VA 3VXSA 3W11C 3ZE2F 2HT4D 3BQUB 4U31A 2XZAL 5IF0A 1VFAA 4LAQL 4I2XA 4NQDE 4UV7L 2OTPA 3IJYB 3PWPA 5JHDA 1U8JA 3WXVH 4XGZA 3O2DL 3PHOA 3VXRE 3VRIB 5FGSA 3VD7A 5E8OA 1MY7A 1NGYB 4QRUA 1F90L 2LQRA 3B6SA 3VXUA 4W6WB 3CU7A 4KPHL 4XH2B 3FRPG 1QRNB 4HGMA 3H2WA 4TUKH 3QDJB 4QF1B 1E4KC 3WIIH 1MCOL 3GMLA 5JW3L 2UVEA 1CDBA 1CDYA 4FQXC 4PUBL 5KAQG 5FYLH 2H1PH 2ILLA 5IWLA 3W39A 1JN6A 2NY6C 2BCKB 4KKCD 1NGXA 2W0FB 4UT7L 5TQ0L 3ZKMC 1IKNC 4X8JA 2DYPB 5FUOH 2JKXA 4E5XA 2F8XC 4AZ8A 4HV8B 1CLYL 1SJXA 1B6DA 3RHWK 2FIKB 4MJ6A 1QRNE 5I66B 1XGRB 3CVHB 3WLWC 5D7JC 3EFFB 1DBKL 1J8HD 1F00I 4JRXD 3M8OH 5D2NA 4CJ0A 1G9MH 4FNLL 1QLFB 4Y4FB 3AXLB 2E8YA 3IS0X 4U7SA 3LN5A 15C8L 3GJFK 4LNVA 4R7DA 3FB7B 3QDMB 4K3DL 1H0DA 3BHBA 2QBWA 2WWMD 4XPBL 4PJFF 1CL7I 2Z91A 1ADQH 5DEGB 3QIUA 3A6CL 2YD7A 4JPVH 5CUSH 1BOGA 3QUMB 3AREC 2EZ0C 2BDNL 4FMFA 3D85D 3MOQA 3QI9C 3PWUB 3QIWC 1Z6JT 3ES6A 3T0VA 3BRGC 4NBXB 3MV7E 1KPUA 5CKAA 3SDCC 1L7TL 1G7JA 5CD3B 5I71C 2Q76A 1QFHA 3IAQA 1L6ZA 4YHNB 3NCJL 1CD8A 2EDTA 2APWA 4RX4A 4CW1B 3KPLB 2Y7QA 4K8RL 4K94H 8FABB 3MRKA 2DQIL 1AKJA 5L9DL 4LKCB 1OSZA 4ODHH 4ZUUB 3WIFA 3LS4L 3DECA 2HG5B 4X6BB 5H8DA 1HDMB 1MCDA 4HWUA 5DK0B 2Y23A 3HCVB 3LKQB 4LLYA 5IKCA 3QA3A 5DQ9B 3U46B 5C0ND 3ZT5A 2GJ6B 5A2JH 3EFDL 5I1HL 1HCFX 3MA9H 2VE6A 4I77H 4R7NA 2AJ3A 3I6KA 3V6OA 4YXLH 2CQVA 1VENA 1TZGH 5JMRA 4KMTH 1EV2E 2AK4B 1L7IL 3MO1A 3QXWA 1K2DB 4FQ2L 4TSCH 5DFWH 4MQXC 4C55A 3UDWA 2IF7A 3LVEA 2CJUH 4JG0L 1SY6H 3RWHA 1EDQA 3M17B 1MNUH 3PV7A 5ELIA 1NC4B 4ZFFB 3E6FB 2ZOKB 5DJXB 2PXYD 4JCLA 3AU1B 1Z9LA 1YMME 3L5XH 4NN7C 1IGTA 4MX7B 1I7ZB 5I17B 4KJPD 1U8NA 1CFVL 2GJ6E 4AL8H 1RIUL 2HTKD 1LK2B 5B38G 1UKTA 3QEQA 4PG2C 4LNRA 3N9GL 4NUGL 3CFJB 5DK3A 3CX5K 4KZDL 5D70L 1IAIH 1BF8A 4BM7A 5SWQB 2AK4E 1RUKH 3DRQB 1BIIB 3KNBA 1IAKB 3OR7B 4Y16C 2NR6D 3RIAF 2F74A 4XNUH 1NBYB 5D2LF 3FZUC 3BXNA 1T0MB 1GOFA 4TQEH 3TWCH 1NCCH 3SE8H 4PJ9D 2BC4A 5KANG 3QT2A 5DD1H 4PJEB 2WP3O 3D0LB 5I8OH 1IBGH 2W60B 3GHBL 4TVPE 4UIMB 2MHAA 3CLEH 3U2SB 5GRUH 5L88H 1HSAA 5BJTA 4PY7A 1EVTC 5GSRB 1OAXL 4LEOA 2PYFB 2EDWA 2VRAA 5C92A 1CGWA 4LLUB 2ZCHH 3QHZL 5T5FL 2GUOA 3WNOA 3ZKNC 3QULB 4KY1L 5GSVA 1ZA6A 5KSAD 3S97C 2R0KH 1J9CT 1U8LB 3ULSA 3SDYL 3GMRB 4Q74A 1UWGL 5EO1B 3NCMA 4EN3A 4N8PA 1RUML 4PJEE 3MZTA 4IJ3C 2XNAB 1CFSB 2XQBL 1D6EB 4U1JA 5GJTH 2F53D 4KRLB 4TNVK 1I1CA 4QXGL 4D9LH 3QNYA