1ZT1B

Crystal structure of class i mhc h-2kk in complex with an octapeptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
QKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The H-2Kk MHC Peptide-Binding Groove Anchors the Backbone of an Octameric Antigenic Peptide in an Unprecedented Mode
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-K alpha chain
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zt1B00
3BHBA 3ARBD 1EGJA 4OF6A 1ZS8A 1MRCH 2XA8H 2XG5A 3VMPA 1I4FA 1FGNH 3OKNB 4OQTH 4EVNA 1A7NH 4Z7VE 5J6HB 5HDQL 4PJ5D 1QFPA 4NZJA 4HXAL 2ILLA 1BZ9B 3L5JA 1U6AH 4S0TD 2C3GA 5TH2B 3W0WB 4S10A 1KBGH 1DBAL 1QRND 1MFBH 4AENB 4E41E 4NNYB 4FABL 3LZFL 3T3MF 2VDOL 1NC2D 4YIQB 2AV7A 1BQHA 5L9DL 4K2UH 4H88H 2FX7H 2HT4D 2NY3D 3N1QC 1QHOA 2H2SD 4DN3H 1MWAB 3F5WA 2BCKA 1OOAA 4NRZB 5FGSA 1MRDH 2BC4A 3I2CH 3UJIL 4HHAA 4BKLB 4KRPC 4IHOB 3UTQA 1A3QA 4F37F 3GBLA 4M1GH 4OLXH 4KXZI 2R4SH 3MUHL 4ETQA 2YPLD 1ZWIB 3I50H 43CAA 3TN0D 3KYOA 1OTSD 1EO8H 3B6SB 3IXAB 3U30C 1JV5A 4JDZB 1BVLB 3G6DH 4WGVB 4IS6B 4UT6L 4HBCH 3AREA 5HHOB 2VLLB 1I3RB 2D7NA 3CH1A 2PO6C 4PJIF 1KULA 5HGDA 2YD4A 3O2WL 5E8EA 3SJVD 4NBZB 4P3DA 3PQYE 1NFDE 5IQ9A 2EEDA 3G6AB 3L7EB 2CLVB 3RWFA 1C16B 1OAUH 2NQCA 3AM8C 4KKAC 5DMGD 1JNHB 4EJ1C 3DHMA 1PY9A 1MAMH 3F62A 3R06A 2ZCHH 3S4SG 1KLGB 1JTOA 4PV8B 1Z0MA 3MRLA 4WNQA 2R23B 4MD4B 1RIHL 5FKPB 2E8YA 3RZCD 5CKGA 3HPLB 5JIIA 4PJ7F 4L3AA 1LHZA 1KIPA 2GUOB 1G7IA 3G6JB 5C6TH 5I8CA 4KQ4H 5GGUA 1KC5L 3BIBX 3MV8A 3TNNA 2VB5A 4O4YL 3F12A 2F8XC 4X6FB 3IJYB 4YGAB 5C0IB 3SEPA 2OQJB 2UV3A 3H2WA 4OIIH 4PJ9A 3RJDA 4GMTL 4CMMA 2AJUL 2I25N 4IIQB 3IKCA 3ESUF 4UINH 4UQ2A 4B53A 5KSBE 2PYED 4LU5L 2IBZY 4PG9A 4PJEA 1NFKA 1UM5H 4QTHA 1AI1L 4FXGB 5EORH 3OGCA 5HHXL 1IL1A 4UIKH 3BKJL 3BH9A 3B8YA 3ARQA 1U3HA 4F9PA 1LVEA 3O3AB 1D5ZB 1NAMB 4Y5XC 5D7JA 5T3ZL 2W59A 4HWEH 1QR1B 3G5ZB 1BEYH 1BVKA 3MRNB 4LCYA 5GRUH 1LEIB 4OZGE 5FOBA 3D1MC 4M5YL 3SDDC 1E28A 3EHBD 3V0AC 4ENEC 1E4XI 5IHBA 4LLUA 1I9IH 3TZVB 4XCNB 3V7AE 3JWDC 1VDGA 3C6SA 5EO0B 1HSBB 3V9FA 5D2NB 4DN4H 2Y7QB 3O8XB 2EYSB 2J6EL 3QH3B 1F90L 1YC8A 3MRQB 3MV9E 1S7QA 3RZCC 1FFQA 4P9MH 1T21B 2MMXA 4ELMB 4XRCA 1QD0A 4D0BA 5HYEA 4X4XB 2YUVA 3SJVA 1MHEB 5F9OL 3QISA 1IC5H 5FGRA 5EG6C 1AGBB 4NN5B 1BZ9A 3SDDB 3IJYA 2ZNWA 4QF1B 3DVGA 5ID0B 1NC4D 3RVTC 3FB5B 5EPMB 2DWDA 2OL3L 1CFTA 4G9FA 5DUBA 3VFUA 2O5XL 5IIEB 4OBSA 1CE1L 1MH5B 1RJYA 3OF6D 2VN4A 3MC0A 3C2SA 2H2SC 3SE3A 4MA8H 4H1LH 5DA4A 2OXHA 4X4ZA 2CUMA 3STZB 1P5VA 5MP6L 2QSQA 5LVEA 3WNLA 3QEGL 2OZ4A 3S35X 4EN3C 4JFDA 2VISB 3MJ9L 3VXPA 4GG6B 4G6KL 4OF0A 3O6KH 4YHKH 5IF0B 1AJ7L 2IAND 2YA0A 2V2TA 4P23D 1EO7A 3SKJH 4U6VH 3TA3A 2E7LA 4XPAL 1YN7B 3NCJH 5F9AC 1BAFH 2MCG1 3B9KD 5LGKA 3QG7L 5D96B 4PJ9D 5DVNA 3NIDF 1QR4A 4XHJC 1X5ZA 4NQEB 4FFYH 5JHDE 1AR2A 2V5TA 3JV0A 3K74B 4KJPD 4QRSB 2BVOA 1U8IB 4WUUE 5M7QA 1OGTB 1DSFH 1JGLH 3FT3A 3PNWB 1BD2D 4RMTA 1CR9L 2R8SH 3QI9D 5IM7A 4HUWB 1YPZE 5C07B 4YK4C 5IP4A 3MRJB 3BPCB 1IM3B 3E3QE 1KPRA 2DQIH 2E7HA 4RDQG 5F9DC 1JBJA 1FZKB 4H25A 3HMXA 5J13C 3PL6B 4AIOA 1D6EB 5DMKA 3MODL 4GT7A 3L3OA 3SKOB 3OBAA 4ORZC 2VDNH 1FORH 4RGNE 5IMOA 1TENA 5FYKL 1RIVH 1J1XL 5DJDA 4PTTA 5HI3D 3HUJF 3L3IB 4OCRH 4PJXF 3U4EA 2UVFA 5J12B 5EO9B 5HYJD 4NN6B 2Y36H 1CGVA 3C6LD 4HX1B 4YNYB 4ZSOA 3WL9A 5E6ZA 3IFPA 5DLMH 2HRPL 3V5KB 1LK3H 4KZDH 3KYKH 1XGYH 4M48H 1JRHL 4JGMA 5D7LA 3KPRE 3Q1SL 1VADA 2W91A 2X6MA 4GW1B 3REWB 3UCRA 2I24N 3LS5H 2XTJE 4AEEA 3GB7B 3RY4A 2D7OA 2R29H 4HWZA 1S3KL 2EYRB 4WEBH 1T7ZA 4GXUN 4WHTB 2DJSA 4IOSD 4W6XB 4YHIA 1U91B 4P59L 3CVHA 3DIFA 3HAEH 2DM7A 5DUMH 2BJMH 3MRPB 3N9GH 4ZAKD 4RGND 1UM6L 4Y4HC 4MQTB 1W0WB 4HWNA 1KCSL 3BWAA 3HG1B 4NPYB 5T33L 1FIGL 2XWJB 4L4TD 2CUIA 3REVB 2IADA 2JIXA 4A6YH 3C60B 1MJ8H 4JVWA 1YY9C 1HWGB 3T04D 4MX7A 5L6YH 4X6DE 3AGVA 4I18B 1I85A 1WLHA 3C5JA 4OF8A 1NMBH 4RISH 1LO5A 4KHXL 4MCYB 4N68A 5DRXA 1AO7B 2PYEE 2OXGA 1ZK9A 4EDWL 3UJTL 4Q6IC 1NUGA 1FNHA 5C9JA 3ARWA 1AE6L 3G9VA 1BVZA 2IANB 5DLML 2AQ3A 2Y36L 5D2NA 3Q5YA 2R1WA 3QG6A 1QFWH 5LG1A 4UOW0 5FYLD 4UTAL 1P84K 3RVVC 4MQXD 4POYA 3FO2A 4N1CA 1EGJL 5FYJD 5AD0B 3RL1A 4X8XA 3FN9A 1IM9A 4Y2DD 1N6QL 1SY6A 5EFIB 1H8OA 5E8OA 3HB3C 3VRIA 5SWZA 3O6FC 4LVOB 1A6VH 1Q9LB 1R6VA 2VDLH 4J3WA 3RWCB 4DOHB 1E4WL 2XY2A 4C56A 2G2RB 3L95B 4Q6IB 1DFBL 5D2LA 3PL6D 5TDOB 5CFHA 1JK8B 4LCCB 3QWRA 3BWUC 1JCKA 4GAJL 3QUXA 1MPAL 1W0WA 2JKXA 4HS6A 1XF2A 3BWAB 1FNEA 1FSKC 4LPTA 1U58B 3L3DA 5GSVA 2RBLA 1VESA 2V5RA 5ISZB 4U6VL 3GDBA 3QAZC 4MD5B 1LILA 4FFVD 3O6KL 2FD6L 3HE7A 4YHKL 4A2MA 5DMYA 1DP0A 1HI6B 2CDGB 3H3KA 1A9EA 3OJVC 1RZFH 1M05A 4TSCL 1A6ZA 2BSTA 5T1DH 5SX4I 3WDJA 1U8KA 1CGSH 4JZJB 4NFDA 2J4WL 1A0QL 5IF0A 4YBLB 4FXKB 4OI8A 2AW2A 15C8H 4UT9H 3UTTD 1GPOH 3O0RH 5EZJA 2EC9T 1I3UA 2YPVH 4X99B 3IFLH 4Y1AD 1RZJH 4F7PB 4R2GB 4JVPA 1YEDB 4MXWH 4NO3A 1GSMA 1R5VB 1S7TB 5TJWK 1LDSA 5FXCH 3HC4L 3GJFB 3MJGX 5BVPL 2X7LB 4IRSB 4CW1A 1LK2B 3C60D 3A6BH 1ZTXH 2GI7A 4KMQA 4Y19A 3Q5TA 3F7PC 4X7CC 1KCVL 4NP4L 3PJSA 1ADQH 5TPWH 4M02A 8FABB 1F11A 1H5BB 4QT5A 4Y4HB 5IEKA 1FJ1B 5SV3A 1F90H 4WWID 4LKXB 1FCGA 4WHDA 3KPSD 4X6EA 5CBAA 3BEWB 5DHXB 4NKDA 3O3UN 4ZSOB 3WL9B 2UZIL 5TE7L 3ZYOA 1YDPA 4YAQB 2VLME 3TEUA 1SQ2N 2OSLA 1MFNA 3BT2H 3B9EA 1FSKB 4WJ5B 5DVMA 4Z7NE 5K9OB 2I9TB 4ZXBD 2X4UB 4ONOA 3WNNA 3S88H 4PJ7A 4UAOB 2JJSC 2FJGB 5T3XE 1CXLA 1U8QB 3C5ZB 1RK1A 4UIKL 3P9LB 2G9HA 4JREB 4Z5RB 5D5MB 4QRTA 3MRPA 3UTPD 2B5IC 3VFMA 4LVNB 3O2VL 2IG2L 1QA9A 4WU5B 1CZ8H 5I2IB 1OP3H 1KEML 3QWOB 1AGDB 4KKLC 1VSCA 1JZ5A 1XIWB 5I1HH 1F3JB 3U6RA 4S1RL 1T1ZB 3SDYH 4AEFA 2AXFB 3C6LA 3D6GA 4R7DB 3HCVA 4XBPB 1J5OL 4IRSC 2D0GA 4ODBD 1QFWI 4Y19B 3UDWA 1NMAL 3MROA 2ICES 3EJZC 1P1ZB 2H32A 2A74A 5C0CA 3S6CA 1TNNA 4Z95L 5FYKE 1KG0A 2FL5B 5DQJA 4ZYKB 2A1WH 3GMMB 4NQVA 4HUVB 3C9NB 1IGFH 1TCMA 2AJZB 2YPLB 4S1SL 1YYLL 2HN7A 4P57B 3ZYJA 5DRWB 5EOCJ 5EC1B 4JY4A 2F15A 4WI7A 1CD9B 5HI4D 4K94L 3VXMB 5JXAL 1WISA 1ZT4A 2ITCB 3T4AA 4WHYG 5I1HL 4NKOA 5ANMB 4W4OA 3PWVB 1SJHA 2C9AA 3DRTB 1BJMA 4F7MB 5B8CB 4JO4L 1QO3B 4LLMA 3O2VH 3BP6A 4Z7VF 5J9PA 5JHDB 2UZYB 5LQBL 2VLRE 1DQML 2CUHA 5CBEB 1MHHA 3PGDA 4GQ9H 4I0PD 3OKLA 4F3FA 1PEWA 2A0LD 1XGQA 4YFEA 1A8JH 3BGMB 5HGGS 2DM4A 3KPSB 1ACYH 4HS6B 2X4PA 3NABH 4KMTL 1J87A 3A6OA 2UYLB 1RULH 3UJJH 1WZKA 4JO2L 4XMPH 3QWRD 1H15A 4TUKH 3ZMRA 2R4SL 3C60C 4LCWB 3SCMD 2BRRL 3P73A 1X5LA 3RNQA 5HDOA 3LEYH 5HBBA 1Z9OA 2WQ8A 3C6LB 3OAUH 2X09A 2BVEA 5MENE 3SO3B 4M6NL 5TE7H 3G5YB 1GIGH 3ULVE 5H8DA 3Q3GA 3VI4E 3ZYZA 3S9DB 1MI5B 1CK0H 5MEOA 4QRPE 2ICEB 4BH8A 5IESL 5DQJB 3R1GH 2DKUA 5JZ7D 4N0RA 3V5DB 1DL7H 5JORA 3LZFH 1PYWB 1JP5A 2GT9B 5ERWB 1YEDA 4LK4A 3KPOB 4NGHL 3OZ9H 1QPXA 3LN5A 3MLZL 3U4BH 5AUMA 1XR8A 5D1ZD 5I17B 1X5GA 3AB0C 1G7JB 3CZJA 1JPTL 4TTDC 5DMIH 3WJLA 1CFSA 4YR6B 4TVPE 5IJKC 4F80A 2P5WE 3KWWA 5FYJE 3OQ3B 2BVQA 4NWUH 4ZTOH 4OZHE 2O93L 5DJXA 4OQTL 1MIMH 4H20H 4BSVA 4OZHF 3H7LA 4L5FH 2ESVB 2QQNL 1CXEA 3T2NH 5J9PB 5LXGH 5EU6B 3U9UB 4ZG1A 3GUTB 5EBLB 4JFYB 3LKOB 1Q9WA 2FATL 3NTCL 4UT9L 4M7ZB 1R3IL 2YUXA 2ZUUA 3OAYK 3QHZL 4JRWA 3EJYC 4PBWD 1ZGLA 4X6DB 4G8GA 1XGUB 2N7AA 2CIKA 4QHNB 1NLBH 4QTIL 1YY8B 1BOGB 5ALCL 4UZGA 4KUZL 3VFWB 3AU1A 1I8MA 3K7UA 1IQDB 4NBYB 5EA0H 3L3KB 4QWWD 4Z7WF 1WFTA 3MLXL 2QR0A 4K7PL 2RFXB 2N1KA 1JYXA 1BFVL 3VFTB 5C71A 1K5NA 5CEXA 2YOCA 3AY4A 1QNZL 3NN8B 5MEOB 1MLCA 4DTGL 4NUJB 2E27L 2LU3A 4WGWB 3AS0A 4NQED 3DRQA 1JRHI 4RMSA 1XAUA 2ZG3A 5C0GB 1EFXD 2XTJD 1YECH 4XVTH 3IDMB 1K9TA 5EZIL 3CVHH 3W0WA 1YMME 1AGDA 4NJAL 3TPUB 1P4IH 3IJHA 5AZEH 1XIWA 1AXTH 2PNDA 4MB4A 4W81A 4I0PC 1RUKL 4ODHL 2W9DL 5JW4R 4WEMB 1QRKA 4OCSH 3KS0H 4HIXL 3GIVB 5GQBA 1A7OL 3JBG7 4YHZL 5F7KC 1HHGA 4JFHD 4PR5B 5GGVL 5I30H 4LPVA 1FL6B 3T1WA 3SGJC 1RFDL 4Z7QE 3UJTH 1C8PA 1FO0B 1I1AB 1RIUH 1A5FL 2PW2A 3WN5B 1WWCA 3TWCL 3QEUA 4UAOC 2V5SA 1FZMB 4U1SA 1G7QA 1TLKA 1ZGLB 4X6BA 1YEHH 3OGOE 5D9SA 1QSFB 1B4RA 3DX7B 4HWBL 3B9KA 1YEIH 3GSOB 1Z0NA 4RGNC 4Z7VB 3VRJB 4BQ6A 1SJEA 2J8UB 2DICA 4FFZH 3E1F1 2W65B 4WW2C 4OLYH 3L9RA 4DVRL 3QCUH 3E3QC 5HHOA 5HXMA 4AJ0A 5FO8B 1JMXA 3LD8B 4K8RL 4DVBA 4Y8DC 5TGBB 3ULUC 3FOMA 4WFFE 4M4PA 5CGYC 1AQKL 3GI9H 3MV9D 2FJFA 1S3KH 2VL4A 2H1PH 2X4PB 3I6LE 2BRQA 3GMPA 1QYGH 1OGAA 1SYVB 1KSRA 2VABB 2LU4A 2FH8A 2ATKA 4BJLA 2YD9A 4JFEB 4FQHB 2VDPL 2X70B 4HS8H 4M48L 1RVFH 4UIMB 1UZ6E 2NXYC 4E41A 1FYTB 5T5NF 1T5WB 5DEGA 5TF1L 1R5WA 3VU2A 2MCPL 3G5YA 4HF5H 2CSPA 4KDTA 5GS1C 4AH2A 4LDLB 3UTSB 4LGSB 3IGAB 3PDGA 3ECBB 5ICXB 4KV5E 4ZFOL 5JW5B 3TCXA 5C2UB 5L88H 3VXRE 4I4WA 1HKLH 4OFYD 2AJXH 3U9PL 2Z4QB 3NFSH 4F33B 4MLSA 1AKJB 4QHMB 3EHBC 5T5FH 1SYSA 3MGOB 1EJOH 5HHOE 4G9DB 4U7KA 4LQFL 3KLAB 4FQ2H 3QEUB 1T3FB 3TIEA 3FO0H 5E2VL 1F4WL 3QUYD 4OLUL 1AY1L 4L8DB 2AK1H 5EU3A 2PYEA 2J7LA 4UQ2B 1D5IL 5E08L 3TIDB 3WFHB 1CE6B 3SPVA 3QIBA 3X3FL 3HZVB 4G6FD 5GRVK 2B8OT 1IL1B 4IJ3B 1MFEL 4NFCA 1QG3A 1PKOA 3WIHA 4Y4KC 1CU4L 1BFVH 1U8MA 3DV6B 2NTFA 2DBLL 4JDVA 3UTZB 1RIUL 2VZSA 2FIRT 1OQOA 2PW1A 4KKBD 3SKJL 2W9EL 32C2B 1FLRL 1H9VA 5DD0H 1G7PB 3MFFA 2EEAA 3GMPB 1IAII 4XI5D 4NRXA 2HFGH 2FR4B 3QP3A 1I1YB 3I85A 4L9LC 5I1EL 1FL3A 1J12A 2FEDC 3QEGH 1T0MB 5K93A 3FT4B 5DD6B 1Z9SA 3VMNA 5JOPD 3EYQD 2QR0B 1AXTL 1OARH 2OTWB 3BFOA 4GBXB 3VGEA 1KIUA 3QXDA 3T1FA 1ONQB 5J1AA 1MIML 3MOBL 1B2WH 5L2KD 4Y16D 1JGDA 2FBOJ 3KNBA 1MHEA 2KPNA 2BDNL 4QHMA 4MA1C 2DQUL 2JJSA 3ZT6A 1IC5L 2BSED 2PCPA 3DMMC 3IDMA 1YNTA 1S9VB 2CD0A 2YD1A 1DUYB 2NTSP 4JFPA 4QYOB 5FUZL 3LV3B 2G60H 3M8OH 5EU3B 2AGJL 2FLRT 4XNZB 4PD4K 3GSVA 3SKNA 1M7DB 1M6OB 4JFQB 4P9ML 5KVFL 5FKPA 5MEND 4PJCB 4D0DB 3GJFH 1A7PH 3U7AA 5GGSY 2G75B 1NC2B 4WWKA 4LLYA 4M6NH 5FB8B 2BMKB 3QFDA 1OAQL 5DK3A 4N8VG 3LEYL 4LSTH 3RVUD 1JGUH 4Q2ZA 2PW2B 1TZIB 2BRRH 3BZDA 4PRHA 4WO4A 4U1SB 2QQNH 4OI9A 1B4JL 4QXUL 3T4YA 2ZUSA 1GGCL 1XF4A 5FECA 4A2LA 1GZPB 2EDOA 4OZGA 4OCYH 1VPOL 2Q86A 5IR1B 5HHXH 4GKOA 3D5OF 5L8KB 3KPLA 1OWRM 4QTHB 5ADPH 2IH1A 4WTZA 3H9HB 1IILE 5ADOL 1KTDB 2JB5L 4H8WL 5IFHL 5DJ6B 4GUPA 3LEVH 3EZJB 2BNQA 3OX8B 5ACMA 1KIQB 1ITBB 1R5IA 2EDYA 4JANA 4I77L 4NGHH 4GMTH 5IQ7L 3MRNA 1RK0A 4LCYB 4H25B 2PTTA 4DKFH 3KNBB 5FOBB 2W92A 5KSUA 3MGAA 5I1AB 4JKWA 5DJ0A 2R0WH 5HD8C 1CK0L 4XGZA 5IB5B 1FN4A 1KC5H 1ZVHA 3UTPE 5ILTH 2Z93B 3BP5B 1GIGL 3RI5F 4ELKB 1JGVL 5IVZA 3MA9H 2X1PA 4WU7A 3MGTB 1BPVA 3VD4A 1FYTA 1T5WA 4WWKD 1G7HA 2KBGA 2XRAL 3P77A 4FRWA 2XOTA 4TNVK 4P5KA 1BFSA 1CS6A 2NXZD 2J5LB 1HILB 3SDXB 1QKZL 3FQRA 1HZHH 2MFNA 1XF5A 3M1BB 3SDAB 2AQ1A 1CFBA 4KROB 1SYSB 4ZO6A 1QLFA 1I7UA 5CGYD 3KPQA 3VGAB 4JRYA 1VGKA 3KDMA 4OM1L 1FVCA 2IEPA 1A1NA 3TIEB 4B7IA 5IFAH 1ZWIA 43CAB 4EOWH 3DIFB 3AREC 4JPIA 4JO4H 5EBMA 5C09E 3ZE2E 3BQUD 4UTBL 5FUOH 3WFHA 3HI5H 4ZFFB 2A73A 2VXQH 2XKUA 3GMLA 1PSKL 4PLKC 3BYTA 2FEEL 2CLRA 5CAYB 3TT3L 3RGVC 1JJUA 5JHDD 1OD9A 3MRKA 4JEGB 5LCVL 4N0UB 4OZIE 3RIFK 1EBAA 3I50L 3AM8A 5BVJA 2PTTB 4S1SH 3L7EA 5IW3A 3SDXF 2A1WL 1F45A 3BZ4B 4R9HA 4UU9A 1ZA3A 4U1MB 4KRPB 3SCMB 3QUYC 2WBJD 1T0MA 5KANG 4UV7H 5EU6E 3MCKB 2VLKE 1A7PL 2VLMD 3FQUA 4K2UL 1CG9A 1HXMB 5ITBL 6CGTA 5IMKA 5KVFH 3UBXG 5EOTB 1KJVB 4U6HA 1UB6A 4MZ2A 3BHBB 3OB0H 1KCVH 5FCUH 4JPKL 5GIRB 4DK3A 1Q72H 3KPMB 4D94A 2YA1A 5J06A 1GGTA 4YFLF 1UACH 1CQYA 1F5WA 5HHME 1CFVL 5C0BE 3BD5A 2WLYA 2R2BB 4JN2B 1N3NA 4X8JB 4PJHA 5DJZB 3VGAC 1UB5A 3C8KB 4ODXB 1BD2A 3UAJD 1EBPA 4JAMB 2CMRL 1XGTA 1AD0B 2NZIA 4QRPA 1M7DA 4EDXB 3DO7B 4HZLA 1GGIL 5GS1B 5J11C 3I84A 2IAMB 1ITCA 1NAKL 5CEZL 4LNRA 3PWLB 3I02B 2HTLC 3ULVC 2GY5A 4H26A 1MI5D 1F2QA 1YJDL 3QFDB 4HPOH 5IHLB 1CDHA 1GAFL 2BC4B 1BVKB 4M1CC 4HHAB 4NC2B 4OAWA 2EE3A 4KDWA 3BVNA 3GMNA 4RFNB 3MRMB 5ITBH 1BMGA 4X7SH 3INUL 3BSZH 4RFEA 4YFDB 5AWNL 4UV7L 5IB4A 2FCBA 4NP4H 2W0LA 4KROD 3L3GA 5FUZH 5K9KA 1XF4B 4UOJA 4GQPH 2MOVA 1MPAH 5E8PB 4Q9RH 1A1MA 4IS6A 4LMQE 4CVXB 2BDNH 1BOYA 1CI5A 4OLZL 4ZTPL 4DGYH 4YGVA 5JA8B 4G9FE 3C60A 2OYPA 4I0PB 1NJ9A 1Y18B 3F58H 2BNRD 5BRZE 1ZANL 1T89A 2Z31A 1YN6B 1NDMA 1A3RL 4R6UA 4TVPH 1LNUA 4BZYA 5CLTA 1RZJL 4MA1B 3NCEB 4U6YB 5F96H 3ULUH 1BM3L 3D69A 15C8L 2H3NA 1NCAL 4PRDA 4PJHB 1FV1A 3QRGL 3BD4A 5DUBB 4WW1A 5FYLH 1I7ZB 5ESVA 3SKMB 4Z7WB 5H94A 4JAMA 4Z7OE 4EUPH 4LLWB 3T08A 2QL1A 1I3VA 1INDH 2G5BB 2YD6A 2ZWLT 4YQXH 4P0DA 4KMLB 3QDGE 3QR2A 5KOMC 3TJHC 3UPRB 2AJ3A 4ONGL 3PHQA 5BV7L 1UWXK 4KHXH 5C86A 2X4UA 3MLSL 4JFDB 5E8OB 1U9KA 4BSJA 3HE6D 1CLZL 1QLEL 1QEWB 2YBRA 3GSRB 5E6IA 5ETUB 1W8OA 5D1QD 3S37H 3DTXA 5E24E 4E42B 1AQKH 2Z0BA 4UDTB 2XTJB 4YX2H 4LCCA 5L8LB 5D5MA 1Y6NR 4YPJA 1DVFD 2BNUB 3QQ4B 4K8RH 1HIML 2AAVA 4NQEA 3TBTA 3OKYA 2ZKHL 5CEZD 2F58L 5FYJL 1DQQA 2D9QB 4MAYA 2CDEA 5FV1L 2B0SH 4XP1H 5DHVA 2GJJA 5IBUB 2X5PA 3P4MA 1X5FA 1HYRC 2R29L 1BQLL 4I77H 3W2DH 3O3AA 5IW6A 5GGQH 2JK5A 4PJIE 4E9LA 3QNZA 2QSTA 5FA4B 1R0AL 2VLKA 2PYFA 1KEGL 5JPNB 4FXKA 4ZPVA 3MSPA 3GJFK 3KLHD 5EZJB 1G1CA 3GGWB 3C9NA 3TZVA 4LCWE 1F4YH 3MV7D 3B5GA 2Q7NA 3FO1A 4XCFL 4U1NA 3BDYL 1A7OH 2G5BA 5T1LD 5FYKH 4PGBA 4KKBC 3FQTA 3HE7C 1QBMH 4XVJL 3VXMA 2Y1VA 4XP1L 1KJVA 4U6HB 1MCLA 2FJHA 4TNWK 5EU5A 3MODH 4ODVH 4G8FA 4K9EC 4GKNB 3DX8A 3S4SA 3JTSA 3DMMD 4XNQB 1CT8B 3MX0A 4X7FC 1IGJA 4YX2L 1J88A 2P49B 4OLYL 2VKWA 4B5EA 4Y4HA 4PY8I 3TT1L 4DZBA 1ZXQA 3EAKA 4H1LB 2HH0H 2BNRE 4POZC 3ES6B 4GRLC 4PB9H 4G42A 4LEOA 3MLUL 4GRMB 5CD3B 3V2AR 5I71B 1BAFL 4N90E 2IADB 1I1RA 1MIEH 2IAMA 4CU6A 3P4MB 3ROOA 2WBJA 4JFEE 4X5LA 3VD9A 1NLBL 4XCYA 1MVFA 5I6XC 3TZVC 4YE4L 4G6KH 3QEQD 3O9WA 1WC7A 3FFCD 4PJDE 2FJGA 3HE6B 4K3JH 3VG0L 1RIVL 3BVNB 2GTWA 5DEFA 3U36B 3CUPB 1MI5A 3NGBC 3TJEH 5BRZD 2ED7A 1RPQA 5KW9H 4B50A 3PQYB 1J9CT 3VGGA 4XPBH 3HE6C 4L5FL 3QI9A 3OJMB 4J3XA 3U0TA 4RA3A 5HHMD 4F9LC 3QXUA 3NBNA 1A9BA 4LAQH 4YGVB 3DX9A 3C5ZD 2E27H 3MLUH 2F5AH 1J18A 4Q58C 5DMIL 1CU4H 4MNQB 1WBYB 4OZFG 4PJFF 1FIEA 1MCPL 4C58B 2HTLD 3K2UL 1VGEL 4NT6A 4GRLA 5DRNB 5JNYB 3ULVD 3QQNA 1CXFA 2R2EA 4LGPB 4RWYH 3RWJB 3MLXH 5C0CB 5FK9A 1HINH 1CICA 1G6RL 4EIZC 4MCZA 3GHEL 4UMGA 4K55A 3VFSB 4Z7WA 3RVXC 3SKMA 4OLUH 3WUWG 3FO0L 4GS7B 1E27B 1YJDH 1UQSA 1IKFH 2XZAH 5ECJE 4U1GC 1HEZA 5J11B 1H3XA 5DMJB 4HIEB 3WHXB 4MA7H 4NYLB 1TQCC 3OG4B 5E5RB 2LTQC 3VXTA 2R2CA 5FDYA 2WBJB 4X4YB 1MLBB 4M93C 4PRBB 5FO9A 2Y72A 1U8HA 3CCHA 3ZDXE 43C9A 3EYOA 3VFTA 2OM5A 2WNGA 4L4JA 5DEFB 3IS0X 3BI9X 2B39A 1KJ2L 3QPXL 3NA9H 1N59A 4C55A 4HS3A 4NDMB 5F1OB 4P2RE 3RWEA 5JW4N 1JPTH 3BZEB 1KT2A 4YHNB 3H3PL 4PG2A 4F7PA 3X3GL 2Z8SA 2ZG2A 3FB8A 4C56E 4ZMAT 3EYSH 4JPKH 4Q9QH 1T1XA 1ETZB 1CGWA 3B5HA 6FABL 2L0DA 2ZUYA 5IVOA 1S78C 4QY8A 3ZKXC 5J3HD 2LFGA 3TNMB 3ZKNC 2A6KB 3WCYA 4YXKL 2R4RH 4Y5VB 3BH8B 1WGOA 1PX3A 1QFOA 3QDJE 4IMKA 4P46B 5CEZE 1S7SB 3DETC 1QOKA 4FFZL 4X98A 8FABA 2PTUA 4ONHA 4URTB 4LKCA 4KV5F 1C5DB 3Q48A 1LO4H 4LCWD 1RZKH 3TBWB 2CO7B 1FO0A 1BEYL 2W0FB 4QNPF 1MAML 3S7GA 2EDLA 2KZ1B 2XN9A 3QPQC 5AYUL 5EC2B 4PGBB 1YDPB 4P5TA 1UZ6F 4HXBL 4IDLA 5DDHB 3WHXA 2CO6B 5BS0B 4WJ5A 2VWEE 1DQMH 5GGVH 2DAVA 3VXRB 1IVLA 2BNRA 5EFIA 3N1FC 4UINL 5FO9B 4Y4FC 4GLRI 4OCNC 4ZAKB 3BO8A 3RGVD 4EOWL 5I9QB 5IFAL 2AJVH 1RUKH 3RWCA 2R1XB 4GG8A 5EU6A 2X1OA 4DZBB 1HE7A 1UJ3C 2XYCA 3AAZA 3MJ7B 3VFOA 4FTVA 3KHOA 4XAKD 2J5LC 5INDA 3RKPA 1AGCA 1ZANH 4HH9A 4G8GB 4KK9C 4OD2A 3F58L 4HAGA 4FA8A 1ETZA 5IFJA 4JJHA 2XRAH 4FQJH 4WI3A 1VFMA 1FNFA 3VD7A 3MJ8B 4LSVH 2ZUQC 5JQHC 4Z95H 4WO4D 2VL5B 1RHFA 4QXWA 1WC7B 3JVGC 3FTGA 2GITB 3UBXB 5F9WB 4MA3B 5ILTL 3QIWD 4PJ9C 2XWBA 2P43B 2GJ6A 4L4VB 4UBDD 3MNVA 3GMMA 5D7KD 3FONA 3WLBA 4BQ8A 4K3GA 3ZKQD 2YRLA 2RR3A 4RGMB 5C0ND 2Y6SD 3LH2H 4HFWB 4JRYD 5IFHH 3H3PH 2FATH 1D5BA 1YEGL 2P8LB 4ZO9A 2KUTA 1FFNB 2WWKT 5ITFA 2NNAB 3FT2A 3T2NL 4G9FD 1IAKB 4YDLC 5HGAA 1KYOJ 2IFGA 5HY9A 2CKNA 4F7MA 2VR9A 2J12B 4GRLB 1FGNL 1BJ1H 1SVZA 2EZ0D 4L8SC 4CAGA 3QUZD 1QHPA 3HHRB 3OKKA 4ODTH 5FDWB 5JHDA 4XPHH 3D48R 5DK2B 5ISZD 5CZVL 3IU3B 2EDWA 1T1WA 1QPPA 4N1HB 3I2CL 1GC1L 32C2A 3MR9B 4TUOB 3X13A 4X6BB 4PJIB 5GGRA 3ZKND 1DL7L 4XVUC 4ENED 1IAMA 5DTFB 1IJ9A 3F8UB 1JUFB 3MNWA 2F54E 2FHFA 4PJHE 5JDSB 3IAQA 1HH9B 4JM2F 5BS0D 5IW1B 3BOVA 5LJYH 2VLJA 4R2GD 3ARXA 3UBXA 5E9DE 5GZND 4ZOAA 3OAUL 1DUZA 1J86A 3C5ZA 1RUAL 3QEHB 1EAJA 4HXAH 3RI5K 3SGDH 3QDGB 4JDZA 4HK0A 4ODTL 4EVNB 1IEAB 4R0LC 3JV4B 3HS0A 1FPTH 1L4IA 4HKJA 4Q6YA 1CD1A 4Y5XA 5D7JC 4XPBL 2BX5A 1G9NL 4PP2A 2DLEA 1EFXB 4ISVB 4OJFL 3MUZ1 1WVZA 1YEGH 4JY6B 5C0CD 4JM4H 3ILQC 3FT2B 2AJVL 1O0VA 5GGTH 1FH5H 4D9QD 5DSCA 1GGUA 1ES0B 2R15A 3H9YA 3DARA 1UKSA 2OS7A 4EQ3A 2VKXA 4EBQL 1AH1A 5E5UB 4GAGL 4OKDA 1UH2A 3L6FB 2AK4D 4Y16C 1KIRB 3CPLA 5IROC 4OM0H 3KXFA 4PV9A 2C7UB 4R3SA 1C7TA 4LSVL 5FUCC 2HH0L 1S7VB 1EEYA 3O8XC 5I66A 1T03L 2E6PA 1JUFA 3MNWB 3S36X 3QIBB 5A40E 5IR1A 3TNNB 1SJHB 4HKBB 5E7FA 3MA9L 2YKLL 1U93B 4ZAKA 3U30B 3LKPB 5HGHA 2A6JB 5D1QB 3NCYP 2AK1L 5LGJA 1AY1H 3ARGB 2JJTC 5IUSA 4H0GA 4DCQA 4POZD 5J1TC 4CMMB 1NGQL 1OB1A 1EJOL 2Z31C 3BMWA 1KEMH 1N5YL 2AI0H 1EGJH 4X4MA 4PJEB 5INDB 2CLVA 3EYSL 3V4VL 3MLTA 1DJSA 1JHTA 2JB5H 4H8WH 4OV5A 2HMID 4GRWF 2ICWJ 3AROA 3QQ3A 3OV6A 3S5LG 3WBDA 3D0VA 3P73B 2NY3B 1RVFL 3DX6B 3K80A 3OKDB 2C4FT 3QUMA 4JKLA 2XN9D 3QXDB 5L6YL 2D7MA 5C08E 3DLQR 1FL6A 1FZJA 2H1PL 2PXYB 1D5MB 1FG2B 3BDXA 3WIFB 4MA7L 2DKMA 4M5ZL 1X6LA 5E5MA 3DWTA 1OAQH 2Q8BH 3NIFF 1EA9C 1ZSDA 4NO5B 3P4OA 1KCSH 2Z8RA 4NSKB 2AQ2A 4PJBF 4I18C 2DQIL 4CADB 1MCQA 2JF1A 5DT1L 4A6YA 4FMFA 4YR6A 5EZLB 4LSUL 5I71C 1HINL 4WEBL 3E6FB 2IMMA 4F7CB 4M8VA 2IBBA 3SE9H 5JO5B 3NVQA 3HC0B 2Q3AA 4OBRA 3RHWF 5CIPA 1CLZH 1YEHL 3EFFA 4MS8D 2X89D 1CFTB 1NGWA 4DVBB 1XR9B 3D25B 5DK2A 2GK2A 3WXWH 1LEGA 2E6JA 3PL6C 1Q9WB 3IJSA 3QPXH 3KYKL 4OCXL 4D9LH 1X4XA 1B2WL 1LK3L 2AK4A 1EVUA 2HRPH 2E7MA 3D39B 5ESAA 1SBSH 3VI3E 1SYVA 4MXVF 2NY5L 4EUPA 4UNVA 4OCRL 5FYLL 3RFZC 3DECA 1YQ2A 3SCMA 1JYWA 2WK2A 1YMMD 1ZT7A 2DI9A 1MY5A 1ZGLM 4XBEH 4PLNC 1XIWC 3AREB 5BV7B 5HJ3A 5F72S 3HMWH 5GSRA 4DKDC 5IOPA 4NJAH 5I1IH 1V3MA 3RWHB 5ICZA 2LV4A 1R5IB 3JV6A 4Y5YC 1DANT 4NQUA 2NZ9D 4QWWC 5SWQA 1R3KA 1XEDA 5IQ9B 3RHWK 4UB0L 5IB2B 4Y19E 2WIIA 3BW9A 2NLJA 1S9YB 5BS0E 4RWYL 2DBLH 3J7HA 5CMAA 1HWHB 3MBEA 4PREB 1VEMA 3MMEA 5C07A 1A6TB 3ARBC 1XGPA 4L4TA 1MH5A 1RJYB 4QHKJ 3X3FH 3TT1H 5C09A 2A9NH 3UBXI 4YDJA 2R23A 4MD4A 4ZPTA 1FC2D 1AJ7H 2BK8A 4I8DA 1TTFA 4WW2A 5I1IL 4R2GC 4PJGF 2OLDA 4LQFH 3HMWL 4PJBA 1U8NB 5GGRY 2ICWI 3O9WC 2ORBH 3BUYA 3MV7A 3SDXE 2I07A 2IBZX 1ZLSL 5L88L 4LBEA 4MA8L 5LXGL 3QXWA 5ESQA 4NHUB 2CMRH 2FH6A 3QNXB 1ZKAA 4H20L 3QIUA 1S7VA 5CJ5A 1MIEL 1KJ3H 3VRJA 4Z7VA 4P2QA 2J3SA 4P4KB 2YUZA 4PGEA 1U8IA 3QIUC 3WJJC 2P7TB 4R4BA 3SY0B 3VXNB 4BUGA 5J7CC 5B39B 1PZ5A 1U91A 4DCQB 2YHGA 5IM7B 1AHWB 1Q72L 3QDMD 2MTPA 3GSQA 1KTLB 3V4VH 3SE9L 5FCUL 4K8RC 1R3KB 4U2ZA 3W81A 1KTKE 1EAPB 3WO3B 1A1OA 1JF5A 2B0SL 2YD2A 4M7ZC 3K4ZA 4U6YA 4ZNEE 4AQ1B 3REVA 1G6VK 3LSOA 1HIMH 1MCDA 1ULVA 5C09D 5IMOB 1E6JH 1FV1B 3QCUL 5C08D 3MCKA 4P2YA 1OP5H 3QH3A 1TXKA 1FVDB 1KENL 5IVXA 3LS4L 3NCFB 1AC6A 4LDOB 4JM2C 3TA3D 3BPOC 4E41D 4D0BB 2VMFA 4G6ML 1R3JB 3KPMA 4I4WB 1FG2A 2B20A 3WIFA 1N5AB 2YN3A 4GAGH 3DXAE 5EORL 3IDXL 4KZDL 2O26U 3MOAL 1X5YA 2IQAB 4E42A 3CMGA 4HPYL 4JRXE 1JPFB 4KKCC 4ODXA 4PRNA 3UAJC 5ENWA 2YN5A 2NPLX 4Z0XA 2R1YA 4KQ3L 1PG7W 1NCAH 1N5YH 2BXZA 4GKSB 3EO9H 4MAYB 4LNVA 2Z8WC 2XPGB 3KS0J 3T8XA 1BWWA 1TJHL 3N50A 2IPKA 1JWUB 5F3HB 5SWSA 4ZUWB 4YDVA 3HUJA 3OX8A 1HZHL 1FPTL 2YKLH 1RZ8B 1KFAL 5H37G 5I1JH 1FVEA 3SGKA 1JGLL 3VGDA 4NN7C 2B5IB 2P8PB 1II4E 5ICYB 3D85A 4P23C 3HI1A 2AABL 3RWIB 3B2UD 4MNHB 1F4AA 4J4PD 3RTQD 1R3LA 2P46B 5DQ9B 3GGWA 1B6UA 4J3UA 4PYGA 1JGVH 1NMAH 5BV7H 4FG6C 4K7PH 5CSZA 3DURB 2PO6A 3NCJL 3BSZL 5T1LB 3OXSA 3PWPB 3EDKA 5IOPB 2N7BA 5AD0A 2EDFA 2FJHB 4P4KD 1K4CA 1MF2H 1AGEA 5J1AB 3QRGH 1FRGH 1RZKC 3OKNA 4RQQA 3QHZH 1GC1H 3ZO0A 1UXWA 1UEMA 4KRMB 4G7YL 1LMKA 1G9NH 4UT6H 5SWSE 4JRYB 2VUOA 1YNTB 4OCYL 4KJWD 1A3RH 3HG1D 3VWJC 4JFPB 1XGPB 4L4TB 3OJ2C 2GW5A 4NWUL 1UFUA 4ZTOL 4LVEA 3GSWA 4ZTPH 3V7AG 4DGYL 5SWZE 3HNTH 1S7UB 3TVMB 4ZUSB 3IETA 4Q9RL 3IFNH 1MRDL 4JFFE 4N0UA 3FZUD 2Y5EA 3G08B 4P2OA 3D39E 3IS1X 5B4MC 2GJZB 2P8PA 5HYJA 3JVGA 2YMXH 1OCWH 3OKEA 4D9QE 4EN3A 1FYHB 1J05B 3LD8C 3RWIA 4BQ9A 2HLFC 4IOFD 2RGSA 1TVBA 4FNLL 4QHUA 5C0BA 1PD6A 1MCSA 2PO6B 1OP5K 4D0CA 3CC5B 1JVKA 2VLJE 4XVSH 1A9BB 2P7TA 1CLCA 1ZAGA 1UB6B 4FTVD 4MNQD 1RULL 3MOBH 3PWPE 4JFFD 4MXWL 5GGSB 1J8HB 1QVOB 3TT3H 1GCFA 2CH8A 3VFMB 1KPVA 1EAPA 1MWAH 4PJAA 2EE2A 5D1ZA 1PSKH 4DZ8A 4LPWA 1LE5A 1P53A 2FHCA 4LU5H 1CFVH 1GPOL 4O2CA 4XGZB 4IRJD 4KJQC 2K9UA 1E6OL 1VFUA 1WWWX 4IRZH 3ARFD 1CGSL 5IIEA 4C4KO 1LO0H 4YHPB 2C3XA 1D3CA 4WTXA 4J6RH 2AV1B 4WNQB 1GZQB 2YZ1A 3GEWB 4KI5E 4L4VD 2Y23A 4JFOB 2OSLB 3EIFA 3MUGB 5IEHB 4Y1AA 3NCMA 5AYUH 4V1DA 4S0SD 1GRWA 3OHXB 3MYJB 4XAWL 3WMSA 3UP1A 1MFEH 1TNMA 3ZKMC 3VFVB 3ARSA 2D7TH 1U2HA 2Z35B 4XNUH 4PJDA 5INCB 3DSNA 1KNOA 1U8QA 5B4MD 3VXUA 3KDMB 4JLRB 2OQJA 1FAKT 1KFAH 5IB4B 1HQ4B 1A6VL 2EKSA 3MJ9A 1XMWA 4O02H 4CVZB 4PRIB 3QO1A 4O51B 4PGDB 4MVBD 4OFKA 4RIRA 1TZHA 4S2SB 2NW3A 2FB4H 1N6QH 4L1HA 5I6XB 4N8VB 4NQCB 1QA9B 4WU5A 5IBLC 3QWOA 5A43C 1HKLL 1OT1A 4PY8J 3TBSB 3NCBB 3TA3C 1A9EB 2EDJA 2IFFL 4IMLA 1D9KD 5GRVL 4UTAH 2ENSA 5EBWA 3QUZA 2ID5A 5I18L 4DUWA 3I6GA 3NIDE 4U6XB 1T7VA 5E1AA 4P46A 4D3CL 1VPOH 1KJ2H 2X44D 2XZCL 5F1NA 2CKBA 4G6MH 4JFDD 4OFIA 4FOMA 4K3HA 1EO8L 2VIRB 3S98A 4P4KC 3PDOB 4PJ8B 3L7FB 5FYKD 1K8IB 2GSIB 4Z7OF 3TBYB 1FGVH 1QYGL 4NQXA 3FQUB 2GSGB 3F7QA 3PWPA 3U0TB 3LS4H 5CEYB 3QT2A 2YD5A 3DXAD 3NA4A 3IRPX 3BT2L 4P5TB 3O4LA 3DNKA 3GRWH 2QJDA 4NNXB 3E2HB 1F3RB 3ZSTA 2RB8A 5FF6B 3GSNB 2BERA 5D93C 3EDEA 4LVNC 4X7EC 3ULUE 3BKYH 3T3PE 3KYMB 1ZHLB 5CWSA 1WBZA 2FX7L 4HKXB 3FRUB 4OLWH 2O61B 3N9GL 1XZ0B 1QO3A 3C8DA 3SE3C 3JWOH 4DKFL 3WFEL 3DTXB 4PJ5E 3KPRD 3I75B 3FB5A 5D93B 5EPMA 1I9JH 5HHNB 1MFBL 1P7KA 1YEIL 3LS5L 4E5XB 4OV6F 3H9SE 3VXOA 5EU4B 3LKNB 5I8EA 1E27A 2BVQB 4QRPB 4HEME 1I8IA 5ADOH 5IMLA 3ZHKA 3TWCH 1HEZB 2QADB 4OD2B 1A5FH 2WAHA 3V4UL 5JXED 5LWYH 4AQOA 3NA9L 5F6HJ 3P0VH 3IT8D 3WFCH 5KSBB 2EE6A 4DOHE 5MHSD 1JIBA 2OCFD 1JMZA 3PWLA 3MJ8A 4QXUH 5F7EH 4E0RA 4KROC 4NN7B 1ZLSH 5KW9L 3DGGA 4PJGA 3U48A 1F6FB 5JPNA 5IB3B 2X9YA 4X6CE 4BFBD 3K4AA 1VERA 2GJ6E 4U49A 1I8MB 1EMTH 1CGXA 1HH6A 3QG6B 2I5YH 2P24B 3VRLE 3LN5B 1CF8L 1IGIL 4RZCA 4IBLT 4MJ4A 2A9NL 2V2XB 3FT3B 3ARBA 1V3KA 1T20A 2HKHH 3ZZ1A 5L7XH 4MJ5B 4DTGH 5IHZB 1HHHA 3K4DA 4H8WC 4Q9CA 4MAYD 5HI3C 2BSRA 1T2XA 3CSYB 2FHBA 1CT8A 1DFBH 5LAXA 5HTSA 4I2XE 3QB7C 4Z8FL 5DHYB 5HHNA 4C54A 3TBWA 2I5YL 1T1WB 2WBWB 3QCVH 1WT5C 1F4WH 2LAAA 4TUJA 3RP1A 5IMLB 5EC2A 1S7XA 3D2UA 1FNAA 5HVGB 2DN7A 3NTCH 1U58A 4X5WA 5JXEC 1MCWM 1RD6A 5DZOA 5A2JH 3UPRA 4F9LA 3MA7A 4WFHD 2NY5H 1TJIL 4CKVX 3U1SL 3QWQB 2O5XH 5ETUA 1FLRH 1FZMA 4JZJA 5SV4A 3EUUA 4D9LL 3FFCA 2FO1A 1XCQA 3IDJB 3TBVB 3U36A 4RGOL 5C0EB 5ISZE 4GH7B 5DHVH 5J6GA 1AD9A 3O6FB 1KEGH 4WFED 4RBPK 4RISL 1S9XA 1KUMA 2HFEB 3WLWD 4LIQE 3T0EE 4S2SA 4FQ1L 3RDTB 4NO3B 1DQQB 1I9JL 4WY7H 4Y7MA 1H15B 5B21A 2JE8A 4MZ3A 3WFEH 5E08H 3SCMC 2VLRD 4MJ6B 4RMQA 4JRYE 4IMLB 3SBWA 1VFBB 3QNZB 4LHUG 4DN4L 1UWEH 4ODVL 1T1YA 3J8F7 4U6XA 1I8KA 3RWJA 1NCTA 1YMMA 3C09C 5F1KC 3NFSL 4G8GD 4XVJH 3U9PH 1NQBA 4OIAA 3S37L 4KKLD 5SX5K 2CKBB 1P4LB 3K0WA 4GJTB 5EU7E 4UQ3A 3PDOA 3KPOA 2Q87A 1R5WB 5T3ZH 1X3DA 3VE0B 5TF1H 1Y6KR 1JRHH 2UWEB 3FO2B 2XNAB 1ZLVH 4Z0BL 1EIBA 2XV6B 5ICXA 4RMVA 4YQXL 1UM5L 5ITFB 5B3JE 1EPFA 4U05A 3BRGC 3BIKB 2OTUB 3L9RB 1IBGH 2CJUL 1OF2A 4KDVA 5EN2A 1XZ0A 4HIXH 1NEUA 3G5XA 1N8ZA 5DJ8A 5E94B 1TZGH 2ESVA 1AXSB 1TVHB 4OIIL 4KZEH 3GI9L 4ODHH 3QUXD 1CFQA 5FGBA 5IHUL 3V6OC 1AD9B 4JFYA 4FQXD 9CGTA 5KANI 4HGKC 4WFGD 3HZVA 5J13B 1I8IB 4DVRH 1KPUA 2WUCH 1OTTD 2X41A 5CJQH 3T0XA 3W5MA 1AHWC 2WLZA 3L3DB 1EUUA 1T03H 4OLZH 1YYLH 4XNUL 5A2LH 1A21A 1L6XA 2BZDA 5D1XB 5JDSA 4E41B 2AXFA 3MQIA 1P7QD 1A6ZB 3MLSH 3QYCA 4P2QE 2IAMD 3S3SA 4PLOB 4ONGH 2GJ6D 2A74B 2FR4A 1HCFX 3TYGH 1V8HA 1AIFA 4ODUB 1RFDH 3VXRD 5C0JA 4XCCL 4P57A 3TYFB 4JO3L 1WV7T 4HPOL 3VMOA 3RGVB 4K7FA 4LDEB 5C0GA 2W0FA 3FOLB 4CVWA 5D6DC 1Q9OA 4IRZL 5CJ8A 4F15B 3CXDL 2IANE 4GMSH 5EOQL 4F57L 1BM3H 5F96L 5HVHB 3ULUL 1I4FB 3MV8D 1MY7A 4K9EH 5A2FA 4JFHE 4M00A 3TH2T 2BNRB 3SPVB 1ZGLP 3HAEG 2IMNA 3MJ6A 5T1MB 5HHPA 5K9JL 5TH2A 4HJ0C 3HZKA 5DRZB 1CBVH 4GG8B 2OJZH 1K2DA 1KB5A 4JFDE 3UTZA 5CBEA 3VFSA 1RUAH 1FAIH 4X6EB 3DYOA 2VZ3A 1KB5H 1LO2H 3KPSA 5A3ID 4Y4KD 1RZ7L 5F9JB 2AP2A 3E2HC 3INUH 5AWNH 5BZDA 1G0XA 2IJ0C 3SE4A 1PVHA 5IESH 2YS4A 5BV7C 3FT4A 4K3EH 5DD6A 1OLLA 1TMCB 1KCRH 4N8CL 4PJ7B 1M71B 3V8CA 2APXA 1DBAH 4GBXA 4KK6D 1RZGA 2VXTH 5E2UL 4ZFZA 5C0FB 4Y0GA 1MSPA 1IC7H 4M5YH 4CMHC 2ADGB 4FZ8H 4Y2DB 5C0RH 4TUKL 4ELME 3IAGC 1LWRA 4GBXC 2DLHA 3HC4H 1T22B 3KPLB 5LCVH 4ZFGL 1AQDA 2RIKA 4RNRA 3Q0HA 5C0CE 3MMEB 2BNQB 3ARGD 2WINB 1VHPA 2NY2B 4Y89A 1T1ZA 2NXYD 4DUVA 5FO7B 5LQBH 3CDFA 3VXUE 3HCVB 1A4JA 5FUOL 1BIIA 2P5ED 5FHAH 3RZCA 1BIHA 3D87B 4OCLC 2NYYC 1B0RA 1I9RH 4HMDA 1NC2A 4WWKB 3HZKB 3A67L 1FDLH 2XQBL 2ZOLA 2CDFB 4X0KB 2VNCA 4APQB 1G9NC 3ALPA 1JNNL 1J0IA 2C4FU 2QHLA 4IEFB 3RVVD 1WZMA 3KJ6H 3KYNB 4KQ4L 4OZFA 5C6TL 1TIUA 4JKPH 1QKZH 3CZFA 1EZVX 2ESVE 5F9JA 4KWUA 3JUYA 2CIKB 3KGRA 5B8CC 2ERJB 1RIHH 3NFPA 2FECL 1E4WH 1JE6A 3FQXB 3OJDA 4MWFB 3CFKB 1KJMB 1S7WA 3DRTA 4BYHA 3L3KA 2ZCHL 5HHOD 5B8CA 2C3VB 2HFFB 3ARDD 2VLJB 1VB9A 3VXNA 5JUEH 3PP4L 4L8SA 4CRPA 3NAAL 4Y2OA 3NCCB 4GQ9L 1ZLUK 4S1RH 2VOTA 3PXHA 3QA3A 4MDIA 1CZ8L 1IQWH 1WZ1H 1ZVYA 4Y4HD 3VXSB 3WE6A 2IG2H 3PUCA 4PP1C 5GS2D 1PEZA 3LEVL 4OQTA 2V5YA 4FFVC 4RNRB 4RRPA 4S11A 4OM1H 3C5SB 4K71B 3CH8A 2SEBA 1QFUH 3IDXH 3U83A 4HBCL 4WFHE 4PRPA 1UENA 3ULVH 1D9KB 2BVYA 3L3JA 4PFEA 4KRPD 1N4XH 3EO1A 5F7FA 1GGCH 2ENYA 2R0ZH 3O6ML 4HIIA 4U7MA 1RJLA 2Z92B 3BGAA 4P5KB 3S88L 1RZKL 1FQ9C 5CSBA 1B0RB 3SQBA 3LQMA 2ZUVA 1KENH 4OZGF 1IMHC 4Z7UE 4LSTL 3V5DA 4M93B 3W11C 3WD5L 2NY1B 3HKFA 2IQAA 1MREH 4KAQH 1A1NB 1IZJA 3R0NA 2BOBB 4P5TD 4YXKH 5C0DB 2JLLA 1DUYA 3PQYD 4PRNB 1D5BB 1MCHA 2HKFL 5H35A 2AKRA 1M6OA 4QCIB 2P44B 3OAYH 4Z7UF 3B9VA 1HHKB 5JW4M 1AGBA 1KBGL 5T3XD 3FHAA 3CSGA 5LGJB 2R2HA 1BP3B 1ZTXL 2QQKH 1U6AL 3S34L 2P5WB 1HK6A 3MV8E 1KB5B 5I15L 4JPVL 3LQZB 4XVUD 1AD0A 5AZ2H 2C5DC 3MBEC 5IWLC 4ONFH 1V5JA 1SVCP 4LF3B 4QRRB 3QUKA 1NKOA 1MRCL 2XA8L 4PGCA 3EYVA 2DS4A 4XH2A 3W5NA 2IGFL 5E03A 4BFIB 1JL8A 2QQLL 4JN1H 3KPSE 2X4OB 5DTFA 4CBPA 3I02A 4YHMH 3FO9A 3PWUB 1JWMA 2IALB 3GSNL 3O0RL 3LIZH 4WHYH 4MDJA 4LARL 1M71A 2J4WH 2D4DA 1ZLUH 1FE8L 4OKVB 4EN3D 2B4CH 3QEHA 2DIBA 3IGAA 5DD0L 4OGZA 3W39B 4NZUL 2AVGA 2A83B 3GHEH 2DLIA 1AGFB 3IDIB 3ARGC 5F93C 1ZT1A 1KYOK 1A1MB 1ADQL 3LRHA 5TPWL 4YHLL 5L2JA 2HT2C 3K2UH 4NO5A 4FFYL 4Y5XB 4NSKA 4X8JA 1I1FA 3AXLB 3R06B 2ZUQB 3QDMA 3D18A 2BSSA 1KPRB 3H7BB 4LHJB 4KRNA 4JY6A 5KSAC 4LSQH 3O11B 1CFNB 3RPKA 4HZLB 1UEYA 4FQXA 3OR6B 1MCRA 2HLAA 5E56A 1X5HA 5KSAA 4OFPA 1DN0A 4ZSOE 3G6JA 4WW1B 2D7PA 3B9KC 2DIJA 2KQNA 3B3IB 4ZUTA 1Q8MA 1RZIA 1XH3A 4HCRH 4ODWA 4AL8H 4XBEL 4LLWA 2EO9A 2AJXL 4XWGL 4KK5D 3V6BR 4YIQA 3KPQB 4K3JL 3VG0H 5IGXH 2YRZA 3ARFC 3CX5K 4RFEB 3C2AH 5GRZA 1UCBH 2V7HA 3O81A 3IDNB 4PJ9B 7CGTA 3HLAB 4HF5L 4TULH 2MCPH 1UYWH 4W68A 2XKNA 2H8PB 3FCTA 2HJKB 1NCCL 5C92A 4JM2A 3ALWA 4HS8L 5J89A 5F7LB 4BKLA 2CIIA 2VDPH 1F8TL 2H45A 3KPPB 4R0LB 1KACB 3FFCE 2QTEA 2IPKB 5CJXA 2OTWA 1NJ9B 1Y18A 4WUUA 2VSDA 1D5ZA 1NAMA 2J8UE 1JF1B 4QRPD 1OB1B 3QQ9D 3QQ4A 1AP2A 2VXUH 4LSPL 4A6YL 3LRGA 4TRPL 3S97C 3V4PL 2YD3A 4J23A 1D5IH 3HZYA 5IKCA 5JPMA 3T65B 5IB2A 4ZFOA 5EZOH 1D7FA 5D7IB 2E9IA 4UU9B 3BKCL 4B41A 4KC3B 1JHTB 5DHVB 5E2VH 1UM6H 3G6JE 1ZLVK 1I3RA 2JB6B 2RCSH 3ETBF 4FQ2L 2JELL 3C87A 3O2DH 4I18A 4L29A 3OXSB 2AV1A 1QBML 4N9GA 4YDJB 2MWCA 1CFNA 4P2CG 3G6AA 2UUDK 3T0EB 1TCRA 4MNGB 3OR6A 2Z92A 4I3SL 4DKAA 1NDGB 3EJJX 4Y1AB 1NSNH 5GIRA 5F7WC 5AAWA 1YMHB 4ORGA 3QI9C 1M7XA 3F5WB 1Q0YH 3SGDI 2R1WB 3QFJD 3P40A 1KLGA 1DQJB 3QCTH 2ZJSH 2ZOKB 4Y16B 2Z35A 3BISA 4F7EA 3DSFH 5I30L 3P4OB 1T3FA 4NUGL 4YHZH 1MELA 4LQ1A 4MMXC 1MUJB 4FQXC 3QDJA 3B6SA 1J1XH 1WBXA 2XKNB 1V7NH 4TSBL 2AI0L 1G7LB 4Z9KB 5D5ME 2B4CC 3QBTB 4L8CA 2VR5A 3E6FA 3LQAC 3O4OB 2DRUA 5D6DA 5AZEL 4LFHG 5D7LE 5CIPB 1FC1A 3CVHL 3H0TA 4HCRA 3WNMA 1VKXA 5DJ6A 3NOIA 2FO4B 2GAZB 1DBBL 1INQA 4MQ7B 4JDVB 2OR7A 2FWOB 1UVQA 2XFXA 4P3DB 4HGWA 1DSFL 1CD0A 1X7QB 3ARYA 1WF5A 2DB8A 5MENA 3HZYB 5JPMB 4HUUB 5IKCB 3ARPA 4PGZA 3U2SA 1UWGH 4Z7NF 1QNZH 4I0CC 5DJ0B 2VDQL 4ZDHA 1CL7L 4G5ZH 3LRSB 3NPZB 1YZZA 2GKIA 4V2CB 3E8UL 1OM3H 1HI6A 2Q76A 1XGYL 5EA0L 3ZSSA 4XPAH 4D0CB 1OAUL 5GJTH 5JQ6H 4MDJB 4JZOB 3RVUC 1M7IB 1TTUA 2DQFA 4QOKA 4YC2C 2FLBT 1A7QH 5DJAB 5E8DH 1L7TH 1QP1A 5F6HI 2YRPA 4OCSL 3W39A 3IDGA 4UDUA 2W9DH 1EEZB 2GFBA 3HR5B 4HKXA 1OAZH 3FRUA 3VFPA 1EX0A 1MEXH 3QDGD 2NLJB 2KL6A 1QLFB 1JWSA 5EZIH 1NGYA 3HMXH 5JTWA 3HRPA 4M7KH 2OL3H 4AT6A 2NY3C 3KPNA 5FA3A 5GRYA 3O11A 3ZDYE 1G7LA 4M1GL 4OLXL 2Y25A 4NO2A 1MJJB 4PRHE 3SHSA 2VH5H 4WW2B 4CN4A 4U4BA 2G75A 3NZ8A 4O58L 3M17B 4KI1A 2YD7A 2IPTH 2JCCF 1UJ3B 3MLZH 3QG7H 2BCKB 1CXIA 1GH7A 3GM8A 3FAWA 3HNSL 3VFVA 1LP9B 2LE9A 5I1KL 2YBRB 3GSRA 5E6IB 4P4RB 5D1QC 4AM0B 3BUYB 3MV7B 3D85B 3VXUB 4OIBA 3RX5A 2HG5B 1JN6A 1OWWA 4GAFB 4HJJL 5EIIB 4V2BA 4YBHA 4WFFD 3DYPA 3WO4C 1YUHA 3F7RA 2V7NB 1YEKL 3LN9A 1R3IH 1T7WA 1F58L 1BQSA 3FJTA 1IEBA 5MP6H 1FZOB 1IC1A 4PGEB 2A6DA 1HXYA 1MVUA 2FSEB 4NC1E 4PJ5B 1H3WM 1E4KC 1NEZG 4JGUA 3X12A 3P9LA 3QIBD 1T4KB 5HGDB 3BEVA 1NC4A 4BQCA 1P84J 3NABL 4KMTH 2W0KA 4EUPG 1KELL 5JIKA 1NGXB 2QHRH 3C5JB 2HA1A 1M1SA 2VLKB 3VFPB 4I3GA 4NT6B 5KN5A 3U0PB 2BSRB 4HLZG 2PYFB 1AI1H 4I48B 1DQTA 3ZE0F 5F21B 1S8DA 3BZFA 3R8QA 4QF1A 4Y4KB 3VH8B 4P5MB 5C08B 1JZ3A 3U4BL 2DWDB 3O3BA 4PJDF 5KS9F 2NW2B 4NQXB 4U1GB 1FZKA 4EDXA 3DO7A 1T2QL 3SOBH 3NPSC 4QXTB 2Q6WB 2EDNA 1SEBA 3P77B 2I9LA 4HV8A 3LVEA 2JJUA 3UO1L 1JPGA 4ORGB 1UJ3A 3V5HA 2BVPB 2PO6D 4NC1C 3LDBC 5JW4Q 3STLA 2XWTB 1I7UB 4JB9H 3PGCA 1AC0A 4EN3B 1BZ7A 4HC1L 3GMRB 3U79A 1HSAB 4U7SA 35C8H 3DXAA 4FG6D 5D8JH 4JO2H 4ZUUB 1MI5E 3T4AB 1JK8A 1R24B 4I3RH 3QDJB 4DFIA 3KJ4B 3L3GB 5DK0B 4OT1L 1J5OH 2MNUA 3WKMH 5C0BB 1AO7E 4CNIB 2F53E 1FNEB 4PG9B 4HSQA 1U92A 2R1XA 4UTBH 3ARDC 1ZEAL 4I0PA 3ILPB 2BP3A 12E8H 1EXUA 1OAKL 3GKWH 1XGQB 2LU7A 4XPFL 1D6VH 1FVEB 4BUHA 4JG0L 5MENB 3NCYS 4JFFA 5TQ0H 3NFNB 2HWZH 4DZ8B 4O9HH 2AERT 3BZ4A 3SGJA 2FZ3B 4HUXB 2QLVB 2X4SB 3BZFB 3B9DA 1ZHBA 4I9WE 5C08A 2R0LH 4ZXBA 1RUMH 4N0CC 3CLFL 5T1LA 5E4EC 5DVLA 5I0ZA 4KPHH 3W82A 1WTGT 3WFBL 5TFSH 3GJFA 2XNAA 3UJIH 1S7QB 1MJUH 2L4OA 4FN0A 2WZPD 4GW5A 5CINL 1MCJA 3VXRA 4LCCC 2IANA 3EJYD 3ZDYF 2R4RL 3N0PB 1QZ1A 3KLDA 3KXFD 5HHQA 5DRNA 3FL7A 1GVIA 5MEQA 1DBJH 4PRAB 4HDIB 1X9QA 1XR8B 5E7BA 3SDDA 3D0LA 1F11B 1H5BA 4QT5B 5IQ7H 4XCEA 3K1DA 3MXWH 3QNYB 3RL1B 3O2WH 1NGYB 1HQ4A 2EXYD 5TQ2L 4CVZA 1F02I 3X3GH 4LCIH 2BNUA 1IFHH 4WI8A 1GOFA 4OCWH 1W72L 3OF6A 1EH9A 4NPYA 4BSVB 1UXSA 1S7UA 3GO1L 4U3HA 4X5WB 1S9KC 3B5TA 3BPNB 4KTDH 5D72H 4HJGA 5BVPH 4PP1D 1ODAA 2NY4C 5D1XD 4PJ8D 4OZ4B 2Z8VC 4KTYA 4M6AA 4X9FA 1TPXC 4OAWB 2X4NA 4Q7DA 4QRUA 4Z76A 4J3SA 1RK1B 2K7PA 5B38B 2NY1D 5I16A 2EIZA 5EIIA 2DIAA 1SMAA 1AIFB 4NDMA 1ZHBB 1D9KC 1EK3A 1YUHB 4P3CH 1IKFL 2XZAL 1S9XB 1T89C 4R96B 2ED9A 4UT7H 4LAJH 2GSIA 3ZKSD 5L9DH 3QDHA 5ALBH 1NBVH 3EOAA 5J4MA 1F00I 4FABH 1YEEL 4QRQB 5KVDH 2G60L 3M8OL 4HUWA 2HRLA 4MJ6A 5HGBA 4IRSD 3ZTJH 2Y07H 4U1KB 4GAJH 3JV4A 3A6BL 5CWSB 2EECA 5IROA 4DKEH 3IDYB 1T6WA 3DX8B 5KVEL 1JPSL 2EYTA 2DQUH 2H32B 2Z9TA 1CD1B 5HDQH 1DBMH 4MYWB 3DGCR 2HP4A 3MCG1 3DV4B 3QNYA 4MS8C 1I7TB 1UA6H 3QDME 2VLRA 1ZA6A 4XP4H 1OAYL 4IOFC 5ESVB 1N2RB 2H26B 5DC4B 1KLFA 5I8EB 1EEUA 3DVIA 1WZLA 4M61B 4YNYA 1OARL 2YPVL 4LEOB 3GIVA 2RAMA 1UKTA 3TJEL 4X6CF 5DDHA 4PR5A 1PQZB 4J7RA 2QV2A 4NKOB 4CU7A 3ROOB 5I1EH 3MRIB 4K07A 1JPGB 4QXGL 3HAEA 1C1EL 2D31B 1RZFL 4TSCH 2CDGA 4X9IA 4PGJA 3RUGB 4YE4H 4XC3H 4GW1A 3REWA 3RIAF 2FD6H 4NKIL 1NANI 5E94A 3HE6A 3RA7H 1H3PH 3GB7A 2ZSWA 1U42A 2W9EH 3MRDB 1I85C 3QHTC 4EDWH 5C0FA 1FNLA 4CDGC 2HTKC 2BVTA 3EGSB 4FTVB 4PJXA 1RUPH 4YHOL 2EDKA 5BMFH 4I13B 1KXQE 5TDPB 2A6JA 4IDJH 4LSSH 2MPAH 5I1CL 1KXTB 2P5WD 4WDIB 3RZWA 5K59F 2VDLL 4ZOEA 2UVEA 2CLZB 5CZXC 1EFXA 4ISVA 1IGYB 3TBSA 1J0JA 2OTPA 3QUZB 1FYTE 4U31A 4HMCA 4I0KA 5DUML 2F54B 5MEPA 5I75B 1J1OH 2B1AL 3N1MC 5T5FL 4P59H 3T0DA 4HUXA 1P4BH 3BJLA 4L4VA 4KUCF 3EOTL 1IGCH 5DHYA 4HG4K 1QFWL 3TZVD 3LHPH 3O41B 1F42A 3BN3B 1J0KA 3OKDA 4GBXD 2YPKB 3W0WE 2AJYH 4S1DC 5CP3H 1BJ1J 4X80H 4X5XB 1KG0B 1FFNA 2UY7A 5ELIA 3HC3L 1D5XB 5FF6A 2VQ1B 3VFGL 2P4AB 4R90L 1R0AH 3GKZA 1ED3A 2CRZA 2DTMH 2X9WA 2EIDA 3S4SB 4G9DA 2HFFA 1MJ8L 1BQLH 3W2DL 4NQDD 2K1MA 4WCYH 1DQLH 5IV2B 4HJ0D 3GIZL 3MRDA 4G7VH 2CR6A 5DRZA 4YHYC 1U95A 1X5IA 1GOGA 1N59B 5FYJH 2F58H 3LKOA 3O3EA 5EZLA 5MI0B 3F6IA 3P9MB 3BQUB 3OG6B 4YHNA 5C7XL 2D9CA 2BJML 4L3CB 3IFOB 4J8RB 1FBIH 2VZUA 3V6ZB 1XGRB 2GIYA 4GSDL 4X7TA 2MJWA 4XPTL 4XNZC 5MI0C 4HGMA 2APFA 3VFWA 2XIDA 4YDIH 1IQDA 3VWJD 1HH9A 4PTUA 3O9WB 4R4NC 4Y2DC 3Q1SH 2V9QA 3WKNA 3MRHA 3F7VA 2LVCA 4HIIB 5I74B 4G8IA 4P23A 4QRUB 5JOPE 1FFOA 5DJ2A 4N1EA 2EIZB 2X42A 5KSVA 2Z91A 1IAIM 1LE9A 3GNMH 4Y2DA 4NQVB 4HUVA 4ONHB 1ZT7B 2DLGA 3C09B 5TE6H 1D5MA 4KY1H 2JCCB 3VI4F 4NHCL 4HKJB 4JY4B 2HT4C 3MO1B 4AG4H 1AQDB 3BPOB 3LN4A 3X14A 4WTZG 3TCLA 4NNPL 5I1DA 5T1KA 3RWDA 4ZNEA 4J3OC 4P2RB 4PY7A 1NBQA 4CW1B 5F89B 1FNGB 1WQVT 3CFBB 1OPGH 4HK3N 5ANMA 3LEXA 5E2JA 4YJZL 4NZRL 1YECL 4XVTL 3R4DA 2ATPA 1CN4A 5I8OL 1MOEA 3MV9B 3HC0A 1EHLH 1CR9H 2R8SL 1SMOA 5BO1L 1K6QL 3EFFB 5IV2A 4Y5VC 2R0KL 1LO3L 4FQIL 3D25A 2BNQD 1CXKA 3PGDB 3ZTNL 3GSVB 1KJ2A 1QFWM 3A6CL 1S5IH 3BEWA 2ERJC 2A77L 5EOCL 1TJGH 3AMKA 3I3DA 3CAFA 1K3IA 3IFOA 4LASL 4ERSL 1MNUL 3ARZA 1CLOL 1WCBB 2FX9L 4U2YA 5KS9A 2IQ9H 1SJVA 1MWAA 3SDAD 5C8JA 4LLVB 4J2XA 3T77B 3T0WA 2NCMA 4OQ1A 1GAFH 1IC4H 4NKMA 4PRHD 4LRIA 3LKSA 1AKJD 5GSRB 5I8KH 4XB7A 4DJMA 1PLGH 3VCLA 5JMOC 2DLFL 4PJ7E 5BRZA 3ULUD 3LPWA 2N56A 3S36L 4F8TA 3FOMB 5C0JB 3RU8L 2G9HB 4OZGB 2DQJH 5CZKA 2EDXA 2VAAA 3DBXB 3NIGF 1OSZA 4IJ3C 4LHQB 2FYYA 3ARVA 1F6LL 4X9HA 5GISL 5EO1B 4WDIA 3LN4B 3S96B 3C5SA 1AHWA 4WRLA 3X11B 1A6TA 3IB4A 4QY8B 2X70A 1XF3A 2P8LA 3NN8A 3PWNA 1WSST 4Q9BA 4RGMC 5F9OH 3WLWC 4M4RA 2NNAA 3MRFA 1Z3GL 3LEXB 5KTEL 4LMQI 1JZ6A 1INEL 1NBYA 2EDRA 4LPUA 1VEOA 3WUWB 4M1DH 5J3HC 4PLJD 4XP5H 1VACA 3OL2A 4UILL 5IMMA 2VR4A 4HQQL 5FDWA 2R56H 4DQOL 5JHLL 3U9UA 2AXGA 2F19H 2J6EH 3FKUS 3LPFA 3R1GL 4NRYB 3V6FA 4AIZB 2YPLA 3IXTA 1HKFA 2R69L 1IE5A 2PETA 3MRLB 3O41A 4ALAH 2CK0H 4O2FA 3VE0A 5JHLH 2WIMA 3GI8H 1BHGA 5HYFA 4QNPE 2WBKA 1YYMH 5ACZB 1OQXA 1ZV5A 2RHEA 5GGRB 4Z18A 2W9LA 2UUDH 4JJ5A 4KU1A 5E6YA 4UBDC 4NCC1 2CKBL 1YY8A 2WWMD 3T77A 1XF5B 3M1BA 3O6FD 5IVXF 4G6JH 3T2OA 2CRYA 4XMPL 2PN5A 2J88H 3UJJL 3WHE0 1MHPH 4R0LA 4JDTL 3GBNL 1F3DH 2AEQH 2V9RA 4NWTH 1YJDC 2DF3A 4NJ9L 1MCWW 3I9GL 2ZCKL 2XTLA 5DD1L 3BP4B 3EO0B 1KTRL 4H0HB 2ED8A 2VXQL 3T3ME 3HPJB 1JFQL 2VAAB 2ICCA 3B83A 2JJTA 2LQRA 2ARWA 4U3XA 3MV01 2AJUH 3D39A 3BH9B 1XGRA 1C5CH 2YXMA 3LSOB 3OTTA 3FN0L 3MZGB 3TPUA 2AEIT 1RHHA 5D70L 3IJHB 3PWNB 2GTZA 3UX9B 1KV3A 4K94H 5JXAH 2NY2C 3MRFB 4BZ1H 1WEJH 1Q0XL 1BIIB 4YEEA 4KTEH 5C6WH 5HDLA 3DOSA 5TDNA 3T0ED 2BY0A 1OAXL 2NX5A 4NM8L 3QIUD 5DQ9A 3QJHA 1FYTD 3VWJA 1MQKH 4G3YH 3EDJA 2NZ9C 2A83A 1HHJB 3SDCC 5EOCH 2HMIC 3JWDL 3H3BC 5FOJA 3V6FB 1NUFA 3MZTA 3O8XA 2B1HH 3ZTNH 1HXMA 3NPSB 1DE4B 1HNFA 4OSUL 2DYPD 5C0BD 1S9VA 3TO4B 4PLKD 1SEQH 3L1OL 4MXQD 3SJVE 1MUJA 4Z78B 1G7JA 2R0WL 1FL5A 2YWYA 4MAYC 1AFVH 2XA3A 1FNSL 1T80A 4OUOA 4L8CB 4MWFA 3U46B 4FQXB 4LIQH 4PJCA 3WIIL 3MV9A 2DD8L 4DGIL 1OSPH 1N3NB 3ARGA 1DDHB 3JV5A 4DEPB 2ADJA 3A0OA 4NRZA 5ADPL 2QQQA 3BP4A 4M03A 7FABL 1PY4A 1C5BH 1WFNA 5DZLA 4JFXA 1X7QA 2VDRH 3SO3C 3HTLX 1I1CA 4TSAL 1C08B 1UZ8B 2E3VA 3D3VD 2VYRE 1BFTA 1OGAB 1BZQK 3HUJE 4PS4L 4TPRL 3G5VB 3OSKA 4H26B 5GGUB 1JGUL 4ZUVA 1BVLA 3GBMH 2GTZB 2HJKA 5DQDL 3DX6A 2NR6C 3RVXD 4PJGE 5F7DB 3CMOL 2ADFH 4XNXL 1RZGB 3SDAC 1NL0H 2OX5A 5BRZB 4WI4A 2VITB 4UDUB 4RFOL 5DWUL 3HR5A 5C7XH 2OBGA 3DBXA 1UXWB 3BP7B 2FGWH 5E5MB 3QUML 3CK0H 5KSUB 2BVOB 3GJEA 4DGVL 5GZOD 2A2QT 1JHKH 1RI8A 5BJTB 4X6DF 2RJMA 5GS0L 2P5EA 4XWOD 4U1JA 5FO7A 2EH7H 1A7NL 2YPLE 4N9GB 5D2LF 3PL6A 1CWVA 4R90H 3CFDA 3LKRB 3HPLA 3VXQA 5JO5A 3ZL4L 3JSSA 25C8H 1HILA 4X80L 5HPMA 5EO0A 4DW2H 4PTTB 2CPCA 2ADJB 1I7ZA 4G43A 5E6IC 5BZWA 3IVKA 5LGHH 4XAKE 2AV7B 3Q6FB 3WIHL 2HFGL 1T7YA 1WICA 4MXVE 4W6YB 3L5IA 4XRCB 4IIQA 1PJ9A 2X1WL 4OCMC 3MUY1 5E2TH 2DQHL 1RQ5A 1WUNT 3CFKA 4FXGA 5HJ3B 5KAQF 4ZD3H 2C3VA 4JZNA 3RNKA 1WFUA 4OGXL 2WUBH 1GHFH 4JQIL 1I7RA 4M43H 2D4FA 1U3HB 1T4KA 3VFUB 4LSSL 1INQB 3MOQA 4U1LA 3BX7C 5GJSL 5TGBA 4PJCE 1NGXA 3HPJA 3BE1L 1KPVB 5K33A 3TBTB 2DI8A 5F9WC 1S9YA 4NQCA 5CD5C 2BFVL 1E28B 4J4PC 3DUHA 2PCPB 4TQEL 4D8PA 4XMKH 3WHE1 2SEBB 2VISA 3TVMD 2Q76B 5DC0A 2DQTH 1H0DA 3N85L 4GG6A 3RUGF 3D0VB 4KVNL 1RK0B 4HWBA 3SKNB 2RQ8A 4WIQA 4ZPTB 1X5KA 1T2JA 1I1AD 4K3DH 5F3BA 4NZDA 5KG9B 4M7JH 4LLDA 5KSAD 5HPMB 1AE6H 1EEZA 2BVPA 4ELKA 3G6JF 4U1NB 5IT2L 3MRRA 4ODWB 1A4KB 1DANU 3T0EC 4Z7QF 4PJDB 4PBVC 5INCA 2NR6D 4X7DC 3NGBB 5E9DD 4YXHL 3KLAA 3DVGB 3L5WB 5ID0A 5KSBF 1YNKH 3WJJA 1R24A 3FQNA 1FL5B 5DVKA 1A3LL 1IM3A 4O51A 1UCTA 1NCNA 4FTVE 2Y07L 4RIRB 2FIKA 1JHKL 2IF7A 3MV8B 3GFUA 1N0XL 3GSXB 3OKOA 1FIGH 3IETB 3MLYH 4NQDB 5DFVC 3H9HA 3B2VL 3VXME 2P5EE 1U92B 4K23L 4N5UA 1NBVL 1NAMH 2WV3A 5D2LB 4N0FB 1OW0C 1OP9A 1PG7H 3V6OA 1T6VN 3CFCL 2E7CA 4UV4H 3G08A 4P2OB 1LP9A 3QSKB 2JJVA 2ADFL 3FB7A 2FEDD 4NQSA 1LP9F 1J0ZA 3T65A 3D3VE 2MKWA 1SBBA 5D5MF 1DEEB 1TVBB 1KN4H 3HE7B 1PBYA 4MD0A 5D7JB 3FO9B 3PWUA 1RU9L 4P9HH 5HYSA 1EHNA 4KUCD 1G9MH 4CVUA 3WSQH 3VI3F 3SKUD 3AB0B 4CVXA 4KI5F 3H9SB 4MGXA 5IB3A 1MCNA 2FNBA 4WHTA 4C4KT 3PNWA 5T3XL 3QEQE 3VXUD 3PWJB 3B2UC 2EH8L 3KVQA 4JKMA 5SWZD 1C5BL 4D2NA 3ZE2F 2V17H 1C7SA 1EERB 3JV6B 4OCWL 1HSBA 2VDNL 1AGFA 2X4QB 3STBA 5DJCB 5TQ2H 4WUKH 2I26N 2YK1H 1P4IL 8CGTA 4LIQL 3V0VA 1FNSH 3LMJL 3VH8A 3DX9B 3EZ8A 1DN2A 4FZEH 4OZIA 1OVZA 2CGRH 3U4EB 4ODSH 2XT1B 2C1PB 3QAZB 4FQPA 2R2EB 1L0YA 5HHVH 1UXSB 3IU4H 3ORJA 3GMLB 1LEKB 2XPGA 5FK9B 4QRRD 5I76A 2QSCL 2XTJC 1YQVH 5C9JB 2V2WA 3H0TB 3OHXA 1IGMH 5TFSL 5TE4H 4DEPC 5DJZA 2ZPKL 2FBJL 4PJHF 4Y4FA 1UVQB 4TN9A 4KUZH 5ALCH 1TTGA 3NH7L 3ME0A 5E00A 2EYRA 1Y0LA 4U1HA 4WO4B 5FYLE 5GRJH 2NY0B 5D2LE 4HIEA 3MJ9H 4FP8H 1DEDA 5KS9E 2HT2D 3L5HA 3VXTB 3KYOB 5KOVC 4ETYA 5EB9A 1DEEA 1RY7B 5D70H 5E9DB 5E8NA 3SE4C 5IB1B 3P30H 4P2QB 3F6LA 5CSZB 3V0WH 2CXGA 2I60H 1U8HB 1QQDA 3CCHB 4WV1C 2O5YL 4M1CD 5JOEA 5GS3A 4JZNB 3RNKB 1DLFH 2VAJA 1PZ5B 4JFZH 3PHSA 1JI1A 3MLVH 4R97C 4RQQB 4KH2A 3KPRB 4OT1H 3RDTA 3RL2A 2FGZA 4QRSA 1IAIH 1GGBL 4X6CA 5AG8A 1MFDL 1T1XB 3K8MA 1C16A 3PGFH 4K7PX 4KKCD 5ISZA 5E4EB 3CVIL 5C2BL 3OZ9L 5DEZA 1WIUA 4PUBL 1YN6A 1Q38A 3L7FA 4H5SB 3KPNB 5FA3B 3THMH 3TFKD 1XGTB 4YO0B 1CIDA 3I6KB 5DMKB 4HH8A 4NNXA 3H9SD 2O5ZL 4ZYKA 3HI6H 4GW5B 2V2WB 2OI9B 4MHHG 3ESVF 1IT9L 5DJDB 3VRLF 1WBZB 3EOBA 4U1IA 1L0QA 5SWZB 4Y4FB 3MLRL 2VC2L 4HDIA 4IOIA 4YZFF 4QO1A 4XC1L 4O2EA 3EYUL 5GRUL 4P9HC 2X7LA 3ROLB 3RVWD 3I75A 3ET9F 4NKQB 4H1LA 4IRSA 3UEZA 1YNLH 1U3HC 1WAAF 5D7LB 1ACYL 5EU4A 2VXSL 2V7NA 3QUXB 5K9KB 1MCOL 1WAAA 4N5EC 3BKJH 4O5LH 2DYPA 4QGYA 4YDLB 1XF2B 4L9DA 2YR3A 4XPGH 4HJGB 3OGCB 1EJ6A 5CP7B 1TETH 3EYUH 1J10A 2FO4A 1DBKH 2GAZA 4LKXA 1N7MH 1NC4B 2VC2H 3GK8L 1RZ8A 3AAZB 3MJ7A 3VWKA 5BVJB 4RBPH 2DKSA 3FB7B 4YXLH 5HYQA 5B38A 1F6AA 4TTDD 3M45A 4XMLH 1I3GH 3UMTA 3WJLC 1J11A 4Z77A 3NH7H 2HTKD 5D1XA 3P4NB 4LL9A 2VL5A 3DROB 3T3PF 1MNUH 3DETD 3FTGB 3K1KC 1IGFL 5F6IB 2IPTL 3I6KA 2UWEA 5TE4L 1A02N 3MRQA 4NN6C 5HI4C 2CQVA 5KVGL 1QBLL 2Q6WA 1KCUL 1N26A 3ARBB 1HCVA 2VQUA 3B8SA 5DFVD 3UC0L 1GYAA 3MYJA 3IDGB 3C08L 3MLWL 1JF6A 3MLVL 5FM5M 2EDDA 5EN2B 2B2XL 3SDYL 3GMQA 1QEWA 3ZKMD 4OD1H 5C0AB 4NZRH 4O2EB 1JWSB 2DM3A 1ND0A 4M7LL 1F3JA 3U6RB 3O3EB 4IRJB 1K8DA 5CBAB 1A47A 3QJFA 4PRIA 2X89A 4HFUL 3S5LB 1OTUD 5B3JF 3ZKXB 1NCWL 1UKQA 1P1ZA 4YK4B 4ZOCA 4NHCH 2C1OB 3G6DL 5T3ZE 4X7TB 1KCLA 1LQSR 1H3TA 4IRJC 4KJQD 1IAOB 4PRBA 4PD4J 2D3VA 5JQ6L 1OT2A 1A22B 2EIEA 1X4YA 3AMLA 2WQRA 3VXPB 5I1LB 2AEPH 4Q0XH 5A16A 3E8UH 1OM3L 5CUSL 3VWKB 4P4RA 4AM0A 3FFCB 3B43A 5F44A 5HYQB 1JGEA 3AUVA 5D6CB 3VA6A 5C0EA 3TA3B 4NZTH 2J8HA 4MNQE 3MRBB 4EI5A 2UZIH 3EFDH 2YC1A 4DN3L 3VFRA 4Z77B 4MD5A 4JO1L 4K94C 3AU1B 5JW3L 4H88L 4ODSL 5TDPA 3QUYA 3MO1A 4OGYL 4AEIL 4LLMB 2BY2A 1PG7L 3NACL 1E4XL 4KXZH 1OTTC 1BBDL 1AR1C 4YDKH 1FO0H 1U8LB 4PRIE 5J8OA 3GSNA 1N6VA 2Z31B 2EDQA 4R7DA 1OTSC 2Q20A 2YUWA 1LNUB 3BGMA 4LGRB 3ISWA 4WCYL 1V7NL 1OLZA 5FM4A 1S7TA 3EBAA 4I48A 3OMZA 1U8JA 2BOCB 5I1GL 1DVFA 1YNKL 3D0LB 5T3XH 3VD5A 4LVOC 1YPZB 3DSFL 4LP5A 4L3EB 2DBJA 2X1QA 3TP4A 2ZJSL 1EHAA 3RIFF 1P7HL 2NY7L 3S5LA 4JPWL 3U7YH 1UJTA 1T7XA 5M94B 3IFLL 1BGXL 2D03L 1KN4L 2FECI 1C12A 4PRPD 1A7RL 4HWUA 1RMFL 2C1OA 1ZLWH 5BS0A 4HV8B 1QSEB 1T83C 1IGCL 1G7MB 1A0QH 2CDFA 4X0KA 4OTXH 1WITA 2NX5D 5DMGC 5GS0C 5T1DL 1PYWA 2X4TA 3VG9C 2KZWA 3L6FA 3W9EB 2EE9A 4NKDB 4HUMB 4BK5A 3MACH 1A6WH 5GHWL 2RCSL 4PJGB 5E2WL 2OR9H 2E7BA 1L9MA 1QSEE 4BZ2L 1TDQA 2OP4H 2PXYC 4EI6B 4MB5A 1ORQA 3OKLB 4F3FB 3K8LA 3CDYA 3PQYA 4TRPH