1ZT1B

Crystal structure of class i mhc h-2kk in complex with an octapeptide
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
98
Chain Sequence
b'QKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-K alpha chain
molecule tags Immune system
source organism Mus musculus
publication title The H-2Kk MHC Peptide-Binding Groove Anchors the Backbone of an Octameric Antigenic Peptide in an Unprecedented Mode
pubmed rcsb
total genus 14
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1zt1B00
2DQDH 3C8KB 2UYLA 4ZUWA 1X44A 4RGNC 1QFUH 4YO0A 1PKOA 3QEGL 4ZXBB 4OKVA 4M7ZB 4FQJL 3SDXB 4HG4J 4FTVE 1U8QA 4AL8H 3B43A 4IRSD 1KV3A 1BQHG 1KN2H 4G9FA 1BOYA 1R3LB 3LN5B 4AIXA 2JIXA 1OSZB 3GBML 4M6ML 3TPUB 1U8NB 1RZFL 4LDLB 4G8GE 3CSPA 4DVBB 3WV0A 1MJ7L 4JFDA 3TV3H 2CRYA 5DR5H 1MWAB 2FD6H 2C1PB 3SKJH 1OW0A 2ADJA 1ED3A 2FLBT 3WJLC 3DLQR 4G7VH 2O5ZL 4M1GL 3T0EA 5F8RC 5GGVH 4PJFF 1BQLH 4PRPD 4MHHI 5INCA 2IBBA 2YWZA 3M8OH 3LPFA 4GKNA 1R24B 2CKNA 4KK9D 3UTSB 3Q3GA 4PRNB 4ZTOH 4K8RD 4P2RD 5FDYA 2QKIA 1NCAL 1N59B 1NBQA 1JYXA 5GRJL 1RUQH 4DN3H 1PW3A 4KH2A 4YNYB 3WE6A 2CRIA 2J3SA 3PABA 3S3JA 2P5EE 3VFVB 3RNQB 5ILTL 4UTAL 1N6QL 3CMOH 1CBVH 2R0LH 4J4PC 4RFEB 2QQLH 3MJ7B 1JTTA 5DJDB 5D71H 3WJJC 1HQ4B 4HJ0D 4W68A 5LGHH 3RTQB 3QPXL 2NY7L 4K3JH 4OTXH 3U9UA 2HVJB 2FB4L 2PTTB 4G7YH 5HVFB 4HKXA 1NBZB 5EN2A 2ADGB 1XGPB 3QFJA 5F88A 4MD5A 1JPFA 4J3VA 3NMEA 1BBDH 1SJVA 4DQOH 3RL1A 1XF3A 2CK0L 3CFBA 3HNTH 4IMKC 4WI5A 2VC2L 5GISL 1EJOH 1JNNH 1CK0H 5GS0D 4JB9H 3MGAA 4I9WE 2XN9D 2E8YA 3MUGB 4NWTL 3C5SA 3GHBL 3FOLB 4HUXB 5D1ZD 1KFAH 1T7XA 1V7NL 4U6HB 5SWSA 1UWXK 3FL7A 1Q9WB 3V6OE 3AS2A 4P2QD 4JREC 5JA8B 5DD3H 2YMXL 4LSPL 4TSAH 2P45B 4HXAH 1MRCL 1BM3H 3LS5L 4HS3A 3U36B 2AJYL 3DMMD 1NFIB 4RCAA 4OGXL 4TPRL 4X6DA 1BHGA 2OI9B 4L8SA 3OPZH 1JPSL 2AI0L 2ARJQ 3P9WB 3TLRA 3UMTA 2BVEA 2W38A 3CFBB 5B3JE 4RQQB 4X98B 3BSZL 4XGZB 2LAGB 3C09C 5INDB 2FO1A 2R23B 1T4KA 3QUMH 4G8FA 1D5ZA 4WU5A 3EYQD 4OCNC 2NQCA 2X4UA 3VCLB 4YHPA 4X6CE 2IG2L 3G6JF 3H42H 4I5BB 2EO1A 5DMYA 1OAQH 4N8VG 4RZCA 4TQEH 1KELL 1M7DA 4WW2A 4PP1D 1JPGA 3EOAA 4FNLL 3HZYA 2EXWC 1SM3H 4HFWB 4LLQB 1VB9A 2V2TB 3ROOA 1O0VA 4CL7A 5ESQB 3DHMA 15C8L 3TO2A 1XCQB 1G6RL 1EV2E 4NQDB 1M05A 3WO4C 2OL3A 1PY4A 3FQTA 1YUHB 2UWEB 3TH4T 4Y19E 3P4LA 5FF6B 4I3RL 2NYYD 3CAFA 2J6EH 1NFKA 4M7JH 5I19L 4LARL 3ECBB 2I25N 5BJTA 4YK4B 2AQ2A 4AENB 4U49A 4Z7VE 1P7HL 3D2UB 2Y07L 2EH8L 1PKQB 1ROWA 1U8LA 3I85A 2DM2A 1GGBH 4N0UB 1O7SA 4X4ZA 2XACC 3IXAA 3KYMA 1N2RB 5GPRA 1H3PL 5TE6L 1NGWA 3NZHL 4TSCL 1MELA 3LKNA 4NQDA 4HKJB 1WT5C 2O61A 4ORGB 5DRXA 4QYOA 3MV9D 4LDOB 2ZSVA 4X7TB 2ENSA 1VFOA 4P9ML 3IVKB 4GAGL 1J1PH 3FQUB 5MEPB 3HR6A 2I07A 2CMRL 3ARBB 5BZDA 2ORBH 1B3JA 3UYRH 1B4RA 1JFQH 5FGBC 2J2ZA 1A9BB 1YY8A 1MLBB 1OF2B 3CIQA 3OKEB 5DZLA 1KCVL 1U8IB 1BOGB 2J12B 2V9QA 3O6LL 2MCPH 3CFCL 4YDJA 4EUPH 4LIQL 2OTWB 1ES0A 2EIBA 5DUBB 1PG7W 3V9FA 3SDXA 1BQHB 3ZYZA 2VDMH 3O3BA 4WI4A 5J6GB 1FFPA 4L3CB 5EZOL 5EZOH 1BIHA 2ARWA 2SEBA 1G9NC 3Q5YA 1LO4H 1KEGL 3BKCH 1SVZA 1I8KB 2ESVA 4ZO9A 1I3UA 3QEUA 3RIFK 1T7YA 3U79A 2OTUA 2CUMA 4LGRB 1FSKB 5EZLB 1CXHA 2OTPA 3MO1A 4QF1A 3TNNA 3ALWA 2P8LA 4LLMB 2E9JA 5SV4A 4RNRA 3HB3D 1A7PH 1M71A 2NY1B 5L9DL 4JFEB 4OT1H 4P3DA 3N1GC 5DJ0A 1I9IH 1PDKA 2F5AL 4K3HA 4RMQA 5INCB 5D6CA 3FKUS 3OSKA 1FFPB 4LLUB 5K59E 1W72L 1AO7D 2BY2A 4P3WA 1F3RB 3P4MA 3C6SA 1Q0YL 3P9LB 3MRLB 3BIAX 4UT9L 3MOQA 4JZOB 4OLEA 3DBXA 5IHUL 1E4XI 3EW3B 5CJXA 2WP3O 4L4JA 1N4XH 3CFJB 1DUZB 2NY6D 4YC2C 4LLVA 2ED7A 1DQMH 1J0YA 3LRSA 2H2PC 5LBSH 1UGNA 3GBMH 3TFKC 1QR1A 5CLWA 2FX9L 3V8OA 5C0CD 5DRWB 3BX7C 4LNRB 1I3RB 1RZ8A 2C3XA 1EEZB 5DT1L 4BZ1L 4IHOB 4MD4B 3B3IB 1P7KB 1NGPL 2AJUL 1L7TH 3HFML 3MBXH 3U0WH 5BOZG 2DS4A 3S97C 2EYSA 4Q74A 4R90H 2IMNA 3ZT5A 2YSSA 3EYSH 3KAAA 3NAAL 1FPTH 3H2WA 3C5SB 4JM2F 5D7IE 1DN0A 4H26B 2BVUA 2Z92B 3MRKB 3QUZA 4FMFA 4H1LH 4KFZC 5D71L 4Y4KA 5I8KH 4MXQD 3I75B 2VLRA 1S8DB 5DD3L 2XPGA 4DOHE 3F12B 2RFXA 5F1NB 1EAPA 1NCNA 4D9LL 4HS3B 2P8PA 2R9HD 3VW3H 4FFYH 4W81A 3HE7D 3WIFA 5I1KH 2VE6B 3BT2H 4GAYB 1GOFA 3L3DB 4FQ2L 4XNYH 3CPLB 3O6MH 5DMKB 4FXLA 5K59F 3EOTH 4QOKE 4XBPB 4R8WL 3TO4D 3J7HA 5ACZA 2NXZC 1MHPL 2ARJB 2K3TA 1WZLA 2XTJD 1DBAL 3EFDL 2WWKO 4KDTC 2FGWH 5DTFA 2GTWA 3EFFB 5HHOE 3UJTL 4XVUD 2HG5B 3CVHB 4U1IB 5CJ5A 3OL2A 3C6LD 3VXRE 2Z92A 4S1RL 2BNQB 3SJVB 1SJEB 4Y16D 4OTXL 4EQ2A 4BK4A 2JB5L 5ENWB 2VERN 4J12A 5EBMA 2FCBA 2VLRD 3GJFB 2XYCA 3RGVB 4O00A 2K7QA 2J8UF 1NC4A 1LD9B 1NGXB 4OLVH 4Y5VC 5FXCH 1YEIL 3CC5B 3RBSA 1CI5A 4JFZH 1MJUH 4FZEL 4R6UA 1U91B 3AU1B 2OQJA 4JFDE 4YXHL 4FQHA 4UQ3B 2EDDA 2HFGH 2NXZB 1SJEA 1S3KL 3C5ZD 1P1ZA 1R3JB 4JY4B 3OTTA 3VXSD 5GS3A 3TBSB 4R0LC 3QXAB 1WWCA 4U0QB 2YXMA 2IPTH 5C0JB 4NJ9L 4L9LC 4P4KC 1K6QH 1H5BC 3FO1A 4OZGB 5FECA 4KK5C 1I9EA 2GUOB 2EE3A 4U7SA 5IBUG 4FA8A 2OZ4L 4GW1B 3HC4L 1FJ1A 4HIJB 3OKLA 3PJSB 4WTXA 5D5ME 1OLLA 3EYVB 3MCLL 3BKMH 1U8OA 3BMVA 3MV7A 5C0CA 4KRMB 2BRRL 4GW4A 4KTEH 4F8QA 5IFJA 4HLZH 2BVPA 1DZBA 1MSPA 1ZHNB 4L9DA 3QULA 1W0VB 4HMDA 4KK9C 5GGSB 5C6TL 4NKOB 3SQBA 2EEBA 2VAAB 1ORQB 4H1LB 2V2XA 1F4XH 4N8PA 3W5MA 3EOBB 4RRPG 1Z9MA 1S9VB 1BQUA 4PJEB 5ISZE 4K55A 3V7AG 2X70A 3SDCB 4R4NC 3TNMB 4OZIF 2O5YL 4MX7B 1H15B 4X4MA 4NP4L 3UX9B 3WN5A 1HIMH 1AGEB 1I1YB 4XNZB 2QSQA 1P4BH 3SGKA 5IHBA 5J89A 4X6DF 4LFHG 1B88A 3G5ZB 5EA0L 2AJXH 3FQRA 3D3VA 3JUZA 4L29B 1B2WL 2MMXA 3PV6B 3HLAA 4QNPE 4MHHG 3T0AA 2FJFB 4DK3A 4JO4L 2CIKA 4NHCH 5KW9H 4PGCA 4XNMB 2NR6C 5J7CC 3IRZA 1BZ9B 4CU8A 4XVJH 1S78C 1GHFH 3WS6A 1F8TL 5EPMA 3DX6B 3JTSA 4AMKH 4W70A 4YBHA 1HEZB 4MAYA 5DFVC 3RVUD 1HI6B 3THML 4CW1A 4U0RC 1P4IL 5EOQH 2ICCA 5E7BA 4PJEE 4ZFFB 4KDTA 4F7EA 2X2YA 5FHAL 5HHQA 4NJ9H 1WV7T 1I1FA 3QXVA 5I30L 1NMBL 2JB6B 3D3VB 3HPJB 4JY5H 2BC4B 4G80A 1OP3K 1CGXA 5E6ID 3BP5B 4IIQA 1EMTL 4JQVC 3PGFL 4X7FC 5ALCH 3VRIB 3W9EB 3GM0A 3QA3A 1Q0XH 3ARDB 1P4LB 5IMKA 4S1SL 2R2BA 2EEAA 4JRXD 1N64L 4MAYB 2NTFB 3T0ED 3BKJH 3T8XB 4D9RE 5M7QA 2CJUL 1VEMA 1TDQA 3TBVB 4K2UL 2VXTL 3EOYG 3L9RA 4Z0XA 2F74B 1W72H 2A6KB 2FECI 3ES6B 3QDME 2JJTA 1NLDL 2A9MH 3KPLB 4LSSL 3LSOA 1R3KB 5D8JL 2BCKB 5HYJE 5DSCA 1XGPA 5HBBA 4RMRA 5HGHB 7FABH 5C70A 2GAZB 3QQ9C 1VGEL 1MY7A 3LQZA 2XZQH 2P44B 3DOSA 4HBQA 5JW5B 1IAOA 3OAYK 3MZTA 3S8WA 4ZS7H 5I1IH 4L4TA 1T1YA 4R90L 4OGAC 4NFDA 1SYVA 2DM4A 3OJVC 2IGFH 4M00A 2Y06H 1RK0A 3SKUD 5DT1H 1G6RA 5D7JC 4X80L 5CUSL 4D9LH 4N8VA 3BO8A 1NGPH 4HPYL 1MI5A 1CGYA 3MRHB 4LOUC 2E7LA 1NGQH 3SDXF 2Y7QA 1CL7L 3WHE0 5E2TL 2AGJL 5IMLA 5FIEA 3WFDH 4DFHA 3U0TA 2DRUA 1NFIA 4W4OC 2Z8SA 3RGVD 2GAZA 4TRPH 4FP8H 2FBOJ 5IUSA 4CVZA 1WBYB 5A2IH 1G7PB 2EDLA 1K4DA 1MFAL 5HPOA 4KZEL 2Y6SC 2WBJC 1FFOB 3BP7A 1VERA 2UZIL 3AREB 1NBYA 2JK5A 1QLRB 4MNQB 4U1SB 1JHLL 3BKYL 3SJVA 5L2KD 1NQBA 4PJ8D 1F4XL 1DQJB 3HI6H 1I8IB 4OKDA 4POYA 3AREC 1LO5A 1RVFL 2CO7B 1QBML 2P5ED 2HTKD 2VDLH 1FIGH 5CAYB 4UUJA 4HHAA 3TO4B 2ZKHL 2IWGA 4UU9B 1AO7E 2H2SC 3DETD 2VDPH 5FEBA 4O2FB 2BNUB 5D7IB 1SBSL 2P5WA 5MERA 4LLQA 4R97C 1CVSC 5B4MC 2X6MA 3EGSB 4WUUB 3BPOC 4WCYL 3HRZA 3O45A 5DJ8A 3VGBA 1CICD 4LRIC 5HGGS 4JO2L 1F00I 1KEMH 1OAUL 4OGYL 1JFQL 3T77B 3IU3A 1C5BL 3BUTA 4RAHA 4RX4D 4YAQA 3WEXA 1YUHA 2UWEA 1H5BA 1CGTA 3BESR 2DAVA 5I1GL 2NY0C 4ZODA 1MHHB 1WC7A 2J6EL 4U1NA 3VXOB 2YK1L 4KUCD 1U3HB 1TJIL 4TTDC 3SKMB 1LE5B 5F6IC 3VMNA 3D2UA 2X4NA 1FYTE 5E9DE 4J4PD 3N0PB 5DQDH 5DK0A 3F58H 4Z78A 1NDMA 1MJUL 1BIIB 4QHMA 1XMWA 5TGBB 4NRZA 1W0WA 2EDRA 4WHTB 3U7WL 1OPGH 2HT4C 5C0CB 4JFQA 4BFBD 4ORGA 3GMLA 3MOAH 4TQEL 1ORSB 5KS9E 5J11B 5IB4A 2JE8A 2BHUA 3IVKA 4C4KO 3QDMD 4M61A 4O02L 2CKBA 3GHEL 5CD5C 4QRSA 3UTTA 3ZDZE 4NCC1 3SE4C 5F1IB 1F11B 2YEZB 3JBG7 1JWSB 2NY2D 4ZUTA 1A6VH 1BBJB 1Q1JH 4MMZC 5D2LB 5DFTA 5E99H 1FZJB 5HHPB 4TULH 3QXUA 3TM6A 3P77A 5GRYA 4M6OH 2DQCL 3FB7A 4OD2B 2KUTA 4Y4FD 3CVIL 3CXDL 4FHBD 3O6ML 1IEBA 1CFQA 4YPGA 5GGVY 2GQHA 1D5XB 3RGHA 1OAQL 1A0QH 1LK2A 4D2NA 3SN6N 1NCTA 1F3DH 1SY6H 2NW3A 5TH2A 2AXFA 3KJ4C 3QAZC 5KSAA 1IGTB 3VFTA 4NPYA 3MO1B 5A43C 3WHXA 3GFUA 1FNAA 1PLGH 3NCBB 3A6OA 3U0PA 1HWHB 1UH4A 3P40A 1Q9OA 4OQ1A 1AGDB 1H3PH 3QAZB 1J0IA 3HAEA 5J12B 1CR9H 3ULVF 4OGXH 3IDXL 1J05B 3BJ91 5FB8A 4Y5XA 4Z7VA 3O6FC 4PV8B 4XBGB 3WNKA 4UMGA 4D0CB 1KTDB 1I8MB 1MEXL 1DEEA 3GMOA 1IFHL 2QV2A 1ZT1A 4ELME 1KNOA 2QSCL 4HJGA 3GHBH 3W2DL 4XP1L 5HVHC 3WIHL 4AG4L 4KROC 3C87A 4PB9L 5JPMB 4PRAA 4OGYH 4JZOA 3BWAA 3AY4C 3FQNA 4QHUA 3HMWL 2VLKA 2OL3L 2X4PB 1ZANH 1RK1B 1DUYA 1OARL 3TEUA 1ZLVK 3U46A 4UNUA 5T3XE 3RZCC 4LLVB 3MXWL 2HVKA 1UWEH 2UZYB 3GDBA 5CKGA 4HWBL 3EJZC 5CZXC 1OAZH 1T1WA 1XIWD 5TQ0L 2HJLB 1DEEB 4G3YH 1V8HA 1FO0L 3C8DA 1RZ8B 5HDQH 5HGHA 2D0HA 3GNMH 2AV1B 4WUUD 3D9AL 4CNIA 1IKNC 2B5IB 3SKOB 2B1AL 3BKJL 4KPHH 5LCVL 4L8DA 2HFFA 1KIQA 4AT6A 2A6JB 4OCLC 2IH1B 1WAAA 2P5EB 3QZWG 4AYFA 2DLIA 3BEWA 2H1PH 2PYED 4PY7A 3UJJH 4Q97A 4DJMA 3GUTA 2Y72A 4X80H 3OHXA 5CUSH 3S5LG 2NX5A 3RZCB 3SCMB 3TESA 5HY9A 2BRRH 2VDML 4JCMA 5ID1A 4LBEA 5C07A 3V7MA 4FABH 1J8HD 3MOAL 2AV1A 4OD3L 1FCCA 4ZS7L 5I1IL 1PEWA 4OD1L 2VB5A 5ILTH 2XIDA 3CFEA 4MD0A 4Y4HC 4KGLA 2XWJB 1CDBA 2OXGA 4HEME 2IH1A 2VDKL 3K2UH 4G8EA 4U2YA 1GSMA 3AFLA 4ZO7A 4NYLA 5HYJB 1XGTA 1E6OL 4X99A 4G6FB 1U6AL 3DTXA 4P9MH 1FAIH 1ZWIA 2BSTA 4LRIA 1X5LA 4I0PB 4K3GA 1W2KT 2UUDK 4JRYB 1NDGA 1EFQA 5KSAC 5CKAA 5CILL 4WFHD 2OX5A 3F6LA 5J1SC 4NNXA 3BDYH 4H8WC 5D7JD 3VA2C 5K9KA 4AY0A 1A1OB 5DHVA 4NKMB 3ELAT 3NCFB 2KZWA 4DKEH 4ERSL 2V7NA 2W9EL 3AUVA 2R0KH 4L3EB 1MFNA 1TXKA 5HGBB 4H8WH 1B9ZA 4G8EB 5D1ZB 3UTPE 1U3HA 4LSQH 1YPZA 3OX8B 1RZKL 2EIZA 5TQ2L 1IAIH 1CXFA 5IJKA 4F58L 1DFBL 3S36H 1YEDA 2HP4A 4Z78B 3MJ6A 3JTTB 3QEGH 3IDNA 4M4RA 3NZ8B 3GSQA 4L1DA 5JTWA 2IC2A 1MFEH 2X4QB 1GRWA 1U3JA 2BSRA 3UTZB 1A1OA 2JJWA 1MUJA 3T3PE 1U3HC 3LY6A 3FOMA 1EH9A 1GGYA 4PJIA 1QRKA 5KSBA 4Y1AE 5IJKC 1BX2B 1FN4A 4NRYB 3FN9A 1YPZB 3OGCB 3OX8A 5FO7B 4YX2H 1ZA3A 4RIRB 3EO1A 2MJWA 2EC9T 1VSCA 4QGTA 3BEVA 4F7MB 1E27B 1KBGH 5DXWA 4APQA 2W0FA 4FQJH 2D7NA 1GJIA 4HG4K 1ZSDA 5HHOA 5IMMA 4FQLH 3RTQA 3P77B 5C08E 1CWVA 4NQVA 1OWRM 2FRGP 3GIVA 4N1CA 3ZYIA 2OR9L 4EN3A 4LPTA 4PJXB 4GXVH 2XXMB 4BQ8A 4ZDHB 3UC0H 5HTSA 5IMOA 5ISZB 3QUMA 4K8RC 3RX5A 3HZKA 3T4AB 3T2QA 1DBKH 3RWCB 4P2RA 1RAMA 4AEIL 4XBEL 1AY1L 5C09A 3RRQA 3HLAB 3FMGH 4F7CB 4XCCH 5LJYH 3S36X 4RA3A 1LEIB 3WKMH 5BQ7A 4NCDA 1BVKB 2Y23A 5BV7L 3MOBH 3WDJA 1TZGL 1J8HE 5GS2H 4K2UH 3V5HB 1AGDA 2ATKB 4OZFB 1JZ7A 3NPSC 1J05A 2XKSA 2IJ0C 4XHJD 1EHAA 1J8HB 3WXWH 1E4XL 3QDGD 1KTDA 1I8MA 1IGML 2I24N 3O3EA 3HE6B 3HZKB 4XWOC 1SHMA 3DGGA 5D5MF 5IFHL 3WIIL 3RWGB 3QI9B 5B39G 3AC0A 1KLUA 1YEHL 4JHBA 1T66C 3IKCB 4G8FB 3IS1X 3HNSL 1CBVL 3U4BL 1A6UH 1I7RA 3U7AA 4QHUB 5DMIL 1IEAB 3TWCL 4UI2A 4DKEL 5DMGC 4ERSH 1LEKA 1P4BL 4PLJC 3TN0B 5D1XA 4Y4HD 4Y8AA 4U05A 1AXTH 5C0RH 5IVXB 4OZGF 3ZE0E 2DDQL 4N0FB 1TZIA 1SMOA 4KK5D 5ADOL 4TUJA 4F2MB 4LMQE 4X0KB 4F15B 2V9RA 3TBVA 3HE6A 2QL1A 2HJLA 4P57B 1MVUA 1A64A 1KCKA 1MCLA 1X5ZA 2PTUA 2NXZD 3RWGA 1NFDB 3GO1H 3UJIL 3PWJB 5C7XL 1IGIL 4MNHA 4C56B 2A0LC 5B39A 3FOLA 4XVUC 3RWHB 2EDQA 3FRUB 1RZKH 1K9TA 3LN4A 4EXKA 2FNBA 3VD7A 4BFEA 4I9WD 3O4OB 1H0DA 2AJZA 2FIKA 1UM5H 3DPBA 3JV5A 5JW5A 5ID0A 4LHUA 2DBJA 1J0ZA 1RIHL 3QDJE 4XNXL 3MRBB 5IVOA 2GJZA 5D7SL 1MIEL 2R9HC 2Z4QA 3V6FB 1KCSL 1S7SA 1G7QA 3X3GH 1FRGL 2P42B 2PW2A 4RQQA 4G3YL 5BS0B 3KR3L 2BNQD 1Z9OA 3DMMA 4HKZB 4MCZA 1S3KH 1FAIL 5I73C 3VXTA 4YDIH 3HPLB 3TGXA 1OT1A 5DEZA 1H3UA 4YHNA 3RTQC 1NC4D 3TVMA 1X5IA 4Z7WB 3QQ4A 3K8KA 4ZFZB 4M7KH 1TIUA 3O0RH 2Q7NA 4WW2B 4X6FA 1XEDA 4WO4B 1DQTA 4X5XA 3MRBA 2GJZB 4N1HB 3U1SH 1A7QL 2OBGA 3MRIB 1M7IB 4Y88A 2HJFB 3FT2A 1N7MH 3RVWC 2ZUSA 1KJ2L 3E8UL 4MCZB 4XP5L 3ZT6A 5D1QD 1JHKH 2PW1A 5ELIA 1UACH 5J06A 1HHIB 4Y4FB 3OJDA 3QIUC 2VN4A 4J8RA 4CDHA 5KVDH 1KJ3L 2A1WL 3DXAA 4HV8A 1UB6A 1UZ8A 5FM5O 4PP2A 4YHKH 3MSPA 5CEZL 3DURA 4NO0A 1YNTB 1NUDA 1F4AA 5B22A 1P7QB 3WNPA 1FBIH 3CCHB 4WW2C 4OLZH 5IJVB 1H3XA 4N0UE 2YRZA 4UILH 5F7NC 1JPTL 2CUIA 3GSXB 3MJ9A 1HH9A 5JLZB 5C0FA 4M4PA 3DUUB 3IFNH 3RVVD 3QNZB 1UWGH 4WWKD 3IGAB 1DQLL 1I1AB 2FGWL 4EKXA 5F7HA 3NAAH 1B4JL 5K9OA 5JPNA 5EOCH 5EOCL 3GSWB 4UT9H 1IKFH 4ODBD 4LAJH 4LLYB 5GGTH 1A1MA 3H3PH 4P23D 3ZSTA 3OB0K 2VLKE 3BE1H 4XB8A 2X4RA 1CFVL 1MRCH 4OQTH 3OR6B 4HGMA 3W81A 5L0QB 1ERNA 1D7FA 3V5KA 3B8YA 1S9YA 2IAMD 1A4JB 3F5WB 1BBJA 4X8JA 5IBUB 1XGRB 4LPCA 3WSQH 2DQEH 3HI5H 1I3RA 5LKNA 4RISH 4U1KA 3MRRB 3N06B 4PJ7B 2W0PA 3U7WH 2XTLA 1UT9A 3BOVA 3WD5L 1RV6X 3GSRB 3QUMB 4KQ4H 4JAMB 3ULUE 3ULVD 2PF6A 2CXKA 2F5BH 4RGND 5IHUH 5E0QA 4MJ5A 3I2CL 3NA9L 2X40A 5FUCC 4E0RB 3MNWA 1M71B 2OJZH 3OR6A 4GBXD 2H3NB 5BQ7B 2EYTA 3RVVC 3O4LA 1QHOA 5JMOC 5JNYA 2DKSA 6CGTA 3ARED 3B6SA 2EICA 4MZ3A 5L0QC 3WIFB 2BNRB 4JN1H 4KAQH 1QRNB 3C5ZA 4I1NB 5IVXE 4HS8H 3HS0A 4LKXA 5GRJH 4JM2A 2FIRT 3CVIH 2JJVA 1RUAH 5L8KB 4JFFA 4X6BB 3GMMB 4HZLA 3A6CH 4XCNB 4FTVA 5ESVA 2IAMB 2YPVH 4UT7H 2XKNA 4KQ3L 1ZEAH 4HUXA 4UB0L 1IQWL 3GSVB 4M1GH 3O4LB 2G75A 3GRWA 2BVYA 4TSCH 3PL6D 1UCBL 2YPKA 4ODSL 3IAPA 3RA7H 3UPRA 1P53A 4WV1B 4PRBB 5D70H 3FZUC 2DQUL 4CDGC 4YBQC 1IVLA 1RK1A 3B3IA 4N0FA 1QRNA 3WDHA 4Y16A 1F2QA 5JORB 1NANI 1BJ1H 2F8OA 3CH8A 3Q2CA 3QHTC 3QDAA 2LFGA 3VWJC 1GGIL 4LGPB 1ZA6B 3O9WC 4DZBB 3S7GA 4FZ8L 3NCMA 4M6MH 3AU1A 3HC0A 2NY1C 4G8IB 3VXSE 5MENA 4P5MA 1J87A 1FG2A 3MCKA 3VWJB 1FGNL 3CSGA 4IDLA 3TWCH 4ZNEA 1MFBL 4DCQA 1A21A 2F54D 4WIQA 3DX7A 3A67L 4X6EB 1SJHA 3LIZH 3PQYD 1LWRA 4KV5F 1Q9KA 2GJ6D 8FABB 4ODXA 3HZYB 5C0RL 1C5DB 2ZCHL 4GAYA 4ORZC 3LRGA 1UXWB 5H37H 1VADA 1YN6B 2WV3A 3QJFB 3DVGB 4U1JB 2BVQA 4BA8A 5ACZB 1M05B 5CIPH 1DN2A 4HBCL 1H9VA 2HN7B 3FQTB 4NQXA 3RGVC 1XR8A 1HN1A 4DGVL 1OAXH 1TVBA 4P0DA 1UQSB 4URTB 4LRNH 1BLNA 1QBMH 2FX8L 4DOHB 3D69A 3V0WH 1XZ0A 3TZVB 4NM8H 4XI5C 3LQAC 3T0DA 3PHSA 4ZFZA 1N5AA 5F89A 2VAAA 3QIBA 3SKJL 4P5KB 4HPOH 2X9YA 3AXLA 2NMSA 5LG1A 5DJXA 4ELMA 3MLWL 3RGVA 5KJRH 3NA4A 4PJBE 1QSVA 2YD8A 3LQAH 5E2WH 1WSST 3BP4A 1SYSB 3UP1A 4LSSH 2X44D 4AK1A 1QSEA 1MF2H 4N9GA 3VFWB 1FL6B 3GMRA 4HUWB 4AEIH 1BVLA 3L5WB 2VC2H 1R3JA 3U30C 1FVEB 1C12B 3QCTH 2EIDA 5H2BA 4PJGA 4UTBH 2YZ8A 3L3KA 3MA7A 3QFJE 4LPUA 4GXUM 4IM8A 4XXDB 1MAJA 1H8OA 1JI2A 3I9GH 5ESAA 3RWFA 3TZVC 3QPQC 1XR9A 4K3JL 3F7QA 1S9XA 1ES0B 1AD0B 1KLFA 4HT1H 5JR1L 4CN4A 1SYSA 1WJ3A 4HXAL 4WJ5A 3G9VA 4X6CA 3C8KA 3QXDB 4JFOB 4PTUA 3PWVB 5C0CE 5IT2H 5FCUL 1UM6H 4X5WA 1C08A 3WNOA 1ZHKB 4X7CC 4G80B 1FHGA 4JO2H 4H25A 4C4KT 4QF1B 3RKPA 3TNNB 2D03L 3UPCA 4EIGB 2VR9A 3G6JE 1P4LA 5ALBL 5AZEH 5DFVD 4D8PA 2W9EH 5TPWL 5MEND 4R4FL 2C1PA 3ZZ1A 5T3ZL 2G5BB 2LTQB 4HK3N 3K4ZA 3MMEB 4JHZA 3SDCC 4GMSH 3I6GB 1I1CA 1Z9SA 1NBVH 1C08B 5HDBF 2BY3A 5GZND 3SGDH 4S11A 1NMBH 1QFWI 3O41B 1DR9A 4NCC2 3V5DA 1MFAH 3IFLH 5CHNA 4KY1L 1YDPA 3BKML 4XPAL 1XF4B 5F9DC 4C83A 3MLTA 4Z7OF 5DZOA 5CJOL 4XPBL 4FQCL 4PUBH 3CX5K 1M4KA 3FRPA 4BQ6A 2NXYB 2VZ3A 3WYRA 3PABB 1YQVL 3L5JA 1HI6A 2LAAA 3NGBB 3GSNH 3M8OL 3NVQA 2PYEB 1ETZA 4XPTL 1LO0H 1A47A 5KAQF 5J1AA 1X7QA 1OCWH 4MQXC 4U6XA 3KS0J 3JV0A 4U0RB 2BNRA 1UCBH 4OI8A 4KV5E 2XI9A 1MIMH 1EUUA 1II4E 5I17B 3HC4H 4J2XA 4GKZA 1JRHL 4G6FD 1JWUA 5EO1A 3DROB 1T0MA 1RULH 1HIML 1UKSA 1F90L 2X89D 4PLKC 2YSSB 5IMKB 4NZDA 4FTVB 3OKOA 1FSKC 1NCWL 4OSUH 3R8BB 1LEGA 1DBBL 2C7UB 1I75A 3WLBB 3QI9A 3T3PF 3GMNA 4XCCL 3FN0L 4TVSa 3QNYA 1XIWB 5DA0B 5J1AB 5C0IB 3MV9E 1CLYH 1Q9WA 4PRBA 4MAYC 4Y1AD 5DD5H 4HCRH 4DAGL 1M6OB 2ICWJ 5MEQA 2APFA 1INQB 5T3ZH 1U8PA 3E2HC 4OI9A 3TN0A 2PYEE 2Q3ZA 1HHGA 3WUWB 3QFDA 1MI5D 1FORL 4L8SB 2ZUVA 2ZOKA 2R39A 3T1WA 3VFNB 3I02A 1HOCA 2Y25A 3BPCA 1XF2B 4PV9A 3QG7L 1QKZL 4RBPH 3MNZA 5B8CB 3EDJA 2CUHA 3TFKD 2WMPA 1D5MB 3EAKA 1P4IH 2F53A 3VFRA 3U6RA 3V4UH 3PL6B 3KXFB 5J13C 1T5XA 1JGUH 2AJZB 4U33A 2ICWI 5D7JB 4P2OD 5AZ2L 1T22A 1FZOB 1I7TB 2V2TA 2GCYB 4HC1H 3VG0H 5J13B 5CP7A 3GK8H 2MTPA 1U91A 1G7QB 1BFVH 3O8XA 1GVIA 4PJHB 4XP1H 4DVRH 4UQ3A 4BKLA 3I02B 1WUNT 3CVHL 1J1OH 4JFFE 1WT5A 2YHGA 3V6BR 4U3HA 1L9MA 3REWB 2NY5L 4XCYB 4KZDH 3W39A 3LKOA 4FFWC 5KSUA 3RNKA 4M93C 3VWKC 3QIBB 5JOFA 1NAKH 1S7XA 3QIWD 4HJJL 2FJHA 3L1OL 3BYTA 4UILL 3MLWH 1PKQA 4KI5E 4PYGA 5FECB 3RU8L 3S96B 3TIEB 4ODUB 1T20A 3REVB 3ULUL 2VZOA 4KKBD 4N9OB 1C1EL 3MUHL 3V6ZB 1TCRB 1NMCC 2BNUA 5D7IA 5MERB 2DQHH 1CVRA 3FB7B 2GEEA 3PQYB 5CP7B 4NUJB 2ID5A 1A9EB 3BGAA 3ZKNC 2P7TB 5GGRA 2WLYA 2XWTB 1BVLB 3L5WA 2WP3T 2EXYD 3Q5OA 2VRAA 3A67H 2DKUA 1LO3L 2VWEE 5C0AE 4U31A 4QTHA 1PGRB 3EDKA 4IRJD 3D0VB 3ZE2E 2YPLA 3VXNB 4OT1L 5KSBF 4L8BA 4ZOEA 2APVA 2DWEB 1A9BA 1EZVY 5GGQL 4K9EC 3VFMB 1UB6B 4BSVB 4E41A 1BIIA 4QHMB 1KB5L 3RL2B 5F70A 4FXGB 3QXDA 1INDL 4G8GA 4PTUB 3NFNB 2WBJB 3U0WL 2ZSWB 4FFZH 3Q6GH 2EYRB 3UYOD 3VGEA 2ZUYA 2ADIA 1RIVH 3KVQA 3MODH 1UVQA 2I9LB 4TTDD 3RY5A 3DV4A 5L2JB 4U3XA 2XZAH 3BUYA 2AV7A 3SDDC 3S35X 4HXBL 4YUEH 3QG7H 1PYWA 1U0QA 3UTOA 2AQ3A 4HWNA 1RZIB 4XCEB 2UVFA 1EVUA 5IVXF 3OKMA 4HK0A 3ULVE 5IG7B 3R1GH 5FGCE 2XOTA 4Z7VF 1FDLH 5BW7A 4UV4L 2APWA 3RUGA 2ERJB 3ULVL 1KIUA 5D5MA 5CGMA 5C7XH 5JW3H 3HMWH 1RUPH 3X12B 2E9IA 3MR9A 3DSFL 5D72L 5EWIL 4NO5B 2B4CH 3QUYC 3T8XA 3T65B 1BFOB 3MV8D 1ETZB 2OR7A 5FUZH 2DLGA 1ED3B 3KYNB 1IC5L 1D6VL 1A3LL 4O2CA 1HHHA 2L4OA 4PJ9A 4M43L 5HHXH 2LE9A 1YNKH 3GMOB 5JUEL 3SGEI 4XX1E 4BZYA 3S35H 2D0FA 4PRNA 4ZAKC 5FUCE 2H8PB 4NWUL 4LSRL 2QLVB 4XNQA 4GBXB 2P43B 4LIQH 4PRAB 3IXTA 5SX5K 3MJ9L 2ENYA 4DK6A 3BE1L 1KELH 4C55A 3VI4E 3WLBA 2A74A 3LN9A 1TZHA 3P4OB 1INEL 4OCXL 1OGTA 1FZMA 4KVNH 2XKNB 4OZHB 3GSUA 4OUUB 3S4SA 5HVGB 4QT5B 4Z18A 3TPKA 1HHHB 5C9KA 3RVTD 5E8OB 1WCBA 2MQ3A 4JKMA 1KSRA 1NH6A 3ILPA 5GGTL 3IDXH 5TDOB 2BX5A 4YHOL 1TJGH 3O3DB 3WUZA 1RJYA 3IDMA 3WIIH 1FFQA 2ZUQB 1UG9A 4CNIB 5GS0L 3QHZH 3QHFH 4GQPH 1YEFH 4ELKA 3QZWB 3RTQD 5IB1B 5KVEH 2GTWB 3MUGA 1NGZB 4UIMA 2HG5A 3CVHA 1HXMB 3MRFA 5KVDL 2NZ9C 1A2YB 1U8JA 4Y4HB 1H8NA 4OLZL 2R0ZL 3I6LE 3KNBA 1C7SA 5E8OA 4L8SC 4LVEA 3T04D 4PJCE 4X5LA 1U8QB 4N8CL 2CIIA 2Q20A 1C5DA 2E6QA 4NZTH 4ZMAT 4WGVB 2D3VA 2YA1A 1LMKA 2DB8A 1KN4H 2UY6A 4NIKB 5DLMH 5I0ZA 1NC4B 2J4WH 1WTGT 1EFXD 5HHNA 2DBLL 3HE6D 4XMPH 1A14L 3S5LB 3QIUD 2FEDD 2R2HA 3DYMA 3PDGA 1MLCA 5F7LB 4M7LL 3W39B 1GHFL 4I77L 1V7NH 3H9SE 3RVXD 2VQTA 5DJCB 1XZ0B 3VG9C 2YD4A 4X8XA 5TE4H 5IF0A 5D1QB 4KHXL 2FJHB 2YPLD 3RWJB 1WTLA 3U7YL 4U1MA 5EOQL 4NQCE 5I15L 4R4BA 4MDJB 4RGOL 3HRPA 4P46D 4ZQKA 3EOAB 1IAIL 5JHDA 4JRYA 4S0SD 2AXGB 4YQXH 4GKNB 3OWEA 4OFIA 1QO3A 1E28B 1XCQA 3DVIA 3PJSA 1NAML 4HEPG 4ZTOL 4MQXD 4XPAH 2DJSA 2V7NB 1MCWW 2B0SL 2F58H 2ADFL 5JO5B 5E2UH 2OP4H 5DFWH 5FYJE 2A83A 35C8H 3PP3H 1LEIA 3O6FD 5H2BB 1HKLL 2DWEA 3EHBC 1NL0H 3MLVH 4Z7UF 2QADD 3FO9B 2F54E 2FEDC 3CXHJ 5T1DH 4F58H 1PZUB 4J1UA 5DQJA 3VRLE 5EU5A 1CD8A 1OTSC 5FKAA 4OD2A 2VIRB 4RA0C 1RZFH 5CBEA 5CEYA 3X14A 1S9KC 1E28A 1MJ7H 3VWKD 3RPIA 1H15A 3RY4A 1LP9E 4HKJA 5F7EL 3L3HA 5E8EB 3MRCA 2IQAA 4TYUA 5DURD 1RIUH 4Z0BH 5MEPA 1CDCA 3BPLB 3FB6B 5C92A 2IPTL 2BJMH 3ARBA 1D5IL 4GS7C 3AGVA 4NPYB 3FO9A 1R3HB 4PREB 3QDGB 3QRFM 4R2GB 4X6CF 4C56D 1VACA 3ARSA 1LO0L 2AEPL 3VWKA 3H9ZA 1OTTC 1U92A 3HAEB 3QUXD 1OD9A 4IOFC 2WZPD 1JZ3A 4DN3L 3MRGA 4JJHA 1MREH 1TPXB 3CLFL 2ZOLB 1LNUB 4F7EB 5FA3A 4HMCA 1YMMA 1CGVA 2DQJL 4KPHL 2EDOA 3RVTC 1IAII 3BN9D 1WZ1L 4OCSH 5ICYB 3SJVD 5DWUL 4HULB 3EBAA 1B6UA 3PWJA 4GKSA 2VUOA 3C6LB 3SE9L 3QEUB 4P46A 2JJTC 4JRYD 4ODSH 1NMAL 4ALAL 3DO7A 4D9QE 3BPNB 1MFDH 3BPLC 5I1AA 1PBYA 3O11B 5IT2L 1X5JA 2JJSA 3GBNH 4ODVL 1T1XB 3PHOA 1RUKH 1KT2B 5IFAH 1JPGB 3FZUD 1U41A 3PGCA 4RFOL 2NXYD 1AHWC 1CXIA 2FYYA 4E41E 2G2RB 3V6FA 2NY3D 1Z9LA 1EDQA 4DWHA 1YMMB 3RVXC 3LEVH 4LLUA 3MRNB 4UTBL 4JFXB 4YQXL 4BSWA 5DWUH 1QA9B 1KLUB 4P46B 1ZK9A 2XRAL 3ZE1E 2NY4B 4CVUA 5GS1B 4AMKL 4GLRI 2QKIB 3GKWH 1MH5B 1Y6MR 1A6WL 3TVMB 4Z7WA 3VXQA 2C1OB 4Z7UA 1AQDA 3MRQB 1RPQA 4PJHF 3VXSA 1KYOJ 4N0UA 5MENE 1T1YB 2MKLC 2X1OA 1SBBA 2VDNH 3BHBB 5KJRL 2MQCA 4O5LL 1FFNA 5A3IC 4OZIB 2C4FT 1U42A 4Q2ZA 1YC8A 2CD0A 4M7ZC 4O51B 2YXFA 3GSNB 3TA3C 5DGQA 3HUJB 4U6TA 4EVNA 5I9QB 1UM4L 3PIQB 1BWWA 1O7VA 3KYKH 5EU6D 3V0WL 4PY8I 4U1GC 5T5FH 2O5XL 2HFTA 43CAA 2Z8WC 3MACL 3BVNA 3IU4L 3QUZC 3SQOL 4HH9A 5DDHB 1GAFL 3CFEB 4MD0B 4R7NA 1HHJA 4DKFH 5L8JB 3ZYOA 4KU1A 5F3BB 2YD2A 4K71B 1S9WB 3F7YA 4P5TB 5E2WL 3VXSB 3LKPB 3QUZB 1BQLL 5IQ7L 3PWPB 2WWMD 3O4OC 2X1PA 2Z4QB 1P7QA 1GC1H 1S7TA 5IGXL 4JRXA 1ITCA 3N9GL 2P8PB 4NQCB 2Y5EA 4JHWH 2F58L 4WFGD 1V3KA 4L3CA 1FYHB 1HH9B 5JLZA 2A73B 4QY8A 1HZHH 1NANH 2VDRL 2OYPA 2Z91B 1DVFC 3CLFH 5SX4I 5AUMB 5I9QC 5DVMA 4WUUA 2P8LB 4DW2H 4HF5L 4POUB 1YY9D 4LKCA 1QFWH 1BFSA 1IM9D 2XQYG 3DRTA 4KMQA 4YWGH 2I9TB 3WUWG 3LIZL 2H9GA 4ZUWB 4RDQG 1D5ZB 3OJ2C 5EBWB 4K71C 4NDMA 2EE9A 5L7XH 4LCCC 1L9NA 4ZQKB 4K07A 3HN3A 5TDPA 4C56E 1G7IA 3CDGB 1S7VB 1AO7B 2XZCH 3NIFE 2JIXB 3ULUD 2XNAA 4GG6E 1T20B 2Z91A 4EDXB 5A2FA 1A14H 4FZ8H 1HHIA 5ITFB 4K7FA 5F44A 2O93L 2FZ3B 3FB8B 1MHEA 5CGTA 2MCPL 2RJMA 4M6NL 1QSFE 3WJLA 2J88H 2EDHA 3G5XA 1KGCD 4OCYL 1IMHC 1YZZA 1NL0L 3MLVL 5DA4A 4UDUB 5GGSY 4MAUL 4O58L 5IJVA 3KPOA 5BJTB 2FATH 3ARQA 2E7MA 4PJ8A 1IC5H 3AMLA 1RFDH 4V2CB 1GCFA 4EN3B 4JE4B 25C8H 3VFMA 3X11B 1QFPA 2QQKH 1NCCL 1AXSB 1NAMH 1KB5H 4FQXA 5FA4B 1TJGL 2R1XA 3GNML 3P4NA 4YNYA 2J7LA 2EYSB 3T08A 3DVNA 5JW3L 1K3IA 4OGZA 4XCNA 5C09B 1RIHH 1ZHNA 4PJXF 2VXQL 2EZ0C 5IB5B 2HJKB 3MLRH 3ULUF 4D0BA 1UH2A 3MRKA 4HWBH 5EC2B 2I07B 5CP3H 3WSQL 1DCLA 4P23C 2DM7A 5IBTH 2F54A 2P24B 5KVFL 4HPYH 5LGJA 3QXTA 2X70B 1S7WA 2FO4A 3L5HA 4K7PH 5EO9B 3I6KA 2R0WH 3I2CH 4NZRH 2NNAA 5AYUH 4MCYB 4J3OC 4FFZL 1CGUA 4WVRA 1KN4L 4QXGH 5D7KE 2WIIB 2IALA 5CZVH 3F7PC 2VABB 5I8EA 5J8OA 4QHLA 5LBSL 1VKXA 5DTFB 1QRND 1ZLUK 1OP5H 3IJHA 1KNOB 2UUDH 4L3EE 4IRJB 4ZTPL 1WBZB 5I1JL 1CF8H 2VLMD 3PWUB 4OI7A 4X9HA 3O11A 5JNYB 2V5MA 5FHBH 1MCQA 1SJHB 3FT4A 3Q6GL 1KT2A 2FO4B 1DVFA 1P5UA 2R2EA 5EO0A 1JZ6A 4OM1H 1Z6JT 4E5XB 4HKBB 1IRAY 5KSBE 4L8CA 3ULVC 1TITA 4OF6A 4OM0H 4MNGB 4CBPA 2NY0D 2P5WE 1IGMH 4X4XA 1F6LL 5HHQB 1J1XL 3RQ3A 1JPSH 5C0EA 4P99A 3L3IA 5C0BE 1YECH 4PIRF 1NAMA 3MGTA 2EIEA 5GGUB 5ACMA 2OQJB 5T3ZD 4X9BA 1AJ7H 1T0NA 1Q1JL 4Q9BA 4B7IA 4Y5VA 2DMCA 3IJHB 1UQSA 2UWEF 2UY7A 1BGXH 1U2HA 1U3YA 3QA3B 1OOAA 4M8QA 5DRNA 3LN4B 3I50L 1YJDL 1H0DB 3OR7B 4FOMA 5F89B 4ZFGL 3QO0A 3QNXB 1A6PA 3AXLB 4LIQE 4ODTH 1D9KA 1HH6A 2AEWA 1ZLUH 5JORA 1HDMA 3CFJA 3PG2A 3QQ9D 3HUJA 4RGMB 5EC1A 5GZNC 3RU8H 1DDHB 4Q9CA 1BZ7B 1NAMB 1YMHA 5IEHA 1DBML 3S35L 1G7MB 4IOIB 4LNRA 4XMKL 3ZDYF 3GMRB 4QGYA 2ZCLH 3WL9A 2GSGB 1OVZA 4F9PA 3IETA 5E94B 2YR3A 5I16A 1CICB 3WKNA 1FGVH 5FUZL 3W0WD 4X6EA 2J8UB 4ISVB 5I30H 3TA3B 4WO4A 3F7YB 1ONQA 1MFCH 1AXTL 3SY0B 4N90D 2YRLA 1C7TA 3IF1A 2HRLA 4M9OA 4U4BA 2XTJC 4QRPA 2YUVA 3O2DL 4IMKA 1NGWB 3BIKB 4MA3B 1IAMA 1G9MH 3MNVB 4PGEB 4ZUVA 4JRXB 1RFDL 4GSDH 4Y4KB 2HJFA 1K8IA 1BZ7A 2Z31A 1MI5B 1CFNB 4CADB 5C86A 5FYJH 4OFYA 1D5BB 4I2XA 4E42A 3FQUA 2HTKC 3MGOA 1G9MC 2CIIB 5GSRA 3C9NA 1AGFB 5AUMA 2ZPKL 5E6IB 2LU4A 4CMMA 3T1FB 3WHE1 1ZGLP 3DYPA 1K4DB 1YQVH 1KJVB 4HF5H 2C3GA 5B4MD 3BKYH 5FUOH 3RKDD 2UVEA 3U30B 1EEYB 3FO2A 3CMGA 5GJTL 5F71A 2B39A 4H20H 3UZEA 2QQKL 4ETYA 4QHNA 2EKJA 5CD3A 3V2AR 4I3RH 1LVEA 1ZLWK 3ZE0F 1MY5A 2W0KA 5MEOA 3C60C 1T0PB 3MMEA 4PJCB 1S7VA 4HHAB 2B20A 4UINL 1KTKE 4NHUB 2SEBB 3FMGL 3IDNB 1IGCH 4IS6B 3JWOC 5E6IA 4QXUL 1S7RB 2FZ3A 3MLXL 2Y06L 1U8NA 1KJVA 1P6AB 4HD9A 3MA9H 2NX5D 5BS0D 4DW2L 1W8NA 5EUOF 5HSFA 3VXUE 4MNQD 2OI9C 4RNRB 3MRJA 1MCJA 3JWOH 3UAJC 2X4RB 2JCCA 3G5YA 2K9UA 4YE4H 1CCZA 2IADA 3SDCD 3G6AB 3C09B 4AL8L 1K85A 12E8H 3T2PA 5I15H 1PSKL 1UJ3C 1U3ZA 3I6LD 1KJ2A 1L7IH 2G5RA 1KG0B 5EFIA 3T0EB 1ZHBB 4IRSB 5D4QA 3GKZA 1MRDH 2DD8L 1R3KA 4S1QH 1HXYA 1BQSA 4ZXBD 1NEZB 5F7FA 4U7MA 4S1RH 1QACA 4XMPL 3UTPD 5KG9A 3DBXB 1FVCB 1R5VB 2EECA 4U6VL 3QUZD 1N64H 1MCSA 1HK6A 3GKWL 4KJQD 4PRDA 4PJAE 1GGTA 2CKBB 4NQDE 4MGXA 3QCTL 3RNQA 1N26A 3S36L 2BOBA 3IJSB 2JJSC 1T83C 1RK0B 1RZJH 1AIFB 4H1LA 4MYWB 5EU6B 3VXRD 2QADB 1P7KA 1K4CA 1E4KA 5HPMA 5LWYH 3C5ZB 5AD0A 2AABL 1CD0A 4TVPH 3TNMA 3U0TB 2DN7A 3QFJB 5F88B 1DBKL 5C1MB 1B0WA 4R4FH 4PLNC 2QQNL 3DX9A 2AK4E 1ZGLM 5EZJB 1RULL 5BRZA 5E4EC 1RZ7H 5I74B 1BECA 1VENA 4JDTL 1XH3A 1VESA 4KKLD 3P3YA 4FQLL 2Z31C 3ARDD 5D9SB 2Y4SA 3D39A 2WBWB 5T5NF 2VLRB 2DLFL 3QDGE 3OKYA 2P47B 4RWHA 1RHFA 1T3FA 3P0VL 1S5HB 2D4FA 1FL5B 2HWZL 5I1AB 5I0DA 2PNDA 4LPVA 1Q9OB 3QIUA 4L8CB 1BBDL 3D48R 1IEHA 4N90E 5DMKA 1YMMD 2XICA 4NO3A 3CU7A 4N0YH 2HYMA 4XBGA 4ACPA 3DX9B 1RJZA 1HILB 3OZ9L 5D7LA 1UFUA 2E7HA 1UYWL 5AWNL 1MVUB 3JXAA 3TJHC 3ZO0A 3MCKB 4JG0L 2BC4A 1CTOA 3C60A 3MROA 1YMME 3T09A 4IDJH 3QEQE 2HLFC 4WU5B 4KK8D 2WNGA 3KYOA 1Y6NR 8FABA 3JWOL 2WIMA 4ODWA 2C26A 5JW4N 5MP6H 5B8CC 1NCAH 4JQXA 3SE3A 4XHJC 4LHUB 3GJFK 2VITB 3LKQA 1NDMB 4CAGA 2OR8A 2BVQB 1G6VK 3MLXH 3ZYJA 2DWDA 4HWBA 4H0GA 5CS7A 3W11C 2V5SA 5IEHB 5EZIL 3QRGH 4N0CC 4G6AD 4DZ8A 1DJSA 1TCMA 3JVGC 3H9HB 1CU4L 1CD1B 5TJWK 4WFHE 4QO1A 1LDSA 4YHNB 4GXUN 5DDHA 5IIEB 4L8BB 4LLWA 3VWJD 1F6FB 4X4YB 5KBNC 3QWOA 2BY0A 1JWMB 2F5AH 5D2NC 1CE1H 1Y0LB 2E7CA 3HB3C 4XAKE 1YEIH 3LS4L 3L7EA 1OPGL 3LD8C 5GRXG 4G8GB 2DQIH 3QSKB 1M7IA 1UKTA 2W9DH 2NX5B 1QVOB 1RJLA 2C3HA 4QOKD 4QXWA 3IDIA 4UINH 5ANMB 3SDAC 2NW2B 1CD1A 4HUVB 5HI3D 1QYGL 2DTML 1OP3H 2ICWB 1RIUL 4POZD 4Z0BL 3O4LD 3G6DH 4XNUH 1MAKA 4MXVE 4Q9RL 4JO3H 3WHXB 3QWOB 4YDVA 1UWEL 1Z0MA 4ODUA 1DBAH 3EFDH 1W72A 5I8OH 4MWFB 3ETBF 1B4JH 4PJAF 4ZPVB 3MBED 3AVEA 5HI4D 2OCFD 3EIFA 1MNUL 3O3BB 1FE8L 2FWOA 2J8UE 1KCRL 4GKOA 5LVEA 3S3SA 4HDIB 1AO7A 35C8L 4H25B 4YFLF 3PXHA 1KENL 1ZLSH 3D1MC 1IFHH 5I8KL 4S2SB 5KVEL 4OIBA 2Z93A 1QBLL 3H0TA 4QCIA 1XGYH 4OFDA 3ET9F 3G5YB 3GZKA 5JDJA 1R3IH 3X12A 3CFIC 5DEGA 3HZMA 4WFFD 3BZDA 1BZQK 3ROLB 2BXYA 4GMTL 4KAQL 4BJLA 4LQFH 4GLRH 3HMXL 4TRPL 3H9SB 4JZNB 3W0WB 4PJ9B 1MJJA 4Z7NF 1D6VH 4QHKJ 1PQZA 2JCCF 1OQOA 1YDPB 2WSKA 4NOFA 4I0CC 3T0VA 5A40E 4TNVF 3N50A 5CEZE 4HLZG 1MCEA 5F93C 4LL9A 5C0BD 2X5PA 3DSNA 3ULSB 3ZMRA 5FHBL 2QR0B 2WBJD 5SWZA 2P4AB 4OZHA 1VFBB 5AYQA 5I71C 4HH8A 1N0XH 5DHYB 3L9RB 5FV1L 5KS9B 3MLSH 3O9WD 5J11C 1FNGB 2NY1D 1EEUA 2R56L 1CXEA 1Q72H 3TBWB 2Z35A 2VXSH 5T3XL 4AEHL 4XVTL 1GZQB 1RUML 4MCYA 5ISZA 5D72H 2WUBH 1P7QD 4QXTA 1A7PL 3MYZA 3W9DB 4HZLB 3GMMA 2IALB 2FH8A 4NO5A 2VABA 2NY0B 3WN5C 3ZL4H 2QADC 2JJUA 3O9WA 3EHBD 4JKPH 4WRLA 1BFOA 4Q6YA 1MCCA 4H26A 5JW4R 1T03L 2BHZA 1DANU 2DL2A 1GZPA 3FFDA 2NY7H 3VFTB 3KNBB 3OKDB 3SDAA 2RFXB 4XP9H 3I3EA 1AXIB 3JUYA 3E8UH 1OQXA 5GQBA 4ELMF 4YR6B 3KJ4B 2W9DL 4MNGA 2AJVH 2FHBA 2X7LA 5IESH 4QXTB 4MQSB 1A22B 1JE6A 2XZAL 3H3BC 3AREA 4PJ5B 2D31A 2A1WH 3WFEL 5BOPA 1X4ZA 2EDKA 3WBDA 4PV9B 3CU1A 4YDKL 4EEEA 3PNWB 2CO6B 4GBXC 4OUUA 2DOCA 2IAND 2BNQA 5FM5M 2AVGA 4UQ2B 3FFCE 2V17L 3MZGB 4BK5A 1OCWL 5BCAA 5GRWA 5SWSE 1A6ZB 2EIZB 3KXFD 4R3SB 4UUJB 2BSSA 5JPMA 1RMFH 2R1YA 1MCNA 1WF5A 2DLHA 4JPIA 5GIRB 5GRVL 3FAWA 3FQNB 3BGMA 4MVBC 4XCFL 4PJDA 2UZXB 4LSDA 5F7DB 3V8CA 1VGKA 2X09A 3KPQA 3QDMB 2P5WB 2APXA 4UTAH 5LQBL 3O3DA 5E08H 3SDXE 3AAZB 4C57C 3N1PC 4XZUA 3HG1E 2HT2C 4X98A 4JY6B 2R56H 4JZJB 1NFDA 4BH7B 3H7BA 4HXBH 1WFUA 1HKFA 1AJ7L 2BNRE 3FHQA 4YHYB 3F7VA 1FNFA 1LE9B 5B3JF 5KSUB 5E00B 1IT9L 3ARBD 1HHKB 5BVJB 3IDGB 1P1ZB 2RHEA 3NFPB 2X4NB 1QSFA 2VDLL 5CZKA 1M7DB 4PJGE 4AH2A 4PJDB 2ITDA 3H8NA 1YYLH 5FKAB 1JK8A 1GIGL 5EUKB 1BD2E 3VG0L 2GITB 4NQUA 5BXFB 1Q0XL 4PJFB 1AI1H 4UDTB 4BH7A 1S7UB 1ORSA 4GRWB 2VH5H 1IGJB 5BVPL 3SGJA 3M1BB 7FABL 3TCXA 4P2RB 3MCG1 43C9A 1QD0A 4ZOAA 3U83A 3WFDL 4QXGL 4DFIA 4JANB 5B21A 2PO6B 4GAJH 2XTJE 1W0VA 3PQYE 1F4WL 4P59H 4PRPB 1OTSD 4HUUB 4NT6B 2MKWA 1JRHI 1YECL 2PO6C 4MJ4A 2DICA 3S88H 4M02A 1N5YH 3ARDC 3HZVB 4HC1L 3B9KA 5D1QC 4GXVL 9CGTA 5L2KB 5I1DB 5D1XC 2IQ9L 2WBJA 1J8HA 3OB0H 2GJ6A 2YUZA 4P2QB 1K2DA 3WXWL 1XGTB 1LNUA 2VDRH 4F57L 3QQ3A 4PBWD 4JJ5B 3G5ZA 1BM3L 4EBQH 2BDNL 5T1KB 2P8MB 3LZFL 4X5WB 3RP1A 3QUYD 5L2JA 5HYQA 4WU7B 2XT1B 3C6LA 1X5AA 4IS6A 1E4WL 2PO6A 1MJ8L 1JP5A 4JO1L 5M95B 3KWWB 5I8OL 1DBBH 4UNTA 5F72S 4PGBA 1DQQA 4HX1A 3U0PB 2VNCA 2I27N 1ITBB 5C0ND 3ZDZF 1T6VN 5DEGB 2V2WB 1SQ2N 1NLBH 3PWPD 4OCWL 5CFHA 5AG9A 5L2KA 3GSOB 1BMGA 3X17A 4P5TD 2IPUK 4ZPTB 5ABDE 4PV8A 5CILH 3MLYH 2G2RA 2PCPA 3MREA 4GRLB 1JGDA 5T5FL 2ZJSH 3QQ3B 5ERWA 5JW4Q 2DYPD 2JB6A 3O2VH 2UV3A 4HJGB 4QRPE 3FB6A 4DGIL 4WNQA 4GRLC 1OAYL 4RRPA 2BY1A 1CT8A 4IIQB 2FHFA 3CVHH 2VDKH 5E56A 3GSWA 1U9KA 4QWWC 3LEXA 4J3SA 4JFDB 2P1YA 4NP4H 2CKBH 4UIKH 4JPWH 3MRQA 5E9DB 5D2LE 4DKDC 3UROR 1A7RL 2QBWA 4IRZL 3VXUA 2HRPL 4OFYD 3RWIA 1JGUL 3EO1B 1G7LA 4JDZA 5AG8A 4O51A 4XPTH 1MFEL 1Z3GH 4ODHH 1KENH 5ICXB 2D2OA 2GYSA 3GMPB 3V0VB 2W0FB 3LPGA 4EVNB 2VZVA 4L5FH 4HQQL 4O2EB 1MHCB 1DBJL 3K4DA 1EHLH 3AB0B 1CDJA 5DSCB 1F58L 4DKAA 4LSQL 4DTGH 3HI1A 5IROA 4XPBH 3OKOB 5C6WH 4L3ED 1FZMB 1N4XL 2NY4C 5D1ZC 3RWCA 2GFBA 3B83A 5E9DA 2H3NA 3BPNC 4HLJA 1RURH 4U1LB 1SYVB 4KDVA 4MJ6A 1V7ML 2E7BA 1V7MH 2YD3A 1VPOL 4NO0D 5D6DC 3IFPB 1BVKA 2W9LA 4P2YA 5DD5L 3VE0A 1HYSC 5DUMH 1IGIH 4M48L 2QSTA 4CJ0A 1T89A 2G9HA 1INQA 3TZVD 1CQKA 3B5TA 2BFVL 5DR5L 1I4FA 1NC2B 1B0RB 3VRLF 1WAAF 5T1LB 3IU4H 1AC6A 3SQOH 1F58H 1CLZH 3HI1B 2VDOL 3N85L 1WEJH 4UZGA 5LCVH 2EZ0D 4HIHA 2WQRA 4P46C 1G7PA 4F7TB 1I9RH 3MPCA 5IM7A 4PP2B 1QUNA 1K6QL 3RWEA 4NNPH 4KJYB 1HSBA 4Z5RA 1P9MA 2RIKA 4WFFE 1T7VA 3QISA 4U6HA 5SWSB 1N8ZB 3N9GH 4FQ1L 1IEAA 4I8DA 4XVSH 3U2SA 5IGXH 1MOEA 2VOTA 2JLLA 2VE6A 1KIPA 4YHLH 3SDYH 2PUQT 5M94B 3TO4A 4PBXA 4NNXB 4X4ME 2DWDB 5DURB 3UTQB 4RWYL 3EGSA 1ZT7A 4OLUL 4HZAA 4YH6A 4G8IA 5MENB 3O8XB 1RZJL 2MHAA 3BW9A 3GJEB 3CJJA 3FQWB 4RISL 3TYFB 2DLFH 1CYGA 5DJCA 5KOMC 4ZFGH 3HR5B 3U4EB 4G9DA 1KIRB 1I7ZA 5JXEA 3MLYL 4OKVB 2ICEA 4GMSL 1MF2L 5BW7C 3O6KH 1JK8B 4OQTA 2AW2A 5IFAL 4X8JB 1I3VA 2GIYA 4EI5A 3TPUA 1U8KA 4YHYC 1QSED 3OZ9H 3V6ZA 4YHIB 1OY3B 2A2QT 4I18A 4QEGA 5JDSA 2CH8A 5FA4A 4IJ3B 4NRZB 2R1XB 1URLA 3QI9C 3JWDL 5I1KL 2ZCKH 4HKZA 5H37G 2A83B 3MNWB 1Q94A 1L7TL 3IDIB 4CU6A 2H9GB 5D2NE 2HJKA 2Q87A 4P59L 2BNRD 1E6OH 4KHXH 4ONHB 2AQ1A 2Q6WB 2Z31D 1HYRC 2ICES 3LEVL 2YPLB 2HTLC 1NUGA 1G7IB 5EU5B 3TN0C 5IMMB 5HVHB 4C59B 4PS4H 3ZE1F 2KPNA 3B6SB 4PGDA 1S7WB 3O2DA 2W92A 2CDGB 4ZSOA 2GTZB 4HIIA 2X10A 4KDWA 1OP9A 1IGFL 3HAEH 4NM4H 3FB8A 4UAOC 4M48H 1FL6A 4F9LA 3EJZD 5CZXD 2VL5A 2CGRL 1RI8A 4PJAB 1EHXA 3FAXA 2ADIB 2P48B 12E8L 4X7TA 2V5YA 1F3DJ 1FV1B 1FH5H 4BM7A 5HVWA 4PGBB 1ZEAL 4CVXB 1U8MA 3QUXA 1HQ4A 4OCXH 3HCVA 1D9KC 3TT3L 1CG9A 4WGWB 1MCOH 3EJYD 4GRMA 1MLBA 4KKBC 4MQTB 3GI8L 4G6ML 1DVFB 5EO0B 2ADGA 2CDGA 3LQAL 4MX7A 5SX4H 4HKBA 3RBGA 1YA5A 2OJEA 2Q7YB 1IL1B 1A5FH 2VLLB 5L88H 2IF7A 2V7HA 3WLWC 3DXAD 2ATPA 2DJUA 3AS1A 1Q9LB 3U82B 5ANME 3NFSL 4Z9KB 2BJML 5IB5A 5C0FB 4G6AC 2BVOB 1A6VL 1P69B 4XNMA 5GJTH 1U8HA 5D5MB 1ZTXL 2VR5A 4YE4L 1KC5H 3Q1SH 4PR5A 4LLMA 2WINA 4LHUG 1RUAL 4ODXB 5E7FA 2QR0A 5SWZB 3PGCB 4XPHL 5D7LD 5EO9A 2E9BA 3JWNC 2OJEB 2NY3C 5DMGD 5D93B 5GISH 1EJ6A 3T3MF 4PJBF 4YO0B 4JM2D 1UXSA 1XGQA 4P49A 4WTZG 1T7WA 5CJQL 3BH8A 4DUVA 4JFXA 4IMLA 5DQ9B 1KTRL 1YMHB 2Q3AA 2R29L 3MV8A 4HIXL 4V1DB 3KPSB 2CMRH 4QRRD 1YNKL 4OFPA 1K5NB 3KPPB 3RDTB 3RHWK 1MCBA 4XP6L 2WANA 4PG9B 4PJ7A 1E0OB 4KJPC 1CN4A 2CSPA 1IILE 1CICA 3ARGC 1A7OH 4Z95H 1INDH 2C5DC 1AR2A 3DIFB 4EN3C 1CR9L 3PGDB 5ID0B 4JFED 2DQFA 5JHDD 2UWEE 3SY0A 5IW6A 2QHRH 1P5VA 3IRPX 3VD5A 1C5CL 2HFFB 3BIKA 1AP2A 1QPPA 4PS4L 3FJTA 2AJ3B 1JN6B 3NCYS 3BWUC 5T1MA 1GZPB 1A6UL 1FDLL 3VFPA 4WI8A 1CFNA 4LP4A 3T3ME 1OT2A 4CADA 4PY7B 3KPSA 4Q58C 2JELH 4GKZB 1FP5A 1A1NB 1L0YA 5D96B 4LEOB 3IAQA 4HH9B 5EU4A 3DGCR 3IDUA 4HIHB 1FVDB 2JCCE 3FTGB 3MBEA 3W82A 1KCLA 2OK0H 2KQNA 3RDTC 1QLFB 4TPRH 5IR1A 3BZ4A 3MXVL 5C3LD 3QZWA 2NR6D 4M03A 3L95B 3RWFB 3PWPA 4RGNB 1HSBB 4Z5RB 4AIOA 1PZ5A 4G43A 1AR1C 4RFEA 3MJ7A 3BD5A 5DJDA 1X5GA 2KKQA 1IBGL 1W8OA 3FT3B 3I75A 4LFHD 2IAMC 4YGVA 4HWZA 4QRQB 4WI3A 1AI1L 3DTXB 4F15C 4WV1A 5EH1A 1LK3H 1D9KD 3MJ8A 3DV6A 4QRUA 3OAUL 3ZHKA 3VD4A 2X4SA 4Y4KC 4AEEA 5ICZA 2M8XA 4P5TC 4LVHC 3NH7L 4Y4FA 4K9EL 1FLRL 4J8RB 5H8DA 2F8XC 1WBYA 2CDEB 3UO1L 3OMZA 3QP3A 1FFOA 3BQUD 3QHFL 3D18A 2R2HB 2V6HA 2CLVA 2OR9H 2DI7A 2C3WA 2FB4H 1AGBA 4D8PB 5CD5D 1YNTA 3HR5A 4QOKA 3WMSA 4JN2B 1LE9A 4APQC 5EBWA 4G43B 1D6EA 1LO5B 1YJDH 2IADB 3WNNA 3WNMA 1VGEH 2F53B 3OBAA 4B0MM 3HMXH 1CFSB 5ENWA 3D2UD 3B9KC 5D1QA 3GSXA 3TJEH 5CZVL 5I75C 1KJ2B 1A0QL 3FFCA 3GEWB 3NZ8A 2AXGA 1INEH 2BERA 5K9OB 1YEJL 3SGEH 3VH8B 1HCFX 5L6YH 1A3RL 1XF4A 3INUH 4C83B 4NQDD 2DQCH 2BSRB 5CJXC 4HJ0C 4MJIB 3WXVH 1JV5A 1OB1A 1MWAH 4PJHE 4WO4C 4U1NB 1PAMA 3VXOA 3ARFD 3OGCA 3SDYL 1G7HB 2IH3A 3QIWB 4RZCB 4POZC 3HMXA 1EZVX 1A3LH 1NCDL 1XGRA 4NT6A 4LNVA 1B0GB 5FCSH 1AIFA 4ZOCA 2VXVH 3CZFB 1K4CB 2UZIH 1BWMA 5F7UA 1TENA 3ILQC 1DTUA 5CBEB 1WISA 4OJFH 2GUOA 3V52L 4C54A 1O5DT 4G6KH 3S6CA 4APQD 3UBXG 1IARB 3KPMB 3Q0HA 5JOEA 4U6VH 1YYMH 4F7PA 3T4AA 4PRIB 5E2TH 3R4DA 5F9OL 2VLME 5IFJB 5BS0E 3KLAA 4FQIH 3WO4B 1U8MB 1TJIH 1AE6L 3K0WA 1CG9B 1C12A 3PHQA 4NQED 2F8VA 2A6IB 1JHTA 4RFNB 5I73B 3GSNL 5E70A 1UB5B 1JF6A 1VPOH 4IRSA 3U1SL 3B8SA 1MIEH 1IJ9A 5ESAB 3O2WL 3QIWC 1F90H 2PTTA 3S9DB 4KRLB 4PUBL 1G9NH 5C0DB 3R06A 3AM8A 1RZJC 3LKNB 4YIQB 1R5VA 1UM5L 2KDGA 4EJ1C 5J9PB 1T04B 5FK9B 1XF3B 4O4YH 3H3KA 3BZEB 4H0HB 4DTGL 4EUPA 5DJYA 4GT7A 4JM4L 1MAMH 4P3CL 3VJ6B 1BAFL 2BXZA 4LLDB 4AM0A 4KKNA 1OD7A 1CLYL 3CDFA 1CD9B 5EIIB 4NKQB 2COQA 1KN2L 1OM3H 3F12A 4I3SH 5GGVL 1YY8B 4KRPD 3K7UA 4W4OA 1OF2A 4OF5A 3KLDA 3LEXB 4RAUA 3D25B 4FZEH 3BJLA 5T3XD 5JIIA 2CRMA 1KTLB 1QLEH 3LV3B 4LPYA 4D94A 1I7UB 1A6TB 4HAGA 1ODAA 5BRZB 5E5UB 3VMPA 4F37K 4PJIF 3CDYA 3OKMB 4HK0B 4ZXBA 4Z7QE 3QWQB 3I6GA 3QH3A 4WEMB 5FOBB 3GRWH 3KLSA 3W0WE 1UJ3B 2HMID 2HT3C 5IBLC 3LKOB 3VA6A 2VSCA 3FRUA 3OR7A 5TE4L 3BWAB 4C58B 4EXPX 5I76B 5E1AA 4MLSA 4DVBA 1P9MC 1XGUA 1OARH 1JWMA 1I8LC 1AP2B 1KTLA 5EDXA 4LSTH 5F97E 1YEJH 5CSBA 4MA8H 1S5IH 2R1WA 3LEYH 4K23H 2GT9B 3C5JA 3K80A 4U6YB 1QNZL 2PYEA 5FFLA 3MJGX 1G7MA 3UZQA 4MDIA 3TO2B 1R0AH 3U4BH 1IC1A 5FOBA 2H8PA 1YEKH 3BD3A 1K3ZA 3SO3C 2VH5L 1JWUB 1B0RA 2R0ZH 5I76A 3ECBA 3SKOA 1T2JA 5F3HB 4P4KD 1N59A 1TZHB 3G6DL 3P4OA 4XNUL 3SO3B 1U2CA 2LTQC 3BRFA 3BDBA 4AIZA 1GIGH 3O6KL 5IM7B 1DANT 1IC4H 3HTLX 1YEEL 2FJGA 1WBXB 4TTGA 3S98A 4P9HC 5MHSE 5GXBB 1A3RH 3MFFB 4LEXL 4NJAH 2FSEA 5BMFL 1EMTH 5ALCL 1AFVL 4JFPA 1G6RB 3HA0A 5D2LF 2ZSWA 1LK3L 2HKFH 3O3UN 4N8VB 3RZCA 5TQ2H 4O9HL 4QYOB 3UYPA 5I6XC 1DSFH 3U9UB 3QXWA 1NCWH 4OSUL 2A73A 4QY8B 1U95B 3QFDB 4HUMB 4MA7L 5E2VL 5HI3C 3WO3B 5CBAB 2X05A 1F5WA 2PKDA 1OTUC 4G6JH 2A6DA 5DJ2B 4M6OL 2MHAB 3I9GL 4QHNB 3ALPA 3GJEA 4OAWA 1XF2A 4NYLB 5HYJA 1Q0YH 1S8DA 2LV4A 5FGRA 4JFOA 3EO0B 1CGSL 2XKUA 2WWKT 4MB3A 1J86A 4N68A 4NUGL 4K9EH 4RGMC 3HNVL 4KJWC 2DQJH 2ICEB 1VFMA 3WJJA 4P2CG 4ZNEE 5I8CB 4O02H 4K3EH 5ITBH 4GAJL 3N85H 2EE6A 3D0LA 1FZOA 3EZ8A 5DMJB 4PLKD 4OJFL 3X3FL 2B8OT 3CH1A 1ADQA 3KPRD 3ZLQC 3IU3B 2NTSP 2WWMC 4IDJL 4ZPVA 3HFMH 5HDLA 3ARZA 1FL3A 4XCFH 1I1FB 2X4UB 5E8DH 3VCLA 4GAGH 1DFBH 5DD6A 3KPOB 2FX7H 4TNVK 3BAEL 1X5KA 1UYWH 4B53A 4F33A 2FWOB 3SDAD 4P23A 3CFKB 4TOYL 1MAML 4YFDB 5IW1B 2XA8L 1YY9C 3S96A 4YHZH 3QIBC 5TE6H 3TYGL 1AD9A 1KEML 5CCKH 4YDKH 2D03H 4WUKL 1G9NL 5F7YC 1ZANL 4MJ2A 5CJOH 2R2BB 3CH1B 4OF3A 5D70L 4P9HL 3LDBC 2C4FU 1ADQL 2M1KA 4PJIE 4ETQA 4FQXC 3CK0H 1H3GA 4OLXL 3IJSA 4IRSC 3AS0A 3JSSA 4LP5A 4LARH 5CSGA 1Z3GL 2A6IA 4ODHL 4Z0XB 2YA0A 4QTHB 2LABA 2EYTB 2YEZA 4L4VE 1IM9A 2F54B 1MJJB 3D6GA 3SCMD 2ILLA 3LKRB 2NCMA 5FOJA 4MNQE 2DIJA 5FDWB 1FPTL 1R24A 1G6RH 2FR4A 2J4WL 4M1CC 1EGJH 3K2UL 2B1HL 4M62H 1F6AB 3OKNB 3P9MA 3QWRD 3WCYA 4OCYH 2EDTA 2Q7YA 4W4NA 3VGAC 2VWEC 3MV7B 5ALBH 1RJYB 3O3AA 2IANE 4RGOH 5E24E 2MPAH 2EDNA 4J4PA 1FYTA 4KKLC 2O61B 3JZ7A 4L4TB 1KGCE 4WTZA 2XQBH 5I8EB 3GMNB 1LK2B 5T5NG 5T1DL 1NCDH 1VFBA 1UVQB 3BKCL 5EOTB 1HKLH 1FH5L 5LAXA 1Z2KA 1Q72L 5GHWL 2I26N 4JFFD 5TQ0H 2YD9A 3EOBA 5IB3B 4JQXC 3SE3C 1S9VA 2RGSA 2DI9A 3SKNB 2Y7QB 5T33H 2HVJA 5CJBA 5J1TC 1NPUA 1HYSD 1I7UA 4V2BA 3WFBH 1FIEA 3SDDB 3NCYP 3P9MB 1C16A 1UA6H 3DWTA 1UA6L 2X4TB 1IZKA 4CVZB 1AGEA 1KF9B 5D7IF 2AJYH 1XGQB 2XZQL 5HHVH 1FFRA 4KXZI 1E4WH 1FYTB 3WS3A 3V6OA 5ICYA 3JVGA 3F62A 1JGLH 2X9XA 3HC0B 1DQJA 1JNJA 3MNZB 2Q86B 4Z8FH 3RDTA 1EBPA 5J57B 5KTEH 2NXYC 4WENB 3TT3H 4YBLB 3GM8A 3TCLB 5C09E 2BZDA 3QUML 1JMXA 2NLJB 4GG6F 6FABH 5D7JA 2X4PA 3CXDH 3MRPB 1J0KA 4YR6A 4GMTH 5EBMB 3SDDA 5EBLB 4MS8C 4TUJB 4F2MA 4PP1C 3AY4A 3QJFA 1UWGL 4M7LT 5KSAD 1IQDB 4N0CD 4HMEA 3KYNA 1U58A 5DD0L 3DI3B 1HINH 2R8SH 2FECL 4MNHB 5I71B 3BP5A 1NJ9A 5J3HD 3IJYB 1JYWA 1LDPL 2L7JA 3MRDA 1N7ML 5IVZA 4BFIA 4YHPB 5KTEL 1M1SA 4H20L 4Q0XH 1J8KA 1UZ6E 5CEZH 5EU4B 1TTUA 3QBTB 1NCBH 1R5WB 3TA3A 1OWWA 2CK0H 1VGKB 1OL0A 5EU6E 3TP4A 5K33A 4L8DB 5ESQA 1FFNB 4OZIA 2HKHL 2VDPL 3MFFA 1Q8MA 3UTTD 1G7JA 1IQDA 2PYFB 5E99L 1RJLB 3OXRB 3G5VA 1G0YR 4DUXA 4WI2A 1U8OB 1A7OL 4D3CL 3DMMB 1QR1B 4QRQA 5FGCB 4HK3J 2GK0A 1H3WM 2JELL 2CDFB 1I1AD 1NJ9B 4LSPH 1EEZA 2AXHA 2NY2B 4HUWA 3UTTB 5D2NB 2ERJC 3C9NB 1JCKA 3DX8B 2CR6A 5DD1L 5SWQA 5JZ7C 3QWRA 4AENA 3ARVA 4MAUH 5D7SH 4YPJA 5D2LA 4X6FB 1AGCB 1KB9J 2XN9B 1UZ6F 1SBSH 5IEKA 2J1KA 4XNXH 4E41B 1S7QB 4LCIH 3GSOA 1DN0B 1MCOL 4PJ7E 3MRFB 5BXFA 3K8MA 2APTA 4PJDE 4LSRH 1OAKL 4NWUH 4OZ4B 4NQEE 1D5XA 5I19H 4PTTB 4S1DC 3MRHA 4PJCA 1IGJA 1JRHH 1F42A 5ERWB 1YC7A 3IYLW 3MUJA 2XFXA 1IM3B 3LKSB 5IP4A 1QYGH 2DTMH 2NW3B 4I48B 4X9GA 1U3HD 2YPVL 4ZSOE 5AWNH 3DMMC 5F9AC 2QQQA 3H7LA 2I60H 4QCIB 3FN3A 5GGQH 1CDHA 1UEMA 4HV8B 1KJMA 4U1SA 2H32A 4J6RH 3LS4H 4XP9L 3PHOB 2DQTL 3QCUH 3LAFA 2BP3A 4MQ7A 5IK3B 4WO4D 4JZJC 2Z0BA 4YC2B 5ITBL 1DSFL 1NMCB 1BFTA 3KG5A 1BD2A 4TOYH 5F1KC 5J6GA 3JWDC 3LRHA 4QRPD 4XAWL 1L6ZA 4MDJA 4GG8A 3AM8C 3NFSH 1MRFL 4BSWB 4A6YB 4WU7A 5HYFA 3O41A 4IBLT 3K1KC 5EIVA 2ZUQC 4ZD3L 1GC1L 4WI9A 4JFZL 1P6FA 4Q7DA 4HX1B 5I66A 5IQ7H 1BEYH 4X7SH 5EU7E 3BFOA 3R8QA 3G5XB 1DE4A 4WUKH 3WD5H 5GGTA 1ULVA 4GO6B 4JQVA 4B5EA 2FD6L 4PRDB 5FYKD 1F4YH 3EYFA 1WC7B 5DYOB 1JZ2A 1D3CA 2XA8H 2X1QA 3VRJA 4M7JL 2HH0H 1E27A 4D9QD 4L4VB 4G7VL 3VXUD 3LQMA 5HHOB 3KHOA 3MV7D 3MV01 4OF0A 5F6IB 4L1HA 4RMWA 3HI6L 4FQXB 3UJTH 4Y5YC 4D9RD 3A6BH 5FO8B 3DROA 3R06B 4OLYH 4H5SA 4OCWH 4FG6D 1F8TH 5JR1H 3LMJH 4G7YL 1JGEA 2CKBL 4M61B 2A6JA 3GI9L 3S4SB 4KK6D 3LKPA 4KVCH 4QT5A 2BOCB 5J4MA 1QPXA 1ZT4A 3WS6C 1B2WH 5EIQA 4NKOA 4EDWH 5LGJB 3STLB 4L4VA 1LGVA 4S0TD 3EYOA 3SCMA 1AFVH 4IHOA 3L3OB 4MD4A 4O2EA 3MUY1 3VXMD 5GZOD 1RUQL 2B7DT 5CEZD 3WUWA 2AK4B 4UV7H 4JGJA 1JPFB 3QDHA 4Z77B 5ETUA 3C8HA 2AERT 2ZUWA 2H6PA 2ZOLA 4LAQH 2A0LD 3MC0A 4MA7H 5E2VH 5IVNA 1GXEA 4Q9QH 2DLTA 3DARA 4PRHB 2YC1B 5DUML 1TZGH 2IPKA 1N6VA 1I8IA 2HT3D 1NLDH 2A9ML 2YPKB 4G9DB 2R1YB 4JPIB 5GIRA 3STLA 4K3DH 4BZ2L 4YFEA 2R2EB 1JVKA 2XQYK 1VCAA 3VGDA 1LEKB 4ONGL 3D3VD 3CDGA 3LZFH 1S78D 4Y16B 2J8OA 1VFAB 2Q76A 3WLWD 4LSTL 3HG1D 3BD4A 4YHIA 4MA8L 4KK6C 2ARJA 4D0CA 3ISWA 4F7TA 4WEBL 4UOJA 3EFFA 4LASL 4P5MB 5HGBA 4V1DE 1PVHA 4PRHA 2YKLH 4XVSL 3LCYA 4KTEL 3PUCA 1N8ZA 3VGHA 1MREL 3SKMA 1LE5A 3QNXA 3ARDA 3DVFA 5I1HH 1CLOL 1V5JA 3GJFA 3DNKA 2GITA 5JMRA 1AQDB 1XF1A 4AIZB 1G7JB 2NTFA 4G42B 5F9WB 3SOBL 1WWWX 1WFNA 2PYFA 4HFWA 3RFZC 2AXJA 3P0YL 4XVJL 3VI3E 1TJHH 5GRZA 4Y16C 4EI5D 2VO5A 3J8F7 3P4NB 1CXKA 3NIGE 2KZ1B 2AEIT 1U6AH 43C9B 3PIQA 3WL9B 4PJAA 3G04A 1EHLL 2J5LC 3DX8A 3LSOB 4RIRA 4OZHF 4JY4A 4D0BB 1AKJA 2FEEL 1WWAX 4CVXA 4JM4H 2XN9A 2H26A 1ONQB 2J5LB 3VXNA 1W0YT 4R7NB 4DGYL 4NOBA 1MHPH 2OSLB 4UT7L 1P84K 5KVGL 1EVTC 5I1DA 2ZUXA 4RMUA 4I18B 3VXRA 3MOBL 5JDSB 1K2DB 4CMHC 1BPVA 4K3DL 3QUYB 3TIDB 3DSFH 2JB5H 3MRIA 3TBTB 2AKRB 4GW4B 2WIIA 5E2UL 4XBEH 5DJ6A 5EUOE 2ADFH 5IMLB 2I9LA 1YQ2A 2DI8A 3CGTA 3QDGA 1DQQB 3MA7B 4IRJA 5D7KD 3HG1A 5E6ZA 1IGTA 3ZKXB 1CZ8H 3RPKA 2DQTH 3QCUL 3BDXA 4JM2C 5J6HB 3DJ9A 1UZ8B 5E03A 4WWKA 5DK2A 2WUBL 2GTZA 4PJ8C 1OGAD 1LILA 3VFUB 5GJSL 2F5BL 4X6CB 1BD2B 5F8QC 4ONGH 4AEHH 1CQYA 4OD3H 5A3ID 4PB9H 5GSVB 3OAUH 2NX5E 4Q6IA 5FCUH 4QTIL 3FQRB 3H9SA 1FC2D 4I18C 2H45A 4CMHB 5J56B 3CFKA 4WNQB 4IOSD 2LQRA 1DQML 2E7LC 3V4PL 5HHME 2LVCA 4Q9QL 1I8KA 2ESVB 1MCDA 2W60B 5KSVB 1H3TA 2WW8A 5AAWA 1DE4B 4FRWA 5AAMA 1X5FA 2W07A 5TPWH 3PGDA 4R7DB 2NYYC 1JF5A 3ME0A 1JBJA 5E5MA 3OKKB 2IQ9H 5IVXA 4XC3H 1NKRA 4CW1B 1D9KB 1HH6B 3ZTNL 1X4XA 2AJUH 2FX8H 1I1RA 5GS0H 5D6DA 3U46B 1J12A 5JIKA 3F65A 4P57A 3BQUA 1PY9A 4PGZA 2BVTA 1DQLH 3HE7B 1MHCA 2WK2A 4XMLH 4EOWL 5CHNB 3WIHA 2BVOA 3RWHA 1FO0A 2ZWLT 4YXLH 4H5SB 4ZUSB 3CSYA 3W5NA 2C3VA 1N0LA 3P9LA 4XHQA 3E6HB 3VXQB 1VHPA 4R7DA 2XZZA 1QLFA 4YHOH 5E5MB 3CD4A 3EOTL 4NRYA 5EU3B 5C08D 1TVDA 4E0RA 3IF1B 1GL4B 4XNYL 5DHXB 5TDNA 5EULV 1YYLL 2OLDA 4D0DB 4ZO6A 3BRDA 1FNEA 4QRSB 4OGAD 3BYYA 1JL8A 5GHWH 3CLEH 1ZE3C 2DYPA 2VZUA 3IFOB 1K5NA 3KPPA 5EO1B 3MGOB 3DV6B 4QRUB 5CLTA 1NSNL 4H8WL 5GSRB 1I4FB 5BVPH 4ENED 1ACZA 3HE7C 4RBPK 4AJ0A 2HLAA 3LMJL 5JXAH 4B41A 1QQDA 1MPAL 2IFGA 4NZUH 2PTVA 3VFVA 4EIZC 2CLVB 4F7CA 4OB5H 3ARFB 2A77L 5DQDL 5HHXL 4EI6B 25C8L 1JN6A 3VD9A 4WHYG 5TH2B 4NN5B 4Y4HA 3U2SB 2HAZA 5C08A 4HCRA 2ZUTA 4ONFH 4XB7A 2XA3A 3O6LH 3VFSA 2D7TL 4E41D 4OZFG 1A5FL 1NDGB 2QHLA 4UBDC 2HLFD 5HHVL 4JFYB 3BH9B 4AQOA 1C5CH 3F58L 1QLRA 4MNQA 1AH1A 5CSZB 4NKMA 4MJIA 2IBGA 3L95A 5D93C 1MLCB 3F6IA 1MCKA 4I4WA 1B90A 4U1IA 1I3GL 5IWLA 1LDPH 4H1LG 3CDCA 3VWJA 2VQ1B 3VFRB 1G7HA 5C08B