3VRLE

Crystal structure of bmj4 p24 capsid protein in complex with a10f9 fab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
222
structure length
222
Chain Sequence
DVKLVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVAIISSGGSYTYYSDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCTRDEGNGNYVEAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords A10F9 Fab heavy chain
publication title Structure of the HIV-1 capsid protein p24 in complex with the broad-spectrum antibody A10F9
rcsb
source organism Human immunodeficiency virus 1
total genus 40
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
E PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vrlE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vrlE01
4H20H 4UZGA 5D5MA 1YEGL 4QRRD 3FN0L 1MCLA 2DJ4A 1MUJA 1IKNA 3MRRA 3Q3GB 5DJYB 1IM3B 3LQAL 4PREA 1X5ZA 2DQIL 4O2FA 5F8RC 5LGJB 1C16A 3HI1B 1ADQL 3WUWA 2DM7A 3T77A 3MUJA 5D9SB 4GKZA 3MV9E 2W1NA 2P24A 1QRKA 1WBYA 4ZDHA 4MCZB 3G5ZA 4JY5H 2XZCH 3O9WB 4QTHA 1HSBA 1P53A 5KS9B 5LWYH 1YYMH 1AGFB 4WI9A 1T83A 1JYVA 3ULVF 4XI5C 5IW1B 5D7LA 4Q2ZB 1OAYH 3MLSH 4LSRH 3U82B 3RDTA 4Y5YA 1SY6L 5EFIA 3UEZA 5H94A 2NXYB 1A9EA 3BGMA 2HN7B 1YDPA 3EGSB 3U0TB 3ARZA 2DQFA 3ARGA 5B22A 1JPSH 1BJ8A 1CK0H 2F74A 5CGYC 4GBXC 1QACA 1QNZL 1FZOB 4NHCL 1DZBA 1NCUA 2IJ0C 3C9NA 3L3KB 3EFFA 5DHVB 5DQ9B 4JB9L 4RNRB 4NN6B 4O4YH 4POZC 5D2NA 1NBVH 1UB5B 3PG2A 1FAKT 3H7LA 2EXWD 5JDJA 2X1XR 4IIQA 3SGDH 2HT4D 4UNTA 4PLKD 2YK1L 1MJJB 3P0VH 3P4OA 4HFUH 4I48A 1UWGL 1UXSA 3UYRH 5ITFA 2FBOJ 4X80H 5BV7C 5T1LD 1X5FA 3E6HA 1MFCL 1QO3A 3WKNA 4YXKH 4NKQB 4Q9RL 2AV7B 3HKFA 5FUCE 5TE4H 1A0QL 1S7XA 1IAIM 2DQHL 4BJLA 2DLIA 2R0WH 3D69A 1RZJC 4N5EC 2PTTA 1FFPB 1NCBL 2IC2A 4KXZH 4OGYH 1QBMH 4GW1B 4MJ5B 5F3BA 3LDBB 4F9PC 3IJHA 4GRLA 4L1HA 2D7MA 4G8GD 2Y36H 4IRSD 3LD8C 5EDXA 3GO1H 5F6HJ 3V7MA 2DLHA 5HGDB 3IF1B 2PW2B 3GMPB 4GAFB 3HCVB 3M8OL 1K8IB 5L88L 2OI9B 3MUHL 2GSIA 1V05A 3CFEB 1AO7B 1FL5A 5HYJA 1EX0A 1PJ9A 5F72S 3PXHA 2GSGB 3CLFH 4JQIH 4L3EE 1HHHA 1XGPA 3NIDF 1G7PB 3SPVB 5C0GA 1NUDA 4LCIL 1NGXB 4MLIA 4HJGB 4S11A 2F54D 3WIHL 2BVYA 2NY4C 3C6LA 4W70A 5F7EL 4KKAD 3UZQA 2R0LH 3TGXA 4Y5XB 1E4KC 5DQDH 3D3VE 1DLFH 1X5IA 4PJ8D 3UJJL 4Z7OF 1NMBH 3QUYA 1NH6A 3QRGL 4YBLB 5DMIL 2WBJB 1UACL 3MJGX 2AK1L 2CR3A 5LGHL 2Y5TA 5KG9A 4UOW1 2OYPA 2A73A 4U05A 2KPNA 4XT1C 3L95B 4YHKH 4PGEB 1HILB 3QEGH 2F53D 1T3FA 4CN6A 4ODUA 5TQ2H 1J05B 1EXUB 1M1SA 1QBBA 4OD2A 4R96A 4J6RH 4NBYB 3OAUL 4JKKA 5FYLE 4G6FD 4K3DH 3DGGA 2D3VA 2FX9H 35C8H 1LWRA 2DJSA 2A9NL 4PGJA 2FHBA 1HIMH 2CLVA 4JQVA 5L2KA 4LSPL 4KROB 4NO3A 4HXBH 4NQVB 5DRWA 4EI5D 1EMTH 2RGSA 1HQRB 1S7UB 3WNLA 4MB5A 5T3ZD 3S37L 5CUSH 2QQKL 4KMTH 5HYSA 5M7QA 2OJZH 1D9KA 1DBBH 2K9UA 3ARFC 3WEXB 2XWTA 1HH6A 3D0VB 1LO0H 5DEGB 3BPCB 1KJ2B 3DETD 2AQ1A 2VLJB 3TT1L 5EO0B 4YEFA 2WLZA 2JCCB 4JREC 1X5LA 3HZVA 1DBJH 4OCYH 1BEYH 4HIHA 3IDIB 5CGTA 1T0MB 1YYLH 4R2GC 3VG0H 4TUKL 5K9QI 1J1XL 4PJFB 4O2CA 3HE6C 4E5XB 1M7XA 3FONB 1LK3L 2I60L 5JPMA 4RGOH 5IVXA 3ROLB 1MRFH 1G1YA 1YNLH 4XVSL 4N1EA 3KPPA 1PFCA 2GJ6B 4OF8A 5C70A 5AYUH 4F7CA 4WHDA 2BVQA 1WIUA 3JWOC 5MENB 1JN6A 2WIMA 4WCYH 3PJSA 4UTBH 3U48A 5BO1H 1OQOA 5CFHA 4DVRH 2P5EA 5D6CB 3T2QA 3CJJA 1UEYA 3V4PL 1A6TA 4M1DL 2VUOA 3MOAH 3LPGA 4ELKB 2I26N 4KV5E 3OL2A 4QXGH 5E8NA 2IGFH 1JZ2A 5HHMB 4RGNC 5KW9L 5C09D 5F7KC 1VERA 2Q86A 4RFEA 4NKMA 1NFDF 1XGTA 5ESQA 5C92A 5C0AA 3T2NH 1U8KB 5C07D 1RZ8A 3HPJA 4Q0XL 1RI8A 5D1QC 4ZUUA 4FN0A 5B8CA 3L3JA 5FO7B 4NFBA 4LVNB 1KYOK 1HKLH 1PKOA 3D39D 5D1ZA 3ARDA 4BKLA 3UBXG 4EQ3A 1BF8A 5IJVA 1D7FA 1JGUL 3P77B 1C12B 3LEVH 2VL5A 2ESVB 1XH3A 4KRPD 4J1UA 1N8ZB 4LAQL 1U8MB 4F33A 2IAND 2X42A 1Q38A 1VPOH 2BNQE 4HBCH 1F02I 3U46A 3EIFA 2X1OA 2H1PH 4UU9A 2AK4D 5DRNA 5DHVH 3EUUA 1X3DA 2XQYG 1FFOB 2FYYA 2XTLA 2IQ9H 4DKFL 5J6HB 1RK0A 2OTUA 3UXFA 3W81A 4NRXA 3RWDA 5HYQA 4LHUB 3L3GB 3MRPB 3MV7E 1RFDH 5BZWA 1FBIL 4M7ZC 1KNOB 4P2OB 3BHBA 5D7IA 1AFVL 4WI5A 3SDCD 3D85B 4G6KH 4LSVH 3ALPA 5SWQB 4KTEH 5DSCA 5CBEA 4C4KO 1BIHA 1EEZA 1WC7B 4UI2A 2VC2H 1JE6A 3O11B 2VXQH 4LVOC 4MCYB 2Q20A 3CFJB 3UTQB 4Q9CA 2BHYA 4HC1L 3EZ8A 5E4IA 3F58L 1UXWB 4YZFE 5D5ME 4V1DD 4WI8A 3HC0A 5DT1L 4O5LL 4IOIA 1S9KC 1Z0NA 3KG5A 3QNZA 2VAJA 5ANMB 1S5HA 5I6XC 3DOSA 2EXWC 2BVUA 4QT5A 4X9BA 2HT4C 4PLKC 2OLDA 4FQ2L 1R5VB 4KDTA 1UWEH 2MNUA 3U36B 4FQLH 4JO1H 2B5IB 1BD2D 2C4FT 3BD4A 5FA3B 4U1JB 5DUBB 3JTTB 3A0OA 4FFZH 3RHWK 3MLWH 4XC3L 4DGVL 2HVKA 4JPVH 4JR9H 3ZDZE 1P1ZB 1UJ3A 3DUSA 5D7LE 2IG2H 4ZUVB 2FL5A 4P2RD 4NM8H 3DRQA 3W0WD 4NUGL 3FOLA 1U8OA 1U8JA 3BQUB 1PZ5B 1HK6A 2YD9A 3FT3B 3VFUA 3U7AA 1PW3A 3S9DB 2BVPA 4IRSC 1ACZA 1FJ1B 3PP4H 1BM3H 2XG4A 1H5BB 2NNAA 5CSZA 5GSVA 5D1XA 4HIJA 4OZ4B 2A83B 2P8LA 4B50A 3BUYA 3TPUB 1DCLA 4P23A 3PGFL 3CFKB 3LEYH 4WFFE 5T33H 4NJ9L 3WS3B 4WHTA 5IVNA 3F6IA 3H3PH 5IW6A 3SHSA 1P7KB 1CI5A 2BFVH 1TZIB 4NQSA 1B9ZA 1A2YB 3KPQA 3MRMA 4KKAC 1B88A 4XNQA 1UKTA 3TO2B 1EGJA 4OLWH 4AZ8A 4Y88A 1IQWH 3RZCA 3W82A 4PJ8C 5IK3B 1CGYA 4HD9A 1IEHA 4RQQA 3ZYJA 3L5IA 2EH7L 5ALBH 3UYPA 3ARRA 4PBXA 3VXMA 3I3EA 3VE0A 5FYKE 3ARXA 1JTPA 4TPRL 4ZFZB 2PXYB 3MA7B 1KJ2H 4GRWF 4EUPA 5J6GA 3QG7L 3QB7C 4I3RH 3QUZB 2UY6A 4XXCC 1W0YT 3WDIA 4Y8DC 4YDJB 3MFFA 5HYJE 5EIIB 3SDXF 3BZEA 4KTYA 1IGTB 1CFBA 3TT3L 4ZFGH 4HUVA 5CP3H 2A6JB 3AXLB 1OWRM 5EU6B 3OQ3B 1MPAH 1YMHB 3B3IA 3JTSB 2PUQT 5JDSA 2C1OB 2A77H 3FZUD 5JHLH 3O9WD 5FOJA 2X7LA 4EI5C 5I1DB 5MERA 5I1GH 1QRNA 5I30H 2BZDA 3PGCB 2BC4A 1HOCA 3MA9H 15C8L 2J2ZA 4C56A 4MJIB 4OFPA 3WJLC 4HT1L 2M26A 1JHLH 2WBKA 2FH6A 4HK3N 4JY6A 1A1MB 1OL0A 2NXYD 2V5YA 3MREB 3U0PA 1VGEH 3DETC 1HHJA 5F1SA 1L7TH 4P9HL 5EORH 1JGLL 1S9WA 1ED3B 1I3GL 4I4WA 1KB9K 3E3QE 3T1FB 1G7HB 5GS2H 1KN4H 2X89D 5DLMH 2H8PB 3UTSA 2WP3T 5L8LB 1FVDB 2YXFA 4NZUH 5T3XE 3L5JA 5DUMH 4G42A 4YO0B 1K2DA 2CK2A 3E1F1 3HMXA 4APQA 1BQLL 3ARSA 4NZTH 4PJHF 3ECBA 1GGYA 4YDVA 4K94L 5IB3B 1A6VH 5T3XL 4ODWB 1OP5H 1CLYH 3U9UB 5L0QC 3DXAA 3WN5B 5HSFA 5L2KE 4CVZB 4PG2A 1WGOA 1S8DB 1ERNA 5E9DD 3QXTA 3QNXB 1KJVA 4U0QB 5K9JL 3CSYA 1YECL 1CZ8L 4RDQG 2NX5B 2A6DB 1PKQA 1A6UH 1DN2A 3MRFA 2JKXA 3TEUA 4JN1L 4PP2B 1KN2H 3ULUH 2DWEA 4JFDA 3TWCH 3QJHA 3MRNA 6FABH 1KCSH 1IC7L 1AR1D 1MIML 4LKXB 3TV3L 3ALXA 5TDOA 5T5NG 4PYGA 2ZUUA 5FV1L 4K7PY 5IVXE 5SV3A 1TTUA 2ATKA 4RWYL 3TIDA 1P4BL 1NEZB 4RWHA 3DSNA 4QY8A 5LQBL 3MNZB 1Q0XL 4HPYH 4ZPVA 2QADB 3QEQA 4RISL 4KRPC 4LASL 5JOFB 4JZJC 5FB8B 2B0SH 1GIGL 1CQKA 1NKRA 2P5EE 3BVNA 1XZ0B 2E7BA 4IRJB 4X9HA 4IEFB 2OM5A 4M7KH 4AG4H 1FNEA 3LIZL 3B2VH 1PQZB 1B4JL 1TZHA 2CK0L 4U1SA 5IKCA 1MAML 1CL7H 3F5WA 3SJVA 3ZT6A 25C8L 4KFZC 4LLMB 1IRAY 3GSXA 2WBJD 3PNWA 4PV9B 4X7SH 5I18L 3BDXA 5C0AE 1SBSH 4O00A 12E8H 1Q9LB 3BP5A 3DHMA 3SDCC 3WD5L 4F7MB 4MZ3A 4ONHA 2X09A 3WJJA 1SMOA 2R0ZH 3G6AA 1F4HA 3NPZB 4XCCH 1OM3H 3VW3L 1SYVA 2QSCH 5I1EL 3VWKA 5ICYA 3H9HA 2H26B 4JFXB 1A4JB 4X99B 3VRLE 4JDTH 4Z76A 5L8KB 1YEKL 4JM2A 1LO2L 4NKDA 1P4LB 4D0CA 4H1LA 4FG6D 2OL3A 2AXGB 2APFA 3BKML 4K7PL 2VZSA 5C0CD 3QEHB 4HFWB 3OMZA 4XP6L 4CVXB 1J88A 3UDWC 5HHNB 2VDLH 1G0YR 5HJ3A 5IB2A 3HC3L 1K4CB 2V9TA 2XXCB 2P8PB 4OBSA 4ZFOB 2WW8A 2VMFA 4GQ9H 3MRHA 5FYJH 1QEWB 2EEDA 2VLJD 1OSPH 2V7HA 3IDNB 1SJHB 1JPGB 5DYOA 3EYFB 3L7EB 5CZVL 4OAWB 1S7TB 3GMRA 3BGAA 2CLRB 5D7IE 1TJIL 2P8MB 5JW3L 4LP5A 1FL6A 1ZGLB 4P0DA 4RZCA 5JW5B 1W0VA 2BSTB 4M3KB 5C8JB 4XP5L 4Y7MA 5F7DA 1LO5B 5B3JF 3CSPA 3FJTA 1FVEA 4J3XA 1A3LL 1HXMB 3O0RH 3PWVB 4I0PA 5MEND 4L4TA 3SGJA 1R24B 1U8NA 4JRXB 2BDNH 3QI9B 3BWAB 2BVEA 1WFOA 3H9SB 1K8DB 1T89C 1RY7B 3PV6B 2F58L 4AT6B 3WUZA 1EFXA 1I4FA 2JB6A 4MNQB 5J4MA 3X11B 3AUVA 2J6EL 2YHGA 4H88L 4R3SA 1U9KA 1HYRC 4PS4H 3K80A 5HHMD 1FVCB 5GS2D 3VFNA 2C9AA 3CZFB 2APXA 2OX5A 4AY0A 2EZ0D 1CS6A 3ARYA 4TUOB 3VDAA 2DLGA 3BZFA 3SCMA 3O3AB 2H32A 1NCAL 2J4WL 4MX7A 1IGML 3SDYH 5IB5B 4WU7B 1HZHH 5MHSD 3ZKXC 1CFQB 1FNGB 3THML 3AM8C 2MQ3A 4K2UL 5IROC 2ESVD 3G5YB 4PJ5A 3PDOA 4WEBL 3T3MF 2VLLA 1CD8A 1KELL 1H15B 3MLUH 2PR4L 4G8FA 4W81A 1T1WB 2V6HA 3Q5OA 1U8HB 3PHQA 3M45A 2CLZA 5FUZH 1JRHI 3K46A 4JG0H 3ULUD 1HSAA 1CGXA 1Y0LB 4I0CC 5KSAA 2DLFL 2J8UB 5E8EB 2VDQH 2R1XB 1IT9L 3FZUC 4HPOH 2BVOB 4LHUD 1PSKL 3ZE1F 1I3RA 3O9WC 5DJ6A 3STZA 4WTXA 1NBYA 5EWIH 2R69L 4JFPA 2X6MA 3P11L 5IFHL 2Y6SD 4PJDB 3D85D 1E6JH 4LQFH 1KJMB 2NY1B 1ZANL 2NXYC 4S0TD 3GB7B 2IPTL 1YN6A 1N26A 4PRIB 4I5BA 3SE3C 5HYSG 5HDBE 5C0DB 1MFBH 2ZOLB 3B5TA 2FJHA 4IHOB 1SEBA 5L7XL 3VXME 3PQYA 2BSSA 4MNGB 5IV2A 2AJZA 4JN2B 4KVNL 3DROA 3JWNC 1Z5LA 4X7FC 1U3ZA 2CRMA 4NN6C 4P57B 3NZHL 1XF4A 3R06A 5DJXB 4HKBB 3V8CA 3G08B 3V4UL 4D9RD 1WT5A 4LIQL 4GW4B 1OTTD 5L8JB 3VXQA 4M6AA 3IJSA 4O9HH 3BZ4B 3NFSH 2ICES 3CMOH 2DL9A 4FQJL 2XWJB 3HUJA 1QUNA 3EDKA 1QRNE 5D6DA 1QBLH 1YEHH 2YD4A 4CW1A 3QPXH 4C56E 4OCXH 5C9JA 1JYWA 1SJEB 5LJYH 4WW2C 2FLRT 5HBBA 4Z7NF 4JGUA 3F7VB 3SN6N 3ZL4H 4HJJL 4ZO7A 4ZQKA 5D7JD 1INDL 5ERWA 1KCUH 4XGZB 5DMJB 4YR6A 1AR1C 3H0TB 4LARL 3TA3B 4OCSH 2A9MH 4QHNB 3UTSE 5BW7C 2YD2A 1BBDL 3GGWB 3QIWB 2N56A 5FYJD 1NLBH 4ONFH 3HHRB 3LQZA 3QH3A 3MJ9A 5F9DC 2IPKA 1C08B 5D93B 3SGDI 4Z77A 4WRLA 3MV8B 3OZ9L 4F2MA 4XNXL 4CBPA 3Q5TA 1MHPL 2AJVL 1QLFA 5IMLA 2H3NA 3DXAE 4KVCL 3GKWL 4UINH 3HMXL 1BIIA 1SHMA 4M1GH 3A6BL 4Y5XC 4F7TB 3RWIB 4AMKH 2R29H 2DOCA 3CCHB 3VFGL 3OAZH 4KXZI 4L5FL 5FGCB 4LSTL 4WV1A 4F3FA 3QXAA 4YBLC 3SGKC 1N2RB 2WBJC 1TIUA 1DBML 4G43B 4P2YA 4P3CH 1DQLL 4JFDE 2A0LD 1A6AA 1FCGA 2PXYD 1D6VL 5D8JH 3RL1A 4F57H 5C0FB 2NY6D 1E4WL 5TDNB 3QUZD 3QFJB 3ZE0F 1QLEH 5EOTA 1J18A 2BNUB 5K9QG 5TPWH 4NOFA 4X4XB 3UZEA 4XP1H 1T2QL 4YXLL 3R0NA 5EU6D 5C08A 2CRIA 3IXTA 4HKJB 4UQ2A 4JPWL 5IB1B 5ID0B 3QEQE 3MNVA 4FG6C 4KHTL 3MRDB 4NBZB 1U93B 3HR5A 3LKQB 4M6ML 4P4KA 1GPOH 3TZVD 4D9LH 4MJID 4X5WB 2I9LA 2WAHA 4GG6F 4QWWD 1CR9L 2CJUL 2DM2A 2OR9H 1F2XK 3L5WB 3ZTJG 1G9MH 5H37G 5F89A 5HD8D 4C57C 2A74A 3LV3B 4XVJH 2AQ3A 3SJVE 1IZJA 1K4DA 5IEHB 2XN9B 2QEJA 2FEDD 1INQA 3LPFA 3MLVH 5GZND 4ONGH 4HUUA 2XY2A 2HLAA 5D72H 1SJVA 3TH4T 4LLYB 2MSPA 3WIFB 1S7QA 3MXVL 4UV4L 3S35L 1YNTA 1ZTXL 4NGHH 1OCWH 4R4BB 1T03L 4EI6A 3GI8L 3D0LA 3ILPB 3ARUA 4R7NB 4GKNB 5J3HD 1I3VA 2Z93B 3VCLB 1T66D 3EYSH 5FV2A 2BOBB 3OJMB 2CD0A 1AD9B 5DHYB 4LLDA 1Q9WA 3SY0B 1MNUH 1MCIA 4XXDB 1EPFA 5IMKB 2N4IA 1Y6KR 5D71H 2BNRD 2P48B 2ARJQ 3GBLA 5FKAB 2VZUA 3TBYB 1ZSDA 1MFEH 4DFHA 3RY5A 2BJMH 5LAXA 1YZZA 4J4PD 2AKRA 2NX5D 4CN1A 4Q9BA 4G9DA 1F13A 2OL3L 1NKOA 4XP9H 1PY9A 3X3GH 4F9LA 4X6DB 5F96H 2EZ0C 2V9RA 2FD6L 4OFIA 1QSZA 1NMAL 4G6JH 4OZHB 3GSNL 4NQXB 3KHQA 4NRZB 1AC0A 5JXED 2Q7YB 1YJDH 1QA9B 2AEPL 3OF6D 4LVNC 2R8SH 3V52L 3LKNB 3LHPL 2GY7B 1KIQB 3GEWB 2APVA 1JHKL 1F97A 2GHWB 3O6LH 4YHOH 3MO1A 4R4FL 2EICA 4S1QH 5L9DH 2ADFL 1KC5L 1TENA 2YEZB 4L4TE 1MJUH 2QADD 5KVDL 1XGUB 4X7DC 1ORSB 1TZGL 2MHAB 2MPAL 3EO1A 5CKAA 1W72A 3LKPA 4H8WL 4IRJD 5GGQH 3KPTA 3C6SB 5DA0B 5KAQF 4EUPG 4YHPA 3ULUC 1CDCA 4OCRL 4M8QB 1JV5A 1ZHKB 3QDMA 5J11B 3BD5A 3HS0A 3Q1SL 3B2UD 3UPRB 2DM3A 4GKOA 5DJAB 3Q5YA 5F1IB 1IAIH 2FECI 4QGYA 4OF5A 3I6GB 1H0DB 2VXUH 2Y6SC 5C7XH 2UWEB 3FB6B 1M7IB 5TF0A 3MC0A 3GSRA 4XMKH 3UPAA 3G6DH 4XPFL 1MLBA 5I19L 2FO4B 2D7OA 3QISA 4YX2L 2X4TA 3OXSB 3OKYA 2BRRL 5ITBL 3K74B 3P2TA 4BH8B 1FYTA 3TH3T 3TPKA 1CBVH 5ILTH 3C09B 4PJ5E 3ARBB 2FEEL 5KTEL 5L6YL 5EG6C 4IMKC 1UWXK 2AJSL 1XT5A 2DB8A 3TYGL 3VFTA 5ETUA 3W9EB 3C2AH 1OTTC 1U8IA 4QRPD 4HS3B 2R2BB 2B5IC 3BW9B 4PUBL 1U3HB 3ZDYF 1CD0A 2PYEB 3HI6H 5FXCH 4Y4KA 4HS6A 2BP3A 3V6OA 1NGPL 3AB0B 4WUKH 5EC2B 4H25A 4LU5L 4NC2B 4DKEL 1KTRL 4QRUA 4JFYB 1FGVH 3HMWH 1NGYB 5DRXB 4NO5A 5HDQL 1CU4H 2R1WB 4M6OL 4PJXA 2F5AL 4JHBA 4WU5B 5D7JC 3QPQD 4JHWL 3MV9B 4HGWB 2DRUA 1H5BC 1ZHLA 1HDMA 4OM1L 1OHQA 1EA9C 3VFVB 2AJ3B 3PQYE 4JRXD 5EU5A 3QI9D 4AEHL 2ZCHL 2K1MA 4OZGF 3H9SD 5KSUA 2GKIA 1EERB 5AG9A 1Q94B 4JCMA 1FC1A 5EU3B 3LN5B 4MNQD 3UBXB 4G3YL 2QLVB 3O2VL 4UDTB 1RPQA 1OWWA 5CLTA 5EU4B 3MROA 1ZHBA 2E7LA 3HUJE 3FQTA 5C2UB 2YKLL 3FQWB 2XWBB 3MODH 1V5JA 1Y6MR 3MRBA 3FN3A 1HHIA 3C8DA 2AJYL 4U1HA 4NP4L 5LGJA 4PR5B 4CDHA 4WY7L 5J13C 1NDMB 3P0GB 1U91A 5I8EB 2X5PA 5DR5L 4NQED 2IH1A 4ZSOA 1F4WH 1RJYA 4BA8A 4BFBD 4QHMA 4M93B 3BN9D 5F7UA 2X4QA 4HG4K 1UM4H 1RURL 1N6QL 2OZ4A 2A0LC 1JWUB 3PWJB 5FKPB 2EC9T 2PXYC 3DO3A 3B9KB 4LLUB 4ZS7L 3L7FB 1U8PB 2NY6C 1AJ7H 3QUZC 4N0YH 5HGAB 3SE3A 3TYFB 5TFSH 4PJGA 4ZOEA 4NQCB 3MJ7A 1BWMA 1JGDA 3OPZL 1XMWA 3DVNB 1WCBB 5I8OH 1BZ7A 1ZEAL 5GRUH 4HCRA 1C5DB 5DHVA 4PRNB 2DD8L 5DQ9A 3E6FA 5FECA 3TZVC 3BEVA 3NVQA 3LY6A 5E03A 1MHHA 2Z31B 4QWWC 2EDRA 4DAGL 5ESAA 4C58B 4CKVX 2X4NA 3BP4A 1I9RL 5HD8C 1IEBB 4L3EB 5HPMA 4EDXB 4N9GB 3VH8A 3FT4B 4P9ML 1BOYA 2AV7A 4OI9A 1FN4B 1FSKB 2C26A 2FEDC 5DD5H 3RGVB 4UTAH 5GZNC 1E6OL 3GUTB 2HKFH 4QRTB 4ZOCA 4MJ5A 4M43L 1KCVH 4I3SL 4WW2F 2OTWB 1MH5B 2HYMA 2LAGB 3IJYA 1RZ7L 4MA1B 2QQQA 2AXHA 3UJTH 3D3VB 5J3HC 4LRIA 1T66C 5F7WC 3KLHD 5C08E 5JXAL 3GMPA 3I2CL 3ZLQC 3O2DH 1XCQA 1CDIA 1U3JA 2NY0B 4MJ6A 5CGMA 1Q9KB 3QCUH 4L8CA 1I9EA 3KLAB 4V2BA 1AO7A 3IFPB 3C60B 2J8HA 1RULH 3TNMA 1PDKA 2JF1A 1AGCB 3QUXB 5JMRA 1T20A 1VFAB 2CKBB 3TJEH 3OHXB 1B6UA 2H45A 3FMGL 2SEBA 4J4PC 3FQRA 3E2HB 1CDGA 5BOPA 3GSWB 4HIIA 4L8SB 5CWSA 5LCVL 3QA3A 5IHBA 3IKCB 3O6MH 1BF2A 4KI5D 3I3DA 4W4NA 4WO4B 2GIYA 5EU7C 1YPZE 2UVEA 5EA0H 4ERSL 4JHZA 3V0VB 5JXEC 3TA3D 5IFAL 1IAOA 5JW4Q 1F90H 1N59B 4N0RA 3OKNA 4AEFA 5IBTL 3RIAF 3QIWD 3W9DA 1RD6A 1JI2A 4QF1A 1QPPA 2WZPD 3EYVA 4RFOL 5INCA 1VGKA 2WBJA 1OF2A 4BH7B 1OAUH 4ODBD 5GHWL 1BQHA 1XIWB 2L7UA 3MV8D 3BAEH 3IRPX 2BMKB 4ORZC 3UC0L 2AI0L 3WFCL 4FXGA 2P42B 1C5BL 1UM6H 1NC2B 2QADC 5E24E 1P9MA 2JJTC 3REWB 1EXUA 4HH9A 4PB0L 5CILH 2O61B 3JWDH 4XC1L 4IRJC 3KJ6L 3QUKB 2DDQL 4JANA 1FIEA 3GSQA 4DKAA 1HYSD 4NN5B 3B2UC 5JLZA 1YEGH 2A6IA 5E2VL 4OUUB 3FN0H 2QQLL 4PJIB 2PO6B 3IDYB 1HHKA 2WANA 4RIRA 1I1AB 4Y2DA 3LQAH 3WEXA 2VR9A 3T3PF 3BH9A 3OWEA 3QFJD 2CIIA 3P30H 1LEGA 1XF5B 1Z9OA 3LH2L 3QDJA 1SQ2N 1Z2KA 2C3WA 4P5TD 2JCCF 3I50L 1GSMA 3DNKA 3HI5L 3L6FA 2IBZX 4JZOA 5CJXC 3FT2B 3IU3A 2AGJH 3GHBL 1XF2A 4XNYL 3V6FB 3W2DL 1BPVA 5EN2B 4QXUL 1SY6H 1NCWL 4RAVB 2GJ6A 1B6DA 4D0DB 3KPRB 5DI8A 3QDME 3OKOA 5T1DL 3WSQL 5EIQA 1J1PL 3U2SA 3NN8A 2VERN 5AWNH 5HGHA 1W72L 5D6CA 2OR7A 1CL7I 4NHCH 2GK0B 5KZCD 4OQTA 1JGEB 1MWAL 4ZD3L 3G9AB 3WFDL 5T1KB 3T1WA 3L3IB 1CGTA 4JB9H 1OW0A 2J7LA 3LZFH 4JY4B 4MNHA 5GS1B 3HZYA 3TVMB 5A40E 4HWBA 2YK1H 3CFIC 1ZT7B 4OLVL 4PRPA 4W6YB 5TH2B 3HE7B 1UWGH 2B1HH 3CVIL 3ULVL 1G9EA 1U8KA 3C5JB 5CEYB 2CDGB 5A2IH 5KSBA 3QPQC 1IAKA 5CEZL 4MQXD 2O5XL 4NNYB 1FYTE 2HG5B 3QHZL 3D18B 1HWHB 5FO7A 5HY9A 3MV7B 3VFPA 3QI9C 3O41B 4LQ1A 2YD6A 2DQHH 4MHHG 3WE6A 3S88L 1G9MC 2Y06L 4HUMB 3QJFB 4MLSA 2X4RA 1C12A 2APWA 4P2QA 4XVTL 4DQOL 5ID1A 3SDDB 5CS7A 4JKPL 4FRWA 5J1TC 1B0GA 3DURA 1QBAA 1AXSB 4FQQA 3VXTA 5D5MB 3V6OE 4Z5RB 2YC1A 1MUJB 2E6PA 3MRRB 1NQBA 1YEDA 1VHPA 5DC4B 4M62L 2RCSL 3F7PC 1P6FA 4PREB 4PJXE 3L3GA 4HKXA 4NZDA 4LCIH 1AC6A 4O2FB 1T7WA 1KNOA 2KKQA 4P2OA 1C16B 3KR3L 4JQXA 3BN9C 1KFAL 3WUWB 3T77B 1VFUA 4YWGL 3WIHH 1DANU 1WBYB 3AU1A 3MRGA 4ZDHB 5SWQA 5F7EH 1TFHA 1IGFL 1UZ6E 3G5ZB 3SBWC 4QTHB 1UENA 2YMXL 4KGLA 3VFSA 4I0KA 3MOQA 3UTQA 4EEEA 1J10A 5D7LB 2ZJSL 4NO0A 4NUJA 3UTPE 3UJJH 3RDTB 4Y5YB 3NIDE 4MAUL 2X41A 4GMTL 5H94B 3BGMB 1A9EB 1YDPB 5DMIH 2AK1H 2DQFB 3ARGB 1YJDC 1JI1A 4H26A 4L9LA 3BDBA 2F74B 2ICEA 3BKJL 1Z3GL 3O6KL 5HXMA 4FOMA 1FAIL 3WMSA 3ZKMC 2HFGL 4M00A 4PJAF 3MLZL 3C9NB 3SGEH 1BVLA 3DPBA 3EFFB 5KVMC 2WK2A 3OAUH 4XWGL 5D2NB 4Z7OE 1RIHH 4K07A 1VEMA 4ZSOE 3CAFA 3QQ9D 2CKBH 3P4OB 3RWJB 4QXWA 1F8TL 3B5GA 2A9NH 4I48B 3WO4B 5ITFB 1P1ZA 4LSPH 3WYRA 3E6HB 1QO3B 3ARBD 5FYLH 1RAMA 2WUCL 2YN3A 3O8XA 2JLLA 1PZ5A 3BQUA 3FT3A 1OGTA 4CGTA 2QQKH 3J8F7 1S7XB 4K8RL 2EYRA 4OFDA 4NQDA 3D69B 1WZMA 4PJGE 3FB7A 2PTTB 4PJHA 1KIRA 3TT1H 3KLHC 5F3BB 5D2LB 2X4UB 2A83A 2HMID 3IJHB 4ESKA 4LMQI 1U3HD 4GRLB 3RY6A 4JJ5A 5DC9B 4PV8B 2PYED 1JJUA 4R97B 3P4MA 3QBTB 3IDMA 1JGVL 4JJHA 4TUKH 4JG1L 5EUOA 1G6VK 2ICWA 1LK3H 2OBGA 3VFOA 5JW4M 2CUIA 1RMFL 2OQJB 2GSIB 3W11D 2ZUVA 4HCRL 5HYJB 1L7IL 1CF8L 4LFHD 3RPKA 1TZIA 2HH0L 2K7QA 2CO6B 4P3WA 3U30B 1G7LA 4GXVL 1K3IA 4PJ7F 3IFNL 1HHHB 1XGPB 2FZ3B 4KI5C 4PRAB 1MRDL 3MV9D 3Q0HA 2HKHL 2JELL 3MLYH 4R26L 4RMWA 3TA3C 1BGXL 4RA0C 3LB6D 1A6ZA 2VN7A 4W6WB 4M1DH 3C6LB 1EHNA 5EOQL 3VD3A 3QIWC 4NBXB 3WNNA 1ZT1B 5IB4B 5D93C 5KW9H 3TO4B 1IBGH 5HVGB 1QFUL 1YC8A 4DTGL 3QUYB 2PETA 2QKIB 2AJXH 4YDJA 1AO7E 5EIIA 5GGSB 2Y5TB 5KG9B 2ZUQB 4WHYH 3V0WL 4C83A 2R2CA 1H3WM 1QFWM 4PG9B 1T3FB 4ODUB 1L0QA 3GNML 4OD2B 4R96B 1HYSC 1MI5A 4OT1L 5JO5A 1YQ2A 3SOBL 4LRNL 3T2OA 3DGGB 3BP6A 3PGCA 1T04A 2YWYA 5ICXA 3O4LA 4LAQH 2QHRL 1MCBA 1EK3A 2W9LA 3CXHJ 1A1MA 3B9KD 3D87B 4NO3B 3VI3F 3LRHA 3DMMA 4RGMB 3DX8A 3ISWA 5DFWH 4NQCD 4XCEA 4P5TC 4DKFH 4MZ2A 1NCDL 4XPTL 5HYSB 5FM8A 1X44A 1D9KB 1ED3A 1HH6B 2B39A 4YJZL 2MKLC 1G7HA 2VDOH 5E99L 2EDOA 1FVDA 3MACL 3O45B 1AFVH 2LVEA 1L0XA 1TITA 4HIHB 5GGVL 3LS5L 5AG8A 4HEME 2A2QT 4MJ2A 3L3OB 4YIQA 4XBPB 5FCUL 4O2CB 3KPOB 5JPMB 2Z31D 5IVXB 5I74B 1RUAL 4MB4A 3PP3H 3F58H 4ODWA 3T0EB 5E6ID 4L3ED 3KPPB 2J88L 3WN5A 4OD1L 5I1LA 4WI7A 4HAGA 5CMAA 1S8DA 4WWKB 5DT1H 4O5LH 4F7CB 2BVQB 3RGVD 3N0PB 1JN6B 1GGTA 1NUNB 3WBDA 3PJSB 3EYUL 3VFRA 3RAJL 4JZNA 2IAMB 2P5EB 2VH5H 2A6DA 2XV6B 4FQ2H 4ZUWB 5HVFB 3S5LA 3QDJE 2FATH 4OD3L 3D3VD 3BO8A 3GMOA 3SKJH 1T0NA 5E8NB 4MQXC 3S6CA 3MPCA 4OKVA 4DUVA 3O6FA 4XC3H 3VFWA 2NY0D 4DGVH 4GQPH 4RFEB 4NKMB 5ESQB 3QT2A 5C0AB 3C60D 4MSWB 1AGBA 3IT8D 1RZ8B 3QUXD 3HPJB 1NEZA 5B39A 4ORGB 5B8CB 3L3JB 4KK5D 1NUFA 1CIDA 1MCEA 2GJ6E 3MNZA 1XGQB 1CIUA 5D1ZB 4ZNEA 2ATPA 4BKLB 3IRZA 1VFBA 3NCYS 5FYLD 1MCHA 1FIGL 1IQDA 1SM3L 2VL5B 2ZUSA 1CICA 1XH3B 2EEAA 4J1UB 4Z0XA 3PGFH 1DN0B 1WBXA 4GKSB 2YUZA 4N68A 1CVRA 1BBJA 4F33B 2COQA 4NJ9H 5DC0A 4K3EL 4DEPB 4PRPE 4PB9H 4OQTL 3U46B 1LEIA 3H2WA 4UU9B 5KSBE 3KYOB 1XIWD 5F3HA 4YQXL 5KN5A 1RK0B 2OTUB 4F7MA 4NRXB 1T4KB 4D0BA 1NC2D 3RWDB 3MR9A 3GMNA 4HWBL 5HYQB 5BZWB 2W0KA 3OXRA 4G5ZL 4U6VH 2P46B 3BHBB 5D7IB 3CH1A 1MCWM 4EOWL 2H26A 2FGZA 3CDGB 5DSCB 1EEZB 4NWUL 3K1DA 3DI2B 4G7YL 1BWWA 2XPGA 4EN3B 4W68A 1DANT 4MVBD 4P2QE 1P4LA 5F9OL 1UC6A 2AXGA 4TPRH 2E9WA 1F58L 2BXZA 2PO6D 4YFLF 4CVXA 1I1AD 4AL8L 5FO8A 2YD5A 3T4AA 3QG7H 1U58B 5B38B 3HC0B 3BISA 1YEIL 3KYKL 1ZVSA 2Y4SA 5CJQL 1CN4A 3QNZB 4HF5H 3QIBA 1D5MB 3RVXD 4QT5B 5JHDA 4QHKI 3QQ9C 4RA3A 5C0EA 5ICZB 4PFEA 5A1AA 2HT3D 1S7TA 3JWDC 2P8MA 3AC0A 3C09C 3WIIL 4WVRA 3ARBC 4UOJA 3CPLA 4PTTA 1DFBL 2V5TA 1CE1L 1EIBA 1TNMA 1MIEL 4HT1H 1A7QL 1G6RA 2BHUA 2HVKB 5TGBA 5TE6L 4H0IA 3M1BA 1UJ3B 3DUSB 4IJ3B 3KPRD 1HXMA 4LCCC 2VR4A 3FOLB 1U8JB 3P0YL 4P9HH 2HMIC 1JGLH 1U3HC 1GOHA 1I3GH 2BVPB 1REIA 3LQAC 4AT6A 1UM5L 1IAII 2NNAB 5CSZB 5GSVB 3JV5A 1H3XA 3AB0C 1J1OL 4HIJB 5D1XB 5T1KD 3DX9A 5A43C 5H35A 2P8LB 5JR1L 3BUYB 3EJJX 2CXGA 5B4MD 3TVMD 3W11C 4P23B 4O02L 4HWEL 3R0MA 3HE7D 1I8LC 3QIUA 1AXIB 1BQLH 2WBWB 4QNPF 4WHTB 2KQMA 1FE8L 2CO7B 4K94H 5T3XH 2IBGA 4LSUL 3NA4A 4OZIF 5HDOA 3O3AA 3WNMA 4BK5A 1J0ZA 3CXDL 3KHOA 3MV7D 3PWUB 4CRPA 5BV7L 5BJTA 3SKUD 3LB6C 1TJGL 1ETZA 3KPQB 3MRMB 5I1KH 2D7NA 5K9JH 4XNQB 3QRFM 3ZHKA 4YUEL 4NQDE 3RZCB 4PJHE 1RZJL 3CH8A 2EDYA 4JO2L 1H9VA 1WWAX 3OGOE 5HVHB 1RJCA 2N7AA 2UUDK 1DTUA 2GFBA 1JUFB 4DZ8A 2EO9A 1G7QB 1IC7H 2A6KB 1MIMH 3VXMB 1U8HA 3TV3H 5EUOE 3VRJA 3C87A 4OSUL 3EOAA 1PEWA 3AS2A 4EUPB 1F3DH 4RWYH 1TJHL 3MFFB 2J8UF 4HUVB 5LQBH 1JMZA 2WWKT 2WM0A 3NACH 1VEOA 1WV7T 1CLZH 1Y18A 5I1CL 4XVUD 4RISH 4LASH 4PJDA 1B0WA 4HJ0D 1GIGH 5JDSB 3B9KC 2X7LB 4IS6B 5MERB 4S1DD 5FUCC 4N0CD 4PRIA 2D2OA 3LIZH 2BC4B 1B4JH 1HOCB 4GS7B 5D7LD 4C56B 5GISL 2CK0H 3RDTD 1MEXH 5GRYA 2LTQB 1RIVL 2DQGL 25C8H 5E56A 3U0PB 5I18H 3ARGD 1HHJB 1BVZA 5TF1L 1QLRB 5M95B 1TVBA 1S9WB 3WD5H 4I4WB 5C9KA 2Q76B 5DJXA 1QVOA 3G08A 2WWMD 2DQJL 5E2UH 3UTSB 4GW4A 2ZPKL 3VW3H 4Z78A 1L9MA 2Z31C 2H2PD 3U83A 5I1EH 3DO7B 2IALA 5E8DL 4G42B 1K2DB 4DZBB 4WFFD 4D3CL 5E6IC 5JUEL 1MI5E 3U7YL 3KLDA 5E94A 3I84A 4APQB 2CDFA 1YEKH 1FSKC 3IDJA 2W9DL 3RGVC 3ECBB 1EVUA 3O4LE 4YDVB 1SJEA 3BKMH 1HNGA 3DXAB 2E7HA 1G0XA 3L5XL 4LPUA 3HC3H 3DYMA 4MA1C 1KBGH 3ARPA 1KJVB 4JO4H 2PNDA 3CSYB 5IHUL 4TQEL 3H0TA 5DF0A 2R56H 4GRLD 1EJOH 1PX3A 1PKQB 2VNCA 2NY0C 4LSSL 3MRFB 2CH8A 3HTLX 3S34L 5CZVH 4LMQE 1LGVA 3T0XA 4L3CA 3C60C 4N90E 1TJIH 5JW3H 2DWEB 4NPYA 4JFDB 3MRNB 3QUXC 3MLRL 3TBVA 5F88A 5DFVD 5I1JH 2MQCA 1ROWA 2ITCB 4KK5C 2J3SA 3F12A 5TDOB 4XP5H 3MLTA 5HYJD 1TXKA 2ATKB 3E2HC 4L8SC 4WNQA 1U2CA 3TIDB 4NOBA 4QY8B 1CDBA 4WI6A 4M02A 1UH2A 3MRQA 4U7SA 2DBJA 4DGIL 5FYKU 4YHIA 2F58H 4ZPVB 5IEKA 3QEQB 1QHPA 3EYQD 3C6LD 3EKCA 5DHXB 3BVNB 1QYGL 1Q72L 1DVFA 4GLRH 1H3UA 4H88H 1FNEB 5ENWA 2DI7A 4G43A 3X12A 1TZHB 1KEGH 1XIWC 3KPLA 4OM0L 3BD3A 3NTCH 4LHUG 5IKCB 1I3UA 3ZTJH 5K9KA 3QUYD 4YNYA 3GSXB 3ZO0A 1T5WB 3PNWB 5DZNA 2I27N 2IBBA 3BOVA 3VD7A 2ADGA 1F42A 5CHNA 2VQUA 4M8VA 3PE9A 1IGMH 4ETQB 3CX5K 3ZYZA 4ONHB 1KLGB 3N85L 3LVEA 5T3XD 3G6AB 2AS5M 3ZKND 3GSOA 3THMH 4MVBC 1ITBB 4NN5C 5E2JA 5IB1A 3GBNL 4ZNEE 3EOBA 3VGDA 3VWKB 4K2UH 5ICYB 3H9HB 4QLRA 1V7ML 2VSDA 4WEBH 1KPVA 5E70A 2PO6C 1T7VA 4Z76B 1I1AC 1RU9H 4OGXL 1P5VA 1KELH 4JDZA 2PR4H 4JM2B 1UQSB 4NKDB 3V5HA 1LP9A 1IC5L 3PUCA 3L5WA 4D0CB 2B7DT 4H1LB 5L2KD 2OL3B 2GUOB 3BGFB 1T1XA 1VENA 1CD1A 1OSZA 3RVXC 1UGNA 1BJMA 3INUL 5IEHA 2DLFH 2XN9A 3GSNB 5IB2B 3MRKA 1D9KD 2ERJB 2HT3C 3RI5F 1EEUA 1IT9H 2I5YH 3RUGB 1PSKH 4FTVA 3MRHB 4LLYA 4OFYA 2V7HB 1FH5L 3T3ME 2EYTA 3DRTA 4DVBA 3P11H 5IFHH 1IZKA 5JQ6L 1BHGA 3MV11 3P9LB 1TQBB 3KNBA 4LSDA 1W8OA 2Z93A 1FL6B 2IPTH 2ZKHL 2AP2A 5F9AC 2BOBA 4RZCB 5DHYA 1W0VB 2GI7A 4TVPE 2HFTA 3AAZA 3U9PL 2VWEE 3B4NA 3TM6A 5F7DB 4XXDA 1EGJH 4MA8L 3ZE1E 2AEWA 2VOTA 3ES6A 3O3BA 5IMKA 1I7UA 3GJEB 4KVNH 5A16A 4I0PB 3MRCB 4L4TB 1U8NB 3GHEH 3TBYA 5GS1C 4ENED 2XKNA 4TVPL 5B4MC 3TVMC 2P5ED 3KPSA 4HIXH 1EFXB 3HE7C 1CGWA 2Y9RT 3V4UH 1AH1A 4LIQH 1I4FB 2JB6B 1MSPA 5JHDE 4X6DA 4EUPH 4FQJH 4R3SB 2XRAL 4OZHF 1JVKA 3H6JA 4M6NL 4Y89A 1QA9A 1WAAA 2JJWA 3VFNB 1WIPA 2NXZB 2VRAA 3GSUA 2F8OA 1AP2B 2EEBA 5C0AD 1I1RA 1GAFH 3LKRA 4L8BA 2HP4A 3BZFB 3SCMB 3VRIA 4MA7L 2H32B 4MX7B 1DL7L 3FQXA 3NCBB 5F9WB 3JVGC 3TCXA 5D1ZD 4IRZL 3ARDD 1XGUA 1MRCL 4LNRA 1G6RL 3FCTA 1KUMA 4LARH 3EAKA 3C6SA 5IF0A 2DN7A 4MD4A 4PJ5B 1BBDH 3KAAA 1IKNC 4F7PA 5DGQA 2F8VA 2VLLB 3BKCL 2OXGA 4G8FB 1N5AB 3PHQB 2CLZB 1KXVC 3OZ9H 4YDIH 3K4ZA 1HSAB 2YOCA 3NPSB 1J0JA 4XNXH 5KSAB 1MHPH 3NFPA 2AJVH 1HNFA 3TBWA 3FFCA 1M7IA 4KVCH 2UWEF 4HJ0C 5FUOH 3TJHD 1ZLUK 1I3RB 3BEWA 5DJ6B 3STZB 3HMXH 1NBYB 3BMWA 4S1DC 5E00A 1U36A 1CVSC 4N0CC 2FO4A 1T83C 3A6BH 4QHLA 4Y16A 2GITA 5TJWK 4JFPB 4E9LA 3VFGH 1FZKB 3RDTC 4Y5YC 4LSTH 4KY1L 1YN6B 4I5BB 3ARGC 1DBMH 3HNSH 1DQLH 1U41A 1SEBB 3GIZL 3DTXB 3PQYB 4PJCF 1A6WL 5IV2B 1E4WH 2AJZB 2MKWA 3BRDA 2WWMC 3DROB 4C55A 2GYSA 1KCKA 1A3RL 4F37F 2VXSH 2H2PC 2R2BA 5C1MB 5D2NC 1T2QH 1XF4B 4YXLH 4IIQC 1EZVY 4NFCA 2FJFA 4LP4A 2ZCKL 3RWHA 3WO4C 1ADQA 1AY1L 5EC2A 3VXQB 2LU4A 3RTQA 1XFPA 4PJDE 1OAZL 5GGRY 4CJ0A 3HUJB 1G1CA 3DX7B 3ZE0E 1YEFH 4PRIE 1P7QA 1R6VA 1MVUB 1UJTA 2CJUH 4HZLB 2FGWH 4CW1B 4NZRL 4HUXA 5T3ZL 1LK2A 4YK4B 1J7VR 3SE8L 2JJSA 1G0DA 1SY6A 3GIVA 4MNGE 3S5LG 1UA6H 4GRLC 2HFEA 1I7TB 4R97C 4ZQKB 1I8KA 5ERWB 4LGSB 4NYLA 2UY7A 4XP4H 2CGRH 5D1XD 4KRNA 3LN5A 4YR6B 3MXVH 5E8PA 5DFVC 4UV4H 3S35H 1T03H 3GI8H 4P23D 5F6IC 1NEZG 1WZLA 5B39G 2D03L 5EU4A 3LQZB 2VLRB 3QH3B 1OB1A 3U30C 5FGRA 3AROA 2IPKB 4Z77B 2MCPH 2XZCL 4RAHA 4YE4H 5LWYL 1YYML 4Y1AA 1NAMA 2Z9TA 3JV6A 4F2MB 4WHCA 1QLFB 2D4DA 3EYQC 1SYSB 3C6LC 3B5HA 2H3NB 1OAYL 4S1RL 3CD4A 5MEQA 4DUWA 4ELMB 2D0HA 4P9HC 2EE3A 5IT2L 1MCOL 2W38A 1EAJA 3S35X 1BIIB 3I6LE 2LE9A 1CK0L 4H1LH 3RZCD 2OL3H 4Z9KB 4BQ9A 4F3FB 3QUYC 2FD6H 2V7NA 1NMAH 5K9OA 3GSNH 3KPNA 3VXMD 3FRPG 1NC4A 2AEPH 3LKOB 2ZUQC 1A6AB 5I17A 4P59H 3V52H 1ACYH 3LHPH 1YEEH 3RL1B 4WGVB 5CIPA 3R8BB 1W0WA 3BIAX 1JHKH 4K94C 4HFUL 1KOAA 5AD0B 1KENH 3ZKNC 5EOTB 1VADA 1C5DA 1W8NA 2DQEL 5IM7A 1GZQA 2GAZA 4R4FH 4NHUB 2ADFH 1KC5H 1I85A 4M61B 5C08B 4UT9L 4UB0L 5KVDH 1DQMH 1TZGH 3QHFL 3QO0A 2MPAH 4UQ2B 3WHE0 2VAAA 3X17A 4GOSA 5TE4L 4MXVE 4JFZL 4JQVC 3MNVB 3PHOA 2R2EA 1CFSA 1QRND 3F65A 4RGMC 5C71A 1DSFH 3HR5B 1QBML 3TN0A 5FGCE 4OCRH 4G80B 2DWDA 4UV7L 4C56D 1EO8L 4N9GA 4EDXA 2QQNH 3FT4A 2I9LB 4K3HA 3Q1SH 2EDEA 1D9KC 4K23L 3GO1L 1A5FL 2X70B 1WICA 1X7QA 5CINL 3L9RB 1K4DB 1MCKA 1P84K 3OKKA 2OTWA 1UVQA 1FZMA 4MB3A 4LCYA 3MFGB 4TYUA 1FO0L 4HUUB 4TNWF 5FF6A 2HLAB 4LKCA 5FGBA 3UTSD 1LVEA 5I19H 1S7QB 4YX2H 5F7LB 5I74C 1DUYA 1YNTB 3VD5A 4EI6B 3D0LB 2FRGP 4APQD 2H32H 7FABL 1VFAA 3NAAL 2J5LB 4LLDB 4WDIA 3LEXB 5L6YH 1Q9WB 4X5LA 2OS7A 4ENEC 3DXAD 1LP9E 2AJSH 4NC0B 1R3KB 3EW3B 3TYGH 2JB5L 3MQIA 2L0DA 4WO4A 1UZ8A 1ZSDB 4Z8FH 3QCVL 2XN9E 4PUBH 1ZGLP 1JNHA 5LAXB 2NW2A 2AKRB 3VJ6A 2F15A 4FTVE 1KULA 1ULVA 1S9XA 1INEH 2JIXA 4JRYA 4JEGB 4LU5H 4DKEH 5DTFB 4JFDD 3NOIA 4PLOB 5C0ND 3TBSA 2NY3B 4KGJA 5FHBL 1VB9A 5JPNA 4GG8A 5B8CC 1IGIH 5HDQH 4D9QE 1LE5B 2VISA 3EOTL 3T4YB 1S7SA 3VGBA 5GJSL 1O0VA 2F5AH 1PG7W 4LPYA 5D1ZC 1G9NH 3ARDC 3ZDYE 4X6EA 3NABL 5TQ0L 3MO1B 5DQJB 3CU1A 4AEHH 2ZCHH 4HXBL 1I7RB 1EMTL 4LL9A 4AJ0A 2FIKA 3P9WB 4I3GA 3QFDA 3MTRA 3QEQD 3EO1B 5ABDE 4KMTL 4BFGA 1W72B 2V5MA 2OJZL 3KPSE 3BESR 3CNKA 4G3YH 5GSRA 1MWAB 4MDJA 4YHPB 5GRJL 4PJIA 1KGCE 2O5ZL 4X6DE 1JV5B 2PW1A 3AVEA 1ZA3A 3HS0B 3PV7A 5SV4A 4B7LA 2YKLH 1MOEA 1YYLL 1WAAE 3TJHC 5DJ0A 4U7MA 4RGOL 5HPOA 4WY7H 3OX8A 4KV5F 3QQ3A 4ISVA 4OCNC 4UT6L 5DR5H 1WSST 3GSRB 4XTRD 3AMLA 2WINA 1TCRA 2X4TB 3KDMA 3VWKD 4K7FB 4WCYL 4ZPTA 1N6QH 1ES0B 3CC5A 2NYYD 2UV3A 4B7IA 1F4XL 4UTBL 4HUNB 3IS0X 4S1SL 1FYTB 4ZS7H 4JM2D 1LD9A 3RA7L 3KPRA 1YQVL 4EVNA 3MOAL 4QXGL 1NAKL 4XMLL 2Y1VA 3OPZH 4KK9D 4YLQT 1EUUA 3S3JA 5EOCH 2GK0A 1F3DJ 1ZEAH 4FQXA 4KDTC 1U8IB 1P5UA 3T2NL 4M7JH 3VXUA 3D6GA 4JHAH 3FFCE 1YMMA 3VWJB 3A6OA 1AIFA 3C2SA 1BFVL 1NLDL 1CYGA 4Y4KB 3MJ9H 4HS6B 1ZT7A 2YA1A 2DMKA 3SO3B 4RDQF 1HKLL 4H25B 3FO0L 4DAGH 3UROR 2CDGA 1UJ3C 2J1KA 1JCKA 4IJ3C 1KJ3H 4PP1D 4M03A 1I9RH 2EKSA 2W91A 4NO5B 2HG5A 3D18A 1K6QL 2VJXA 4O2EA 4HC1A 1E6OH 1FFNA 3KYMA 3MGTA 3VXOA 5T5NF 1MCQA 1RZFL 1ZHLB 4XMPL 4I0PD 5SWZA 1MF2L 4M43H 5D1XC 4L4TD 4C59B 4I3SH 1NL0L 2DQCL 2W0LA 4OIIL 4KUCD 3VGAB 5KSUB 2M2DA 1RZ7H 2Q7NA 4P23C 4UIMA 3SDDA 1EFXD 1VCAA 1MFDL 1CQYA 5T5FL 3V4VL 2IQ9L 4PJ7A 3RGHA 4K71B 5HYEA 3I2CH 3OSKA 3H8NA 1RZGA 4YZFF 4Z5RA 1RFDL 2DI8A 2AV1B 1KTDA 1X5XA 3VA2C 3OKLB 2BCKA 2YXMA 5AZEL 3CDFA 3JV0A 1ZHBB 2NXZD 3MROB 1O7VA 3FQTB 3NMEA 3MRBB 2VC2L 3BH8A 1FQ9C 4G9FB 5JA9A 1B4RA 1HHIB 3SCMD 4U1HB 3FN9A 3BPLB 5LCVH 1U91B 3RZCC 2G2RA 4OLUL 4ZSOB 1PG7L 2IH1B 1FORL 1A21A 1RJYB 5HVHC 4QHMB 1RZKL 2I07A 4XAWL 4ERSH 2QSVA 4LLAA 1YEJH 1A9BA 4XBEL 2X4QB 5EC1A 3S98A 3ZDZF 4IBLT 5HYFA 4PJ5D 1D3CA 4U6XB 3WDHA 5C6PB 3CU7A 4RFOH 2ZUXA 4P5KA 4AM0A 3JV4A 3SO5A 3CIQA 5J56B 4MQ7A 3D5OF 4JO1L 4PJGB 4XCNA 2IFFL 2GJZB 3MJ7B 4X6FA 3UC0H 3WFCH 2AI0H 1JGDB 5K33A 1C5BH 5EB9A 4QOKA 1AQDA 4FFZL 5KSAD 1BZ7B 4BZ2L 1A8JH 1JTTA 2Z8VC 4Y1AE 3H3KA 5H2BA 1KACB 3AY4A 4PB0H 3T0VA 4JPVL 4XC1H 2W9EL 1B90A 3NFNA 2IG2L 5J7CC 3KJ6H 4FHBD 2ZZUT 3E6FB 3RZWA 4FQ1H 5FECB 2DDQH 4NM4H 4MXQD 4GS7C 4BQBA 3RWJA 1IARB 3BEVB 5MP6H 2EDKA 1S7RA 1MHHB 1NAML 5ESAB 2LTQC 2W0FB 1LMKA 3RY4A 5E2VH 2V5SA 5ACZA 2X4NB 3BP4B 3QR2A 2QQLH 1N4XL 5I75B 5HPMB 3VH8B 4XZUA 1J8HA 4I2XA 1BFOA 4ACPA 3PQYD 3V5DA 4KQ4L 4NQCE 4TTGA 3DBXA 3LH2H 5D2LA 2X4UA 4KI1A 4PV8A 1KXTB 4E42A 2NW3B 3IJYB 3HI5H 4CADA 1OLLA 4I9WE 5DURD 4APQC 2BFVL 3ZSSA 4X4YA 2K3TA 4U1NA 3MV01 4HQQH 3DVFA 3GHBH 1XCQB 4XNYH 3W2DH 1IKFL 2OQJA 4MJ6B 4L8CB 4XWOD 3QWQB 4XPAL 4QXUH 3QEUA 3TNMB 1BREA 1NCWH 1MHEB 4DCQA 4PG2C 1T20B 1IQWL 2VZTA 4JM4L 3C8KA 2FZ3A 1YY9D 4PRAA 1TVDA 1JFQL 1UB6A 5T1DH 5ALBL 3O2WL 3WSQH 1J1PH 4L3AA 2SEBB 4HV8A 1D5IL 1W72H 3FQRB 4OZFA 1CFNB 3VXPA 4HIIB 5CWSB 2DKMA 3QA3B 3BI9X 3SKMA 1MWAH 1NFDB 3WFDH 1KJ2L 4PJBA 5C0NC 3BDYL 4I3RL 4NCDA 1P7HL 1ZT1A 1Z6JT 3P4NA 1F4AA 2OXHA 4OLVH 5IB4A 3VI4F 4OLYL 1JTOA 1OAKL 1S9VB 1IAOB 2E8YA 4HULB 3GSVA 3CVIH 3TO4A 1E4JA 3OKNB 1JF1A 4IDJL 3ZHLA 2HRPH 4FZ8L 3W9DB 4QF1B 1MPAL 2QKIA 3EYVB 3NCEB 3EHBD 4TULL 5INCB 1B2WH 1VGKB 5IIEA 1OF2B 1DBKH 1AQKL 5GGSA 4FABL 1BECA 1BQHB 2DQDL 4FXGB 2PN5A 4KKNA 3MA9L 3K3QA 2Y06H 4PG9A 5DD3H 1WWBX 1JHLL 4HH9B 3SE4A 1G7JA 3PGDB 1XGYH 4WFGE 5FCSH 3BSZH 1UWXH 3G04A 3N1QC 4MAYA 4L4VB 4WUUB 4XVTH 5DUPL 1EBAA 4DQOH 4JANB 4JKPH 3OR7A 3GSQB 4RFNC 2XIDA 1FL3B 1L7TL 1V8HA 5JLZB 1KTLA 4ZXBA 2A6IB 2FB4L 3ZE2E 2V2TA 3Q2CA 4NO2A 3BIBX 4WENB 5ADPL 4JRYE 4E41A 1YA5A 3IVKA 1HHKB 1GOGA 4RIRB 4YHNA 4Y2DB 3VFMA 2ZG1A 2RCSH 3I6KA 1F4YL 5CEXA 4HXAH 1FLRL 1U6AL 3WJJC 3BH9B 1IGYA 4XTRC 2CIIB 1LEGB 3KR3H 3QDJB 1KFAH 3O45A 2R4RL 3VWKC 2IMNA 4YWGH 5E7BA 2NYYC 4ZOBA 5FGSA 5C08D 3GRWA 3L6FB 4OBRA 3AS0A 1YN7A 2AERT 4JZOB 3L3OA 4XBPA 1IJ9A 3KPOA 2YMXH 3NZ8A 4JM2C 4U1LB 4XB8A 4HS8H 3MJ8B 3IU3B 4QTIL 5DVOA 4ZAKA 5AUMA 2D4FA 5L2JB 1XF2B 2ZJSH 5IVXF 2ZUWA 3BGFC 3G6JA 1ZT4A 4P4KD 3T0EA 1KB9J 2G75A 1L6XA 1RUPL 4KK9C 4X7TA 5BRZA 1I9JL 4GMTH 4W6XB 2UZYB 4WWKA 2ERJC 4PJIE 5DI8B 3N9GL 4GLRI 3F6LA 4XH2A 3L3HB 4PLJD 3KWWB 3OKOB 3BKJH 2KQNA 6FABL 1OOAA 3U2SB 1NUGA 3NN8B 2IAMA 5HGHB 1UKSA 1J11A 2HFGH 1VACA 1QSFA 4ZUWA 3MLZH 3EDFA 1LE9B 1TQBC 3V2AR 4XWGH 2P7TA 1NANI 4MNHB 3HZYB 5J9PA 4PP1C 4LFHG 3AGVA 4EBQH 4XNUL 4PRPB 1E27A 3TCLA 4K3GA 1F8TH 3KPMB 1MCJA 4MSWA 5KSBB 1CGVA 1JNLH 5DJZA 1IAKB 1NFKA 2GJJA 4I0PC 2WUCH 2Z92A 4ORGA 3SGJC 5IJKA 3QNYA 5HY9B 3VFPB 1JWSA 1XGQA 4M7KL 5KVGL 3NH7L 4K8RH 3KPRE 4TSAL 3SKOA 3WE6B 1GGCL 2N7BA 2OZ4H 1CFVL 3FHQA 1OGAA 1CL7L 2DIJA 5KVEH 2X4RB 4ODXA 3IGAA 3OJ2C 3GDBA 1ZLWK 4P2QB 2EYSB 4P4RA 5ID1B 5E5UB 4ZUTA 4YHLL 1JGVH 3VXUE 3IXAA 4JG1H 1R5IA 2CR6A 2QSTA 1DN0A 1B0GB 4GKSA 3DURB 2NXZC 1U8QB 4FQQB 3RPIA 3VXTB 3MYZA 1RMFH 2NY3D 3VD4A 1UCBH 1DQQA 2YC1B 3SCMC 4HCRH 1UADC 1XEDA 4OCWL 1EJ6A 1CF8H 3KYOA 2QSCL 1YEDB 2HH0H 2RHEA 4N8CL 1MJ8H 1GH7A 1AKJB 1T4KA 2FHCA 1E4XL 4MS8D 4HKXB 4XRCA 3F62A 5JMOC 4J3TA 1DBAL 3HZMA 2Q3ZA 2PCPB 4GRWB 2E9IA 5SWZE 3MRGB 3AU1B 2YR3A 2NZ9D 3CDGA 2XQBL 5EOQH 2VDLL 4EN3A 3MCLH 3WFHA 3VFSB 3SDXB 5DMGD 3OB8A 4EXKA 4V2CB 1T22A 4NO0B 3W39B 4NUJB 4HWUA 1BP3B 2YPKA 4PJ7E 1DEDA 1OSPL 1QFUH 3NPSC 4ZTPH 2J6EA 3QQ4A 4DTGH 3QDMD 5KSAC 1U58A 5B38A 3KGRA 3PL6A 4X4MA 1BVKA 4DN3L 2GEEA 4H26B 2L4OA 4L9LB 5E2WL 4FQPA 2ICEB 1X6NA 1D5MA 4UNUA 5B21A 5C6TL 1G9NC 3DUUB 5ICZA 5FDWA 4MXQC 4FMFA 3GNMH 1QKZL 4N0UB 1BVLB 2CUHA 1ONQB 4JPIA 4OT1H 3RHWF 1FLTX 5BV7B 3SOBH 2XZAH 3ROOB 4LRNH 5DMKA 5FOBA 5FM5O 2VDKH 1K9TA 4QHUA 2QHRH 2VDRL 2BSRA 1H8NA 3NBNA 3DV6B 1FYTD 5D7KE 5F44A 2CDEA 2YUXA 1LDPL 3O8XB 4MD5A 1N7MH 1OGTB 1NCDH 4XPTH 4PS4L 2EYRB 1FGNL 4NQDB 3LD8B 1NDGA 3FB7B 5GRWA 4PJHB 5A2JH 1KIRB 1WT5C 4L4JA 5E99H 3MACH 2DS4A 4QOKE 4D94A 1I7ZA 3U7WL 4NZJA 5GGVH 4JJ5B 3S3SA 3LS5H 3P4MB 1EHLL 3E8UL 4PYHA 3IDMB 4Y4KD 4XWOC 2KDGA 2VDNL 5EUOB 5D2NE 4OGAD 2ICWB 5FCUH 1NCTA 3RFZC 5DK0A 5D6DC 3VFOB 1YY9C 1RUAH 4UMGA 3FB5A 3NCFB 2Q3AA 3PIQB 4PJ9A 1AE6H 4YK4C 3WFBL 2J88H 2DAVA 1HCVA 3RWGA 3PWUA 4JKMA 1RUQL 4EIZC 4KK6D 4JGJA 1G7LB 2Z91B 4OI8A 3VXRA 1DR9A 3EYUH 3RWEA 5IESL 1J8HE 4I2XE 2D31A 2E9JA 3HN3A 4YGVA 3RL2A 1A6ZB 4UOW0 3DSFL 5K59F 4OD3H 5D2LE 3RVWD 1JUFA 3UTPD 5HDBF 4FA8A 3EHBC 1G7QA 2A6KA 1P4IL 4XCFL 5FFLA 4WI3A 3EFDL 2XZZA 4KPHL 4KJQD 1E6JL 2D9CA 5FDYA 3BJ91 2F19L 4C83B 4MGXA 2WSKA 4HKZA 3IYLW 4PGZA 4GRMA 4TUJA 1XGRA 1KEMH 2M8XA 4K9EL 1MI5B 4JO3L 4BELD 4WV1C 5JO5B 5EULV 2C4XA 5J12B 2RAMA 2EDDA 1SM3H 4K8RD 4IS6A 4XPBL 5KVFH 3BP6B 4ZFFA 1T04B 2AABH 4PJBE 5ICXB 3O4LB 3CUPA 3OKMB 1OVZA 4LGRB 3WDJA 3TIEA 3DMMB 1WF5A 5DDHA 1YY8A 4OQTH 1T6WA 5E08H 3DX8B 2IH3A 1QLRA 4O9HL 4XCEB 4YQXH 3SDAA 2EDJA 4KJYB 4WHYG 2E7CA 3PHSA 3K8KA 5CLWA 4HWBH 2Q76A 2Q8BL 2C7UA 5BQ7A 3F7QA 1OD7A 5KJRL 2DIBA 2EIZA 3DO7A 1EV2E 1OQXA 2ARJA 4DZBA 5EPMA 4ODSL 4P4KC 4HMCA 4G7YH 4YIQB 4OKDA 3ZL4L 5IVOA 4LBEB 5F9OH 4CMMB 4BZYA 4PLJC 3TH2T 4AL8H 5F1NA 3RI5K 2KZWA 3RVUD 5I1LB 2DTSA 3WXVL 1QG3A 5CMAB 4OCSL 43C9A 5CD3A 4ZYKB 1BX2A 4TOYL 3NIFE 2DKUA 4E41E 4CU7A 4NRYB 5CJQH 1M6OA 4JAMA 3V6ZB 3VFRB 4JZNB 4MDIA 5DWUL 1S9YB 4Z7UA 1WZ1L 1XR8A 4DGYL 2FWOA 1WWCA 3S5LB 4WJ5B 3CFDB 5C0IB 5I8CB 1U8LA 3BO8B 3GMOB 2WP3O 3GI9L 1T0NB 4GW5A 4WTWA 3VGFA 4OKVB 2J5LC 1IM9A 2NY2B 3O6FB 1PD6A 1MIEH 1QFOA 2ITCA 1A7QH 3VFWB 5FO9A 4D8PB 5TE6H 1AO7D 1H8OA 4R0LA 3MOBL 4M1GL 2RFXA 4KWUA 1AGBB 4AENA 3G6JE 3T0EE 5B39B 5BRZE 2Z35A 3P0YH 3GRWL 2DJUA 4U2YA 1ZLSL 3S97C 3WNKA 4YBQD 1CLOH 2ATPB 3LRGA 4P3CL 4OF0A 1VFBB 3S96A 3VU2A 1UM5H 2PTUA 5EOCJ 5IWLA 3J7HA 1J1OH 3RQ3A 2W60A 4F9LC 2DF3A 1IQDB 2NY3C 1QSFE 1QSVA 4FNLL 1CICB 4HWEH 4Z0XB 1WBXB 4NDMA 1KG0A 3RVTD 5I16B 1BBJB 4MMXC 3CLEL 1FE8H 3SQOL 3MZGB 4MS8C 1OAXL 3WUWG 3TESA 3H42H 4LSUH 1LEIB 2ED8A 1T5WA 4CNIB 3CXDH 3K0WA 5BV7H 1DE4B 4OLZH 5F3HB 5KN5B 1TJGH 3V9FA 4ETQA 1AHWA 2D7QA 4N8VA 5BZDB 4D0BB 4D9LL 1KLGA 2X10A 2NZ9C 8CGTA 2FEEI 3MR9B 3GMNB 5HI4D 3OXRB 3BKYL 5DMGC 4YUEH 2ORBH 1AD0A 1IVLA 3CH1B 3S4SA 4WWID 3GK8L 1RVFH 4JO2H 4L4VD 5CCKH 1OGAE 4OTXL 5AZ2L 5J1AA 2XPGB 3WLBA 5I2IA 1JZ4A 1UQSA 3DWTA 4LHQB 1MFAL 4KROD 4OSUH 2GUOA 5JNYB 3O3DB 5FO8B 2EDLA 3T4AB 4Y2DD 3EJYD 3UPCA 4NGHL 1OCWL 3GSNA 2JK5B 3FQUB 1ZVSB 2QR0A 4HW6A 2VDML 3RUGA 3MNWA 3QIBB 4R4ND 2D0FA 4I8DA 1MREL 5DMYA 3EYSL 3QDJD 2DQUL 3WXWL 5JHDB 5I1IL 5C0EB 5I1CH 1C7SA 3CDYA 4RRPA 1IEAA 2R2HA 2YRLA 3P9LA 4HWNA 2ZWLT 2E8ZA 5D71L 3LSOA 4FXLA 4MXWL 4X4ZA 3CPLB 4PTTB 2H9GB 2F8XC 4MQTB 4RX4A 2WUBL 4WW1A 1MFEL 1G6RB 5GISH 1I9IL 5TGBB 1R5WA 4U6YA 2CKNA 3M1BB 1RIVH 4F37K 2DQGH 4KQ3L 2GJ6D 1WIOA 5DFTA 3GJEA 3ZYOA 5TF1H 3MRCA 4PGDB 2NY7L 4G8IA 4X4ME 2OSLA 4G6JL 3VXSA 3HNTL 4KUCF 2P1YA 4Y4KC 1IGJB 1L0YA 3V6OC 1YJDL 5J0BA 2DQJH 4OGAC 5IP4A 1QR1A 1PBYA 3SO3C 5H35B 2XA8L 3DX9B 1UH4A 5E8DH 1S78D 3W5MA 2W65A 4GJTB 4D3CH 1PX4A 3U7YH 4PRPD 4M9OA 5F71A 3QIUB 4S1QL 5GZOC 4WFEE 4KK6C 1AP2A 4OQ1A 2P5WA 4A6YA 2FIRT 4GSDH 3WHXA 3BP7A 4O51A 3L5XH 1XF3A 5BJTB 3VGAC 1ETZB 4R9HA 5BMFL 3A67L 3S8WA 3RVWC 2EIEA 3GJFA 2MQ0A 5IHUH 4TQEH 4K71C 4MHHI 1AGEA 1VKXA 2GW5A 2YRPA 4LSSH 4P2QD 1N0XL 4KDWA 1A64A 1CXHA 3GJFK 2GFBB 4DZ8B 5C7XL 2E7LC 5MEOA 1K85A 1LNUA 4KJQC 1N5AA 3VRJB 2G5BA 2IADA 5AAWA 3EOAB 1WBZB 1U2HA 2BRQA 4MD0A 3DIFA 3MRLA 4BZ1L 3BPLC 2XQYK 4FFYL 2FHFA 5ILTL 9CGTA 3DHJA 2R0KL 4EI5B 4K8RC 4P2OD 3VXRE 4DGIH 1Y18B 2Y5EA 1VESA 3QO1A 3IFOB 1FZKA 1GYAA 1I8IA 4FP8H 1QYGH 3LPWA 2ZCLH 2C3HA 2QBWA 1R3LA 1CXKA 2ZG2A 4NO0D 3HRZB 5EBLA 5DJ2A 3DTXA 1BQUA 4M5ZL 1DDHA 3I9GL 4HBQA 5KOMC 4LIQE 5F1KC 5F70A 4NKOA 4NT6A 1TVBB 1IGCL 1F45A 3C5ZA 1SEQL 3N85H 2MFNA 1QVOB 4KAQH 4N0FB 4P46A 4GG6B 4W4OA 1MCDA 3UTTA 3LMJL 4Z78B 3GBNH 4R7DA 2IALB 4CVUA 2HT2D 1V7MH 4PRDA 5I76A 1HHGA 1OP9A 1IILE 3T65A 5I75C 1LEKA 1FRGL 3HUJF 3DX7A 1WTGT 4OGXH 3RVUC 3LRSA 5E94B 1CXFA 2CDFB 1SVZA 3IDJB 1IC5H 1MVUA 4HZLA 1S3KL 5E1AA 3VMPA 1MCPL 1EVTC 4BK4A 1N3NA 1PLGL 3RU8L 1U42A 2VDPL 4Z7VF 4BYHA 3O8XD 3BQUD 1C7TA 1VSCA 3LDBC 3INUH 1X5YA 1X6LA 4TNWK 1KF9B 3IAGC 1I7TA 4NQDD 2EDHA 1KLFA 3UJIL 4LRIC 1FH5H 4J8RA 4FQIL 3IFLL 5JQ6H 2OI9C 4XBGA 1M7DA 1HINL 4JFEA 1F00I 1HI6A 4L3CB 3OGCB 2VITB 4NPYB 2XXMB 1AGDA 2GCYA 3QXUA 2ZKHH 4X8XA 1JF6A 1BLNA 2VLRA 3TBVB 1NGZA 5F88B 2RBLA 1F4WL 3F12B 1MLCA 1MCNA 3U9PH 3MLTB 5E2TL 4YBQC 4MA8H 3T0AA 4KRPB 4WNQB 2ZG3A 4NKIL 4I18A 1SYSA 4JPKL 3C08L 1Q8MA 1J87A 4ELMA 3HNVL 5DD0H 1V3LA 2B4CL 2VZOA 3MRQB 4TVPH 1FV1B 4N0YL 4YHIB 2J12B 3U4AA 5FYJU 5IEKB 2AK4B 5INDB 3RVTC 3O3EA 5C0RL 1X4ZA 4Z7UE 3ZKSD 1JIBA 1T7ZA 1DVFB 1PKQE 5ENWB 5GRUL 1FO0B 2XRAH 4P3DA 4M6NH 3X12B 4AIZA 1L6ZA 3LKOA 3KPLB 5JW4N 4QYOA 3SQBA 4K3JL 5K9KB 4M4PA 4QXTA 5C6WH 4YNYB 4AK1A 3DVGA 3BJLA 1P9MC 5AD0A 4X7EC 5HI4C 2HJKA 4HG4J 3MGOA 2ADGB 4KTDH 5CHNB 1SVCP 4NHUA 1DL7H 4EZMA 1NSNL 2IEPA 3VGEA 4M61A 4IRZH 3RJDA 2BK8A 2IQAA 1MRCH 1CE6A 3GSOB 1G6RH 1IAMA 4ZTOL 4ZOAA 2HVJA 1MI5D 3DECA 3EOBB 3MSPA 4UTAL 4KROC 4QRSA 2CRYA 2E27L 5B38G 1KPVB 1MJ7L 4G80A 3BKCH 3O4LD 4XHQA 4JDZB 4Y2DC 2VKXA 3KXFA 3EJYC 4XCYA 4PY7A 3V5HB 1LP9B 2EE2A 4Q7DA 3A6CL 2YN5A 3DMMD 4PRHA 2X70A 2VSCA 3MX0A 1T1XB 1CD1B 1OSZB 4R4NC 1BD2B 3L9RA 2IBZY 4X0KB 1YPZF 3MRKB 3G5XB 1V7NH 4PGCA 4P2CG 1X5HA 4FTVB 4PJEA 3DUHA 4Q9RH 1FNHA 3QP3A 2EYTB 4HEPG 3DRTB 4N90D 5KANI 5CJOL 4DVBB 3TJEL 2FX8L 3K8MA 5GS0L 2WIIB 3KNBB 5EZOL 4KY1H 4AH2A 4M1CD 4Q9QL 3WLWD 1AI1L 1VEPA 3LEXA 5JQHC 3AS1A 1F3JA 3AAZB 1ZGLM 4PD4K 4R8WL 2UUDH 1R3KA 1A6WH 1FPTL 3ES6B 3O3BB 1I7UB 4IOSD 4GAYA 2BNQA 4UIKL 1RUKH 5A16B 3M07A 3WFEL 1RZIB 4GAGL 1OW0C 1TVHB 2H41A 4J3WA 5CP7A 2MCG1 1S78C 5EH1A 2XKNB 3KPSB 1MAKA 1IMHC 3RUGE 1QFPA 4UQ3A 4LCUB 2YD7A 2ZCKH 3NIGE 1AY1H 5DTFA 1TLKA 1UM6L 5BXFA 1L9NA 1OAZH 1WFTA 4Z7WA 3QWRA 3FRUA 1OP3K 2DL2A 2NY2D 1LE5A 5CILL 3O6FD 4LLVB 5JA8B 3I75A 3L3DA 4OZGB 3T4YA 3GSUB 4KZDH 4IMLA 3LKRB 4FXKA 4L8BB 4NZRH 1Z9LA 4YDLB 4EJ1C 1JWMB 3REVB 3SE8H 1T80A 3WKMH 3VRIB 3KYNA 2VIRA 5DQJA 3D2UA 2V17L 4WI2A 2EDBA 3TBTA 3FQXB 5EBGA 1I7RA 3EBAA 1ND0B 2GTZA 2FSEB 2X4PA 1JNNL 4LNRB 3VXSE 3FCTB 2AJUL 1T6VN 2UZIH 1MWAA 5IF0B 4MD4B 1CICD 1M71A 3P30L 4F7PB 1DEEA 2D03H 1ZOXA 5CJ8A 3ZYIA 5JZ7D 3V7AE 1GC1H 2P5WE 4P2OC 4OF3A 2AGJL 4JQXC 3EDEA 3NFPB 1KIUA 2XFXB 3TBWB 3FFCB 4EXPX 3MCKA 3P73A 1A7PL 4S1RH 2YPVH 4FQHA 5IT2H 1MCOH 5H8DA 3BEWB 4Y0GA 2IPUK 1KLUA 5E00B 4XPGL 1A7OL 4NC1E 3NGBB 4Y16B 4QHLB 2GITB 3HLAB 1N6VA 4K7FA 1ES0A 4A6YL 1LQSR 4JFHE 1T7YA 5LVEA 3LN9A 1PVHA 2QJDA 5AWNL 4YC2B 1D5BA 4TVPD 2C4FU 4XHJD 2H2SD 4X98B 2WQ8A 5DEFB 3LZFL 4FFWD 4L9LC 4CN4A 4M7LL 1QSEA 3VMNA 4Y5VA 2B1HL 4JFFA 2DQEH 1EZVX 4MQSB 3QIBD 5F97E 5HHXL 1BAFL 2HT2C 4U31A 2Z4QB 3VWJA 3K2UH 3RWCB 4UT9H 5JHDD 1N64L 4UB0H 3DV4A 2R4SL 3QHFH 2FJFB 4F58L 3RWHB 2XA3A 5E9DB 3RNQA 4X6CF 4JFZH 3RTQB 1EUTA 1RV6X 2NQCA 4WW2B 5C0BA 4CMHB 4UV7H 1EO8H 3O8XC 3BQUC 1DQDL 4FQCH 1D5ZA 4PJXF 1P7QB 3UX9B 2UVFA 4AEIH 1MCSA 1T21A 4K23H 1A5FH 1JL8A 4HUXB 3R8QA 2FBJH 1LK2B 1FG2A 5CINH 3B9EA 3GIVB 2QV2A 1UZ6F 2HFEB 3RRQA 3RY6C 3RKPA 3B6SB 3RX7A 4AIXA 3U1SL 1I8KB 1FO0H 1KCLA 4NYLB 3F8UB 1FNSL 5HHOA 5E8PB 3ZZ1A 2UYLA 5IMMA 2E9BA 2AV1A 3UTTE 2HFFB 3OKLA 3WS6A 3QIUD 7FABH 1OB1B 3NAAH 1YNKH 4U3XA 3EDDA 2YD1A 4G9FA 1MY5A 4Y1AB 1NAMB 3JV6B 2X9WA 5IGXL 3IDUA 2NY5L 2JB5H 2ENYA 5MEQB 1KB5A 3QCVH 4Y4HA 3QUMA 5KS9F 5GQBA 1DQJA 1T5XB 1QD0A 3UTOA 3DJ9A 5E5MA 4U6XA 2V7NB 5FHBH 5K9OB 1IFHL 3K8LA 4JFEE 3KPNB 4PRBA 1NC4B 4N8VG 3EOTH 4Y19A 5I17B 2GJZA 5EZIH 2VLRE 5GJSH 4PJGF 1RIHL 1I8MB 3RNKA 2CIKB 4J2XA 5CIPB 2O5YL 1W0WB 2CKBL 2F5BL 3NABH 1AXTH 4S10A 1VADB 4PIRF 5TQ0H 3S4SG 1CG9A 2VABA 1GHFL 5EUKA 4U6HB 5IM7B 1GZQB 1A7NL 2GAZB 5J12C 3DX6A 1HEZA 5FYLL 2VXTL 5C0CB 1QQDA 3ZKMD 4ELME 4ONOA 4U7KA 3UMTA 3QO0B 2VAAB 4H1LG 3UO1L 1SBBA 2XKUA 4EDWL 3H9YA 5DZLA 2W0FA 2NY1D 5EBWA 3PHOB 4XNMA 2R2EB 1CFSB 3DMMC 5GRJH 1BOGA 3BT2L 4PRID 1A1NB 3TN0B 1QOKA 2B8OT 2P49B 4KZEL 2O5ZH 4ODTL 2DWDB 1MCFA 4LDLB 1A14L 2VQ1B 4DW2H 1MCWW 2YD8A 1ZHNA 1UT9A 2RB8A 1X7QB 1QFWL 3RIFF 4RRPG 3OKKB 4ZNCD 2RQ8A 1UVQB 3E0GA 1FZMB 4UT6H 4LCYB 2NW3A 4URTB 5C3LD 2YWZA 4M1CC 5FF6B 1GZPB 4LKCB 3WLWC 2DLTA 1CDJA 2ZSVA 4AEEA 4ODHL 4HLZH 2XG5A 1DUYB 2HTKD 5JIPA 1F4XH 5IMOA 3MLYL 4S1SH 3WN5C 3HPLA 2Q8AH 1CTOA 1MHEA 4KJWD 1XF1A 3RA7H 3U4BL 1EFQA 1YQVH 4OB5L 4WDIB 3H3BC 3KXFE 1NAKH 4XMLH 5ISZA 4X5XB 1J12A 1CFNA 1NGQL 4PRHE 1U92B 5F6HI 5J06A 1NFDA 5C0JA 1IBGL 3OKDA 3I6LD 1UZ8B 1NBQA 1J86A 5BCAA 1JNHB 2ICWJ 2AJXL 2NW2B 5CAYB 1BFVH 5HHPA 3ORJA 1NLDH 3V7AG 3VJ6B 2NY2C 3O6FC 4PJEE 1KCRL 1S9VA 3HFML 2DQTH 4Y4FA 3TLRA 1S9XB 3HZKA 2JIXB 4JRYB 3FO0H 4LEXH 4J7RA 4QKXB 1ZLUH 5ADOL 1XCTA 3TBSB 2Q6WB 4C4KT 4BSWA 5JPNB 4GG8B 1T0PB 1A1OA 3TC9A 2VISB 4UAOB 1K6QH 1S7SB 4HK0B 2EXYD 1FC2D 3MBXL 4NNPH 3VG9B 5E8OA 4X6EB 1RZFH 4OJFH 5DK3A 2YSSA 4XMPH 1MF2H 1I1YA 3MMEA 3PGDA 4KC3B 1NL0H 2DQCH 3V95A 4OIIH 1OTUD 4WUUA 4L4VA 2FIKB 1CICC 1PAMA 3QFDB 5EO9A 1MFDH 5T5FH 1FL3A 4HX1A 1SMAA 3V4VH 4ZMAT 4LCWA 1RHHA 4U1MA 3N1MC 2R1YA 5GSRB 1U0QA 5JZ7C 5ELIA 1DVFD 4MDJB 5E6YA 4S2SA 2VDOL 4WEMB 2PW1B 2FNBA 1KTKE 5AZEH 3ET9F 1HQ4A 1ZA3B 4Z7WE 5DK2A 3I02A 3D9AL 3GMQA 2CMRL 1R3IL 3SKNB 1MHCA 5IR1A 3V5KA 2DQIH 5DJ0B 1A02N 3PWPA 4IOFD 4ODVL 1ADQH 2P47B 4GXUM 3OX8B 3QQ3B 3MBEA 4ISVB 4OLUH 1PG7H 1FORH 1RZKH 4XAWH 4U1LA 4XBEH 2WINB 2VWEC 3MJ8A 4PJFF 1TCRB 4XHJC 2H2SC 3KDMB 4BFIA 4ZPTB 5L2JA 3MLPA 3CC5B 5LXGL 4FFWC 2XY1A 4PPTA 2VH5L 4PJAB 1I1CA 1LD9B 3ABZA 4EVNB 2ADIA 2FATL 2IFFH 3L3HA 3KWWA 3SKJL 3QIBC 4PTUA 1QNZH 2C3VA 3HRPA 2XN9D 1X9QA 4BZ2H 1PG7X 3AREA 4FQXB 4GUPA 5ECJE 3ULVE 1LE9A 3VXUB 2W9EH 5CEZE 3QG6A 4FTVD 3B9VA 4OFYD 1YMMB 4JKLA 5BVPL 5I9QB 1AIFB 4I1NB 5F7HA 3X3FL 1OTSD 2VB5A 4BQCA 3KPMA 7CGTA 2R39A 4D9QD 1NAMH 2RR3A 4LEOA 5D7JB 4U49A 2E7MA 1KV3A 1MFCH 5AEAA 5KSBF 1MQKL 5I71B 3ARQA 1UEMA 2EKSB 1N4XH 1A4KA 5DVLA 4WI4A 4P99A 1A0QH 4O2EB 4X9IA 3HC4L 1KPUA 4KQ4H 1FFNB 3KYMB 3X13A 3MGTB 1R0AL 3KS0H 3QYCA 3VXOB 1NCBH 2YBRA 4X8JB 2YA0A 2VLKA 5SWZB 4UILL 4H5SA 4UDUB 3IETA 1QSEE 5DVNA 4PB9L 2D7TL 4NWTL 4YDKL 5E95B 4XX1E 2EYSA 4JFFE 3KPSD 4UIMB 1U3YA 3OAYK 4QEGA 3C5SA 2A1WL 3QIUC 4PJ7B 2GT9A 3FQNA 3ZKQD 3WO3B 1KGCD 1U8QA 2ICWI 3KLSA 1RZGB 1IKFH 3M8OH 5CIPH 5L88H 1QPXA 4U6VL 4XPAH 1AR2A 1KTDB 5CBAB 1ZLVK 2BCKB 5J13B 4Z7QF 3ULUF 4PGBB 4AYFA 5GJTL 5JIIA 3VXNA 1HKFA 4JM4H 1DLHA 5FM4A 4Z18A 5C0BE 1G84A 3NA9L 1AKJA 1CT8A 3QZWB 1JFQH 1B3JA