3VRLE

Crystal structure of bmj4 p24 capsid protein in complex with a10f9 fab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
222
structure length
222
Chain Sequence
DVKLVESGGGLVKPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVAIISSGGSYTYYSDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCTRDEGNGNYVEAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A10F9 Fab heavy chain
publication title Structure of the HIV-1 capsid protein p24 in complex with the broad-spectrum antibody A10F9
rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system/viral protein
total genus 40
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
E PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vrlE02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vrlE01
1G6RH 4P2CG 1OGAA 4TQEH 1IFHL 3ARBC 1IMHC 3C5ZA 4YAQA 2X4NB 1IAOA 2VMFA 2NPLX 4X0KA 1EHLL 4OCWH 2H2SC 5D1ZD 4JQXC 1W72H 1ZVHA 4PJ5E 4K8RD 2AERT 1GAFH 1KNOB 4Y4FB 4POYA 5CJ5A 4UIKH 2CKBA 2EDQA 1OOAA 1N64L 1C7SA 3DX9B 3QT2A 4S1DD 1M7IB 1KTDB 2ZUUA 3BN3B 5L2JA 4IDJH 3V4UL 3QXAA 3HC3H 1Q9LB 3WNPA 3HZMA 4Z7OF 4LCWD 3EHBD 4MAYD 4Z0XA 4OJFH 5IM7A 4LF3B 4WWKB 3GRWH 2O61A 5F9DC 4CRPA 4LSVH 1QVOB 3ZTNL 2AEPH 3MOBH 5I30H 3UP1A 1FG9C 2XTLA 4GXVL 4KK5D 4PGEA 4ZO6A 1U8MA 4E5XB 5FKAB 1X4ZA 5DFTA 3GMOB 3VWKC 1E28B 1ACYL 3MXVL 3NZHL 1H0DB 4KGLA 4R4BA 2MPAH 3TBVA 3WDJA 3JUZA 3C6LB 1XCQA 2WINA 5GIRA 4PP1C 1A7OH 4YBHA 4AIXA 1H3TA 3S7GA 3O6LH 4OZFG 1VENA 2IFGA 3PWJA 1MIMH 1EFXB 2FHFA 3QUZA 3QDJD 5GS0H 1HZHH 5EU6A 1WFOA 2JTDA 3HAEG 2I26N 1N7ML 4JO3H 5J7CC 1OT1A 1T1XB 5CEZL 5F7EH 5DMKA 1U8LA 1L7TL 1ZWIB 2FNBA 1IAMA 2ARJB 5I75C 4OCRH 4NRXA 3QFDB 2B1AL 2HWZL 2WIIA 3FMGH 3UPAA 1FNLA 3LPGA 4NFBA 3CFKB 4JO2H 2F15A 3UTSD 4O2EB 1I8KB 3G6DH 4C57C 2MHAB 1K6QH 1QQDA 3L3IB 1HYSD 1QPXA 2F54A 1P6AB 4LCWB 5HGAB 4JE4B 1QG3A 4MAYB 4NFCA 5HYSG 3F7VB 2EDRA 4YHLL 3L3DA 1RD6A 2X2YA 4GMTL 5DJXB 1KJMA 2CGRH 3WFZA 1HKLH 3S35H 2IADB 2DQTL 4J4PC 5F3BA 4XB8A 1CWVA 4HK3N 1A3QA 3WHE0 1P5UA 2YUWA 4W70A 2W9EL 4KQ3H 1F3RB 5D7SL 3TC9A 5BQ7B 1MAML 4U05A 2EYSB 4KTYA 1FPTL 5D5MA 4YO0A 5SWZE 5J9PA 1GHFH 4CBPA 1RQ5A 3QDJB 4DGIH 5DC9B 3MV7E 3JWOC 4GKSB 3RIFF 1NFDE 4Z7WB 4E41E 3C5ZD 4LPCA 3BP5A 4KROB 1UVQB 4EI6A 5T3XL 3UJJL 3EFFA 1BQLL 3F65A 3GDBA 1MCNA 3DVNA 2QQKL 2VLKA 5A2FA 4D0BA 4OCLC 1AO7E 3IU4L 4U0RC 4YIQA 5D2LA 3UTSB 1U8QA 2KZWA 1EO8L 5MERA 3PWNB 3HI5L 1S7WA 1REIA 1LP9F 4XH2A 3VGAB 3KYNB 4RMRA 1CFTB 2ENSA 5A16A 3TBWA 5K9QG 1NEZB 4LASH 1FJ1A 4GFTB 5LXGL 4NKDB 2D03H 4M4RA 1T7VA 3FQUA 2J6EH 4HIHA 1ZT4B 3UYOD 4BZ2L 3ZE1E 1YN6A 1IAIH 5EIIB 5C0IA 2QV2A 3V4UH 5E1HB 3MACL 2R69H 2I24N 5FYJL 4V1DB 5C07A 3ZDXF 2A38A 4DFIA 1F6FB 3MJ7B 3DTXB 2NY6B 2YD4A 4PB9H 4ODXA 3UJTL 3P73B 4U2YA 4MXVE 3MSPA 2BVQA 4HF5H 4U1IA 3BP6B 1YEGH 4HT1L 2ZOLB 1YEDB 4NUJB 3FHQA 4NBYB 1OGAB 4HKJA 3VFVA 3C5ZB 4YAQB 2HKHL 3ZKQD 1HSAA 5LCVL 1Q0YH 2IQ9H 2DQIH 1IAOB 4M62L 4X0KB 3X14A 3SDXA 4FFVC 2C1PA 4CU7A 1J5OL 2CIIA 4LFHG 2GYSA 4ONFL 5HSFA 1JGLL 2CKBB 1S5IH 3G04A 4HMDA 4UDUA 1D5MA 1L7TH 5CZXD 4JR9H 5L2JB 4KZEH 3S37H 5LGKA 2XZAH 3QXAB 3BKMH 2FSEA 2HWZH 3GMPA 3VI4F 5T33L 3O2DL 4WUUD 4LDOB 5FYKL 2ED8A 4TNVF 3HZMB 2W92A 5D7JA 2QKIA 4Z0XB 1QUNA 1DJSA 4KQ4H 3OB0H 1I3UA 5IM7B 1NCWL 5J13C 5E99L 1HDMA 1Z9LA 3CC5A 2O61B 1NQBA 4JAMA 4TPRL 4RX4D 1CF8L 3DXAA 1EMTL 1MELA 4LCUA 4G9FE 4PGEB 5GRJL 1U8MB 3LPFA 4R0LC 1F11A 4K94H 3F7PC 1SMAA 4R4BB 3F58H 1MCQA 1DQMH 2ESVE 3ARFC 3TBVB 5GIRB 2J8HA 1XCQB 2WINB 1PY9A 5BV7H 3OAZK 2DM2A 3UTPD 2BSSA 4MCZA 1EEQA 5F8QC 2W9EH 3PWJB 1I8LC 3QUZB 4DZBA 4YFLF 5EU6B 2NY7L 3Q6GH 1T03H 4R4ND 2MOVA 5DEGA 1FL3A 2APTA 3FAXA 1Q1JH 5DMKB 1U8LB 3PGFH 4QRSA 4NRXB 3HCVA 2E8YA 2VLKD 2WIIB 2HP4A 2IBBA 4QTIL 2FEEI 2VNCA 5LVEA 4Q9QH 1PKOA 4XNZB 1QQDB 1BQLH 3KXFE 2EE3A 2WAHA 2F54B 2Y25A 1TNNA 1I75A 4X6DA 1LO4L 3JVGA 3WNOA 4X7DC 4LSDA 4PY8J 2A73A 1MHCA 3L3DB 5TDPA 2PXYA 2E7LC 4NM8H 4S1RL 1KJMB 4AT6A 5GGTH 1MOEA 4ZOEA 1QRND 1P1ZA 4G7VL 5F3BB 1GC1H 1RZKH 1GGBH 4PJBA 1SJHA 3ELAT 1C16A 1ZA3A 1R3IL 2HJFA 1PSKL 4LAQL 5GGUA 1YECH 3VH8G 3S34L 4BQ9A 3QI9C 4NHCH 4KKCD 1FG2A 5D5MB 4YO0B 2P45B 5J9PB 5A40E 1MFCH 1QA9A 5EN2A 5HVWA 4CN1A 4ZXBA 4WJ5A 5DJDA 4LP4A 4XCYA 4KRNA 3P77A 1EUTA 1J05A 3BP5B 4WI5A 4OFYA 4EI6B 3KLDA 3EFFB 1KFAH 3DVNB 1HH6A 3P9WB 2VLKB 1N5YH 4D0BB 3UAJC 1ULVA 4YIQB 3TT3H 3BQUA 5D2LB 4NQEE 4M62H 1U8QB 2A77H 1MREL 4XPAH 5MERB 5LQBL 1S7WB 5DD3L 4XH2B 4QHKI 1PLGH 3BRGC 4PJ9A 3BXNA 4Y5YA 2VAJA 1UM4H 5A16B 3TBWB 4Y4HC 1FJ1B 1MCOH 4P46A 5EU3A 4LCCA 4RDQF 3D1MC 4JVWA 2YUXA 3C08H 3FQUB 4X80L 5C6WH 4D9LH 4I1NB 2IQAA 4HIHB 3GGWA 4BQCA 4Q9BA 5EIQA 1VFAA 2G75A 1YN6B 2R0WH 3KYOA 2OK0L 1IGCH 5C0IB 4ISVA 4J3OC 1DBMH 5C07B 2ID5A 3RZWA 1V3JA 4MJIA 3DXAD 2AK4A 1A1NA 4XC3L 2H32A 4OI7A 4ODXB 3C09B 5D7IA 5AWNL 2BVQB 2D4DA 3VI3E 1JFQL 3O6FC 4HPYH 1TPXC 4U1IB 4IOIA 1WEJL 4H0GA 5IGXL 2AVGA 4WTZA 2IANE 1MFNA 4Z95L 1ND0A 4FQJL 3U7YH 4HKJB 3I50L 3VFVB 1W2KT 2BOBA 1NAKL 3AY4C 1HSAB 5EH1A 2J8UE 3NZ8A 3X14B 3SDXB 1GGIH 4G6JL 2C1PB 4RDQG 4YWGL 2CIIB 1MQKL 1LDPH 1ZHLA 4DCQA 3R0MA 2FJFA 4OT1L 4BSJA 3LRGA 4L4JA 4JN2A 5CINL 2NY2C 1CFBA 4HIJA 3G04B 4OCMC 4UDUB 2ATKA 4ZAKC 3MV8A 4WI2A 5I1JL 1KCVL 1D5MB 1JVKA 5BOPA 4OD3H 1KEML 4KDTA 1V8HA 3O3AA 2FSEB 3GMPB 4JFFE 1BQHG 5TFSH 5A2LH 3H9ZA 2DAVA 3NPSC 5D7JB 3BH9A 5DUBA 2QKIB 3KVQA 3VXSA 4Q0XL 5DURD 4HUUA 1HDMB 3CC5B 1X5HA 1SHMA 1FCGA 2PXYD 2VDLL 1BLNA 3H42L 4JAMB 3K46A 4NYLA 4W6XB 5FGCB 4ZG1A 4L9LA 3DXAB 4P59L 1BF8A 3WFHA 4LCUB 4G6FB 4MJ5A 4NQCE 3OJDA 1UFUA 4EEEA 3T08A 1F11B 35C8H 4G5ZL 5GZOD 1J0JA 5JW3H 3TM6A 1BZQK 1J1XL 1HYRC 3WUWG 3ZKXC 2BSSB 4EXKA 4MCZB 2YPLD 4F7CA 1ZA6A 3EYUH 4DZBB 4ZXBD 3BPCA 2CDGA 4LQFL 4LKCA 5DEGB 1FL3B 1SYVA 1Y6KR 2BX5A 3KPSA 4XNXH 4OFYD 5DT1L 4XC1L 3MLVL 4QRSB 3HCVB 3TH4T 3WDHA 2GJ6E 3EFDL 1R3JA 2MSPA 3N9GL 4EN3A 3B2VL 1NBQA 1AHWC 3BKJL 3L3GA 4PJ9D 1BJMA 2NY5H 2WV3A 4IOFC 4X6DB 1T83A 4F8QA 4XBPA 2WZPD 2V9RA 3QEGH 1YEKH 4JKLA 4P46D 4U1KA 1RIVH 4ODWA 5DURB 3LS5L 3Q0HA 2A73B 1MHCB 2VL4A 5TDPB 2PXYB 1A5FL 4AT6B 3KHQA 3BE1H 4GAGH 3EYQC 5H37G 3CK0L 15C8L 5ESVA 1A7QL 3H9SA 1P1ZB 2F74A 4M7JL 5DK3A 5FCUL 5EOCH 3DURA 1H3XA 3T77A 1CBVL 4PJBB 1SJHB 1C16B 4MJID 1ZA3B 5AYUH 2HJFB 5GGUB 1A1MA 2E9IA 4LHUA 4YQXH 1FG2B 2P7TA 1J88A 1QA9B 5EN2B 4X8XA 1Z0MA 2WP3T 1VFUA 2VLRE 3RGVC 4ZXBB 3I2CH 4HJJL 4WJ5B 5DJDB 2LQRA 3O6KH 4XCYB 3P77B 5BXFA 1J05B 1L0XA 4ZTOH 1AR1C 1V7NL 4LLMA 4N90D 5IFJA 2VZSA 3H8NA 4LVEA 5E4IA 5KVGL 5IGXH 3RDTA 1JPTH 1HH6B 3I50H 1I1AA 5I9QC 3AM8A 3QWRA 4JFZL 3BQUB 3QNZA 2DIJA 1X7QA 4HBCL 5HD8C 2F19H 2QQNL 3VDBA 4PJ9B 3BXNB 4Y5YB 5I71B 4CDHA 1T89A 4P46B 5EU3B 1W8OA 4LCCB 1VDGA 4QGYA 3HMWL 5EBWA 3TYGL 2EDLA 2IQAB 1NSNH 3GGWB 1Z2KA 5I1DB 1VFAB 2G75B 3HNTH 3VXSD 3ARVA 3KYOB 1KEMH 4ISVB 5C0CE 1CK0L 3QHTC 5EDXA 5IVXF 4PFEA 3IS0X 1AXIB 4MJIB 3QIWA 4CN4A 1FLTX 2AK4B 1A1NB 2VDQL 4NC0B 2H32B 2BNQA 5I1GH 5D7IB 3H42H 2VDLH 4YDVA 1DZBA 1DTUA 4HWBA 1UA6H 2IC2A 4IOIB 3HPLA 3L6FA 1OM3H 3JWDL 5DRNA 1LO5A 4WEBH 1VACA 1ND0B 2PCPA 1BM3L 1P84J 3WIHH 2BOBB 3HE6C 2H41A 4NN5C 4E0RA 3PHSA 1QYGH 3S36H 3RVWD 4KJYA 3NZ8B 4JFPA 3EJJX 5GPRA 2APFA 1YYML 4U6TA 5BS0E 4G6KH 3KPSD 2XRAH 3EIFA 5F9WC 1FFRA 1UENA 1ZHLB 3JBG7 4DCQB 5KOMC 1CLCA 5ITFA 2GCYA 4JFOA 4F7EA 2FJFB 2OZ4L 3QPXL 4JN2B 4ZFFA 4HIJB 3TO4D 1OW0A 2NTSP 2ATKB 4UINL 3MV8B 2J7LA 3MV9E 3FN0H 3NMEA 3ILPA 5JHDE 3QQ9C 3O3AB 1AQKH 3WO4C 3EYSL 3D6GA 1CGVA 2OI9B 2X9XA 3WNLA 3BH9B 5DUBB 3VXSB 4P9MH 2X1OA 5FOJA 1ZHKA 4HUUB 3BPOB 4KK6C 4PRHD 1BLNB 4NYLB 2A6IA 1EDQA 4L9LB 4ZOBA 4J3UA 3WFHB 1WAAA 3LD8C 4GKNA 2GK2A 4MDJA 3OJDB 4MJ5B 4AL8H 4F37F 4JHWL 4P23C 2B20A 5HDOA 3V6ZA 2E7CA 2Z9TA 2AXFA 3CSGA 1RULL 3W82A 1TJIL 1KYOJ 1UXWA 1A7QH 3VW3L 2EIBA 4LHUD 1KXVC 4O02H 5IFHL 2NYYC 3GSQA 1YYLH 3SOBH 4F7CB 4NN6B 2OYPA 1Q8MA 2X1XR 2VDRL 1ZA6B 4OLEA 2CJUL 4TTGA 2EYTA 3BPCB 2CDGB 2X6MA 1OWWA 2ED9A 1BEYH 1CN4A 4LKCB 1SYVB 4TULL 1BOYA 1PEWA 2CR3A 3KPSB 4GJTB 4C56A 3BGFC 5F7HA 5E2JA 4G3YH 4L4VE 1CIUA 1QKZH 1VGEH 3H9HA 3O4LE 1A14H 3UBXI 1I1AD 1R3JB 2E27H 3BYYA 1RUQL 2EECA 4EN3B 4DGVH 4RNRA 4UTAH 3AS2A 2CKNA 5CCKL 4K7PL 4PJEE 1KCKA 2QQLL 4IMKC 4S1QL 4JFZH 1FL5A 3L3GB 4XBPB 4HBCH 3W9EA 4U1KB 4ODWB 3L3OA 4ELMF 3U7AA 5I1LA 5D72H 2HG5A 1EHXA 2E9JA 4M1GL 4Y16C 5ESVB 3VXME 3H9SB 1I85A 2F74B 2NY0C 5GISL 1BVKA 3D5OF 3JUYA 5ALCL 3ESUF 3DURB 3T77B 1DL7L 4F57L 4M4PA 2EE6A 3J7HA 1A1MB 4XVJH 3MLRL 5EU4A 2BNQD 1CK0H 4LHUB 5DJ2A 5KSVA 3KGRA 1K4DA 3W0WA 1BF2A 2V9QA 4RFOH 2AAVA 2P7TB 1DCLA 2JJVA 4LSRH 1T2QH 4L29A 5DXWA 2NY3D 2AQ3A 1NBZA 3SEPA 4HX1A 5BXFB 4ZTPL 4LLMB 5IFJB 4TNWF 1ADQA 5F7LB 1JMXA 2F5AH 1B9ZA 2CUHA 3MRCA 1OPGL 2OP4L 3RDTB 4QXUL 5ILTL 3BGMA 1ZGLP 5EZLA 5MP6H 4H0HB 1I1AB 5J1AA 1JGEA 3QNZB 3FQRA 2VDML 1X7QB 3K8MA 3RWHA 5JXAL 4EJ1C 1CXEA 1LK3L 2A0LC 1K5NA 2DI7A 5CEXA 1PD6A 1QEWA 3ZT5A 4DW2H 4ZDHA 1DSFL 3VWJD 5BMFH 4KKAD 2ZZUT 2X7LA 4YUEH 3ARGA 1T66C 1U8PA 5EBWB 1C8PA 4P99A 4NC2B 3TH3T 4Z8FL 4NO5A 1RUKH 3P3YA 2EDJA 2D7QA 1OAXL 3B3IA 1OSPL 3AMLA 4K8RL 43CAA 3ZTJH 1QNZL 4NN7B 3QIWB 3PV6A 3ARRA 2BNQB 5F7YC 4I3SL 3P0YL 4JDZA 5KSAA 4YDVB 5I15H 3NIGE 5D8JH 3HPLB 3L6FB 5DRNB 3RUGE 1LO5B 2BFVH 4PRPE 1VACB 3TVMA 3HZVA 5CLWA 1KUMA 1VFMA 3TFKC 4E0RB 4JO4L 4ZSOE 5D1QA 1TJIH 4GQ9L 1S9XA 4KJYB 3LQAC 1O0VA 2VB5A 4JFPB 3DETD 4Z76A 4U1GB 4Y88A 3RI5F 5ACZA 1XF3A 4ORZC 5E9DE 2GJJA 3INUL 3GM8A 5ITFB 2GCYB 2VL5A 4JFOB 4F7EB 4G8GA 1YMHA 3BAEL 1CICC 3W2DH 3MFGB 4ZFFB 4PV9A 3ARBD 2YD9A 3MLSL 3TN0A 1Q72L 4R8WL 3KJ4C 3T8XA 1N5AA 3DI2B 1VPOH 3ILPB 4Z7QE 3BPNB 2Q7NA 4X6EA 2H2SD 1IEHA 4ODTH 1H3GA 1ZXQA 2VAAA 2UUDK 1AFVH 5BO1H 1KEGL 1X6NA 1ZHKB 5AZ2L 4LLQA 3HPJA 3MRPA 4M93B 3S3PA 4HMCA 2A6IB 4PGBA 1BWWA 4A6YA 2YUZA 1RIUH 4FQCH 4GKNB 4MDJB 5CILL 3D39E 3QXDA 4FG6C 4JN1L 3V6ZB 3A6BL 4F58H 2AXFB 1RJLA 5ECJE 4OZHE 1CQKA 2E9BA 4QYOA 1UXWB 1IC4L 2MMXA 2OJEA 3VA2C 3W0WD 3GSQB 1C5DA 3Q2CA 1AXTH 3OBAA 2FX8L 2ILLA 1WBYA 3MV7A 1JPGA 4LIQH 2EYTB 5DC0A 5IB5A 4C56B 3VWKD 1II4E 1S8DA 5JR1L 5C0ND 3H9HB 4G6MH 4WVRA 1FORL 3Q48A 2K3TA 4PJ5D 5B3JE 2EICA 4ZTPH 2ZUQB 5AZEH 2DLFH 5HHME 4A2LA 1MCWM 4H25A 2UY7A 4MHHI 3OKNA 4RNRB 1GOFA 4ODBD 3LMJH 1YNLL 3QIUC 4WTXA 4X9GA 3S96A 1FL5B 1SMOA 4K23L 2I5YH 2VXSH 1YEEH 1W8NA 2UZIL 3K3QA 1NLDL 1SY6A 2O5ZL 3W9EB 3L3OB 3ARGD 3MRBA 3OMZA 3V5KA 5I1LB 2BVYA 1MJ7L 2HG5B 5D2NE 3CFCH 2BSTA 4XHQA 2DQEH 1BVKB 5DR5L 1IQDA 1MWAA 5CUSL 3RX5A 4OLXL 3B9AA 2LTQB 4BK5A 5E5UB 5EU4B 5DJ2B 5KSVB 4OFDA 5HHOA 1K4DB 2CKBL 1OAKL 3W0WB 1ZGLA 1QNZH 1Z5LA 3U7WH 1WZLA 4JCLA 5F9JA 1ACZA 4L29B 3IDMA 1I1CA 1X4YA 1NBZB 4DTGH 2AJVL 5CJXC 3QDME 5IESH 4HX1B 2VIRA 1BHGA 1FZMA 4JQIH 4BSWA 5I1CL 4UV4L 3MRCB 4WW1A 5IWLC 3BGMB 5FK9A 5EZLB 2WUCH 1F4HA 1J86A 1QTYT 3U2SA 5CJBA 1KLGA 5IMOA 5SX5K 5J1AB 3MCKA 1JGEB 5J12C 5I6XC 3L1OH 5F96L 1NLBL 3FQRB 1IBGL 2LV4A 5D2NC 3RWHB 1QHOA 5CEXB 1K5NB 1VESA 1QEWB 3ME0A 4F80A 4ZDHB 3TN0D 1MFBL 1ZMYA 1SYSA 5TPWL 1MI5E 2X7LB 3G08A 4OAWA 4YDIH 2R9HC 5I75B 5EOQL 3R8BB 4PBVC 3ARGB 1U8PB 4K94C 1RY7B 5C0RH 4R8WH 1MF2L 3P30H 2HLFC 1NFDF 3IETA 3F6IA 4NO5B 4IHOA 2DWEA 1LK2A 3B3IB 43CAB 5FIEA 4Y5VA 3PV6B 8FABA 4F15B 1JNLH 3WNMA 4JDZB 5KSAB 1RMFL 5E6IC 1ZLUK 3QCVH 4U7SA 1BECA 1R0AH 1JE6A 2AI0H 2CLRA 3WFBL 3TVMB 5SWZD 3HZVB 3I3EA 2QADD 3A6BH 3L7FA 2Q8BH 5D1QB 2DQJH 3MV7D 2FO4A 4AZ8A 3PJSA 5IQ7H 1S9XB 4Z7WF 3HI6H 4TRPL 3ET9F 4TSBH 3QIBC 4Z76B 4M5YL 2LVCA 5E7BA 5ACZB 1TZHA 1XF3B 4UT7H 3QI9A 1QSZA 3O9WC 2X4PA 2VL5B 4J6RL 4G8GB 1YMHB 1EAPA 1NC2A 4QXGH 4MA3A 4XVTH 2VKXA 4PV9B 3E1F1 2GHWB 5FGBA 3TN0B 2FDBP 3T8XB 4KI5E 1N5AB 4PRBA 2PN5A 4MXVF 1RZKC 4X6FA 3OZ9H 4X6EB 3S8WA 4KJPC 4WNQA 2VAAB 2O5YL 3Q1SH 4Y4KA 2UWEA 1KELH 2KKQA 4LLQB 1T80A 5IBTL 3HPJB 3MRPB 1C08A 1MCRA 3PDOA 3T0AA 3BESR 4PGBB 4QHUA 1KJVA 3RIAK 4A6YB 3BKYL 4XNYL 3HR6A 3QXDB 1J1PH 3ABZA 3HG1E 3V7AE 1XAUA 1RJLB 4FS0A 4QYOB 1QSFA 1IQWH 4MXWH 5HHOD 2OJEB 4RAVA 3WMSA 4OFKA 2DMBA 2FZ3A 2QADB 1C5DB 1M05A 4K3DL 2R2BA 1WBYB 3HC0A 3MV7B 1MFEL 1PQZA 1YEFL 4HKZA 1JPGB 3RP1A 5IB5B 3GKWH 4L8DA 3IFLH 3K4AA 4UNUA 4KI5C 3O6FA 1NEZG 1S8DB 4O58H 2FATH 4JJ5A 1YQ2A 4P9HC 2BOCA 4H25B 1ZE3C 1AGCA 2IBZX 3OKNB 5I76A 3LB6C 1TJGL 4NCDA 1A6WH 5KZCD 4TVPL 1H5BA 3HMXH 2D0FA 4KVNH 5DFVC 1ZK9A 3QG6A 4Z9KB 1ODAA 4R4FL 3S96B 2PF6A 2VYRE 1K3ZA 2B5IB 1J12A 1FNEA 3MRBB 4XP9L 3V5KB 2BSTB 4GH7B 1T21A 3C8DA 5EOQH 2IAMA 1IQDB 4ZS7H 1MWAB 3NCYS 3KYAA 2JCCA 1F8TL 5I19H 3BIAX 3B8SA 3CAFA 5I1AA 5HHOB 5JOEA 1RVFL 1ZGLB 2ZNXA 4JFEE 3FZUC 3V6OA 1GGTA 1Z5LB 2DQDH 1OAUH 4CMMA 3GKZA 1LDSA 3MGAA 2R56L 5F9JB 1MPAH 2IANA 2KDGA 3AXLA 3ROLA 3SE8H 3IDMB 4M1CD 1UGNA 4OB5L 2CXKA 2VIRB 1FZMB 2FLRT 4BSWB 5IV2A 3GO1H 1KGCE 4WW1B 5FK9B 4FTVA 4CADA 3WFBH 1BJ1H 3U2SB 1E6OL 1KLGB 5IMOB 3HC4H 3EZJB 4IM8A 3MCKB 3QI9D 1OD9A 5ALBL 4XAWH 2XTJE 1LEIA 5HGHA 5KZCB 4ZFZA 3OKMA 5IJVA 5DVOA 1TNMA 4Y8AA 2J3SA 3V8CA 5IHBA 1SYSB 5J6HA 4PJDA 3G08B 3WYRA 4OAWB 4KY1L 1J1OH 1U58A 1DE4A 3QYCA 3PIQA 3MV01 3UAJD 3K7UA 4TTDC 4K9EH 4O2CA 3FFDA 3IETB 1YEJL 4IHOB 2DWEB 1LK2B 2EDHA 4JM4L 2IPUG 2VH5H 1UM5L 1YMMA 4NQCA 3D85A 1F13A 4Y5VB 8FABB 4Y4HD 4HIXL 2XN9A 2JF1A 1NCUA 3BEWA 4MNQE 2R29L 3ULUE 4F2MA 2CLRB 4L1HA 4JZJC 5DD5L 4OLWL 1ORSA 3D3VA 2XTJC 1YEHH 3D69A 4PJ8C 3L7FB 5DHXB 5E2VL 5IVOA 1FLRH 2FO4B 3PJSB 4NKIL 3MREA 1FV1A 1OCWL 1TZHB 1FGVL 2ZUSA 3QI9B 5F7NC 4EUPH 1UM6H 3WEXA 1MVFA 1QO3A 2X4PB 3O6FD 4KUCD 2C26A 5DUML 2ZSWA 3JWNC 1EAPB 1NAMH 1NC2B 3EDEA 4MA3B 3QR2A 5AAMA 3RA7H 4PR5A 3KWWA 2N1KA 1Q0XH 4PRBB 2V5TA 3ZSSA 4G6AD 3HNVL 4RGMC 3OG6B 4G8IA 4OIIL 4X6FB 4PJFE 1DLFH 3PGDA 4XCFL 2HH0L 4P3DA 3BYTA 4JDTH 4WNQB 4Y4KB 2UWEB 4HFUL 4I4WA 1V05A 1C08B 3PDOB 3VXUE 1JN6A 2DIAA 4HQQH 4WRLA 3HRPA 3ULUC 2NY2D 1JBJA 4QHUB 1KJVB 2J8UF 3BZDA 1PG7H 3SE9H 3EJZC 2C5DC 4XMLL 5E56A 4XP6H 1FIEA 4E9LA 1UB6A 1QSFB 4OZGE 4DOHE 1B0RA 4RAVB 4KHXL 5I8KH 2FZ3B 2GSGA 1M05B 5CKGA 3NCEB 1P4BL 4HHAA 1DBJL 1ZVSA 3OKKA 3CLEH 2R2BB 4P4KA 3HC0B 4HKZB 1PQZB 3IDXL 2IAND 1CGYA 4L8DB 4JREB 2AV7A 3KPQA 4ZFGL 5GGVH 4O9HL 4ZPVA 4RAUA 3O6FB 1TPXB 1SJVA 3SDXF 1W0VA 4F7MA 4JJ5B 3BZEA 1DR9A 4FTVD 3SBWA 2Q8AL 2EDDA 2XIDA 1BAFH 3FO0H 2BOCB 3HE6A 5B39A 1AGCB 3A67L 5I76B 1S9YA 1H5BB 2BZDA 3BMWA 4UUJA 3SO3B 1FDLH 3QG6B 1A7NH 1E4XI 2D7TL 4AENA 3L5IA 4ODHL 3R1GL 1FNEB 4YXHL 4O5LH 5I8OL 2YD7A 3WCYA 3ES6A 1PVHA 2NY2B 1ROWA 4JEGB 3U46A 4WFGE 1T21B 1E4KA 4KY1H 2XT1B 3RU8H 2J88H 2IAMB 3EYVA 2HA1A 2CRIA 2JCCB 2OCFD 3SCMA 4W68A 1YMMD 1SBSL 4NQCD 3DGGA 4IOFD 3VE0A 1CLOL 2PR4H 3SGEH 5KVFL 4K3EH 5F9OH 5I1AB 7FABH 2YD2A 3CMOH 5CD5C 1KB9K 2P46B 3S3SA 2V7HA 1HINL 4CMMB 2IANB 3AXLB 3EYQD 3ROLB 3VDCA 1A4KA 3P4OA 3DUSA 1NCCL 1NCBH 3D3VD 2VXUL 1FRGL 2AJYH 3ZE2E 5L2KE 5IV2B 1G7LA 2YKLH 1E0OB 3L9RA 1NGPL 2Z8RA 5F3HA 5J8OA 4FTVB 4CADB 1T2XA 1QFUL 4LLWA 1ETZA 4GAJL 4P5TC 5D1XC 1LEIB 3T2NL 5HGHB 5D93B 2GJ6D 4LMQE 3RGVD 1J0YA 3OKMB 3QSKB 4ZFZB 5IJVB 2W0KA 1AD9A 1AR1D 3U0WH 5J6HB 4PJDB 4QRRA 3HZYA 2HYMA 4PJHE 4RMSA 1U58B 1DE4B 4X6DF 2Z4QA 2W91A 4RWYH 2HRPL 3PIQB 4GG6E 4M1DL 4I0CC 1RZJH 4O2CB 3FFDB 1UKTA 1PEZA 4YDLC 4UOW0 4WW2C 4MJ4A 4ODUA 1YMMB 5L8JB 3QZWA 4NQCB 3D85B 1QSEE 3DMMC 2X4SA 1JGVH 4FQXC 2G9HA 4HKBA 2XN9B 1C5CL 2BY1A 2GSIA 1F4WH 3KLHD 1XGUA 4UT6H 1N2RA 1SEQL 3BEWB 3FT4A 3MBXL 4UBDD 4LMQI 5JHLH 2MKWA 1GCFA 4F2MB 1JGUH 5J3HC 4PJIE 5DJ0A 3O2VH 1ORSB 3D3VB 3WJLC 4GBXA 1G6RA 3D69B 4YX2L 3STZA 2VLRD 3SGJC 4EI5A 3MREB 1S7UA 1EGJA 1CYGA 1I4FA 1FV1B 4YLQT 2E5EA 1XGYH 2ZCKL 3A6CH 5KS9A 1W72A 3WEXB 3PWPE 1QO3B 5DJ6A 3RPIA 1S5HA 2ZSWB 3EJYC 3O8XA 1J8HA 5C0FA 4D2NA 1E6JL 5DD1H 2FX9L 4PR5B 4U6HA 3HE6D 3KWWB 5GS1C 4WU7A 3L3KA 1B2WH 1BFSA 5KANG 4G8IB 5C0EA 5EO9A 3PGDB 1JZ2A 3B5TA 3ZDZF 4JPVH 2AKRA 3ESVF 4P3DB 1GSMA 4POUB 5FDWA 2VLJE 2VXVL 1WV7T 3A67H 5KAQF 4I4WB 4BYHA 1JI1A 4U6VH 4NQXA 3KR3H 2QQQA 3GRWA 1JN6B 1QBLL 2VZ3A 2E6QA 1KN2H 2VSDA 3SE3C 5I8OH 5EO1A 4HKXA 3QQ9D 2V17L 3HS0A 4RFNC 1UB6B 5D7IF 3QEQE 4S1SH 3NA9L 4NZUL 5HXMA 1B0RB 3FL7A 2OQJA 3WD5H 1NGWA 2GSGB 1FCCA 4HHAB 2NMSA 4KK6D 2FJHA 1ZVSB 3OKKB 1SBSH 4P4KB 4NZRH 1MHHA 4IRZL 4MA1C 4PY7A 1HIML 1N4XL 4YZFE 5BVJA 1EIBA 2AV7B 4ONGL 2ZJSL 4P23D 1DFBL 3KPQB 2KQMA 3CXDL 4ZPVB 4RAUB 4MA7H 1W0VB 4F7MB 1IGMH 3TWCH 3BZEB 1T22A 5KAQG 1KV3A 2NXZC 5GRUH 2FHBA 2B4CC 2NYYD 3HE6B 5B39B 5HHXH 2VDPL 1S9YB 5E2UH 1P7KA 1YPZA 5KTEL 4UUJB 1BZ9A 1CZ8L 1HI6A 6FABL 4AH2A 4HWBL 3MV9D 4AENB 2J5LB 5F7FA 5JHDD 1AI1L 4MMXC 4TUKH 3VFGL 4M8VA 4P2OA 1XIWC 3MR9A 4QRRD 3L3HA 1O7VA 5MI0C 3ES6B 4U3HA 2R4RL 5JPNA 1A3RH 3U46B 4WFHE 5EU7E 4WTZG 2NR6C 1T7ZA 3U4BH 3EYVB 5CJ8A 3L95A 2VZ1A 3G6AA 3FTGA 3SCMB 3DGGB 3NGBC 3VE0B 2AS5M 2Y07H 2HFTA 5SX4H 1RZFL 2JELH 1UYWH 4JM2A 4OKVA 2QSCH 3KPNA 2V7HB 4U2ZA 1T7WA 4Z7UE 3PWLA 4PJEF 2MQ0A 4AMKL 3ARQA 1A4KB 1NCNA 3P4OB 3DUSB 4IJ3C 3U48A 3V0WL 2NY0D 4ZUUA 2AXGA 4XMKL 2ICWI 1G7LB 5BJTA 1DBBL 2Z8VC 2X9WA 3L9RB 4EI5D 2Q3AA 5F3HB 4OTXL 3U9PH 2PYEA 2ORBH 4OIAA 5T5FH 1VSCA 4PJGA 4LLWB 5L6YH 4FZEH 1ETZB 2QR0A 1IKFH 4L4VD 2W0FA 5IIEA 4CMHC 3P0GB 2CRYA 1G6VK 2XY1A 3HR5A 1KENH 2FB4L 1D5IH 4M7ZC 3GHEH 3FO1A 4UV7L 1KC5L 5EU7C 2M8XA 3ROOA 4M3JA 1NMAL 4NM4L 1AD9B 2BRRH 2DQFA 2AK1L 4ZUSA 3BKCL 4XP4L 1FYTA 3NA4A 4QRRB 3HZYB 4UTBL 2Z4QB 3MLUH 5T1LA 1JYVA 2J6EA 2VABA 1KBGH 5CJOH 4H8WH 1BGXL 3WFDL 2R0ZL 3V7MA 2KL6A 5DQDL 5LGHL 1J9CT 1KJ3L 1JK8A 3QIUA 4ODUB 4XGZA 4PG2C 4QEGA 2IMNA 1INDL 3PL6C 3QZWB 5M95B 2X4SB 3MA9H 2G9HB 2KH2B 2FBOJ 4HKBB 1E27A 4XXCC 5IVZA 1MQ8A 2GSIB 5F70A 1XGUB 1C1EH 1N2RB 1T66D 1UJTA 5FUOH 5L88H 3TIEA 2DN7A 2P4AB 2F9BT 3FT4B 4OLYH 1QOKA 1JRHL 4HK0A 2DL2A 5DJ0B 4Y19E 3IAGC 2NY0B 4GBXB 1G6RB 2BNRA 2JK5A 3DSFL 3STZB 4JZNA 1A21A 1UCTA 3BDBA 5D6DA 4EI5B 3DGCR 1S7UB 1Z9MA 3P0VH 1I4FB 2GY5A 4HEPG 4WHDA 3V5HA 3FKUS 3THML 5KS9B 1W72B 4GMSH 2X05A 4J3XA 1MCPH 5DJ6B 4MS8C 3HE7A 2RR3A 2VKWA 3RPIB 1S5HB 2J4WH 4MXQC 3BRFA 3MMEA 3O8XB 1J8HB 5C0FB 5EULV 3HNSL 1CE1L 3JXAA 2ERJC 3TP4A 4U6HB 4LARL 4PRIA 3TFKD 4JRXA 4GW5A 4WU7B 3L3KB 3S88H 1JI2A 3WE6A 3QHFL 5C0EB 5EO9B 4XWOC 1SJEA 3WHXA 3T2PA 4KMQA 3T04D 2AKRB 1N6UA 5DMIH 5C09A 1A0QH 5FDWB 2Z91A 3V4VL 1AGFA 2BK8A 2XZCH 4LHUG 4P2OD 4NCC1 4W6YB 4NQXB 5LBSH 1F90H 4LLDA 1ADQL 5F6IB 2HKFH 1OTUC 5EO1B 2NQCA 4HKXB 1HWGB 5ANME 5MENE 3GI9L 1T6VN 1V7MH 1YJDC 1VB9A 3HS0B 1CR9L 4LPWA 1JGDA 3S98A 4K7FA 1HCFX 2F8VA 2OQJB 3T0EE 1I9JL 1NGWB 3VG0L 3VRJA 2FJHB 3X3FH 4FQLL 4BFEA 2I07A 2XQBL 1MHHB 4PY7B 5BVJB 1TZGL 4JKKA 1U8JA 2I9TA 4DN4H 2Y06H 1UG9A 5I17A 4WENB 4KRLB 1T22B 2RHEA 5E9DD 2W07A 2YC1A 1FIGL 2H9GA 2P1YA 2X44D 3ULVL 4MJ6A 3IFPA 3SDAC 1UWGH 1P7KB 1YPZB 3M45A 4QWWC 3QP3A 1PW3A 1BZ9B 1ES0A 2FJGA 1HI6B 4OZHF 4WCYH 4WHYG 3QDGA 3MLPA 4FZ8L 4AH2B 3RQ3A 1L0YA 4WI7A 3RVVD 3O9WA 1FYTD 1BMGA 5KJRL 1A7RH 1EBAA 3LN9A 3MR9B 4P2OB 4M5ZL 3L3HB 4H1LA 1CGSH 5ERWA 4ALAL 5T1LD 5JPNB 2A6KA 2AK1H 5GGTA 5E24E 2AEQL 3BKCH 3T0EC 2W9DL 3L95B 3G6AB 3QIUD 3FTGB 5TF1L 1G9NC 2X4OA 3D39D 4NJ9H 1R3HA 1OB1A 5B3JF 3JWOL 4JM2B 3LQZA 3WFCH 4OKVB 2VERN 1EAJA 4JQVC 3KPNB 1YNTA 1NANI 1YUHA 2C9AA 3PWLB 1FNSH 1H8NA 1HXYA 1CXIA 2IEPA 3MRJA 2VZVA 4ZUUB 2AXGB 2VDKL 1ZLSL 3LRHA 5BJTB 4JZOA 1BBDL 3O2WL 4NO0A 1XGQA 2VZTA 4AEEA 3E6FA 2PYEB 4KJQC 1FZOA 1UWEL 1XR9A 3N1PC 3ZDYF 5EUOE 4PJGB 3ARXA 3QULA 5FYLH 5BW7A 1U8OA 2QR0B 3SKJH 3VGDA 2W0FB 4A6YL 5C08E 1F3DH 5IIEB 3LEXA 4GS7C 4N0UA 3OPZL 4MVBD 3V9FA 4PJAA 4OF8A 3HR5B 1EERB 3RZCC 3GBNL 3FO1B 3ROOB 5GRXG 3UJIL 3TH2T 4JRXD 2DQFB 4ZUSB 3G9VA 1FYTB 1QSVA 3K81A 3HNSH 4AQ1B 3D18A 5T1LB 3WS6C 2VABB 5K9QI 1DQTA 3MYJA 4URTB 1JPST 2ADFL 1JK8B 2OJZH 4WV1C 1CLYH 3O4OB 3QIUB 4XGZB 2J2ZA 4IOSD 3D39B 1KTRL 5DHVH 4LSSH 5IVZB 1E27B 2R9HD 1I3RA 4NGHH 1K9TA 1NCDH 4P2RE 4WO4A 5I1EL 2CUIA 3TIEB 1A9BA 5DO2D 3G6JA 1D3CA 1YEIH 4HK0B 2HLFD 1OARL 3SO5A 2BNRB 3S37X 2JK5B 4OLVL 4JZNB 5FUCE 5FUZL 4HULB 3MRFA 3C2AL 3DX7A 1SY6L 3QDMD 1Z3GH 5C0JA 5C2BL 2WWMC 3V5HB 5LG1A 1D6VH 2F53A 4R7NA 5E6ID 1RURH 1LMKA 3HE7B 3EKCA 3MMEB 4XCCL 1T5WA 2P5EE 1I3VA 1MWAL 1EH9A 2VISA 3U30C 2MJWA 1LQSR 4PRIB 4JRXB 4YE4L 2B0SH 3KDMA 4GW5B 5DGRA 3VD5A 3WE6B 3PWUA 1SJEB 3WHXB 3QIBD 1G0DA 4N1HB 3QDGD 5F1OB 5EA0L 2GITA 2C3XA 5C09B 5HDQL 2Z91B 4HZAA 1HILA 3O3EA 1AGFB 3O9WD 3GI8H 5GS2H 2CR6A 3IT8D 5ITBL 3VMNA 1ZLVH 3MODL 2J12B 4CJ0A 1AXSA 4LLDB 2Y7QA 2H26A 3MQIA 2DQCL 2RB8A 2JB5L 4NP4H 5FUCC 3DWTA 1K4CA 4LSTH 1SVCP 3ULVF 1CD1A 1YY9C 2WBJC 1JGDB 5C0GA 4L5FL 4FQIH 4NWTL 4K7FB 5IMLA 1U36A 5BV7B 2W9DH 3VRJB 1SQ2N 4M6ML 3U1SH 2I07B 5KOVC 4OLUL 1NGQH 4DK6A 1U8JB 1MCBA 3ZKMC 2NXYD 2VXQL 2I9TB 3NH7L 4XNMA 2X1WL 2V5SA 5I17B 1LVEA 4ORGA 1FO0H 5HYJA 2YC1B 1PKQE 1D5ZA 2H9GB 5GZND 2DLGA 2FEEL 1IL1A 2UYLA 4MJ6B 3IFPB 1OL0A 2DQHL 4QF1A 5JXEC 2HRLA 4OF5A 1KCRL 1ES0B 2FJGB 1UC6A 4KXZI 1FH5H 3QDGB 2BHUA 4KI5D 3MX0A 1XGRA 2OXHA 4L4TE 1DBAH 3O9WB 2AGJL 1MCWW 4H1LB 5ERWB 3RWDA 3UJIH 1OAQH 4QOKE 4V2BA 2CDFA 2A6KB 5GSVA 1QBBA 2MCPL 4JO1L 4XVSH 1AC0A 1HQ4A 3LB6D 5F7WC 3MBEC 2OTUA 1K8IA 3W81A 2A6JA 5DUPH 4D9RE 5DFVD 3PHQA 2X4OB 4LVHC 4QHLA 1R3HB 3NACL 5T3XE 4YFLI 1OB1B 4BUGA 2MQCA 3QCTH 3LQZB 4YHIA 2EC8A 3EO9H 1JWSA 3B9VA 4P48A 4WO4D 1YNTB 1YUHB 3DRQA 4CU8A 1QD0A 3RKDC 1HXYB 3ZSTA 2NXYB 3MRJB 4ZD3L 3EDFA 4JZOB 5SWSA 3LH2L 4NO0B 1RIHL 1XGQB 2YD5A 5ESAA 1G9ML 3E6FB 1KCSH 1FZOB 1TTGA 1XR9B 4YHOH 3MRGA 4Q7DA 3QULB 2YMXH 2Q87A 1U8OB 2F53D 1T0MA 4ZPTA 3FZUD 3LEXB 3MUHL 4N0UB 3U82B 3GMRA 4LRIC 4PJAB 1NBVH 5FYJE 3LZFH 4ZQKA 1S7RA 2R0LL 3CVHH 3IB4A 3TT1L 3VFNA 4M61A 3D18B 5E08L 1G7MA 3AMKA 4DAGL 5ADPH 1DBKH 3MYJB 1TQCB 1UEYA 3B5HA 1KTLA 4UB0H 1CDBA 4GOSA 5C92A 4JFDE 4FQ1H 5GJSL 5EA0H 1EO5A 4FFYL 5L9DH 3TA3C 5C86A 5GRYA 2ATPA 5FDYA 4BZ1H 3RGHA 3QEHA 1IC7L 1CFNA 4PJXA 4I3RH 2DKUA 1I3RB 4DGYL 4WO4B 4X5LA 4XNUL 3MLYL 1WFUA 1A9BB 3G6JB 1CTOA 5KSBE 4RIRA 5T5NG 3SDYH 2EH7L 3WIHA 4WFFD 4IIQC 1GZQA 3HFMH 2OLDA 3BUYA 2DBLH 1JNNL 3MRFB 4GO6B 3DX7B 5TQ2H 1QFWL 2CPCA 5C0JB 4A2MA 4YK4C 3UC0L 5FYKE 3NCJH 2F53B 3GZKA 5C2UB 4R7NB 4DQOH 4RISH 2HT4C 3O81A 3B9KC 6CGTA 3F12A 3MC0A 1TVHA 1T5WB 4OZIA 1WIOA 2VISB 2Y4SA 2XTJD 1VGKA 4PJ8D 5JW4Q 3KDMB 2D31A 2D0HA 2PTVA 4NIKB 1OTTD 2FH8A 3PWUB 4NUGH 4JPKH 3UDWC 4QTHA 2DTML 2GITB 4U1LA 4MAUL 1FE8L 1HILB 3O3EB 4NZTL 3ETBF 4HBQA 2DDQL 1BWMA 3NCBB 1F58H 2A83A 3AREA 4QRPE 1AXSB 4F9PC 1JCKA 1HKFA 4LEXH 2Q76A 2H26B 2Y7QB 5EZIH 4GRLA 2YD1A 4UOW1 2XICA 4MZ2A 4Q6IC 3BGAA 4K07A 1K4CB 4MMZC 2XG5A 5FHBH 5B22A 4X9HA 1CD1B 5C0GB 4XCNA 4MCYA 5HTSA 1WT5C 4HMEA 4O4YH 5IMLB 1G7QA 4WFED 4YHML 4K2UH 4WW2A 1NUGA 3ULUD 2EDTA 4X6BA 5LGJA 4Y5XC 4PJFF 3ARTA 3MXWH 3DMMA 3L5XH 4HCRH 4FQXA 3EJZD 4HG4J 1S7VA 5E8PA 4LCIL 1A7BA 3MGOA 3ARPA 3IRZA 4XNMB 4NNPH 1BIIA 2XNAA 4LSPH 4U3CA 3QXTA 4ORGB 5HYJB 1AD0A 1GPOL 1D5ZB 3I6KA 1CGTA 1IL1B 1RUPH 2HT3C 5DDHA 2UYLB 2BERA 3SGJA 4QF1B 4EBQH 1CFVL 2PTTA 3DV6A 1OHQA 3E2HB 4X83A 4YDKL 1ZT7A 3X3GH 4HLZG 4KKBC 5D71H 1AR2A 4OZGF 1XGRB 5GJTH 4HXAL 1MSPA 1DUZA 1FC2D 3V4PL 4Y2DC 3RWDB 3GHBH 1MCLA 1PZ5A 3KYKH 2UWEF 5DA4A 4X7SL 2CDFB 3SGKA 5GSVB 5HGGS 4B0MM 3DARA 3TT1H 2NY1C 1HQ4B 5TQ0H 2OTUB 3QRGH 1K8IB 2A6JB 3FFCA 5IF0A 3PHQB 2IPUK 4QHLB 3PXJA 4AJ0A 2DJ4A 1FFNA 5JW4R 3ZT6A 3NTCL 1UZ8A 4YHIB 1JWSB 1IC5H 1HN1A 3GSNH 5D70L 3NCCB 3QXWA 3DRQB 4B53A 1OLLA 3LKPA 4YFDB 5CKAA 8CGTA 1QHPA 3RY5A 4M7LT 4BZYA 1VEMA 5SWSB 2EYRA 3WLWC 3VFTA 5ESAB 2YRLA 2VZOA 1CD8A 3SJVE 5D7LE 1OF2A 3MRGB 3GNMH 4OI9A 1U3HC 3CXHK 1T0MB 4OQ1A 4YBQC 1MCEA 4OUOA 4ZPTB 5I73B 3M8OL 4LAJH 3GMRB 4XPHL 2IGFL 1UH4A 2RCSL 1DEDA 4ZQKB 4X4ZA 3NAAL 4JY5H 2WUBH 4DKFL 1S7RB 4HD9A 4HS8L 1FAKT 3LIZH 4Y1AA 3MLWL 3RHWK 3V0AC 3VFNB 4M61B 2OZ4A 1NCTA 2JJSC 4Z7VE 3HUJA 1G7MB 3QBTB 5JOPE 3RWCA 3DBXA 1DANT 4MNGE 5GRZA 5D1XD 1KTLB 4ETQA 4H20L 3ZE2F 3T0XA 5CJQL 2WK2A 1V5JA 1NMCB 3CU7A 4V2CB 5LWYL 2XKUA 4HK3J 3Q5OA 4WFGD 2ATPB 4QO1A 4M6OH 3QEHB 1CFNB 4MGXA 4PJXB 2YK1L 2FO1A 1XGTA 1GYAA 5IROC 4YHKL 4L3EA 2FD6L 4RIRB 5JIHA 5DJZA 1GZQB 5I8EA 2ZCLL 3BUYB 2CK0L 5A2KH 2ZSVA 3DMMD 4FQXD 4PGJA 5B4MD 1AJ7L 5JUEL 3OAYK 4GG6F 5L2KD 1DLHA 1KIRA 2H1PL 3WJJA 2P5WE 1ZEAL 3C60C 3CVIL 1RZIA 3F12B 4R7DA 1CDIA 1N59A 1TVHB 4EDWH 1A3LH 4UDTA 5J3HD 2DJSA 2VTFA 4OZIB 3EAKA 1TVDA 2VDOH 2WBKA 1VGKB 2JE8A 2VDNH 4JG1H 1X5YA 3E6HA 3P11L 3UTTE 4BSVA 4AEHH 2D31B 3UZEA 3BWAA 3IJYA 2HAZA 1UADC 3AB0C 1JJUA 4X6CA 4QTHB 2ICWA 4PJDF 4U1LB 1OP3H 3W9DA 3RTQC 4R9HA 4LSUH 4WGVB 1P9MC 2A9MH 1CFVH 1WWBX 2ZCHL 3A6OA 2N7AA 2F5BL 3EJYD 1UJ3C 2A83B 4R2GB 2PO6C 3AREB 5KW9H 5IJKA 3AROA 2Q76B 1NJ9A 3DHJA 1FAIH 1RSFA 1PZUB 5T3ZL 4UILL 1IEBA 3NIFE 1OAZL 4LVOB 4HIIA 4HPOH 4OBRA 3FFCD 4D0CA 3NBNA 3VCLA 1UACL 4KTEH 5ICXA 3U9UA 4PTUA 2AJUL 4MCYB 4XCNB 2X4UA 4EVNA 1G7QB 1AH1A 4KDWA 1GIGL 4YDLB 4M6NL 2FBJL 4WW2B 5JQ6H 3T3MF 4X6BB 2EEDA 3PWVA 5LGJB 2K1MA 1MEXL 3PL6A 3DMMB 4FQXB 1S7VB 5E8PB 5L0QC 1EK3A 5JW4N 3MGOB 5KBNC 3WXWH 1BIIB 1RFDH 5IB4A 2HTLC 5DK2A 2RAMA 2XNAB 2Q86A 4QRUA 1AD0B 3I6KB 3WIFA 3PWPD 1IGIL 2YXFA 4N8CL 4H8WC 5DDHB 1NMBL 4XX1G 3CD4A 4HWEH 1U91A 1KB9J 3TZVC 2PTTB 3DV6B 5M7QA 3T0DA 1ZT7B 5E2WH 4ODVL 1U8NA 1FFOA 12E8H 4FHBD 4UQ3A 2HFGH 4J3WA 1H3PH 1DUZB 4JPIA 2X89A 1G6RL 2NXZD 3JZ7A 4TQEL 1PZ5B 2VLJD 4YZFF 5F7KC 2BRQA 3QFJE 1XGPA 4TN9A 2BY0A 4OCWL 1JV5A 1W72L 3FFCB 5K9OA 5IF0B 1XCTA 1JHKH 3K8KA 1GAFL 4MD4A 5C3LD 1I9IL 1NH6A 1YNKH 2X10A 1FFNB 1R3LA 4H20H 5D1ZA 1XIWD 4NFDA 1UZ8B 4UIKL 5BZDA 1OP5H 3RAJH 1WZMA 3QEQD 2Y9RT 3LKPB 5HVHB 1KJ2H 1MIEH 3K4ZA 4IDJL 3MLXH 2NR6D 5T1KA 2YK1H 1RUAH 1MFAH 4DZ8A 2EYRB 3VFTB 4OJFL 3E8UH 4AY0A 2B7DT 1DVFC 1OF2B 4HJ0D 1CXHA 3GRWL 1FFPA 3V8OA 3BD4A 3HB3D 1EEUA 2MNUA 4LSVL 4WEUD 5FAAA 2AEPL 3MOBL 5I30L 1G84A 5J6GA 2X42A 4MA1B 2BDNH 2Z92A 4NBXB 3CX5J 1JP5A 2Z8WC 1GOHA 3AC0A 2QSVA 2CRZA 1ZEAH 2MPAL 4Y1AB 4QXTA 2OS7A 3OR7A 5DD6A 1A7OL 2QLVB 3PQYE 4Z7UF 5DVLA 4D3CH 3O6LL 3HUJB 3P11H 4UIMA 1MIML 3RWCB 1OAYH 3DBXB 4JKWA 2VR4A 1HZHL 5GS0L 3EDDA 2VO5A 4GRWE 4ETQB 1IGFH 3VFUA 4JO3L 4PP2A 4WFHD 4BFIA 4OM1H 5F7EL 4GW4A 1SVZA 4N0YH 4OCRL 5F88A 1R5IA 4FFWD 3X12A 2E6JA 5HI5C 1GRWA 3TPKA 1JPSH 1XGTB 3VFWA 3FMGL 3EZ8A 3MJ9H 5EWIH 2X4RA 4JO2L 1WQVT 3KPRA 4HXBH 3G6DL 1ZGLM 2PTUA 2NY4C 1IKNA 1K6QL 4L3EB 3H3KA 2R4SH 1EVTC 4NQDE 5B39G 5DJZB 5I8EB 4N68A 5DEFA 4KUZH 1OQOA 3PL6D 4W4OA 2ZSVB 4JJHA 3GSXA 3QPQC 5K33A 1NKOA 1DLHB 1KIRB 2CGRL 2AEWA 4K7PX 2OMBA 1HKLL 3S35L 3BFOA 1RZIB 4R7DB 1N59B 3MLZL 3REVA 2WQRA 4UDTB 1MY5A 2VLLA 4IJ3B 1QR4A 3TESA 3E6HB 4KQ3L 3IFNH 4BSVB 2NX5A 3BWAB 3GFUA 2A74A 3IJYB 4CUCA 2ENYA 3STLA 4BUHA 1M71A 4X6CB 1GXEA 1GHFL 2ICWB 3W9DB 3DTXA 2Z31C 4P2QE 4DGIL 4CMHB 3DVFA 4QLRA 2X89D 4PD4K 2CLVA 4JHAH 4MXQD 2ZG3A 3RZCA 4M7ZB 1NJ9B 4LLVA 2HFEA 1YQVH 1ED3A 3ZYZA 3SKUD 1IEBB 5IW3A 4DFHA 4PRDA 5KVEH 3BD5A 4HIIB 1BD2E 3EUUA 4XWOD 4D0CB 5CS7A 3VCLB 1A2YA 4WY7H 4HAFA 1H9VA 5DRWA 5ICXB 3I3BA 4PTUB 3U9UB 3VGBA 3ULSA 2FR4A 3EOYG 4PY8I 3UX9B 2X4UB 4EVNB 3S6CA 4PJCA 4JGMA 5EZOH 1BJ8A 3G5ZA 1I9IH 3PWVB 2KZ1B 3PL6B 1WBXA 4Y19D 4LASL 3UZVB 5T1KD 2D03L 1OTUD 1P53A 2J6EL 4CNIA 3H3PH 5IB4B 5DK2B 5HYEA 1I1FA 2Q86B 1IAIL 4QRUB 3D48R 5I2IA 4I0PC 5C71A 3RVUC 2R2CA 2R69L 5AD0A 5KS9F 4FNLH 3WIFB 5B8CC 5C08A 3TO2A 3PGCA 4YC2B 1U91B 1KB5H 4PB9L 5C0BA 5C0DA 1X4XA 2X9YA 4UOJA 3HMXA 4HF5L 1YEGL 3QZWG 1U8NB 1FFOB 5BCAA 4HSQA 5J06A 4UQ3B 1BVZA 4X4XA 1IT9H 4JPIB 4KHTH 3KLAA 4YXKH 2WMPA 3H9YA 1LP9A 1KULA 4H88H 2ERJB 1Q0YL 2IQ9L 2O5XH 2DQIL 3BX7C 3STBA 3WKNA 1XGPB 2YR3A 1LWRA 3RIAF 3SDAD 1JV5B 5J89A 4QWWD 5K9OB 1XCTB 1IZJA 4DVRH 3BI9X 4MD4B 3DRTA 5E5MA 3QUMH 2B39A 4FFZH 2YRZA 1R3LB 3GUTA 5D1ZB 3DUHA 2JIXD 3P2TA 2I25N 1S5IL 5BZDB 4NPYA 4NHUA 1CLZH 3KPRD 4JR9L 4JPWL 4KZEL 3S37L 2XZAL 5IB1A 3T0ED 3BKML 3UTOA 3MCLH 5T1KB 1U0QA 3RBSA 1MFDH 2XKSA 4U1MA 2XQYG 1BQSA 4DZ8B 2ADJA 4HS6A 4J8RA 5EORH 3Q6FA 4HGWA 4KQ4L 3LQAH 5GHWH 5E94A 4BQ6A 4CU6A 1FFPB 4WUUA 4N9OB 3NFNA 4Y4FC 4Q58C 5AEAA 5J6GB 4J1UA 4LNVA 4BFGA 5FV2A 4R26L 2Z92B 4UNVA 3KYMA 3BN9C 3WBDA 5M94B 4K94L 4RX4A 5MHSD 2NX5D 3F58L 1K8DA 1DQML 4K3JH 3MLZH 1I9RH 4QXTB 1UEMA 5BV7L 4X4YA 3OR7B 2H3NB 5DD6B 2A6DA 4KJQD 5ETUA 3CFIC 4UIMB 1QFWM 5ISZA 4MB4A 4QGTA 5KN5A 1QACA 1ZS8A 3Q6GL 1F6LL 1T03L 5GGVY 3VFUB 3QQNA 3RZCD 4PP2B 3DLQR 4LCWE 4BFIB 4GW4B 1T7XA 4JRYA 1Q1JL 4CN6A 1U42A 3PGFL 5F88B 1R5IB 5EUOF 3X12B 2DTSA 2DI9A 5DJCA 3VFWB 3C6LC 4Q9QL 4XPBH 2X4RB 1KN4H 3KPRB 4JM2F 3WV0A 4DEPB 3D0VA 4MQSB 4PUBH 1ZAGA 1TETH 1WFNA 1O5DT 5DEFB 3SKOA 3GSXB 4K8RC 3OJVC 3ZYJA 4RMQA 2IG2H 2JB6A 4MQTB 1F3JA 1KPUA 4NM8L 4EUPA 4PS4L 2BY3A 5GGTL 3QDJE 2P8MA 2W1NA 1KIQA 3PABA 3REVB 4PJGF 1GC1L 3WIIH 4S11A 4YBLB 1RZKL 2VLLB 4Z7WE 1JTPA 1NAMA 4APQA 1GGBL 5JO5A 4L3CA 5C08D 1KCUH 2NX5B 3I85A 1A6VH 4U0QB 5JIIA 2GI7A 3TJHC 4Y0GA 1QRNA 1YECL 1DQDH 2A74B 3MUZ1 5C0BD 3UPRA 3EHBC 3STLB 4NHCL 4MAYC 1M71B 1EJ6A 1MFCL 3UTSE 1U3YA 5E8DH 3C5JA 4ERSH 1ZVYA 2CLVB 4ZNEE 3RZCB 4LLVB 3CZJA 2HFEB 2MCG1 1ED3B 2EH8H 4KTDH 4PRDB 1KG0A 1KFAL 1N5YL 3SDDA 1GJIA 3ARUA 1A2YB 3TT3L 4CL7A 4LOUC 5DRWB 1SM3H 3ULSB 2A77L 2FR4B 3QAZB 4XPAL 4PJCB 2A1WH 2C3WA 4V1DE 1Q9WA 2BVPA 1OD7A 1PLGL 4CGTA 3G5ZB 4HC1H 1CI5A 3QISA 1BFVH 1UM4L 1N6QL 1XF4A 4JKPH 1WBXB 1CU4H 4KROC 1D9KC 1MCOL 1OTSC 2GAZA 3C08L 2L7UA 3OAZH 3VXRE 4CNIB 4D9LL 1YDPA 1I1FB 2JJTC 4JPWH 4XZUA 2R0WL 5I2IB 2WBJD 1IGCL 4RFEA 4JDVA 1H3WM 1DBML 5AD0B 4AIZA 1OGAE 4FQHA 1JIBA 2HJLA 2A9NH 5C08B 3TO2B 3T4AA 4RMVA 4IIQA 3VDAA 4MYWB 3PGCB 3QWQB 4QRQA 3VGAC 4XBEH 5DVKA 2D7MA 2EZ0C 5C0BB 5C0DB 3DO7A 3ZKMD 4HPYL 1M1SA 5HGBA 4MHHG 3N1MC 3RJQB 4X4XB 2ITCA 1WWAX 1JHLH 4R26H 3KLAB 3OF6D 3U7YL 3HLAA 1KPRA 4NZDA 1LP9B 3U30B 5ISZD 5J11B 5JXED 1GGIL 4OGAC 2NY6C 3VFSA 4AEIH 3KAAA 1D6EA 3DRTB 4JRYD 1LDPL 5E5MB 2YPVH 1NL0H 3ARDA 4JG0H 3BP4A 1QBMH 5I16A 3GUTB 4PBWD 3O6MH 1IM3A 4NPYB 3LEYH 2L0DA 1J10A 4NHUB 3CCHA 3C5ZC 4K55A 5IB1B 4OD3L 2AJXH 3WNNA 5CZKA 4U1MB 3MBED 5TFSL 2ADJB 5FM5O 4HS6B 4J8RB 3LOWA 1E4WH 2RBLA 3Q6FB 4HGWB 5C6TH 4GXUN 1Y18A 4PREA 5E94B 4LRNH 4WUUB 4M7LH 3KHOA 3NFNB 1UCBH 3WKMH 4J1UB 3SHSA 5EU6E 1EZVY 3TGXA 4YHZH 1JHTA 1NFIA 2AXJA 3RKDD 3KYMB 4APQD 2EDNA 2GY7B 35C8L 3MROA 4X7EC 1TENA 4PS4H 1MJUH 2BXYA 4R3SA 1K8DB 5JW3L 3LKOA 4Q6YA 1L4IA 3L3JA 4X4YB 2A6DB 3H7BA 5ETUB 1FBIH 4L4TD 5F1KC 4MD5A 5ISZB 1I3GH 2BSRA 5KN5B 5LAXA 4PLJC 3EYUL 2Y6SC 1ZS8B 5C7XH 1A7PH 2F54E 2YPLA 4XI5C 4XNXL 4JRYB 4JKMA 1TTUA 3QDHA 2XA8H 25C8H 3VGFA 1GGCH 3V6BR 5HI3C 4KZDL 2DM4A 1ZANH 5DJCB 3SDDD 3WN5C 3LDBB 4Y2DA 4YXLH 5JW4M 1VADB 1T4KA 2PYFA 2YZ8A 3ZL4H 2EDBA 5H94A 3QUZC 3D0VB 4EXPX 2NY5L 1PX4A 1P4IH 3SKOB 3TA3D 1R6VA 3QEGL 3ZO0A 1YEKL 4JVUA 1RIVL 2W9LA 3UTPE 2JB6B 4RGND 5D5ME 5EBLA 1F3JB 1KPUB 4EUPB 3BE1L 5CSBA 4GAGL 1N6QH 2P8MB 1KIQB 3PABB 4I18A 1WIPA 4KK9C 1LEKA 5F1SA 4H1LG 4CDGC 5HYIA 4P9HH 1SBBA 1OVZA 1NAMB 4I48A 5CZXC 5EOCL 4APQB 5JO5B 2KBGA 4L3CB 5BRZA 5AYUL 5I1DA 2VC2H 1QRNB 4K71B 5FYJD 3UPRB 3IJSA 1RV6X 2R23A 4YQXL 2VLKE 3M1BA 2GW5A 2CRMA 5I0ZA 4PJ7A 5D2LE 4XPTH 4M48H 5KSBF 4HFWA 1AY1H 2HT2D 3C5JB 3I2CL 5HHVH 5F1IA 2LABA 3O6KL 3FQTA 4GAYA 4ZTOL 3WSQH 4E42A 4YGAB 4I13B 1A8JH 2BNUA 2C3VA 2Y72A 4XPGH 5IFAH 2V6HA 1KG0B 1JPTL 4YHNA 3SDDB 1G7IA 1LEGA 3WLBA 5JDJA 5T1DH 3ARDD 5C07E 3RNKA 2F19L 1H15A 1Q9WB 2BVPB 4Z7NF 3ZKND 1B4JH 1IZKA 4R4NC 4PGCA 1XF4B 2APBA 4MD0A 4TVPE 2GAZB 4RGNB 4G42B 1NSNL 1YDPB 2CDEA 1F4XH 4XZUB 3HNTL 5K9JH 3TYFA 4RFEB 4JDVB 4AIZB 4FQHB 2EXYD 2HJLB 1NC4A 1EEYA 3T4AB 1W0YT 4IIQB 3UTQA 3WXVH 4DKEH 1NGXA 4QRQB 3SDXE 5I1GL 3VFPA 3DO7B 4OM0H 3MZTA 4NSKA 1WTGT 3MRDA 1UA6L 5HGBB 2X5PA 4UT9H 1OM3L 2DIBA 2ITCB 5DD0H 3BW9A 4TSCH 4WEBL 3P4MA 5FB8A 3HLAB 1LO2H 3DYMA 3LSOA 1KPRB 3WIHL 5IHZA 1BFOA 1AP2A 3W5MA 2AXHA 4HS3A 1QYGL 3D25A 2HT3D 3S36L 4DUVA 5I66A 2GUOA 4QRPD 3FN9A 5DJYA 3VFSB 5IT2H 2WM0A 1IGTA 2BJML 4G6KL 1D6EB 2XRAL 3C09C 4KKBD 4YPJA 2AV1A 2J1KA 2R2EA 1KSRA 3GSWA 2AJSH 1X5JA 3ARDB 1MLBA 3V52H 3BP4B 1EEZA 2MTPA 1GL4B 3O3UN 5I16B 5IVXA 5FGCE 1IM3B 3V2AR 4FA8A 1MRDH 4JB9H 3DXAE 5JMOC 4Y2DD 4FQ2L 5DJAA 3CCHB 2C4XA 3FN0L 1AQKL 4KZDH 3IXAA 4D94A 3TO4A 4L8SA 3IAQA 5DZNA 2W0PA 4N8PA 2MFNA 4NQUA 1ZHBA 4P9ML 3MA7A 3GJFH 1Y18B 4PREB 2QHRH 2GQHA 3IJHA 5JTWA 2CD0A 4QRTA 5HY9A 4B50A 5FO8A 2BMKA 4AL8L 3RNQA 4OKDA 1JHTB 1NFIB 4PRHA 2CMRH 3MROB 5BRZD 2MQ3A 2YA0A 4OLZL 4N0CC 4R3SB 3WLWD 3LKOB 5AAWA 2DQGH 3L3JB 4O02L 5D7JC 3H7BB 1YYLL 3SOBL 3QUYA 5E8OA 1RJZA 4MD5B 1MHPH 2BSRB 5LAXB 1BVLA 3MFFA 1LO0H 1BEYL 2YPLB 3QQ4A 5EO0A 2LE9A 4PRAA 4X6DE 3ULUH 4LKXA 4G3YL 1QKZL 3DUUA 1VGEL 1A14L 4C55A 4KRMB 2E27L 1K3IA 4DN3H 4Y2DB 4X4MA 3MGTA 4DGVL 1T4KB 2NZ9C 2PYFB 4UTAL 2YA1A 5H94B 3JTSA 3LS4H 3N85H 4PJBE 5DC4B 5E5RB 4IDLA 1AE6H 3QCUH 4OF7A 4Z7VF 1T20A 1RI8A 2XY2A 4U31A 4ZUVA 1A4JA 5EBLB 5HPMA 3OKEA 4R97B 5D72L 2PETA 2XZQH 3NCFB 1LEKB 4I18B 1QLRA 3BPLB 5TE4H 2UZYB 2XWJA 4I48B 4HUKB 2UVFA 1MNUH 1RJYA 1NC4D 5BRZB 5TGBA 4KKLD 4XP5L 4XVJL 4FABH 3NFSH 4NRZA 1J8KA 3IJSB 2Q6WA 2R23B 3H3BC 4OUUA 2HN7A 3M1BB 2P44B 3OV6A 4RFOL 1WCQA 4PJ7B 5HBBA 1A47A 3HTLX 4HFWB 4LSRL 1T2QL 2IFFH 2WLYA 2BXZA 3C60D 2FEDC 5F1IB 3UO1H 3DYPA 3FQTB 4GAYB 1E4XH 3X17A 4E42B 3ZDZE 3RPKA 1IAIM 4LPXA 2F5AL 2BNUB 2C3VB 3JTTA 1C12A 3DYOA 4OD2A 4GKZA 5MP6L 2HFFA 2DBJA 4YHNB 3KPMA 1G7IB 5EBGA 1L6ZA 3RVXD 1LEGB 4ELMA 4ZMAT 2EDWA 4CVZA 5DZOA 3WLBB 5FHAH 3UZQA 3RNKB 2R8SH 1H15B 2BJMH 5C0AA 4ZXBC 1TXKA 4OF6A 4MJIE 2PO6D 4DW2L 1AKJA 2AK4E 4ZFOA 5BMFL 4PGCB 2NTFA 4QXWA 4P3CH 4YUEL 4I2XA 4MD0B 3V79C 5D7IE 4OCSH 1TMCB 1WITA 3B9DA 2YOCA 2B2XH 3W11D 1BQUA 4KDVA 4GSDH 1FSKB 1WZ1H 4FQ2H 3VWJA 3RWJA 5BVPH 2CDEB 3TYFB 5IBLD 1RUKL 3BQUC 3TJEH 4DUWA 5CFHA 3N1QC 5JOFA 4NWUH 1NC4B 3BIBX 1EEYB 2F58H 2IPKA 2E6PA 4OCYH 3UTQB 3NIFF 3I6LE 4WIQA 1NGXB 1KCLA 4PJ9C 1RAMA 3VFPB 3IDUA 4NSKB 3UTTD 3MRDB 5L8KB 5I15L 4P46C 3V0VA 3LHPH 4M43L 5D8JL 5IQ9A 2IH1A 3WS3A 1QLEH 3BW9B 2BFVL 4ODSH 3P4MB 3VXQA 5FB8B 3LSOB 4TYUA 5IHZB 5IVNA 3QUYD 4LK4A 1BFOB 1AP2B 3MV8E 4OLZH 4HS3B 1RZ7H 3D25B 1BJ1J 3CXHJ 5I66B 2GUOB 5DJYB 1L7IH 1IGTB 1PYWA 2AV1B 2R2EB 3GSWB 4CAGA 3VXSE 3EOTL 1MLBB 1EEZB 2Z31A 3EYFA 3W2DL 1YY8A 5IVXB 4NKOA 4X9BA 3C6SA 4UU9A 4Y7MA 1CL7H 1INEH 5DJAB 2DD8H 2Y5EA 5ICYA 5ICZA 1CE6A 3KJ6L 1VPOL 2VRAA 4F9LC 3IXAB 4J23A 4WDIA 5DLMH 3TO4B 5J57B 4L8SB 2OR9H 3ARBA 3N06B 4ODTL 2VQ1A 3FT3A 5JZ7D 1ZHBB 2F8OA 1AFVL 3MA7B 5BO1L 4RWHA 2Z35A 3MOAH 3IJHB 4JQXA 1Z9OA 1IAKA 4QRTB 5HY9B 1RIUL 4FQCL 4WHCA 3S3JA 5FA4A 5FO8B 1AGBA 2BMKB 3RNQB 1F4YH 3NOIA 4XPFH 1A6UH 4PRHB 3FRPA 5E8NA 3KPSE 4N8VA 4UI2A 4F58L 1I7ZA 4KDTC 2BVEA 3OB8A 5EC1A 2YS4A 4FP8H 2X70B 3OAUH 2GTZA 4FRWA 1DVFD 3QUYB 5E8OB 1AXTL 1RJZB 2W59A 3BPOC 4NO3A 3SPVA 1IJ9A 3OL2A 4LIQL 4OF0A 4XP5H 1BVLB 1DQLH 4MZ3A 3MFFB 1S7QA 1S9VA 2WIMA 1LD9A 3B9EA 3QQ4B 1UWXK 5EO0B 4PRAB 4B7LA 1PY4A 4HUVA 4LKXB 2AABH 3DUUB 4G6ML 5DHVA 4EDXA 1R5VA 1C5BH 5EC2A 3WFEL 5AZEL 2DLFL 4WTWA 3VWKA 3FB7A 4NOBA 3MGTB 3F5WA 3OSKA 4YDJA 3H9SE 2FGZA 3LMJL 4PJ5A 3JTSB 2C3HA 5C0AD 5MEQA 3EO0A 1AKJD 4ZUTA 2I5YL 2VXSL 1YEEL 1WFTA 3I3DA 1T20B 4ZUVB 1A4JB 1CDCA 2X1PA 5HPMB 3OKEB 3RVTC 5GXBB 3CH1A 3GSVA 2FRGP 3CFCL 4XVUD 5CLTA 5ESQA 2V5RA 4GRWF 1QLRB 4OCXH 1MRFH 2DQEL 2XWJB 1I1YA 4ENEC 4EN3C 1KIUA 4B5EA 2F8XC 2NZIA 1RJYB 2B4CH 3PP3K 3LCYA 5TGBB 5TE7H 3ZYIA 4NRZB 1A64A 4PGZA 2Q6WB 4PTTA 4OUUB 1T83C 2HN7B 3C87A 3QPQD 3SE4C 4X7FC 4OV6F 1A6PA 3EO1A 4MLSA 2LAGB 3U7WL 1KLUA 2QBWA 3CLFH 4RQQA 3QQ3A 4DTGL 3HUJF 5H2BA 5IESL 4TSAH 4JQIL 4M43H 4PPTA 1XZ0A 2NY3B 3JTTB 1C12B 4OD2B 3BDXA 4GKZB 2WUCL 2HFFB 2UUDH 4J4PA 4KVCH 4MQXD 5IB3A 3KPMB 4OSUH 4ELMB 4G8FA 4LNRA 4CVZB 2EEBA 3L1OL 3ZLQC 5ID0A 2Z31D 4KPHH 2IPTH 4GXUM 5C0AB 1F00I 5TDNA 1AKJB 4ZFOB 3EOTH 3O0RL 2NTFB 4YDIL 4I2XB 4NJAH 4NQDD 3RDTC 1EJOH 3F7RA 5C0RL 3VWJB 3RWJB 2VJXA 3P30L 1CGXA 1ITCA 1WF5A 43C9A 5BOZG 3KJ6H 3AM8C 3TBTA 5FM4A 1FO0A 1LO3L 5JOFB 1GVIA 4OGXH 4AM0A 5FYLD 2IPKB 1Y0LA 1M7DA 4POZC 1JZ4A 1JNLL 2HLAA 3FCTA 3BHBA 3ZTJG 3D2UA 3V0VB 3QCVL 5IQ9B 2IH1B 1R0AL 3WS3B 2AI0L 2JJWA 1MRCH 4X6CF 3VXQB 4G7YH 2XKNA 3RVUD 2Q8BL 3IDNA 5IB2A 5KVMC 2Q7YA 5F6HJ 1ZTXH 2DQJL 1PBYA 4QHNA 5IQ7L 1EVUA 3U4EA 3HI6L 4TSBL 4NN7C 3QIWC 5SWZA 2FX7H 5H8DA 4UT7L 3MUGA 5SV4A 1S3KH 1PYWB 3GIZH 4YHYB 2FGWH 1NFDA 2Z31B 4L8BA 1BD2D 3EYFB 3LEVH 4E41A 1YY8B 4LEOA 4QXGL 4XVTL 2X1QA 4NKOB 3C6SB 4UU9B 4N1CA 5ICYB 5ICZB 1WAAE 1CE6B 1J0ZA 3VRLE 1JZ7A 3OZ9L 4PP1D 4WDIB 3WFEH 1AO7A 4EZMA 3ARBB 2VQ1B 4OGZA 3SGDI 4Z0BH 1QRKA 3Q1SL 3FT3B 4U1GC 3I9GH 3PG2A 1KELL 1U8HA 3VD7A 1FYHB 2FH6A 2Z35B 2DQUH 3TV3H 2P48B 3MO1A 5E8EA 3ALXA 4KK8C 4OGYH 3OGOE 1IAKB 2D7NA 2VXTH 3BT2H 3GBLA 1N6VA 1G7JA 1KTKE 5FA4B 1AGBB 1OW0C 2ZPKH 3KS0H 5ELIA 2FECL 1J1PL 1D9KA 4C56E 5E8NB 4N8VB 1AC6A 3ZDYE 1I7ZB 5TE6H 3P4NA 3DROA 3P4LA 3MRNA 3CVHA 1IQWL 2JJTA 4WUKL 5EC1B 4MXWL 1VHPA 2GTZB 4U33A 5DEZA 5F21B 4NO3B 3K2UH 3SPVB 1FVEA 2D2OA 4C58B 5A1AA 4Y4FD 4TOYH 4M93C 3GKWL 4ZNEA 3IFLL 1S7QB 5GS2D 1S9VB 5EU5A 3O3BA 4HUXA 1LD9B 3UYRH 3SKNA 3AS3A 2APXA 4HUVB 4KI1A 5I1KH 4O58L 2FATL 5DWUH 5DHVB 4EDXB 4J4PD 1R5VB 2B1HH 5EC2B 5FFLA 3TBYA 4R0LA 3CFJA 3VWKB 4DUXA 1YJDH 3FB7B 4F7TA 3F5WB 4YDJB 2VN4A 3IYLW 4HW6A 1A6WL 3ARFA 5GGQH 3HMXL 4PJ5B 1FN4A 4KVNL 5MEQB 3EO0B 3B83A 3GK8H 4PD4J 4ZUTB 3TF7C 4NC1E 1I8LA 5I18H 1ZLUH 2D9QB 3MV11 1V3KA 3QG7H 3W0WE 3VXRA 4YEFA 3CH1B 3GSVB 3GBMH 5ESQB 3O0RH 1IRAY 1UH3A 1U2HA 2ZUQC 5JLZA 4FMKA 1I1YB 4OZFH 4ZS7L 2ZKHH 1EFXD 3CX2A 3T3PE 1EGJH 1WICA 4LL9A 5I19L 3HAEH 1LO3H 4PTTB 5E95B 3EO1B 3S5LA 5IW1A 3D2UD 2DQDL 1OAUL 2EO1A 4G9FA 5FGSA 1KLUB 1MPAL 1A6TA 3SE8L 4RQQB 3OJ2C 3QQ3B 5H2BB 1G7PA 1LGVA 1UKSA 4M3KB 1I85C 2E7LA 3GO1L 2ESVA 1XZ0B 3SQOH 4OQTH 4NQTA 3TJHD 2LTQC 5IB3B 3FRUA 2ZG2A 3ARZA 3CSBA 3HC4L 4NC1C 4G8FB 4UZGA 4BH8A 4LNRB 3DVGA 4XAWL 1G9NH 2JJUA 5ID0B 4E41D 2Y36H 5TJWK 5L7XH 1T1WA 5TDNB 2NW2A 3B43A 4GRMA 5E2TH 4XWGH 3ULVE 5DMGC 4HCRA 1J11A 1J1OL 2CSPA 1AO7D 1TJHH 5C0NC 2OR8A 3WN5A 1NANH 4NQVA 3IAPA 43C9B 3KXFA 4K9EL 2XQYK 3ALPA 4LOUD 3BDYH 3TBTB 3BSZH 3MUY1 3VFRA 1FO0B 2VH5L 4AM0B 4FFVD 2FYYA 4LSQH 4GQPH 5GRVL 5DHYA 1Y0LB 2R0KH 4U0RB 1UZ6E 3FAWA 1M7DB 5GGSY 1J0HA 2HLAB 3FCTB 3BHBB 4KROD 1D9KD 1OTSD 2VITA 2X4TA 4Q9RL 1U6AH 3D2UB 2B8OT 3ARGC 1WCBA 1IGJA 4G8GE 2DKSA 5CZVH 4Y4HA 4AG4H 2XKNB 1YEHL 3DJ9A 4XP1L 3IDNB 5IB2B 2Q7YB 1FLRL 5DK0A 4XMPH 4WUKH 1FFQA 4QHNB 2QSQA 5DI8B 3U4EB 1IILE 5SWZB 4M7KH 2EZ0D 3ULVC 1QZ1A 3MUGB 1VFBA 4F15C 1UM6L 3BJ91 4D9QE 4NQSA 5KSAC 4DKDC 1MCFA 1NFDB 2VR9A 3NIDF 4L8BB 3BD3A 4E41B 5E1AA 1NAML 4LGRB 4LEOB 3RA7L 4YPGA 1K85A 3GSNA 3TVMC 3LKNA 4PJCF 1Q0XL 1EXUA 4V1DD 3ARFD 5D1QC 1DLFL 1AO7B 4OGAD 4NQEA 1GH7A 2NY6D 1RUMH 2EDOA 2OL3H 2YSSA 5GQBA 3ZT7A 4JDTL 3OXSA 3AY4A 4LPYA 1FGNH 1U8HB 2UV3A 3VXRD 2P24A 3MO1B 1U92A 4HQQL 5E8EB 4Y2OA 2X09A 3NABH 1PG7L 1G7JB 3SE9L 1OGAD 2BHZA 1RK0A 3TN0C 3K74B 1D9KB 2I60H 1BPVA 3DVIA 2ARWA 4XP6L 1P7HL 3P4NB 4HG4K 4ZAKA 3GMQA 3DROB 3MRNB 3CVHB 4LU5H 1IFHH 4BK4A 5I8KL 3UMTA 4PRNA 3CLEL 4G9FD 1FVEB 1EHLH 3BISA 4O00A 3UCRA 3JV6A 1FZJA 3K0WA 5EU5B 3O3BB 4HUXB 5CSZA 5ABDE 5J13B 1JWUA 3REWA 3SKNB 5GGVL 2ESVD 5JMRA 3ECBA 5BZWA 1N64H 4LPTA 3TBYB 4R0LB 5GGSA 1BAFL 3CFJB 3DV4A 2ZUXA 3FO0L 3G5YA 1MJJA 4F7TB 2J8UA 2QADC 2DLHA 4AYFA 4G9DA 4PLJD 3ARFB 2Y6SD 1FN4B 1FDLL 2JKXA 4BELD 1A7NL 3D9AL 2KPNA 4P57A 4XI5D 4XXDA 4NOFA 4H5SA 1VCAA 5D7KE 5HHOE 4O5LL 3VXRB 3ZTNH 5SWQA 3U79A 5HI3D 1JTTA 4GXVH 3BRDA 1T3FA 1MHEA 3FQXA 4U3XA 5CBEA 3KXFD 1R3KA 5JLZB 4ZO9A 1ACYH 4JFFA 3RU8L 2J88L 3MXVH 3NZHH 2D3VA 3QUZD 1X6LA 3OX8A 2EC9T 4OCNC 5EU6D 5TDOA 3DX6A 2PR4L 4K3EL 5F9OL 1TITA 7FABL 2B5IC 3B6SA 3CMOL 3S5LB 3RHWF 1AHWA 5IW1B 1F2XK 1TIUA 4G9FB 1J18A 1CD9B 1A6TB 1N7MH 2FCBA 2YWYA 3OR6A 4KK9D 1NCBL 5CEZH 1G7PB 4KXZH 4Q9RH 2GFBA 2AJYL 2GK0A 2ESVB 4TUOA 2YKLL 5IK3A 5E70A 2B1AH 5D5MF 2F54D 1T0NA 1MVUA 3FRUB 2HVJA 4XP1H 3VD3A 2D7OA 4BH8B 1Y6NR 3DVGB 5DF0A 2CIKA 4HH9A 4ZNCD 5EZJA 1T1WB 3T0BA 2NW2B 1EPFA 4GRMB 3U0WL 4YHLH 4GMTH 2EDYA 2GJ6A 3RGVA 1HNFA 3FB6A 5D2LF 4NQED 4RWYL 2IWGA 3WN5B 2DQTH 1Z6JT 4NQVB 5A3IC 1VA9A 1RZJL 1XH3A 3KXFB 4MWFA 4U6XA 1MAJA 5EB9A 3VFRB 2FYYB 5D7SH 4WGWB 4CVWA 1T1YA 5DHYB 1MAMH 1JGVL 4J3VA 1FPTH 1XEDA 5C9KA 3HI1A 3WDIA 4QCIA 1Q38A 5HVFB 2VITB 4LGSB 3OB0K 1F4WL 1R24A 2X4TB 4I9WE 4UT6L 2GJZA 1RHHA 5CP7A 2DYPA 5JHLL 4ZAKD 1WCBB 1IGJB 1JGUL 4Y4HB 3O2VL 1KOAA 5T3XH 1WIUA 4XAKE 3UJJH 5DK0B 2OMNA 2QQKH 3IU4H 1XGYL 2EKSA 3A6CL 3ZKSD 4Y5VC 2CQVA 5HDLA 1VFBB 1F3DJ 4HJGA 2VLRA 4NQSB 1EO8H 2UWEE 4H1LH 3HI5H 4OV5A 1NUDA 2C4FT 2A2QT 5IBUB 5E1AB 5DD1L 4EUPG 4M1CC 5HYQA 4YPGB 3GSNB 5LXGH 1B2WL 3LKNB 3MRMA 1EXUB 1KJ2A 5C07D 1CFQA 4M9OA 1L0QA 1F97A 4JPVL 4NQEB 4BQBA 4BZ2H 2YSSB 4TVSa 3OXSB 1QSFE 1MCHA 3MACH 4TVPD 5FYJH 4B41A 1T6WA 3JV0A 4U6VL 3KR3L 3CFDA 2P24B 1U92B 3D9AH 3KPLA 4YEEA 1HSBA 1ZLWH 3UJTH 1KN2L 2EDFA 1RK0B 5FGBC 4AK1A 4JFFD 3DNKA 4HT1H 3R8QA 5HPOA 2UZXB 4UQ2A 4ZO8A 3CGTA 4ZAKB 3GMQB 5C0CA 4S1SL 1DANU 2HKHH 4KV5F 4Y4KC 5LCVH 1JWMA 3WD5L 5DYOA 3OXRA 1G9MC 4PRNB 32C2A 3BO8A 1E4JA 3VGEA 1EV2E 4NZRL 3U0TA 3NPSB 5CIPH 3JV6B 4KFZC 1FZJB 4N0RA 2G2RA 1J5OH 5F89A 5CSZB 5C8JA 1JWUB 3REWB 4ONFH 4MA7L 2LVEA 3ECBB 1IGML 1JGLH 5BZWB 3TWCL 4N0CD 4P23A 4Q9CA 5GRUL 5GGSB 1MCSA 3DV4B 3G5YB 5D7JD 3MJ9A 1MJJB 5HHXL 2J8UB 3CUPA 4LLUA 4G9DB 5T33H 4NCC2 3O2DH 5E2UL 1OLZA 5FYKH 5BS0A 3ZKXB 2JCCE 4H0IA 4JREC 3ARYA 4G6FD 4NKMA 4P57B 4S2SA 3QJFA 1NCWH 4XXDB 5E99H 4TUKL 4H5SB 4TPRH 4ESKA 2XV6B 1CF8H 1EMTH 5SWQB 3V6OE 4RSVA 5I74C 4X7CC 3MV9A 5GRJH 2UVEA 5CHNA 1T3FB 1MHEB 3FQXB 5JHDA 1A3RL