2OS7A

Caf1m periplasmic chaperone tetramer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
231
structure length
206
Chain Sequence
PDIKFASKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDENKEKESEDPFVVTPPLFRLDAKQQNSLRIAQAGGVFPRDKESLKWLCVKGIPPKVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLPKGNVSWRIINDQGGLDRLYSKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Chaperone protein caf1M
publication title A novel self-capping mechanism controls aggregation of periplasmic chaperone Caf1M
pubmed doi rcsb
source organism Yersinia pestis
total genus 32
structure length 206
sequence length 231
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2007-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2os7A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2os7A02
1R5WA 4JHAH 3KPOB 4JFPA 4MS8D 3HZMA 3G6DH 4KQ3H 3H9SB 1FGNL 3ZYZA 3IJHA 4XAWH 3VH8A 1S8DB 3V52H 2ICWB 5DJ2A 4PLKC 5DR5H 5C0GB 4CN1A 3C9NA 2D7TH 2EIDA 2GFBA 3MRFB 2RAMA 3D0LB 3MJGX 3T2QA 1XGQB 2B4CL 1JNLL 3MZGB 1WAAF 5HHOE 4PRPB 5DUBA 4KK8C 1KG0B 1UXSA 3L3KA 1C12A 1KJ3H 2B2XL 2DQDL 2ITDA 4J12A 5FYKL 3ARFB 4WFEE 4X7TA 5ESQA 1XF2B 2A6DA 5JLZB 4JKKA 2FX7H 3EOBA 3QI9D 3ARGC 1T66C 3RDTC 2FZ3A 1AHWA 3FQUA 3QULA 5I17B 4S11A 3FMGH 5DD3H 1V3MA 2BY3A 4HKJA 2VLLB 3GBLA 1U8LB 4KJYB 4HMCA 4UZGA 3LOWA 3AU1A 4ZS7H 4Z18A 1FDLL 5MENA 4ZSOE 3MLXL 5IEHA 2DQHL 4U1KB 2BVOA 2DWDA 2IBZX 4F7MA 1M05A 2VDML 4QXUH 5D7KE 5IEKB 2B4CH 2NW3A 1JNLH 5IQ9A 5IVZA 4EBQL 4N0CC 3G5YA 3AFLA 4LAJH 1HYSC 5ICYB 5L2KB 4RIRB 3WNMA 1NANI 1PW3A 1OY3B 3LQMA 3VXNA 3W39A 1ES0A 3G6JE 2V17H 2B2XH 4AZ8A 1S7RA 5IIEA 3GSUB 1V3LA 3RX8A 3GK8H 4JREC 4RMWA 4TNVK 4E41A 1KSRA 4ZQKB 3SPVA 3FKUS 3VD3A 3HE7C 3QIBB 3NACH 4H5SB 4TNVF 3EO0B 1KXTB 5TDPA 5F7MC 2AK4E 1JK8B 3T08A 5C0NC 5ICZB 3ZKXB 2JIXD 1UZ8B 3PHQB 1G7QB 2BVYA 1IKNC 5HGHA 5IBLC 5E2TL 3PWNB 1A3LH 4OZIF 3TZVA 5EZJB 1FSKB 3FFCD 3HTLX 4PRHA 4S2SA 5F7NC 3PWLB 1FDLH 2CK0H 1FCGA 5D7LD 3MLXH 3SY0A 4TULL 3DUUB 2H2PD 3ZMRA 1FL6B 4NP4H 4U1GB 2VXSL 4U05A 2VDMH 3QZWG 4GLRH 4EBQH 1I7RA 2YA2A 5HYJB 3PE9A 5HGAA 3KLDA 2X4RB 4OGZA 1P53A 1HH6B 1RY7B 1U8OB 4DQOL 3CDFA 4RAHA 4PJDF 4LPVA 5IB3B 1QPPA 1HSBA 5IJVA 1NGXB 3SDXB 4JQVC 3U4AA 2P5WE 3DO7B 3BISA 4R90H 3DYMA 3VXQB 5F88A 1UH2A 1GGUA 2EYRB 1XF4B 4PRNB 4Z7WA 5L9DH 4K94H 3EJYC 3V0AC 2UZXB 3S36X 4XCNA 2F54E 1IFHL 2VDRL 5C0CB 5DS8B 4PTTB 2FLBT 4FMFA 1JGUL 4K3EL 3C5ZC 4NWUH 4D9QD 5D7JB 5HHNA 1WEJL 5E8OB 4U1SA 4LF3A 2HJLB 3W11C 3L7FA 1CN4A 5MEPA 3BUYA 5DK2B 3HS0A 4KY1L 3GZKA 4P4RA 5C08B 4P2OB 1MSPA 5BZDA 3BFOA 3D0VB 5GGRB 5HHXH 4XB8A 5CD3B 2V2XB 4X6BA 1DQMH 1ZT4A 4HS6B 3SJVE 4ELMB 1LGVA 2H26B 2LAGB 1FO0H 2QTEA 3RWCA 3CSBA 5CJQH 4AK1A 4OBSA 1YY8B 5IF0A 1UWEH 4RFOL 1FIEA 3B83A 1Z0NA 5LGJA 3V4VL 1J8KA 2A74B 4PJGB 4OKVB 4PJFB 2FYYB 3U36B 1JGUH 4PTUB 4LLYA 4K3EH 4HKZB 1Y6NR 1HDMA 2C3GA 2NY6B 5CUSL 1ONQA 3VE0B 5CD5D 4QNPE 4RX4A 1U58B 5M94B 1U91A 1AE6L 4BUHA 3RNQB 4NC1C 2ADFL 3CX5K 5E8DL 1JNJA 4KY1H 2AEQL 3T8XB 4HQQL 1QP1A 3VFWB 3O6KH 3GBNL 1MWAL 1MREL 3CFJB 5CHNB 3FQNA 4MXVF 5A2KH 3GMRA 2GK0A 4Y1AA 3KPQA 3STLB 2B0SH 5FCUH 3FO0L 1KXVC 1CS6A 1BZ7A 4OUOA 3V4VH 3FB7B 3GM0A 2FO4A 3U1SL 4PB9L 4LLMB 4C83A 1U8HA 3MBXH 3L3DA 3B9EA 4U1LB 3WFCH 2A38A 3JV4A 3V5DA 1QSED 2Q3ZA 3OR6B 5CUSH 1Q9LA 4CADA 1KJ2L 3GNML 4DVRH 3GSXA 2HT4D 5TF1H 2JB5H 2ADFH 5E8DH 2VZ3A 2AEQH 3VXPB 3BHBA 5GJSL 2NLJA 4OCWH 4HQQH 2XOTA 4GBXA 5E1AB 5T1MB 3SDAD 1M4KA 5SWSE 4ERSH 3U0WL 1MWAH 5TFSL 2Y23A 1OSZA 1VSCA 4I3SL 1BD2A 4N0RA 5IR1B 3VRJA 4LFHD 4PD4K 4WUUD 4NUGL 1UEYA 5MEOA 1X4YA 5DWUH 4TYUA 5IB2B 2GSGA 3F65A 5ALCL 3A67L 4HSQA 4JFEB 1DQJB 3O3BA 4Q9CA 1J8HE 3U1SH 3RKDC 4KU1A 2NY0D 4B5EA 3VDBA 1M71A 4LKXB 4MNGE 4I3RH 4UDUB 4YC2C 4TPRL 2Y5EA 5T3XH 4JFFA 2J6EH 2AEIT 4UT9H 4C56B 1I1YB 1EBAA 3C8KB 4X80L 3KLHD 1OB1A 2O26U 1HE7A 1MJUH 2B5IB 3ALWA 2NTSP 1CLZL 1R24A 1MFDH 4JKLA 3O2DH 1KIUA 1CF8H 3K4ZA 2X44D 2OL3H 4P46A 4W4OC 3HUJA 5HGGS 1NC4A 4FXLA 5T5FH 5IFHH 3CIQA 3U0WH 1UA6L 4KZDH 3VXME 3WIHH 4QRRD 4OD3L 2PO6A 4LBEA 2VWEC 4NUGH 5L7XL 5D4QA 3GMQB 1OAKL 5JDSB 1SYVB 3CX5J 4JZJC 3V6ZB 4RRPG 1ZWIB 4L3CA 2DKUA 4L8CB 2AGJL 2EKSB 4JZOA 4X7EC 1YY9C 4Y5YC 4RGOL 1QRKA 4PJCB 5DDHB 1GOHA 4F9LC 5L0QC 4Y4FA 3V9FA 1IAIM 3L7EB 5I66A 4EI5D 4WJ5B 4X80H 1NJ9B 2VISB 2Q20A 43CAB 1E4WH 1F3JA 1SQ2N 4HUUA 3MV7E 1XIWB 3LKNA 4JM2F 1Q9WB 4LVHC 2VDKH 4HPOL 3X11A 1EZVY 2BSSA 4GRWH 5TH2A 4LARH 4NQCE 4NOBA 3ZYIA 4WFHE 3SHSA 4OZ4A 3OGCA 3QG7L 3B6SA 1A2YB 4KKCC 4QGTA 5LGHH 3ROLB 3RA7L 3ARUA 1DQLL 1KT2B 3VXTA 2VXUL 1D5MA 3U4BH 2E7LC 5TQ0H 3KPRD 3MPCA 1MI5A 4XNQA 4AIZA 1NDGB 2Y6SD 5IB5B 4PJHF 3MGTA 5C0EA 3HE6A 4M1GL 3P0GB 1TENA 1I1CA 1K4CB 2X7LA 1CD1B 4O51A 5A16A 4M8QA 1J1OL 1QFOA 3MACL 4PD4J 1CICC 4EI6B 1A1NB 4POZC 3SDYH 4NZRH 1BX2B 5EUOE 1NBYB 4EUPH 4K7PY 1TNNA 4KK9C 3L1OH 4D94A 2CJUH 1TCRB 3RGVB 3UBXG 4K7PL 4WEBL 3LKSB 2I60L 3LS4H 1X5LA 3IDYC 4FXKA 3H7LA 1A7RL 5I1KL 3VJ6B 3PJSA 4G6FD 5IT2L 2XNAB 1NC2D 4OSUL 1C7SA 3L5HA 3QDGE 2EYSB 5JXEC 3QXTA 4AQOA 3NCYP 4M1GH 3RY4A 2GJ6E 1WIOA 1TITA 1FVEA 4TTDC 1U3HB 3WO4B 5I1EH 3BPOB 2BJMH 3MJ7B 2XTJB 4ODUB 5TGBA 2OQJB 1UB5A 4PJ9C 4QHMA 4U3HA 3IDXL 5J1TC 3M17B 1XGRB 3IVKA 4MX7A 3KS0H 2DQTH 4F7TA 2EIZA 5EFIB 3C6SB 2HKHL 1AD9B 4XP4H 4K7PH 4PJIE 3T4YB 4MJ4A 3V6OE 1QSFB 2X89D 4ODSH 3QDJE 3ZDZE 1ZT7B 1A7RH 2R2HB 5D1QD 2AV7B 5CCKL 1Y0LA 5IKCB 2F15A 2FWOA 4MXQD 4FFVC 1LILA 1UC6A 1HSAB 2DQJL 5DA0B 1A14L 1NUDA 5GIRB 3LPWA 3P2TA 4HD9A 4HKXB 4JAMA 4HUVA 5DRXB 3ILPB 1MJJA 1WICA 2MQ0A 2FGWL 4NFCA 4YDLC 2XWTB 2YPLB 2XRAL 4IJ3C 2HLAB 1S7UA 4OCXH 1NCTA 5HPMA 2NZ9C 2HTKD 3R0NA 4RBPH 1IL1A 1X7QB 3DHJA 3MV8A 2GAZB 3FOMB 4NNPH 3RVTC 2XKNA 1OLLA 3BH9A 3IDXH 4YDVB 3X12A 1LVEA 4KVCL 2WLYA 4GRLD 1DBMH 1HI6B 1Z5LB 4YDKL 3RFZC 2ORBL 2D7OA 3LRSA 4KKBC 3VFOB 3DECA 3BKJL 2X9XA 3VXOB 3ARQA 4XC3L 2BCKB 5C0BA 4KJPC 1LK2A 3GRWA 5D1ZA 4R0LC 3UTSB 5JORB 1A5FL 1RZIA 2FB4H 1EEUA 4DKDC 5FYLD 3V6BR 1NGQL 2AJVL 5B3NA 3QIWD 3BRFA 3DO3A 3SKMB 1AGBA 1JYVA 3KPNB 25C8H 3RVUC 5JMRA 4KROB 4LLDB 3BH8A 1RMFH 1K9TA 1M7DA 2FGWH 3O8XD 2XRAH 3H42H 1DBBH 3QO0B 1VADB 4OZGB 4EVNA 1GGCL 5SX5H 2H3NB 4FQXA 4I5BA 1JPGA 4X8JA 5D72H 3MRMB 3TH3T 2YHGA 4KVCH 4Y2DC 3FRUA 3N85L 1T7XA 5DC0A 4YDKH 5K59E 2ORBH 4JPIA 1C5BL 5DEZA 4PJAB 2DM3A 1H3PL 2ZUYA 2VO5A 3EYFB 5HYSG 4PRBA 1QO3A 4IOFD 3O11B 4NO2B 5F6IB 3VXUB 2VTFA 1CFTB 4JFDA 3GKWL 5CSZB 1NGQH 2AJVH 4R4FL 2LTQB 5C09D 5L88H 5F9DC 5DD0L 4JG0L 3TBYA 4PLKD 3UJJH 3I6KA 5EOCJ 1CG9B 1L0XA 1RQ5A 2ATKA 1NL0H 2ESVB 3QFJE 2YUWA 3TNNB 2Q76B 5I1LB 1IGJA 3LQZA 4HAGA 3T0BA 1CXFA 1EEYB 5I19L 1T0MB 4ONHB 4UB0H 1KEGL 1GGCH 3L5WA 4KK8D 2K7QA 4JY6B 5A3IC 5E2VL 4YGVB 4Z7VE 4JY4B 5FUOH 1CQYA 1MRCL 5BOPA 3BYYA 5FHBH 5GS2H 3WHXA 2AABL 3QZWB 3ULSA 1L6ZA 3D2UB 3P30H 2H41A 1JFQL 3ARGD 1D9KB 1T66D 3S9DB 3RDTD 4F2MA 5JQ6L 1AJ7H 1CGWA 3AROA 3MREB 1INEL 5GGTA 4F7CA 1JBJA 3GKWH 2Q86A 3MLWL 3WJLC 3QIBC 2D03L 2HVJA 1T21A 3LEVL 3ZDXF 4YO0A 3ZKXC 4JG0H 5DO2C 4BSWA 1G6RB 1HXYA 3VH8G 5C0AD 5DRZB 1FZOB 4NO5B 4M1CD 5I8CA 3DX8B 2AW2A 1FSKC 3T04D 1AY1L 3QNXA 4N0CD 1GGBL 1TZGL 2ZSVB 1HYSD 4L1DA 3RPIB 3FO2B 4Y88A 5IOPA 5E2VH 2DMKA 4U1GC 5IMOB 3EYOA 4HKBB 3BE1H 2VLRE 3UPAA 4Z77B 3GUTA 1KEML 1CE6A 3G5ZB 3AAZB 3IXTA 4CU7A 1JI1A 3JUYA 3S96A 1JFQH 2ARJA 2NW2B 3HE7D 1AO7E 1LO5B 3Q3GA 3GMLA 5SWQB 1NAML 1SMOA 3B9KA 4AMKL 5C0ND 1X5KA 1R0AL 1LP9E 3RL1A 4LSDA 4PJBA 3OMZA 1T7ZA 1D3CA 4PLJC 3MLWH 1R3IL 3OKKB 1LEKA 5KSBB 1IM3A 2IQ9H 5JW3L 3QQNA 4WNQA 1I7UA 1NPUA 2IAND 4IRSB 3MV9B 3PQYB 3O4LE 5FGRA 3GMPB 2IQAA 1X5JA 2BC4B 4O2EA 1CR9H 2XIDA 2A1WL 1UM5L 3SE9L 5DZOA 5IMLA 1D6EA 3HLAB 4L8SA 3HR6A 1AY1H 4OZIA 1G7PB 1YPZB 2WWKO 1TZGH 3HNTH 1NKOA 3DXAB 2DQUL 5D7JC 4DFIA 2CIIA 3G9AB 4U2ZA 4DWHA 1A6UH 1CXIA 3UTTD 5EC2B 5D7IE 5J06A 2PXYB 3QH3B 2Q87A 1KEMH 4DVBA 2ENSA 3LV3A 1CLCA 4XHQA 4N90D 4RGMB 4JKWA 4JVUA 1I3GL 3Q5TA 3SCMA 2BK8A 3IYLW 1D6VH 4L3ED 5AYUL 4OB5H 1R0AH 3NZHL 4P2OC 2EO1A 3EJYD 4UDTB 1F6FB 4IOIB 1B6UA 5DT1H 4JG1H 5F9AC 4LSPL 1R3IH 5GS0L 4K2UL 5FGBC 5JW3H 5KS9F 3P9MA 2OR8A 4B53A 2WIIA 3FQRA 4Y19A 1PG7L 4KUZL 4NZTL 3C5ZD 2J12B 5FA3A 2ATPA 1J5OH 2A1WH 2W92A 3SE9H 5CP3H 1AR1C 1DFBH 1PEZA 2SEBA 5CIPA 4FFYH 3W11D 4IHOB 4WHYG 5CZKA 5FM4A 2A83A 4G8GD 3WKNA 1BZQK 2DQUH 2PW1B 4PJ5E 2NY6C 2WUBL 4N1EA 3HI1B 5F8RC 3L3IB 5L6YL 1XF3A 3S35L 1DN0A 2E6JA 1BQHA 2DN7A 2GY7B 3D39D 1IAII 5DEFB 1BFOA 4LLQB 5GGVL 1PFCA 3O2WL 1EFXB 4N0UB 3G5XA 4MWFB 4WTXA 5HDBE 4Z0BH 3QEQA 5GS0H 4K2UH 3D69B 5I15H 1FNGA 1PG7H 4KUZH 2OLDA 4APQB 1ORSA 3ARZA 2J3SA 3HB3D 2YD9A 1A6TA 4IBLT 4NBZB 4P0DA 4HZLB 1CCZA 5DJ8B 2CUIA 4F57H 1B0GB 5DUMH 4ZFGH 1A4KB 1Q8MA 4NPYA 3T4AB 4ESKA 2EEBA 4QHKJ 5E56A 5CMAB 3DRQB 3EAKA 1UWGL 4L8BA 5TE6L 2AV1A 5L6YH 1LDSA 5FKAA 5C07A 2VDNL 3C2SA 3T77B 1KPUA 4NQSA 3BPNC 2C9AA 4XCEA 1FVDA 2DLHA 3SDAA 3O2WH 1TFHA 5EU3A 3RVWC 3HCVB 4J1UB 4AYFA 2ILLA 1S9XB 4ZUSB 4CMMA 3K74B 2D9CA 2WUCH 4DGYL 5KVEL 2VDQL 5IFJA 1ZS8A 5FYKU 3C09B 1S9VB 5E6IA 4GG6A 3M07A 5CKGA 5HDOA 4POYA 5CFHA 4F9PC 4RAUB 3FQWA 2VQTA 3OKLB 5I1AB 3OKDB 2FBOJ 3PIQA 1F4WL 1UWGH 3NFSL 1ZHNB 3O9WD 1CDBA 1VGEH 2OX5A 3AY4C 3BGMA 5EU6E 1TQBB 1T20A 3D9AH 4AENA 4XX1G 2B5IC 5E2WL 1RUPL 4JN2B 3LHPL 5J9PB 3RZCA 3MJ6A 1A1OB 1MCJA 2JLLA 4PS4L 2DM7A 3HHRB 3BGFB 4Z7UB 1MUJA 4K9EL 2UUDH 3RKDD 1GXEA 3GMOA 3FQTA 4G8FB 3IAPA 1L0QA 2OR9L 2QBWA 3GB7A 1CK0L 4OGXL 5EB9A 4OLYH 3I75B 1WAAE 2VDQH 4G8IB 4K23H 1NLBL 1JWMA 4P5KB 2Q7YB 1T7YA 2NY3B 1OAZH 1TLKA 1JV5B 1FYTB 2FX9H 3T0EE 1JF1B 4Y5VA 4H25A 4FG6C 4PREA 3TYGL 3DNKA 5IMKB 3BO8A 3NFSH 3FT2A 4V2BA 2O61A 4RA3A 4YPGB 4EXKA 2YZ8A 4K3DL 4P99A 3PDOB 2EICA 1XIWC 4R4NC 3RX5A 5F3BB 1JTPA 4X6EA 1RK1A 4NSKA 5D5ME 1D5BB 5SWZE 3LHPH 4YHKH 4OF6A 1DBAL 1OHQA 2GUOA 3UBXB 3QRFM 3TO2B 2CKBA 5E9DB 4L9LB 4P5TA 4PRID 3WYRA 1YY9D 2XZCL 3LKRA 4MNHB 3MBEB 2RCSL 1P6AB 1IGIL 5KSAB 1MAJA 4J4PC 1CK0H 4Q2ZA 4QY8B 3BSZH 5DFVC 2WNGA 4OQTL 5EH1A 4JFQB 4YHZH 3E3QC 1LEGB 1MHEA 3F7YB 3D85D 3G6JB 2YEZB 1Q0YL 4XBEH 3TYGH 4LVEA 3RL2A 1IT9H 1FNEB 4P2CG 2Z9TA 4NRZA 2VNCA 3N9GH 4YHNB 4GAYB 3WXVH 4A6YL 2R1XB 4RGNC 2X40A 5C7XL 4K3DH 5AAWA 4KKCD 2MQ3A 4QWWC 4AJ0A 4O9HH 4S1SH 4JM2A 1TJHL 4NCC2 1ZSDA 5DI8A 5GS1B 1K4DA 2PTTB 2BRQA 2YWZA 3H3PL 4LK4A 1KJ2B 4OFYD 3GJFB 4NQED 5I1IH 4WIQA 3FB6A 5CZVL 2G9HB 1MVUB 2RCSH 4G6AC 1ADQA 2XT1B 4JKPL 3TV3L 5EU5B 4PV9A 1UM6L 2MTPA 4OCRH 5FO9B 3ZKND 2BOBA 4YIQB 5T3XD 1CICD 3OHXB 4E0RB 1CBVL 2XZAL 4POZD 3DX6A 4QHKI 5T1LB 5I2IB 4ZUUA 4BFIA 3V4UL 4LVOB 3VXRD 1IE5A 4DAGL 1U3HC 1OP3H 2P5WB 3WO4C 1N5AA 5IM7A 4WO4B 5CWSA 4KK9D 3WFHB 4YNYB 1EK3A 5KOVC 1VGKA 5DQ9B 5C7XH 4UV4H 4RFEB 4MA1B 2LV4A 3LSOA 1MCQA 1FV1B 2DWEA 2MOVA 3JBG7 2V7HA 2HH0L 1ZA6B 4U33A 1CI5A 1TJHH 3HKFA 3IDMB 2D31A 2R4SH 3NABL 3MJ9L 4P3DA 3TT1L 1OGTA 4PR5B 3ZTNL 1ND0A 4XWGL 2DIBA 4HHAA 5IW6B 1UWXK 3H3PH 5D1QA 5F7FA 3GO1H 4GAJH 1A6VL 5FM5M 5JXED 4OF8A 2AXGB 1FN4B 4GW4A 4JKPH 4LRNL 5HHVH 4TTDD 4X9BA 3RIAF 4NKDB 3GMNB 2WW8A 4Y0GA 3OJDB 4XMKL 3OB0H 1FG2B 4L4TB 4GT7A 4PJ9D 1QLRA 4DAGH 3SQBA 1UM4L 4U6VL 2JCCF 3SJVB 2DLEA 3HI5L 1RHHB 1Q38A 5J57B 5HY9A 3CFEB 4ZUWA 4GRLA 1A6ZA 4MNQE 3JWDC 5ALBL 3K81A 1OSPH 2BNQE 1P4LA 1RZ8A 3ARDA 3WL9B 3V5HB 1W0VA 4FFVD 5F97E 4MJIA 3HC0B 3WXWL 4G80B 2O93L 1OGAD 3B8YA 5FF6A 3BVNA 4LGSB 1B4JH 5DJAA 3AREB 2NZ9D 5ENWB 4M9OA 1SM3L 3FONB 2HJKB 3BXNA 3BP5A 1Q72H 4KC3B 3RVTD 4KROC 1ZK9A 3W82A 5BRZE 2MHAA 3ELAT 3OX8A 2L7JA 3DV4A 3VFRB 4M03A 3EGSB 4U2YA 4S1QH 3UPRB 4L5FL 4OGYH 5F7DB 1UM4H 4U6VH 1O5DT 4MXVE 3HI5H 4U3XA 4KKBD 4RISH 4MD5A 2R1YB 4P4KC 1KJVA 5H8DA 4AH2B 3T2NH 3RTQA 4KJPD 2BNRE 5ALBH 4YHMH 4F15C 2P8MB 4KQ4L 2A77L 4JRXE 4BSJA 4XP9H 4JO4H 4DCQA 2W38A 2XA3A 1QKZH 5KZCB 1TXKA 2OR7A 4UUJA 4CVXA 1NAKH 1KV3A 1HHKB 2HJFA 3RVUD 3WXWH 4BZ1L 5I9QC 3NN8A 3H9SD 3MCKB 1JN6B 5DLMH 1G6VK 2LTQC 4R7NB 5FO7B 1WZ1L 1R5WB 1CYGA 4JFPB 2IJ0C 3TT3H 2EH8H 1MLCB 3HZMB 5C0JB 2IH3A 4YLQT 1SM3H 5D2NA 1DCLA 3VH8B 4Z9KB 4L4VE 5DJ2B 1A8JH 2EE9A 4Y2DD 3WV0A 4PRPD 3ES6A 4P2RE 4K7FB 3C6LA 5CEZE 5T3ZE 5DHYB 3LEXA 1SMAA 2FL5A 3P4NA 4JRYE 2CGRL 3ARFD 5GS3A 4KQ4H 1UXSB 4UQ2A 3FL7A 3L3KB 1PSKH 5EC1A 5TJWK 3LH2L 4WTWA 2HRPL 3DUSB 3UPCA 4S1RL 5GZNC 2ITDB 4JPWL 5ESQB 2EDEA 2A6DB 3MFFA 3NVQA 4X9FA 4XPGL 2Q3AA 2J7LA 3EOBB 3NA4A 3NOIA 4BZ1H 4Y4HA 2V6HA 1FIGL 2FZ3B 1AHWB 4WCYH 1K2DA 3CDCA 3QULB 1L7TL 4X6CF 4J3UA 1WZ1H 1OTUC 4HKJB 1HOCA 5A3ID 3E6FA 4OZHE 5H2BA 2W65A 5F7WC 5IEHB 5LWYL 2F53A 2BVOB 4UNUA 4OTXL 4F7MB 5L2KD 2ICWJ 4XPAH 5AZEH 2NW3B 3DWTA 5IVZB 5IQ9B 3OR7A 2CGRH 3VXNB 3W39B 2F58L 3B43A 2D9QB 1H15A 1S7RB 3TWCH 3QIBD 2H8PA 5IIEB 1QSVA 5DMIH 5E5RB 3RVVC 3U0PB 3VXSE 1CDJA 4XPGH 1QBLH 5DO2D 1CD9B 4E41B 3SPVB 5TDPB 2Z91A 2ADJB 1HXMA 4OD2B 3MRIB 1W72L 2R4RL 5HGHB 2JKXA 2J5LC 2X42A 3QUXA 4IRSC 1QD0A 2ZJSH 4V1DA 1JRHL 4HWEH 3PP3H 4XP1L 4S2SB 4NQCB 4XCYA 2D3VA 2AEPL 1Q9OA 1KTDA 1N4XL 3SY0B 3O45B 5HYJD 1IARB 1E4XI 4OTXH 2IFFL 3UTTA 1DQQA 1I7RB 4FTVE 5HGAB 1EEZA 2PXYC 1INDL 3K1KC 4WGVB 4M43H 3WLWC 1S9YA 1I9JL 4M8VA 4PLJD 4DGVL 4U3CA 4PJHE 3GBML 1TVBB 1VA9A 2VL5B 4JCLA 3P77A 4KI5C 5CINH 3I85A 3C60A 5F88B 1W8OA 5E00B 4LHUG 4Z7WB 3QNZA 3SGEI 1IGFL 1JTOA 1KFAH 3FOLA 5C0CD 2VR5A 3Q5YA 1KF9B 4K55A 1SY6L 3UJIH 4XCNB 3QCUL 3QXWA 4R9HA 2NCMA 3MXVH 1A7NL 4UV7L 5D7JD 2B7DT 5F7LB 1DEDA 2X9YA 5JW4R 2AEPH 1N4XH 1YEDA 1KCKA 4AEIL 2MFNA 1T89A 4XNUL 1G9ML 5DJYA 2IFFH 3KJ4B 4U1SB 5F72S 5D7SL 3KPSE 2C1PA 5C08D 1TZIA 4P2OD 3GSWA 2F8OA 5CEZL 3MZTA 3BUYB 1IGYA 5T3ZL 4U1MA 4RSVA 3X3GL 3QCVL 1I9JH 1P7HL 4KJWC 4P4RB 4ZFOA 4B7LA 5BZDB 3GBMH 3GGWB 3D18A 3LN4A 3MTRA 5GSVA 3TLRA 1BBJA 4DK6A 3F58H 3TJHC 5EZOH 1ZT4B 3VFTA 1AIFA 1VFMA 1AH1A 4K3JH 3RWCB 3AC0A 3QQ4A 1FJ1A 1AR1D 1IGFH 1VEOA 2QHLA 4XB7A 2FJGB 1QOKA 3EDFA 3D6GA 5F3HB 5JW4Q 5KS9A 5LGJB 4ZAKB 1A7NH 2NY6D 2VITB 5KANI 5EBWB 1HQ4A 4LLYB 2VKXA 3RJDA 3INUH 3QDJB 4EJ1C 4QTIL 2EDQA 1G9MH 3UP1A 1ONQB 2KQMA 1E4JA 2E6PA 2ICEA 2IWGA 1U91B 4HPYH 3LY6A 4NZUH 3MLYH 1T1WA 3ZSSA 1DVFA 3CLFH 5CEZH 4KDTC 2M2DA 4JKMA 2DQCL 5HYIA 2FR4A 4UILL 5E7BA 4HIJA 5JPNA 4KDWA 4J3TA 2X4QA 5LCVH 5JOEA 2EDWA 4MD0A 4KTDL 2CQVA 4NJAL 3FQNB 5I76A 3ZDYF 3V8OA 2GK0B 1KB5L 3KPQB 1LE5A 1A7QL 2J8UF 1BZ7B 3I6LE 2HFGL 4HWNA 2HN7A 1NAMB 4KHTH 5BJTA 2ZSWA 3O4OB 4U31A 5EU4B 1U8HB 3L3DB 1JPTL 3C09C 2JELL 2ICWI 4NGHL 4PUBH 3HA0A 3JV4B 3REWB 4QTIH 4HMDA 5ANME 1HKLL 2NY5H 5I71B 3VWJC 1ZMYA 1Q9LB 4CADB 3O9WA 3WEXA 1HIMH 2R69L 1DL7H 1WWAX 3OG4B 5CZXC 3RVWD 2DQCH 1G7IA 1CDUA 3SE8L 5D8JL 4FZ8H 1NCWH 4ONGL 3BHBB 4URTB 4UIMB 4GBXB 43C9A 1YMHA 4HDIA 3BDXA 4IMLB 4KTDH 1OSZB 4JFED 1QBMH 4HAFA 1CLOL 3BGFC 5J11B 2WBJB 2YC1B 5EO0A 5MEOB 3U4EB 4QHNA 2GSGB 4YHOL 4LNRA 4NKOB 1CFVL 3I50L 3ZE1E 2EDBA 4Q74A 4C56D 3JWOC 5GRZA 3CZFA 1JPTH 1M71B 1OF2B 2NY3C 4NGHH 4JFFB 4PGBA 4TQEL 4X6DA 4MJ6A 4XCFH 1HKLH 3VD7A 5D2LF 4KPHL 5ERWA 4YBLB 1EHNA 1OB1B 4OM1L 4FRWA 4OQ1A 2BXZA 2B39A 3LB6C 1KTLB 4YBQC 5I1JL 2EIEA 3RU8L 4OM0L 1F8TL 3NIFE 2VXQL 3QFJB 2X05A 2CK2A 1KCUL 1U8IA 3ULUE 1NC4B 2D4DA 4G42A 3WFEL 1LO2L 1M6OA 1A21A 4WENB 3ZE2E 3BUTA 2M1KA 2PO6B 4LBEB 3MFGB 1BREA 4RWHA 1T3FB 2WV3A 2WWKT 3KDMA 4PYGA 5JPMA 1I8LA 5B4MD 4HX1B 3MBEC 3PGDA 4R26H 5KSAC 3RZWA 4FG6D 2Y72A 4KRNA 3BOVA 2VZTA 3SKOA 1EAJA 1PZ5A 5F9JA 4TQEH 4FFWC 4LL9A 1KN2H 4RMUA 1YYLL 4IMKA 2AQ3A 3IDJA 4JQIL 4YFDB 1XIWD 2O5YL 5I66B 4LQFL 4R4ND 8FABA 4ORZC 4P3CL 5IV2B 1F3JB 3QXAA 4GG8A 4M6AA 5IVNA 3LKNB 1U8MA 1WZKA 3BRDA 4LLUA 4HIEA 3KXFE 2V9RA 1FAIH 4WVRA 3GDBA 1YEEL 2FJFB 5JA9A 3SE4C 5F44A 5ISZE 4OZ4B 3OGCB 5GS1C 4N5UA 4J4PD 4QT5A 3TO4A 5F1KC 5DFVD 3O6ML 4NQEA 3VXTB 3EYSL 4FQ2H 5GPRA 4XCCL 1U93A 2VLRB 1YMMA 4ZO9A 1I8IA 2W59A 2X1QA 4XNQB 2I9LA 2QL1A 5DVMA 4AIZB 4NT6A 1KBGL 3MGTB 3HE6B 4CW1A 5B21A 2P44B 5JOFA 1C5CH 4X83A 4FFZL 5A16B 4LVOC 2H2SC 4M8QB 4QWWD 4LQFH 2C3VA 2CLZA 4KTEH 4WO4C 1KTKE 4M3KB 4EEEA 5EZIH 3WE6A 5IVXE 4MA1C 4KK5C 1M7IB 3NFPA 3HMWL 2FNBA 1QACA 1L6XA 1JGEA 5E4IA 1U8QB 2P8LA 4RWYL 4FNLL 5CJXA 4ZXBA 2MKWA 4FXKB 1V7ML 4G6AD 4WW2B 3TN0B 3BAEH 5KN5A 4RMSA 1AQDA 2FJHB 3GI8L 1RFDL 4HXBH 4LSVL 1IAMA 3QEGH 4DZ8A 2GIYA 4DEPB 4HUNB 4XCCH 1CGVA 3DETC 5D7IB 4NNYB 1U3HD 3K4DA 3P73B 3R0MA 4WI9A 5BVPH 5DA4A 3C87A 2XTJD 1CXHA 2VMFA 1C1EL 1FVEB 1LO3L 1ZKAA 3SN6N 4FFZH 3HNVL 1UJ3C 1KLGA 2CMRL 3ARBA 2W60A 3F7VA 4E9LA 2VN7A 1UB5B 3QG6A 4QHMB 1PZUB 1A7OL 5EIIA 1CFSA 2FD6L 1QSFD 4D0BA 2EIZB 2X2YA 5E7FA 3BZFA 3MRPA 1YEFL 1K6QL 1JZ2A 1XGUA 2RFXB 4RWYH 4BKLB 4NWTH 5HVGB 1OAYL 3H3BC 4BQ6A 2J1KA 4JHZA 1QUNA 4N8VG 5JIKA 4NNXA 1MHCB 1CL7I 3GI8H 5JIIA 3ULUL 2IBZY 2R0KL 2FWOB 4DUVA 3CDGA 1RUQH 2BOCA 1QRNE 2UWEF 2ZG1A 1LO0L 4PJ5B 4D8PB 4F37F 3GI9L 3HMXL 4LLWA 4HIHA 4HS8H 2YPLD 3AREC 1QFWM 3EOYG 4JAMB 4HUVB 1C1EH 1VFUA 3HNSH 4F3FB 1BLNA 1S7UB 1ZHKB 2D0FA 3HC4H 3HNVH 4LMQE 5LAXA 4WFGD 1AGFA 2XKNB 4TN9A 3KLAA 1A7OH 3BH9B 3UTPE 3VMPA 3X12B 4ZO8A 1BBDH 1T7WA 4M61A 1UKSA 1YQVL 1IGTA 1V8HA 4OD1L 1YEFH 4PJ7B 5IHZA 2VXVL 2E7MA 3UTSD 3LRSB 2GITA 1BD2E 4N68A 2DRUA 4ZG1A 1CFNB 5BXFA 5C0BB 4D9RE 15C8L 3ULUH 2R0KH 1RZIB 4A6YB 4WI4A 3KPOA 5I0DA 1IGCL 4MGXA 3H9SA 3FTGB 4KROD 1WUNT 4ZNCD 1AGBB 1IM9A 3NPSB 2ICWA 5C0GA 3BN3B 3BH8B 3GIVA 5H37H 1G7JA 2VAJA 1EAPB 3D0LA 2M26A 3TM6A 5I1GL 4EDXB 1J0HA 2K7PA 4EVNB 2B1HL 4Q9BA 2EDTA 4LSSL 4PRPA 4FQXB 4I5BB 1JPGB 4X8JB 4Z8FL 1CE1H 1KG0A 5JTWA 5TQ2L 3FRUB 4QF1B 3TPUA 1YQVH 4UIKL 3ARFA 5DJDA 4JPIB 2QV2A 2F5BL 4IRJB 2P47B 3VXUD 2HFFB 2NY4C 1QO3B 1F00I 3CLEL 15C8H 3ARYA 3WUZA 5I17A 3EO1A 1WFNA 3CFCL 4LOUC 1IGCH 4KJYA 5E08L 2ESVD 2ZG2A 3MUJA 3S37L 3SQOL 1SJVA 1AHWC 3TBYB 3CMGA 1RUAH 2ATKB 5A40E 3QHZH 3TJEL 1IGJB 3LQZB 2D7PA 4HCRL 1DSFL 1N0XL 4IRZH 3KPMA 2DAVA 3NIDF 5ICYA 3D2UD 4H20L 2YKLL 3Q0HA 1EUUA 5GZND 1EGJA 3WHXB 3GSUA 3ULSB 3U7YL 4U1JA 3DYPA 4TNWK 2F5BH 4TNWF 4ZQKA 2CKNA 3D1MC 2BMKA 5HI4D 3S36H 1GAFL 5BV7L 4F2MB 2JK5A 1OTUD 2OMBA 3ZHKA 5JZ7C 4UAOB 4F7CB 1FZKB 3QXUA 2Q86B 3P3YA 3W0WE 1BIHA 1CT8A 3SQOH 2HVJB 4GOSA 4YO0B 1MCKA 1SEQL 4LHUB 4Q9RL 4BSWB 1HXYB 5BZWB 4X6CA 2ZPKH 5FYJE 5I8CB 3TJEH 1FL6A 3TZVC 4HCRH 1NMCC 1FH5L 3QNXB 5SX4H 1MCDA 5IOPB 5LJYH 4QXGL 3DSNA 2YKLH 1HH6A 2ZP0T 1AGEB 1S7TA 3RVVD 3QSKB 2F5AL 3L3GA 5IB3A 4QOKE 1CE6B 4RFNB 1DZBA 3IXTB 2ARJB 4CJ0A 1A0QH 3Q3GB 3GMLB 4CVZA 4QRPE 1HH9A 3B9KB 4PJ8B 1GAFH 4G9DA 3UC0H 3RL1B 2EYRA 3OB8A 1XF4A 3OF6D 4PJBB 4PRNA 5FOBB 5BO1L 4I4WA 1V3KA 3MRKA 4IRSD 4JFZL 3D3VA 3MV9D 1LEKB 1IM3B 2YD1A 5DXWA 4WNQB 2X1OA 3MGOA 3BKYH 1I7UB 1RJLB 4PTTA 2IQAB 4O2EB 5I1DA 5TF0A 4YHPA 3DXAD 2CDEA 1D6EB 4L8SB 4OZIB 3MROA 5C2BL 4X9HA 2PYEE 2PXYD 1P4IL 2HJLA 1KULA 1NFIB 4UU9B 3WLWD 2CIIB 3MLRH 2Z4QA 3KJ4C 4P2QE 4P9HH 5DK2A 3ZYOA 4LKCB 4P2OA 4KI5D 3U48A 1T03L 5GGRA 2Y06L 5H94A 2HKFH 4LPXA 3SCMB 2ITCA 4QRQA 5B8CA 4X7SH 4ACPA 3CVHL 4PJDB 4OLUL 4M62L 1JIBA 3LDBB 1YY8A 3R06A 4M00A 4QHUB 1VEMA 4G3YL 3C5SA 4KKLC 3VMNA 2A74A 1PJ9A 3P9MB 4PJGA 2WIIB 3FQRB 4OKVA 3RVXC 3ULVE 4GJTB 2FYYA 3U36A 5FA3B 2ATPB 4M48L 1R3HB 2X6MA 5GGSA 3VI4F 3MV8E 4WI8A 3VE0A 5C2BH 1UADC 2MNUA 5CIPB 1ZLWH 4TRPL 2AK1L 5F7YC 1Q9KB 4OIIL 2NZIA 3RNQA 4KJWD 5JHDD 2KPNA 4XH2B 1XF3B 1B88A 3T8XA 3H2WA 2ADIB 1T03H 3EDEA 3TJHD 2Y06H 1EFXD 4X7FC 1MFCH 1YJDH 5I30L 1BFOB 3OXRA 1KLUB 2B1AL 4P23A 4O58L 2VC2L 4OLUH 3BP4A 1WQVT 3G5XB 4O02L 4GKZB 4MZ2A 5GRXG 4NM8H 3C08L 5HJ3A 2JCCE 1T2QL 2D4FA 2F9BT 1FNGB 4G7VL 2OZ4A 1NMBL 2GW5A 1X44A 1M7XA 5T1KD 3OR6A 3HRPA 3DVNA 5K33A 3QHTC 2WBKA 1PKQB 5IQ7H 5FYJL 3B3IA 4F8TA 1PDKA 4OIIH 3X3FL 1JMXA 2A9NL 1W72B 3MRBA 5I71C 4L8BB 5I18H 2VQUA 2A6JA 3HG1A 1QR4A 1TQCB 2F19H 4R4BB 5EO9B 5FKAB 5C07B 1SJXA 5JUEH 1KPUB 1QLFB 2DQEH 4QHLA 3H9ZA 4NQSB 3UJTL 5IW1A 2ICES 3QJFA 2VC2H 1FVDB 4GBXC 1E0OB 2QQNL 2W9EL 3RPKA 3Q48A 4LDEB 5IG7B 5DVLA 4JFEA 1DQJA 1WITA 1BWWA 5J11C 4J6RH 4O5LH 3T65B 1B0WA 3OXSB 4ONFH 1NMBH 1ZS8B 3VWJD 4C56A 3HRZA 1HQRB 3ESUF 3NCCB 3MLZL 5E4EB 3DURA 2PW2A 3NPZB 1FNLA 3C8KA 5GSRB 1T1YB 3X3FH 3PDGA 5CZXD 3LRHA 2A9NH 2YD7A 3PIQB 4JDTH 2XYCA 2WSKA 3W5NA 4YBLC 4JO2L 1U6AL 2CRZA 1S3KL 3S34H 3MOBH 2X1WL 3EFDL 1LDPH 2E7BA 5T5NF 4MQTB 3RZCB 2QJDA 4P46C 3TPKA 3RWFB 5I8OH 1SVZA 1SYVA 1F3DH 2HVKB 4NUJB 4XVJL 4XPTL 1ZWIA 3GMOB 1QYGL 3AMLA 1KC5L 1Q1JL 2PO6C 1OAUL 5EZLB 4DOHE 2NY3D 3FFCE 1FYTD 3BX7C 3QCTH 3CSGA 3NIGE 2BVPB 4BH7A 3PV6A 4XPBH 4JRYB 5D7LE 1JWMB 4WFED 3ULVL 1NCCL 3MLZH 1A9BA 3L7EA 1YN6B 4P9ML 4WJ5A 1NJ9A 1YA5A 5LBSH 1KIRA 2LU4A 4H25B 4DJMA 3MJ8A 4JHBA 1E27B 2LVEA 3LB6D 1TCMA 3BO8B 1QFWI 4Z0XB 4YBQD 3HN3A 4R8WL 3VWKB 1JF6A 3DROA 4Y4FC 5D2LA 4NJ9H 3FT2B 1U6AH 2O61B 1NSNL 4MDIA 4CJ1A 2DDQL 3EFDH 1A2YA 5E9DD 4X6EB 4NSKB 5FUZH 3L95A 5KVGL 3QDMA 1EJOL 2CKBB 3MBED 5KSAD 5IMMA 1P4BL 4JPVL 4P5TB 1DUZA 3LKRB 1KC5H 1Q1JH 1NDGA 4N0FA 5IB5A 4Q2ZB 4X4ZA 3WIFA 4FFWD 1K4CA 5I8KL 2QQQA 3TA3A 1S7XB 3ULVH 3T3PF 1NCCH 1IGML 4D9QE 1MHEB 3HE6C 3IJSB 3UROR 1A1NA 2V5MA 1TVHA 1BX2A 3VXSB 4WV1A 4HC1A 4B7IA 3KYNA 1TCRA 3RGVA 4FQPA 1EMTL 4HUWA 2DDQH 4FS0A 1XH3A 4JM2B 1ZAGA 1AGCA 1ZSDB 5DI8B 1CLYH 1OP5H 4K71C 3MRDA 5KVGH 1T6VN 5EA0H 1K4DB 5FGCB 2XNAA 5E8PB 4GRWF 2CDFB 1GVIA 2MPAL 4JPVH 3UYPA 4N8VB 3FB6B 2EYSA 5CJBA 4ISVB 5GISL 4DEPC 6FABL 4OZFA 3CVIL 5T1LD 3NGBC 3PABA 5J56B 2BOBB 2H2SD 5I1CL 1IGMH 4WO4D 2VOTA 2EC9T 3ZHLA 4PJHB 4BFIB 4M5ZH 1N5AB 5IM7B 3M17A 5CWSB 4KK5D 1RIUL 4Y4KA 1JPSL 4NC0B 9CGTA 3C6SA 1AD9A 1VGKB 3WFZA 3T4YA 3IFOB 3LSOB 5FOJA 3GSNL 4DKEL 2R2HA 3VFPB 1P9MC 3ECBA 1OGTB 1UCTA 2N4IA 2YK1L 3LZFH 3FO9A 1HEZA 5FEBA 5KJRL 4HHAB 4Z76A 1F4XH 3DETD 5EUKB 1N5YH 4Z95H 4GLRI 3P0VL 3QO1B 4M6NL 4L4TD 3CVIH 1CTNA 4JY5L 1F4AA 5I1CH 4XXCA 1MCRA 1QSEE 3QRGL 1QLRB 1X7QA 1JHKL 3MODL 3PL6A 1HI6A 4AL8H 5I73B 1Z5LA 5BS0A 2VSCA 3VFOA 3IS0X 5E95B 3OZ9L 3VXOA 3T0WA 2FIRT 2BCKA 2XQBL 4Q97A 5EU7C 5IK3B 3CMOL 1P4LB 2DKMA 3ARDB 2YK1H 3ABZA 1W0VB 5DVNA 1TETH 4WUUE 4MJIB 3H9HA 5DQJA 2ZUUA 3ARED 3SKMA 5D1ZC 2VH5H 3P0VH 4M6NH 2AXFB 4PJEE 3BVNB 2IMMA 1B90A 3BT2L 1CDGA 4JCMA 3BWUC 3BXNB 3NPSC 3BP5B 4BK5A 3MODH 2WLZA 2MHAB 1FNFA 3JV6A 3CSYA 2R39A 3OX8B 3F7RA 4CMHB 3DV4B 5CEXB 3E6HA 3UYOD 4YXLL 1BJMA 2DQFA 1LO4L 3V4PL 5GJTL 2NX5A 4FQXC 5FECA 3TYFA 4MD5B 3UDWA 2J8UE 1JWUB 1KJVB 3W9EA 1GYAA 3RTQB 3EYFA 2Y5TB 2MMXA 2XQBH 3O11A 3UMTA 5CEYA 1IC4H 1RV6X 4NO2A 5AZ2H 3S3SA 3SGDI 4KKAD 4QRRE 3ROOB 2DI7A 5DJCA 5T1DL 4UUJB 4CVXB 5FUCC 1OPGH 4XVTL 4PB0L 1DP0A 3QXVA 2HJFB 2VABA 4ETYA 1P1ZA 3NN8B 4Q6IB 5KANG 2ESVA 3TBSA 4DZBB 4LVNC 3BT2H 2VXTH 2YN5A 3TNNA 5HI3C 5I1LA 3Q5OA 1NCBL 4OF7A 2HG5A 2IH3B 5D2NB 1T0MA 4WDIA 4TUKH 1F58H 5HHPA 4JY6A 1JGVL 1YEIL 4YGVA 2NTFB 1YECH 1QFUL 1RU9L 5EULV 2AJXL 4YXLH 1VFOA 1MPAL 3ES6B 3QZWA 2XI9A 3D2UA 4FQQA 2D0GA 2YN3A 5GJTH 3CXHK 3BESR 1MCPL 4PJXF 3LEXB 2R0LL 1D9KA 2IGFH 2NY4D 1YDPB 3P4NB 4JGJA 4YX2L 3MLSL 4Y5XA 2I24N 3LIZL 3QEHA 3RWDB 5AD0A 4UQ2B 4KMLB 3O41B 5EC1B 4LOUD 4JN1L 1KCVH 4KZEL 1H0DB 3I3BA 4ZS6C 3UBXI 3V79C 2Y9RT 5EORH 1WLHA 2APBA 2X4OA 4XVTH 3WLBA 1JGDB 1EBPA 1ITBB 4UAOC 1G6RA 2ENYA 1BFSA 3KPRE 4Y4HB 5A2JH 1K2DB 3P40A 4OIAA 1NCBH 5MEND 1HOCB 1NGPH 2NPLX 4OV5A 2ZSVA 3AS2A 1N59A 3P0YL 2OM5A 5IMOA 5H2BB 1QFUH 1RU9H 4MA8L 2W65B 3K2UL 5AG9A 1YNTA 2F53B 2YBRA 5CLTA 4J3VA 1FQ9C 1MPAH 4FQLL 4NN7B 3RUGE 3T2OA 5FDWB 2AJYL 3OR7B 4NQDB 4U6TA 5E2UL 2QSTA 3OAUL 3MLSH 4KAQL 3LIZH 5JZ7D 4RFNC 4E41D 4HGWA 3V0WL 1A1MA 2H8PB 4OLVH 5EUOF 3B9KC 1EVTC 3PNWA 2NY2C 2Z91B 3PQYA 4XMLH 1HXMB 2BC4A 3TZVD 3TIDA 4DN4L 5ILTH 5DHVH 4NQCD 5JQHC 4PY7A 5AG8A 1CIUA 4JFHD 1YPZA 3QUXB 3HAEH 5C9KA 2G5RA 4HIXL 2H32B 1D5IL 3P0YH 2E27H 5FIEA 1KTDB 4MA8H 3OKOA 4L8SC 4LEOA 4XNZB 4YXKH 4LCCA 5EC2A 5HHQA 1E28B 3QH3A 5MP6L 5D9SB 3MLTB 1DQQB 5DGRA 1NBVH 1EEZB 2DJ4A 3EYQC 3OAUH 3SGKA 4I0PB 1BOGB 4KAQH 5JR1L 1S9YB 4UDTA 3VFMB 3V0WH 4HXAH 2AJSH 1JNNH 3SCMC 3P77B 5IFAL 4N0YH 1EPFA 4F7PA 3CXHJ 3LDBC 2DI9A 3Q2CA 3R8QA 3PG2A 4JGMA 2C3HA 1I9RL 4HG4K 2W0FA 1QHPA 3MC0A 4OLXL 2V5RA 1L7IL 1YEDB 3HI1A 3HPLB 4X4ME 2VUOA 1HCFX 1I1RA 5EBLA 5DJYB 3IU4L 2XFXB 3ARWA 1RJCA 3F62A 1DLHB 2C1PB 4PYHA 1EH9A 3GSWB 4U1MB 3WSQL 1QSZA 4HBQA 2ARJQ 4N0UA 4ZFOB 2UVEA 4MWFA 3BDYL 4KKLD 3LN4B 5CSGA 1MCHA 4PV8B 1BBJB 3D69A 3RVXD 2OTPA 1AIFB 1F90H 7CGTA 2VLKA 3CXDL 4APQA 4ZAKD 3QQ4B 1G7LA 1YEGL 1MELA 3IDGB 5B39G 4HZLA 5KS9B 2OI9B 1TNMA 1OTSC 3PWPA 3S5LG 1B0GA 4OCMC 3ZKMC 1A4KA 1ZLSH 5K9KA 3P4LA 1NLDH 1QLEH 4OLXH 3L5JA 4LCYA 4YXHL 4HWBL 1HQ4B 3V0VA 3DRQA 1Y18B 4RX4D 1IQWL 1ZVYA 4FQIH 4DKFL 5CGMA 2VLJA 1NMAL 2GCYA 2PCPA 2C1OA 2I25N 3IU4H 4ODXA 4UTBH 2ICEB 1F13A 3T77A 1EV2E 4OFIA 5D6DA 1QRNB 2UWEE 4G6KL 1DVFB 1TQCC 3LKPA 5I16A 1XEDA 4TSCL 5JOPD 1EVUA 2RQ8A 4GMSL 4HIJB 5JPNB 3RIFK 4J1UA 2X4QB 4Y1AD 3RIFF 1RZKH 3EOTH 3FT3B 4O4YL 5C09E 5I76B 4ZUSA 5CBAB 3DX7A 1VPOH 1DUYA 5K59F 1R5VA 3G04B 1LE5B 1SBSL 1YEGH 2ZKHH 4GH7B 1MCWW 1RULH 4G9FA 3K8LA 4RRPA 1T7VA 5DZLA 3LPFA 5IB4B 5BJTB 1DQDL 4I2XE 2ZSWB 2XN9E 3IKCA 5E6IC 3OKDA 5I1AA 2DLFL 5E4EC 1IQWH 1ROWA 1RZJH 4DKFH 1NMAH 4LIQE 1AXSA 4GMTH 2DBLH 1Q0XH 1J18A 1TMCB 3WEXB 5JDJA 4E42A 2CR3A 2FEEL 1KIQA 2C5DC 2C4XA 4HG4J 4GBXD 5EIQA 2C4FT 3BZEA 4LCUA 3DSFH 1BVLB 2W0LA 1A6PA 1G7IB 4LU5H 4ZTOL 4GMSH 43C9B 1YMHB 1HWGB 4AQ1B 4HDIB 1JPST 4G8FA 1NCNA 2Q8AH 3O2VL 5AAMA 3RZCC 1WIPA 4GS7B 4WY7H 3UO1L 5HHOA 5C0AE 4NQVA 4MJ5A 4QHNB 3LMJL 1MVFA 4ZODA 1JZ6A 4LGRB 1JV5A 2LU3A 1JF1A 4HGKC 4JFFD 4J3WA 4U7KA 4BH8A 1MJ8H 1MIEH 1DQDH 1X5YA 3CZFB 4XPHL 4N5EC 4HS3A 5CAYB 2DLFH 1I1AA 1WFUA 1N6QL 4X6DB 5J13C 4MJ6B 1T22A 2W9DL 4J3OC 4KVNH 4LRIC 4G6JL 3MLUL 4WGWB 5FFLA 3L3OA 2XA8H 1D5BA 3UX9B 1UXWA 4P46D 2EECA 3FT4B 3C2AL 1NC4D 3UBXA 1CGTA 3LQAC 3TO2A 4L9LA 4XPFL 4ZSOA 1U8IB 2PO6D 4G42B 1AQKL 1FLRL 1M6OB 3TIEA 2IALA 1RZKC 5FM8A 2IANE 3NIDE 4P5TC 1BQUA 3OKNA 2R2CA 1LEGA 2UUDK 1FAKT 2Y36H 1K8DB 3G6JA 2YEZA 1MWAA 3DGCR 5JA8B 5ITBH 4XPHH 4Y4FD 3SKOB 1FNEA 1PZ5B 4O2FA 4JDZB 3UTTE 4GAYA 4JFOA 1UCBH 4G6JH 3IDJB 3OJ2C 3V7MA 4OCYL 1IAIH 1G0YR 1RZJC 4N90E 2L0DA 3W0WB 1B2WL 3SE4A 1RZFH 4L3EE 4LLUB 3C2AH 1CD0A 4HIEB 4H8WC 2PTTA 2JJVA 1KJ2A 4JM2C 4EIGB 1AQKH 4X98B 2XWJA 4MAUH 3RNKA 1E6JL 3TO4B 3NFNA 2EDJA 2VLRD 4HWZB 5EU5A 1IC7H 5FYLH 2ZOKA 4W68A 4YIQA 1EHXA 3HFML 3HE6D 3OHXA 4I18A 3ZTJH 3KGRA 1U93B 4ZOAA 1YMMB 4D9LL 1I8IB 1H8NA 3MMEB 5T1LA 1P5VA 2WIMA 2BDNH 2X4UB 4XBPA 4LEXH 4CN6A 1VKXA 1RJYA 2P5WA 1S5IH 4G8GE 4CW1B 4WU5A 4TUOA 2HWZL 2OP4H 1WJ3A 4ZNEE 5JOFB 3DVFA 3QDHA 2A9ML 2Q8BL 5L2JA 2CLZB 3A6CH 4PBXA 5KSUA 3D39E 1NBZA 5ACLA 3WUWA 4LIQL 1F11A 1B2WH 3IDMA 2F54A 3WE6B 1XCTA 1BFVL 1J87A 5J12B 5IW6A 1JGEB 2P8LB 3B2VH 4E5XB 1D5ZA 1XT5A 1CQKA 4ZXBB 1X5AA 5KN5B 2AXGA 4GKSA 1FN4A 1E6JH 1AQDB 3QYCA 3WNNA 4J3XA 3B9VA 2PYEB 5D1QC 2FATL 2NXYB 3QUZA 1KPRB 3OJDA 5EBMB 1WBXB 4OF0A 1KELL 7FABH 1LQSR 4AT6A 4M5YH 35C8H 3CZJA 4BQ9A 4XMPL 3CFDA 4FQCH 5DD1H 5TPWH 4BA8A 3O6FB 5HDBF 4NC1E 3QUMH 1YEJL 3U79A 2HWZH 3UTOA 1INQA 3SJVA 3HZKA 2HT3C 1RHHA 1AFVH 1KLGB 4ZDHB 3ARBB 3F7VB 2XICA 3ZZ1A 3QG6B 1OP3K 4MCYA 5I73C 2X41A 5DJ0B 4HBCH 4D0BB 1OL0A 3V5HA 5TE7H 3BZFB 3MRPB 1F97A 1T1XA 2F74A 5FYJU 1EHLL 3HC0A 3TBVA 5HYSA 1Q94A 3VI4E 2NY1B 4EUPA 3ARDC 2DMCA 2ZZUT 2VR9A 4ZO7A 3CDGB 3IGAA 3OAZK 4JHAL 2BOCB 4OZFG 3G6DL 1RZ7L 3FONA 3S8WA 3FN9A 1P7QB 4HIHB 2HLFC 2I27N 4ZOEA 1ZANH 1PX4A 3SO3B 3CC5B 5EPMB 3QNYA 4K8RC 5JW4M 4P59L 5F7DA 2D7TL 3L9RA 1XF5A 1YNLL 3QQ9C 1FORH 3FCTB 1AGFB 2FGZA 3PWUA 4OT1L 2JCCB 2P8MA 3UYRH 4JO3L 1IGTB 1SJHA 5LQBL 5J1AA 5C0BD 4LPUA 3RTQC 2GITB 4KV5F 2FX7L 3KHQA 3NCBB 5BXFB 3MXWH 3NCYS 2V5YA 5I1HL 1LNUA 4R7NA 1TDQA 4JB9H 5FO7A 5C0JA 1MLCA 2XPGA 4I9WD 1RZ7H 4KTYA 4Q6IC 4ZS7L 3TFKC 1H3TA 4X6FB 1ZLUK 1IM9B 1YN7B 4R2GB 3GIVB 4P59H 5D2NC 1G7JB 3SDDA 1CXKA 1YNLH 4M7LH 4M7JH 4FQXD 4K7FA 3QI9B 4QXUL 3W81A 4PLOB 5DHYA 3K80A 2CO6B 3BJLA 4OT1H 3C6LC 4BJLA 3LCYA 1J8HA 2V17L 3TPUB 3DUSA 3VGFA 2VWEE 4JO3H 5J6GA 5LQBH 3EYVA 3GK8L 4MNGA 5DJDB 1ZGLM 4DTGL 1A64A 3EUUA 3LPGA 3O3EA 4JFDD 2C3WA 3NACL 3ZLQC 4PRIE 1BF8A 5A43C 5CJ8A 2VDLL 4Z78B 5HI3D 5I1HH 2QSQA 2EIBA 3EO1B 3HI6L 2QSCL 5D5MF 2RIKA 1A3LL 4Y4HC 3P9LA 2N7BA 4D0CB 1G1CA 2B8OT 2CK0L 3NA9L 2IG2H 4ODHL 1H3XA 3P4OA 5E94B 4M1CC 4NP4L 3VG0H 2AXHA 3I2CH 4Z7NE 3VXMA 2BHYA 4OAWA 2NQCA 3KPMB 1NFDE 5ID0A 3HR5A 3THML 4PG2A 4NN7C 4DGIH 4HFWA 2YZ1A 3R8BB 4ZS6D 3FJTA 3VA2C 4DOHB 3E1F1 1MY7A 3U0PA 4HUKB 4U1JB 2J4WL 2DICA 3GIZL 4DTGH 2W9LA 1D5XB 2CIKB 2BMKB 4R90L 2IMNA 2JK5B 3TH4T 2ADJA 3WMSA 2VDLH 1RUKH 5L9DL 4OD2A 3MRIA 4K94L 4KI5F 4LHUD 2H1PL 1WC7A 1FC2D 1WFTA 3HI6H 3MV7A 2QSCH 1CT8B 4KUCF 3TGXA 3G6AA 5T3XE 3UZQA 3V95A 1ZHLB 5HGDB 5HDLA 4NQCA 3W2DH 2A73A 4XBGB 3OTTA 3NA9H 4X6CB 3VXRE 4ODHH 3MO1A 3QUXC 4NWUL 2OJEA 2E7CA 3O45A 4I77H 2XY2A 3TESA 4XNZC 3THMH 4JR9H 2EDLA 3ZE0E 5JNYA 4X4XA 3BIKA 4YHYB 1S7TB 3L3GB 4YFLF 2X5PA 1HNFA 3B9KD 1A7BA 2AJ3B 1TVBA 2C4FU 2VL5A 1HZHH 2J4WH 3GIZH 5HHXL 2NY2D 4CVZB 1DQML 4NCDA 3T3PE 1N8ZA 1HH9B 4G9DB 5E00A 1FO0L 3RWEB 2GI7A 5CJQL 4W70A 1TTGA 2H1PH 1UWEL 5EUOA 1EXUA 4I4WB 3C60C 3MRKB 3D3VB 4LCIH 2X70A 1MCBA 3MGOB 1J0YA 3U46A 5L8LB 2OMNA 4Y8DC 5I1DB 1W2KT 5B39B 4YHPB 2YXMA 2AERT 2CDEB 1JVKA 2CRMA 3S5LB 1X5HA 2RJMA 3MROB 4YH6A 1IEHA 3EYQD 4CU6A 4GRWE 5L8JB 1T89C 2DQGL 3QDGA 5KG9A 3OAYH 2Z4QB 3SCMD 3GGWA 3NCEB 2GJ6A 2C7UA 2K1MA 5H94B 3O6KL 4N9OB 2ITCB 2LE9A 4QRQB 5B8CB 4Y8AA 1KOAA 1OGAE 1RJZA 4P3WA 2P4AB 2B0SL 2FJGA 5FCUL 4Y19D 3R06B 2OK0H 5F3HA 4CDHA 3C5SB 4ZAKA 2VITA 3MBXL 4PJIA 5EBWA 1S5HA 1QFPA 3V6OA 2P49B 4F58L 1J10A 3WFCL 2OI9C 3QDJA 4U6HB 3BI9X 5GGSB 3HB3C 1B6DA 5E5MB 4HEME 4X5LA 3ARRA 1DEEB 1BHGA 5INDA 5ABDE 2PUQT 4DVRL 2DQGH 2P7TA 1BP3B 2JB5L 5TF1L 3WDJA 2P5EB 2BNUA 4XP6H 5CJOL 1XR8A 3GSOA 1F2QA 4OCWL 4WFFD 1DVFC 1CIDA 2DIJA 2FEDC 4ERSL 3OXRB 4P23B 5DURB 1QSEB 2VE6B 4MA7H 3QEQD 2DYPA 3BP4B 4LHQB 1W8NA 5DWUL 1V05A 5HVHC 1UACH 1OTSD 3ZKMD 4X7CC 1KYOK 5HJ3B 4CRPA 3BGAA 1NAMA 4NHCH 2LVCA 5DJZA 1A47A 1LE9A 5EU4A 3RQ3A 4X4YB 4I3RL 5F1IA 4F58H 5T3XL 4UT9L 2J6EL 3ZKSD 3REWA 4YHLH 1DTUA 1G9NC 1SYSB 4NM4H 4ZD3H 5DQDL 3DVNB 2CPCA 1G0XA 1JCKA 3B3IB 4MAYA 3DVIA 4Z7OF 5C07D 3IDIA 4M7KL 1PLGL 1MJUL 3MRBB 1MFDL 4A2LA 3MUZ1 2A6JB 3HG1B 5CP3A 3O2DL 5CJOH 1CF8L 2QHRH 2X4SB 3O9WC 4Z7QF 1QQDA 4UIMA 2OL3L 1EIBA 4QHLB 5T5FL 4IMLA 5IFHL 5IW1B 3QJFB 4KZDL 1WZMA 1VB9A 4PG9A 3WIHL 1FNSH 3FB8A 4NFDA 3WN5A 5I75C 2WBJA 2YC1A 3U4EA 4ZYKA 1I9IH 4B50A 2WM0A 3MX0A 4PGEB 4NKOA 5ESAA 4GS7C 5ELIA 3TVMA 4CL7A 5E6ID 1OF2A 2J8UB 5LG1A 3VFVA 4L1HA 3HRZB 2YA0A 5DQDH 2GHWB 3O3AB 2FH8A 1IC5H 2PW2B 3DURB 5L2KE 2X1XR 1ZHBB 1E4WL 4M7KH 1PLGH 1RIVH 1L9NA 5C70A 1KTLA 2YD5A 4EOWL 2VDKL 3IFNL 4H1LA 1WZLA 4OZHF 4LARL 3CDYA 3QFJA 2NR6C 3RZCD 3BD5A 5IVOA 5LGHL 2YRPA 4AIOA 3SGEH 1I85A 2VL4A 1T3FA 1X5IA 3UEZA 4Z7VA 2YPVH 4HX1A 1XAUA 3U4BL 5TQ0L 5E8NB 4N5ED 4HLZH 4XP5H 1I3VA 1I8LC 1KB9K 4PJXE 4M9PA 2QR0B 4BH7B 3PV6B 5D6CA 4UT6L 1KLFA 5F1OB 2V2WA 1Y6MR 4ODTL 5HYJE 2WQ8A 1A9BB 1ED3B 1ZEAH 4C55A 5DMKB 1HHGA 5JXAL 4XGZA 1KIRB 3SDYL 3FZUC 3MJ8B 4NZRL 5IV2A 1KYOJ 4PY8J 1IAKB 4IMKC 3DROB 2VUYA 3SDXE 5D2LB 4EOWH 4JHWL 3IFNH 3L1OL 3QPQC 2CJUL 1GPOH 4MDIB 2FJFA 2X9WA 3CFKA 3LS4L 1CFQB 5C9JA 1S78C 1I9EA 1R6VA 3L95B 2H9GA 4P5TD 3QDMB 5KW9H 1S7WA 3OL2A 3T2PA 5ESVB 4YHIB 1EHAA 1SEBA 2CUHA 5C0CE 4XNYH 3FN3A 5IMMB 1HK6A 3S6CA 5DHXB 1OP9A 3TO4C 1UWXH 2VLRA 4KJQC 3WD5H 3ILQC 1DUZB 2OXHA 4N0FB 3WIFB 1AO7A 1C7TA 4UT6H 3TA3B 5IESH 5I1EL 2C3XA 4ODTH 1LP9A 3ZKNC 3IXAB 2BJML 4OLZH 1RUML 5JXAH 1TVHB 5EDXA 4WV1B 5C08E 4M6OH 3GHEH 2FX8L 1AXIB 2DQTL 3KYNB 4JE4B 4JHWH 3RY6A 1RURH 1M7IA 4JM2D 4MD4A 4XP4L 1U8QA 4HUWB 4ELME 5F7EH 1XH3B 4ODSL 4WW2A 5DC4B 3TN0A 4R97B 1AGCB 5J12C 3MRDB 4NN6C 5T5NG 2FJHA 1XGYH 5CJXC 4ZXBC 4MHHI 3JTTA 4NO3A 4PJFE 5D7IA 4NNYA 2NXYC 3P73A 2AQ1A 1WCQA 4OZFB 3PABB 4GSDL 4KH2A 4PRDA 3S3PA 2A2QT 4OCXL 4X5XA 3CGTA 3L3JA 1G7MA 1TPXC 1RUMH 1A3QA 4X5WA 4NNPL 3KPPA 3U7WH 2YD8A 3IF1A 4MCZA 2FX8H 4QKXB 4H0GA 4Y4KB 4F80A 3ARBC 3GMMB 1DBML 4JLRB 1P9MA 5HVWA 4TSAH 3TC9A 3IB4A 1KB9J 2GSIA 2O5XH 2MWCA 2AS5M 1UFUA 2RFXA 4TVPH 4BKLA 5DJ6A 1J7VR 2P48B 5MHSD 2ZCHH 3IT8D 1MHCA 3ECBB 5GRVL 4CBPA 4ZPTA 2CR6A 1GOFA 3FO9B 5GRWA 2NY7L 1HEZB 2FB4L 1KPVA 4Z76B 2NY1C 4PJ5A 4D8PA 1KENL 4NKIH 1NCAL 5HXMA 3SGJA 25C8L 1FYHB 1JGLL 3GEWB 2GEEA 4DK3A 3IU3A 1KUMA 1NCDL 1RMFL 2HT3D 3VFNB 4GSDH 1GHFH 4F3FA 1ZHKA 1IZKA 3H42L 2YPKA 1DBBL 3QIUA 5JMOC 3SO3C 5C3LD 4UQ3B 5DFWH 3R1GH 2PTVA 2XZQL 3MRNB 5D72L 5HTSA 3WUWG 4OQTA 5CJ5A 1TJIH 3PL6B 3QIWB 3WJJA 4KDVA 5BS0B 1EGJH 4PJ7A 3MNVA 3V6FB 2X10A 3ARDD 3PGCA 1JRHI 1CFNA 3F8UB 2CXGA 4JO1H 2NNAB 1O0VA 3PWJA 4MJID 2VB5A 4JFEE 5E6YA 3WFDL 4W6YB 2NY7H 4NFBA 3PF2A 4A6YA 1UG9A 4NRXB 1E4KC 1Z3GL 2HLFD 3DGGA 1KENH 2CRIA 3FTGA 3H9HB 3Q6FA 5DQJB 5L88L 1CDYA 1NCAH 3UJJL 3L5XH 4GKNA 3MCLH 4K8RD 5JIPA 1JGLH 1NL0L 4C56E 1NCDH 5FHAH 2UWEB 3QQ9D 1FFOA 3F12A 1EAPA 2ARWA 5DMGC 4Y16A 2EEDA 5DFTA 4I8DA 4UB0L 4EDXA 4OCSL 4PY8I 4R2GC 4B0MM 3JV6B 3CSYB 5MEQB 4TOYH 2XZQH 3E6HB 3I9GH 5FUOL 2GKIA 5B38A 2DQFB 4NKQB 4QF1A 5FHBL 5C09B 3ZE1F 4CU8A 4PP2B 3RTQD 1MLBA 1U8PA 4QYOA 3P30L 2NX5B 3N1MC 1AKJB 3TYFB 1FLTX 5FECB 4IRJA 1R3KA 3GSRA 3W9EB 2HFFA 1AJ7L 4EUPG 5CEYB 3ARFC 2GJZB 3WFDH 2XN9B 4N1HB 3BEWA 3MRLA 5DJCB 1Z3GH 1LD9A 2ZNWA 5C8JB 3TFKD 5EU6A 2VABB 4PJCE 4QO1A 1P1ZB 3MJ9A 3TBSB 3NIFF 3IRZA 3ULUF 3RP1A 2EDRA 2HG5B 4L29A 1IEBA 1N7MH 4WDIB 4QCIA 3ZE2F 4OCSH 5HHPB 4MA3A 3FN0H 2ZUVA 3T1FA 5A2IH 3C6LD 1MQ8A 4JQXA 3BE1L 4U1NA 1OOAA 4RMTA 1R3JA 3BEVA 2X4PB 4FQQB 1Y6KR 1WAAA 2IAMA 3J7HA 2MJWA 3FHQA 1NDMA 4JVWA 5JHLL 4UBDC 2BFVL 2CH8A 1K8IA 4Y5XB 3QEHB 3T0EA 5AD0B 5J6HB 4RAVB 1A6WL 3O6LH 3OQ3B 1FZKA 1IEAB 1U42A 3SOBH 4IDLA 4Y4HD 3E3QE 3M8OH 3B5TA 1KGCE 2VKWA 2IQ9L 2X4OB 3WLBB 1CGSH 4LHUA 2A6KA 3ZT5A 3BYTA 5BZWA 1UYWH 2YS4A 1GGIH 3QHFH 1CR9L 1SJEB 5B3JF 1NCUA 1V5JA 4Z7WF 5SWZA 1MF2H 2RBLA 1BJ1J 5FV2A 4RGNE 1OD9A 4OV5B 3HNTL 2F53D 3EYUH 1N59B 4S0TD 1ETZB 4O00A 3E8UH 1A6UL 2GQHA 1YNTB 2YBRB 3MLVH 5CILH 1AGEA 4NQDD 2R0ZH 4JM4H 2EDNA 4YWGH 2W0KA 4YBHA 5JHLH 1D6VL 4PJ8A 2BFVH 4ODVL 4OB5L 4LCWE 1LK3H 3DX9A 4Y7MA 1A4JA 1CL7H 4HGWB 5FOBA 1A1MB 1A6WH 2GTZA 3OKMB 4OFKA 2EZ0C 4OV6F 5DT1L 4TSBH 4JG1L 3PNWB 5IVXF 2ZUQB 5LVEA 3QAZB 1RJLA 5IHUL 3QUXD 1FHGA 1WV7T 3TIDB 4MB3A 4V1DD 5IW3A 1J5OL 4LSTH 3TNMA 2OZ4H 4M93B 4PY7B 1DFBL 3QISA 2BY2A 4QLRA 4FFYL 1MCCA 1YEKH 2R0WH 1NFIA 4UU9A 2EDKA 3OKOB 4LEOB 3AM8A 4LCCB 5E99L 3MA7A 5HHQB 5IHLB 1PAMA 4LKCA 1QSFE 2VDPL 1QEWB 1S7QB 1I4FB 4I0PD 3NAAH 3C5ZB 5BQ7A 3DUHA 1L4IA 5K9JH 4FP8H 4L9DA 4ODVH 4PJDA 3WNKA 3C60D 4MB4A 1ODAA 1ZGLA 4QHUA 4Z0BL 5B8CC 3ZT6A 4UINH 5F70A 4JPKH 1IZJA 4DW2H 5I15L 4F7PB 5IHUH 1JNHA 3VDAA 2YPLE 3D39B 1R3HA 3RWIA 2DIAA 2W0FB 4F57L 4ZFGL 5DUML 2QEJA 4YR6B 5C0IA 1Q9KA 5F9OH 4WFGE 4BYHA 5IROA 5E99H 2E3VA 4XH2A 4X0KA 2VDPH 5EBLB 2ADIA 1J11A 4F8QA 1G1YA 2CRYA 4ZUTB 4ELKB 5F1NB 1KLUA 4ZUVA 3UTSE 1OAXL 3ESVF 3IDNA 3WS6A 4YAQB 3ZYJA 4Y89A 4LPCA 3CH8A 1S7SA 3BD3A 4HFUL 4GKZA 4P23C 4P5MB 1R5IA 4D0DA 4ETQB 3Q1SH 2Z31A 5GRJH 1U36A 4IOSD 1T0PB 2VLKB 2WUCL 1I3RA 3IETB 1G7LB 3VGGA 3ARSA 1PKOA 3I6GA 5HHMD 3VW3H 4OZGE 4Q6YA 5DGQA 2BNQA 4HK0A 1PKQA 3PWPB 5IBTL 1E6OH 4Z5RB 1XZ0A 5K9KB 1MFBL 4LCYB 3V0VB 2EEAA 1W72A 1DANT 3F5WB 3CK0H 3FFDA 1MCIA 1VGEL 3QWRA 4R4BA 2VLJB 2E9JA 5EO9A 1N64L 4PJAE 2GCYB 1DVFD 2PCPB 1KCSH 3D9AL 2C1OB 4ZTPL 3IFPA 4ODXB 5ADOH 2FEDD 4QXWA 2R56H 1ZLWK 4WWID 4BZYA 5C6TL 1QLFA 1C16B 1OAXH 4Z6AT 3VXUE 3LKPB 5I16B 5BRZA 4HFUH 1I1FA 5IG7A 4OKDA 4ZMAT 3FQXA 3K7UA 1XFPA 1CVRA 4XNXH 3DX7B 3HUJF 1DUYB 3NTCL 1R5VB 3T65A 4OLYL 3OXSA 2QSVA 4HT1L 2V9TA 1LEIA 4K23L 2ZWLT 1HQRA 2BNRA 4G9FB 1OAZL 5IBTH 4JRXA 1JHTA 1OARH 2FX9L 1U8JA 1FFNA 5GSRA 1T1YA 2RHEA 1MFBH 2FLRT 3S97C 3IKCB 4D9RD 1FO0B 4KV5E 4P57A 3U6RA 2FSEB 3W9DA 1SY6A 1N64H 1AXSB 4ZTPH 4UOJA 2BZDA 4LDOB 3CSPA 5DF0A 5C6TH 4E42B 1KIQB 3EBAA 2VR4A 4AY0A 4LCUB 3BZEB 4YHKL 2AXJA 3L3HB 3WIIL 4JEGB 1X5XA 3RWFA 2JJWA 4L4VA 4UOW1 5INCB 2HVKA 4NUJA 2J88H 4HGMA 1FPTH 4NRYA 3LN5B 4P2RA 4KHXH 5EZLA 5TDOA 3O3DB 3NTCH 3BSZL 4HT1H 5HHOB 1FBIH 4G6MH 4NQVB 2WINA 3DJ9A 2BVPA 4MJ5B 2EDOA 2P24A 2R9HC 3DMMA 4JRYA 4L4JA 4YHZL 1U3JA 1NUGA 4Q58C 3SE3C 2Q6WB 5B4MC 1YN6A 3WKMH 4WU7B 4BH8B 4LRIA 5L8KB 4XBEL 1MAMH 4OJFH 2VLMD 5GRUH 1E27A 3UXFA 4HS3B 1IT9L 4CNIB 3BZ4A 4HUMB 4JZJB 4LPTA 1I1AB 2EYTA 4Z0XA 3VWKA 1J0IA 3SDCA 3N9GL 1T22B 3H8NA 3SKJL 2NR6D 1FVCA 1ZTXH 3WXVL 4Y5YB 3JWDL 2GJJA 3EO9L 2AKRA 3L3OB 4O9HL 4S1SL 1UXWB 1JJUA 2EH7L 5DVKA 3WIIH 3D85B 5KSBE 4OZHA 4GRMA 4LSQH 1XCQA 4ZSOB 4CGTA 3MV9E 3QFDA 4LVHB 5I1IL 1QFHA 3TIEB 2IALB 1TJGH 4GQ9L 2HMIC 4OCRL 4LP4A 1A3RH 3OKNB 1S7XA 2EDDA 4ODWB 3DXAE 3FZUD 3IJSA 1MWAB 4WUKH 3AXLA 1CGXA 3VXSA 2YD4A 3TA3C 1KB5A 3KJ6L 4S1DC 3G5VB 3QPQD 4O2FB 1N2RB 3SKJH 4C58B 4JFOB 3W0WD 2AK4B 3JWDH 4UV4L 4WV1C 4H1LG 2GT9A 4KI5E 1J1XH 1S78D 3EO9H 4GQPH 1G9EA 5J7CC 3MRGB 5FYJD 2R4SL 3RGVC 2EH7H 1VEPA 2FO1A 3UZEA 3ARXA 3BP6B 4HLJA 1RSFA 4U49A 5E8PA 3TO4D 4X7DC 4KJQD 1FRGH 2CDFA 1U3YA 3GO1L 3ILQD 4GAJL 2BY1A 2KZ1B 4N8VA 2XWJB 4OUUB 1I8KA 3BKCH 4Y2OA 3RNKB 3VDCA 4ISVA 3NFNB 4GQ9H 5HHVL 1YMMD 2MCG1 4FTVA 1H3UA 2ZOKB 2G5BA 3UTZB 2OL3B 4NHUB 4I18B 5ADPH 2CD0A 2QQKH 4PJHA 3O0RH 4FQHA 2DLTA 1MFNA 4XBPB 1VKXB 1RJYB 4FZEH 1MIMH 3BPOC 3KJ6H 4WU5B 4TUOB 5HDQH 5IB1A 2PN5A 2XTJC 5JHDE 3ULVF 3IFOA 5L2JB 3VFGL 5KSUB 1NBZB 4BFEA 4Y4KC 2JF1A 1W0WA 1F2XK 3BPLB 3WUWB 1F11B 4N0UE 3VFPA 1JHLH 1G84A 1OSPL 2F54B 2EDXA 1XCTB 3TCXA 4ZXBD 3WFBH 2CXKA 3RJQB 2R29H 2WMPA 5EUKA 5EG6C 3S88H 1D5ZB 5SX4I 4PBWD 2NXYD 4G43A 5J0BA 3QQ3A 4GKSB 3QO1A 3U0TA 1PD6A 4NO0A 3RIAK 1B4JL 2K3TA 3KPSA 1J1PL 3EHBC 3QUZB 1WF5A 2WQRA 4XAKD 3O6FD 4AT6B 1Q72L 1MJ7L 4XVSH 2G2RA 3CFDB 3ARBD 4S1QL 1FNHA 4I0KA 4KRPB 4OGYL 4KWUA 4XXCC 1INQB 3HZKB 1Z6JT 2ICCA 1GC1H 5FK9A 1JWSA 2EXYC 4ZFFA 4RISL 3P4MA 3OKEA 3VFGH 2E8YA 4U7MA 4UNVA 1F3DJ 3PL6C 3T2NL 4MCYB 2PR4H 4YHML 4XTRC 1ACYL 5IK3A 4XP9L 4JO4L 5MERA 2NY1D 4ZOCA 1WISA 1QKZL 4M4PA 1P7KA 1T1XB 2F74B 4HF5L 2OSLA 1XR9B 1NAKL 3TBVB 5HYSB 4WWKA 1Q94B 3EOAB 4EUPB 1WWWX 2AXFA 4D2NA 5ECJE 2R23A 1G6RH 1P7QD 1J1PH 4LMQI 5DLML 1QTYT 4MXWH 3IGAB 4M6MH 3TT3L 2EH8L 1QNZL 2PNDA 4YDJB 4R0LB 4GUPA 4YZFF 2WWMC 1MJ7H 2R1WA 1WBZA 5CEXA 5I0ZA 3QNYB 5T33H 1QFWH 2IPUG 3L9RB 1XF5B 5DEGA 5KVFL 5E2JA 3L5IA 1JWUA 1MCFA 3MV11 3PWUB 4PFEA 2Y5TA 3VI3F 1ACYH 1GZQA 4Z7UE 1PSKL 2XG5A 3UDWC 5HD8C 5FKPB 1SJHB 5J1AB 3ROOA 2VAAA 1AXTL 4HF5H 2IEPA 3NMEA 3DV6B 4Y2DB 4B41A 5ANMA 5F6IC 2DTSA 4Q6IA 1T0NB 4DZBA 1LNUB 4WCYL 3S98A 2IADA 4Z7OE 5DMGD 1H3GA 1FYTE 4U1IB 2XPGB 1IM9D 1QNZH 3CU7A 1AGDB 1V7NH 4R2GD 4AG4H 3U9PH 4Z7QE 4HUXA 3KAAA 3ETBF 2NTFA 4G5ZH 5SWSB 4H0IA 1BZ9B 3SDDB 5KVFH 2W0PA 3T0AA 2FECL 1YYMH 4XPAL 5AZEL 1VCAA 2DMBA 1P2CA 4ENEC 1FGNH 2WANA 3NIGF 1GC1C 1YDPA 4TVPD 5EO1A 3RWDA 5E9DE 2YA1A 5DYOB 1J8HB 3O41A 4XNMB 3TWCL 1H0DA 5J6GB 5DMIL 2NXZB 1D9KC 3EYVB 3NH7L 3CAFA 4MNGB 3KG5A 1AXTH 1CVSC 1H5BA 1QBLL 4Y5XC 3SKNB 3DTXA 3K46A 3O3EB 1JGDA 3DIFA 4GFTB 1CU4L 5HI4C 2IF7A 2ED9A 1I7TA 2YRLA 2DQDH 4PJBF 1OVZA 5FYKH 4ORGA 2ZJSL 3P9LB 4HWEL 4UNTA 4WHTA 1LHZA 4FMKA 2EE2A 3AS1A 3P4OB 1YUHA 5B38G 3VXMB 2Z35A 3HMXA 4OAWB 1DANU 4UBDD 5FDWA 5ID0B 4WTZA 3HR5B 4NQDA 3E2HB 4HFWB 5GRYA 1QBAA 4M43L 3DBXB 4UTAL 1DDHA 3BKML 2DQHH 3NH7H 1MAKA 3OJVC 4PJXB 3V2AR 5CINL 3PHOA 3T3ME 1BVKA 1CU4H 3DYOA 2H45A 1KFAL 5F7KC 3TBTB 1WC7B 3BPCB 4JFYA 2ZUQC 3MV7B 3QAZC 3ZT7A 3UJIL 1F5WA 4HJJL 3G6AB 4ODBD 3KXFA 3MXVL 4BZ2L 2H32A 1H8SA 2A73B 1OAQL 4M93C 5ISZA 1QPXA 1UB6B 3MO1B 3BMVA 2OJEB 4PGZA 4O2CB 1E28A 4NQTA 5D9SA 3F7QA 3MLTA 5C0DA 5E2TH 4LCCC 2BERA 1F3RB 4I0PA 1BOGA 4PGJA 5JNYB 4X4XB 3BIKB 1UEMA 2EZ0D 4RGMC 2EDHA 3VFMA 3KYMA 4UTAH 3CCHA 3BKMH 4TULH 3S37X 2VXSH 3MYJA 3TCLA 3SGKC 3F58L 4MB5A 1N8ZB 4KXZI 5EZOL 2BVUA 3QEUA 4K3JL 3D3VD 3STZA 2B4CC 1PQZA 4DQOH 3QXDB 3H9YA 4L4TE 5EUOB 5IJKA 1EXUB 3V5KA 3BWAB 3JWOL 2QKIB 5IVXA 4HJJH 2X70B 3U46B 4BZ2H 3RAJL 4FQJL 4R3SA 5AYQA 1OAQH 5TDNB 4WEUD 4QRSB 3INUL 3HPLA 3UTQA 1B0RB 3BQUA 3KPLB 1K85A 2XFXA 4HPYL 1DLHA 4NZUL 3MLYL 4I13B 1IFHH 2VDRH 2VQ1A 4WHDA 4UMGA 3CLFL 3QDGB 5KG9B 4AEHL 3I3DA 4YDIL 3SEPA 3SGDH 4HCRA 3I3EA 2GJ6B 1RZGA 2C7UB 5LCVL 4PV8A 1WEJH 4XT1C 4NCC1 2Y7QA 2XXCB 1OCWL 5AUMA 1RJZB 3DRTA 5DC9B 3MUHL 2EE3A 2FRGP 2JJTC 3IDGA 3U82B 1NBQA 3JWOH 4APQC 4KHTL 3RAJH 4FQJH 4PJIB 4I0CC 1S5HB 3QUYA 1Y18A 4GAFB 1U8NB 4GW5B 2W1NA 4PUBL 1ZA3B 2NY5L 3N06B 5IWLC 4PJEF 4RFOH 2VERN 3KYOA 2P5ED 2GTWA 5K9QG 4K94C 4GG6F 1HIML 4NKMA 1DL7L 3VGDA 5INDB 1QRNA 1L9MA 1KCLA 2P7TB 4AEHH 2YD3A 1ZXQA 4YDIH 2BNUB 2R2BA 3GHBL 1XR8B 4FZ8L 1NCWL 3GSOB 4P23D 5D6DC 4MHHG 5DURD 2Y25A 3LD8B 5HVFB 5EOTB 3FT3A 1WWBX 5CBAA 1AE6H 1OCWH 1QBML 3FRPA 3TBWA 3KWWA 2DYPB 3G04A 4MLSA 4AM0B 1JYNA 4P49A 3BPNB 5F89A 5E70A 2VRAA 1A9EB 1X6NA 5IB4A 5DJZB 3MOQA 2DS4A 1LE9B 1X9QA 3GBNH 1MREH 1BQSA 2N7AA 3DVGB 5F1IB 3MUGA 5J1SC 4XCFL 2HYMA 1C5DA 4LPWA 1LWRA 3FO0H 3OBAA 3HG1D 1ZT1B 4MAYB 1UZ6F 2JJUA 2ZCLL 3IDIB 1EDQA 1TQBC 4PB9H 4EN3A 1N3NA 1J0ZA 1BVLA 3GHBH 3MGAA 1UH3A 3IS1X 1QQDB 1KJ2H 4YUEL 1GJIA 3GJFH 3GNMH 4MMZC 4G8EA 4KGJA 4PG9B 3CH1B 3FB8B 3WN5B 4G7YL 4ZYKB 4KGLA 3EDJA 5GJSH 4R26L 5ESAB 5BW7A 5MENE 1VFBA 3TVMB 1IRAY 3WNLA 3DLQR 3CVHA 5TFSH 3PWVB 4I3SH 4NBYB 4ALAL 1N6UA 3BRGC 2CUMA 3VFVB 3MR9A 1KN2L 3RWGA 2QQLL 3QWQB 5ALCH 3A67H 1J0KA 1I1AC 1JI2A 3LRGA 2AAVA 4PGDB 2ZCLH 2P42B 3FT4A 4HIIB 1NGZB 4TPRH 1FAIL 2YRZA 4H1LB 4ZFZA 4E41E 2QLVB 4WI2A 4YUEH 3BP7A 3RUGF 4L8DA 4XXDB 2Z93B 2DJUA 4L9LC 4MDJA 4IS6A 2R9HD