1CGSL

Local and transmitted conformational changes on complexation of an anti-sweetener fab
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
ELVMTQSPLSLPVSLGDQASISCRPSQSLVHSNGNTYLHWYLQKPGQSPKLLIYRVSNRFSGVPDRFSGSGSGTAFTLKISRVEAEDLGVYFCSQGTHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG2B-KAPPA NC6.8 FAB (LIGHT CHAIN)
publication title Local and transmitted conformational changes on complexation of an anti-sweetener Fab.
pubmed doi rcsb
source organism Mus musculus
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgsL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgsL01
5EO9A 3V4VL 4H0IA 1L0QA 4OZHE 1JPTL 2NXZC 2VISA 3O3UN 4GRLA 2VSCA 3CJJA 2Z9TA 3C60B 1V3MA 5MP6L 3MLRH 1KJMA 4HUXB 5C08A 3BAEH 1W0VB 4A6YB 4POZD 1HH9B 4D2NA 4OD2A 1JWSB 4CL7A 1NAKH 1U95B 4YC2B 4EUPG 4F7TA 3M17A 3S36X 4FP8L 4GKNB 4DVBA 2EXYD 3ZE2E 2NY2C 2WM0A 1ZANL 3CFBA 5F8RC 3UXFA 4XNQB 4QOKA 2UZXB 4JQVC 1MNUH 1NGYA 2ERJB 2H9GB 4TUOA 1ZT1B 2ZPKL 3MACH 2KBGA 2W65B 2IPKA 2HG5A 3HUJA 2ADGA 1YEIL 1ZEAH 4PJCE 1JHLL 1XH3A 1J12A 2MHAA 3GB7A 2V7HB 1XIWC 3QNZB 1FNAA 1FZJB 3SQOH 5IW1A 1TQCC 2AJXL 1Z5LB 1U3HD 4Y5YA 1ZXQA 3ULSB 4PRIB 4DAGL 3O2DH 5C9JB 1E0OB 3TIDA 1WFOA 2H2SD 4LPUA 1RZIB 4ZUSB 4X0KA 1M4KA 2M26A 1VFBB 2V2XA 5K9QI 1KOAA 2A6JB 3SE3C 1RJZA 3QJFB 1SQ2N 4H1LA 4XPFL 1BQSA 3WUWG 5C6WH 3T4YB 4PV9A 1AHWA 1RK0A 1FCCA 3I50L 4WFEE 1MCJA 3FT2B 1KG0A 2GUOA 4PV8A 5D4QA 1TIUA 2CDGA 4XBGB 5IVNA 2OI9C 2X5PA 2NX5B 5LBSH 2NY1B 1P1ZB 2OP4H 3ULVD 4LLAA 4PLKD 1I7TB 1CGWA 4XVSL 4LLYA 3MRIB 1XGTA 3DUSB 5D6CA 5EDXA 3FMGL 3HRPA 3BHBA 3GIZL 4PRIE 3HZMB 1T1XA 4X98B 1MOEA 2R29L 3AMLA 4OBSA 4M6OH 4WV1B 1YMMB 2FJHB 4G7VL 1P7QD 3DGGA 2HTKD 1F45A 2VIRB 1QBLL 1XGPA 1ND0A 1V05A 2WAHA 5CJXC 1DQMH 1HINH 3MRJA 3D1MC 4M61B 3GSNH 1WWWX 2IADA 4RGOH 5KVDL 1A6UL 5K9OA 4HV8B 1HI6B 1Q94B 3L9RA 1BVLA 4HBCH 4JZNB 2W1NA 1H3PH 3S8WA 4PGEB 4PJXF 4Y2DB 1KCVH 3HB3C 2NX5E 2ZSVB 4NZRH 1MCCA 1AGBB 3KJ6L 3NIFE 4HDIB 2EIEA 2B39A 2N7BA 4QRTA 3T77B 1I9RH 1EJOL 4DW2H 5ALBL 1PSKH 4HC1L 1TQBB 1TTGA 5HHVL 4P9HH 4XPTL 1G7IB 3FTGA 4J4PA 2AQ2A 2YPKA 1LK3L 3BYYA 3LH2H 3F7VA 4I3SH 1YMME 3VCLB 4K7FA 1OGAD 3GI9L 3KXFB 5F93C 3IDNA 5FO9B 3LS5H 1P7HL 2GCYA 1T66C 3F58L 1UVQB 3VXSA 1UCTA 5KN5A 4YFLF 5C0RL 1HWHB 1DEEA 1A6AA 5E8NA 3MCG1 4I2XB 4QXGH 1A4JA 5FXCH 2EZ0D 5EZOH 3QXUA 4MB3A 4U2ZA 3WFDH 1NLDL 5DD5H 4KH2A 3L7EA 3ARED 3IU3A 2XWBA 4CVWA 3IGAB 3Q0HA 4QGTA 4F7PB 2BXZA 1NLBL 1UWEL 2AJ3A 1QACA 1J8HB 3SPVA 3VXTA 1AO7B 5LGHH 4NCC1 5EBLB 1S9WA 2QHRH 3ECBA 1FO0A 1P6FA 5D71L 4KK5D 2LE9A 1NUFA 1J1PH 1V7NH 2Y1VA 3RVTD 4DUWA 1HCFX 1S7VA 1T20A 3BD4A 3GZKA 1YNLH 5GS0C 4NQEA 1BQHB 1JK8B 4I2XE 2B8OT 2FLBT 5F7EL 3CXDH 1CK0L 1TJIH 4RFNC 1ZLUH 4P4KC 5JORB 4WI5A 1MI5B 4IMLA 2FB4L 1D7FA 4Z7OE 4V1DD 1KIQB 4HEPG 4S2SB 5E6IA 1PEWA 4W81A 3QUZB 3HPLB 5AWNL 1J8HE 3QUKB 4OAWA 5L88H 4DN4L 1AO7E 3QWRD 3OJDA 1CE1L 4XC3L 1JZ4A 1F97A 1IAOA 1O7SA 5C0AD 3ILQC 3IAQA 4PRAB 5EZIL 4N0CC 5M95B 3MOBL 4KHXH 3L3OA 1UYWH 2EDDA 3BP5A 3X11B 1Q0YH 3L1OL 3FL7A 4BSWB 4NN7C 1OWRM 1WCQA 1FL5A 1ZVHA 5TPWH 2XI9A 4LSRL 4MJIB 2F53D 1NBYA 1HHGA 4J12A 4ZS6C 2CDEA 1CXLA 1G7JB 2W9DL 3CU1A 1RUAH 3WCYA 4UDTB 4FMKA 4H8WH 2E8ZA 1F11A 3F7YB 3KWWA 4DZ8B 3OPZL 5B38G 2BY3A 1MJ8L 1CU4H 1B0GA 1HOCB 1JGUH 4NJ9H 2WQ8A 1NEZG 4NQSB 4WI4A 5EA0H 4F15C 2BNQA 2X4PB 4FXGA 3MBXH 3THML 1N8ZB 4JFDB 3Q5YA 3ORJA 5BV7H 4L8DB 3O0RL 3FRUB 1A6VH 4HS8L 1U8NB 3CFJB 3L3JB 2A74B 4WO4A 3NGBC 4LEXH 4JHAH 5DWUH 3UO1H 3B2VL 3BRFA 2GFBA 1A7RL 2HN7B 2P5EB 3CDGB 2RHEA 3V6ZB 1FIEA 1ACZA 4KXZH 4U6TA 2WW8A 2B2XH 4MJIE 4QXTB 2AEQH 5ENWA 5DJDA 4GO6B 5F71A 3T2NH 3MLUH 3U4AA 4JPWH 3TBTA 4ISVB 1YY9C 4RMVA 3GRWH 3Q48A 4I3GA 4DGVL 5DURB 3HE6D 5JW4R 3NCBB 1L6ZA 4S1RH 5A43C 4M6ML 4G8FB 2OMNA 2H26B 5INCA 4IRJC 1EGJH 2IAMD 5HGDB 4OI8A 4KZDL 5CIPH 4L4TA 5FKAB 4CU7A 4JFDE 4EI5D 1W0YT 4QHLA 4UOW1 5KJRL 3DO7A 1U8LB 4S11A 5CILH 1WTLA 4NGHL 3LDBC 1BWWA 4JY6B 4M7KL 3RPIA 1M6OA 1XR8A 3TP4A 4LLUA 4P9HC 3MJ9L 3P4LA 3OHXA 4M48H 1TETL 1WIUA 2P5EE 2VYRE 1ZSDA 2YKLH 5JMRA 1OAUL 1RZJH 4G3YL 4R7NB 5H2BB 5BZWB 4DTGH 1LEIB 5FYLH 4HIXH 3P77A 1BZQK 4RGND 3BPCB 2BVPB 4YE4L 1CGYA 4YK4C 3B9AA 4JANB 4PP1C 3QNYB 4NBZB 5IVZB 2VITB 5TE7L 5F1IB 3RTQC 1YYLL 5TFSH 1OWWA 2F53E 5DJCA 1NEUA 2D7PA 1S7XB 2J8UE 1BD2D 3L5XL 1D5BB 1VGKA 5K33A 1I8IB 3EZJB 4GAJH 4ZPTB 1CTNA 4NJAL 1UWGL 5LQBH 1FYTB 2PYED 2VJXA 1T2QL 4JE4B 3B2UD 3IFOB 3C08L 4CGTA 1A1MA 1CFSA 5TDOA 2C26A 4NM4H 4U6XA 1NAMB 5BS0B 2XXMB 5KTEH 3G5YB 4UT9L 1MY7A 3GFUA 4DZBB 3QEQB 4NO0A 5C0IB 1G9NC 4GKOA 1I1AB 4OZHA 5C0EB 3TO4B 1QBAA 3ARSA 2F5AH 2Q8BL 3OAUL 4WCYL 4XVJL 3TA3A 4YHML 1IRAY 4F7CA 4WW1B 1CFBA 2XNAA 3FQWA 4ZFGL 4YBLC 1K4CB 2DWEA 4WUUA 4KTEH 1ORSA 4B7LA 3ARFB 2IQ9H 4LLMA 5DHVH 5CEYA 1QO3A 4IOIA 4E42A 1IGCH 2VQUA 2X89A 4EI6B 5IEKA 1NMCB 1AGFB 4Y1AD 4Z7WF 5ESQB 1UXSA 3RIFK 5LGJA 1I3GL 4MD5B 3STZA 4QF1A 2UY7A 4GS7C 1IQDA 1I7ZA 2YK1H 1FYTE 5JXEC 2ZSWA 1JF1B 1Y18B 2NY6D 1NGQH 4FQXD 2J2ZA 4YDKH 5GIRA 4IDJH 2R8SL 4Z0BH 5BS0E 1U58B 1ZA3A 3OWEA 5DA4A 5C71A 5C92A 1EEYA 3W9DA 1G1CA 4WEUD 4BFGA 2JIXD 4G6AC 4BJLA 3KPQB 3ARGB 3QEQE 5DVOA 2ARJQ 4TSBL 3RY4A 3QNXA 2HT3D 2PXYB 4Z5RB 4OLYL 4DKFH 3O81A 3C60A 4LAQL 1W0WB 1U0QA 2NPLX 1JI2A 3OKEA 3UBXI 1PLGH 4ZAKB 4XAKE 3AROA 3G9VA 2ICCA 2X4RB 3BJLA 2XTLA 1CFVH 1TJHL 3LRSA 3I3BA 3DROA 2V2WB 5J89A 3TFKC 4H8WC 3L5WB 3FQTA 5F1NA 3I02B 2W92A 2EKJA 3PGFL 4PJAA 4L29B 1DBJL 3STLB 5ID1B 1CTOA 1IEBA 4L8CA 3BT2L 2H9GA 3L95B 4K55A 5LCVL 2W65A 4TSAL 1HIML 1MFBH 3GUTA 2JTDA 5IFAH 2P5WB 2PYEE 1CXHA 5FV1L 3HUJF 5F96L 5BV7C 2V7HA 2WLYA 4YJZL 3TV3L 2DICA 3PWPA 3RGVB 1J11A 1GSMA 1AR2A 4KROB 3ROOA 4YDJA 1FBIL 3WJJA 4HG4K 2ITCB 3S9DB 1UQSB 1NBVH 1FSKB 1YEEL 3JWOH 1P4LA 1L9NA 1IAMA 3CSYA 1OQXA 5DRWA 5BW7A 4HUWA 1FVDB 4AEHH 3RIFF 3NH7H 4I0PC 3D3VD 4ODVH 4CN1A 1RJCA 4O02H 2XY1A 4OQ1A 4LCCB 5GRUH 3EYOB 2HKHH 1IC7H 2WV3A 2DQDL 4O2EA 3SGJC 1FN4B 2NY3C 3KNBA 4MXQD 5FB8B 5DMYA 2YZ8A 3BJ91 1KLFA 2DM4A 4PRBB 4XBGA 3FN3A 2NZ9D 3IFNH 2NY0C 1I7TA 1QBMH 2VXQH 5TE4H 2P46B 3LPFA 3PL6D 3WHE1 4O4YL 4XRCA 4OIIH 2BX5A 4XP1L 4ETYA 1RZJC 4X7SL 3RUGE 3O6KL 1AY1L 2FD6H 4GJTB 5JOFB 1A3LL 3X14B 2R1WA 5HYJD 4XXDA 5CJ8A 2EYTB 4BFBD 3CXHJ 1U3HA 3DRTB 3KG5A 3P9LB 1N64H 2XZQH 3WDIA 1JUFA 3PHSA 3BH8A 4J2XA 4X9BA 3KHQA 1ZHKB 3MXVL 2YD1A 3QRGL 4L4VB 4HV8A 4FQPA 4JZNA 4G8IB 4OQTA 3T0AA 3GSQA 1MFDH 3FCTA 1D6VL 2P8MB 5HHNB 2HKFH 5FDYA 3MRHA 2W60A 3U46B 4UIMB 1S7UB 4HJGB 4HK0A 4ZQKA 5TDNB 3WIIL 1AH1A 3H9HB 3E0GA 1T7XA 4BQCA 3OX8A 4FQ1L 1KB5H 2E7BA 4M7LT 3WNKA 5TQ2L 2VC2H 1JPST 3M8OH 3BAEL 2UUDK 4R0LB 4EUPH 5GSRA 2EIBA 5IMLB 5GS0L 1VA9A 1NAKL 4BK5A 4YFDB 1EAPA 2J6EA 3U7WL 2EDYA 5GJSL 3QJHB 2H32A 1LO2L 1M7DB 4I2XA 3FFCB 1P7QA 1N0LA 4L4VE 4WI9A 3HAEA 5IMMA 5JO5B 2VDMH 3MACL 5D96C 2OR8A 1YECH 1U91B 4BZ2L 4WHTB 3SDAD 4IRSC 1IGMH 3QPQC 5L2KD 3EOYG 4NKDB 4L3CA 5D9SB 3IDJB 2YBRB 2VL4A 4ONHB 3SQOL 2VDOL 3BESR 5C8JA 1KNOB 5HGAB 3V5KB 1MCHA 2L7UA 4NC0B 2YRLA 2FYYB 1LVEA 2A6IB 1M1SA 2DKSA 2JB5H 4R8WH 2CJUH 1JTPA 1L7TH 1UACL 4QWWD 2C1OB 4Y16B 5TH2B 1ZOXA 5IEHB 1CICC 4AT6A 1NC4D 2NNAB 1KFAL 4QCIB 3V6OE 3EJZD 2JJUA 1I85A 1G9EA 3PNWA 1OGAA 3FFCE 1NCTA 2EICA 2RB8A 4P2YA 1P84J 4XHJC 1WITA 2MQCA 3O4LE 5D5MA 1IM3B 3BZDA 1UB6A 1KIQA 4X9GA 3DUUB 4OI9A 2W9EL 4XNMB 1H9VA 5INDA 2XTJB 1J5OL 1RFDH 3AREA 2ICES 5J13C 1OP5H 2CDFB 3RPKA 2XV6B 2DDQH 2WWKT 5DQJB 3FQXB 4TSCL 4M6OL 4YX2H 1C5DA 3NCEB 2HRPL 5E8EB 5JTWA 1KC5H 5K9JH 4Q9RL 2EDNA 4CNIA 4RBPK 5IT2H 3LD8B 4KC3B 1RD6A 3IT8D 2FHCA 3BP7A 4JJHA 5CZVH 5JOEA 3T65B 3QDMB 4FFVC 3U0TB 2BNUA 4IM8A 4UDTA 4KKCD 2IG2L 3BZ4B 1KN2H 4DZ8A 5E6ZA 1W72B 3EYQC 2F19H 1H3PL 2VR5A 4MAYD 3U9PH 4ODHL 3VFNB 1KCVL 3QO0B 5H94B 3H9ZA 4KRPD 4YHOH 2WUCH 3WFBH 5HD8C 2XTJE 4NQSA 3O9WD 3UAJC 2DLIA 2Z4QA 4IS6A 2OL3B 3VWKC 3OTTA 4V1DA 5D7SL 1ZHBB 5IBTL 4YXHL 4DW2L 2CKBH 4L8DA 4N0UA 3FRUA 1EHLH 3CFJA 3FO9B 4P9HL 1GVIA 2OCFD 2PUQT 4P5TB 1BFOA 1T0MB 5F7DA 3S5LB 3IJSB 3TWCH 1VKXB 2VH5H 4LDOB 5A40E 1CDYA 3HC0B 3G6JF 3V6ZA 3O3DA 1R3JA 3AFLA 1BQHG 4KI5D 4LLVA 2O5XH 2DQHH 2ARJA 1VENA 4ZOAA 3REWA 3QDME 4MZ3A 1JPSH 4OCNC 4ERSL 1HDMA 2GEEA 1ACYH 4ODWA 1FNSH 1J18A 5I73B 4LCIH 3RWIA 3VGAB 3BKMH 5KW9H 2K1MA 2F53A 3CFDA 1QA9A 4MA8H 2J8UA 5ERWB 1A3RH 1EAJA 3LKNB 5FUZL 3CUPB 1REIA 4U6YB 5LWYL 4YHZL 3VD7A 1OAXH 5BRZD 3QG6B 5FKAA 1LE5B 1VFUA 3C09B 4YH6A 4ZDHB 1N6UA 1U8LA 3DBXA 4PP2B 4RCAA 1G84A 1G9NL 2PYFB 2NTFB 5I1CL 4Z7VE 1J1PL 1FGNL 4U1LA 2DTMH 2FDBP 2NCMA 2YD8A 1HXMA 5GGSY 1MHCB 1BMGA 1U8QA 2NY4B 3CSBA 1LEIA 2J4WH 1HEZA 3CDFA 1KYOJ 5FO8B 2BVPA 3UTZA 4PGBB 3MREB 1YPZF 3MGAA 3UYPA 3CXDL 2C9AA 1WJ3A 2VXTH 3QDGD 4P2QB 5FHAH 2PCPA 1F4HA 5F1IA 3BX7C 1IC4H 1IKFH 3WNOA 4OLVH 5JA8B 4OSUH 1S7XA 3OB0K 2XPGB 1I8IA 1CIUA 3AUVA 2Z8VC 2GT9B 3BH9B 1RJYB 2YWYA 5E8PB 4X6DE 1LNUB 1R5VA 1IARB 3G5YA 4LKXB 2VLMD 5GISH 4OIAA 4DZBA 1KUMA 1VADB 2R9HD 4KHXL 4EI5A 5CBAA 2BSSB 5EIIA 1S7WB 5IBLD 4TQEL 3ZT7A 4X99A 4HUVB 5HJ3A 3RWDB 3LKQA 1YNKL 4HKXB 1QFUH 3GMMA 1R0AH 1NMBL 1K4CA 2X4OA 2F54D 2CXGA 4P2QE 1JNHA 3IU4H 4AENB 3RNKB 1DDHB 4KY1L 2R2EB 4MNQD 4H8WL 5E8DH 3K8LA 4FHBD 4M1DH 4D0CB 4EN3D 4MS8D 5C0JA 4P0DA 4LSVH 5ESQA 3EOBB 3GMLA 4KRNA 4LCUB 4U6VH 1DFBL 2QQLL 4IMKC 4KDTA 1JGUL 3HE7B 2PN5A 2I9TA 2LQRA 1G7QA 3O3AB 3W11C 3MXWL 2FX9L 1BD2A 1U58A 1IAKA 1FAIL 5BV7L 5JOPD 1A6VL 4P9MH 5DMKA 4HWUA 5T3XD 1BQLL 2PYEA 4G6FD 5HI3D 4LEXL 4JHAL 3V5HA 1T7ZA 1P9MA 2ID5A 3WO4C 5FA4A 3G6JB 3I6LD 1CGTA 1JRHL 1YYML 2CPCA 3MBEC 3AVEA 2R69L 1W0WA 3EYSL 3PE9A 2PETA 3WUZA 4O51A 4Z7UA 2AEQL 3V0AC 1KTDA 3T2NL 4ZAKA 2FEEL 4MX7B 2J8HA 4JPWL 2X4RA 2FX7L 1KPRA 1PQZB 2C4XA 3MUGA 1QSZA 4FQCL 5AG9A 3IS1X 5EU4A 4TULL 1A14L 3OR7B 4GRWF 2BVYA 3DETC 1WQVT 1FORH 2VAAB 4GW4B 1RUKH 3RKDD 3WIHA 4OTXH 4P4RB 4Y19D 4ELKB 3MCLL 2Y36H 4M7JL 2DQUH 4JY4A 3NIDF 4Y1AA 2VQTA 5DJ8B 1CDUA 4ZOEA 2R56H 2M8XA 4FFYL 3RWHB 3S3JA 1BAFH 1X7QB 3ARDB 1JZ5A 4OZIF 4QRQA 4FQXA 2DB8A 2P24A 4U7SA 1MLBA 1A5FH 3G6JE 5D2NE 2ICWA 1DVFD 1ZT7A 4NQUA 5DJ2A 5F89B 3HMXL 5D72H 4OZFB 1RZJL 4HGKC 2R0LL 3MNVA 4DTGL 5I2IA 2JIXA 2GW5A 3CPLB 1TZIA 4OB5H 4Q7DA 3LV3B 2EC8A 3RUGA 2DKMA 2EDLA 1AFVH 1YPZB 2HFTA 1FVDA 4G9DA 1F3RB 4YHPB 3OAYK 4JO3L 1I8MA 2PW1B 3SGEI 3HI1B 5C7XL 5SWSD 1ZA6B 5HDLA 1FYHB 3B8YA 2OJEB 5IW6A 1MFAH 43C9A 2DMKA 1XCTA 1JWMB 1FN4A 2FIKB 5FF6B 4JDZA 4X6BB 5DLMH 4GAJL 4MNQE 4RISH 4X5WB 4XCEA 3DNKA 5L7XH 3G6DH 4OFPA 3QQ9C 5FB8A 4HIIA 1P7KA 2WBJC 1I1FB 3VDBA 5FYKU 4JN1L 3A6BH 1KEMH 1ZVYA 2OMBA 1KCKA 4D9LL 4NRXA 3CVIH 3GM0A 1FCGA 32C2A 4H25A 4JG1L 1ES0A 3SDDC 3S88L 4FQQB 5CP7B 2C3XA 2E6QA 2F5AL 3DURB 5HGBB 3B4NA 2IQAA 1NUNB 2A6KA 1FL6B 2DQFA 3IFPB 3R06B 2AQ3A 2XKNB 4LF3B 1WZKA 1YPZE 4YGVA 1MCOH 4QTIH 2X4NA 2IQ9L 1A9EB 4WW2C 1WSST 4PB0L 5I8OH 2EYTA 4APQD 2Y23A 1CVSC 1J1OH 5T1MB 4JRXB 1AGCB 4PR5B 3DTXB 5AYUL 4CUCA 1GGBL 2FRGP 1XCQB 5GGUA 4LVHB 4LQFL 3GSWB 2YK1L 3D3VA 3V7MA 2O61A 2D31A 1V7MH 3M1BB 4L4VA 1VGEH 3MCKA 5DSCB 2YWZA 4MLIA 3HI5H 1IGYB 3VD4A 4WU5B 5CWSB 3CXHK 2GJZB 3ALXA 5DXWA 4Y19E 4E41D 2X7LB 1SYSB 4UIMA 1S7UA 4L5FH 4R2GB 5ADPH 1DQTA 3SDXB 3RZCC 2E3VA 3H9HA 4QRPB 5IB1B 1UFUA 4NKOA 3TYGH 1FFQA 4K7PL 4RAUA 1PLGL 1G9MH 1WTGT 4MNGA 1A6TB 4MVBD 3FB5B 3UBXB 3X12A 5DJZB 2Z31C 5JA9A 5EPMA 2HJKA 4WFGE 4JRXE 1G7HB 1OSPH 4GRWB 4FFWD 4WGWB 2MCPH 1A9BB 5C86A 3WDJA 2ITDB 4DWHA 3EFDH 1M7DA 3DXAD 5CGMA 4AIZB 3FFCA 4PJHF 4QHUB 1TVBA 3RL2A 2K7QA 2X4UA 4AM0A 1AGEB 3O4LA 1EUUA 1MFBL 1JWUB 1UM5H 1X4ZA 4JFEB 5IFAL 1DCLA 3IDJA 3TBSB 3SDXE 5KVFL 3H3PH 2Z8WC 2X4QA 5DRZA 2V9QA 3OGCB 4PREA 4QRPE 1DJSA 3VGHA 3OKYA 1NBVL 2GK2A 2A6IA 1KT2B 2X9YA 5DK0A 4Z18A 3VFVB 2GY7B 5D6DA 3U0WH 4MGXA 4NBXB 4Y4KD 2A9NH 5E2WH 2G9HB 4ODVL 3RJDA 4O02L 2NNAA 2B5IC 3ZKNC 1I8LC 4GRWE 4P2OC 4WEBH 5GRUL 3P4NA 4CVZB 1KCUL 3MLPA 3IVKB 3O6FB 2HKHL 3HCVA 3QA3B 3LQMA 3GBNL 1OTTC 1AR1C 3WE6B 1N4XL 5ID0B 3U2SA 3NIDE 3EDJA 1DQJA 4IIQB 4M7ZC 2CRZA 3BDBA 2P47B 3NOIA 3NPSB 3F8UB 4NSKB 4JFEE 3DUUA 1DBAH 5D5MF 4OFVA 1K8DB 1SYVB 3EO1A 3MGTB 1NMAL 2RR3A 4XNMA 1LE9B 4JRYB 1MWAL 1T2JA 2VXQL 3SE4C 4XCFH 2FCBA 4H26A 2FJFB 4Y5XB 2BSRB 3QXAA 4E41E 3SDAA 3TBVA 3C8HA 1FFNA 5L2KA 4A6YH 4WU7B 1B0RB 1F8TH 3SJVB 2FD6L 1EXUA 5DQDH 1F6AA 1KTLB 4NZTH 3S6CA 5EU5B 4MLSA 3AM8C 5E8EA 2Q1EA 5DHYB 4XX1E 1UADC 3I6GA 5J6HA 4M3JA 1KGCD 4I4WA 4LOUC 2PR4L 1BIIA 1HKLH 4GBXC 4V2CB 4LGSB 5MEOA 1FFOB 1NC4A 2BY2A 4GLRI 3O11A 1K6QH 1MPAH 4GXUN 1U3JA 2VDNL 3ET9F 4KVNL 5HDOA 3O8XD 3QO0A 4J3SA 4XP4H 3ULUD 3BP6B 3EO0B 4JRYE 1U2HA 1GPOH 4GUPB 2DYPD 4XC1H 1HYSD 2D9QB 4KVCH 3S35X 3SJVE 2AXGB 3GHBH 4JFQA 4Z7VA 1KN4L 1JPGA 4BM7A 2NY5C 4FMFA 3S5LA 1RQ5A 3IJSA 1VKXA 4MNHA 2N4IA 1VEMA 5C09B 4K71B 4PG9B 4OLUH 4U1NB 1OP3H 4BZYA 4OV5A 1RHHA 3GSOB 1KBGL 4K94H 4J6RH 3T0EB 3MV8B 5EOQL 3QIUB 4F58H 3BQUB 4BSJA 5K9QG 3GSRB 5CEZD 4PJHB 2X9WA 4MA1B 1WCBB 3VA6A 2F8XC 4OD3H 3F5WB 4KZEH 1YECL 3CC5B 3VRJB 4TVPD 5CJOH 4CDGC 1IGML 2PO6B 5JNYA 3HN3A 3UJTH 5IFHH 1LO5A 3H0TA 1CG9B 3QG6A 1BJMA 3LQAH 2IMNA 1FG9C 2AEIT 3LEXB 4PY8J 4X6DA 2FEEI 4PP2A 2W59A 2GJ6D 3TGXA 4A2MA 3PP3K 4R8WL 3D0LA 4PJ5B 3O9WA 1L7TL 2BDNH 5ICXA 1CGXA 1HHJA 4F7EB 5C09E 1QQDB 4LSSH 1BFVL 1CFTA 3STBA 5D1QB 3T0EE 3MV8E 2GYSA 1LO3L 4L9LC 5FO8A 4PGBA 5E70A 3CK0L 1KCLA 3C8KB 3Q6GH 1L0XA 4PBVC 3DHJA 6FABH 3T3ME 4FZ8H 1D5ZB 2AV7B 3O2VH 4ZTOH 4X6CF 1NBZB 4CADA 1MY5A 1JIBA 4G42A 4M5ZL 4TUKH 2GT9A 4F7MB 2FL5B 1Z9LA 4F33B 1RJYA 3KPLA 2OTWA 4P2CG 4P46B 3JV0A 5E8PA 4HUUB 1MHEA 3EFFB 4HAGA 3L3DB 4LKXA 5DJ6A 4PJ5E 1VADA 5BRZA 1A2YB 1V3KA 4X4ZA 3TBWB 5BQ7A 1PG7W 5DD0H 3EYVB 2RBLA 2YMXL 4PY7B 2QADD 4KI1A 1A7NH 1KC5L 4BUGA 1OARL 2XN9D 1F4YH 3DMMD 3OG6B 4L4JA 5IT2L 5GS3A 1CD1A 2H3NB 3OJVC 1T5WA 2BOBB 2DL2A 1X5HA 2R2EA 3QI9C 3QUYD 4ZD3L 2I07B 2ZCHH 3C6LC 1YMHA 1HHIB 3BGFC 1KENH 4XPAH 4QXUL 3Q5TA 5E4EC 3QDGA 2NXZB 3WFBL 4WJ5A 1HHKA 3VDAA 1JVKA 3FKUS 3NFPA 1OLLA 1UZ8A 2DI8A 5TGBA 4G6KH 4PY8I 1AD0A 1UA6H 1Y6KR 5CD5C 4XXCC 4MDIB 3WN5A 5CZXD 5D2NA 3TN0C 2EXWC 3QFJB 4JPIA 5FUOL 1AQDA 2NY2B 3C5ZC 1HZHH 2DQHL 2R0ZL 4HZLA 3QG7L 4GQ9L 1ACYL 4HLJA 4EKXA 1VACB 3BKML 1XR9B 4L8BB 4KK9C 4KQ4L 4NRZA 5KW9L 3OR7A 1XIWB 2CD0A 4MA8L 4RRPG 1AKJB 2F54A 3P0YH 3D25B 3DX9B 1WBYA 3ILPA 1TQCB 1TZHB 3SKJH 4MNQA 1SJVA 3VXNA 4EN3A 5HHQB 1C08B 4GKZB 4TNVK 3NCCB 2OQJA 4K23H 1LGVA 4Z8FH 1ZGLB 1X5JA 1ZLSH 2F74B 5F7UA 1EO8H 3EGSA 2VL5A 3T0DA 5T3ZD 3TVMD 1BECA 5LKNA 3MYJA 2J4WL 3CPLA 5DS8A 2I5YH 4CW1A 4ZNEE 3VFMB 3RVVC 4I18C 5EBGA 1AJ7H 3LEVH 2MSPA 4CMMA 3VFPA 1HHHA 5IQ7H 4YPGB 3QO1B 1S5IH 4TVSa 4GXVH 2OI9B 2L7JA 3MNWB 1ZA6A 2OZ4H 1WFNA 1IKFL 4OLVL 4X6CB 3IRPX 3VFTA 5FF6A 2Z92A 5C0CB 2NY1C 2VLRD 5EU7C 2AXFA 5T5FH 1MF2H 5DJ0B 1RK1A 1F4XH 5L8LB 7FABL 3VXOB 4JM2C 2YPVL 1E4KC 1BVKA 1U6AH 1GH7A 3LQAC 5I75C 3QXDB 3FT4B 4Y19A 3T2PA 5GISL 5DF0A 2QKIB 5IV2B 4MQXC 4FQQA 3ZE0E 1J10A 3B9KC 5B39A 2BVQB 4AEEA 3GMOA 5IG7B 5HGBA 3FQUA 3UDWC 3GBLA 3PHOB 4XNYH 5IB4B 4UV4H 5GS1B 3RY6C 1GOFA 4KK8C 5FO7A 3KYNA 2AP2A 4YHNA 4QRSB 4JVPA 4H88L 3SY0B 2I27N 1DVFA 2WQRA 4PTTA 1ETZA 2BSTB 1TCRA 5I1JH 4R96A 4M1DL 5T1MA 4OZ4B 3GI8H 1AGCA 1OD9A 1Q1JH 4LSVL 1NCCL 4X6CE 3DTXA 4P3WA 1DQLL 2P45B 3VFOB 4UAOC 1MH5B 4Q97A 4YUEL 4X4MA 4BFIA 3WXVL 2COQA 4TNVF 5SWSA 3M1BA 5DUPH 4N9OB 4TTDC 2PTTB 3E6FB 4FQ2L 2QSTA 5AD0B 1IGYA 1X5ZA 3O2WH 1IEAB 3CVHH 4BQBA 1DLHB 4P9ML 3OKOB 1K85A 3MLTB 3N1FC 2EDJA 1FVCB 4NHCH 3SDXA 5EBWB 3UTOA 2XWTA 3LB6D 4OZFG 2FZ3A 3S36L 4WFHD 4UT6H 4PD4J 1DR9A 5C07D 3T2OA 4LHUD 1A1NA 1J86A 5E5UB 4U1HA 5D1XC 4Q6IC 12E8H 5CCKH 4G80A 3UBXA 5T3ZE 5J9PA 2FECL 3QIBD 1CDBA 1UKSA 1G7HA 4PJIF 4R4FH 4UI2A 5DC9B 5C6PB 4JZJA 1KXTB 1RUML 1CF8H 4AIZA 1RUKL 1S8DA 2JJTC 3DI3B 4QHUA 3TZVD 4PJGF 2WINA 4C56D 1H3XA 1G7PB 2OTUB 1NAMH 3VD3A 1ZGLP 5FYKH 5CFHA 4HC1A 1QLRA 5IB2B 3CAFA 1GZQB 1Z6JT 3TNMB 2K7PA 1NANH 2X1WL 5D1ZC 3QUMH 3ZHLA 3FN0H 4OCXH 3BI9X 4RA3A 3TBSA 4PGCA 1H8SA 3UTPD 1A5FL 1MJJB 4EZMA 1E4XL 3OGCA 3WL9A 2BVOB 1OB1B 1TVHA 3R1GH 2BC4A 3MV9B 4E41A 1H8OA 4RFNB 4D94A 5MEPA 3GIVB 4P4KB 4OB5L 1T6VN 4YLQT 4LVEA 1IKNC 1AFVL 1Q9LA 3DIFB 2XZCL 3RWFA 4BQ9A 1QG3A 3GJEB 4YDVA 3RWJA 5CGTA 1XAUA 1MCWM 5I6XC 3QIWD 4CVZA 4L8SA 2HFEB 2AJUH 3DVFA 5DMGD 1MFAL 4JREC 2N56A 3L3IB 1MCQA 5JW4N 5DLML 4WWKD 4ODSL 2YD6A 5KSAC 1YEFH 1HH6B 4IIQA 2VDQL 4KUCF 1QRNB 4LVOC 1JZ7A 3WEXA 3BMWA 2DQIL 3JUZA 5F9OH 2GTWB 2VDPH 5T1LD 1YY9D 2XT1B 5LJYH 4P23D 1FQ9C 1IE5A 4HPYL 2DQEH 4NN7B 3BDYH 3CVIL 5EO0A 4C83B 3TF7C 2Q87A 4UQ2B 1JHKH 4JFPB 1HSBB 5JZ7C 2BSRA 3MV9E 1RJLA 1CXIA 1KJ3H 2ESVD 4KKNA 1JHTB 1QLEL 3U6RA 2NY5L 4R4ND 4ZS7H 2DIBA 3K46A 1CI5A 3OKKB 3UCRA 2P8LA 4QTIL 1KTLA 1EPFA 3AY4C 4TOYH 2HT2D 2VDKL 2P48B 3N1MC 5EUOE 4EDXA 5H35A 1IQWH 3FB8A 3PGDB 4ELMF 3KPPB 2DLFH 1JF5A 2F9BT 4FXLA 4Y4KA 1FZMB 3VRIB 1LDPH 2AI0H 1OTSD 4DCQB 1QRNE 3NGBB 3NVQA 4UTBH 4MD0B 2AJVH 3MYZA 1MRDH 4XTRD 5DVLA 3IDYC 4C56E 4QRRB 3MFGB 3BP6A 2MNUA 3EO9H 2YSSB 1K8IB 4GUPA 4NQVB 3PWJA 4GW1A 3H7BA 2VLJB 1BEYH 4RAVB 1R3KB 2Q76A 1LO4H 2AXGA 1KELL 3F6LA 4LPWA 3U1SL 1I9JL 4Z0XB 1T22A 3QCVL 4PG9A 4IRJB 4PJIB 1CFNB 3LS4H 43CAB 4NCDA 5JMOC 5KBNC 4I3RL 3QIUA 3BQUA 5C70A 5CEXB 4PJGB 1PEZA 3MRGB 3U4BH 4NQCB 1HNGA 3LDBB 4LFHD 5DFVC 3LHPL 5HGHB 3F5WA 4HK3J 3WSQL 1UM5L 3BGMB 2A77H 4QRRE 2R4RH 2FO1A 4UT7L 1U8IA 3IKKA 1H3WM 4M1CD 3H3PL 1CLYL 1IAIH 2Y06H 4G9FB 4X6FB 3G04A 2VLJE 1FLRL 3LEXA 4HCRA 3O8XA 4YK4B 4ONFL 3SEPA 1GGIH 4WI2A 3DV6A 3RTQB 4MA3B 4OFIA 5FYJL 3U0WL 4F7EA 5E2WL 2Z35A 1K2DA 1RVFL 1KB9K 3I2CL 5ESAA 3KDMB 5A16B 5I1AA 5I8KL 3MRKA 2R0WL 3VFWB 4B5EA 3L7FA 2Q20A 4MB5A 3S3PA 4HWZB 4Z9KB 3S37X 4HKJA 5JLZB 3IDXL 4NQCE 3C8KA 5CSZB 5EIQA 3TT1L 2AS5M 1QFWL 4H20H 1D5ZA 4R3SB 4JLRB 2AV7A 3LIZH 4KI5F 3ARBD 1ROWA 1ADQH 2J88L 4PJBB 1IBGH 4F7MA 5C6TL 2BNRD 4JFZH 1ZT4B 1FIGH 2X44D 3TO4C 4G9FE 4P46A 5GZOC 3PQYB 2F15A 4YBLB 2YC1A 4MDJB 3QSKB 3WS6C 5EORL 1J1XL 5HGGS 3KYMA 2DM7A 1RZ7L 4YNYA 4JRWA 5DQDL 1BM3H 3VG0H 4U05A 5JR1H 3CLFL 1SHMA 5HVWA 3NFSH 2EDOA 1DQDH 1OF2B 4GS7B 4G8GD 3MLWH 4ELMB 4G6JH 1S3KL 1S78C 5T1KD 1I7UB 5JHDD 4X4XA 3LN9A 1MAMH 3LQZB 2BOBA 1NJ9A 4PJFF 1AP2B 3TPUA 3X13B 4MJ5B 5A2KH 3REVB 5JW4Q 5I19H 5C2BH 1K6QL 1MPAL 3F62A 1Q9KB 3N85L 5IVXA 3D85B 1KJVB 4PJBE 1JV5B 4LARH 3I84A 1BIHA 3U36A 1RAMA 3V7AE 4YHLH 3HMWL 3BIBX 1T1WB 3KPRD 1WEJH 2IPUK 3MLXH 3PQYE 3G08B 3DI2B 4XC1L 1WZ1H 2DQJH 3QEGL 1UJTA 2AK4D 5DK2B 4NBYB 3OKMB 1NFKA 2DS4A 4MDIA 5KSUA 5BOZG 5IQ9B 4XMPL 4OLUL 3VXRD 3T0VA 4ELME 2LU3A 4UQ3B 5ADOH 5JIIA 2PNDA 4XI5C 2OS7A 4Q6YA 4WNQB 4OCRL 4JQVA 4F58L 4ZNEA 2BERA 2D7QA 2QSCH 3P2TA 4POUB 3QH3B 3ARTA 2KH2B 3BWUC 1OAZH 2XN9A 3DMMA 3NFNA 3VRLE 5BV7B 1XIWA 5D2LF 1JYXA 1WBZB 4YHIB 5FYLD 1XEDA 3V0VB 1T0NA 5D7LB 3DX9A 4WHDA 1TZHA 5IFHL 2BJMH 3QUYA 25C8L 3S34H 5IROA 2GSGA 2HFFB 5I8CB 1C08A 2SEBB 1N26A 4K3JH 1T80A 1MIEH 1TFHA 4I0PB 1ZGLA 4WENB 2FECI 1Z3GL 1KSRA 5MENB 2F74A 3CFCH 2HH0H 3VXMD 2Y07L 1TDQA 3SE3A 5F88A 4LCCC 3ARYA 2P44B 4Y4FC 4F8TA 2R0KH 1A4KA 2NY3B 4P59H 4XNUL 5TQ0H 5KVGL 4N9GB 4XNXH 4F9LC 5CIPB 3RP1A 4YPGA 3QO1A 5FV2A 1MJ7H 3MNWA 3C5SB 2NQCA 1T21A 5EOCL 1MJUH 1YY8B 4FZ8L 2NY0B 2F5BH 2ATKB 5D7LE 1JYWA 4XWGL 1E4XI 2OL3H 4YO0A 1OOAA 3EW3B 4D0DA 3IF1A 1H5BC 5JQ6H 1ONQA 5KSVB 4ZXBC 4OGYH 3VGGA 3VXOA 3PXJA 1F00I 3BISA 2YUWA 2YEZA 2X1QA 5J1AB 3RNQA 3LKPB 2QKIA 5FGSA 3B43A 4PLNC 4D9RE 2G60H 1C5BL 3D0VB 4RSVA 4NNPH 5IG7A 1FC2D 4YPJA 3K4AA 4LCYB 3PHOA 2E27H 1B90A 1A7NL 5E00A 2JJSC 4HXBH 4LIQH 4LP5A 1F4YL 1S9VA 5ISZD 4RIRB 4UOJA 1XGQA 4HXAL 4NQDB 4QRSA 5TDPB 2F58L 3MUZ1 3CX2A 1NFIB 3RAJH 1U92B 3TVMA 2MOVA 4LPCA 5CLWA 1B3JA 4OZ4A 4FG6D 1QFPA 4H0GA 5JXAH 3MV7D 5IMKB 2H2PD 4PRHB 5DJAA 3W0WD 3MLZH 4EIGB 4FTVB 3KYAA 3DVGA 5B3NA 5BXFA 2Q7NA 5GGTL 1ED3B 3MFFB 1KJ2L 1OTUD 3MJGX 5AD0A 2C7UA 1QYGH 5DUBB 5FYLE 1A0QL 4LRNH 4NWTL 5JDSB 4PJ8D 4GRLC 4N5UA 4O2FB 3OKOA 1YN6B 5L9DL 3ZSTA 5DHVB 3NIGF 1R3HA 2W0FA 4KK6D 2W07A 4NQXB 1L4IA 4J1UB 2ADJB 5FDWB 3GMNA 1UB5A 4NQDE 1N2RA 4OT1H 3IDIB 1YEDB 5D96B 1AXTH 5FEBA 4IRSB 2RCSL 1IT9H 5D2LB 1ORQA 4PRHE 4G6ML 2V17H 2XIDA 4LRIA 3P0YL 4XPHL 5CJ5A 3O4OC 2VZOA 4FTVE 1WAAF 2UUDH 1G7PA 5F9JB 4DN3H 3UP1A 5C9KA 4JG0H 3MMEB 2V9TA 4HD9A 4ZG1A 4K23L 1CICB 4Z8FL 3F65A 3OKNB 1ZLSL 1OCWH 3IAPA 4P57A 3RWEB 4TUJB 1IL1A 1MJJA 4P3DA 4X5LA 3RKPA 4M43H 1OB1A 3BPOC 4IOSD 1DUYA 3MV9A 3V4PH 3B9EA 3GSUA 5H8DA 4P4KA 2RJMA 3W2DH 5GGVH 5HD8D 1BX2A 2Y72A 3DIFA 3UX9B 5F6HJ 1NL0L 2EE9A 1AHWC 5GJTL 1UJ3A 5DJYB 4LHUA 3WNMA 4PUBH 5EUOA 1JL8A 4AYFA 1NC2D 4QHMA 1T5XB 5EU3B 4PRPB 1UWXH 4GMTH 4M9PA 4YWGL 3QYCA 2XKSA 5J13B 5C0ND 2OR7A 1RIVL 1SMAA 3QIBA 1F4XL 1QRNA 1QFWM 1Z9MA 1U8OB 3IFLH 3W0WE 3TZVA 4C56A 4N68A 3O2DA 1SJHA 1N7MH 2VWEC 5JHLL 3SGDI 3FQRA 4JFPA 1HSBA 2QV2A 1SEBA 4TPRH 3JVGA 4UV4L 4O00A 4I1NB 5B21A 1RI8A 3KLHD 2FNBA 2GSIB 5C0BB 3SDCC 4AQOA 4EBQH 2ZJSL 2Y7QB 3ETBF 5ITBL 1QFWI 2E6PA 5SV3A 1MIMH 4JHWL 3TH4T 2CLZA 4JKPL 4D8PA 3N1QC 5I1JL 4QT5A 1A8JH 5E0QA 3GI8L 2B1AL 4L3ED 3V4VH 1Q1JL 1JPTH 4PRPE 4JO4L 3VWKB 1MWAB 1VFOA 5MP6H 5DUPL 3QIWA 3S35H 1Q38A 3P4MA 5FM8A 5AZ2L 3EOTH 4LKCB 4RBPH 3RU8H 5I1EH 5ALCH 2YUXA 5HI4D 4J4PC 2JF1A 4OZFH 2YSSA 4FP8H 4ZTPL 3VXQA 1EBAA 1NGXB 4ETQA 1JGDB 2IH3A 4BSVB 3LAFA 2VLJA 3D39D 2X2YA 4UT6L 5T1LA 5L2JB 2Z0BA 5C0BE 3BPLC 3VFSA 4P23A 3UPRB 3C6SB 3GSNA 2ZPKH 3MOAL 1ZAGA 2EDKA 3RVXC 2Z91A 1QR1A 1JHLH 3H9SD 1I1RA 1UENA 2ESVA 2IGFH 5F6HI 3VWJD 4GRMA 4HX1A 1MRCH 3WIFB 5J4MA 4ZSOB 1WF5A 2NXYC 1CF8L 3A67H 2AJXH 5A3IC 1SJEA 3EYUL 3EHBD 1KULA 4UUJB 1LD9B 1TCMA 3RWCB 4IJ3C 2QBWA 4JFYB 1RZGA 1N59A 5FYKL 5IB3B 2FSEB 1KB5B 2ZUVA 4DAGH 4FRWA 5EUKB 2AXHA 3V5DB 1E27B 1ZS8B 3GMRB 4U1SB 5CGYD 1MUJA 3QUML 4HHAB 2C1PB 4XPFH 4X6FA 4C57C 1D9KD 2CK0L 1U42A 2APFA 1G6RL 4AH2B 5GGRB 5J7CC 5FK9A 3DX6A 3I50H 1BLNA 3RTQA 3AU1A 3MRFA 4MA3A 3DX8B 4O2CA 4FXKB 4BUHA 2NW2A 2WSKA 2V2TB 3VA2C 2VE6B 4O5LL 5A16A 3UTSD 3RVWC 4C55A 3JZ7A 4X6EB 4XVSH 1F3DJ 2YRZA 4QNPF 4N8VA 2AJUL 4ZSOE 5C08D 1B0WA 4U6HB 5KG9B 3FMGH 3DVNB 3GIZH 3HKFA 1YEFL 2NLJB 4NKQB 4JGMA 3KPSB 4D0BA 2R29H 3W39B 2HJFB 3MOQA 4EVNB 4M9OA 4J3XA 2VLKD 3OXSA 4G7VH 1OQOA 4DUVA 4LLQA 4PJBA 3P11L 5DYOA 4R9HA 1T1YB 1CLOH 4LDLB 4PGJA 1RY7B 1QBLH 1ZT4A 2DQEL 3L3KA 4KJYB 5E2VL 3OF6D 3LEYL 1JHKL 1HQ4B 5ELIA 1K4DB 4I13B 4HKZA 2F8VA 3K1KC 1KJ3L 4Y4HD 4ZFOL 1A6UH 3ARQA 3NAAL 3OB0H 2D03H 2NW3B 1L6XA 2QR0A 4ZS7L 4KDWA 2VQ1B 4FQLH 5I18H 4JY5L 4ZFFB 4GRWH 5DJXA 2UY6A 3T3PF 4XHQA 4GG6B 3KJ6H 3Q6FB 2X4SB 2N1KA 1CDIA 4HS3B 2BCKB 1IQWL 4NIKB 1I7UA 3BP4A 2EDHA 5K9KB 3AXLB 4ORGA 3BO8B 2HLAA 2DLEA 5ALBH 1IGTA 4LGPB 1I9EA 3FOMB 1QUNA 3ARXA 4MJ5A 5HHVH 4XPTH 2BRQA 3KPSE 1AGDB 1LK3H 1KIRA 2GTZB 1CLZL 3QAZC 4PGDA 1N3NB 3C9NA 3LPGA 3TIEB 3GI9H 1ODAA 2YD5A 1X44A 1H3TA 3P4OA 5IVXF 2AJVL 3KHOA 3WO4B 1KCSL 4OBRA 4LBEB 4WO4C 3MBEB 1NDMB 3FQNA 4QHNB 2FHBA 5EFIB 5C0RH 3G08A 3IJHA 1ZHLB 5KSBA 4K8RC 4K7PX 3ARBA 5CD3A 3SKNB 4ZUWB 2BNRA 1LO4L 3E6HB 3GMQB 1BZ9A 5B4MC 4KJWC 2HWZL 4Z78A 2IJ0C 4ZO7A 1RMFH 2AABH 4KJQD 3MODL 4ZODA 1WZMA 4GG6E 3KLDA 3E8UL 4M8QB 4UQ3A 1NLBH 1GXEA 3QQ4B 4N0YL 1CBVH 4WNQA 3B83A 2CLRA 3SDDD 5KS9B 4JFHD 5D71H 3UTSE 3MO1B 5AUMB 4G8GA 3VH8B 4ENEC 5T1KA 1PDKA 5JHDA 1WBZA 4FABH 2A6DB 1T04B 4FQHA 4PLJD 4DK3A 2A77L 2R4RL 3QISA 4S1SH 3V7AG 1CGVA 4HUMB 4J8RB 4CVXA 1I1CA 4JN2A 3L3GB 2HFFA 1IAIL 5F7EH 2WIIB 1CK0H 3QEHA 5ESVB 1LHZA 1RIHH 4KJPD 4I9WE 1C16A 2FB4H 1QHPA 4LL9A 4P5MA 3TJHC 3ABZA 3GRWA 3FO2B 4JAMA 5I17B 1KPUB 4JHZA 3FO0L 4KDVA 1CGSL 4Y88A 4GQPH 5TJWK 3VXUB 2AK4A 5AWNH 3QEUA 4DN4H 1EGJA 1V3LA 3PG2A 4NN6C 1CE1H 3K4ZA 4X7TA 1YQVL 5KS9E 3HR5B 4PJ9B 1MCLA 1FNHA 2XZZA 2WBJB 5CIPA 1WUNT 3WLBA 3VXRA 4JVUA 3ZKMD 3VXSD 4ZOCA 5EZIH 4H20L 3FB6A 1SEQL 2H8PB 2G5BB 3MOBH 3MUY1 3DARA 4LCWB 2Q8AH 3LIZL 4LSQH 4HWBH 1ADQL 1XF5A 3ZE1F 1BF8A 1IBGL 1MVUA 1F58H 4J23A 2D0HA 5DD6B 3OAYH 4X80L 3CD4A 2ENYA 3WFHB 3V6FB 5I30L 2MPAL 2NYYD 3TA3C 1DQQB 2K3TA 3UYRH 4WW2B 3T1FA 1FHGA 5I1DB 2Y6SC 3OPZH 4LLWA 4BYHA 3NFSL 2K9UA 2V5RA 3C5JA 4PJ7A 1VEPA 1BPVA 3EJYC 3ZDXF 3P30L 3VU2A 1BFTA 5E8OB 3THMH 1HILB 3TC9A 4R4BA 2NY7L 5GRXG 4E0RB 2B7DT 1NFIA 3VXMA 1RIUL 3OKDB 3O0RH 1U92A 5FOBB 1SY6A 4HS8H 2OSLB 3HC3L 5DEZA 5ACMA 3VXPB 4NKMA 5BVJB 5I19L 4LCWE 2UYLA 5CAYB 3DX7B 4HGWB 4RQQB 3O41B 3RZCB 4BELD 4XGZB 4YFLI 5HHMB 5I1HH 4FTVA 4GH7B 2FBJL 3PDOB 5I16A 1ED3A 2LAAA 1B4RA 3MFFA 5IJKC 5E6ID 2DQJL 5JDSA 1R5IB 3D69B 2AJZA 5ANMB 4O2FA 4YZFF 2APVA 4QO1A 2Z31B 4DGVH 5HVHC 4HQQH 5I15H 2HVJA 5DHVA 2JLLA 4JKLA 4M6MH 1NGWB 3QUXD 1FNGB 3EYFB 4J1UA 5ADOL 1B88A 4KZDH 4PIRF 4YHYC 3MRPA 1FFPB 5KJRH 4GW5B 1YEGL 2MFNA 1KLUB 4U3XA 4M7KH 4U1KB 1Q0XL 4JFFD 4XCCL 2IPTL 3HZVB 3MJ9H 4OF3A 5JPNB 1S9YB 4QEGA 1X5FA 1TETH 1EZVX 4OF8A 1DZBA 1FV1B 1A6ZA 4HFWA 4JGUA 5IIEB 1BBJA 1OAUH 1D3CA 4G3YH 5HHME 1WWAX 5SWZD 5F3HA 3RVUD 4YE4H 3WJJC 1CZ8H 1M71A 1VSCA 2HVKA 5ANME 2MQ3A 1MIEL 5TE7H 1NUDA 3W0WA 4HIJA 2VZUA 1EHNA 4U1JB 4P2OB 5BW7C 5SWQB 4X5XB 5DFWH 3S4SA 3BN3B 4NJAH 1M05A 1UWGH 1Q8MA 1V8HA 4JKWA 3WKMH 5IHUH 4RZCA 3KPOB 3VI4E 5IJVA 5CMAA 4X83A 4M7ZB 4X4YA 2LVEA 4Z7QE 4POZC 4WIQA 5DRNB 4GSDL 3CLEL 2ZWLT 4Q0XL 4PRPA 2ZKHL 4TN9A 1N0XL 4WCYH 4XVJH 2EXYC 3JV6A 1WC7B 4YHMH 4M1GL 1T3FB 1XF4B 1T4KA 5IM7B 5HHOB 4F57H 4PTUA 2HJLA 4NDMB 3BIKA 3QRFM 3K7UA 1I3VA 1C1EL 4YBHA 1D6EA 1EHXA 4J3VA 3HI6L 1XF2B 4L4TD 1NFDB 3GDBA 5FM5M 3SKOA 2XA8L 2VB5A 4NNPL 1I3GH 4GBXB 5ETUA 5GSVB 2LABA 3TO2B 3VJ6B 3GSXB 4OCSH 3RAJL 5FM5O 3SKMB 2H2SC 2ATPB 3PABA 5I1GL 2ED7A 3L6FB 1U8PA 5I8EB 1F6LL 3QQ3A 4EOWL 3DHMA 4JDVA 4Z7NF 2RAMA 5GGSA 4NUJB 4XNZC 4DKDC 1E6JH 3MLZL 5FGRA 4LAQH 4YIQA 3BVNB 5HHOE 1IGIL 4FN0A 1NC2A 4LKCA 5I66A 3NA9L 4LRNL 4PJEF 1FO0L 1KPVA 2MCG1 1WWBX 5F44A 1DBKL 2VDLH 3ULVC 1NFDE 4PLKC 5JIKA 1KF9B 3ZDZF 3HTLX 4S1QL 3BEWA 2CRYA 3PGCB 3O3BA 3PGFH 3ZDXE 1DBJH 3DECA 3BT2H 3C6SA 1BGXH 1QR4A 4OT1L 5LCVH 1HIMH 2O5YL 1OAYL 2FJGB 4OF7A 5LXGL 4OM1L 1ITBB 5F96H 2HTKC 1IT9L 2IPUG 5EU6B 1FBIH 4ZSOA 4XH2A 2Z8RA 5B8CC 3G5VA 2ZNWA 5E1AA 3V0WL 5FECB 4RX4A 3RI5K 1YEEH 3RDTD 5HYQB 3HS0B 2IMMA 5IB3A 2EH7L 2FSEA 1KB5A 5HDBF 1HKFA 4H5SA 3OKLA 3GMRA 1A21A 4EUPA 5F3BB 2DQDH 1FH5H 2IANB 4OZGF 1A7PH 3LN5A 4L9LB 5DEGB 5DO2D 3DYPA 3MGOB 4AH2A 3J8F7 2Z93B 4AG4L 4HMCA 3WNPA 4MJ2A 5I1KH 5IMOA 3S37H 5FKPB 3P0VL 2A9MH 6CGTA 3RHWK 5GGVL 3W2DL 5EULV 1T03H 4KHTH 3C87A 1FPTL 2C5DC 5GRJL 2VABA 3D39A 3C60D 4S1DD 3LKOA 4X6EA 2RFXA 4O4YH 1BOGA 2EIZA 5F6IC 1IAII 3PP3H 5T33H 2EZ0C 4HT1H 3FO1B 3GJFA 4JM2F 2BSED 1J0IA 4X7SH 1FVEB 3O6KH 3VWJA 1KLGB 3KPSA 3AREC 5IK3B 1A3LH 1MCIA 3IFLL 3QCTL 1U8JA 2ICEA 1FLTX 1DUZA 3D18B 3HG1B 4TRPH 4RFEB 4WFED 5E9DB 5KZCB 2IANE 4K8RL 5D7IF 5EIVA 4P2RB 3WUWA 5FCUH 3AS3A 3MXVH 1QKZH 3WV0A 4NNXB 4KK5C 2B0SL 2QL1A 1HNFA 3QI9B 4KPHH 4EBQL 1QNZL 4R7DB 3IETB 3C6LB 3RVTC 5AZEL 1EERB 1GGCL 5C0GB 3BGFB 4UOW0 4GG6A 4GAYA 1E28B 3BN9D 1OM3H 4HS3A 2BCKA 4PRID 5E4EB 2AVGA 4PJDF 3RI5F 5K9KA 3WIHH 4OF5A 4QLRA 3WIIH 3T4AB 3U9UA 2VSDA 3VFUA 3KR3L 3DSNA 1LP9B 2XOTA 1EFQA 3FOMA 4FQ1H 5F7YC 1CDGA 1UH4A 1R24A 3UTSA 4PYHA 5TQ2H 2M2DA 3S35L 2GTZA 3EOTL 1N3NA 3BEVB 4PJEB 3WHXB 3RU8L 2Y5TA 4MJ6A 3FONB 5ALCL 5I1EL 2FWOB 5FYJE 5GS0H 4JB9H 2YPLB 3TN0B 4U1GC 4FQJH 1EBPA 1NCAL 5E9DE 2ADIB 2JJWA 3U7WH 1EX0A 1QSEB 5A1AA 5EO1A 5GJSH 4P2RE 3RHWF 1ZHLA 3C5ZB 1LO2H 5IESH 2VLKA 3I75B 2NX5D 1WLHA 2NY1D 5KSBF 4NM8H 4URTB 4HG4J 5I1IL 4ZO9A 5D93C 4I48A 4OF6A 3OF6A 4BZ2H 2EYRA 1CFQA 3SGEH 3WBDA 2BOCB 2IGFL 4Y4HA 4M8QA 3PWUB 1ZLWK 1NDGA 4KGJA 1P4IL 1MRCL 4M93C 4NZDA 2VDOH 1YMMD 5FIEA 3A67L 1LP9E 3PV6A 5KS9A 2ILLA 3DPBA 5T5NF 1GGUA 4WI6A 4KAQH 2CKBA 1UACH 1VDGA 4PJEE 1T2XA 1ZWIA 5J8OA 1EV2E 2FGZA 1ZVSB 2APBA 5IKCA 4NO5A 2YPLE 3DLQR 3BD5A 1KFAH 5CBEA 2ZCKL 4JFXA 4OZGB 3I6KB 3CDYA 3AS0A 2XZAL 1Q72H 2ZCLL 4Y2DD 4I18B 5B22A 4Z76A 4UZGA 1JPFB 4NO2A 5CHNA 3W9EB 1K5NA 3PWLB 4OKVA 3HFML 5HHPB 3ARVA 2LU4A 4NNYB 1TNMA 3QULB 2W9EH 1J5OH 1ZE3C 1OSZA 4B7IA 3KXFD 2LU7A 2GQHA 5K59F 3TYFB 5EOTA 2A0LD 4JM2B 1LDSA 1PBYA 2R23B 5I75B 3E1F1 4Q9BA 5EN2A 3HE6C 1PYWB 4TSCH 4K3EH 1R3LB 1EEZB 2G5BA 3U82B 3KGRA 3ZLQC 3SDDA 4MQ7A 2AJSL 4WY7H 2HRPH 2IAMC 8FABB 3B9KB 4Q9RH 3QWOB 1CLOL 3ARRA 4NPYA 3H42H 4OZGE 4Y5VB 2VLLA 5D7IB 3WFHA 2B4CL 4EI5C 5GS1C 4G5ZH 1WBXB 2OYPA 2IG2H 4WW2A 2V5YA 2D03L 1J8HD 3ZSSA 3T0BA 1AO7D 1LEKB 1NCDL 4FQLL 3SCMB 5I18L 4ODHH 1FL3B 1SBSL 5HY9B 4ZMAT 1RULL 2FGWL 3T8XB 1VFAA 4UAOB 5EU7E 4RGNC 4JDTL 3F7RA 2R2CA 5JW5A 4UNTA 2AQ1A 4ZUUB 1RU9L 1EFXB 5KAQF 5D7SH 4KTYA 5IBTH 4YXHH 4W4NA 2A73B 3VH8G 3VXPA 4M02A 4X9IA 4RNRB 5E2UL 4M5YL 4RQQA 4WTZG 1BZ7B 1FZKA 2GITB 3FB7B 5DMJB 2I24N 3MROA 5CJQL 5D7IE 3AMKA 2UVEA 3B2UC 3U30C 3VGEA 5F7HA 1P9MC 4I5BB 4K3HA 5D1XB 4U4BA 3I3EA 4QY8B 4Q6IB 4ERSH 1W2KT 1R5IA 5ANMA 2KZWA 3QUZD 1OGTA 3BUTA 4JO1L 1DP0A 1C5CH 3CH1B 5B38A 1RMFL 2AABL 1P2CA 5FUZH 5SX4H 5DEFB 5LWYH 4YHZH 2JCCA 4KUZL 3MRRB 1NEZA 1CBVL 2UWEA 3TJEH 4N90E 3UTQB 2I9LA 5JZ7D 3WHE0 1KJ2B 1G9NH 1UG9A 15C8L 1JN6A 5I1CH 4MJID 1MCFA 1FGNH 3R0MA 5DDHB 5D1ZB 5BZDA 4WHYG 3KXFE 5IB5A 4FABL 4IHOB 3KYOB 4GKSA 1MLCB 3VGDA 4S1SL 2R2HB 3HRZB 2NY6C 3B3IA 3HZYB 1OT1A 1I4FB 4FQXC 4MD4B 5CJBA 2VAJA 1S7TB 3UYOD 1AD9A 3LPWA 4JJ5A 2A1WL 4P5KB 1CDJA 1LK2B 1RIHL 3KPTA 1F2QA 1PKQB 5I6XB 1I8LA 2HT3C 4JFDD 4HS6B 5F7NC 2FHFA 4X5XA 3G5XB 2V7NA 4JREB 2YD3A 2C3VB 5ICZB 1CD8A 1YUHA 5KSAB 4BKLB 4W6WB 1QSFB 2QTEA 4LVOB 2P5ED 4YEFA 1U8HB 1YDPB 4RMWA 5F7WC 4B0MM 1ZHNB 3L5IA 3QUXA 4GLRH 2DQTL 1QVOB 4OQTL 1S7QB 3NN8B 7CGTA 4OM0L 2DBLL 3MRCB 3RBSA 1PY9A 2CIIB 2Q8AL 3UTTB 4ZFZB 4LSQL 3TPKA 4HWBL 4TQEH 1I3UA 2VO5A 1F58L 5F9AC 1JGEB 1T0PB 1YNKH 2XQYK 5DURD 4JFFA 5E5MA 3TNNA 5HHOA 1NMBH 2VXVL 4J7RA 5DD1L 4KRLB 3TH2T 1QLFA 4NDMA 3VFRA 3IKCB 1MI5E 3ULVL 3MZGB 4KY1H 1CL7H 3UYRL 5SWZA 1XGUA 1PKQE 3AM8A 4LNRA 2AJYL 1YNTA 4XB8A 4DKAA 4OGZA 2BMKA 4PJXB 5EBMA 2BFVL 4XPGH 5DQ9A 3HLAA 1NCUA 1Q9WB 1DFBH 2QQLH 3KPNB 3G9AB 5EZLB 2J6EL 2AEPH 1CS6A 2XFXA 4HULB 1QSFE 3MXWH 4UU9B 2Q86A 2FX9H 2MTPA 3GSXA 4MWFB 5MHSE 1FAIH 1OLZA 3FFDA 4RMQA 3SKMA 1J05A 3L6FA 3AB0B 2CXKA 5I8EA 2DMBA 1BQLH 3D2UB 3IDYB 1AC6A 2EH8H 2EYSA 3QXTA 1IMHC 1J8KA 3ZTJG 1U93A 1WGOA 1JRHH 4XMLH 1YYMH 1S5HA 1T7VA 5MEQA 3CFKB 2R69H 1A1OA 2J12B 5I1HL 3AAZA 2QQNH 3EYSH 3BVNA 4YFEA 2V5SA 3FRPG 4MXQC 1AXSB 3OR6B 3O45B 4D3CL 2NZ9C 5EC1A 2FX7H 4K2UL 1FYTD 4JPKL 5EZJB 3H2WA 4WRLA 3GJFK 4FQCH 4HQQL 2BP3A 4TULH 5I15L 2I60L 1A14H 3ES6A 5I76B 1MHHB 5DTFB 4PJXE 3PL6C 5F72S 3RX7A 1XGRB 1CT8A 1LO0L 3MRNB 5BS0D 2ENSA 3PIQB 5DC0A 5HI5D 3MCLH 3QEQD 1AE6L 4M7JH 2VZSA 4AJ0A 2JK5B 4WDIA 1I1AD 2G2RB 5J56B 2AKRB 2CRIA 4FFYH 4KQ3H 2X70B 1S9XA 3CVHB 1IZKA 4YAQA 3CSPA 3ARFD 4XAKD 4MSWB 5ISZB 4NP4L 4XP5L 3HMXH 1T1ZA 2R0LH 1FZOA 1NGZA 1XMWA 5FECA 2P7TB 3KYKH 1AIFB 5HYQA 1UGNA 4PRDA 5FA3A 1JI1A 1CZ8L 2EKSB 4FFZL 3KLSA 1GOHA 4JO3H 4B50A 3GKWH 5C7XH 1KV3A 3CNKA 1NUGA 5D6DC 3VFGL 1NSNH 2VNCA 1RZ8B 3DSFL 1INQA 3MGOA 2HMID 5DI8B 3ARGD 5DZNA 2EEDA 4PJ8B 5E6YA 5IF0B 3WKML 5IHUL 2JB6A 2FBOJ 2PXYD 4MCZB 4KKAD 1PW3A 3GK8H 4HSQA 5C3LD 1YC7A 4JN1H 1H0DB 2RGSA 3PWVB 4D9LH 4ZAKD 4JG1H 3S88H 3G6AB 1W8NA 5HDQL 4U1IB 3QUMB 3S96B 4ZUTA 3FO1A 2OR9H 1MEXH 2BK8A 5BCAA 1FVEA 4GOSA 1SVZA 1G6RB 4F57L 3MRQB 3K8MA 3DJ9A 2H6PB 4KWUA 5I0DA 3GGWB 4UNUA 3SDAC 4ONGL 4PB0H 5F1OB 5DZLA 3RDTA 4PRNA 5AYUH 5TF1H 1IGJA 1GGBH 4LQFH 3HA0A 2P5WD 1P4BL 4UV7L 2R39A 4U7MA 2VXUL 4OCMC 2W0PA 3ALWA 4NNXA 4EQ2A 4CJ1A 5HYSB 1JZ8A 4HFUL 3RGVD 4KROD 4QWWC 4NRYB 4R7DA 3QHFL 1G7LA 4Z77A 1DTUA 2YOCA 4OCSL 5FYKE 4ODBD 4FA8A 1Z0MA 4PJCA 4NO3B 3QFDB 2UZIH 3LN4B 1E28A 3EJZC 3E2HB 3BZEB 4PB9H 1WT5C 2D2OA 3SE9H 1E6JL 2VN7A 4K7PH 2YRPA 3MR9B 3MRMB 4HUXA 2FIRT 2AK1H 1W0VA 4A6YA 1HH9A 3FONA 4XXCA 3BRGC 1JWSA 4ALAH 1U95A 1PZ5B 2VDLL 2ADIA 4FQIL 5ICYB 4GKNA 4QRUB 3JV4B 5T3XH 3I75A 3BIAX 1JMXA 4FNLL 4XNQA 1WV7T 3H9YA 1BGXL 1ZT1A 1NH6A 4Y0GA 4J3WA 3OL2A 3PWNB 1DE4B 5F1SA 1Y0LB 3QNZA 3OZ9L 1LEGB 1FZJA 1XF3B 3BXNB 5KVFH 1U8KB 1HK6A 1KCRL 2E7MA 1T83A 3V79C 1EUTA 1NGPH 3QZWB 1Z5LA 4KKCC 2ORBL 3ULSA 2AGJL 3B6SB 5E08L 1GZPB 4PRIA 1CDHA 1FGVL 2IBZX 1OPGL 1OT2A 3IDMB 4KKLD 4MAYC 4F9PA 1MAJA 5C9JA 5IWLA 3EOAB 4QTHB 1RZIA 2HA1A 4XVTL 4F2MB 4ZUSA 4K3GA 4KRPC 4L4VD 2F8OA 1KCUH 1VFBA 4Y4FB 3O9WC 4OFDA 2A6JA 2P8PB 3QJFA 1FH5L 3GBNH 1A7PL 4I18A 3T4YA 3H7LA 35C8H 1N4XH 5I1KL 3S37L 1FG2B 3W9EA 3PWLA 2A9ML 2WBKA 5D70H 1T03L 4KHTL 3MLSL 5FOJA 4WI8A 3FT2A 4BQ6A 5HHPA 2P5WE 4HKBB 2R1YB 3FZUD 4ZPVB 2NX5A 2AAVA 1P1ZA 1NMAH 4HUNB 4KI5C 5I1LB 1MWAH 1H5BB 3MRIA 3DUSA 4ZXBB 1OP9A 5D7JB 5T33L 4HT1L 1E4KA 2WK2A 3HZMA 4X98A 1PYWA 2VMFA 4MXVF 5J11B 1EEZA 4WV1A 1YMMA 1I8KB 1IM9B 2FJHA 3FFCD 4ZOBA 4ONOA 1IC5L 2YD9A 4TRPL 1O5DT 5FYJU 3MLYH 3O3EB 4Z7WB 1DEDA 2VIRA 3O4LD 4K07A 2PR4H 1DBML 4M61A 1WBXA 2OBGA 5FCUL 1QKZL 1C12B 4H0HB 4BA8A 1HI6A 1Q94A 4KPHL 2VDNH 4KVNH 3N1GC 1FL3A 4PGEA 5HY9A 2H1PH 4Y2DA 1D5XB 3T8XA 5IHZB 2IFGA 2ZSVA 1AGBA 5AYQA 1OM3L 3WS3B 4MCYB 5J06A 4HDIA 1WZLA 4Y16D 3WIHL 3T77A 1FNEB 3SQBA 1Y6NR 3QDJB 1G7IA 2VISB 4GRLB 3V2AR 5F7LB 2IBZY 1KN4H 3HZKB 3INUL 3VCLA 1KJMB 2ED8A 3KXFA 5FO9A 4LHQB 4JB9L 1J87A 4OD2B 1UVQA 4FQJL 4Z7WE 1QEWB 1KBGH 4F7TB 3M17B 5EOQH 3WN5C 5E7FA 4YR6B 3BZFB 5D2NC 2FEDD 5IESL 3CFEB 4DVBB 3D5OF 4NM8L 3TBYB 2XTJD 1B9ZA 3U7YL 4QOKB 2R9HC 2WWMD 1DN2A 1NGYB 3QXWA 3IGAA 2J7LA 2HG5B 5IBLC 3HUJB 4F7PA 2JJTA 3O4OB 2MHAB 3GB7B 1J8HA 2EEAA 3WFEH 1AO7A 2DBJA 5EBLA 1UCBL 1FNFA 1MFCL 3OMZA 3QDJE 5IW1B 1F42A 1UWXK 4EN3C 4MS8C 4KAQL 4YGAB 5J3HD 3QDMD 5CLTA 2D9CA 3TIDB 1BFVH 3BPOB 1A6WH 2R2HA 3W81A 1GIGL 4X0KB 1LO3H 1S7TA 1TITA 1BQHA 2V2XB 5F7KC 1JK8A 1Q72L 1IKNA 3CK0H 4P5KA 5JORA 1BOYA 1MI5A 2CO7B 2ZUUA 4JO2L 5E99L 1UH3A 5HI3C 1AHWB 4QOKE 1MHPH 4L1HA 1GC1C 4S2SA 4S0SD 1KG0B 3G5XA 1JNLH 2GUOB 3HUJE 4PG2A 4PV8B 3MUHL 2CDGB 4M5ZH 2C3VA 3MRBB 3QUZA 3HPLA 3QUKA 2E9WA 1ULVA 4P5TD 5KSAA 3IDGB 3W82A 1XGTB 1YDPA 4XVUD 2VZTA 5D6CB 3QQNA 1CD0A 1T89A 4IOFD 3BHBB 3CFIC 3CGTA 1I7RB 3NN8A 4PRAA 4Y2OA 4K3EL 3MRCA 3NPZB 3UROR 3BKCH 3X11A 2YMXH 3RKDC 4WY7L 1KXVC 4BSWA 4IRZL 1OARH 2DKUA 4HJJL 2E7LC 3H42L 4AL8L 3DGGB 4MJIA 1XGPB 1YC8A 3SDCB 1DBBH 5DMIL 4CN4A 2X4TB 1R3IL 4G5ZL 1G7JA 3MRJB 4ZD3H 4HJ0D 1P53A 3F7YA 4JGJA 4N5ED 5K9OB 3QHZL 4UTAH 4PJXA 3L9RB 1DVFC 2YN3A 1HOCA 2OZ4A 4QXUH 3KPNA 5EZLA 3GBMH 1H3VA 3BSZL 4G8EB 2X4PA 1ITCA 1N8ZA 2X09A 3OGOE 4JFDA 4PS4L 5T5NG 1F2XK 1U8NA 3L3JA 1UKQA 2NY4D 3FOLB 4MXVE 3MV01 2A74A 1ZLVK 3FTGB 4HEME 2VWEE 2YPKB 4OIBA 4ZO8A 2HN7A 2P5EA 3Q3GB 3CDGA 3WNNA 4K7FB 1N5YH 4P2QD 1U8MB 4OI7A 2X41A 1N6VA 3CFKA 3IDNB 1KIPB 2GCYB 5FUOH 4QXTA 3SGKA 1I3RB 3BPLB 2R0ZH 3VXSB 3WD5L 1UM4L 3QG7H 4GQ9H 2J5LB 1DEEB 4ISVA 5E8NB 3ZYJA 3V6BR 1A4JB 4KQ4H 3N9GL 2WUBL 5F7MC 4G8FA 3ARWA 3L7EB 3MRNA 2H26A 1C5CL 3IU3B 1XF1A 2XWBB 3PIQA 2CMRH 2NXYB 4OJFH 5HGDA 3MA7B 2R1XB 3GHEL 4IJ3B 4UBDD 2AJ3B 2JK5A 5M7QA 3SPVB 3TJEL 3Q2CA 3VXTB 2AKRA 3VGFA 1OL0A 2GI7A 3BDXA 4JY6A 4APQC 2DTSA 3UZVB 4WHYH 2X70A 3CVHA 1FO0B 1MCWW 3W5MA 5HTSA 1M7XA 1VB9A 4R7NA 4NC2B 5BZWA 5H2BA 4OCWL 1HSAB 3ZYZA 1UEYA 2P7TA 1T20B 4TVPH 4NQEB 3BPCA 2OTPA 4LIQE 2LV4A 4JANA 3QNYA 5CSGA 5IVZA 2VITA 3HE7D 3UJJL 1ZKAA 2ZUXA 5MERB 1TENA 4IMLB 4KMQA 4XP9H 2D0FA 2R15A 1VEOA 1D5BA 4ZPTA 2HFGL 5DI8A 5IF0A 1FYTA 3SN6N 2GHWB 1EEUA 4L8SC 1OY3B 3IFOA 3NZ8B 7FABH 1ERNA 4MVBC 4MCZA 2YPVH 1NAMA 3OJDB 4JVWA 2XA3A 5BS0A 3MZTA 5CP3A 1YEHH 2FH8A 4DVRL 3QEQA 5C0IA 1I1AA 5C0EA 3VMOA 3TO4A 1FP5A 1CQKA 1VERA 3QUMA 4W6XB 3L3OB 3S96A 3BP5B 4OZHF 2DF3A 3WS6A 4WW1A 4NQEE 3NACL 4HZAA 3MRQA 5E2TL 4H88H 3TESA 3ARFA 3JWNC 3UPCA 2QSVA 1NBYB 1HHGB 4M6AA 4U2YA 1NCBH 2CDEB 1CL7L 3P73B 2QQKL 2HT4D 4EI6A 1QRKA 1VHPA 1AGFA 1NCCH 1DQLH 1RZFL 5I9QC 4XPGL 2ZUWA 4MD5A 4XPBH 4YUEH 3QR2A 3WXVH 1B0GB 3ARDD 1JF1A 1Y18A 1HE7A 4FQ2H 3ZE2F 1BFSA 2AEPL 2BNQB 4FXGB 3QAZB 4Y4KC 5D8JL 1J0YA 2IBGA 3EUUA 3JXAA 3UJIL 3KPQA 3ARGA 3ZTJH 2EH8L 2PTUA 1A02N 4WO4B 2PXYA 4Z5RA 3S36H 4XMLL 5E1HB 3WJLA 2GFBB 5J1TC 2QQNL 5DR5H 4DKEL 2ZUQC 3IB4A 2LFGA 1FNLA 5DJDB 2CSPA 5SX5K 3TBTB 1CR9L 1ZMYA 2V2WA 5E4IA 1UZ6F 5E7BA 2C3WA 3L5WA 4HIEB 4IDLA 4LPXA 1RUMH 3I02A 4XBPB 3CX5K 3K2MC 1NCWH 5T1DH 4YBQD 5INCB 4L29A 3STLA 5ID1A 1H8NA 3K74B 4I0CC 3L95A 1KTKE 4PJAF 5HHXL 2BNQE 1UM6H 1EA9C 4L4TB 1DE4A 4CBPA 4QHLB 4U1MB 3DO7B 2P5WA 4NFBA 4KQ3L 1Y0LA 1OAKL 3RPIB 3RGVA 1M6OB 3QPXL 2ICWI 4LLUB 1E4XH 2Y6SD 2ITCA 3OHXB 1INEL 2QLVB 1UQSA 3KYKL 2AW2A 4JRXD 4WFGD 1GZPA 1A7QH 3O6LL 3P77B 2XZCH 4QTHA 2OXHA 2CR3A 3O8XC 3SKUD 2WP3O 2O93L 3GKWL 3ULUC 4F2MA 4LSPL 4LCCA 2KZ1B 3EYOA 4Y4FA 1INDL 2HTLD 2ZG3A 3KS0J 5DJCB 1HYSC 4OGAD 1NSNL 1YEJH 4NN6B 4ODSH 5HYSG 1B4JH 5CINL 2VDQH 5LAXB 4R2GD 4WFFD 1A7OL 4PJ9C 1A1MB 3H8NA 4PRBA 1CFSB 2DQIH 3GK8L 4QRPD 5TDOB 3OAZK 4HKBA 2R1YA 1TTUA 4HPYH 3Q5OA 4NO0B 1DL7H 3VW3H 4WUKL 3TA3B 4UIKL 2OR9L 1MEXL 1QLEH 2NY5H 1UC6A 4F7CB 3S97C 5JOFA 2XNAB 3X14A 4MB4A 3RY5A 2DWEB 4WUUB 3NCYS 3P9MB 1RUPH 4LLMB 5CEYB 1QO3B 3BE1L 2VDKH 4J3TA 1TNNA 4IOIB 5D7KD 4E42B 3O3EA 3DRTA 4Z7WA 5EWIL 3P9LA 2ED9A 2CO6B 5IEKB 5TF1L 1JNNL 1BBDL 4HLZG 4JFED 3LRHA 5LGJB 3STZB 4QF1B 1ZHKA 1IQDB 1C12A 1I7ZB 1JF6A 2B20A 2ZSWB 3MSPA 4RGMC 1BJ8A 1X6NA 4G8IA 5GIRB 1JGVH 3U4EB 2P8MA 5HHNA 4M3KB 1EEYB 2UZIL 3U46A 4MCYA 1ADQA 4HJGA 3T08A 1CCZA 4OLXL 5TDNA 3QNXB 4PB9L 2WZPD 4LASH 3X3GL 1FNEA 3QZWG 5FGCB 3QDJA 4Y8DC 3SE9L 4Z95L 1KELH 3O6FD 2A38A 1IZJA 3LMJL 3HC4L 4HPOL 3HZKA 3U1SH 3OKEB 5HVHB 4WEMB 2AK1L 4R0LA 4WUUE 1I9JH 3ULVF 5IMLA 3QCVH 4L9DA 4RWYH 4ALAL 3SDYL 2I26N 1QEWA 3LRSB 3DROB 3V6OA 4I3RH 4Q9QL 4YR6A 3QJHA 4YHYB 3BZFA 4UDUB 2DLGA 3FQTB 5T3XL 5F1NB 2HLFD 3CFEA 3VDCA 1B2WL 4ODTH 1GC1L 4PJAB 3TBYA 5JO5A 4JRYD 2R4SL 3LHPH 1IEBB 4L8CB 3P40A 1U91A 3WSQH 4LHJB 4WHTA 4Y89A 3GUTB 4Z7OF 2QADC 4UT7H 4NKDA 5JQHC 4OZIB 3DMMC 5D9SA 3SJVD 2YBRA 4ONHA 4WFFE 3BFOA 1RURH 1CLYH 1Y6MR 3PWPB 1FLRH 1EJ6A 5FGCE 5KOMC 1KNOA 3ROOB 4YDJB 5HGAA 3V5KA 1NGPL 2FYYA 3NZHL 3QUYC 4ONFH 4U49A 3Q1SL 5IROC 5FYJH 2FX8L 1P4LB 2C1OA 1E4WH 2LTQB 4Y16A 5TH2A 5IEHA 5DRWB 3CSYB 4HUWB 1RVFH 4WI7A 1UZ6E 3I2CH 1IFHL 5SX4I 4N0RA 4QCIA 5I8KH 1OAQH 2OLDA 3SGDH 2R0WH 4GT7A 4O2EB 3IDXH 35C8L 5D7KE 4PJAE 3TT1H 1QFWH 5D70L 1A22B 3DGCR 3KNBB 1IM3A 2NR6D 5CZXC 2J88H 3MRDB 1VESA 4OZIE 4X8XA 1A7BA 5C6TH 3MRBA 3V9FA 1OW0A 2DM3A 4CJ0A 1GOGA 3PWPE 3IDGA 3CMOH 5C09D 1IILE 4XRCB 5EORH 4U0QB 2CDFA 1J1XH 4G7YH 5DQJA 2CGRL 3FQXA 1I7RA 2EDBA 3MV8D 3T0ED 3QIUD 3BQUD 1RZ7H 2ZUYA 4MHHI 4NKIH 4U3CA 4RWHA 3CLFH 2R1WB 3T0XA 3I85A 4OCYL 2AV1B 4XXDB 1A64A 3WLWD 3MLYL 5GZND 1S3KH 4JQIL 1U3HB 5F70A 1AQKL 4FOMA 3SDCA 4HUKB 3T65A 2X4TA 1MREL 3QDMA 2PO6D 4MJ4A 1JUFB 1YN7B 3U0TA 3BH8B 2HYMA 3BPNB 3BZ4A 2P4AB 2APXA 2EDRA 3N85H 1W72A 3KVQA 4C4KO 3VFNA 4N1HB 3ZKSD 2H1PL 3GSQB 3TVMC 5H94A 1PFCA 3U83A 3FCTB 4XNZB 3HMWH 3UPAA 4KKBD 4PJ5D 4CU8A 3MRHB 2W60B 4G8EA 4NQTA 4R26L 2OL3A 1ZHBA 4HK0B 3QEGH 4ZQKB 5DUML 3UC0H 1F02I 3FOLA 3FO9A 3RX8A 2XICA 5D1QD 3OX8B 4HAFA 3ZDYF 1CL7I 4P5TA 1T0MA 5FGBA 3Q3GA 3HC0A 4XMPH 4JM4L 5GSRB 1U8MA 3MTRA 3V8OA 3V8CA 1KIPA 1PX3A 4CKVX 1I3RA 4OCRH 1EAPB 4H1LG 2GIYA 1X5YA 1UH2A 4X7FC 4NWUL 2H32B 1P7QB 5DT1H 2Q3AA 3HAEB 4P46D 5IMMB 4BZ1H 1U3YA 5ERWA 3LKNA 1X5AA 2MKLC 3CUPA 5B8CB 1JRHI 4U6YA 3MA7A 2J8UF 3DRQB 2R1XA 25C8H 2QJDA 4L3CB 3WFEL 1KB9J 1LE5A 4ZDHA 5I0ZA 4LRIC 5C8JB 5I74C 2PYFA 2NTFA 3V95A 2IH1B 1Z3GH 4KTDL 3ULVE 4YHKH 4E9LA 3F12B 2Y07H 3SOBL 3GNML 1MHCA 4AT6B 1HSAA 1A6WL 2VDRH 4YXLL 4XNUH 1JE6A 5KVGH 4PJHE 3MREA 3NMEA 1D5IH 4F3FB 5B3JF 3PNWB 1OGAB 4P2QA 5MERA 2NXZD 4AK1A 3N06B 5EOCH 4NZJA 1MHPL 1HCVA 1D5MB 3LB6C 5D5MB 2XPGA 5C2UB 1UB6B 1JNLL 4XWGH 4RRPA 4BH7B 1UJ3C 5F6IB 3BH9A 3HPJB 3NZ8A 5INDB 3AREB 1LNUA 2DIAA 3QFJD 2VRAA 4OLWH 3QIBC 2NY2D 2VR4A 3CZJA 5AEAA 1C5BH 3BKCL 2BSSA 2XKUA 1S7WA 4NN5C 2PKDA 3TZVC 4N8CL 4CRPA 4HUVA 1C5DB 3RWDA 4HKXA 4CNIB 1XIWD 5CKGA 4HXAH 2F58H 3BKYH 4B41A 1DBBL 1AKJD 3BP7B 1OGAE 4AENA 3JVGC 4PLOB 3RNKA 1DDHA 5CZKA 3P73A 4JPVH 4D0CA 2BNUB 1OHQA 5KVEH 1JCKA 3EOBA 5D5ME 4UTAL 3RRQA 4LCUA 1IGFL 1PG7X 3LSOB 3HE7A 2CIKB 5IP4A 3GBML 5GGTH 4XP6L 1F3DH 1F90L 3O3AA 1KJ2H 1VPOL 1A0QH 4NWTH 4IS6B 2Z4QB 3I3DA 4V1DB 1EO5A 4N0UB 5FUCC 3J7HA 3QIWC 5L9DH 4U1GB 5DMGC 1RPQA 3G6JA 1BFOB 5DD3L 5F7DB 4R97C 1N5YL 4WWKC 3O3DB 1R3JB 1DLFL 5C0AB 1ZTXL 2YZ1A 4HCRL 4MZ2A 3K81A 4LLVB 4MX7A 3ULUL 4Z7UF 5C0CD 2ARJB 5D93B 3REWB 3ZTNH 1PQZA 1HDMB 2FATH 4ODWB 4P23C 2RCSH 3RWIB 2C3GA 2Z8SA 3PP4L 4HIEA 2VAAA 4G6MH 4M93B 4XBPA 2F53B 3CFDB 4GW4A 1QA9B 4XPHH 2J8UB 4P4RA 2CMRL 4NUGL 4ELKA 4OJFL 4R4NC 5DJ8A 3RL1B 5GS2H 1I1YB 4V1DE 5EH1A 4U1MA 1SMOA 3RWHA 4N0UE 3ZDYE 3DBXB 2HT2C 1X7QA 3ARDA 5CEZL 4U1LB 5F89A 4LSDA 1RUQL 3QFJE 4OZFA 5BJTB 1HXMB 1OTSC 3HB3D 5C0AE 1U8QB 3DO3A 3LV3A 4TVPL 4GMSH 1YPZA 2HP4A 2XY2A 1HEZB 5JUEL 5HBBA 1ZLWH 4CDHA 1H3GA 3RUGF 1NL0H 4YHPA 3UTZB 4XTRC 5GJTH 2PW1A 3HI1A 2PCPB 2OJEA 4XP9L 4XAWL 5IBUB 1JWMA 2FIKA 4YWGH 4X6BA 2YS4A 4MQSB 5GPRA 4I77H 4X5WA 1RIVH 1T66D 3EAKA 5LAXA 2ZNXA 4A2LA 4JHBA 1SY6H 3HE6B 1I1FA 3TLRA 2APWA 1YEHL 1R5VB 2IAMB 1G0XA 3B5TA 5JHLH 5CP7A 5F9WC 2MKWA 3DURA 4EI5B 5CBAB 4Y5VC 5EIIB 3JBG7 1FL6A 3IFPA 3R06A 4X99B 5LG1A 2XKNA 4LF3A 5HJ3B 4BH8B 1O7VA 4I0KA 5ITBH 2ZJSH 3LKQB 4PBWD 3GMMB 5B3JE 2IFFL 3T04D 5DHXB 3QXVA 4JHWH 1A9EA 5L6YH 2X4OB<