1CGSL

Local and transmitted conformational changes on complexation of an anti-sweetener fab
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
ELVMTQSPLSLPVSLGDQASISCRPSQSLVHSNGNTYLHWYLQKPGQSPKLLIYRVSNRFSGVPDRFSGSGSGTAFTLKISRVEAEDLGVYFCSQGTHVPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Local and transmitted conformational changes on complexation of an anti-sweetener Fab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2B-KAPPA NC6.8 FAB (LIGHT CHAIN)
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1993-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgsL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cgsL01
2F53B 1GOHA 3CJJA 5JW5B 3UX9B 3VXNB 2Y23A 3OR6A 4S2SB 3ZE0E 4HPOH 4OCYH 1GGBL 1GYAA 2O5ZH 4NC1C 4KI5D 3TZVD 3NA4A 4G42A 3BZDA 5ALBH 4HWNA 4YHLL 1FNEA 3KXFD 3LQAC 4OLEA 2IQ9L 5C0IA 1LE9B 5D7LA 1RZ7L 1OAQL 2BSSA 4M6OL 3Q5TA 1FCCA 3LV3A 4LCWB 3T3MF 1FORL 1U8HA 1PVHA 3MV8B 3SO3C 5BZDB 5EA0H 1BQLL 2IPTH 1WWAX 3MTRA 4YBLC 4PRDB 4KUZH 4X9IA 3NIFF 3MUGA 2Z8WC 1WF5A 1BBDH 1CS6A 3K2UL 2XXCB 4W68A 3MJ8B 1CDJA 3D0VB 3WS3A 4HDIB 3QWOB 1Z9OA 2DM4A 3RWHB 4EI5A 4LASL 5EIVA 1UWEH 4NBXB 4PRDA 5L2KB 4KKBC 2A77H 3DVFA 1T0PB 1BJ1H 2J6EA 1UKSA 3BN9C 4XPGL 4DK6A 1WBYB 4OLWL 1P4IL 3LKOB 4ZOEA 2EIZA 1CFVL 1EFXD 5EBWA 3QDMA 2ORBH 3B4NA 3DNKA 4RRPA 2R2EB 4ZXBC 3QHTC 3PNWA 2NY5L 3T08A 4XZUB 4ZTOL 4PTUB 4NPYB 3BWAA 4QOKE 1A3QA 1KFAL 5D71L 4IDLA 4KTDL 1MI5A 1MRFL 2IFFH 4U7SA 3U6RA 4PJEA 3LD8B 1DQLH 1A0QH 5FYKE 2GW5A 3F5WB 5EULV 3SPVA 5KSBE 3ZHLA 1JYWA 4UDTB 3CFIC 3SDAD 4FQ1L 2IPUK 5D1ZB 5DWUL 5DK3A 1MRFH 3AS3A 3LB6C 3V7AG 3LHPL 3OF6A 5T5FH 1WV7T 3CLFL 1RVFH 1YY9D 5DQDH 2FGWL 1BAFH 4JN1H 4XCCH 5EO1B 3RVWC 4CMHC 1WK0A 2IAND 5GSRB 4OCYL 1UCBH 1MCEA 5T5NG 1HHJB 2DI9A 1M6OA 3ULSA 2R29H 4TTDC 4BKLA 4K55A 5FB8B 5FKPA 5CILL 4W4OA 2OMBA 3AB0C 4NZRL 3ZE2F 4X80L 4HDIA 3RU8H 2VISB 4NT6B 2O61A 2I27N 2J7LA 2Y9RT 1OAXH 1GHFL 4BZ2L 2Z8RA 5DD5H 3FRUB 4N5ED 4OF8A 1G0DA 3LN5A 3W9DA 3KVQA 4NSKB 4C83B 1A1NA 5CJXA 3HE6B 3JBG7 3A6OA 3UO1H 4OZIB 1CFBA 2KPNA 3AU1A 3UTQB 1KEMH 2MFNA 4JGUA 5FA3B 4MAYD 1X5GA 4FZEH 2R0KL 2XQYG 2DQHH 1MCBA 3CSYA 3LQZA 4LBEB 1CTNA 2FJFA 4LQFL 3O11B 1DSFL 1D5IL 5I75B 5DD3L 1UB6A 1U8PB 1GGBH 5JXEA 3O6LL 3IGAB 3E6FB 5MP6L 1KCSL 3DETD 1YMHA 4PJ8D 5ALCH 4FA8A 4PR5B 3WFDH 2C3GA 1W72A 3NCJL 4MMZC 2D2OA 2DQTL 1AXSB 3E6HA 3GHBH 4R26L 4NWTL 1ZHBA 1NPUA 3FB7B 1VACB 5E24E 4PJXB 1D7FA 2JKXA 1U8JB 1QOKA 2ZCLL 1CL7L 2DOCA 5FHAH 2G60L 1G1CA 3P4LA 4U6XB 1MQKL 3LKNA 5L2JB 5EZJA 4KXZH 3GB7B 5J1AA 1HE7A 1LEKA 2QQLH 1A14L 3KWWB 3QI9D 4KPHL 2CK2A 1UJ3A 1ZEAH 1A8JH 2GUOB 4D0CB 3OSKA 3V0WH 3GB7A 5HHNA 3O2DL 5FYJE 1NCDL 3ARPA 5LJYH 3FOMA 3HRZB 3GNMH 3Q6GH 4JRXA 5FFLA 3DVGB 4Z7WA 1D9KB 2AGJL 1HOCB 4XVSL 4Y2DC 3V52L 5FCUL 4AENB 4Q9CA 3C08L 3C8DA 2H8PB 2A6IB 1C08B 3G6JA 3UPRB 3MXVL 3MCKB 5CWSB 4P46A 4PJGB 4PRIE 1A7RL 4M7JH 4UB0L 3FT4B 5HPMB 2OP4H 4JDVA 2YD7A 3HMXA 5BRZA 4CUCA 3TVMC 5HXMA 5FAAA 4XP5H 4Z7VF 4JDTH 5ACMA 1OL0A 1SEQL 3MGOA 5INCB 1QUNA 2APBA 5INDB 4KGJA 5EUKA 2Z4QA 5D2LA 5DTFB 2DLFH 5JHLL 4R4FL 1RJZB 4UTAL 3E0GA 4LPXA 3WMSA 4MNHB 1QLFA 2J8UF 1NUDA 1IARB 3B6SB 3C5ZD 1NUGA 3SDXF 1KTKE 5EO9B 2A9MH 2X9WA 1KENH 1XGUB 5DF0A 3HLAB 2AERT 4U1JA 2FECL 3IDJA 3FB8B 3CFCL 5FYJH 5D70L 4DKFH 2YSSA 3HG1D 5CZXD 1JTTA 1ND0B 5EBGA 4JGJA 5E4EB 5E2VL 4LCIH 5L2JA 4U4BA 3O6FA 3QUZB 1BVLA 3T0EC 1YY9C 2HKHH 1AQDB 2HT3C 2R23A 4S1SH 4JFED 4UIMA 5E6IC 3ZYZA 5SWZB 3QQ4B 1AGDB 2NW2B 2DLHA 4KMTL 4IOFC 3MFFB 1N5YH 3QB7C 4H8WL 3O3UN 4P99A 1P7KB 4ZAKD 4X4ME 5F7WC 12E8H 3AS1A 4OCWH 5DJ2B 3RP1A 5HHQB 4PY8I 5TQ0L 4WI3A 3VXPB 3LEYL 4MA1C 4ZUUB 4HH8A 1S5HB 4OCSL 4N90D 3RWCB 3HC3H 5DC4B 2AJZB 4KK8C 5DI8A 5DC9B 4JKPH 4FQXA 3WXVL 3FOLA 4Y1AD 3P4MA 5HY9A 4XNQA 3W2DL 3P3YA 2OTPA 2X4UA 4JZJA 1INEH 3WKML 1XEDA 2HH0L 1JNLL 3B9EA 3STLB 4JHAL 4H26A 2F54D 4NWUH 1QSEE 3C5SB 3QUXD 3O4LD 3HE7B 3M17A 3QEHB 4PJEE 3LS5H 4PJIF 2HFFA 3QXTA 4ISVB 5HGBB 43CAA 2ZUUA 4WI5A 3L1OH 3V4VH 1QFPA 1AHWC 1WTGT 5IESH 3O4LA 3QUXA 3QO1B 2O93L 1T7WA 5IOPA 3KPSA 3U9PH 3BVNA 2YN3A 2GFBB 1E6JL 3VXMA 5JTWA 3DX7A 4P5TC 1HXYB 5D7JA 4QYOB 5T3ZE 5DJAB 2CSPA 5E5RB 3MLZH 3SDAC 4NZUL 4OF5A 3VGAB 1GZPB 2VSCA 1A5FL 3R1GL 2X1WL 3ARDA 4Z7VA 5HI5D 3HAEA 1AGDA 4KI5C 1ORSB 2A2QT 2C3XA 3RGVB 2MPAL 2ERJB 2JIXA 3L9RA 3BEVA 2E7MA 4ODVL 1ROWA 4YDIH 1JI1A 1BHGA 3CVHB 5CD5D 1KLGA 3DUUA 1CCZA 5DXWA 5DS8B 2ADFH 5B4MD 2CIIB 3QR2A 3CX5J 4QXUH 1CLYH 3R8QA 4ZXBD 3VFPA 3HRPA 4JM4L 5DRZB 5IW1A 3VRJB 2HRPL 1OAKL 1IL1B 4WTZA 5GGRA 3VXMB 3DI3B 4MXVE 5DMGD 4KRMB 2ADGA 4YPJA 1MCLA 4LAQL 5IIEB 3RVTC 3H9SB 1QFUL 3RDTA 1CLZL 4KK5C 2XI9A 4OUOA 4GT7A 4TQEL 2FX8H 2I24N 3PHOB 1XH3A 2COQA 4CDHA 3RWJB 3G08B 5TE4L 3B43A 1P4LB 1OGTB 3QG6B 1RUAL 2NXYC 1G7LB 4ZUSA 4NNXB 1SJHB 1QZ1A 3VFUB 1FGVL 1XZ0B 1KJ2L 4G8GA 3U7YL 4LLDB 1FHGA 4UT7L 3OBAA 4L4VB 1CR9H 1LK3H 4XNMA 2VLRA 4XZUA 5I15H 3VFMB 25C8H 4M62L 2DIJA 3VXOA 3DURA 1RIHH 3PF2A 3TZVC 4UT9H 1X5ZA 2PXYD 2Y1VA 1N59A 3EOTH 3GBNL 1LO5A 4DVBB 4F57L 1W0VB 3WIFA 5GGUA 1R5WB 1A7QL 2QADD 5C0BA 2VNCA 4CVXA 4GAYB 4IRSB 3QBTB 1WT5C 2MMXA 1FZOB 3H3BC 3ZYOA 4CADA 1PYWB 2E6JA 3UC0H 4DVBA 1X5XA 1YNLH 4Y4FB 4LCYB 4QRQA 1BOGA 3SE3C 1WAAF 4XH2B 3MRMB 4YAQA 4LVNB 3CVHA 3KLSA 4NQTA 4OGAC 1V7MH 4M1DL 4PRAA 4HIHB 3QIUA 1BIHA 2R1WA 4U1SA 4XNMB 2EKJA 5C3LD 1ADQA 1MHCB 4NO3A 5CSZB 3WL9A 4QLRA 1PQZB 3BH8A 2BVEA 1CXEA 1UWXK 4JFDE 3TA3A 1NLBL 4QHUA 4U1IA 1J11A 5DLML 5C0AB 3LN4B 2G5RA 1BGXL 4K7FA 3UAJD 3KHOA 4YXHH 2FYYB 2N1KA 4OZHA 3IRPX 3RWJA 2ZUTA 3VGDA 1KN4L 4NN7C 2V2TB 4NBZB 3MOAL 4KC3B 5BJTA 5I1KH 1XF2B 1KCUH 2NTFB 1EX0A 1RUML 1BECA 1S9WB 4YXHL 3ZDZE 3IXAB 1X5FA 5ERWB 3ALWA 3V5DA 1BQUA 4HMCA 1BZ9B 4HUVA 1M7IB 1WIOA 1S7UA 3GM0A 2VN7A 5I17A 5K9OB 1T03L 4FMKA 4QXGH 1T2XA 2ERJC 5DDHB 5LGJA 1CFSB 4MCZB 4OSUL 3LH2L 5I75C 4P4KC 1X7QA 4DVRL 1CK0L 3PJSB 1KTLB 2FO4B 1N4XH 4XX1G 1CK0H 4WNQA 1V7ML 2D03H 3TJHD 2E6QA 2MHAA 3EJZC 3LQMA 5C9JA 1F4WH 1TJGL 4WHTB 3U48A 1MAKA 1VGEH 5BZWA 2YPKA 3VFWA 3EYUH 4C54A 5F7UA 4YC2B 4JJ5A 4G6MH 2AV1B 1FFRA 3CXDH 4NUGL 5D7IF 2J88L 1BZ9A 3HE7C 2VITA 3I6LE 2IH1B 1L0YA 2VLME 2HT2D 2X1QA 3WJJA 5DJ0A 3K4ZA 3ZDZF 3W39B 4JZNA 4PJDE 3BUTA 3TCLB 1DQQA 2R0ZH 3V2AR 4G8GE 3NZHL 3AGVA 4XXCC 4LGSB 1ONQA 3AREC 2BRRH 5T1MB 4JHWH 4EIZC 4Q9RH 4PTTB 3CFEA 3WE6A 5IJKA 1HHJA 5HGHA 1A6TB 1DQDL 1WFTA 1I9IL 5EC2A 3MA7B 5IFAL 1UYWL 1F97A 2HG5A 4K71B 3LS4H 3PP3H 5ID1A 4WHTA 4F2MA 4ODTH 3BGFC 4GQPH 3MRRB 3OKEB 4S1QH 1Z9MA 3QDGA 4JFDD 1AXTH 2H2SD 3PIQA 5TFSH 1E4XI 3BPOC 1CE1H 3C9NB 3PDGA 1FVEA 4K3DL 3VCLA 3CUPA 3C5ZB 1FVDA 5KSAB 1JYVA 5EWIL 3V4PL 5CZKA 5D7SL 5CEZE 1EO5A 5FGBC 3F5WA 4FTVB 5HVWA 4YZFF 2EYSB 3QHZL 2AJSL 1JVKA 1IZJA 3BDYH 2IQAA 4QRPB 5EZJB 4AM0B 4Z77B 4NIKB 4JM4H 1ONQB 4G7VL 2XYCA 1OPGL 5C3TA 3H3PH 3GBNH 4KTEL 5KVEL 1NAKL 3BXNB 4FQXC 4Y16D 5C0BE 2AJYL 5FM5O 5BV7H 1ZT4A 5KS9A 3GUTB 2IPKA 3WIHH 5E9DE 4R3SA 5DVMA 2HA1A 3BIKA 5KSVA 1N0XL 1YUHB 4EI5C 1CR9L 1LK3L 1F4AA 3OKEA 4Y5YA 4YHOL 1OM3H 1I7RB 4QHKI 1QO3A 5EUOE 3VFWB 5E6ID 4CJ0A 4QOKD 3OKYA 5TH2A 1P84K 4OLVH 2BOBB 1UKTA 3T0ED 3GHEL 2EH8L 2BNRA 3O3BB 4LCWE 2XG5A 2RQ8A 4KDWA 2O61B 1RIVH 4EZMA 2WAHA 5HI4C 4LSPL 5JDJA 4UINL 2EYTA 2Z93B 1A6VH 5AG9A 4LAQH 3SDYH 3HR5B 3RVUC 1Z6JT 2GTZA 2VDNL 5CZVH 2DN7A 2R9HC 1T04A 5KVGH 4ZPVA 4D0DB 1KIRA 4U6YB 4XBGA 4LHUG 3ZKQD 2MKLC 1ODAA 3GSXB 3HRZA 3DBXB 4I8DA 3ZL4L 3PIQB 1JTPA 2BVOB 4M5YL 1M71B 5DJYA 3L3DB 3TVMD 3JWOL 3BP4B 3OZ9L 5KVFL 3UPRA 2JCCB 5L0QC 2ARJQ 4JRYE 4KZEL 1MY5A 4OCRH 2EDDA 4XMLH 4I5BB 4RZCB 1JPSL 3L3JB 1S9YB 4PRHA 2VABA 2EE9A 4JAMA 4MQTB 3STLA 4GRWF 4ZSOE 4P2RA 2XWBB 5KOMC 1J1XH 1MCPH 5MI0C 1OY3B 5EOCJ 4KJYA 5HVGB 5TQ0H 3KS0J 2NW2A 3OKNA 2X4NA 3QIWA 5JDSA 2ZUQC 1BPVA 3MLUH 4RX4A 4NKIH 1NBYB 3NZ8A 4HIJA 1NFKA 1U8KA 4LKCA 4HH9A 4P2RB 5DMIH 3U9PL 2H1PL 4OIAA 5EFIA 3HI5L 1FFPA 1RHHA 3VXME 1FE8H 5JW4Q 2DKUA 3HMXL 3S98A 3TNMA 5C86A 3I50H 2A38A 4AQOA 4P5TB 3TZVA 4G6KH 4J8RB 4LSDA 5FGSA 4LSRL 5DHYB 4NWUL 2EICA 4Z18A 5DK2B 2OZ4H 4RAVA 1A4KA 3BIAX 3KNBA 4WW1A 3RY6C 3ZKND 3FQTA 3V8OA 1QACA 4ONFH 3FQWB 5FUOH 1I8MA 6FABH 1G9MC 2AAVA 1ZV5A 5I18H 2VIRB 3P4OA 1S3KH 2XQBL 4PJ8C 5FOJA 2X4UB 1CU4H 3EIFA 2A73A 1F8TL 2FBOJ 5HYJD 5F6HJ 3HC4L 1UEYA 4L4VE 4OD1H 1XGPA 4X6BA 3S36X 4IRSD 3FJTA 3HZVA 2HFGL 1WZ1L 2HFFB 4ISVA 4QT5A 3C6SB 4WFGD 3OXRA 3C6LB 3TNMB 4FXKA 3C8KB 2CK0L 1VEPA 2NXZC 4H0GA 1J8HB 3U2SB 1CVRA 1FYTD 4JPWL 3MV8E 3QT2A 4MJ5A 3TN0B 4BZ1L 4ETQB 2MWCA 5IHUH 4DW2H 4YDJA 3D2UD 1R5VB 1A6UL 2OP4L 5IG7A 3DVIA 4TSAH 4U1GC 2VDKL 5GJSH 4J3VA 3ZHDA 4N9GB 1UM6L 1K3ZA 1GGYA 4RMVA 2HYMA 3OB8A 3SJVD 3IVKA 3OR7A 1CD0A 1ORSA 2VDMH 1XT5A 4JQIH 5IMOB 3I75B 1AJ7L 3X13B 4HH9B 3V6ZA 1S5IH 3UJTL 5EN2B 1Y18B 4H1LB 3TN0C 3W9EA 3L5WB 4K3JH 2XTJD 5D7JC 5HI3C 5IMOA 1B9ZA 4MSWA 1F00I 4JFZL 3MRQA 5IKCA 3WO4C 5SWSE 3B83A 1HHIA 3QCTH 5CIPH 2A6DA 3WBDA 3H9HA 1KPUB 3VXMD 2JJTA 4QRQB 2FZ3B 3ZLQC 2VB5A 2CDFB 3RQ3A 3GHBL 1U92A 4N8CL 3PWJB 3S3JA 3OJMB 3MV01 5FM4A 2B0SH 4HJ0D 2AXHA 3O6LH 1BD2D 4FQXB 5TF1L 1F6AA 1DBJH 1IFHL 2H26A 3L5WA 3QNYB 4PRIA 3V52H 5I1DB 3BP5B 4NKDB 1AE6H 4QF1A 3WO4B 4YHPB 1MCFA 1QEWB 3MRDB 1SJVA 1UZ6E 3X17A 1N64H 1W8OA 5AYUH 1CG9B 4J12A 3OWEA 1JWSA 1F6AB 2RJMA 3FB5B 4YHNA 1VPOL 2MCPH 3O3DB 2FWOA 5IT2H 3U0PB 3S96B 2X41A 4WFGE 4ELMF 4YHML 1QSEA 4EN3D 2A6JB 2CDFA 2QADC 4Z78B 1GHFH 1RZJC 1UZ8B 4KY1H 1CD1B 3OPZL 2ESVA 3RVXC 2F54B 4K71C 4EUPH 4QY8A 5HVHC 3DGGA 5FUZH 5EZIL 4WHYH 4YHYC 1ITCA 4XCEA 2V2WA 4RFOL 4NP4L 5JPMB 3IRZA 1Q9WB 1UZ8A 4R26H 3ROLA 3PWNB 5DDHA 5LGJB 4TSBL 4OZIE 4G8GB 1HZHH 5T3ZL 4D9LL 1B2WH 5E94A 5EO0A 1X7QB 2M1KA 4L4VA 5KJRH 1AO7A 5GHWL 4RGNE 4J3UA 3R0MA 1LNUA 2BMKA 4HIIB 4WTXA 5CJ5A 4IMKA 5DYOB 3UJJH 1W72H 3MV11 1ZHNB 4PJ8A 4L9LC 1JWMA 4HQQL 2AS5M 2DS4A 1H8SA 4LLUA 4P5KA 1R3HA 4HFWB 4I0CC 1AC6A 5ICYB 1KJ3H 4C57C 3KPPB 4NYLA 5DO2D 3ZMRA 3H9SA 5B39A 3DROB 2CDEB 3GMLA 3SCMA 3EO0A 3QSKB 1A2YA 4APQA 1YEFL 3IKCB 4FQQA 2H32A 4XP1H 3WFHA 3KR3L 1K8DB 4HKJA 2FSEA 3GMMA 5H35B 4BK4A 4JB9H 4KMLB 4QKXB 1BEYL 1OGTA 4X80H 1FNGA 5DA0B 1OTSD 5IBTL 2R4SH 3BESR 3EW3B 3S6CA 2VC2L 3GMLB 4JFHD 3FONA 4MJIB 1OP3H 4KKAD 4JFFA 5D5MA 4Z9KB 1JPTH 3RL1A 4NKQB 3O3DA 5L2KA 2Z8SA 2ZNWA 5DFWH 1FNEB 4JFPA 4TOYH 3D85B 4OLWH 1KTLA 1T7YA 1UA6H 3MLRL 1T7XA 5DQJA 5KVDH 2PKDA 1ZT7B 1CBVH 1U36A 5D5MB 1YNTA 1FNHA 3I3BA 3TBWA 2PW1B 1UWEL 1L7TH 4WWKA 5E00A 1V3JA 2HMIC 4WEBH 1A6AA 4W81A 1T1XB 5C71A 1OTUD 1P9MC 1JPFA 2CDEA 3SCMB 3CDGA 3MGAA 1R5WA 3IKCA 3KPRB 3SBWC 5EOTB 4C56B 3FB6A 2VZTA 2NXYD 2P5EE 3GSWB 4LIQE 3WFEL 1B88A 1W0YT 1TITA 3CC5B 3CFKB 3MLSL 3DECA 5CGTA 1LEGB 3ZSSA 2X4QA 3HUJF 2NXZB 4JO4H 4M7ZC 4WO4C 1P1ZB 3UCRA 5LVEA 5IQ9A 4HJGA 2O5ZL 3SKJL 1IKFH 4I0PB 4S1DD 3EOAB 2HN7A 2O5XL 4EOWL 5D2NA 2BVUA 3BH8B 4P4KB 3MNVB 2Z35A 5B21A 3D1MC 3NN8A 2BCKA 2P8PA 3MUGB 4PB9H 4RISL 1HI6A 4HJGB 4M3KB 3QULB 2DQCH 2IF7A 2VC2H 3MZTA 5I1AA 2MJWA 43C9B 2FO1A 1M05B 4QRTA 3QDME 2F8OA 5H35A 4LASH 4I77L 4HCRL 3ARDD 4JCMA 1G9ML 2NY4D 3Q3GB 2J8HA 4HW6A 3Q2CA 4MWFB 4BA8A 1T6WA 3QFDA 3VI3E 1DBKL 3JV4A 2FJFB 5K9KB 3PDOB 1NDGB 5HHMB 1KB5H 1JF6A 1YPZE 3P4NA 4I0PA 1WVZA 2I07A 3DSFL 2CH8A 3OAUH 1XGRA 3KYMA 3PQYA 4YHLH 3BP6A 2LVEA 1CFSA 1L0QA 3GMPB 3E6HB 1ZSDB 1D6EA 4FG6D 3QULA 5D7LB 4ZNEA 2YXFA 3BW9B 1T80A 1MH5B 5F3BA 3E3QC 1UB5B 2YA1A 4IDJH 4JFEE 3MGTA 2A74A 5J7CC 3MV9A 1EHNA 5CS7A 3BP7A 1FZJA 2BDNH 4NQCE 5TQ2L 1SBSH 5D1ZA 3UTSA 5E8OA 5FUZL 4YWGH 3QCTL 1MH5A 1JFQL 2D31B 2CKNA 5GGTA 4JFFE 4MAYB 3OPZH 1OP3K 1CTOA 4P2QD 4IRZL 2Y5TA 5LCVL 3HNTH 2NZ9D 2Z93A 4X4YA 1KIQB 1DN0B 3L6FB 2I07B 3FTGA 5M95B 4PD4K 1CXKA 3DRTB 3NCYS 1H3XA 1SJEB 4NHCL 1KIRB 3EFDL 4U6YA 4XBGB 3P0YL 4LEXL 1J7VR 3QDAA 2Z0BA 3K46A 4P46B 3WE6B 3FTGB 1ZS8A 2CKBL 2IMMA 4D3CH 2CGRH 2BY2A 1DBJL 2K7PA 3EO9L 2V17H 3AAZB 4PJXA 5CGMA 1YJDC 4M61B 3QDGB 2YK1H 1WIUA 4RZCA 4PJ9C 1JJUA 5SX5K 4PJ7A 3AU1B 3QUML 4Q9QL 3MRLB 2JJSC 3X3FH 3OHXA 2ARWA 4MNHA 1UM4H 3D39A 4PLNC 1RD6A 5EBWB 3DMMB 3TBVB 5C0JA 5LWYL 4AIZA 1FNSL 2MTPA 4M4PA 5FECB 1ZK9A 1RK1A 2ZKHH 2ESVD 5A2FA 4UUJA 4PRHD 4QOKA 1F8TH 3SGKC 3SEPA 3DVGA 3VFRB 3UEZA 2RFXA 5FGCE 4CGTA 5IJVA 1XF1A 5FUOL 5C09A 3SKNA 2E5EA 4OFYD 4PJGA 3FZUC 1DP0A 4PP1C 3A6BH 3EJYC 1AGFA 1NMAH 4M8QA 4OUUA 3T2QA 2PTUA 1IJ9A 1TZGL 1CL7I 3K8KA 1SY6A 3GBLA 5BVJA 1JMZA 4BQ6A 4GW1A 4ZOCA 1AR1C 1NC2B 3BGMA 1BFTA 5EU6D 3K8LA 4Z0XA 1VCAA 2A83A 4MNGA 5FCSH 4DW2L 2H1PH 4XWOC 4G43A 3EHBC 5A3ID 4F7MA 1QRNA 2I60L 3AC0A 3HNSL 2E7LA 1MIML 3CD4A 1HIML 4KI1A 1ORQA 3B2VL 2VDPL 1V5JA 3QEQD 3C8KA 5GGRY 3QRGL 4I2XA 4G6AC 1TQCB 1WC7A 4JQVC 3GFUA 3VGGA 5EIIA 4YUEH 5E9DD 1HQRA 1HILA 3P4MB 2X4OA 32C2B 3N9GH 5HY9B 4ZFGH 5GS1A 3BDBA 4OI8A 2Q20A 4KKNA 2PTVA 1NL0H 1E28A 4I18B 1HSBA 3QI9C 5A3IC 4HULB 4V1DD 5ILTH 4FP8H 4H0IA 3NGBC 4PJ5D 5IVOA 1I1YB 2DBLH 2VDQH 1AR1D 2JJSA 1A1NB 2BK8A 3RL2B 1K5NB 2X89D 3JUYA 3UZQA 4Q7DA 2F8VA 3RA7L 2HFEB 4Z7UF 2BHZA 1OLZA 1HKFA 3NACH 1ZKAA 3CSYB 1PKQA 5IB1B 3ULVD 1UJ3B 2ENSA 15C8L 4YHNB 3B6SA 3FZUD 4JRXE 1BJ1J 4Q6IB 3HMXH 1U8LB 5LCVH 3FFDB 5T1LB 1F02I 1JZ8A 2IAMC 1JGEA 3C5JA 3TEUA 3NH7L 2CQVA 1MI5D 5EFIB 3N1GC 2VR5A 2IMNA 2LU7A 1SBSL 3G6DL 4Z7UE 3PWUA 5AAWA 1GSMA 1U8LA 1AI1H 3U0WH 4FOMA 4QY8B 4CN1A 4G5ZL 4JO3L 5ITBL 3BH9B 3L7FB 3PWJA 1IMHC 1JPST 3ILQC 1R5IB 3ECBB 3BE1H 3LPGA 3NAAH 1N0XH 4OLUL 3KWWA 1DEEB 2APFA 3JWOH 1CGSL 1EHXA 2ED9A 1YEEH 3HPJA 5IVXA 4MX7B 2AJYH 4ZO6A 1I9RH 4GMTL 4KTEH 1OP5H 1IVLA 4X4MA 2XWJB 5SV4A 1I1AB 1QA9A 4ZFFA 3VD7A 5IVXE 3SDAB 5F7KC 3NTCH 5J89A 5DZLA 3P0GB 4I77H 1NCNA 3G6JB 2WBJC 3MRGB 3D87B 1G7LA 2DRUA 4ZUSB 3VW3H 4ZTPL 3QHFL 3FOLB 3SDAA 4J4PA 4AH2A 2H32B 2R2HA 1ND0A 2AJXL 5SWQA 3W5MA 1JYXA 3SDDC 1OT1A 5KW9L 3CFDA 4JDZA 1TTUA 2OXGA 3RDTB 2PYEA 4K9EH 4P2QB 4U0RC 4MXQC 2O5XH 3P40A 3LS4L 1NMBL 2YEZB 5E8PA 2QL1A 1R3LA 1DVFB 2F53A 1HINL 3L95B 5K9QG 3MFFA 1QFWH 1J1PH 3DHJA 2DYPA 1CLOH 5DVKA 1UM5H 2YPLE 5MI0B 2CIKB 1ZT7A 2AQ1A 3H9YA 5HGDB 1CXLA 4MNQB 3T0EA 1OSZA 4FXLA 3MSPA 1QBLH 3PGFL 1I1CA 4NO0A 2IANE 3HC0A 2MCG1 3GJFB 3MBED 2ZCKL 5D2NC 4HAFA 3T77B 1OPGH 2IALB 5HYQB 5GRJH 2HLFC 4L8DB 1BOGB 3S7GA 5CKGA 2W0PA 1H15A 2NXYB 2OM5A 4ODHH 3P73A 1GCFA 4WI6A 2DJSA 5C0EB 5HDBE 1Q9KB 4S1RH 5GZOC 3SBWA 4Y2OA 5ITFB 4GQ9H 4G8GD 5DRWA 1KXTB 1TJGH 4P3CH 4WEUD 5DJ8A 3FQNA 3PWVA 4HKJB 4UOW1 4Z7OE 3UTTD 2NMSA 1PEZA 4KDTA 1EHLH 2XZCL 5CSBA 3WCYA 3AS2A 4ODTL 4U1KB 2YD3A 3UJIH 5DMJB 5HSFA 4PRNA 2FCBA 4A2MA 3FQNB 4MZ2A 5LBSH 1YC8A 1T03H 3LQAH 3HC0B 2J8UA 1QSZA 4JB9L 2NW3A 5DT1H 5I1AB 1TQBC 1Z0MA 2V7HA 4O9HL 1MCCA 1QQDA 2VUYA 4MVBC 1MCOL 3QUMB 2IAMB 1JRHH 2HJLA 3O8XC 4GRWB 1NCBL 4NM8H 5FM8A 5CEZD 3I84A 4HKXA 2NW3B 1FZOA 1NAMA 2QTEA 3DXAB 1AIFB 5GGSY 3BN9D 4XHJC 3HCVA 3STZB 2D9QB 3MOAH 3RAJL 1U8OB 3FO9B 5C6PB 5KS9E 4TULL 3SPVB 1SMOA 2DQIL 1KB5B 2BVPB 2ZPKL 1S8DB 3EYUL 4N68A 4U1HA 4NO2B 3SGEH 1RUQL 35C8L 5JHDB 1J0ZA 1UXSB 2QHRH 1VGEL 5J3HC 9CGTA 2E3VA 5C0AE 2YRPA 4TUJB 1F3RB 3RVVD 3RWEB 2YPVH 4P59H 4M02A 3F7VA 5D7LD 1UACH 3SKMA 1MFBH 4K7PL 4LSUL 2DTSA 3T65A 4E41D 3K7UA 4J1UA 5DD1L 5GRXG 1RURH 3QO1A 5EOQH 1KJVB 5F72S 4OV5A 1W0VA 2CD0A 1KC5H 2BVYA 4LSVH 4OZ4A 3D3VE 3DTXA 3ZTJG 4M1DH 4M48L 1I8KA 4I48B 2OXHA 1U93B 1LQSR 3TPKA 4NC0B 2XTJB 3B2UD 1DL7L 3DRQA 2XT1B 3X3GL 1B4JH 1JGLL 4YHMH 2NLJB 2EZ0D 4YO0A 3FO1A 1KNOA 1OTSC 1S78C 4GRMA 4YDKL 1EO7A 3B9DA 1D5MA 2MCPL 3GJFH 2YD2A 4GRLC 4KU1A 3VGEA 4XNYL 5CSZA 3FO2A 3WL9B 4XCFL 5DA4A 3RUGF 3WFHB 3GMNA 1HNGA 5BMFH 2AJ3A 5CP3A 2Q6WB 1D9KC 2H2PC 4JVPA 2FO4A 5ETUB 1NMCC 5DT1L 4AIOA 1IFHH 1NLBH 3MNZB 5CEZL 1J8HD 1AFVH 3B9AA 1S7XB 4HC1A 3NN8B 3KGRA 2AABL 4HKXB 3UBXI 5D2LF 5IGXH 5KN5B 4O4YL 2Z31A 2NTSP 1R24A 4R7DB 2FD6L 4M9PA 3VJ6A 4L8SA 1EIBA 1JGDA 1FG9C 1NFDA 4KHXL 4U1LA 3MXWH 4KVCL 3NABH 1D5ZB 2N4IA 4D9QE 2E27H 2DAVA 4LPCA 3SY0B 3RNKA 1IE5A 5DJZB 4HFUL 1HK6A 1U3ZA 4GOSA 4OGZA 4R7NB 1YNLL 4KTYA 3VMNA 4K94C 1D5BA 1QSFD 5J0BA 2AK4D 2P5WA 4A2LA 2NY0C 2F54E 4YIQB 2DDQH 5IFHL 5D1XD 1J9CT 1KN2H 2AK1L 1RJLB 2ZCKH 4Y5XC 3RVXD 4TRPH 3MNWB 4CW1A 4G8FB 4IM8A 3PQYE 3MPCA 5CFHA 5AWNL 1G1YA 1R3IH 1AJ7H 2ZG1A 4NDMB 5FYLH 4YDIL 2ZJSH 3UPCA 1JGVL 1KTDA 2M2DA 4M1GH 1C7TA 4QRRD 5F3BB 1GZQA 1A7OL 1CFQB 4MA8H 4OD2A 4W6YB 4FFWC 3TNNA 4TVPD 3WNLA 5FOBB 1UM6H 1F2XK 3R06A 4K8RH 1A5FH 5FO9A 1GGUA 4NN5B 4XNXL 2O26U 3PHQB 3VXTA 3O2VL 4ZS6D 4J3XA 1KXVC 1QFHA 3RIAF 5KW9H 4YPGB 4K94H 4W4OC 5IHUL 4G6FD 1MFAL 3BAEL 2X09A 5TDPB 2Q6WA 2KQMA 4IS6B 2CK0H 1A7BA 4HJ0C 1CLZH 1EVTC 1MLBB 4I9WE 3H0TB 4NNYA 4AT6A 3K80A 3CFEB 1EEYA 4YPGA 3O6FC 1FH5L 3P0VH 1OGAD 3BD4A 4BFIA 5EUKB 4JPKH 4FZ8H 3NMEA 1OAKH 4J4PD 3TYGH 1WJ3A 1CU4L 1F6LL 1SJXA 4G8IA 2F5BH 3MUY1 4U05A 4LSSL 2UVEA 5L9DL 1UFUA 1JHLL 2Y7QB 5DK2A 4YEFA 1E28B 1HSBB 5ANMB 1IAOB 4NFDA 2V7NB 3DX8B 4LHUB 5IMMB 4LF3A 4XRCB 5F9WC 1XF4B 2ZUQB 5D93B 2VLRE 2V7NA 4WU5B 5IV2B 4RIRB 2EDRA 1U2CA 4LMQE 4FQJL 3ROOA 5ABDE 2VZ3A 1K6QH 1MFCH 1HSAB 4MQ7B 5DUMH 1G9EA 3VD9A 4NKIL 1E6JH 3EFFA 3FN9A 4FFYH 4AY0A 1YY8A 2GJ6E 3B9VA 4IJ3C 4OI7A 1ETZB 2JCCE 3INUL 4WFHD 1FO0H 3PUCA 5EU5A 2DYPD 3OB0K 4KXZI 1EJOH 1C1EL 1Q0XL 3VFRA 4E42A 1YY8B 2OR7A 3FT3A 3LZFH 4N1EA 3L5JA 3HMWH 4EDXB 4OQTA 4X6CE 4YGAB 1K2DA 4YLQT 2B5IB 4JN2B 4JREC 2NY6B 2VOTA 4MCYB 1EFQA 1I1FA 2H8PA 4AQ1B 2AV7A 1BVLB 1UJ3C 1HN1A 1OGAB 1JHLH 2VQ1A 4PLJC 4LHJB 4MS8C 3SOBH 1CICA 1UQSB 1FFNA 2Q8BL 3MLXH 5C07E 3D18B 5HPMA 4AM0A 4PJ7B 2YA2A 4TTGA 3DJ9A 1NGZB 1OTTD 4JZOB 4PJHA 3MC0A 2CRZA 4X6CB 4PY7A 4Y8AA 1MCHA 4PJ9D 4X6DE 2DLFL 4L9LB 5IK3B 3MRBA 2VDPH 3V6FA 4ZYKA 4QRPE 3CX5K 2HVJB 4NN6B 4E0RB 2I60H 7CGTA 3JTTB 2X05A 3QH3B 4OKVB 4EDXA 1G7HB 1TJIH 2GEEA 1CDCA 7FABH 4PG9B 4XNXH 4DFIA 1YN7A 3H9SE 4MLSA 4YH6A 1A4JA 5KG9A 4Z7QF 3MXVH 3VGHA 3MACH 5HYJA 5GS3A 5D7IA 1OM3L 2VIRA 3P4OB 4XBEL 1CN4A 2EDKA 3PWPB 4BK5A 1RZ8B 2JE8A 5B38B 4QTHA 4PG9A 3NCMA 1JNJA 3Q6GL 1K8IA 4L1DA 4YXKL 5AWNH 2NY2B 3VFOB 1LO3H 4JPVL 3MRQB 3PXHA 1NC2A 3ES6A 4L5FH 5HYSA 5TGBB 1O7SA 4P3DA 5L7XH 1JE6A 3HG1E 5JPNB 5FM5M 1C5BL 2FDBP 1Z9SA 3VRJA 5I1CL 3G5XB 1FG2B 1B0GA 5DJ6A 3QEGL 2IC2A 4K3DH 3VFSA 5H94A 1BP3B 2VQTA 3SGJC 3MRIA 4A6YL 4KUCD 2SEBA 3NABL 2VQ1B 5TFSL 4FQ2H 5GS1B 5C0CE 2A9NL 3O2VH 1ED3A 1FZKA 2H45A 4P23B 1UKQA 2FD6H 5DI8B 1OT2A 3DARA 3LKQB 2EYTB 4X9HA 4JY4A 4WWKD 3R0NA 4LQ1A 1HQ4B 3C09C 4DK3A 3QP3A 3UXFA 3HB3D 3U82B 5FCUH 2AGJH 4BQBA 4UBDC 4NZTH 2ZJSL 3RL2A 4LRNL 4L29B 1DVFD 3K4DA 4OIIH 3G5VA 4OLZH 1JMXA 5FYKD 3WIIL 2HT4C 3O4LB 3QUXB 4PJCE 4C59B 1BWMA 3DUSB 1A3RL 1X4YA 2FJHB 2PCPB 3WUWA 2AVGA 4HK0A 2D7PA 4S11A 2MQ3A 1J86A 1DL7H 1TIUA 3QFJA 5MHSE 1YN6A 1BD2B 4FHBD 1RIUH 4FQXD 1J0JA 5IBUB 1VB9A 4QYOA 1IAIL 3V4UH 2PETA 5C6TH 2CMRH 4GG8A 2VR4A 3LD8C 3IU4L 4WUUE 3BRDA 4NFBA 2YEZA 3F6IA 3HAEB 4PJCB 4ELKB 1NGYB 4KJPD 1ZLUK 4Q0XL 5I1GL 5JZ7D 4O4YH 4HIHA 3ARRA 2P8LB 3ARXA 4LLMA 5DD1H 1KCSH 2F5AH 4BUHA 3HPLB 4WI8A 5I1IL 1Q94A 4HBQA 2DWDA 4FXGA 5TE6L 4P48A 3EDFA 5IWLA 5ADOH 3QXWA 2CDGA 4HGWB 4IRJA 3OAUL 3AY4A 2J3SA 4LHQB 4OZFH 4JM2D 3TA3B 2NY6C 5MENB 1LO4H 3ULUF 5I71B 3U2SA 3MRHA 2PW2B 3EZ8A 5FEBA 4ZUWB 2JJVA 4TULH 5DRZA 4TVPE 4NQEB 2HJKB 3QDHA 4DEPC 4IRJB 2EXWD 4KK6C 3ARGC 5HYIA 4FABH 1A0QL 5I2IA 3EDJA 2VXVH 5F7LB 4XI5C 5ESQA 5CBEB 5IB4B 3EKCA 2IFFL 1PKOA 3GSQA 1TMCB 1N5AA 4YAQB 3VWKB 4JFFB 1BGXH 1J10A 1NGQL 1XAUA 4PRPB 4UTBL 1AQKH 1AO7D 5I76A 4M93B 1KFAH 4XNUL 2C1OA 3ULUC 5C08E 3RU8L 1XR9B 2L7JA 4HD9A 4U1KA 2XNAB 3TO4C 1NMCB 1LP9B 3SDCD 3BGFB 1JL8A 2HJFA 4JM2B 1G6RA 4PB9L 4RISH 1IEHA 4P9ML 1NEUA 2CDGB 4HGWA 5JUEL 4DKEL 3BX7C 4J1UB 2YRLA 2B1HL 4Z6AT 5EU4B 2DQJL 1ZGLB 2BP3A 4HLZG 1Q1JL 5LGHH 1YYLL 5C0BD 5I1LB 1JNHB 4ETQA 3LV3B 4JN1L 4P3CL 4XCCL 3MRPB 3SKJH 4YGVB 5HJ3B 3MR9A 2ED8A 5E99L 5IKCB 3NPSB 5DD0H 4HEME 1IEAB 4PGDA 3UC0L 3RNKB 3O6MH 5T5NF 5I2IB 3QJHB 1MFEH 4HWBA 4OTXH 2EE2A 1PSKL 2WWMC 1LP9E 2R1XA 4FQ1H 3D0VA 2DQUH 2BERA 5FYKL 1CQYA 2OTWB 2W9DH 3K2UH 4OCXL 3ZYJA 3IU3A 2AQ3A 2R0LH 1XMWA 4RFEB 3I9GL 1EJ6A 2APXA 1BQLH 1S9WA 1P1ZA 3LEVL 4X9FA 1GGTA 4JFXB 1DQLL 1DR9A 1FNGB 1OAQH 3PP3K 5AUMA 3UTTE 4OZFB 5EN2A 3QEQA 25C8L 2LU3A 2DBJA 3WN5A 1SVZA 1MQ8A 4R2GC 5I1DA 3V6OA 1CLOL 3TCLA 3WUWG 4CVWA 2D9CA 1QFWL 2H6PA 4TN9A 5JNYB 3MJ9L 3WKNA 5I8EA 3KPTA 1UA6L 3MLRH 3VA2C 1VGKB 1EH9A 2W9EH 4FQPA 4KRPD 1F13A 4K9EL 3G5YB 2FLBT 1F3DJ 5ANME 3NCYP 1C12A 1OB1B 4C56E 4XI5D 1N8ZA 3TLRA 4RGMB 1KPUA 1AXIB 1JPFB 4N0CD 1QSEB 2DMCA 1FL3B 2KUTA 2Z92A 4R0LC 3WUZA 3KPOB 4A6YA 3D69B 1VFBB 3I02B 3CUPB 5M94B 5FHBL 2N56A 3LRSB 2AP2A 4NRXA 3E8UL 1BBDL 2HRPH 1KJ3L 2Z31D 1EBPA 2WBWB 3PWNA 4LPYA 4ZODA 5CEYA 3SDCC 1U58B 3TO4D 4PLKC 3MLYL 4H5SB 3PXJA 3U1SL 1FJ1B 2ADFL 5E2JA 3RJQB 3IDMA 3OR6B 4S2SA 1H3UA 5DUBB 1JNHA 3WIFB 4KJPC 4F7PA 2IQ9H 3ARBD 3IDUA 4TUJA 4L3EE 4H20L 1TQCC 5C08D 3UJJL 1CDHA 5D6DA 1G9NH 4H5SA 1C12B 3P77B 5KN5A 4YBLB 3REVA 1L9MA 4PREA 1CZ8H 3QJHA 1X9QA 3OF6D 3BIKB 5KSVB 3KPNB 4WJ5B 3TPUB 5B8CB 5KJRL 2PXYC 4PGCB 2YZ1A 1KB9K 3ZYIA 1MJUH 1ZGLP 1WISA 3QUYD 2VH5L 4XC1L 1NGXA 2GTWA 2UUDH 1KF9B 3C87A 4UV4L 5EZIH 2NZIA 3LN5B 3WO3B 1S7VB 1H3PL 2EYSA 2PYED 4U33A 5BQ7B 5E94B 5DSCA 5I8KL 4FQLL 4ZSOB 3QCVL 2C9AA 3O41B 4X6DB 2YKLH 1UVQA 5T1KB 4JRXB 2XIDA 5GGVH 4JHAH 5KTEL 4D8PB 5FB8A 5C0IB 5EG6C 2HH0H 4I4WA 3WKMH 1N64L 2FEDD 2EC9U 4OZGA 3KLDA 4HIEB 1UH4A 1XF3B 3H7BB 3V79C 1LGVA 2XTLA 4BJLA 2HT4D 1CLCA 1OGAA 1MIEH 1UXWA 5HDQL 2W0LA 4MHHG 2EDYA 2P5WE 2BHUA 3SN6N 5IW6A 4HV8B 1A1OA 5IFJB 4Y8DC 2Y5TB 3B2VH 1NEZB 4L8SC 2RGSA 1LD9B 3WNMA 3W0WB 1N5YL 4H25A 1MUJB 4HJJH 4KMTH 4GKZA 3FB8A 1F4HA 2NYYD 3NACL 1IKNA 3LN9A 3HI1A 2NR6D 5DEFB 3F12A 2NCMA 2CUMA 3PL6C 1HHKA 1PBYA 3PV6A 1NBVH 2ARJA 2GK2A 2APVA 3SE4A 1KGCE 2UWEB 1DQML 1K8IB 4IOSD 3VFTA 4WU5A 5I9QC 2VLJD 1SM3L 3DVNB 4GSDH 3QWRD 2MQCA 4KJYB 5IW3A 3CDCA 4D9RD 2X4NB 4YC2C 4H88L 3DO3A 1OAZH 2Y36H 3DVNA 1WBXA 1CD8A 5EB9A 3WEXB 2OR9L 3LKOA 1UM4L 2GY5A 4MS8D 1RZIB 1VHPA 5I74C 1S9KC 1MI5E 2FL5B 4BKLB 4Q9QH 2X5PA 4H88H 3HLAA 3ABZA 3F12B 4OD1L 1F11B 3BISA 3KYNA 5IEHA 4Y89A 4RBPK 1B90A 3VFNB 2EECA 5BXFB 2XQBH 5SWSB 1AGFB 4HUKB 4WWKC 4YNYA 2ICWJ 3BI9X 1YYMH 3NFSL 1GGCL 3SDCB 1YMME 2VLKB 3M8OH 4WFFE 2CR6A 4WV1C 2R23B 5FKAA 1U8JA 4O5LL 3MGOB 5SX4H 4J3TA 2IPKB 1NCDH 3S4SG 3QIWC 5ID0A 5D5MF 4OZIA 3X14A 2GJ6A 4IBLT 1HHGB 4EUPB 2GCYB 4X6BB 4OIBA 5GS0H 3GGWB 4AMKL 5EO1A 5CKAA 4JQXA 3IDJB 2DMBA 5F89A 3E6FA 3OQ3B 3X11B 4Y5XB 5ACLA 3O3BA 1DBAL 5BO1H 3OB0H 5GRYA 4JQVA 3L3GB 3RX8A 2D7MA 2NX5D 1T20B 2J6EH 3MGTB 1OWRM 5IB3B 4Y16B 5CIPA 4HXBH 2YUZA 4DWHA 4Y0GA 4N0UB 3NCJH 4LDLB 4CRPA 1VACA 1S9XA 3WFDL 4CKVX 1I1YA 5CBAB 3QO0A 1TLKA 1JPSH 5H37G 1TZIB 1PAMA 5D4QA 5F93C 5DS8A 5EC1A 4Z76B 2FGZA 4YBQD 2FJGA 1G6RL 1OD9A 2L0DA 1RUPL 3B9KA 3DSFH 3DBXA 2LAGB 3IFNL 2CO6B 1TETH 2DI8A 3P0YH 2VXUL 3PGCA 1EFXA 5E2TH 4K23L 3PL6A 3IDYC 4OZGE 4LEOA 3IDNA 3QA3B 1DEEA 1QPXA 2FBJL 5E8DL 3E8UH 3MRBB 4UILH 3L3GA 1B0GB 2R2HB 3L3JA 5L8KB 3V0VA 1E4JA 2B8OT 3VXRB 5SWSA 1HXYA 4MNQD 1WCQA 4FQIL 4L8BA 3B8YA 1FV1B 5F96H 3V9FA 1JFQH 2YWYA 4DUWA 2XKNB 5LAXA 4Z7VE 1G7JB 1IQWH 4M93C 3QAZC 3RPKA 5IVZB 4P5MB 2ATPB 1GAFL 1UZ6F 3QEHA 4XB7A 4EOWH 3GGWA 1RHHB 3VXOB 1RZ8A 5IVXB 3MV7A 3BP5A 2DM7A 1BAFL 1I1AD 3KYKH 2BZDA 5EBMB 1PFCA 5IVZA 1DANU 3T77A 2YC1B 5E03A 2Q3ZA 2R2BB 2OJEB 3MV7D 1IGTB 4U31A 1ZVSB 2ZOKB 2WBJB 4V1DA 3OKDA 3WFEH 2OL3A 2F9BT 2ICES 4YHZL 5CD3B 5TGBA 3C60A 1KB9J 3S96A 4U1JB 4L8BB 2DTMH 4M7LH 4G7VH 4E41B 4BSJA 4NOFA 3Q5YA 2ZSWB 3MFGB 3S5LG 5GZND 3K3QA 1UWGL 5IB2A 5SWQB 3ILPB 3WDIA 1QLEH 1MHPH 3QUZA 5EWIH 4G6FB 1FL6B 5IB4A 2F53D 1DDHB 1YEIH 2YD8A 3SKUD 3DXAD 5FA4B 3KPRE 5JR1H 4O51A 2E8ZA 2GQHA 4AEIL 1MFDL 1UT9A 1Q1JH 4LLDA 1AXTL 4G6JL 2H2PD 4OF3A 4BSVB 5C8JA 3WJJC 4DKEH 4NO0D 3TN0A 5FK9A 5C0NC 5D1ZC 3WD5L 4UDUA 5BV7B 2BMKB 1MCIA 4HWEL 4OFVA 5AAMA 4XHQA 1CYGA 4QF1B 1WFOA 3EOBB 1CDUA 4Y4HB 4XNUH 2X7LB 4UMGA 2Q8AL 2BSED 4AIXA 5I1HL 2AEIT 4MDIA 3FO9A 3O3EA 1OQXA 2EIEA 5ICYA 3RZCD 2E9WA 1UEMA 4QTIL 1EDQA 1T22B 1MLCA 5F9DC 3DO7A 3C09B 3I9GH 4HG4K 3O9WD 3CVIL 3RIFK 4JEGB 2I9LA 1FORH 4F8TA 1BMGA 5FYKH 1PG7L 5DJXA 1MPAL 2P42B 2C4XA 4GJTB 3EYOA 3QIUB 5EBLA 3JUZA 4MJ4A 1DUYB 4BSVA 5C8JB 3BKML 5ADOL 1FBIL 3S4SA 4OGAD 1EEZB 1KXQE 1CBVL 4AG4H 3NCFB 1I3UA 1NUNB 2UZXB 2WM0A 3GO1H 5J6GB 1CGWA 2VL5B 4F8QA 5D1QD 3LDBB 1U8IA 2ZP0T 4NOBA 2V7HB 5HJ3A 1EUTA 5GGUB 3HKFA 5MEOB 2X70A 5J56B 3GBMH 3F7VB 4OZHB 4OSUH 1BFVL 2N7AA 4CU7A 5CINL 5D7JB 5E00B 3MV7E 5D1XC 4RFNC 4MJ6B 1AQKL 4P9HC 3IDXL 2BNQA 2D4FA 2L7UA 1A3LH 3K0WA 4UIKL 1U8MB 3FQRB 4WO4A 1ACYL 1CD9B 4OLZL 3F62A 1IBGL 4I3GA 4PJFB 3WS3B 1N5AB 2ENYA 4DOHB 5I17B 5JW4N 4Z7WE 3KXFE 3FO0L 3GMMB 2WWKT 4XP9L 5J3HD 2VL5A 4L3AA 3DV6B 4JY5L 1MCQA 4N0RA 1CDYA 2XWJA 4BFBD 1Q0YL 5L2KD 2BNRE 1HNFA 2DQFB 1JZ6A 4R2GD 2EKSA 4NZJA 1XF3A 1E4WH 4XHJD 4Q0XH 4RMWA 5I1GH 4TSBH 1FVCB 3IU4H 1JZ7A 1VADA 1LK2B 1QVOA 1M4KA 1YEHH 4EBQH 1YNKH 4M6NL 3V5HA 4BH8B 4MLIA 4RQQB 4NQSA 4R0LB 3T8XB 3UDWC 5J9PA 3RKPA 4L8SB 5I1CH 3JV6A 1FLRL 3H7LA 4GMSH 5BQ7A 2BNUB 1DQQB 5E1HB 2EC9T 1F3JB 3L9RB 1S7RB 3WV0A 3L3IA 4AEEA 5T1MA 1NCCL 4OIIL 3HAEG 4DN4L 4KHTH 2QJDA 2OLDA 4LP5A 4UT9L 5BZDA 1OSZB 2UUDK 1PX4A 3BP6B 3CVHH 1IAMA 3AUVA 4YXKH 4I48A 1KPRA 4R9HA 3GJFA 4BSWA 3ZTJH 5SX5H 1U95B 2BNQE 4OAWB 2RHEA 3MNWA 1NGPL 2HKFH 4WUKL 2ARJB 3IAQA 3RVVC 3OJVC 4NDMA 3Q5OA 1FC1A 2BSTA 3GSNH 3IFOA 5ICZB 2WK2A 2G2RA 2ITDB 3IS0X 3AAZA 4XGZA 3LAFA 4FQ2L 3H3KA 1CGTA 3WFCL 4L4TB 4JPWH 5TE4H 1MCWW 4ZSOA 3ARFD 5DR5L 4BH7A 2HFGH 1CDBA 1NDGA 1XZ0A 3DRTA 5DRXB 5TDPA 3O6KL 5FECA 1KJMB 4ZNEE 3IDMB 3E3QE 4K3JL 4JLRB 3SDDD 2PUQT 3TO4B 4XTRD 4JKKA 4KJQD 4YE4L 5I9QB 3W11D 2V2TA 1RZJH 5CGYD 5ACZB 3VCLB 1YEGL 2NNAA 4MYWB 5D1QC 4PUBH 4XBEH 2EYRA 5DGQA 3UTZA 2CO7B 4GS7C 3HMWL 1TVHB 1AHWA 3IFPB 4U1NB 4G6KL 5IROC 1BQHG 5JMRA 4OUUB 4PJGF 2BVTA 1FZJB 1A6UH 1OAYH 4XAKD 3IAGC 2HLFD 3RX5A 1KPRB 4KAQH 4ZPVB 2KZ1B 1EEQA 1KCRH 2GT9A 1K3IA 3MBEC 2JK5A 1MSPA 5GGQH 1SEBB 3HB3C 1AKJD 4OLYH 1BM3H 2P8MB 2FEEI 3VRIA 2VRAA 4KH2A 5IUSA 2ILLA 4XT1C 4ZQKB 2R4RH 4XMKL 3OKMA 3UTSE 5IEHB 1HOCA 2FX7H 4AENA 5DMYA 2I9TA 5D1ZD 5I73C 2P8MA 1YEGH 1SYSA 3U0TB 3ULUE 4GRMB 4M6AA 4PJXF 3QXAB 3KPRD 2FX7L 2Q7YB 1I7UB 3AMLA 5A2IH 4HUXA 3ZL4H 1KCKA 1KELL 4K8RC 4DKDC 4ZYKB 1HHHB 2AJ3B 1C1EH 2H9GB 4TUOB 4HIJB 4EQ2A 1M7IA 2D0HA 2VDNH 4MQSB 5F1OB 4PBWD 3WXWL 4PJAE 4MGXA 4XPAH 5DR5H 2BVOA 3RWDB 3BKCL 3MCLH 5L8JB 3MLUL 1YN7B 4ZUTA 4ORGB 5F8QC 3K4AA 4RAVB 1YZZA 2V2XB 2D0GA 4MAUH 2ZG2A 4NNPH 3GHEH 2PTTA 3ALXA 4PFEA 1IC7H 4JAMB 4IHOB 1YMMA 2WQRA 4OLVL 1RULL 4WEMB 2XKSA 3EYVB 1I7UA 4XMLL 1Y6MR 1QBBA 4PRPE 4RGMC 2HTLD 3V7AE 1RY7B 2C7UA 1H3VA 5BOZG 1SJEA 1IM3B 3CVHL 2YC1A 4GW5B 4M5YH 3AM8C 1ACZA 1P9MA 4DN4H 4BZYA 2AK1H 2O5YL 2YRZA 3PE9A 1BX2B 3HG1A 1MNUL 2X2YA 1C08A 3BDYL 5JOEA 3PL6B 3QHZH 1G7PA 4B50A 3NA9L 5C0DA 2IBGA 3CMGA 4TPRH 3MQIA 2Z91A 1IGJB 4XPFH 2WV3A 4XPHL 4LSPH 1IC4H 4LVHB 4N9GA 3MRLA 3BAEH 5ISZD 3GKWL 2VSDA 4QRSA 4IIQA 3G5XA 3D39B 3A67L 1AGCA 3VDCA 2JB6A 4JJHA 4HWUA 1IGYB 4F33B 3C5ZA 1RSFA 5B39G 5C7XL 4GS7B 1I9IH 2APWA 4LKXA 2PYEB 1NFDF 1NGPH 2HKFL 3V6BR 3QUZD 1HSAA 4YHOH 4M1GL 4DQOL 4G8EB 5JLZA 1P53A 2BRRL 3CU1A 3NIGF 4Z8FH 3P30L 4NGHL 1MRCH 1EFXB 1J8HE 5J1TC 3RUGB 4HUUB 4LPWA 1YJDL 1QA9B 4ZFFB 4X7CC 4OZHE 3S34L 3GSVB 3V0WL 5JA9A 1AH1A 1KN2L 5DJ6B 1Y0LA 4X8JB 4OFKA 4J3SA 4QGTA 3H9HB 5IHZB 1H3TA 4Y5YB 4D9QD 2GFBA 3NIGE 1MQKH 4PBXA 3FQTB 1WBZA 5E56A 3D3VA 4O2FA 4JG0L 2A0LC 5B3NA 4ALAL 3RVWD 1EGJA 5CINH 5TDOB 2AK4E 4PJFE 3L7EB 4M43L 4TVPL 3BH9A 3QIWD 4WY7L 4QNPF 1KC5L 1FFNB 3RTQA 3VXUD 4ZFOB 3MYJA 4JY6A 4WIQA 5J6HA 1EHAA 1C7SA 3RNQB 1LHZA 5JHDE 2PF6A 1U8KB 2GSIB 4LKCB 5MP6H 4YR6B 3MJ7B 4HT1H 2XZZA 3QRFM 3HR5A 1W0WA 4HLJA 1ULVA 1UG9A 4LNVA 5FV1L 1LWRA 4Y4HA 3ARDC 2B5IC 3BO8A 1MPAH 4YR6A 3VI4E 5GGSA 3VD5A 3GIVB 1YQVL 1ZANH 1K2DB 2F8XC 3IAPA 3C60D 3CVIH 3QFJB 1T5XB 3G6JF 1K8DA 4JRYD 2J88H 1U8NA 2J8OA 4JM2F 4KGLA 3VH8B 5TF0A 5BS0B 4FFWD 2X1XR 3LDBC 4G80B 2AEQL 5I16A 3FKUS 5KZCD 4PLOB 3LQAL 2WUBL 3ESVF 1PKQE 5GRWA 3HPLA 2YD9A 3GBML 2FATL 3S4SB 4XMPH 3VH8A 4YGVA 3W0WD 3IDGB 3BZ4A 3VFUA 1EMTH 3GSVA 5DYOA 4Y4FD 2VTFA 4L3CA 1EHLL 1CFNA 2DQDH 4X8JA 4JZJC 4M43H 1ZHNA 1FIEA 4YDVB 1A6ZA 4KKCC 4LOUD 1MFDH 5DJCA 5JR1L 4NJ9H 1UWXH 1UC6A 5E95B 2HJKA 2E9IA 4EI6A 3O4OC 2DL9A 5IROA 1BD2A 5FUCC 1CFNB 1NGWB 1DLFL 35C8H 1RUQH 3OKLA 2NZ9C 4ELME 3KLAB 1WIPA 1AQDA 1RK0A 5DURD 3RAJH 3L3OB 4K9EC 4N8VB 1HDMB 5GRJL 3GIZH 4NUJA 4I2XE 1U8MA 4JY6B 2YPLD 3HZKB 5I1KL 4NQCB 3T2NL 3QXUA 2OI9B 2NX5B 3D5OF 1RIHL 2HLAB 3OKOA 1ZTXL 5F3HA 1QRNE 1MCOH 2QQQA 5F9JB 4KTDH 3ARBC 5D96B 4X5WA 2D7NA 4EKXA 1FQ9C 2R1WB 4JG1L 3BPNB 4Z7QE 4G3YL 3IJYA 1K4CA 1KOAA 2OK0L 5H94B 4UT6L 1OQOA 5H2BB 5GS1C 1S78D 2G2RB 3LMJL 4G9FD 1Q72H 4KMQA 3DIFA 1IC4L 4FNLH 4EI5B 3UTTB 3CK0L 2EO9A 5I16B 1PY4A 4F9PC 1GH7A 4PJAF 4NQSB 4R0LA 2NPLX 2PR4L 5TDNA 1UWGH 2DB8A 4YX2L 3CFJA 5EZLA 1J88A 4RA0C 2FBJH 5C07D 5HHXH 1TNNA 3P11L 3ZDYE 4I13B 2BOCA 4XPBH 5E2TL 4WWID 3J7HA 2X6MA 4WJ5A 1B3JA 5F1KC 5ESVB 4G42B 5HYEA 1T5WB 5JQHC 3HUJE 1RUPH 2VE6B 2FEEL 2EEAA 4EQ3A 2FWOB 1KJ2B 2ZWLT 4X4ZA 1KJ2H 2PW2A 3MRHB 3T3PE 1KTDB 2R1XB 3JV0A 5IF0A 2ZOLB 1NFDB 4X7EC 1S7QA 4DKAA 4EN3C 3VH8G 1PZ5A 2VAAA 2XKUA 4U49A 3D9AH 3O8XA 3QDJD 1J1OL 3VD4A 3JWDC 4X4YB 3VDAA 2NY1D 3CFKA 1A1MB 5EZLB 1JZ4A 2FX8L 1Q9WA 5A1AA 4LSTL 3VW3L 4KROC 5F96L 5C92A 4QNPE 2UYLB 5JNYA 4XPAL 3D3VD 1T1YA 3QEQE 4AT6B 4ZFZB 3S35X 1HH9B 1CLYL 3FFCA 4GBXD 1LO2L 2DD8H 4UAOB 3VXUA 1KBGH 5E7BA 3GSRB 4BQ8A 2WINA 4X6DA 3STZA 4QRPD 4O5LH 3FB5A 4LLVB 1OP5K 1MF2L 1KG0A 3ARSA 1DQJA 3MV8D 3NFSH 3BE1L 5IFJA 4YQXL 1NKOA 2R4RL 4XMKH 5CBEA 2EXWC 4KK6D 3QFDB 4NRYA 3VWJB 4FQQB 3CXHJ 4FTVE 4OB5L 5D1XA 1PEWA 5GSVB 4O58L 3I6KA 1QNZL 4XCYA 4HXBL 1LEKB 1NCAL 4M6ML 5DO2C 3G6DH 4MA3B 3RZCB 5ESVA 3L6FA 3MV9D 1F3DH 4N8VG 5TPWL 4PJEF 3CZJA 1BFOA 3I6LD 2C26A 4TUKH 5KBNC 1CIDA 4MD5B 5MEPB 4WCYL 1GJIA 4PR5A 5IMLA 5EUOB 5L88L 2HKHL 2N7BA 4R8WH 3IKKA 2EXYD 3TP4A 1N3NB 2EDWA 3MODH 1OCWH 1NBVL 3ZZ1A 5TE7H 1S7VA 5J13B 3OX8B 4OLXL 5IMLB 3TNNB 1XIWA 4JKPL 2E7BA 1GVIA 2ZG3A 3BQUB 5I30L 3U9UB 5ENWA 5DVLA 1EO8L 3WEXA 4DGYH 4MDJA 4NSKA 3HC3L 4MQ7A 3TVMB 4C83A 5HHOD 2OL3H 3DI2B 4HKZB 4HS8H 4JRWA 4U7MA 5HHNB 3OJDA 3RHWK 1FNSH 4PJHB 5E7FA 4P4RB 2EH7H 5F7NC 1OSPL 4RGNC 1HILB 1SEBA 3T0EE 4YFLI 1TXKA 2KH2B 2VDOL 4JFPB 1FNAA 2C1PA 3C2SA 4D0DA 1AY1H 3F58L 1WBXB 3JTTA 4GLRH 5LQBL 2LTQB 1I1AC 3VFGL 4DGYL 1XF5B 1XIWB 2X4PB 4G9FB 3U83A 5ID0B 3NCBB 5ESAB 1VFBA 2WBKA 3I02A 2QBWA 3GSUA 2FX9H 2HVKA 2Q7YA 2DWEA 3KPRA 4YDLB 3DMMA 3TBVA 3PDOA 4LEXH 2OSLA 5FGRA 4H25B 2JF1A 3TBTB 3RI5F 5I74B 2W59A 5DUBA 4G43B 1YUHA 5C09E 3TBSA 1J0IA 1MCDA 1QO3B 4GMSL 1FLRH 4UQ2A 3M45A 1WFNA 4K3HA 2HWZL 1E4KC 3T3ME 4EJ1C 3SE9L 1HHGA 5CUSL 3N85H 1N3NA 5LWYH 1II4E 5IHZA 3QIBD 1CGVA 2EDTA 2XTJC 5D7JD 1P7QB 1ZVHA 1YEHL 4PJ5B 1KCVL 4NQUA 4P4KA 4Q6YA 5EU5B 3VFSB 3SE8H 3UBXA 1CF8L 1JRHI 3SDCA 3UMTA 1QD0A 1A4JB 2HTKC 4LRIC 4GKSA 4XC1H 1T2QH 5HPOA 2A6KB 5B38G 2OCFD 1EAPB 5I66B 4J23A 1TPXB 4LCCB 1CT8B 5AZEH 4P23A 3BGMB 3KJ4B 1VFUA 1RZFL 1XCTA 1BZ7B 1A21A 3IFLL 4XP6L 4MNGB 3C08H 1IGIH 4XP4L 2X4TB 1IAKA 2GK0B 3HFMH 1AO7E 4H20H 1I1RA 3GNML 1HWHB 5I1EH 2GIYA 1LVEA 4HPYL 4R4NC 4WENB 5MERB 3O2DH 1YA5A 3JVGC 4NHCH 3ULUL 2YA0A 4LPVA 1IBGH 4LHUA 4X98B 5D7IE 3THML 2XV6B 4PV8A 5BW7A 2VXQH 2YKLL 3OXRB 4P2RD 4W4NA 3HNTL 5FHBH 1I4FA 3QAZB 2QQLL 4HZAA 3DUSA 5IVNA 1CICC 2GJZA 3TGXA 1F58H 3FFCD 5FHAL 3RRQA 1TQBB 1VESA 4UQ3B 5C1MB 1YDPA 1DFBL 2G5BA 3EJYD 4YWGL 3ARVA 4G80A 3TBYA 1J1OH 4F9PA 1BFVH 1A1OB 1I4FB 5CJBA 4QRPA 1AXSA 1QRND 4K07A 5EC1B 5TJWK 2OZ4A 4M8QB 2DQTH 4JFFD 1IT9H 3I6GB 2XA8L 3RWGA 1K4DB 1IQDB 2V5MA 3L7EA 5ALCL 5KSAC 3TH4T 5A2KH 1MWAL 5LAXB 5C2BH 4X0KA 4K3EL 5E8EB 3G04B 5CD3A 3MJ9H 1J05B 1RVFL 4LVEA 4J8RA 1I3GL 1D6VH 1G9NL 1JIBA 4LQFH 4L8CA 1I7RA 1MVFA 3VFOA 4MB5A 1RZIA 4ZUVA 2P46B 1ZT1A 5C09D 1I3RB 2HTKD 3U1SH 3UO1L 5LXGL 3Q0HA 3P11H 5IJVB 1KLFA 3BJ91 2CLVA 2GJJA 4ZD3L 3V5KB 5DUPH 4M00A 1CDIA 2B7DT 1AKJB 1EVUA 4F7TA 3QG6A 2Q8AH 4Y19A 4XNZB 3WLBA 2P1YA 4P2QA 3NFPA 3VG0H 5KVDL 3LMJH 3LIZL 1KUMA 3V6FB 2HRLA 4FFVD 1YYLH 4LCCC 3B3IA 3FQUB 2KL6A 2UY6A 2OMNA 3LVEA 4P9MH 3UYRH 4PJAA 5C2UB 2I5YH 1JPTL 1EUUA 1MELA 4G6JH 3S5LA 3O6FD 4G3YH 1U3JA 2HT2C 4U7KA 5DJ2A 5HHQA 1OVZA 1BEYH 3L3DA 5IR1A 1SMAA 1A7NL 3C60B 1VKXB 1FV1A 5GGSB 4XP1L 4CVUA 4XNZC 5FF6B 4GW4B 5FYJD 3KPSD 1R6VA 4QTHB 5C0EA 1X5YA 3U46A 2QLVB 4FABL 1F4XL 4W70A 2PCPA 4M7LL 3GIZL 1F4XH 2B4CC 2IBZX 3LRGA 4PJFF 4R97B 5ADPL 1KTRL 4RGND 4YHIB 4ZFOL 3FL7A 3L95A 1DLFH 2HFEA 1T22A 5CJXC 1C5CH 1L7TL 3BKYH 4FG6C 4RBPH 2CIKA 5TE6H 1X5JA 5CMAB 5ALBL 2WBJA 4HIXH 3HPJB 2BNRD 2YHGA 2IANA 3SGEI 1WUNT 3MUZ1 2DQJH 1ZLVH 2CLZB 4TOYL 3BZFA 4P57A 2VKWA 1CE6A 1Q94B 4I3RH 5EORH 1UENA 1TZHB 4RFOH 3BQUD 3P73B 3MRFA 1T20A 2VDLH 2ADGB 3OXSB 3VG0L 4MD4B 1CGYA 3CPLA 5JO5A 2NY4C 1ADQH 3PWPD 4UTBH 2AEQH 5GRVK 1GZPA 2D7OA 5MEOA 4GG6A 1T5XA 4GXVH 1JUFB 4ZD3H 1T83C 5CP7A 4NQCA 3D2UA 2VLMD 5ESQB 3S37X 4U6TA 3ZE2E 1YQVH 2R56H 4HWZB 2FH6A 3RJDA 3EO1B 5ISZB 3FRPA 2PO6A 3KJ6H 1W72L 5I8EB 1AE6L 1T6VN 2CJUH 1U3HA 3MA9H 1KIPB 2AJUH 1LP9A 1XFPA 43CAB 5E6ZA 4V1DB 4HF5L 1VADB 2IAMA 4KV5E 5AZEL 4ZXBB 4F37F 1V3LA 1MCWM 4XC3L 2V5TA 4J3WA 4Y4KA 3ARED 1U3HB 4P49A 5F97E 1IT9L 2A9NH 1RV6X 3RUGE 1U8QA 1INQB 1R3KB 3EYSL 4A6YH 4YEEA 5EZOH 4M4RA 2MKWA 5DK0A 5BO1L 1I85C 2RAMA 3TH2T 4MA3A 5CUSH 4NNXA 4JFZH 5F21B 4EEEA 3VI4F 1RFDL 2W1NA 5HTSA 1ZA6B 2WIIA 4N0CC 2NY1B 1HXMA 1N2RB 1N6QH 3G6JE 4WI9A 4ZUWA 3CC5A 5F9JA 2P45B 1T5WA 4RGOH 4X6CF 1S5IL 3MRFB 2HFTA 1N7MH 5FUCE 5FO9B 3KPPA 4NYLB 4B53A 5J12B 3VXQB 3QG7H 4IJ3B 5IW1B 4PB0L 4XGZB 1G7IB 4XP6H 1U8QB 2P49B 3QDJB 1EERB 1A7PL 2OJZL 3BPCB 3F6LA 3GI9L 4ODUB 3CIQA 4KK5D 2ZSVB 4HZLB 3T0XA 4PPTA 4ZPTA 4GH7B 1XCQA 1AIFA 3MRGA 3MCG1 2FECI 4LCYA 1T0MB 5F7HA 4WHYG 4WVRA 3F7YB 1I8LA 5H8DA 4JO1H 2Q86A 2UYLA 4OQ1A 5EU7E 5EO0B 5DD6A 4HKBB 3PG2A 2VWEC 4U0RB 1OAZL 5FIEA 1IGMH 4B7LA 2HWZH 3LKSA 4HUMB 4L4TA 1BFOB 2BOCB 3DUHA 5GGVY 1H9VA 4EVNA 2O5YH 4GKZB 3TM6A 5HHMD 3MRRA 1H0DB 2ZUXA 5EU6A 2AI0H 3UTZB 4Y4KC 1DQMH 4RFEA 4LLQB 2X42A 4KK9D 1X3DA 4FMFA 3NFNB 4NRZA 1D6EB 5GZOD 3HHRB 1PY9A 3ULUD 1RZKC 1HHKB 6CGTA 1S7QB 3AROA 3LZFL 5IW6B 2J8UE 1CI5A 1T1WB 3BDXA 3DLQR 2AV1A 1Q0XH 4NRZB 3VFGH 4PYGA 3QUKB 1IC7L 2K7QA 1AO7B 1FNLA 3BXNA 3EBAA 4FQCL 1NCTA 1GPOL 3T65B 4NKMA 5GGTH 4ERSL 1BQHB 3OKKB 2FNBA 5KSUB 4MD5A 5MEPA 3RIFF 1MCKA 1QTYT 3MV8A 5GXBB 5D1QB 1FYTE 3GEWB 4QO1A 1A6TA 4R4BA 1NCWL 3VMPA 1RU9H 3TBWB 5I0ZA 4QXTB 4G9DA 2GSGA 2Q1EA 2W07A 5CP3H 8FABA 1IM9D 3U6RB 3VXTB 5T3XL 1KELH 4XCNA 2RCSH 3QISA 3ARFB 5IEKB 4JO2L 1KCLA 2Q86B 1G0YR 3MREB 4JKMA 2FRGP 4DJMA 4OGXH 1OCWL 4RQQA 8CGTA 2ZCHL 4O2CA 4PJXE 4XCNB 4R8WL 2JTDA 1BJMA 3MBEB 4X9BA 1YEKL 1Q9LA 4X5LA 5ECJE 3BQUC 3KYMB 1A6PA 4LSRH 3Q6FA 4GAGL 2AK4A 2UZYB 1EJOL 4IOFD 3RVTD 3KPNA 3TPUA 1UH3A 3P0VL 5HI3D 1FE8L 5E2WL 3RZCA 1SQ2N 5F7MC 1VSCA 5DMGC 1ITBB 4OM0L 3ULSB 3EZJB 4PBVC 1NBZB 2P8PB 4D0BA 4N0FA 1T2JA 1T1XA 2J4WL 3E2HB 4X7FC 1JK8A 1MFCL 1K6QL 5CZXC 3SO5A 1M7DB 2EH8H 3HUJB 2ICEA 5EUOA 5CD5C 1NBZA 3FHAA 4XX1E 5AG8A 1DE4A 3GSUB 2M26A 2RFXB 5JW4M 3O0RH 5BVPH 5EU6E 3ZT5A 5HI5C 1JNNL 2LQRA 4LCCA 4ZAKC 3HE6A 3QIBA 5F8RC 4MXQD 3Q6FB 3QQ3B 5C07A 1CQKA 5HVFB 3L3IB 4OCLC 3C6LD 4P9HH 4WUUB 1CGUA 5F9OL 1ETZA 4HXAL 1XGQA 3SQOL 5D1QA 5IK3A 3MLYH 2OQJA 3MBXL 3GMNB 5F71A 3VRIB 3O6KH 3TV3H 4RMQA 1RAMA 4JPKL 2WBJD 2QV2A 4KKLC 3I2CL 4OKVA 3QA3A 5IBLD 3SDYL 4TNVF 1A6VL 3V4PH 2B2XL 5J8OA 4Y1AE 3V0VB 1JN6B 4ZAKB 4IHOA 4GKSB 2ITDA 1NFIA 5HHOB 2JCCA 5EIIB 1MFAH 1LILA 1RZKL 3NFPB 1EAPA 5I66A 4KHXH 5HGAA 3JTSA 3SY0A 3V6OC 5IGXL 3RZWA 4JRXD 2H9GA 4C55A 3X13A 3U7WH 1NFIB 5HHOA 2XWBA 3MYZA 4IRJD 1MRDH 3RWIA 1AFVL 1DN0A 5CCKL 4TNWK 1BOYA 2D7QA 2DQEH 1P69B 2R2EA 3WFBL 4LCUA 1E4XH 4XWOD 5HHOE 5BMFL 4X6DF 4XBPB 1XR8A 3ULVH 4L8CB 3LEVH 4TRPL 1DANT 4OF7A 2IGFL 1W8NA 2YOCA 4LLYA 4LIQL 5IG7B 3D39E 3T0AA 1MREL 1KEGL 1MAJA 3TIEB 2YD6A 2OL3B 3HN3A 5HHXL 4G6ML 3BP4A 4ODWB 5JOFA 4YX2H 4PJIE 4TYUA 2GI7A 3TT1H 1PSKH 2E7LC 3I3DA 1MCJA 1B4JL 3WJLC 1U92B 5SWZA 5F7DB 1FAKT 3V5KA 2I26N 3CK0H 1EXUB 2P7TB 3H42L 4F15B 2HT3D 4EBQL 1QG3A 3QYCA 2V5RA 4M48H 3KYOB 2A6KA 5DHVB 4PGZA 3FN0L 3QIUD 2KZWA 4AIZB 3JVGA 3RI5K 3WDHA 4DVRH 4P23C 4MAYC 4RWYL 1FC2D 1MHHA 1UYWH 3WN5C 4QXGL 4QRUB 3B9KB 3EDDA 5CEZH 1YECL 4NQEA 5L8LB 3IJSA 2AJZA 3BRFA 1NGQH 5JQ6H 5L2KE 2HAZA 4E0RA 5DHYA 4QRRE 2WP3O 2V9TA 4ZQKA 4MJ5B 4HS6B 5HI4D 3IDNB 3KNBB 2JELL 3GDBA 2F19L 1Q38A 1M71A 5DJYB 2NY0B 1ZANL 1WICA 4JPIA 4OBRA 1JRHL 2YUXA 5GS2D 5L0QB 2BSRB 2FHCA 4JFOA 5EIQA 4LF3B 5K33A 2A73B 1H3GA 4GKNB 3LSOB 3ETBF 4JGMA 5KSBF 4POYA 3JSSA 3GMQB 5F1NB 1QSFE 2X4RA 1ZE3C 1HWGB 5LBSL 4YJZL 1JCKA 4LFHD 3KXFB 3LB6D 3AREB 1DVFA 3QNZB 1KLUB 4RDQG 5EOQL 3V0AC 1JF5A 4Y16A 1MVUB 4Q97A 2FATH 3GO1L 1WSST 4O00A 1MFBL 4LSUH 1S5HA 3BPLC 4MSWB 1H3WM 4MNQA 3H42H 4P5KB 1JF1A 3TYFA 5BS0E 2HP4A 2QHRL 2UY7A 3TIDB 3EJJX 1SY6H 2YWZA 2FJGB 2A6DB 2ZPKH 1MLCB 4TTDD 2XXMB 1P6AB 4HX1B 4MQXC 4RFNB 3MLTA 1FZKB 1RJYA 4XXCA 4CU8A 4X7TB 1Q9KA 3LKNB 4Z5RA 1T21B 5D7KD 1GRWA 1NGWA 2C1OB 3PGCB 2KQNA 2A83B 3OKLB 5KAQF 3CLEL 2ZUYA 1AKJA 4F7TB 1QBLL 2X9YA 2VWEE 1BLNA 1V3MA 3LCYA 3FONB 3HE7A 3M17B 3QEUB 5HGBA 4HX1A 3HA0A 2DQEL 3FCTB 2YD4A 3ESUF 3M1BA 1YECH 5CCKH 1N8ZB 2VZVA 5I1LA 1G7IA 5C0RH 1QLFB 2BJML 3IXTB 1GIGH 1Z5LA 3HZMB 4NQEE 5EO9A 4JFDA 1YPZB 2IG2L 3DXAE 2P5EA 3BT2H 5B39B 4LSQH 3QH3A 1B4RA 2B4CL 1FVCA 4MDIB 1Z5LB 1HDMA 3FRPG 3HZMA 1WBZB 3SDXA 4JG0H 3D25A 4X7TA 4F9LA 1BQSA 3HR6A 4TPRL 1YPZF 3SKOA 1R0AH 3F65A 5D7LE 4JFQA 4JFXA 4HKBA 2EXYC 1T7VA 2R1YA 3HCVB 4ODHL 3EJZD 1JZ3A 2HJFB 4JM2A 4L4TE 4HK3J 3RTQB 3QDGE 4S1DC 2IGFH 3SKOB 2VZUA 3EOTL 4HXAH 4PJIA 4YDVA 2YUVA 3KPSB 2R1YB 4OFDA 1TNMA 3EYFB 1MRCL 4X6FA 3P30H 4NGHH 5I15L 5IB2B 3RPIB 4JFDB 4Z7OF 3S3PA 1V05A 4OJFL 3HZYB 5C7XH 3R1GH 3UDWA 4JE4B 3L7FA 2X70B 3V8CA 5ITBH 3BN3B 3SGJA 1F42A 4G5ZH 4GO6B 1KPVB 2JJUA 1IILE 3VG9B 4H1LG 1HCVA 3KPSE 3MJ6A 1AI1L 3U0WL 4GG8B 3MUJA 4I3SL 3DRQB 4UIMB 5FGCB 3FMGH 4XPHH 3MCLL 3FCTA 1G7MB 4RMUA 1PZ5B 2VAAB 3K1KC 4OGYH 3VXRE 4D8PA 3VFVA 1I9JH 2OYPA 4NM4L 3G6AB 3NTCL 1RHFA 1Z0NA 15C8H 4GBXC 3TA3D 4FRWA 4OD3H 3IJYB 1LNUB 1H8OA 4HIIA 3RL1B 1NFDE 3QNYA 4GAFB 4PRIB 3MBXH 2Z35B 4DTGL 5GIRA 3OAYK 4QXUL 3UTOA 1MOEA 1JNLH 2DLGA 1JV5A 3DV6A 3WNKA 4ZMAT 2FHFA 3VXSA 1KIPA 3BVNB 4OQTL 1XF2A 3W2DH 4PGBA 3UTTA 4K7PX 1A9BB 3EDEA 1A6WL 1T66D 4ODVH 5GSVA 1JZ5A 2Y72A 1NGXB 1A9EB 1SBBA 3RY5A 5HHPA 4HC1H 1NL0L 3MO1A 1NEZA 1UXSA 1QFWM 3MOBL 1J18A 3VD3A 3UTSB 4PGBB 1A1MA 3L3OA 4Z78A 4JFYA 5A40E 4OCSH 1WWCA 3O2DA 4C56A 3BEWB 4C4KT 3MLZL 1L9NA 4X8XA 1MWAA 4WRLA 3EGSB 1IC5H 4P0DA 3NIFE 3NCEB 4PJHF 4YHKL 4E41E 4F7PB 1D3CA 2YBRB 2CRMA 1RI8A 3O8XD 2X10A 2MQ0A 3BKCH 4OM0H 1L6ZA 4UOW0 4S0TD 1OAYL 5F7EL 2ATKA 4I4WB 3V4VL 3L1OL 4K2UL 1EGJH 4L9DA 5CEXA 4PGCA 5B22A 2QR0B 2E6PA 3CMOL 3ARZA 4GUPB 2IPUG 4Z95H 4QXTA 4RAUB 1W2KT 1O7VA 5BJTB 5IIEA 3BP7B 2QSTA 4KQ3L 3OKMB 2D31A 1P2CB 3MRKB 3VA6A 2VLLA 3CFCH 5FYJL 5FYLD 5JMOC 5DJ8B 4WI4A 3KPLA 4KKAC 5ILTL 1UCTA 5DURB 3QCUH 3TWCH 2AI0L 4ACPA 3QPQC 4U1SB 3DX6A 3DROA 5ICXA 4RGNB 2VKXA 2DLIA 2VN4A 5CEYB 2EO1A 2QSVA 2ZKHL 5E8NA 4ODBD 3QRGH 4JKLA 2GT9B 3CU7A 4OCWL 1KJVA 4OV5B 2EDJA 5EPMA 1QQDB 3HNSH 1X5HA 1FGNL 1M6OB 3N50A 4JO1L 2AEPL 5M7QA 4HKZA 4FQCH 2BY3A 1LO5B 3IGAA 2DIBA 5I8CA 1G7QB 4XVJL 2YK1L 5KZCB 5FXCH 4GSDL 3LKRA 4V1DE 1TZGH 2P5WB 2BVPA 5KVMC 2QSQA 3CXHK 5E5MA 4JFEB 1WLHA 3X14B 3O8XB 3AMKA 1G7QA 4AL8L 3RWIB 4JANB 3QPXL 4P5TD 2R69L 4R96A 5FYLL 4LARL 1DZBA 2J5LB 3JWNC 1RQ5A 4Y1AA 4KHTL 4JHBA 3W0WE 5J1AB 2VL4A 3PQYD 4NQDB 5A2LH 4Q2ZA 1ZEAL 4OAWA 4OZ4B 5J57B 5J12C 4ONHA 1RJCA 1PG7W 4R96B 4RMRA 3DGCR 3BFOA 3R06B 1PGRB 5C9JB 4RAUA 4IRZH 1ZSDA 3VXUB 5IQ7L 1INDL 3PABB 2CPCA 3T0BA 5IJKC 5AYQA 5B8CA 4KQ4H 1JHTB 3TBSB 1SEQH 4I0PC 3QO0B 1U91A 5EZOL 5EH1A 1AP2B 2FYYA 4Y4HC 4Z7WB 3X3FL 2X40A 3FT2A 3T04D 3WFCH 5H37H 1QYGH 4XXDA 4XAKE 2RIKA 1D5MB 5E8OB 1RZGB 4IIQB 4XAWL 4KK8D 3NGBB 3DYMA 4KV5F 1FDLH 4YK4C 2V17L 3T1FA 4ONOA 3BHBB 2P5ED 4N8PA 5F70A 4I9WD 3QQ3A 5C07B 1T04B 2EE3A 4JDVB 1D5XA 1MJ8H 2B1AL 1MHHB 5T3XE 1KIQA 4PS4L 2OX5A 2BFVL 1C16B 3MLWH 2DQHL 1LE5A 2Y7QA 3HI6L 3QNXA 2EIBA 1ES0B 3DYPA 3O9WA 4P46D 4XCFH 4IRSC 1HHHA 4KZDL 1MI5B 3VGFA 4M1CC 3U4BL 4JVUA 1KB5L 5L6YL 4MXWH 2YD1A 3GI8L 4QOKB 3VJ6B 4YDKH 2W65A 2XN9B 3MLVH 2UZIH 4MD0B 2FB4L 5KOVC 5MERA 3PV7A 5MEQA 1JPGB 3DSNA 4HCRH 1AGBB 5JOFB 2G60H 5E6IB 2YPKB 1ADQL 1IQDA 4ZDHB 4NRYB 3VWJA 4U6VL 3D0LA 2M8XA 1CT8A 3B5TA 3BJLA 3TN0D 2DQCL 5C0AD 5E70A 3D6GA 3RKDC 1AGBA 1LP9F 3U9UA 2R29L 2GCYA 4CN4A 4GKOA 4UQ3A 5D7IB 4XC3H 1WEJL 1EEYB 3C5ZC 2W0KA 1UCBL 4HAGA 1IKFL 5KS9B 3GUTA 4CMMA 1UACL 5B38A 2YPVL 1CZ8L 2QQNH 4HWBH 4YBQC 4RAHA 2J5LC 5DQDL 4APQD 1RK1B 4YDLC 4G6AD 5I1JL 2CJUL 3TT3H 1IEBA 4F7MB 3NIDF 4JY5H 4PTTA 1NSNL 3MLSH 1Q9OA 1T4KB 4XP9H 4LLYB 3VXRA 4G7YL 4J3OC 4H0HB 3BZEA 4ORZC 1O5DT 3QXAA 1RMFH 4ZO8A 1S9XB 4IOIA 3AVEA 4QTIH 3OAZH 2P48B 5INDA 2PO6D 5GJTH 5T33H 1X5LA 2XKNA 3QIUC 3D3VB 4O2FB 3RDTD 5SWZD 4O9HH 4LK4A 3IDXH 5D71H 3TH3T 4L4TD 4X6CA 3SE3A 3KLHC 1CFTA 4ZTOH 4U3CA 3VG9C 2DIAA 1J8HA 3GJEA 3LKQA 4F7EA 2EDOA 2R2BA