3X1GA

H294m mutant of copper-containing nitrite reductase from geobacillus thermodenitrificans showing two coordination geometries at the t2cu site
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTMQFNHAQKGAVAMLKVTETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence of the flexibility of the CuM site
rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
total genus 99
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1gA00
2DWTA 3H4HA 2EIMB 3NJKA 3NJFA 1AR1B 2ZWNA 3WKPA 3NJNA 3T6XA 2JFCA 3IEAA 1CYXA 2XX1A 4GXFA 1UATA 5PCYA 1PLCA 2J56A 2YXWA 4BDVA 2IAAC 1PY0A 1J9RA 2H47C 3S3CB 1KV7A 1BEXA 2IH9A 2HLEB 4BWTA 2GBAA 3ABMB 3NT0A 2B3IA 2XV2A 2CBPA 5AZUA 1JZGA 1M9WA 1NIBA 1NTDA 1RKRA 3NYKA 3QJUB 4HHWA 1J9SA 3UACA 2J55A 3X1GA 3OMNB 3S3DB 1J9TA 1JXGA 1ASOA 4G70B 4ENZA 4YSSA 1L9RA 3IN0A 4Q8BA 4UF7C 1ADWA 4HIPA 4HHGA 2DV6A 2GB2A 4UAHA 5B7FA 1GS7A 1I53A 2LLNA 5I6PA 3CVDA 1SNRA 4E9YA 4GP4B 1TEGA 4K9JA 1AAJA 3ABKB 1OCZB 3KW8A 2R7EB 4AKPA 1PCSA 1AZUA 3NSFA 4JHVA 3AG2B 1BQ5A 4FA7B 3GYRA 5I5IA 2PP9A 4GP5B 1DZ0A 2FQDA 3FQ2A 2VM4A 1DYZA 5LDUA 3NSYA 2FQGA 3NP4A 4E9QA 3FYEB 1AANA 2DY2A 1JVLA 5ANHA 4BDVB 1OF0A 4AX3A 4YSPA 2VSMB 3QJVB 1AS8A 2XV0A 3FT0A 1N70A 2YQBA 4HCIA 4A2HA 2AANA 1AG6A 1AZRA 2VMJA 1X9RA 2IWFA 1MZYA 1NZRA 5I28A 2OCCB 3DTUB 1OE3A 2QPDB 4ZK8A 2PLTA 5D4IA 3WKQA 4KO7A 3D12B 4NERA 4HZ1A 3UABA 1KBWA 2GC7C 1L9TA 4F2FA 1EZLA 2P80D 2BP8B 1J5DA 2PPEA 3X1NA 3TASA 1GY1A 4AI7A 4N8UA 2PCYA 1A4CA 1QLEB 2MTAA 4WKXA 1E5ZA 1J9QA 4G7QB 1PMYA 4A67A 1TEFA 4E9TA 2XWZA 3PLYA 1IBZA 2EINB 1CYWA 3UGEA 4E9VA 2R7EA 4DPAX 2FT8A 1XB8A 3NJLA 4BXVA 1IUZA 3CZUB 4M3HA 2QPEB 1JZEA 1ILUA 3RYMA 3JTBA 1BXUA 1ASPA 2YAMA 3ASOB 3TBCA 1RZPA 2WO2B 1PNCA 3AG1B 4L0PB 5D4JA 3AG4B 2IWEA 4X4KA 3OMIB 1W8EA 5IY5B 2BO0A 3CG8A 4MFHA 4RH4A 3JT2A 5AKRA 3C75A 5B1KA 3ABLB 4DP9X 1L9PA 5D4HA 1ZIBA 1AACA 1ZDSA 2E86A 1WA1X 3FSZA 1BYOA 2VW4A 1KCBA 4DP4X 2PPCA 2VW7A 4DPBX 1AZCA 1ETJA 2IDUA 2TSAA 2UXFA 4NB7A 1SDDA 4NAJA 6PAZA 1IC0A 4HALA 5EHFA 1JZFA 3S8GB 1NPNA 2YXVA 2NRDA 4CSPA 1VLXA 2XYBA 2IWKA 1JZIA 1ET8A 1YLBB 4KNUA 2HZHA 3DKHA 2J5WA 1JXFA 3AZUA 2GI0A 3T6WA 2HX9A 5I26A 3CDZA 2BP8A 4FAAB 1ZIAA 3X2QB 1V55B 4QLWA 4YSAA 1KCWA 1MDAA 2RACA 2Y1AA 5I5MA 5I6KA 1WA0X 4HCGA 1NDTA 2OJ1A 5I5JA 1E65A 4KOCA 4Q89A 1SHWA 1E30A 1KDJA 2UX7A 2HX8A 3HEIB 2IDSA 3ZBMA 1OCRB 2XXFA 2Q9OA 2GIMA 4A68A 2XV3A 4PAZA 2CALA 1AIZA 3ABGA 1A4AA 5FC9A 2XUWA 1QHQA 3OQRA 1AOZA 4A2EA 2UXVA 3QPKA 1V10A 4YSRA 3PAUA 3T6ZA 3HB3B 2VW6A 1BQKA 1GW0A 2YAEA 2I7SA 4HAKA 3IN2A 1NWOA 1ET5A 1MG3C 1SJMA 4KO5A 3TA4D 4GYBA 3SBQA 1X9UA 4P5SA 3EHBB 1L9OA 1EHKB 1SF5A 3NSDA 4G72B 3NJMA 3BVDB 2PPDA 1SDDB 1KYAA 3N55A 7PAZA 3GXUB 1CC3A 2XLLA 2XVBA 1W6WA 5B1BB 1AZNA 1XMEB 3ERXA 2IDFA 4YVUA 1AG0A 3EH3B 1PLAA 3OD3A 3FU9A 1URIA 2BP0B 1JOIA 2BP0A 4YL4A 4BK5C 1KDIA 3DIVA 3FU8A 1BQRA 1ZPUA 3ZX1A 1L9QA 1A4BA 2IDQA 4A2FA 2PP7A 2FJSA 4KOBA 3PPSA 1A65A 2AVFA 1FWXA 1A3ZA 4KNTA 1SF3A 1NWPA 1HAWA 2GC4C 3AG3B 3KW7A 1GS6X 2DYRB 7PCYA 1GR7A 1WA2X 5TK4A 4YVNA 2H3XC 4YSEA 2QDWA 2TSBA 1B3IA 2FQEA 2CJ3A 2XX0A 3UAEA 1PF3A 1NIDA 1RZQA 4YSUA 1CURA 4CSZA 3NJGA 3TU6A 4HCFA 4A2DA 2AZAA 3UAAA 1AQ8A 1IBYA 1N68A 1RCYA 3UADA 1A8ZA 4E9WA 3EF4A 2FNWA 3PAZA 3PCYA 4YSDA 1OE2A 2EIKB 2B08A 4JKNA 4G7RB 1E67A 1WS7A 2YAQA 3MBWB 2OV0A 3FQ1A 3T9WA 1BAWA 2Y69B 3PXLA 5B1JA 2BHFA 4GP8B 4BWWA 1JXDA 3N2JA 3FQYA 1IKOP 2XU9A 4A66A 2YAOA 5B7MA 2WSDA 1OV8A 3L45A 2H5UA 4UANA 1MZZA 3TBBA 1J5CA 2YARA 1BYPA 1NPJA 2FQFA 3FS9A 4AKQA 3IBOA 1XB6A 1KGYE 3WNIA 2IDTA 4YSTA 1GYCA 1L9SA 1F56A 1KBVA 1NICA 2BZ7A 2UXTA 1GSKA 3FPXA 4W1TA 3WI9A 2BWIA 3FYIB 3ASNB 3ZDWA 4DP0X 9PCYA 2J57A 4DP2X 1BXAA 2YAFA 3CVBA 5I6NA 2JKWA 2GSMB 1NIFA 3OMAB 1AS6A 3PAVA 3SQRA 5PAZA 4DP7X 2GHZA 2X88A 3X1FA 5F7BA 2FT6A 1M57B 2DYSB 1HAUA 4DP8X 1NINA 1ET7A 2EILB 2HX7A 5B7EA 5B1AB 3NJIA 1NIEA 3X1EA 2FT7A 1CUOA 2VSKB 2N0MA 5I6MA 1OCOB 1NIAA 3WIAA 5E9NA 3EH5B 4EF3A 3S8FB 2CCWA 2QT6A 2UX6A 5B1JC 1OE1A 3WNJA 4YSQA 2MRYA 3ZIYA 2BW4A 3H56A 4JHUA 2FTAA 2YAHA 2UXGA 2AZUA 3V9CA 3NP3A 5A7EA 2XXGA 4P5RA 3AW5A 3FU7A 1MG2C 1OCCB 1TKWA 3IE9A 2HRHA 2DWSA 3NJJA 2PCFA 3GDCA 4YSOA 1PZAA 3QJTB 1ZV2A 1GS8A 1JZJA 3BQVA 4PCYA 1JZHA 1QNIA 4KO6A 4DP6X 4KNSA 4E9SA 3WG7B 1FFTB 2I85A 2X87A 3G5WA 2ZXWB 1FA4A 1JERA 2BW5A 3QQXA 3T6VA 2CUAA 2W8CA 1ZDQA 4DP1X 1HFUA 1SFDA 2CAKA 4E9RA 3FSWA 3QJRB 3U25A 3FPYA 3NSCA 5I6OA 4QKTA 2VM3A 3AY2A 1ILSA 3QJSB 1AZBA 1ID2A 4GY4A 2PP8A 2ZOOA 2P80A 3V9EA 1WAEA 3MX0B 2I7OA 1V54B 2QDVA 1WS8A 2JXMA 4A2GA 3OM3B 4DPCX 4YSCA 4F7KA 2WO3B 1PAZA 3T71A 3CVCA 4AKOA 6PCYA 1JVOA 1PNDA 2HRGA 3FU7B 4TXVB 2HXAA 1AS7A 1PZCA 8PAZA 5I6LA 4G71B 1T5KA 5B3SB 1TU2A 2BWDA 4F2EA 3S3BB 3SBRA 4DP5X 1ASQA 1E5YA 3FSVA 1M56B 3QJQB 1OOWA 1W6LA 5TK2A 3X1BA 4BWUA 5AFAA 2PPFA 2FWLB 1SHXA 2ZONA 2VN3A 2PPAA 5F7AA 3NJHA 4N4YB 1GY2A 2AFNA 4BXSV 4G7SB 3EH4B 2Q5BA 2YAPA 1BXVA 4KO9A 3SBPA 1PZBA 1R1CA 3H4FA 2W88A 4WTQA 3CDZB 4W9ZA 4M4RB 2A3TA 4AZUA 2IH8A 3FSAA 1PLBA 1SFHA 1XB3A 4E9XA 2BZCA 2EIJB
chains in the Genus database with same CATH superfamily
2W0KA 3IB4A 1WAAA 1WCBB 2VQ1A 2G2NA 3SPVB 5IQOA 3KH3A 2ZWNA 1JF6A 3O45B 5FYJH 4HKBA 4G6KH 3RVWD 4TOYL 3EO9H 4PJ5E 5G2NA 1MHHA 1MHCB 1T5WB 1CD0A 1OAUH 3LIZL 5DS2A 2IAMA 1OF2B 2D0HA 4I3RL 4RBPH 1BQHB 1ZV5A 4NUGL 5BZXA 3ZKNC 4N2LA 4AITA 1Z32X 4CRPA 4U4BA 4FMVA 2P24A 4OJFH 5E2UL 1J18A 3UAJD 5CEYA 5EZJB 3TIDA 4XNXL 3KCWA 5AZUA 1HILB 1FYTB 4OQTA 4X6CB 3VD2A 2ICEA 3WMPA 3T1FA 5FYJL 5F3BA 3CZGA 3MBED 4Q8BA 1O7SA 3MJGX 5JIDA 3NGBC 1EZVX 1BREA 2J8OA 3LKNB 4KTYA 4N8VG 4XNMA 5DZLA 2FYYA 2GB2A 3EDFA 5LAXA 2E8YA 1GS7A 2RIKA 5GRWA 4NC0B 1I3UA 2GJPA 1FVCA 1ZLEA 3ZKMD 4EIZC 2VL5B 1ZLDA 1AI1L 3SQOH 3U4KA 2EYRB 1KMGA 1TJIL 3KW8A 1CDGA 1YEDA 1WLHA 4OFYA 5IB5A 4PB0L 3SCMB 1XDTT 3L6FA 1BFSA 3V0WL 4PJGA 3L4ZA 1VHPA 3FUKA 1YA5A 3LEXA 2ZCLH 1KCVL 4PVMA 1HI6B 1NGPH 1INQB 2KLRA 3NSYA 2LU3A 5A6MA 1QHPA 5KYWA 3B7UX 4XMXA 1M7DA 3SYPA 1JUFA 5I15L 4R97B 1SLUA 3NK4A 1H8OA 2VSMB 3QJVB 3U6XS 3MBEB 3IXAB 5H4ZA 4KTEH 5DS8A 1AD9A 5FWRA 1SXBA 4IRSA 1E5UI 3PNWB 3RRQA 1AR1C 3EGXA 1AQDB 3LZFL 3S36X 5J0BA 4YEFA 2M2DA 3DTDA 4K3JH 1T83C 4IJ3B 3VXQB 3LNFA 4B96A 2I07B 3DDGA 4JFQA 5K59F 4DEPC 1JF1A 1UWXH 4MDJA 4Z7NB 1A4KA 5IQ9B 4W9CC 4P4KB 4PB9L 2X4OB 3BKCL 3QXVA 4LEOA 1I1AB 1QRKA 5I71B 2FX9H 3PWUB 1BZOA 4M1DH 1P7HL 4A7TA 1GRWA 3F7KA 2OCFD 3VA6A 2A6DB 3GHEH 1FVEA 4LRNH 5DJ2A 4QRPD 5ABDE 1QSED 2XY1A 3KGUA 3MRKB 5KSVA 2ZWKA 1LWRA 2XWRA 4JAMA 5J6HA 3ZKSD 4OZHB 1QA9A 2CU9A 5DC0A 3S5LA 4ELKB 5AW6B 5I1EH 3LH2L 4ZXBC 5DWUL 4FNLH 3FTXA 5C0BB 2NY2D 1DJHA 4YPGA 1EFXB 2IO5A 3QFJB 3QEHB 4KK6C 1KJ2L 4X4KA 1J7VR 2LLGA 4W9GC 1W8EA 5G5DB 5JW4R 1JD9A 3HS0B 2CR0A 2D7OA 3BYYA 5T1LD 4B97A 2DJSA 2OW7A 1FYTE 5HGDA 1TJMA 2GBUA 1YUHA 4DKFL 1ZIBA 4YO0A 5JOEA 3BLPX 3WJJA 4Q6IA 4BFEA 4OLVH 3SPCA 3DYPA 1Q94A 3ZHNA 4PJHE 2VAAA 4Z7OB 3KPSE 5DZAA 4JHZA 2E9BA 1QQDB 3LRKA 5L2JB 4Z7WF 4PJHA 3K5RA 3OLGA 1DO6A 1AIFA 4TKWA 3OKNB 4ZMAT 3RWEB 3O4LD 5I5RA 4TVUA 4DVRL 1PLGL 1X5FA 4I2XA 2LU5A 2G9HA 3BVUA 3B37A 1M3JA 3L3DA 4Y19D 1IBGL 3QNYA 4R9HA 1HDMB 2K9UA 3K91A 4ATWA 2B20A 3F7PC 3S8GB 2NRDA 2NYKA 3LRGA 4X5LA 1WFJA 3ECWA 3P9LA 3LCYA 2I9TB 5HDWA 2Y25A 3OPUA 4AWJC 4ECNA 5FYKD 4OGZA 1JPTL 4GLRI 4Z77A 3LN4A 4F37K 4KKQA 4M8QA 2VLJD 3W39B 5LLIC 1U8HB 4QYOB 3ZHLA 5BZDB 3V8CA 1U8IA 3QISA 5SX4I 3QDJE 5FDWB 2P49B 4P2RE 1D9KD 2VLRB 3DX2A 2XN9A 4X5WA 2YQ2A 4Y1TA 1OGAE 3MRBA 3G5XA 3GBML 2RACA 3SCMC 4GMSH 2IQAA 3MROB 5HHME 1U8CA 3IDMB 1R46A 3X13A 3L9YA 2V7HA 4Q89A 4CNIA 5AB9A 4RRPG 2W9EL 4L4TD 5T8IA 3DV4B 3DX9A 4WF7A 2HJKA 2XXFA 1MJJB 4ABWA 4BFOA 2WBJA 2XV3A 4FKHA 4G8EA 5FC9A 3SKMA 3L3KA 1QHQA 4LLUA 4NI3A 4XVSH 4G8IB 3NIFB 4JO4L 1Y18A 4Y19E 5DUPH 2B77A 2X7LB 1J1XH 2YAEA 4BA8A 3IPFA 3FT4B 1P7QD 2W91A 3MOAH 4Y19A 4DEPB 5BV7L 3S88L 5A40E 2DH3A 3IF1B 3WMSA 2BINA 4HVBA 5IF0A 1G9NC 4U3HA 1NBCA 1JCVA 1PCXA 3QH3A 5D1ZD 3Q1EA 2GKIA 3FUDA 5I1AB 1S7XA 2D3VA 3IU3B 2WXHA 4PJAA 3BZ4B 3F7QA 1P2CB 5DJXA 2Y5TB 5HGGS 5L8LB 5HI5C 3LRSA 2X2HA 2BY2A 1VEMA 3LZOA 4HJIA 2DM2A 1GKOA 1ODUA 4NQDB 3W2DH 2ZX7A 3GI8L 3K8KA 1OCWL 3N1GC 4NNYB 4NT6A 5MEQB 2IFFL 5D2NC 5KBPA 3T2NH 1URLA 4FP8L 5C3TA 2AQTA 3U1QA 3ZE0F 1CFNB 3VMNA 2NR6A 5D7SL 5HI5D 4EI5B 3BZFB 3F12A 2G3MA 3DHJA 3HS0C 1BFTA 4OCNC 2L8AA 3B9VA 3V8OA 3ARGB 2VABB 4F58H 1SHSA 3WHE0 1OP3H 1S46A 2VXSL 1YPZE 3C6EA 3NCXA 4G43B 1GS6X 4FCHA 1MH5A 3GJEA 2FUQA 4X2UA 4IRZH 5HYJA 1TVDA 3K5SA 4G59C 3BQUD 1B3IA 4KJWD 1BF2A 1XGYH 2IAMB 4Q97A 4JO1L 4XNUH 4YSUA 4PCSA 1HEHC 2P5EB 3LKQB 3O0LA 4YHLH 5BVJA 1C8PA 1F1GA 4A7SA 3H7LA 3HCVB 1UJTA 2EYTA 1JS4A 3BZEA 5I73C 1YMME 4J3TA 1HILA 3QQ9C 1D6EB 2X10A 2YGPA 3G08B 2PYEA 2VQ4A 2XKUA 2N4IA 1D5XB 2ICEB 2APSA 4Z7OE 3WAKA 3Q13A 2PYEE 4U0QB 1DBMH 3QCVL 4NZ8A 5D2LB 3NJVA 2YAQA 5H37A 4WV1B 2Z7UA 4Z7VB 5B21A 3VB8A 1L0YA 2GIXA 3EYQC 1RZKC 3FQYA 2JJVA 4RAUB 1KT2A 1MF2L 3IDJB 4I18A 1H5BC 4QY8B 1IGMH 2WWKO 4WUKH 1M3IA 2XWJA 1QVOA 2D7TL 4CILA 1ACYH 1E9OA 1MZZA 3ESUF 3RY4A 3BEVA 3RVWC 5ADOH 1JZ7A 1F11B 4LSTH 1W0VB 1PZUB 4O51A 3CFBB 3QUYD 3U82B 1UT2A 1GYCA 3UPAA 2K8MA 4BFKA 3BAEL 3DO4A 4ELMA 4RRPM 3KS0J 3QCUH 1QI5A 4JQIA 4O4YL 1J86A 4DP0X 1M7IA 1GJUA 9PCYA 3LVTA 2D4FA 1XGYL 5ICYA 3M7OA 4MAYA 4MMZB 4I3SH 1G6RB 5IM7A 2EXSA 4UTAA 4MDJB 2VZUA 5CEZL 3C6LD 3K74B 1BMZA 5DS8B 5H4YA 1I1AA 1O6TA 2J6EL 1XIWD 3RWDA 2FT7A 1CUOA 2HTLC 4IU3A 4H1LH 3CFJA 2W65B 1HX0A 4JZOA 4MMXA 2A99A 2Q1EA 1QYGH 2YPKA 2JK5B 4P5MB 4XOEA 1CXHA 1BAFL 4Y4KC 3RDTC 2XKNB 2A9BA 4G8FA 2YD3A 4PS4L 4Y5YA 4YBHA 3Q7JA 2XXGA 4N8VA 3HI5L 3FO2A 4LHJB 3VRIB 3NIDE 4PD4K 3VMPA 3S36L 4JFZL 3VVWA 1KCLA 2AV7A 5LG1A 1N6QL 3MSPA 3GDCA 4ZXBD 4YDJA 1E9PB 5F9WB 4L0YA 1RK7A 2YPVH 4ZMWA 5AG8A 2OJEB 1JZHA 2YHGA 2QLVB 4X8GA 5D1XA 1KIQA 1X7TA 4L4JA 3EFOA 3G5VA 4N3UA 4L9LB 2GPZA 1MAJA 3BO8A 4PIRF 4UQBA 4P4RB 3BGFC 2DMHA 2Q76A 3SDDB 4UILL 2VUKA 1T1WA 1AOHA 4DAGL 1JNNL 4KFZC 2GUYA 4AGQA 2J1YA 1UXWA 3BGAA 4OU3A 3N1FC 4AJWA 1ILSA 2E7DA 2EZ0C 3L3DB 1KCSL 3VXQA 2PP8A 3UTZA 5L6YL 2Q2LA 5J4MA 1QQDA 1DSWA 3QDME 4B3EA 1ED3B 5EIQA 3CSBA 1E42A 1FGVL 3GIZH 3QK0A 3S97C 2X4OA 4JHWL 3FTWA 3O2DH 1U8HA 3Q6GL 4Z78A 2HJLA 5E6IA 4AEEA 4NI6A 2ZPKH 1ASQA 3D08A 3CJJA 5AD0A 5KEZA 2EDDA 2WWOA 1DVTA 3X1BA 3H9HA 3VFUA 3I9PA 1FSKB 1RIHL 3E8VA 2F15A 1JGDB 4NXSA 5J6HB 3GJFA 5LXGL 3WN5B 1VFOA 4Y4FB 3WTXA 3S96B 4D8OA 4J4PC 4XVTL 2NUTA 4DT2A 1BD2D 1S3KH 5B4MD 2IH8A 5ECGA 5FGRA 4I77H 5JIHA 3K6FA 1FZMA 3D0VA 2C9AA 3GHPA 3H54A 4RFOH 3CZJA 3REVA 3LQMA 2GTQA 3T5WA 1BCIA 4DZ8B 2HA1A 3I2CH 4ZFFA 1YNKH 1ZSHA 3FFCD 3AQXA 4Z8FH 4JL2A 3U6XA 4UT6L 3BX7C 3LD8C 3S2AA 1YY8B 2Y6SC 2ZCHL 2DQHL 3BKCH 2FYVA 1U3JA 1V3KA 2X7LA 3WKMH 1NLBL 1J9RA 2YMXL 3NVQA 4J28A 4FFTA 3S3CB 3HI6L 5BS0D 3UBHA 1AQMA 3IJEB 3JWDC 4WKZA 4G8EB 2ZZUT 1LE9A 2CGZA 3IK2A 1NTDA 1L4IA 3MGAA 3WLBA 2I27N 1NGQH 2J55A 5KVFH 2P7TB 2NYZA 2MNWA 1RLBA 2JNZA 1ASOA 4OD1L 2W59A 3UC0H 2DJMA 4PG2C 5MHSE 4M02A 4UF7C 2WIIA 3B9KA 4XBEH 1CCZA 4QR7A 4WNQB 1F97A 5CJXA 4WI0A 1I53A 2N1TE 2CRMA 1MHEB 3PWPD 3RQ3A 4M8QB 2W60A 4O5LL 1BVNP 3F6JA 1K9TA 3OLDA 3EJPA 5IBUG 2XNAB 2NDGA 1VIWA 4U3SB 4KVNH 4PWEA 2H7WA 2NX5A 1KEGL 4PJAB 5ESVA 4Z7QE 2VXQL 2F53D 1T66C 4NO5B 3AG2B 3IMSA 3FF7A 3O2DA 4UOJA 3PY9A 1L9MA 3TEYA 4PRPE 4YGVA 3ZGIA 1FC2D 4BH8B 1MCOH 3BPOB 2WJ5A 4F33A 4AY0A 5L0QB 1DJZA 1PFOA 4ZYKA 4XB8A 5E8NA 3WFBH 1MOEA 4JM0A 2VXUH 1YN7A 3EYSH 4LQFL 1CE6B 2WLYA 4K5NA 5EORH 3DV4A 3AM8C 3KDPB 4K3EH 5EO9A 3BGFB 1BM7A 4PV9B 4FTDA 3CFCH 5I1LB 3LVEA 3SPGA 4LKCA 5JXAH 4Y1AA 4R26H 4JPIA 3N6YA 1KV3A 3II3A 3U9PH 1ZLUK 3CVIL 4EZJA 4P2OC 1OE3A 1H6UA 3UG3A 3QIUD 4HWEL 4RDQG 1PL3A 2BCKA 3BP6B 3P69A 3F64A 5E8EA 3TPUA 3FTGB 3ATAA 3B5TA 2EYTB 3QS3A 4MMYB 5A6IA 1UWFA 2BHYA 3O6KH 3G08A 3R19A 2MTAA 5HJBA 1JHTB 4G7QB 4HJGA 2Q8BH 1PKQB 2X2YA 2YBRA 3GXDA 5IMKA 2HKHL 4K0OA 3UZVA 4UZGA 2BH0A 5T1MA 1JPGB 3U9WA 1IKNA 3CGTA 1JJUA 4PWJA 3D2UD 4KFMA 4XP1L 4JFDA 3T4YA 3JTBA 1F41A 4NZUL 5C0CA 3X3FL 1R33A 3BAWA 1OAQH 4F8NA 4JY5H 4HUWB 1KIRA 2Q8BL 5JUEL 2FWOB 3OKMB 1CT8A 5HDOA 3KPRB 2VLKB 3ABLB 3MYJA 4QCIB 4KTDL 2YD6A 4B5ZA 3FQXA 3S35H 4HFWB 4EKXA 3RWIA 4FEMA 1RZJL 3V5KA 2R23A 1A9VA 2VSCA 3BN3B 3P3SA 4G42A 4UDUA 4WVRA 4LLVB 2HTKC 4DKTA 2CHWA 4LSSL 1OK0A 4TRPL 4R90L 4TPRL 4LQ1A 3VA2C 1Z5HA 5F0LB 5EIIA 4OLYH 1M2VB 2VW7A 5MENB 1IB5A 1T04B 4NZDA 2AV1B 4X9GA 3ZDXF 1LDPL 4N90D 4P46D 2EO9A 1ADQL 1E4XH 5DLLA 4NB7A 3NH7H 4Q9CA 3EO9L 1KSRA 4J3OD 3QYMA 3LN5A 3D85D 4LDEB 4P06A 1GHFL 2CE6A 2ZF8A 4MHHI 3F01A 3UIZA 3W37A 1RL1A 4GKZA 2WNXA 3TM6A 4HIJB 4ZAKA 3KJ4B 4KDWA 2OR7A 1VGEL 4G8FB 2XZQL 1N0LB 4D8PB 1MCRA 4P2AA 2FIRT 2Q7YA 2W9LA 3AZUA 4FQQA 1ZHLB 3L9BA 4IOFC 4NC1C 4TUUA 3B2DC 3PREA 4G6AC 3SB3A 3U36A 4Y4HD 3KPOB 4LVNC 2QL1A 3UJTL 2VR5A 4JLRA 1F2QA 2BIOA 3X2QB 4EUPH 5GZOA 4LHUG 5IROD 5F3HB 4FQ2L 4HIXL 1WZAA 5T3XE 3QIUC 2PCXA 4NQEE 5EZPA 4YDIL 5ITBH 3UG4A 3UPCA 4ABVA 1KT2B 1D5MA 3IDJA 4QY8A 3HZKB 1R5IA 4TTDD 4B9IA 5JHLH 5L2KA 2CKBA 1HKLL 4PRIB 4JN1H 1MCFA 1KDJA 1PG7H 4Z95H 1BGXH 1OY3B 1RSFA 1RY7B 4H20L 3TCLA 4KI5D 4FL4B 1QR1A 3BUPA 1ACYL 2WQVA 3ULVL 1D7BA 1UD5A 2MPAH 3L8QA 3DHMA 1XIWC 3QWRD 4OBSA 1I3VA 2O61B 2XN2A 4B6ZA 4C56A 1AHMA 3BRGC 3RU8L 4U6YA 3UYRH 2CLZB 4UQCA 1M7IB 5ICYB 1G9ML 4LP5A 3SEPA 3GD1C 5I18H 1RUAL 1U3HA 3L3HA 1SXCA 5B22A 1KTBA 3HS9A 5I1DA 1QUPA 4F7MA 4S0TD 1BX2A 4K2UH 1GSMA 4GI9A 1HTYA 5GRVK 3P0YL 5DFAA 5LGYA 1KTKE 3OV6A 4ODUA 4BFFA 4KNQA 1LK2B 4U6XA 5C09D 1EHKB 3LHAA 4EJ1C 4J3SA 1M05A 3DNKA 4G72B 1J48A 4FQHA 3QDJD 2L3BA 2VLKE 3MNZA 2JK5A 3BVDB 3GSUB 4QXTA 1SDDB 1ZTXL 2R1WB 4JRFA 4NO0B 5FECB 1PAMA 4PHZA 5D7IF 3VH8A 1XH2A 4OR1A 2XKNA 5AG9A 4GFTB 3ZR5A 2XLLA 1ZS8A 4N0CD 5KSBF 2ADGA 5DJDA 1ZGLA 1NCHA 1JGIA 1UWGH 3C5ZD 3CXDH 3LQZA 5A2KH 4JRYB 3EH2A 4NC2B 4H2CA 3PDGA 3LNGA 3FB8B 3VFTA 1WFMA 1IT9L 4IW4C 5E0FA 3TEUA 5INCB 2X6VA 3GMOA 3T3ME 4W4OA 3P77B 4EEEA 3BIAX 4OZ4A 4URTB 1YJDH 4P5TA 4UIKL 3EYFB 3LSOA 4GUPB 3SOBH 5KSAC 3REVB 4FF9A 4R84A 2WTPA 4ZTOL 1WEJL 4H25B 4PJGE 5DYFA 3ULUC 4IU2B 2W0FB 1JZ6A 2HSIA 5DK0B 1X9QA 3WSQH 3UAFA 4GXUN 3BQUB 4F8TA 1YN6A 4HJ1A 4WNJA 1PF3A 1MELA 4APXB 2FJGB 2LOEA 1NC2D 2BSTB 1BZ9A 3K80A 2JB6B 5DQ9B 3C08H 2NNRA 3FH5A 1A0QH 1L0XA 2EIBA 1GYWA 1GMIA 3OQ3B 4FXTA 5KYXA 3MV7A 3L3JB 3H2QA 5CM1A 3SYOA 5D1QD 3UPRB 3TOPA 4XBEL 4X9IA 1A1NB 2QQNL 3CZFA 5FAAA 5ITBL 3ZSSA 4MA7L 2I25N 3D85A 1OW0A 4XCCH 4AH2B 3QORB 4NQSA 3QEUB 5CD5D 5F44A 3KVDD 2ZUSA 5K39B 5CF3A 1E3XA 1FI8C 5J1TC 5CWSA 2EZ0D 4H1LB 5HYSB 2OK0H 1RHFA 4XOAA 2CHXA 3FQ4A 3IDIB 1GTFA 4ZYKB 4JO3H 1UZ6F 1R6VA 3L45A 3WKML 4D7PA 5GS1A 4JFWA 3WTVA 3TBBA 2NY5C 3GSNA 4L4VD 1IAII 3JUYA 2BIQA 2K6ZA 5I1IH 2F5BL 4NO5A 1EH9A 2KL6A 3OKEA 3RVUC 2J2ZB 4HS6B 1RJYA 3FPXA 5AW8B 2R2EA 3U9UA 1MCCA 4F5CA 2JB5L 3V4PA 3SDDC 1CBVL 4WFGE 1R3HA 3HHRB 1UUNA 1FH5L 4Z0BH 5SWQA 4HIEB 2DEYX 3SPHA 2CUMA 3RI5K 3FTGA 4KVCH 4I9XA 1AGFA 1QHOA 1M57B 4NRXB 3K2IA 1JPFB 5IQNA 1NC2A 5HYFA 3B1TA 3D25A 3CQFA 1PKQA 3HFFA 5IG7A 3WLBB 5D7JC 1BM3L 2EIEA 3LDBB 4PJFF 5D70L 5EU5B 3V0HA 1FL6A 1KACB 4MCZA 5EN2B 3I50H 5GSRB 3GSVB 5GZNA 1VA9A 5A1AA 3U4EB 3VDCA 4FQJL 3BZ5A 2XZAL 1FGVH 2BW4A 3GIZL 4HWZB 1W2KT 1FYTA 4JHUA 4AVJA 2VXTL 2O5XL 3VFSB 5CUSH 4I9WD 3O6FB 1KCUL 3SCMD 3WCYA 1XTMA 4P5RA 4P2QA 5TD4A 3TJHD 1BA9A 1NBZA 4NSKB 5E99L 3A4FA 3MOBL 4P2CG 4WRLA 2Y5QA 2EIDA 1MI5A 3NIDF 2FWOA 3OKMA 4UU9A 3C6LC 4F2MB 2NX5B 4JB9H 4YSOA 1HHHA 1PZAA 2YSTA 1J1PH 2CK0H 3F65A 4GOSA 2XG4A 4PBDA 3OKKB 1T3FB 4E9SA 4WFGD 4YOKA 2QHLA 4I2XE 1Z3GH 4OT1L 3II2A 1I8KB 3M17A 1OSEA 1SXZA 5D96B 3FUFA 4LLVA 4NM4H 3TEZA 5I74C 3DVGB 4O2CB 2J73A 2WVSA 5T3XL 3SBWC 2WXIA 3LZPA 3FFDA 1UACL 4AEIL 4ZPTA 1IAIL 5E6ID 2JLLA 2X1QA 4RMBA 4UINH 5FF6B 3D39A 4F8LA 4CJ1A 5I1EL 4JDZB 4Y1AB 5I6OA 3S5LG 3EUDA 4XC3H 4TF4A 3SZKC 3D39E 1QPPA 3ARFA 4L1BA 3V9EA 3EYQD 4LLYB 4H88H 4X6DA 4GG6B 3F6IA 1MCWM 4K9EH 2RR3A 5DMJB 2WO3B 5E8EB 3T2QA 1ZWIA 5J1SC 4GRMB 1T04A 6PCYA 1NBVL 3MFFA 4PJFB 4TXVB 4BQ6A 5I6LA 5FUOL 4AQAB 2Z93A 2DLFH 3GS4A 3HUJE 1T5KA 4MXQC 5E1HB 3FCSB 4HH9B 4BIKA 1EERB 2DQEL 2LT9A 3SBRA 2BSRB 3IJYB 1ZT7A 4KUCF 5D8JL 3QJQB 5AFAA 1A66A 4M6OH 3SODB 6CGTA 1TENA 4ZAKB 3VXMD 2PPAA 4TVSa 2AFNA 5EOQH 2NY7L 5GGQL 1OOAA 4ODXB 1EXUB 1EUUA 4BXSV 3QBTB 4G7SB 5ENWB 3OKOB 1ZCRA 1BXVA 1IFHH 2FEEI 3LPFA 4JFOB 4KO9A 4XPHH 3FQTA 3HJ0A 4BE5A 3PFUA 5E8OA 1CB4A 1VFAB 2EYRA 1QMUA 2ZUTA 4X9HA 3FSAA 2X1PA 3R8BB 2WWNA 4PJGB 3QCUL 1BFOA 3NA9H 4Z7OF 5EZOH 4ZSOB 4RISH 1WCBA 3ZL2A 3DJZA 5CZRA 5J8OA 2VXQA 1UD4A 5D9SB 2EDJA 2W80C 4DQAA 2OPCA 3IWVA 4M48L 3K7UA 2DQFB 1UATA 4N0YL 2UVFA 4NO2A 1HN1A 2EAEA 3RWIB 4AUYA 4ODVH 3HG3A 4AXWA 4JO4H 1CR9L 1RURH 5G4MA 2H47C 4HFUH 4XZUB 2AJ3B 4HS3B 3MBEA 5JYLA 4M93B 5EIIB 4FFVC 3DXAE 4NPKA 3TV3L 3KYKH 2CO7A 2VUOA 4BUGA 2A6JA 3F83A 5D7KE 2LHAA 4L4TA 1RKRA 2VAAB 2R69H 4G9DB 4OI9A 3LQAH 4W9IC 1SLWA 3LRHA 4JFFE 4UT6H 4XI5C 4YHMH 2JIXD 1IQDB 5BQ7B 1CZ8H 1KY7A 3MNZB 1E0OB 3SE9L 3JVGA 4X99B 3PRZA 1BX2B 2DV6A 4LSVL 3SGJA 2AEPH 3B6SA 3K1DA 2ZCZA 4K07A 5D71H 3RY6C 4DO4A 1UM5H 5C0DB 1IC1A 2NY6D 4N8CL 3VI4A 3ZE0E 2ADGB 5DJDB 4IHBA 3SDXA 3FT1A 1FVCB 1KC5L 1OCZB 1B6DA 1DJXA 3UBXI 5GSVB 4BHUA 3HAEH 3ZO0A 4DZBA 4NQEA 3FO0L 1S6NA 3Q2VA 3LN4B 3E7JA 5ACLA 2F68X 1NBVH 2EVFA 4F3FA 3JYBA 4QF1B 1E8YA 1KN2L 2YGQA 1JK8B 4RGNE 5LDUA 1LK3H 4ZMYA 3AS1A 4KMTL 5ISZD 4F91B 3JYCA 4KH9A 4M7KL 1E2WA 4F58L 5CBAB 1OF0A 4AX3A 4XNYL 1C5BL 3GXMA 1K72A 1V7MH 2HFFA 3DURA 4HBQA 5INCA 3ZTJH 5HGDB 1IC5L 2AANA 4MS6A 3JTSA 1HL8A 5CINL 1OM3H 1CFSB 4FLQA 5I28A 1JYXA 2DMKA 2ITDA 2OZ4H 5CP7B 4PJIF 3ZKND 1CLZL 1JGEB 2VERA 3ALXA 1E40A 4ODWB 3UABA 3H9SE 1DQIA 3DI2B 3L3JA 1T5XA 2V17H 5DK0A 4PTTB 4YHKH 4NPYB 1GYUA 2WBWB 4N8UA 5C07D 3IFNH 4MNQD 3E6FA 4N5EC 4F1ZA 1E5ZA 1J9QA 4HOXA 1YN6B 4ELMF 3KLHD 3D2TA 4QWWD 3PWPE 2QZ5A 3ARRA 4KZEL 2NZ9D 2GY7B 3EJZD 3MV11 2O5XH 1IGTA 2H1XA 5CEZD 4A04A 1AGDA 1XIWA 2P47B 5J5EA 2VM9A 3GM8A 1HNFA 4HCRA 1YAZA 2ALWA 2AEQL 3QR2A 1PTZA 3CZKA 5CGYD 2VDPL 5DJ6B 5J6SA 5KS9F 5KJ4A 4B0MB 4YHLL 4L0PB 4NNXA 3ZHKA 1XF3A 3QEUA 1DVYA 3G6JA 4KX7A 5E5MA 4NP4L 3G5XB 3CHPA 4OVUA 1CYGA 5LWYL 3C5JA 1S5IH 3WAJA 4H1LA 1BEYH 4OB5H 3RI5F 4P2QD 5SV3A 5CO1A 2GW5A 2FX7H 2B9BA 1A6ZB 3W0WD 3K6SB 3NOIA 5JW4Q 1QX1A 3H3PL 1T0OA 1ZA3A 2DQIL 3OB0K 2E27L 3RVVC 2PPCA 4QAMB 3BZFA 3PL6C 4UT9L 4DP4X 3IS0X 3MRFA 1H0DA 3Q2CA 1A1OB 4JPKH 3RE0A 3VXUB 2D03H 1DE4B 1EO8L 1TVBB 2XTJB 2F1AA 4Z7UF 4LSQL 3CFNA 2H0EA 5F1IA 1TMQA 3UJIH 2NSXA 2HWZH 5EHFA 3ENEA 2WQSA 4MCZB 2XJLA 4NJ9H 3MV7E 4PJHF 3BSZA 3SKNB 3AFLA 1JXKA 1LO5A 1ZA6A 5HHPB 1VLXA 4P9ML 2O6CA 4JFEA 1G4MA 5AZEH 3VD5A 5EF1A 1YLBB 1NCDL 2AP2A 5DLML 2AJYL 4OLZH 3H9YA 5FYKH 1RVFH 5I26A 4N5UA 2OX5A 3BUYA 1MI5B 1E7UA 3QRLA 5EOQL 2GIYA 3HA0A 1P2CA 4OM0H 2JQMA 3HZ3A 5K69A 3LIZA 2H2SC 1H8LA 4D0DB 4XP9L 1P84K 1QFWL 2WLJA 4HZLA 4WW1B 3WSQL 1IC7H 4NYLB 5IJVB 3FFDB 3B83A 1DQLL 3UZQB 4V33A 1OTSC 1IAKB 3D39B 5D8JH 1T20A 2DIEA 1A4AA 1FNAA 3IU4H 2HFEB 3OQRA 3HS8A 4G8GE 3X12A 1R3HB 2F74A 2IAMD 4IRSC 5K59E 1DJYA 2TRHA 4UINL 2DD8L 3MV7D 3MQIA 1UEYA 2Y9RT 3GNMH 4ZPTB 2OXGA 2N01B 2UZPA 3GJEB 2K78A 5LWYH 2FL5A 2XJKA 1RHHB 4EDWH 3EDEA 3FONA 2HPTA 4CDGC 2QVKA 4PJCE 4OGYH 1A4JB 3KLLA 3RIKA 2X4SA 4EIGB 2P5EA 3LKQA 1CFTB 3MLXH 4XX1G 3NAAL 4CMHC 4X8XA 5EF2A 2HG5B 4D9RE 3UERA 2ZWSA 2IGFH 4GXVH 3B2PA 2VZOA 1F45A 4AQAA 4F9LA 4TL5A 4W70A 5ENWA 4LESA 1AMXA 3BN9D 3QIWC 5CLZA 2R2HB 1GJIA 4YBQD 3BPNB 5FK9B 3X14B 2YPKB 4YDKH 4K3JL 1N7ML 3LV3A 3EH3B 5KVDE 4XP6L 3QZBA 5F7DA 1MKFA 2FH8A 3VWJD 4AK2A 1GOGA 4DGVL 3JWDH 4B9JA 4FC3E 2DWDB 3KJ4C 2GT9A 4JRXD 1A6AA 5D72L 4A2FA 3BP7B 1PZ5B 3CK0H 2PP7A 5EEXA 1BDYA 1YECL 2VJXA 5D1QB 4K71C 5E8PB 1JZ4A 4YDJB 4JJ5B 4U3XA 5E6SB 3U0PB 4MQXD 4UNIA 4H26A 1R0AL 1NWPA 4HS3A 4MQ7B 3ZTCC 2GC4C 1JV2B 3HI6H 4UQ2B 3RAJH 1J05A 1DHKA 1VCAA 2FO8A 1T0NA 3K4AA 3SE3A 1F02I 4H20H 4LCWA 3RGVB 3NMEA 5E7BA 2JTDA 3GMRA 3VCLB 1A14L 3ZZLA 2BIMA 5ESQA 4YQXH 3QEQD 4Z7WB 4K73A 2Y3NA 1DVSA 3DROA 4UBDC 1NMCC 3L48A 5CU9A 3UAAA 5FXCH 3FRUB 3DYMA 4GRMA 3V7MA 3PJSB 4O58L 5AVWB 4PRPA 4L4TB 3EF4A 5E5LA 4HEMA 2EH7L 2AQNA 3PAZA 4JRYE 4WJ5A 1A9BB 5F7FA 1FE8H 3OJDB 1A1MA 4WFFD 2W92A 4X8JB 2FEDC 5IT2L 4MZ2A 3EBIA 1YNLH 2O5ZL 4E5XG 1QFWI 4HWUA 5FCSH 2EDOA 5HDBB 4R7DB 4I0PD 3VTAA 2OV0A 2E5EA 4X5XA 4Q9BA 3ECBA 3LEYH 1U42A 2X9ZA 4XRCB 3N2JA 1NCAL 1E5AA 4AUUA 1XF1A 1TTRA 1O9VA 2VLJB 2J43A 4PGCB 2WKOA 4LLQB 2NLJA 3MV9D 5E9DA 4YXKL 4ILDA 5ANMA 4PV8A 4GAGH 3QUXA 3V4VB 1XB6A 4BHUI 3MV8E 4S1DC 5F0PB 1A6PA 3AXLA 1B0WA 1NICA 4PW9A 1E8XA 1GGIL 2DKUA 2R4RL 1TFPA 4R90H 4TPRH 3SQBA 2YRZA 1MRDL 2FLRT 4HOWA 5K9JH 4NM8L 1X5MA 3GQFA 3DO7B 5F7BA 3IGAB 2C3XA 4RSYA 1HAUA 2BVUA 4ZNCD 3WUWA 3C5SB 4IDLA 2IF7A 5FFGA 1NCWH 3BXNA 5GGVY 1AYOA 3MA9L 1OCOB 2C34A 2MCG1 5HGHA 3TTSA 4AL8H 1HQ4A 1W15A 3P2TA 1HC1A 4DKFH 4MS8D 2QT6A 5BQ7A 5B1JC 1WUZA 4BSWB 2WQUA 1TYEB 2A1WL 2MRYA 2NY3D 1AD0A 1RFDH 2I32A 3BEWA 5IVZB 2A2QT 3W56A 1XCQA 5K9JL 3TVMB 4QOKA 4I5BB 4L3EB 5IW1B 4I85A 1FFQA 1MVYA 4JG0L 4N1CA 2DQEH 4FQ2H 3DK2A 2XC8A 4F15C 1OCCB 2VJ0A 2X4PB 4XP4L 1ZAGA 3VYOA 1N2RA 1P1ZB 3B4NA 5LDSA 4YLBA 1XBDA 5K1NA 5MEPB 1CK0H 2UYLB 2WVVB 2VN5A 2B16A 2HJFB 3O4LE 4MJ6A 4QRPB 2OS7A 4D9LH 3VQ1C 4L29B 2H6UA 4PVBA 1F4WH 1XXFC 1EEUA 4X7FC 1I9IH 4LVHB 4N9GA 4NNXB 3BUDA 5EPMB 3D0VB 1FL5A 3QI9D 4I89A 5EBWB 3LXAA 1A14H 3MRFB 4DZ8A 5DYOB 5I30L 2WLIA 4K55A 5BS0B 5I18L 3RIAK 3PV6B 2ZOKB 3IGUA 5IJKA 1LDPH 3TZVB 2VXUL 4GAFB 1TCMA 4C83B 3ECUA 5DEZA 5AYQA 1WAEA 1HOEA 2K4WA 4OJCA 4Z7VE 3FL7A 4LKCB 4HWBA 5E6RB 3RG1C 3CFTA 4AKOA 4QHPA 2UUDH 1JCKA 5B8CA 3CMOL 2APBA 4J1UA 4XH2B 4Y9FA 2P7TA 5D72H 2ZKYA 1J10A 3TF4A 1ZXQA 3S3BB 3RU8H 5E4AA 4Z78B 1BD2A 1IGML 3NUKA 2NY0C 3BUYB 4Q2ZA 1E6OL 2F7QA 2JKNA 5AWNH 3KPSB 3TBSB 2OI9C 1TNMA 5CN3A 4HKZB 1JHTA 2C1PB 4HJGB 4LO9A 2O30A 1JGDA 4XCNB 5GRXG 5SV4A 2QKIA 1A6VH 1G87A 2OMBA 3MLUH 2YO3A 3MX0A 3M6DA 3NCYS 2C8NA 1CU4H 3J27A 4LLDB 4XNMB 3QR0A 4J8RA 5C09A 1MAML 4NQCE 4NYLA 4QXVA 1L7TL 1MI5D 1UHVA 1XT5A 3D09A 4OIAA 4OSUL 1NSNH 4JFDB 2IG2H 3HE7D 4OIIL 5E1AB 3NJKA 4KPHH 5FO8B 4EDXB 3DVFA 5HHXH 1QZ1A 2IWGA 3NJNA 3N42F 2BVOA 4YEEA 4S11A 1LP9E 1A6ZA 1G7MA 5GRVL 3ZTNL 2A9MH 2AXWA 3P2BA 1UCBH 3Q3GB 3AY4C 1JI1A 3P0VL 3TZVD 2IGFL 2VLKA 3UZQA 1UOWA 2B5IB 3QJZA 4XX5A 3RNKB 2P28B 5CXPA 4OCRH 4FA8A 4DFHA 3TT3H 5FM8A 3SN6N 5DR5H 3EF7A 4PJ9B 2BDNH 1KTLB 4LLWA 4F9PC 4PJ8D 1DE4A 1NIBA 1YEEH 4Y16D 3K6OA 4DKDC 3DETC 3NRQA 2WWMD 1S8DA 2GG1A 4CAGA 4HUKB 1I8LC 1NAMA 3TH3T 3EXJA 3FB5B 4ZX6A 1B4JL 2BVPB 1WTLA 4OLXL 5D7KD 1IGJB 4XP4H 4MMXC 5E03A 3Q5OA 3W57A 3HOGA 4L8SB 3TCXA 2AI0H 3TTYA 4J8QA 4WI0B 1G7LA 1JG9A 1OL0A 2R2HA 1EAJA 2DW5A 2IPUK 4R2GC 4JCMA 1HXYB 3NABH 1PD1A 4NQVA 4Y5YC 1DQLH 2EABA 5EU4A 2QPUA 1IMHC 4U3SA 2QELA 1U41A 2J71A 3A4DA 4PRAB 3L5IA 2GSIB 1MLBB 5JW3L 2J8UB 5ICXA 3O6ML 5KSAD 4DAGH 4F2ME 5DJ2B 1UA6H 3GMPB 1AO7E 4M43L 3X3FH 3FQ2A 5KSBA 5FK9A 4HMEA 1F3RB 1RQ5A 2ENJA 4IRJD 2C3VB 4J3XA 4BZ2L 5IB2B 2DBLH 5CMAB 3H0TA 5E6YA 1RJCA 4OAWA 3KPMA 4HMDA 4JFEE 4AQ8C 1NQBA 4WUUA 3DETD 2WXMA 2QVIA 4NJ9L 2YQBA 4HKBB 1R5IB 1PZ5A 5FUZH 4GIAA 4N25A 1CGTA 1UYWL 4NQQA 4XC1H 3VD7A 2HFEA 4NN5C 1JZ2A 4ZK8A 2PLTA 2V4LA 4ZUSB 4KO7A 4J3OF 3SE4A 3TZVC 3UP6A 3HFML 2VDNB 4W9DC 3GKWL 4HD5A 5CEYB 1C16A 1AGBA 1R3JA 3KS0H 4LSQH 3VGHA 1NAMH 3QUZA 4GMTH 3A6CH 4N9OB 3V4VH 3HE7C 2J1KA 3GT6A 3NZ8A 3FFCB 4J3OG 1A4JA 2XWZA 1QRND 3D52A 2JQZA 1A4KB 2IOIA 1OGTB 1YYLL 4NKIL 4JFDD 3V0VA 2HG5A 5FO7A 3PJSA 1JZEA 3ECBB 2FEEL 1EJOL 3TBYA 2CR3A 3E6HA 5LCVL 3QXAB 3KXFD 4ADIA 5HHXL 4ADGA 4PI0A 4OCXL 2VL5A 5FO9B 3ZZSA 3CVHL 2QQLH 4HV8B 2PW2B 5E9DB 1EFQA 4GRWH 4LCYB 3WTTA 1S4IA 4R7NB 5C6TL 4N2HA 3TH2T 1CDJA 4XT1C 4N2AA 4HJSA 4UV7L 5JTWA 3QEHA 2AAAA 1RZGA 3WFDL 4PRIA 1XD1A 2VTFA 3CNKA 1MW2A 3FSZA 1WT5C 3KBHE 3N91A 2VW4A 4DUWA 5EF3A 4X0KA 3CDGB 2CXKA 4XVJL 4BFRA 2HMID 2IQAB 2NYYC 5TDPA 4IMKC 1Y0LB 4F9LC 1L0PA 5FM5M 5DUBB 3WN5C 4OD2B 3LS5H 2X12A 4IRSB 4KK5D 3NESA 5IB1A 1ETJA 3FQWA 1UADC 3UJJH 1MCDA 4IOFD 4XWGL 4L8BB 3MRGA 3INOA 4X8CA 4OLVL 1EZUA 4TL4A 3WXVL 2WW8A 2YD0A 1WF5A 1ZD6A 3ZKQD 4YDKL 2Y7MA 4NRYA 1NJ9B 2AEWA 4MX7B 5DQJB 2OZ4L 2P8MA 1IEBA 1LK2A 1HCYA 5TE4H 2DTMH 2J5WA 2IGLA 4L18A 3KXFE 3QNYB 2YLKA 3U30C 1NMAH 1K3ZA 4P46C 1R17A 1LHZA 1JTPA 1ZIAA 4GO6B 1N5AB 2VLME 4GXVL 1BQSA 3WTUA 3B2UD 5IVZA 3KNBB 2WVVA 3MGOA 3S36H 1U8MB 1A2YA 2PN5A 5HDLA 1CD1A 1YQ2A 2DLTA 3DUUB 3HUJA 4HCGA 2VDOL 2XN9B 5DA0B 2V5MA 3W0WE 3ETSA 1PGRB 4F24A 1E30A 1EO5A 5BMFH 3HEIB 4HU2A 2KQMA 5BCAA 4QNPF 1LILA 1ZGLM 1MFNA 5E2WH 3OGCB 3H2WA 1B0GB 3WEMA 2GI7A 5HGAA 2OYKA 5C0JB 4EN3D 4FL4C 4Y7OC 3HB3D 5CBEA 2X0VA 3CFEA 1MHPL 5I16B 1HNGA 2VE6B 3Q2LA 3QARA 1BFVH 2QQKL 4A2EA 4PRPD 1ETZA 1DBJH 3NEOA 1P5VB 3GRBA 4N28A 5DVPA 3E3QC 5CNHA 5GIRA 2YA2A 3UGXA 2Y3AA 4WK2B 3BD4A 5L6YH 4OF6A 5HVFB 5EEVA 3I02A 1X9UA 1C5CL 1QFUL 2R39A 4POZC 3PDOA 4FYSA 1X7QB 3DSNB 3VFPA 4WK4B 1W72H 3B34A 5IQ7H 4QHLB 2DPKA 5ACZA 4KKCD 3D48R 1HZHH 1Q0YL 1KFGA 2KT6A 1BVZA 1MY7A 3RX5A 1NKGA 1P5UA 4QOKE 3OAZH 3UPRA 3MOAL 1OTTC 3QZWA 2ALAA 4XPHL 2A9DA 3HCVA 3RUGF 1D7DA 4ENED 1P4UA 1JNHA 5DUMH 1MN4A 4WI4A 1PLAA 5AZEL 1FAKT 3B8YA 1TJGL 1S9VB 3U0TA 5EMYA 4LFHG 1CVRA 3MLZH 2BJMH 1AMYA 2V8MA 2TAAA 1O9ZA 5EB9A 4HW6A 2XBTA 2YWZA 1GW6A 1YPZA 3VI4E 1DVZA 5D6CA 5DUPL 4KKCC 4Y2OA 4BK4A 1CE1L 4R0LA 1BQLH 3HLKA 2HVJA 3OG4B 2BHUA 3C2SA 2H32B 4WO4B 3U4BH 3MUUA 4D9QE 2NSMA 4JFXB 4WHTB 2AW2A 2Y6TE 2OZNA 3BEVB 4MNHA 2NY5L 2DWXA 2RMNA 3T1WA 2XBDA 2XX0A 3SDXE 4OZFG 5AYTA 3CFBA 3ZDYE 2FX7L 3EOTH 3K81A 1RZQA 3ARDB 1IGFH 1E4HA 5IR1B 4JY6A 4AG4H 2WC7A 1S9KC 2L4OA 3FTSA 3WUZA 2P48B 1G7QA 3NDYE 4NWTL 1QBAA 3P11H 3BLKA 4OZFA 5B3JF 2MTPA 2EEBA 3RAJL 1PQZB 5CJ5A 1T22B 4ODHH 4ALAL 2F1BA 1NCCL 2IH1A 2QVTA 4PBXA 4Z3FA 3VWKA 2EDQA 2ED8A 2P5PA 1TITA 2G2RB 4XPAH 1OAYL 1CL7I 4C8XA 2IFFH 2QV4A 4UZSA 3TBSA 5AKTA 2FO4A 2FVNA 7FABL 3TN0D 2PYEB 1R3KA 3KYOB 3BN9C 1SY6H 2F58H 3O6FA 4NKQB 4AV0A 2OAAA 1Y6MR 3O2VH 4WCYH 1DVFC 4A66A 3QXDB 1IZJA 5HYSA 3BCDA 2JKSA 2A7BA 3CCHA 5IB2A 3QZNA 3RDJA 4MA1C 4RMRA 3ZTDC 1XSIA 5EU4B 4EUPA 1SQMA 4Z7VA 1RJZB 4JB9L 1EBPA 4UZUA 1NGWB 5SWSD 1ETA1 4HOZA 1UZGA 2GSIA 2YXFA 3ATEA 1COBA 4K7PY 2QADB 1C1EH 2X38A 3K2UL 4NFCA 5L7XL 4PWHA 3VX0A 2O5YL 5EU7E 2PW1A 5I6NA 3ULSA 3H1ZA 4L2YA 1IVLA 3DX4A 5CR1A 3ESOA 3BZDA 3T4AA 4ERSH 2YK1H 4JZJA 3QRGL 2KZKA 2Z8WC 1ZANL 1G7PA 3L7FA 5DD5L 4EVNB 3HNSH 1SXSA 1MWOA 1N8OE 3UBGA 4XP5L 3M1BB 1EPFA 1HK6A 4X42A 1NIEA 4QHMA 3VFNB 2GVYA 4A7GF 5ISZA 1ZLVK 3QZPA 1TLMA 3CFDB 3MCKA 1X5LA 2GAZA 2ZSVB 3D9AL 4MDIA 4X6DB 3G9AB 3G6JE 3ULAB 1PPIA 1WH0A 1TTCA 1KJ3H 3U4BL 4AYEC 2FTAA 3V9CA 4XXDA 1FF5A 3E6HB 1DQJB 1D5XA 3A22A 4ZFZB 15C8L 4ZX4A 2PW2A 4G1EA 2WM0A 5D7IB 3V0VB 2GEEA 4RGOL 4PRHA 4F8QA 2V33A 1WWBX 3QS2A 4OW6A 5C0DA 2ED9A 3V0EA 5HDBE 4F2MA 4G1MA 1FFOA 3BQVA 1KIUA 1MCHA 2J8UA 3D0LB 1IKNC 3P73A 3FAXA 5ICXB 2WZ6A 1FYHB 5FYKE 1BSIA 2R0WH 2UY6B 1FFTB 2NNCA 4U2YA 1MREH 2GTZA 1BJMA 4FFWC 4J2QA 1DL7H 4X0KB 5K1JA 5F7UA 4WNSA 3NIGB 3LAFA 3BE1L 1AGEB 4XCCL 4KVPA 4OTXL 3AQYA 1RVFL 2WYTA 1SFDA 3FZUC 3TNNA 3QJOA 3RWGA 4E9RA 3GSQA 2DDQH 4J3VA 1VF5C 4QT5A 1UOKA 2BCMA 1IL1A 2BY1A 3FQWB 1YSOA 2AJXH 3FPYA 4TSCH 3R06B 5LN8A 2B5IC 4CGUB 4M6NL 4NN7C 1HYSC 1DJGA 4PEEA 3FO1A 1NDGA 1DTUA 2W9DL 5IHUH 1ZVNA 4OD2A 3FU7B 1J9CT 2B9AA 2HXAA 1PZCA 3N40P 4R83A 3VXOA 3WFCH 1C16B 3P3YA 3Q05A 4G71B 5B3SB 2BWDA 4LK4A 2CBOA 3P4OB 4Q74A 3PGCA 1VDGA 4YFLF 1SJEA 4ONFH 2X44D 5KSAB 3DVNA 5ID0A 2WLZA 4I8DA 3NJHA 2XDHA 1GPOH 3GC3A 4ZODA 4HG4K 4OLXH 2H2PC 3MI6A 3DUUA 3HUJB 2FHFA 4QRTA 3ZDYB 2NY2B 2OJZH 2E75C 4ODSH 4JFOA 4M4RB 3UTQA 4HLEA 4F27A 3C8KB 3MCG1 4RMTA 2PXYA 1MWAB 2HPOA 2NZ9C 2N7AA 5E5RB 5HHMD 5KUKA 1Y6NR 5J1AA 4QWWC 1XH1A 1S9YA 1TZGL 1KJ3L 4JMXA 4W68A 5HGAB 2CDFB 3QRGH 4OZGA 3AACA 1B4LA 1KIQB 3OLEA 3TEXA 1KF9B 3HE7A 2VE6A 2BS8A 5ESVB 2LAGB 3CLEL 3QG7H 3GBNH 3MLVH 3BYTA 3CPUA 2FATH 5F7YC 1OAZL 4QRQA 4BCXA 1ZT1A 1KV7A 3U7WL 3U7YH 4F33B 3VXSE 4TQPA 2DTML 1GTNA 3TNMB 1YN7B 3DHPA 2X3BA 5E4EC 3PQYD 1JPEA 3WEBA 1J8RA 1VGKB 4FZ8H 4J7RA 3N5AA 4K2UL 4E68A 5I8KH 4JL1A 2NUPB 3FCBA 2ZKHL 1ADWA 3K4DA 4JPIB 5ICZA 5J7CC 2VL4A 4L8CA 1BBJB 4AGMA 5GRJH 5H35A 3PUUA 5JR1L 1F4YH 5F1KC 3GPEA 5BUAA 1T6WA 2NX5D 4XN8A 5JHLL 4NWUH 2ZKXA 4LVOC 1B0RB 2ZOLA 4AT6A 3L5JA 4GP4B 3AREB 1V7ML 5D1ZI 2WIIB 4LRIA 3K72A 3UTTD 4JFEB 4A6YL 4A2MA 1FAIL 3NSFA 2ED6A 4UCFA 3WFDH 2NXZB 3ZO9A 1IGTB 4D2NA 3WN5A 1MI5E 4FA7B 3B3IA 3P9MA 4ZX3A 2WNWA 2FLMA 2OW6A 2EVHA 1NANI 1IGFL 1SRDA 3AQZA 3B7YA 1IM3B 4CU6A 1MCWW 3HVNA 2K3TA 2W07A 2ZUVA 1S9VA 3U0TB 5HHOA 1AANA 4FI8A 1JVLA 4XI5D 1OSZB 4Y1AE 4BFJA 1A3QA 1KC5H 1QRNB 2X4UB 3FT0A 1IO4C 3DX1A 3FU0A 1OT2A 4B9KC 2WKLA 4S2SA 1F42A 1P4LA 5HI3D 4HU8A 3BKJL 4WIQA 5A3ID 4IBLT 3KJ6H 2VDNH 5FM4A 2WUCH 3CC5B 4Q6IC 3WKQA 5IREA 4UQ3A 3Q2WA 1ACCA 3DSFH 4Z7NF 1MFCL 3ARTA 1L9TA 3DX8A 3FQNA 4WKZB 4NPJA 3X1NA 2OK0L 3KEDA 2XWBA 1A4CA 4HD9A 4AW7A 4GQPH 1A5FH 3UBXA 2N1KA 2WVUA 2XA3A 3U2SB 1TEFA 2X4QB 2EADA 1S7QB 3U46A 3VFPB 3U83A 1ORQA 5ALBL 3ZZ1A 1JNLL 1LO5B 4X5PA 5HHPA 1CR9H 3MCYA 1RIUL 4F93B 2Z31B 1FGNL 3CZUB 3V0WH 1CXFA 4HULB 3KYOA 2HB0A 4IHOA 1E2VA 5KBNC 5EBMA 2DMCA 1HZHL 5IMKB 4OCSH 4L3FA 4BZ2H 4S1RH 1T7WA 3G3LA 3RTQA 5JPNC 3ASOB 3VD1A 2OXHA 2OMYB 1JK9B 4JFDE 3VX1A 3CH1B 4GRLD 1JNHB 2OLDA 3PYCA 3MA9H 4IOIA 2C4FU 1WFNA 3L5HA 4JFTA 4MFHA 4RAVA 5BV7H 3C75A 1JIBA 3BAXA 4ZI8A 4KV5F 2CGYA 1BZQK 4BH8A 2BIHA 3MAWA 1U30A 4F7CA 3B2MA 2DQGH 4K5OA 4Y5VB 3T3PE 5EC2B 2QHRH 5IJVA 5GGTA 3SPVA 3UX9B 1BF8A 2GT9B 2HUEA 5DUJA 3JZ7A 3BUTA 3SOBL 5H8DA 3RJOA 3MJ6A 2XA8H 4TSBL 4X6EB 1WFIA 3VFNA 5I17A 3QDAA 5FOBA 2CIKA 4LOUC 1GKEA 4ZMTA 5LGHL 1I9JL 1PSKL 3E0GA 3ARDA 4KHXH 5BRPA 1I4FB 3CXDL 1XF5B 4GMSL 3SD2A 2NQCA 4PMEA 4U6YB 4UNTA 2XQYG 3ZHDA 4CADA 1DFBL 1XL6A 4GEIA 1P9MA 1A6UL 4X6CA 1A7OL 1WIUA 2XV6B 3L2NA 4RGNB 3BWZA 3T6WA 2X4SB 5F3BB 4F7MB 5IQMA 2WBJD 5DK3A 5JNYA 4HIJA 4BUHA 1R5WB 3D69B 1IV8A 1KYFA 4HAGA 1AHKA 1XGPB 2XWCA 5K9KB 2ZD0A 5I19H 3MLTA 1NBYB 2HAZA 4HXBH 2WXLA 3ILQC 3GZPA 3A24A 4WSJA 3F58H 3INUH 4IKNA 4NOFA 4WJ5B 5I5MA 4MJIB 1KWGA 2DEWX 4AC2A 2UZXA 4FQHB 4DKEH 2Z4QA 4AM0Q 3T8VA 1HJBC 2KHAA 3VXRD 1JYWA 2AJZB 3EYVA 1TQUA 1FIGL 4NO0A 4NQDE 2UX7A 2YPLE 4HUWA 1G1OA 4N24A 4WAFA 3L1OL 1ZS8B 5CJOL 5D7JD 5LVEA 3MYJB 4QCIA 5D2NA 2ADYA 2YPLA 1HHKB 4CJ0A 2ICWA 1CXLA 1DBAH 1WAAF 3ABZA 2FECL 1UEMA 2GK2A 2WSKA 3H9SB 3NIFF 4OCMC 4W9EC 2LV4A 4FHBD 4NUJB 5FA3B 1NUNB 5D2NE 5J12C 4EQ3A 4Q9QH 1ZKAA 3L3OB 4FQJH 2RA1A 2R8SL 4NOBA 5EV7A 3T6ZA 5L0QC 2VW6A 1FLTX 2YWYA 4Q4EA 5A7BA 1MJ8H 2NTSP 5F0MB 5ITFB 1E4KC 2LE9A 3MRRA 3G7TA 5F7LB 1T89A 3UG5A 3L7FB 1MCPH 2AV1A 5AL0A 4K7PL 2ZYHA 2CLZA 4G7YH 4XVJH 3P4OA 4YGAB 2C9UA 4QTFA 4DGIL 3GI9L 5FKAB 1U3HB 3WJLA 3VCLA 1DBAL 2Y06H 35C8L 3PHQB 3PP3K 3QUGA 3H7BB 4LEOB 4JM4L 2PCPB 4PBWD 3SE8L 1M7XA 3N0PB 3H85A 5DEFB 1NOFA 2QSQA 5I0WA 3C09C 2ADFL 2JELL 2Z31C 1TZOA 1QAWA 1SOSA 12E8H 1EUTA 5B1BB 4X8JA 1JTOA 1M6OB 1GHFH 2WLNA 3VXRE 3A6CL 3X14A 5EEZA 1AG0A 1VGEH 3GZKA 3T4AC 3FU9A 4E41A 4WTXA 4CVXA 3NACH 3VFRB 4FQXB 1KDIA 1KB3A 4I4WA 5ILTL 1BQRA 35C8H 4A39A 1BIIA 1A4BA 2EKSB 4ZUVB 4NZTL 1BZ7A 3MRHA 1XGTB 2DM3A 4XCFH 4TSBH 3ZVVA 3Q06A 2V9UA 2AGJH 2TRYA 4U1MA 4PJEA 2IBZX 2R9HD 4MCYB 2CBMA 3VRLF 2X09A 1W72A 2WQ8A 2BVYA 4Z3IA 4DGYH 4QRRA 1K2DA 1XR8A 1GR7A 3IE4A 5DRXB 3GSNB 4K3DH 1W16A 3GSQB 4N9GB 1N6UA 2JF1A 1KBGL 3FULA 1J05B 2CA4A 2H1PL 3BIBX 1AO7A 3EYFA 5FA4A 2XQBH 5T33H 3MJ9L 3OKEB 3THML 3P4MA 3ZKMC 2V2WA 2H2PD 1CURA 4CSZA 5E2TH 3D3VE 3NJGA 3U9UB 4HCFA 1KFAH 3SKMB 1EAQA 3O4OB 2SEBA 5LG6A 1AQ8A 3R7QA 2IMMA 1OB1A 2EEXA 3V0AC 1D5IL 1BPVA 3MBEC 5CLXA 4TUKH 3RLSA 4I2XB 1CIDA 2Q3XA 4F57L 2IPKB 1OE2A 43CAA 4J5VA 2OYLA 3VVVA 3EOAB 4IKKA 4JGJA 4ZOCA 4JKNA 3UZEA 2J4WH 4KQ3L 3OLIA 2JKRM 2PNDA 2YR3A 3D25B 5I24A 3T9WA 2F8OA 3VU1A 2Y69B 4XMLL 4LSPH 3VTMA 1DL7L 4HUUA 1ZHBA 4JQVA 1DEEA 3RHWF 4BWWA 4QOKB 3W39A 5EU5A 4MD4A 2GJ6E 1P53A 3ZQXA 3HE6B 5ILTH 3RY6A 3ZE0B 3BZ4A 2YD5A 2NCMA 3FO9A 2EIZA 4MCMA 2VDLL 3MRBB 3R0MA 4PV8B 1ITBB 5K5YA 1WK0A 3QDJB 2UYLA 4FHJA 4NNPL 2HG0A 4ZS7H 1LGVA 5I66A 4L29A 1FNEA 4JE0A 4GFXA 5AOZA 5C09B 5I0ZA 4UTAL 4GG6E 3IS1X 3SQBB 1B4RA 1RU9H 2N7BA 2X4NA 4LASL 4G6KL 3Q5TA 4L5FH 4FDWA 3GLZA 3M86A 2EH8L 4QO1A 3S2CA 5CEZE 5TFSH 1H8NA 1X4ZA 2VC2B 4B0MM 2CIIA 2DQCH 3KG5A 3RL1B 2HX7A 4XMWA 2DQTL 2QSCL 2EXWD 3M45A 4GW4A 5AVRB 1HCFX 1F0LA 3NK3A 3AXIA 2IFGA 1VGKA 4YX2L 3WIAA 2PXYC 3R8QA 3CSTA 4G43A 5HGHB 4UQEA 4IS6A 1D5ZB 1E7VA 2I5YL 2JVUA 2UX6A 5FYLD 3FU6A 4HLJA 4R5XA 1CXKA 1WZ1L 5KOVC 4P2QE 2K8QA 2NDFA 3DECA 3SDYH 5HI4C 4PRID 3NP3A 4PTUB 1J1OH 4LLYA 3ASWA 2AK4B 1IAIM 4MKMA 3GSVA 5DC4B 2OMYA 3M07A 1LMKA 3AREA 2UWEF 3QRBA 1SLXA 3BJLA 4HWZA 4PREA 2R8SH 4KK9C 3FMGL 3RWCB 1TFHA 4OF5A 1P1ZA 1VFMA 2L0DA 1YY9C 4YHYB 2EXYC 3LNHA 4ORZC 3SO5A 3U1SL 4I88A 1NCBH 4XO3A 2D3LA 1I9RH 2HJFA 3RTQB 3L4YA 4A7UA 4CBPA 5K9OB 1FC1A 3BW9B 4UU9B 1XXDC 5JZ7D 4FXKC 3BH4A 3KHOA 1TTUA 1KTCA 2G60H 3K6IA 1HL4A 2D73A 2K0RA 4EDXA 3IXTA 2CAKA 1RJYB 1E9OB 3NCFB 1QFHA 4MZIA 4P23A 3FCTA 3N44B 3O6LL 3WFHB 5I1KL 3ARGA 3WNKA 3NSCA 4NQED 1JZ5A 5EEYA 4HWBL 4LRIC 4BFIA 4BEIA 1CS6A 1SN0A 3TO4C 4LCWE 1J8HD 3GTNA 4A2GA 4YSCA 2FAUA 5TJWK 2ILLA 3T71A 1S3KL 3MUHL 4JDZA 3VU2A 1EGJL 1U95B 2V9QA 2O6PA 4XNZC 1U8OB 3VXUE 2P43B 4YUEH 3TA3D 1WIOA 2GJRA 3GXFA 1XR9B 4BKTC 5LKNA 4LEXH 1CFVH 5TK2A 3L4XA 3NCCB 3IDGA 2Y36L 4NRZA 2DS4A 2IADB 2AJUL 1QBMH 3QA3A 2Z8VC 3GMLB 3QUZB 2W65A 3PPEA 5HPMA 1X5GA 1G7LB 4EI6B 1H3PH 4K23H 4JKKA 4KKBD 3FRPG 2OL3L 5CIPH 1FLRL 2ZF9A 4WTQA 1NMBH 4N87A 1KYOJ 5FO7B 1U36A 2CXGA 5BNXD 3C60D 3ZR6A 3ZHFA 3IFLL 2FJFA 2YFNA 4W9HC 2EIMB 4F8PA 1GIGL 5CLTA 1HHKA 3GO1L 3DRQA 1AR1B 4WI7A 4OZIE 2XG4B 3M46A 1MPAH 4DTGL 1I8KA 3M17B 3PQYB 4C4BA 1DQVA 5C0AD 5E4OA 4Y5VA 4N3TA 1LO0L 3SZ6A 3FW6A 3HRZC 4UM9D 5ALBH 3SIKA 1JK8A 5IHUL 4GRWF 4XVOA 2GBAA 3O3UN 4RWYL 1PY9A 2DQFA 3PAYA 4NO2B 5AYUL 4QD2E 2XQBL 5DCCA 3THMH 3WS3B 4QJ3B 1M9WA 2ZUWA 2Q76B 5GPRA 5KTEH 3VXUD 3D6GA 2X6BA 4NX0A 4K8RL 5BOPA 3X1GA 4MCNA 2WOYA 4MZ3A 4PJXE 5IK3B 4JFSA 4ATTA 1MFCH 3GXIA 1E3FA 1X7SA 4HP5A 5DJZB 4O02L 1XF5A 2BVQA 4ZS6D 3ZZQA 4U6VH 3UJIL 4A63A 4WWKD 1U8KB 4U1SA 4Q14A 4JG9A 4W6YB 5DD0H 4ANUA 4IU3B 2NY7H 2YRBA 3UTZB 4L8SA 1A6TA 1SNRA 2A4ZA 3BKML 3A4AA 4MMXB 1PX4A 1OGPA 5DD1H 5T1LB 3G6DH 3PUCA 4NPYA 3RP1A 1PCSA 4MX7A 3BMWA 2Y07L 1XAUA 3LEYL 3BJ91 3KGTA 1BQ5A 2HJLB 5DK2A 1T7ZA 2IV9A 5EUOA 1BIIB 1SM3L 3QXAA 3DJ9A 4FKEA 4N8VB 1LO2H 3H9HB 3VFUB 5JOFB 4TQIA 5FB8A 3O9WA 4ONFL 7CGTA 3HBZA 2Z4QB 1U21A 3DIFA 3HNTL 2H8PA 5IVNA 4LCYA 4NZRL 1QSEB 3NPZB 2VLLA 2R1XA 4KY1L 4RLDA 2NUTB 4DIXA 3W11C 2XV0A 1WISA 4WWNA 5DJ6A 5IJBC 1BP3B 1YEJL 1P7KB 2YSSB 1CF1A 4MB4A 2EC9U 4O2FA 5GGRY 3G6JB 1WRFA 3H9SA 5FA3A 3VSTA 3RKDD 4MD5A 2WBKA 5D4IA 2IANB 2IALA 3TF7C 1M4KA 4PJ7B 4OD1H 5FHAL 2FZ3A 2SEBB 5DZVA 4HX1B 3LKSB 3DMMD 2BP8B 4KZDL 1GY1A 2JJSA 3L2LA 3QUYB 1K3IA 2PCYA 5ADOL 3GK8H 4FNRA 1JF5A 4LSDA 4BYHA 1ETZB 2A4CA 4DVRH 3ALWA 1PMYA 4JR9H 4WWKA 4DTGH 5CINH 2BY3A 5B3NA 3PLYA 3RBGA 4M6AA 1IBZA 5D2LE 3K2UH 3W1ZA 5KVDL 5DHMC 3VI3A 3UTTE 1ZOXA 1N6VA 5I8EB 1IEBB 3CC1A 1X7QA 3DSNA 1Q1JL 3QC6X 4WI3A 4YC2C 1QO3A 2EEDA 5AD0B 3TFBA 1WG3A 4QLRA 1SJHA 5E4EB 3EOAA 2X1WL 5CZVH 1FN4B 5D4JA 1I75A 1NC4A 1NCNA 2GABA 4M7KH 5GSVA 1Y1UA 5IY5B 3PABB 5AKRA 3CLEH 2IVFC 5GZOC 4R7NA 1L9PA 3QIBD 4JUSA 3BMVA 3I75A 4L4VE 1RK0B 1QEWB 2QFPA 5D4HA 5EIVA 4N6QA 1AACA 2NY6B 4Q58C 5I1GH 3QIUA 5CS7A 3MRHB 4FNSA 4B7IA 4L4VA 4EMZA 1LEIA 3N42B 5KYYB 3DGCR 4RMSA 2DQMA 3CFIC 4AEHH 1XGUB 3RL1A 1XR8B 3JTSB 3Q5YA 4LARH 1O6SA 2IH3B 2KKQA 4H8WH 1ONQB 1M6UA 3BLBA 4FKKA 2VIRB 1KJVA 3O9WD 4IS6B 5KN5B 2OR9H 4JFXA 2F61A 4QO1B 3W2DL 3SDDD 3QHFH 3T2NL 1U3HC 4GW4B 4J3UA 4H4NA 3SE6A 4E41D 4KNUA 3TV3H 1G6VK 2ATKA 5FUZL 4LU5H 1ORSB 4M5ZH 3BFWA 4LLAA 3FTVA 1KY6A 4MHHG 4UILH 1MUJB 2BS9A 1PKOA 3FONB 4GSXA 3CDFA 2D7MA 4OV6F 4P0DA 5A2LH 5C7ZA 4XNQA 4QLWA 4FD0A 4JKPL 1MHEA 2V5RA 4Z3EA 3UZVB 1A2YB 3RIFK 4XB3A 5KZCD 1KXTB 3BH8B 5GGTL 4KOCA 1J1XL 3OAYK 1K8IB 1XH3A 3U4AA 4G82A 5D2LF 3BFOA 4XCEB 2R59A 2QR0B 5DQDL 3ZBMA 4NS0A 1OCRB 2Y7NA 2P1YA 4HGMA 5L4MA 5IHZB 5AOKA 3QAZC 2J1WA 1KB5A 1Q9KB 3KPQB 3GSXB 4JJHA 4RCAA 2VSDA 3BH9A 1NFDF 3VQMA 2R15A 3BT0A 4JZNB 3LPOA 1MNUH 2B15A 5EEWA 4XOBA 3PAUA 3NFSL 3KEHA 4XPGH 1GW0A 1S7SB 3FDWA 1BEYL 4OB5L 1T20B 5GIRB 4EI0A 1OPGH 4JQVC 1XEDA 5M95B 3MBXH 2WMPA 1H3PL 5JHDB 5ESAA 1JTTA 4LPVA 3Q8CA 5DFWH 4QRPE 3QUYC 4RMWA 1OAXH 3QZOA 5BXFA 4MASA 5FX3A 3VXRB 4GAYB 5KVGH 5KYNA 4FMKA 1Q9WB 4NQCD 1F3DJ 4Q56A 2YA1A 5F1SA 5AVZB 2FL5B 3N9GL 5C0NC 2WQXA 4NRZB 4YUEL 1ZSDA 3TN0A 1U95A 2G3NA 4I3RH 4XHJD 5EC1B 4PW4A 2V7NB 1T7YA 5CZXD 1ZV9A 4YAQB 2KUTA 3JTTB 3BAEH 1UQSB 1O0VA 2WLLA 2BY0A 5IHBA 4PRBA 3IDGB 4DN3L 1TT6A 4ERSL 5LAXB 1G7JB 1HHIB 2CDEB 3C87A 5IB4A 1CICD 2HLFC 4CC0A 1QLRB 3QJHA 4G80A 1OW0C 5LGKA 1A1MB 4C56D 3H3KA 3FUMA 4TS6A 4WI2A 1M1XA 2IDQA 2PTVA 1J0HA 5H37H 3HR5B 4MB1A 4KU1A 1F4YL 2ZT9C 3ARVA 4KKAC 1MFVA 3MNVA 4H5SB 1FO0A 3HG5A 5GISL 4R0LB 5GS1C 3VGEA 1SF3A 2X89D 4FXGB 4XHQA 1WA2X 1ROWA 2HT2C 4P99A 2GCYA 2WTRA 1YDPB 4ZBJA 5TDNA 2APVA 2CUHA 4G42B 4OLUH 3UAEA 5AZ2L 1XCXA 1HKLH 4MQ7A 4EN3B 2F7OA 2IIJA 5HHOE 3ULUH 3DRTB 3EGXB 4KJPD 1M9SA 2V5YA 1XEUA 1IBYA 4LLMB 4XNYH 3UADA 5F9JB 3T0DA 4FHKA 3W5NA 1KENL 2WQAA 4FEIA 1PQZA 1T80A 2XIIA 5KYUB 2GAZB 2ZSVA 1DJIA 3TYGH 4TLSA 3FRUA 5SWSB 4H44C 4YN3A 2Q87A 3TIDB 5DHYB 2AQRA 2XN9E 3CUPB 2AXGB 2BHFA 2JCCA 3POCA 1Z9OA 4XXDB 4TVPL 4YHOL 5HYJD 5EF0A 5ETUB 3S7GA 4CVUA 1HU8A 3ILPA 4QXTB 4LASH 2ZICA 4Y4HC 3BPNC 4R6UA 3BP5B 4MDRA 5BZWA 3Q2NA 1I1AD 5C0EA 4HS8H 1MRCL 2A73B 1KGYE 4G1MB 3GSNL 3RTLA 4YSTA 1VB9A 1F56A 4GSUA 1KGJA 2VO8A 1DUYB 1U3HD 1EAPA 2OTWB 2BX5A 1NCBL 1MWAA 3QNZB 4Z3JA 1PVHA 4KITB 5ANMB 4FJYA 3NN8A 4JHAL 2JKWA 4P46B 4BZ1L 3WO4B 4YWGL 1B90A 2D2CC 5AVSB 3ULSB 3HZVA 3LEXB 1D6VH 5GS2H 1A0QL 4UYQA 5CSGA 3T0AA 4TUKL 3APFA 4NDMA 4XXWA 5B7EA 3ZOAA 5HHNB 4XNBA 3X1EA 2JV6A 1HS6A 4AW4A 1M7DB 4X0NA 4IBWA 2VMDA 5ISZB 1UXSB 3SKOA 2WLIB 5BS0A 1SJXA 1IJ9A 1VFBA 4QDGA 3MBWA 1I85C 1T2QH 3TZVA 1EEQA 5K33A 1MREL 2VJ8A 5DRNA 4HXAH 2HFGH 1I7TB 2F19L 2DBLL 2DZEA 1S9WB 1DQJA 5AOIA 4J6IA 3ZQWA 2FBOJ 2H6OA 3T2OA 2AI0L 1D9KC 3VI3B 1BWWA 1AD0B 3BEWB 1S5HB 3NJJA 4UNUA 5FECA 4BH7A 2J6WA 2YGOA 3DX3A 5BZDA 3FRPA 3NABL 3N85L 3LD8B 4PWFA 1EAOA 5JZ7C 4NNPH 4YR6A 4Z1PA 1GC1L 4ORGA 1JV5A 2CO1A 3BAKA 3G5WA 4HIIA 3U1PA 2UY6A 1A6UH 1LEIB 3MLYH 2QKIB 3LXBA 5ES4B 1E4WL 2DLFL 5LNDA 4KKLC 4FCAA 2E76C 3PWVB 4KJYB 4DCQA 5HDQH 4KJQC 2BNRE 1YC8A 4OV5A 4R0LC 4WEMB 4LMQE 5GS1B 1RK0A 2V7HB 1KGUA 2APWA 4KGJA 2FK9A 2HJKB 2MIZA 2VIRA 5G5DA 4AMKL 1EANA 1S7VA 4MD5B 2Y2TA 3QJFB 3LN9A 2VLMD 2IPTH 2I7OA 1V54B 2OMUA 2PWFA 2QDVA 3RZCA 4GW1A 1IU1A 2Z3FA 4S2SB 3KGSA 3VFGH 1RUQL 3DARA 2XPGA 1IC4H 1QBLH 5SWQB 4F2EA 4AGPA 2A4EA 4YHIB 4Y2LA 2PXYD 2BSTA 4WFEE 3CFUA 4KZ0A 3FSVA 5IJDC 1WZLA 2ZAGA 2JJUA 3QT2A 1M71A 4MNGE 4OIIH 5AVQB 2AMGA 2ZONA 3I6GB 4LMQI 4NIYE 3C9NA 4U1HA 4W81A 4Q9QL 3VWKC 1Y07A 3K1KC 4X98A 4BE6A 1BWMA 3NZUA 1XHHA 4L9DA 2FX8H 3AXHA 3IM1A 3DOSA 4Q2ZB 4PY8J 4NUQA 1FUNA 3SBWA 3PWPB 5CEXA 4XAKE 3VJ6B 1PLBA 5I0VA 2PXYB 4KROB 1Q0EA 5EBMB 3WJJC 2F8VA 4DN4L 3CVHH 1DQKA 4RA3A 4OGAD 5DWUH 1CDIA 4U31A 4YS4A 3KDMA 4N8PA 1KXTA 2JFCA 2ZG1A 4TUOA 1IGIH 1TYJA 1HQRA 4NT6B 4WWKC 5F96L 4PRAA 5C6TH 4DESA 3MO1A 1HHHB 1XH3B 1AKJD 3H9ZA 5IOPA 1PBYA 3LKOA 4PJ9D 2DIJA 1LP9A 4KHTH 2ZUYA 5IHZA 1CGVA 4GI6A 2YZ1A 4TQEH 2L7JA 2X4UA 2R69A 3RA7L 5DXWA 2PWEA 3SDAB 3GSXA 4KH2A 3EO1A 3QIWB 3T65A 1P4LB 2QGCA 1DVFB 3WV0A 1QSZA 1TJXA 5EIIG 2CK2A 3GJFK 3CC5A 4GIOA 3VXRA 4JANB 4MD0A 5FWQA 3O2WL 1JPFA 1FG2B 43C9A 4LLWB 4LBEA 2CLRB 2X4TB 3ARFB 3AU1A 4EXKA 4HZAA 5BVJB 2V2TB 2WLLB 1H6TA 1CDCA 5MERB 2J21A 5DJAB 3U48A 3FB5A 2R27A 5TPWL 5E23A 3V5HB 1AGBB 5ERWB 1MUJA 1A64A 4CADB 4UMSA 3US1A 3EBHA 2NXYD 1RUPH 4LIQL 3VFSA 4M1GH 3S8WA 2ZUXA 5DUML 3VACA 4N0UA 3IGFA 4GP5B 4XAWH 3UMNA 2A77H 4DO6A 3TCTA 5IESH 2VM4A 5GGVL 2FR4A 5F1NB 2Y7SA 2VZTA 4NZUH 2FQGA 1J0IA 4F57H 3MA7A 2H0JA 5F89A 3SKJH 3B2VL 1XD0A 5FFOA 3D30A 2W0LA 4XCEA 3LZQA 5KJ7E 3FQTB 5HYIA 3ET9F 1UVQA 1AS8A 4HCIA 4DKEL 4NM8H 1AG6A 1ND0A 1AZRA 2HH0L 2MJWA 2AJYH 5FV2A 3O6MH 2A38A 2OKMA 3QUMA 2DMBA 3TV8A 4AUJA 1YEFL 2CR6A 2HRPL 3QPQC 3ZU8A 1LEGA 3C2AH 5IVXE 5IESL 4D0CB 2DI7A 5D2NB 3TPKA 4O2EB 4DQOH 5DRWB 5JDJA 3N41F 1SVCP 2GC7C 4B9GA 5EDSA 4GAGL 1WAAE 4YXKH 4O9HL 1WDAA 3DA0A 4WKXA 2CMRL 1U2CA 3U2IA 1RK1A 4KKNA 1L6XA 4DFIA 5KYUA 1AFVL 4XGZA 5DHXB 3RTQD 1LD9B 1S7QA 3U46B 1UFGA 4IGBD 5EU6B 5IB1B 1MH5B 4AGOA 1AGCA 2PWDA 4AOFA 2JCCB 3RYMA 4LGPB 1YEEL 4X7TA 5KVEH 4IHOB 3NZ8B 3NFNB 1N4XL 1A7NH 1Z7JA 3FT2B 3EDKA 1FDLH 3OMIB 1N5YL 4Y5YB 3MLTB 1QSFB 2A73A 3TWYA 2P5WD 5J13B 1H6EA 3SDXB 4AVIA 3RVXD 5H94A 4BGLA 3US0A 1ZY9A 5KSBB 1ZLUH 3QQ3B 3H0TB 4F7CB 4EO5A 4JO5A 2X9XA 4I4WB 5DO2C 2HTLD 4GJTB 3M88A 3DJSA 3TVMC 4ABUA 3GSOB 4J3BA 1J0JA 3OAUL 2Q3ZA 1J5HA 3L95B 5HY9A 3IRCA 1YDPA 5TDNB 4KJQD 1G9MH 4LSUH 1AJ7L 1IC0A 3T04D 1JZFA 2BSBA 2AJ3A 4QRRB 4HJ0D 3FBKA 3HI1A 3DYOA