3X1GA

H294m mutant of copper-containing nitrite reductase from geobacillus thermodenitrificans showing two coordination geometries at the t2cu site
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
b'IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTMQFNHAQKGAVAMLKVTETG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
molecule tags Oxidoreductase
source organism Geobacillus thermodenitrificans ng80-2
publication title Structural evidence of the flexibility of the CuM site
rcsb
total genus 99
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1gA00
3FT0A 4E9TA 1NIBA 2UX7A 2HZHA 2PPAA 3OMAB 5IY5B 1AQ8A 5I26A 1L9OA 3CVBA 1E5ZA 2VM3A 6PAZA 4YSPA 4FAAB 2IWEA 4QKTA 2VMJA 3FSVA 4L0PB 4BXVA 1L9PA 3MX0B 5B1JA 2WO2B 1EZLA 1YLBB 4UAHA 3UAAA 4X4KA 1ASQA 1QHQA 5I6PA 4DP6X 2YARA 3WKPA 1MG3C 3AZUA 3NP4A 2OJ1A 2XUWA 2IWKA 1SF5A 3PLYA 4K9JA 5F7AA 1SDDB 4HIPA 3S3DB 2BHFA 3AG2B 3NJLA 3WNJA 1KCWA 5I5IA 1NIFA 2PP7A 1AZRA 2X87A 3DKHA 1IC0A 4HCFA 2MTAA 3FSAA 1DZ0A 2BWIA 4E9SA 4Q89A 3FS9A 2EIMB 2P80A 3NJJA 2FT7A 4UANA 4YVNA 1A4CA 2HX9A 2XYBA 3SBQA 3FYEB 4WKXA 1BXAA 1GR7A 2PPDA 2QPEB 2BP0B 2BW5A 3QJRB 2EIKB 3WNIA 3CVCA 4A67A 1AS7A 1AIZA 4FA7B 3BQVA 3QJTB 2YXWA 1NIEA 1CURA 1N68A 2YQBA 3SBPA 5ANHA 3KW8A 3AW5A 5D4JA 4W1TA 3OMIB 5AKRA 3NJGA 1AAJA 1M57B 2NRDA 4KO7A 4M3HA 1ZDSA 2XU9A 1RZPA 5TK2A 2IH8A 3T6ZA 1OE1A 2IDTA 2XXGA 2UXTA 1OCOB 1W8EA 3UGEA 3EH5B 4DP8X 3T6VA 3IE9A 2XLLA 2BZ7A 2VM4A 3ZBMA 1XMEB 4A2FA 2YAQA 1PLBA 3BVDB 3UACA 1N70A 4YVUA 3NJHA 3S3BB 3S8FB 3CG8A 4A2EA 8PAZA 1EHKB 1FFTB 2QDWA 3OQRA 4DPAX 4HAKA 2VW7A 3IN0A 2DWTA 3T6WA 3NJMA 1AS8A 2AANA 2GI0A 4W9ZA 4E9XA 1J9SA 5FC9A 1L9QA 2VN3A 3ZDWA 4E9RA 4BK5C 1W6WA 3N55A 2XV2A 4HCIA 2FWLB 1URIA 3X1FA 2XWZA 1DYZA 4GY4A 3HB3B 4KO6A 3AG1B 2ZXWB 1KDJA 1BQRA 2FJSA 4YSOA 1E67A 3NSYA 4HCGA 2YXVA 4JHVA 1KYAA 2CBPA 3QJVB 5I6KA 2W88A 1BXVA 4YSCA 1R1CA 3T71A 3TASA 2PP8A 3D12B 1JXFA 3G5WA 2Q5BA 1AZUA 2X88A 3FSWA 2VSKB 4BWTA 1PF3A 1GS7A 1ZIAA 2EILB 2ZWNA 3WIAA 1AZCA 5TK4A 3V9EA 1AACA 1PLCA 2AFNA 5B1AB 2CCWA 1OE2A 4UF7C 1GS6X 3KW7A 2GHZA 2J5WA 2FQFA 3NJIA 7PCYA 3ASOB 4YSUA 1JXDA 2PLTA 2RACA 1WAEA 2BZCA 4NAJA 4G7QB 1AR1B 3PAZA 3FPXA 1BYPA 1PZCA 1OV8A 2XX0A 1IBZA 4DP5X 1ZDQA 4JKNA 1PNDA 4BDVA 2I85A 2B3IA 2H3XC 1RZQA 1WA1X 3NSCA 3EH3B 1UATA 2AZAA 2TSAA 5I28A 1X9RA 1CC3A 3X1EA 1ZPUA 2J56A 2DYRB 2JFCA 3X2QB 1CUOA 2FT8A 2GB2A 1PNCA 2J57A 3NJFA 3PXLA 4ENZA 3UADA 1VLXA 3PCYA 4KNUA 1A8ZA 2HX8A 2HRHA 2R7EA 2UXVA 1BEXA 1GW0A 4KNSA 1F56A 2JXMA 3GDCA 5AZUA 3L45A 4WTQA 3GYRA 1B3IA 4NERA 2FQGA 2CAKA 1JOIA 2JKWA 3DIVA 4YSDA 3H4HA 1JVOA 4YSRA 1SJMA 2EINB 2AVFA 3TBCA 1MG2C 1RKRA 1KGYE 2IDSA 3ERXA 4PCYA 5B1KA 5AFAA 2DV6A 3WG7B 4YSAA 3NJNA 2VW6A 2W8CA 5F7BA 2XX1A 4PAZA 2FQDA 4YSSA 1NPJA 1JZGA 2TSBA 4TXVB 1ASPA 1A4AA 2HX7A 2A3TA 1T5KA 1JZHA 2CJ3A 2FTAA 2QPDB 1ILSA 1TKWA 1V54B 1SFHA 1NZRA 1JVLA 1WS7A 1KBVA 1SNRA 4GP4B 1NPNA 1NTDA 1AS6A 1NWPA 1IBYA 4N8UA 9PCYA 4DP1X 1AG0A 1ILUA 3NT0A 4G7SB 4HALA 3NJKA 5I5JA 5I5MA 1E65A 2BP8B 1AZBA 2PCFA 3EF4A 1A3ZA 1SDDA 2ZOOA 3V9CA 1TEFA 2DY2A 4QLWA 1ET5A 1J9QA 1RCYA 2Y69B 1JZFA 1JXGA 3AG4B 2CALA 4CSPA 2PP9A 4AKQA 1J9RA 5A7EA 2BWDA 1ET7A 3CDZB 1PLAA 3U25A 4A66A 4F7KA 2YAHA 2EIJB 3AY2A 1NIAA 1PMYA 1A4BA 3QJSB 4KOBA 4E9YA 3X1BA 1ID2A 3FU7A 4RH4A 4Q8BA 2GC7C 3QJUB 4BXSV 1M9WA 2BP0A 3ZX1A 4KO5A 5EHFA 1PZBA 3FPYA 3TBBA 2HXAA 3CVDA 5LDUA 3IEAA 5I6NA 1E30A 1SHXA 2UX6A 1GSKA 3C75A 5B3SB 1L9RA 4E9VA 2OV0A 1IUZA 1CYWA 3ASNB 5PAZA 1KDIA 4E9WA 1BXUA 1XB3A 4G72B 1ZV2A 3CZUB 4N4YB 6PCYA 5PCYA 2XVBA 1PCSA 2FQEA 2IDFA 3FSZA 3FU8A 1BQ5A 5B7EA 1ADWA 2CUAA 1V55B 3TA4D 3SBRA 2Y1AA 1PAZA 4HHGA 4JHUA 2H47C 2XXFA 1BYOA 2PPEA 1NWOA 2XV3A 4DP9X 1I53A 1KCBA 4YL4A 1AZNA 3FU9A 1MZYA 4DPCX 2QT6A 1AANA 2XV0A 4GP8B 2PPCA 3S8GB 2YAMA 1HAWA 3EHBB 2P80D 1GY2A 3ABLB 1NIDA 3X1NA 3NP3A 3ABKB 3HEIB 3X1GA 5I6LA 4BWWA 4ZK8A 1ZIBA 1PY0A 3AG3B 3GXUB 3PPSA 2IWFA 3OD3A 3N2JA 1QLEB 3UAEA 1BAWA 1X9UA 2N0MA 2GIMA 4DP7X 2MRYA 3FQYA 2B08A 1ET8A 5I6OA 4YSQA 5B7FA 3FYIB 3QJQB 3FQ1A 1GS8A 2E86A 2H5UA 3NSDA 1MZZA 3JTBA 1QNIA 1OCRB 1PZAA 1M56B 1JZEA 1WS8A 1OE3A 1NICA 4MFHA 4BWUA 3PAUA 4GP5B 1IKOP 4DP4X 1J9TA 2UXGA 2YAFA 3NYKA 2VSMB 4M4RB 2VW4A 4AKPA 2HRGA 4KO9A 2ZONA 4KNTA 1AOZA 4DPBX 3IN2A 4P5RA 2IDUA 3WI9A 2IAAC 2R7EB 3S3CB 4EF3A 4A2DA 3TU6A 3T6XA 2WSDA 3JT2A 2BO0A 4HZ1A 1NDTA 2BW4A 2OCCB 3H4FA 4GXFA 3RYMA 4P5SA 1HAUA 3ZIYA 4NB7A 1MDAA 4A68A 4CSZA 4A2HA 5B1BB 4G71B 1KV7A 2I7SA 1V10A 4AZUA 5B7MA 3IBOA 2YAEA 1L9TA 2YAPA 2I7OA 4AX3A 3WKQA 2DWSA 4G7RB 3OM3B 4YSTA 1ASOA 1NINA 3OMNB 1OF0A 1J5DA 1OOWA 1GYCA 4G70B 2LLNA 2PPFA 4AI7A 4DP0X 1WA0X 1W6LA 1JZIA 2WO3B 1JZJA 2IDQA 5D4HA 1BQKA 3ABGA 1E5YA 2BP8A 1XB6A 1XB8A 3NSFA 5D4IA 1TEGA 4BDVB 1JERA 3QQXA 2HLEB 2IH9A 1FWXA 1KBWA 1ETJA 3QPKA 2GC4C 4E9QA 5B1JC 3FQ2A 2YAOA 3T9WA 2PCYA 3ABMB 1A65A 1OCZB 1FA4A 3H56A 1AG6A 1WA2X 3SQRA 3MBWB 4F2EA 3CDZA 4KOCA 2FNWA 2J55A 2FT6A 2UXFA 3EH4B 3FU7B 2DYSB 4AKOA 3UABA 7PAZA 4GYBA 3PAVA 2GBAA 4DP2X 1SHWA 1HFUA 2QDVA 3DTUB 1L9SA 4HHWA 4F2FA 4YSEA 5E9NA 1CYXA 5I6MA 1SFDA 4A2GA 1OCCB 2AZUA 2Q9OA 1J5CA 1SF3A 1GY1A 2GSMB 1TU2A
chains in the Genus database with same CATH superfamily
4K7PX 1A25A 3Q7JA 3FUDA 4U1KB 3PQYE 3RWIA 2CBMA 2FO4A 5M94B 5DK0A 1LMKA 1I75A 5I26A 4UU9B 4X4YA 2N01B 1S9YB 2C9AA 1SEBA 2V8LA 4IIQA 3TH4T 4Z7OB 5CWSB 3D18A 1L9PA 2Q0ZX 2E27H 4Z7NB 4UZGA 3NCWA 5E2JA 2M2DA 3GIVB 1E50A 1MG3C 1T0MA 1H0DB 2QQKL 4IKLA 3VFGH 2OJ1A 4HJJH 5T1DL 4FXTA 3PLYA 2BRRH 2L4OA 5CP7B 5J89A 3AG2B 3MV01 2Q86B 2R59A 1GJIA 1BQHG 1NIFA 1AZRA 4M1GL 4Z5RA 4EI5A 1IC0A 2FL5A 1GH7A 2WLZA 3DROA 3NA9L 2PYEE 1D6EA 4OTXH 1D5ZB 5EUOB 4HCFA 2MTAA 3LQAC 3ZKQD 4F15B 3PGCA 4I87A 1YEHL 3AM8A 3H9ZA 1I3GH 4OLZH 5FS5A 2FLBT 4MB1A 3VRIA 3ZYZA 3PQYD 3SCMD 5AW7B 1TTBA 4HX1A 5F71A 3RKDD 1R3LB 5I71B 2W81C 4XVUC 5GGTH 3KLLA 3II2A 4DGVL 1QUNB 1MCDA 3WO3B 4LSQH 3SBPA 2WXRA 5ANHA 1COBA 3MGAA 2YEZA 2ED9A 4MTMA 2XVLA 3EGDB 3NCEB 1E42A 4PRIE 1WIOA 2Z7ZA 4G6JL 4LARL 5F21B 3II1A 3D0LA 4XNXL 1AAJA 2H7WA 2BY2A 1ZDSA 2MCG1 2JJTC 3ULUH 2G5BA 1QPXA 3T6ZA 4HT1H 3HCVA 4QWWC 1RZGA 5DJ0A 4M8RA 4A7UA 4GKOA 4U1NB 5ISZA 3U6RA 1BQHA 4F8OA 2YD3A 5I73C 1AP2A 2EYSA 3N41B 3WAKA 3TF7C 1IT9L 1SEQL 5GGVH 2WWMD 4Y4HC 1EH9A 3IJYB 1DO5A 4L18A 3S88H 3VXTA 3PWPE 5HJ3B 4DKEH 2VXQA 1LP9B 1CIDA 1TQVA 1W0WA 2KZBA 2VABA 2WBJD 5DZOA 1EUTA 5MEPA 3IN0A 3L13A 2VE6A 3L3OB 2IALB 2AANA 3MODH 5I74B 4UTAH 4F3FA 2R56H 3AACA 2F1BA 3QWQB 4IU3B 2IV8A 4E9RA 2X1OA 2J88L 4FA6A 2W59A 1URIA 5ACMA 4LEXL 4HUNB 5FR3A 1DYZA 1R5WB 5IBUB 3ZL1A 2EIEA 2QADC 4LAQH 2G3NA 2Z1KA 3GSXA 3MXWL 3BPCB 4HWZB 5E5UB 4ZAKD 1BMGA 2ZXWB 1KCKA 3KM1A 4L5FE 1WFUA 4XRCA 4ERSL 3QFJD 2N7AA 2UWEF 4F8QA 1L3WA 1J10A 2JKJA 3WY1A 5LN8A 1MHCB 2AQ1A 3HLAA 2Y5TB 4NZTH 4PRDA 4Y16A 3CH1B 4UB0H 3RY6C 1BWWA 1Z9OA 4PVBA 3K91A 4ZNCD 4WUKL 4HLZH 5EN3A 1THCA 2HFEA 1NEUA 2JJUA 2OZ4H 1T7XA 4BBWA 4LF3A 1GS6X 3CZFB 4PY8I 2A9CA 3DPDA 1U8KA 5DR5H 5GGTL 2E75C 4TSCL 3CXDH 3LNEA 4QD2E 1EAOA 1Q72L 2KLTA 4JZJC 3TA3A 4YHYB 4ZG1A 1BVNT 5CJBA 1YEDB 2D9CA 4ERSH 1QSFA 1DSFH 2EDFA 5KVGL 1Y6NR 1BW8A 4Z23A 4HC1A 3FTZA 3S96A 4MASA 3SZKC 5DD1H 1JZ3A 3RIFF 1WBYB 1BZOA 3M46A 3ZRSA 2R69L 8FABB 2O61A 2QHRL 4CMHB 4F7TB 2LU3A 1D9KC 3GI9L 4ZSOB 3NIFB 3F7QA 4L37A 2FIKB 4XNQB 5ETUA 2YD9A 3X1EA 4PJEB 3FTUA 3L3HA 3MRMB 5GGVL 1XGPA 1M71A 3G6JF 3B3IB 3SBWC 3GBMH 1V7NH 1QBLL 3VI3B 3O6KH 1MJ8H 1RP8A 1ZT1B 1T6VN 4FADA 4WI0B 4N9GB 4KNSA 4QHMA 5L88L 5KG9A 4HIXH 5AOKA 4LHQB 4MKMA 5JZ7D 3TBSB 2BM3A 1KYDA 3VFRB 5KBPA 2VGLM 2W9DL 4KKLD 4ONGH 2GKIA 5IROA 4B96A 1SJMA 1UM6L 4TTGA 4ZD3H 5B1KA 2CSPA 3FO2A 3Q8AA 4EBQH 4H1LA 2X4NA 1KJMA 4NKMB 15C8H 4GSUA 1UM5L 3MJ9H 3EYVB 2OJEB 1AMXA 2UVEA 5G5DB 4EDXA 5F7UA 1A14L 2Y9RT 3ARDC 3CSPA 3KYOB 3MUJA 1MCPH 3MRNA 3RVWD 4CVZB 5J9PA 3UJIL 3D30A 5CEZH 2ICEA 2XN9B 2IANB 4QRQB 4ZI8A 1HJBC 3F64A 1CXEA 4PRHD 3ZVVA 1GYUA 2VC2L 3LOWA 3DURA 1MNNA 3B2PA 5A3IC 1FVEA 3ES6A 4JFZL 4G7YL 2K6YA 3PWPB 1I3GL 3ILQC 4OLZL 3UZVA 3GMNA 4XC1L 1MAML 1OAYL 2BCMA 5JPNB 2BP8B 2RD0A 3LB6C 1QYGH 3TVMD 1R24A 1DFBL 3EF4A 4GBXD 4RLDA 3WHXB 1A3ZA 4G8GA 5KBLA 3QZPA 4N6RB 1TF4A 2B5IB 4XPFH 5IT2L 2ZOOA 1XF4B 3DHMA 4HJJL 4MA1C 1TEFA 4OFVA 1J0KA 4X6DA 5DZNA 1QEWA 3E9TA 5AQ0A 4KY2A 2C3VB 5JXAH 1F2QA 2WXMA 3HC3H 1HOCA 1BFVL 2GW5A 1U8NA 4JQIH 2PP9A 4N90D 3G5VA 4HIHA 2V9QA 2VC2H 2EYRB 2PUQT 1MY7A 2Y22A 2J71A 3AQDA 5FW8A 4KOBA 3FO9B 9CGTA 2YPKB 3CN1A 1UACH 4G8EA 1PG7L 4BXSV 2PR4H 1GOGA 4PJ9B 1JN6A 3QGVA 4LFHG 3QSKB 1VFAA 3JWNC 3D2UD 3MO1A 1BVKB 4KO5A 2X3BA 1OAKL 4OB5H 3ECVA 2DEWX 1UFUA 4EE2A 3E1ZA 5E1HB 4GRWF 4N2EA 1SYVB 4HKXB 4ZDHB 3EJPA 3ROOA 2XA8H 3QUXA 3W39B 1YN7A 1MCEA 2Q76A 1FNAA 2FCBA 2NY6D 5EC2A 4WIQA 1ZGLA 2VDQH 5C08A 1AGCB 2YKKA 1BQ5A 4LPCA 2PO6C 5I66A 1WK0A 1QTPA 2HLAB 5F3HB 3TA4D 5EN2A 1JPFA 4WV1C 3BPOB 4WNQB 3WJJC 2QMKA 5IOPA 3P3TA 4KTDL 4WWNA 2NNFA 4IMKA 2P28B 1F4XH 1D3CA 2WJ7A 4PQXA 1N64L 2ALWA 4ATWA 2BSDA 2D7TH 1FCGA 1OAUH 4OZIA 1HNFA 4LSRL 4W9CC 3EHBB 2HMIC 4CBZA 4JHBA 3NP3A 1SN0A 2R4SL 1RZJH 2BFGA 2IFFH 4D0DB 4I8DA 5DD3L 1REIA 2ED8A 3C60B 4PJXF 3GXUB 2BNUA 5CILL 3ULUC 3BZEB 3GMPB 4XPAL 2Z8VC 3D87B 3O9WC 3IJ9A 4TUKH 4R5VA 3PHAA 3CHQA 5HHXH 3QEUB 4TLKA 1A9EB 1I8MA 3QCTH 3MU3A 1KEGH 3B9EA 4HP5A 5I0WA 2P5EA 4HX1B 3QJQB 5IW6B 3NIDF 4XTRD 5CBAA 3VTAA 5GRXG 5KS9F 4UQEA 1F11A 4PJBF 1IEAA 1QKZH 2J2ZB 2XWRA 3PWJA 5I8EA 2A9NL 4A7GF 1NQBA 1Z3RA 1HKFA 1R5VA 4R7NB 3MJ9A 4ELMA 3EGDA 5MEOA 4M29A 4NQCA 1MFDH 2NY3D 1UHVA 3V2AR 2JJSC 4WY7H 2X6VA 1PX4A 2DD8L 3FT4A 3O3AB 4CAGA 3DX6B 3WIIH 1JTOA 4OUUA 2Z34A 3W5MA 3FQ4A 2P8PB 4ZX5A 4PY8J 1IAOA 3QS3A 5BV7H 4X0NA 4AYDC 3MDJA 3QNFA 1YNLH 5EBGA 5LAXA 3BHBA 1VKXA 2IMNA 1LQSR 1BJ1J 1MCHA 5C07A 5BVJA 4MAUH 3BGMA 5FA4B 3U1SL 2FSEA 3ZKND 1PCXA 3TBVA 1A5FL 4A68A 1Z7JA 2E6QA 5E8EA 4P2OB 2YD7A 3ZXAC 4A2HA 3CWGA 3FQUA 4YO0B 5IMKB 1IM9B 4N86A 2L7JA 4D9QE 1YYCA 1BOGA 5HGAB 1SMAA 2H8PB 4LF3B 5FECA 1QFWI 1EAPB 3HJEA 4F5CE 3AY4A 2DWSA 4JKKA 5HVWA 3RVXC 1HDMA 4NUGL 4D9LL 1X5HA 1LO5A 4TLUA 3G7TA 5BV7L 2CR3A 5FO9A 1R46A 2LVCA 1SN2A 2OW6A 3MLVH 1UQSA 3GSXB 2CNZA 4Y5XB 3IDUA 3WFEH 4D8OA 1M7UA 1FFOA 4BKLA 1JF6A 3MPCA 4JFPB 3LEXA 2XTJE 4PGJA 1EXUA 5ES4B 4WO4C 4PRPA 4AQOA 1CI5A 5C0FB 4RGOL 1M05A 2N0KA 5ENWA 5J12C 4E9QA 1BD2B 1BEYL 3IFNL 3APFA 3WEOA 3PL6D 1FZJA 5EU7C 5AZ2H 5DO2D 3C6LB 5MEQB 3EOTH 2PWGA 3VXPA 3JTSA 2YHGA 5FKAA 4Y2OB 3WIHH 1WAPA 3PWLB 4GKNB 3CC5A 1YUHB 4U6XB 4P4KA 1Z66A 5KG9B 4QXUH 1VCBC 4K15A 4KJWD 1FBIH 3FB7A 3IDNB 4FXGC 4AVKA 5JW4N 1D5IH 3BP4A 3OAUH 4FXKB 2YRLA 1KJVB 1YMHB 2QDVA 3DTUB 1LGVA 2FX8H 2QSTA 2ZOLB 3PGFH 1K72A 4H1LB 5I17A 1F5WA 5FLVA 4JFZH 3MV9D 3ZTEA 2WWKT 4AEIH 4M6OL 3WJLC 4BD4A 1XCWA 4RFEB 1FGVL 2CKNA 4TL4A 1L6ZA 4WWID 3FZUC 1IGMH 2A1WH 3I6LE 5ETUB 5E8PA 1H8SA 4HWBH 1HCYA 1UGKA 4JQXA 2C26A 5ID0A 5JW5A 1IMHC 1EUUA 4PS4L 3GM8A 4Z7QF 3QBTB 3T0WA 5IV2A 4DO6A 4PRNA 2H2PC 4APQB 3HUJB 1ROWA 2WLMA 3RVVD 4CU8A 1SXAA 4OLUL 3AZUA 4M3JA 3D33A 4X99A 3U9WA 4G8GB 1SDDB 4L1HA 5F1IB 5AW6B 1Z1WA 1NAMH 1A6AA 2O30A 3DMMD 3S3DB 3X3FL 5K33A 5C7XH 2UY7A 3AJ7A 4X5WA 3GJEA 4PRHA 2L8AA 3DX7A 5T1JA 3KLQA 3CVHA 4R4FL 4OVVA 4Z9KB 3REWB 5A2KH 3DA0A 4N2IA 4HCRA 4ANWA 4BQ9A 4WCYL 5LHDA 1R3JB 2E9JA 4QRPE 1BBJB 4QUOA 2A6JB 5ALBL 3HNSH 4AENA 3U7YH 3GZKA 1S8DA 2WXJA 1KN4H 1NUNB 4JFYA 1INQA 5HHNB 1DL7L 4X6FB 3U2SA 4EN3C 3H6JA 1AIZA 4YZWA 4X5QA 2VAJA 4OY9A 5HGHA 2UWEE 3C8HA 3GSVA 4XGZB 3T1FB 2IBZX 5IR1B 3AW5A 4QXGH 4GG6F 1A9BA 4QRSA 4U2YA 2DI7A 4P23B 4HLEA 2W0LA 4NP9A 3PUCA 1PZUB 4OW6A 3MBEA 5J6GB 5TK2A 1QEWB 2X38A 1G6RB 1C16B 2XXGA 1D7FA 4BZ2L 1EERB 1HI6A 2C9VA 1XIWD 4P2QB 4GAAA 1HOCB 1TTGA 1I8LC 2AEQL 2FLMA 2R8SH 1N19A 2IQ9L 4GXUM 5LGYA 2ZG3A 2XLLA 3LZFH 2E46A 1HH6A 1DUYB 2Z31D 2HG5A 4J8RB 2NY5H 4ECNA 2FJUB 1PLBA 1T5WB 3BWSA 4FN0A 2DF3A 3T08A 4J3OF 4FXLA 5AW4B 2Q7AA 2WP3T 4X7FC 4XCNA 5E24E 1KIPA 2QDWA 5C07E 4AM0A 2A99A 2UY6A 2R4RH 2DTML 5DC4B 4XZUA 1KG0B 3LQAL 1OTSD 1SYVA 3FO0L 4MSWA 4P3WA 3WBDA 1KB5L 1X7TA 5T1LD 1JHKL 2CRZA 2MPAL 3IDYC 4HCIA 4HK3N 3ZHLA 2ID5A 1IBGH 1KIQB 2QL1A 1BQSA 1AGCA 1MJUH 2V2WB 4I89A 1OSZA 3NFNA 2Q10A 3FRPB 4Y2NA 5F70A 4NJ9H 2BSRA 3GNMH 1OGTA 3VD7A 3OTTA 4ZPTA 5E5MA 2IG2L 32C2B 1UXSA 3VFOB 3BWAB 4FXGA 2ADJA 4YXLL 1ZK9A 4Z77B 3M88A 1E5AA 1KC5H 4YFLF 3QO0B 1ZIAA 3CZLA 4LLMA 2K45A 3L9RB 2O26U 4N8VB 4DKEL 1ML0A 3Q5TA 5D7JB 3FT4B 1PLCA 3Q5YA 4PBWD 4F58L 5CBEA 2VCOA 4A6YH 4DGIL 5ILTH 1KN2H 3WNOA 1KGCE 5FGRA 5HYJD 4GQ9H 2R1XA 3A24A 3UPAA 4BSWA 4MQ7B 1I1AC 4N3UA 4B0MM 1FN4B 1V7MH 5D8JH 4XWOD 2P5EE 3MRHA 5DMGD 1S9XB 2XX0A 3HE7A 2AXWA 2VQ1B 2ZD0A 3RDJA 4XWGH 2G2NA 4JKNA 4R4ND 1FGNL 1IFHH 2EIBA 1FV1B 1GSMA 3F65A 5KJ4A 1IGYB 4TNGA 2VDPB 4U1SA 4PJDA 4WU7A 1E9QB 1IBGL 4EZMA 5FECB 5I28A 4TVPL 1KNOA 3KVQA 4FQ2H 2DYRB 4PMFA 1OAXL 4XMXA 4R7DB 2IQ9H 2X12A 1P4IH 4ELMB 4W9IC 1ZTXH 3LJ3A 3UROR 3ZDZE 4IRJC 5EZJB 2HTKD 1U36A 4UQCA 4HWBL 3FCTA 3POCA 4MMYA 4FKEA 4V1DB 1BEXA 1F56A 3VXUB 4DZBA 1S9VA 4MJIE 5F97E 4IEFA 1SYSA 3FKUS 5LAXB 2FIRT 3O4LB 4K0OA 4WENB 1MFVA 4X7SH 2DLIA 4H20L 3X14B 1WRFA 2EINB 3RX5A 5EF3A 2IDSA 3QR0A 3FQNB 3DXAB 5CR8A 3OAWA 1W8NA 2ZCLL 1CPUA 4WWKC 2HSIA 1GJUA 4XMPL 2MNJB 2C9SA 1AGFA 1AR1D 1RZ8B 1WQVT 2X6CA 2B4CL 1OP3H 3U6XA 4PWFA 1JZGA 3TT1L 1ZA3B 1ASPA 3F6JA 2D03L 3VGHA 3U1PA 4KBPA 1PD1A 2A3TA 1JZHA 2QPDB 4IBTA 4WCYH 4OVUA 1JZ4A 3EOTL 3M7FB 3V52H 1E8YA 2PTVA 5DHVB 3S48A 1FG9C 1NTDA 3RURA 2BVQA 1X7QB 4UIMA 2G75A 3VDBA 4NUQA 1Z9SA 2FBRA 1F90L 2ZYRA 4XB3A 5CFHA 5IEHB 3GKZA 4LARH 2HVJA 1VJSA 4OV6F 4PG2C 3P3SA 4NCC2 2Q8AL 1IE4A 3CFCH 4ZFZB 3HE6C 1GGUA 2ZUVA 1HE7A 3U9PH 1C12A 2AJZB 2FJHA 3HS0B 1CFBA 3MXWH 4NPYA 5EU7E 3EJSA 5EBWB 2N56A 2QTVA 4M1DH 1U3HD 4OFKA 5A7EA 1GKEA 4I3SH 5CIPH 3K5RA 2DMCA 2YAHA 1EEYB 3WUWB 1NIAA 4E41D 3FTGA 3AS3A 4ZO7A 3CTTA 1ZGLP 4K9EH 4O2FA 3OF6D 2E9WA 5FUZH 2O5ZL 3LIZL 5F8RC 2WWKO 1HXYA 5IESL 3TFKD 4JAMA 4L4TD 3IEAA 5I6NA 1SHXA 3N1PC 4KJYA 1GSKA 4M7LL 3RWDA 3L3JB 5CCKL 3EFFB 3VD2A 2UZIL 5C0BB 1YAIA 2OTUA 2AHIA 2DZEA 2W9LA 3MXVL 2IJ0C 1WWBX 2HFFA 1EQWA 2NY0B 5DMKA 3L3DB 5E99L 1V3MA 3LPOA 3O0LA 1HHKB 4XMWA 4KI5D 2GUYA 4LCUB 4K3EL 3B56A 4P59L 4JB9H 4FFVC 1ADWA 3KPOB 3S34L 2XZAL 3EYUL 1CDCA 4N28A 1FIEA 5H8DA 5LCVH 3CHXA 4PGBB 4NQVB 5B4MC 2PPEA 2W9EH 4LLDA 3K71A 3KNBB 2FR4A 1NEZA 2WBJB 3I50H 4DKFH 4Z7NE 4J6RH 3PFQA 4R90H 2AK4B 4DPCX 1LO4L 1AANA 3HLAB 1PZ3A 2Y7QA 4M1CC 2YAMA 3TYFA 4Q9RH 5JMRA 4Y1AA 3EW3B 4OF6A 2W95A 4XNUH 1CFTB 1RJZA 3HEIB 5LNDA 3ZQ9A 2O6PA 2HCZX 2AJXL 1U8IA 3ARXA 4WO4A 3WS3A 1ACCA 3KYNB 3UAEA 3VD9A 1E3ZA 3O4OC 1B2WL 1UXWA 2EACA 2Y2WA 1E3XA 1E8ZA 2JELH 4H1LG 4PLJC 1HTYA 5EG6C 3MRQB 2XTJD 3RA7H 1ANUA 4B6ZA 3BVNB 5J13C 3AS2A 3UTOA 4W70A 1ET8A 4NZTL 1T89C 3DYMA 3CFBA 1I9IL 2R69A 4KJPD 5ACZA 5IHHA 3NSDA 2IXQB 4NQEE 1U58A 1QNIA 1OL0A 4JRYE 1OB0A 2R27A 3GSWA 2MWCA 3E8UH 3Q9QA 5ERWB 4F57L 1KTJA 5EU3B 2XDHA 1W0VA 5F7FA 4ADIA 4MNQB 4Z78A 4DP4X 5FYJD 3D39A 3WE6A 5J8OA 3KPPB 5ITFA 5D71H 2I07A 2ERJC 4WDIB 3Q2NA 1AD0A 2IAAC 5TE4H 4BKTC 2F7OA 1DJSA 4N9GA 5EFIB 3H9SB 1K6QH 2PYFB 3QA3A 3IPEA 4WY7L 5DD6B 3L1FA 3T8VA 3BWZA 4ELKB 5GGTA 2YRZA 1HHIB 1NJ9A 2IFGA 1M7DA 1QRNE 1DUYA 1AO7A 2CUMA 5B21A 5KSBB 4Z7WB 2FBJL 2FB4H 1YNLL 4KKAD 1EJ6A 4U3SB 5JYLA 2JIXA 4ODVH 2OXHB 4OBSA 3V0EA 3VSUA 4LZKA 3RUGF 3ZQWA 2IEPA 4Y19E 1H3TA 3BQUD 4LLYB 5IMOA 5JOPD 4Z6AT 4XZUB 4IKJA 1UM4H 2UZYB 4NM8L 3RQ3A 4KMQA 4A55A 5LUMA 3FW6A 3S3JA 4WUUB 4BH8A 2LLNA 1S7WB 4PD4J 4AI7A 1GMEA 2JTDA 2DYPA 3BCDA 2WKOF 4Z7QE 4JN2A 5E6IB 3PWPA 2VKWA 3L1OL 1R3HB 1L5GA 1VSCA 1I1FB 3KWTA 1N59A 2WXNA 1JERA 1FV1A 5D1ZA 3K6NA 1UZ6E 3LNGA 3LAFA 4JFED 2LTQB 2SODB 5IB4B 2P45B 4G6AC 3BT2L 3BDYH 1OCZB 3HG5A 3MRGA 4K3GA 1GVIA 1FA4A 1PTZA 1MRCH 5DRXB 4AEIL 4D0CB 1T89A 5A2CA 3CDZA 2F15A 1CVSC 1P9MC 3ZL4H 2EH7H 2J55A 4RMVA 3U0PB 3JTTB 3AU1B 2CO1A 2X9XA 4UINL 4QEGA 3ZZQA 2D3VA 1U6AH 4PCTA 4PJ9A 1RQ5A 2DLFL 1XR8A 3BKJL 5D1QA 1EO7A 3FJTA 4LOUD 1JUFA 2P43B 3S3PA 3MRRB 2OYPA 1A4JA 2EKSA 4NN7B 1HWWA 4HZLB 4QJ3B 2Q87A 2GSMB 3GPSA 3SKNA 3VFNA 5I1DB 3CFEB 3EO9H 5EPMA 4E9TA 4ZS6D 3VM5A 1YQ2A 2Q8AH 2OR9H 4UDUA 1ZHKA 5CMAB 1D5BA 3DJZA 4RGOH 4AMKL 1AHMA 2GJ6E 5IFHL 1AQKH 5IOKA 4BINA 2X4PA 4QOKD 4X5XB 1FSKC 3I6GB 1YECH 1G7QA 3EYUH 2FBJH 3D0VA 2OQJA 1MW3A 3GINA 4HJGA 1B6DA 1HYSC 2IG2H 4D94A 4WJKB 5BCAA 2CDEA 4QO1A 5GIRB 3I6KA 2XUWA 3E6FB 4MCMA 4N0CD 4RZCA 1RUPL 3HB3D 5HDQH 2FZ3A 2ZWZA 2VYRE 6TAAA 3AS1A 3VMOA 4HS6B 3PQYA 3SCMA 4YLQT 4OGXL 5HVHC 4P2RA 4Z7VA 1NOFA 2VXTH 4NQDA 1EJOH 5BOZG 4FHJA 3HAEA 4IBWA 1OAUL 3CK0H 1CFVL 2CO6A 2EEBA 2NDGA 4P2QE 1W91A 4MLIA 1CE6A 5DEJA 1T7ZA 3QUMB 4PJIA 4M1DL 5HI4D 1IQWL 1A6VH 2AEWA 3QUML 2G75B 5DJ6A 4GG8B 1JBJA 4N2BA 3OKKA 3P02A 4JQXC 4ODUA 2X4SB 3MLYL 1ITBB 5I1CL 1TJGL 3BXNB 4P3DA 4UOZA 5ISZD 3KW8A 3NN8A 3H3PL 1V8HA 3OG4B 3WFHA 4FQ2L 2QBWA 3MHZA 1PQZA 3LPWA 1SPDA 4LRNH 3N06B 4A37A 2X9WA 2VL4A 4L05A 4XVTL 4HOZA 5JW4M 4KK5C 4OQTH 1KWKA 2I9TA 3V0IA 1LDPH 2FH8A 2O6FA 2VDKH 2UXTA 2VRKA 5CINL 4M5TA 1XSIA 1W8EA 4WEEA 3UGEA 1N0LA 4TUOA 1PFOA 2C7UB 1CQKA 1H3VA 2C9XA 1A6ZB 4L4VE 3GSNA 2GQHA 1E6JH 2FYYA 5ACLA 1ZHBA 3NH7H 4Q2ZA 5LNGA 2IPTL 3Q01A 3T6QC 2LAGB 4U2ZA 4JN1H 4OGXH 8PAZA 4LSPH 3V7MA 1DANU 1XVSA 2LFGA 1KN4L 4W93A 4DJMA 5CJQH 3RWEB 5DTFB 3GXFA 2VW7A 2AV7B 3WNPA 3WEXA 5IREA 2NYZA 5DQJB 3CMOL 3DNKA 5HHPB 1A7OH 2A6DB 3QC5X 4XB8A 2QV4A 1OF2A 2XQYG 3BDBA 4JDEB 4NQSB 3QHZH 5FYKH 4M4RA 3LZRA 5C0DA 3Q1SL 5HVGB 2CJUL 4DF9A 3UZQB 1TXKA 5D6CA 1KDJA 4QYAA 3A47A 5D2NB 4QJ4B 2JJTA 5G4OA 5BJTB 4MA8H 4ZMOA 4LLQA 3L4CA 2BERA 2D3NA 1KXHA 1EFXA 2CIKA 2GSIB 3AY4C 3WS6A 1AE6H 3VB8A 4MGXA 4NNPL 3QCUL 3TIEB 3TWCH 2X88A 4AQ1C 3QNYA 2OMWA 3VDCA 4PJDF 2W07A 4F37K 1WPCA 5AZEL 4Y5VC 3ORJA 4MQXC 4FD0A 5B38A 1N6QH 1AZCA 2CGZA 2V17L 4I3RL 4JKPH 3L5XH 4GSDH 3APCA 1M6OA 4HS8H 4UT7H 3SGJA 4BJLA 2GHZA 4U6XA 1ZAGA 2HT4D 5I9QC 4GW1A 4NN6C 4YSUA 5BRZA 1MW1A 4P48A 5GZNC 4E0RA 4FXKA 3FTVA 2Y7NA 1WCBB 3WTTA 1TQBB 4GAGH 4BV1A 4JPIB 3QWOA 2NY0C 3SKJH 2XCMC 5B3NA 3RJDA 1JZ6A 1L7IH 5C0CD 2EDRA 2UYLA 3QXAB 3VCLA 2BS8A 3L5IA 4IK7A 4LPYA 3X12B 4NFBA 1CI3M 1BGXL 2R29H 1IGML 2A1WL 2XIIA 4L29A 2C1OA 2WTPA 3BO8A 4FMFA 4KZDH 3VVVA 2TSAA 3O3DA 2A5UA 2DQJL 3MTRA 5ANMA 1Q38A 4WKZA 3UTZB 2MNWA 5EU6E 4JREC 3L3IB 2QADD 3MX0A 4ORZC 4ENZA 1HSBB 2VLRB 2WXOA 3T2NL 4XNDA 4GUPA 1D9KB 1F4YL 1UXMA 1TIUA 4ZTOL 3K4AA 4AUJA 3GDCA 3MCLL 5DJZA 2XQBH 2D0HA 2BNRA 5D7IF 3FTWA 4YSDA 5I1GH 5AL0A 2AI0H 2ADGA 3EH1A 2ESVB 1RVFL 3QUYC 3FN0H 1R3KA 3MLVL 2VDPH 4LL9A 1U8QB 5BS0E 5ID1B 2V17H 3W3BA 3DX7B 8CGTA 3ME0B 1SXCA 2ZCZA 3ZTJG 2GAZA 1RFDH 1F18A 2WANA 1JIBA 5D55A 3S97C 4C56A 3ZO9A 1WFIA 1AGDA 2H2SD 1CB4A 4TVPH 3RVUD 5J6HA 5T1KB 4EIZC 4JFWA 1G7JB 4ZOAA 2GJZB 2P26A 1S7QA 4BIKA 4ONGL 3MLZL 2GIYA 3MA9H 3DJ9A 3HZVA 5DO8A 2XZQH 3B7YA 2NYYD 4J2QA 2EH7L 2NCEA 1FLRL 2X4UB 4JZNB 3VXSD 1RXLA 1CDHA 1J11A 1EGJA 4L9LA 5FEBA 3MV9E 4ZUVA 5MP6H 2IGFH 3VI4E 3HHSA 4MJ5A 3OZ9H 3V95A 1N5AB 3ROLA 4O2EB 3RJQB 1NFDF 4JPVH 3LEVH 3OB8A 4MXQD 4N1EA 3O2DL 3BKCH 5ICXA 2B16A 1C16A 1XSOA 2X4RA 3TX4A 4Z76B 1U3ZA 4AV0A 2WMPA 3QR1A 3L81A 3ZHDA 1MOEA 1SJEA 1DQJB 4AITA 4AKQA 1ET7A 3MA9L 3GXIA 3U48A 3CHRA 4C57C 5SWSB 3A6CH 3JV0A 3MV9A 3N9GH 1KB3A 3FBKA 3EDDA 3QJSB 2KC0A 4LSRH 4E9YA 1JYWA 3U0PA 1HKLL 1VDGA 3FUEA 1FCCA 3SIKA 5IG7A 4Q8BA 1UD8A 2L3BA 1F6AB 2Z8RA 3CVHH 3PJSA 1XR8B 1GCFA 1MHHB 4KJQD 1PSKH 5F0PB 1Q72H 3FPYA 3EKCA 2AJSL 4M5YL 3FHQA 1AOHA 3KGSA 3MSPA 3SDAD 4AK1A 1CE1H 2CLRA 2Q3AA 4EO5A 4KVCL 2EKSB 3ASNB 4IRJA 4R9HA 4ZTPL 1WTLA 4G72B 4NRYA 4NHCL 4N4YB 3OZKA 2HVBA 2VZOA 5F3BA 2X09A 5GXBB 3P3UA 1T7VA 1JNNH 2KYIA 4P5TC 2TRHA 5JIKA 2HJLA 3QZOA 5EO9B 1K4CA 2FBOJ 1YNTF 3U4EB 1S7UB 1S9WA 1I7RB 4DGVH 2FECI 1AGEB 3QDJB 4G6MH 1OAKH 1I53A 2ZXCA 1VACA 3HIZA 2BDNH 5HJBA 3NDZE 4HZAA 4GAYA 5T1LB 4S10A 3ZMEA 1Q9WA 3IVKA 3BAEH 1SRDA 1YEJH 1PLGL 3ESNA 3QE5A 2EVJA 4JGUA 2GY5A 3FOLA 3NPZB 1PY0A 4JN1L 4XNMB 5CP3A 5IK3B 3CD4A 5HHVH 2QR0A 2PYEB 3PAYA 3PQYB 4NWUH 4PJAB 4X0KA 3SCMB 1T83A 3T0XA 4AYBA 1GYWA 4NRZB 1JWMA 4FYQA 1U95A 4L1BA 5E4AA 4LCCB 4L0YA 1A1NA 4WHTA 4FQHA 1KYFA 3QG7H 4P4RA 3DX8B 3KJ6H 3IDGB 1LDSA 3GLAA 1M7XA 2GG1A 1CE6B 2V5MA 1UWEL 4HS8L 1TO5A 1VFBA 5D5ME 4OT1L 2OKMA 1VA9A 1UB6A 2IANE 1QFPA 1RK0A 5GS2H 1NANI 1OWWA 5E9DB 3V4UL 1TPXB 4DK5A 3D05A 2VL5B 3IKCA 5FYKE 2VR6A 1B9ZA 3Q2LA 5K1JA 3QZLA 4BWUA 1WG3A 1R0AH 1E9QA 2ZOUA 3PP4H 4IM8A 1JXKA 5GZOA 3O8XC 4BFFA 4TM9A 4WW1B 5L8KB 4MXWH 4OLYH 5DHYB 4NAQA 4NIYE 4RCAA 1O9VA 2PO6D 2X0UA 4HPYL 4JRYA 4DSYA 4AJWA 1G4MA 1ECYA 3TNMB 5D6CB 3TPKA 3T6XA 4ETQB 3QUHA 4TUUA 2EIZA 1TCRB 4Y5YB 1UYWH 4PWKA 1GGCL 2WGNB 4NQCE 2X6MA 3S35H 3CXFA 5F6HI 2F54E 2Z4QA 3RYMA 2DWYA 1I1YA 4G8FB 1IZJA 3MNMA 3KXFD 1BXXA 3MKKA 4P5SA 3FQRA 4ZFOL 1ZHBB 1CL7L 4Y2LA 1L7TL 3NCJL 2C4XA 3CH1A 4NFCA 2ATPB 5SX5H 2OMWB 3LRGA 5DU7A 3IE4A 1ECZA 4Z7UB 1MQKH 5KBMA 4HIJB 4M9PA 5CHNA 3GBML 3S4SA 2FE0A 1LK2B 1MCRA 1T22B 4U6YA 4UV7H 4XX1G 1KFGA 5IHBA 2YAPA 1UD3A 2I7OA 3ZDZF 4F1SA 1KJ2H 3QH3A 3VXUD 4G7RB 2QPFA 1NINA 3L6FB 2O5ZH 4HSAC 4QY8A 4E0RB 1GYCA 1UYWL 3LHAA 4XVUD 3L5XL 4GSDL 5E2WH 4RA3A 3QI9C 5DJ2B 2F53D 2FX8L 3T4AB 5E4IA 1WP6A 3PJLA 3NABH 3K2KA 1C5BL 1WZLA 3MR9B 4XVTH 1AJ7L 2BHUA 3POHA 1FWXA 1XFPA 1KBWA 3VVWA 4IW4C 1MIEH 1NSNL 3UO8B 2VLJD 5B1JC 1FYTA 4XE5B 3T9WA 3VFUB 3KH3A 1A65A 1CGVA 4HOXA 4MDJA 4XWGL 3RRQA 5BXFA 4OZGA 4EKXA 2A83A 3PF2A 4QTHB 1VGKA 2CDGB 4FTDA 5F7WC 1MH5B 4YHZH 2P5WD 2NY1C 4Y4HD 4AKOA 2HT2C 4YXHL 1MCOL 2RMNA 3LN5A 3QUXC 4KKNA 2ICEB 4GYBA 1KN2L 5KSAB 5HHXL 1DE4A 2A73A 4OF7A 4POZC 4GW4B 1EWHA 4TVPE 3O6LH 2VOTA 4KXZI 5K1NA 5FDWA 2ZXQA 4YDKH 4RMTA 3TVMC 2Q9OA 1WTGT 5MENA 1GY1A 1R47A 2GPZA 4C56B 3CPUA 1NC2A 5HDQL 1FIGL 1XF4A 2YD5A 2J8HA 5I2IA 3PNWA 2ZG2A 1NIBA 2E47A 2YR3A 3ZDXF 3WXVH 1H3GA 5IIEB 1CXLA 3P73B 5TDPA 3DUUA 1F3DH 3MX0B 3TZVB 3RKPA 4HIHB 1JMXA 1UJ3A 4KTEH 1XD0A 3BESR 2AK4A 2JWYA 1JNNL 3MV7E 2YARA 3DIDA 5CF3A 5AZEH 1E4XI 2CKBA 1MIEL 1NSNH 5FWRA 4JPSA 4IYKA 3L5JA 1N5AA 1F3JA 4O2EA 2AKRB 4J3OD 4PJCE 3TTYA 4IOIB 4RRPG 4X6DB 4ILDA 3QFJE 2ZAGA 4NN6B 1UCBL 3WFCL 5I5IA 2X87A 2F68X 3MI6A 1KLUB 4QHLA 1ND0A 1FGNH 3ME0A 4Z3IA 2H6UA 3B6SA 5JORB 1MREL 2R0ZH 3FT1A 4PP2A 3W39A 1LD9A 3M1OA 2NY5L 3BSHA 3CUPB 4HEPA 1PG7H 5E51A 3F12B 4E68A 2GABA 3LZFL 5T1KA 3KLHD 3FO9A 5HHOE 3WTVA 1GZHC 3J7HA 5IP4A 3GXMA 2R29L 1S7VA 1VFAB 3FUKA 3VNYA 1AS7A 3S35X 3Q9PA 1LE5A 3LV3A 3PDGA 1WFMA 2NR6D 3KR3L 3PWJB 3VYNA 5I30L 4Q7DA 5JXAL 4XN8A 4M5ZH 3HI5H 2JCCA 3JXAA 1MDTA 4HPOH 4KRPD 2IPTH 1X9LA 4L4VD 1SM3H 2BHZA 2NQ3A 2XTJB 3IPFA 4PJDE 3SGDI 3SYPA 5I0ZA 3CSFA 4M93C 5IMLB 5K69A 3GBNH 4PR5B 1TPXC 3O6ML 2NNRA 3DX6A 3QHTC 3HRZB 4FFZL 4I9XA 5EN2B 2ITDB 3EH5B 5AKTA 4LFHD 1T0PB 3CXHJ 4IMLB 4YZFE 1NMBH 4NCDA 1SXZA 5T3XD 3L4ZA 1WV7T 3KCPA 4I2XA 2F54B 2JKSA 4FI6A 1H5BC 2NW3A 4HJTA 4AGOA 1HJCA 1CT8A 1UTDA 3O45B 1JGDB 1DLFL 1TJIL 2YKLH 4XZ4A 3OPUA 3NCYS 4XAKE 1MFDL 2XA8L 4ODWA 4QRRB 2WLHA 1UJTA 4B9IA 2KZKA 5IROC 1K4DA 1AS8A 3KPRD 1TLKA 2BIQA 4MVBD 2G3MA 1A6UL 3EYFB 5CD3B 1N26A 3QB7C 4MB4A 4NC2B 5JUEL 3ZDXE 5H35A 5C9JB 2XV2A 4JDVB 1UUSA 3N44F 4HUMB 2CHWA 3RY4A 3DOSA 4Y1AD 3CHOA 3W2DH 4F7EA 5A3ID 4UOQA 4TQIA 5KSUA 1S9WB 4X5RA 1O6TA 1MCBA 1SHSA 1XQ4A 1HL9A 1XGUA 2EZ0C 2DBLL 1YZZA 4I0PD 4UQ2B 1JV5B 3EJQA 2H6OA 4K3DL 5I76B 2PP8A 1NFAA 5HD8C 4KDTC 5DC2A 2FX9L 5SX4H 3EOAB 4WLCA 4JY5L 3E2HB 3GXPA 5E8EB 2J44A 3FH5A 1FFNB 1KPVA 1C7SA 4WFED 1OKEA 4P2CG 4UF7C 2XC8A 3F04A 1XZ0B 1OGSA 3NJIA 2AABL 4ENEC 3ASOB 3MA7A 1X4XA 2E4TA 2E9GA 2NT1A 2PLTA 2RACA 4NXKA 4LHUB 4PJEE 5B8CA 4KH9A 2DQEL 3WNMA 2MOQA 2JELL 2J73A 5C09A 1JUFB 4BK4A 3VXMB 5D7JC 2AXFB 3A6OA 3EGXA 4CN4A 1UA6H 4RRPA 4CNIB 5C6WH 2WB1A 4DVRH 2ZPKL 3W82A 3ECBB 2AJUL 3SD2A 5GS0H 1G7LA 1TYRA 4Q0XH 2GTWB 2WUBH 3EH3B 3MC0A 1I8LA 3ZGIA 4FQIL 5E8PB 4PGCA 5KAQF 5EO1B 3D3VE 1U6AL 5JLZA 2LV4A 3GHBL 1X5GA 2H3NA 1M9SA 1NLBL 3WFEL 2YD4A 3I6GA 3K6OA 4FI7A 1NGXB 2PKDA 4XH2B 1DDTA 1B88A 4K73A 4TULH 4JDZA 2CA4A 4IQHA 3BAEL 3C2SA 5C3IA 5HYIA 4V33A 5MERA 2Y06H 2VXVH 1EXUB 3L1GA 5DUJA 4NJAH 3STZB 1RKRA 1FL3A 4QOKA 4XN9A 1L7IL 4H1LH 1NEZG 4K71B 3VFUA 4DEPC 2VW6A 1OHZA 1P1VA 3O9WD 1MLBB 4PJXE 2XX1A 4KKPA 1ACZA 3DX4A 4OZHF 1OPGH 1RH8A 4O4YH 2MEJB 4RFEA 3FU6A 1ZWIB 1A4AA 3DTXA 3WAJA 1CLOH 1GGYA 2F58L 5C0IA 1WSST 2HJFA 3AAZA 3FB7B 3B8YA 3IDNA 4QRAA 5TE6L 1TKWA 4PJIB 4PHZA 1ED3A 4MA7H 5JDSB 2VLJA 3BUTA 3JWOL 43CAB 2CCLA 3ZDYE 3GRWA 4BRJA 3HUJA 5CLYA 2B4CC 4ODUB 4WJ5B 1MJUL 1MI5D 4OLWH 4OGYL 3D8MA 4P3DB 4AYGA 4YR6B 1R4XA 4ORGA 3LKNA 2EDEA 4NC1E 2APVA 3MNWA 4YHKL 4BQ8A 5L2JA 2ADFL 3IFLH 3BVUA 2GCYA 4EMZA 1JZFA 1YDPB 4NFDA 5L2KE 2W9EL 4HC1H 2XVGA 1JK8A 1Q9LB 1S9YA 1N0LB 5E4EC 4FTVE 3V4PA 4R5XA 4GI9A 2VDMH 4UT9A 2V2XA 3BW9A 3BH9A 4YPJA 3RZCD 2J1YA 5J3HD 4J2XA 1A4BA 2XTJC 1X5ZA 4LASL 5FKPA 4QRFA 3FU7A 4E5XG 2VLKA 3RPIB 3WL9A 3U79A 3HS0C 3CFUA 4JFYB 3AT8A 4X6FA 4FRWA 4AEEA 4AIZA 1E28B 4XCNB 5EBMA 2VSCA 4MB3A 2NY7H 4S1SL 5D9SA 5TFSH 1YYML 4OLXL 4H88H 5GS0D 3CFKB 3HKZA 2WVVA 4OJEH 4ZMQA 3UEQA 5B3SB 3DX9B 5C0BE 2FL5B 4PV9A 5K39B 1RZKH 3ARBA 4N2DA 1TVHB 2P7TB 3VE0B 5D6DC 1DVFA 1JTTA 2J1ZA 4K8RC 4FMVA 4S0SD 1BVLA 2XRAL 4P23A 1Q0XH 4APQD 2IADB 4C59B 3DSNA 5E03A 3QUKA 3MJ6A 4U6TA 1V5JA 3RWHB 3N40F 4JL2A 3P0YH 3UZQA 1XIWC 5EU6A 2XJKA 2B2XL 2X6UA 4W4OA 4YXKL 1MJJA 3L95B 1AQDB 1JWSB 4HW6A 3VWJA 1ZSDB 2XV3A 2CNYA 4CL7A 3F7VA 1E2WA 1JHLL 4GEIA 2DJSA 4JFXB 4RX4A 4QHPA 4CU6A 4YAQB 1T3FB 4P2RD 4YEFA 4JPWL 2WYHA 4K8RL 4TYUA 1ZLUH 1U21A 3FBQA 3ZTNL 2HB0A 2CHDA 4F8TA 4G80A 2JB6A 4O02H 2W07B 2DAVA 4OT1H 5CP7A 3PL6C 1MWOA 2X4OA 5DVKA 2WQUA 1A6VL 3MBEB 4BWWA 4FQXA 5T3ZE 3B9KC 3EJYC 4PRID 5CZKA 1JD9A 1Z5LB 3DDGA 2EVGA 4HH8A 3NACH 4P2QA 5SV3A 1U3HC 3QEQA 1LEKA 2WZPD 3I2CH 3MUHL 3UZEC 2NR6A 3O3EB 4KRLB 4K2UH 3VTMA 3PWUA 1T2XA 1D7DA 1YEEL 4HXBL 3IS0X 4MQ7A 1IB5A 4QF1A 1RIUL 3BP7A 4U1LB 4J7RA 4ZYKA 5DSCB 3LKSA 2R9HD 2XG4A 3NTCH 2E86A 4PJ8D 2DW5A 4Q74A 4FG4A 1RUML 1KV3A 5DC9B 2FWUA 4QRRA 3FFCA 4L29B 4MJ2A 4NQXA 4WU7B 5KVDL 2QGDA 3OX8A 5AW8B 3NH7L 3UTZA 3CLFL 4AYMC 2DS4A 3S2CA 1GYAA 3B9DA 3D0LB 1AFVH 4LOFA 2Z31B 2QQKH 4AMWA 1OP5H 2BOCB 3IDIA 4MMYB 4V1DA 1ZT7A 4H0GA 2GJ6A 5DJ0B 4S0TD 1FNGB 2VDKL 2DMKA 4P06A 1TJHL 4U1IA 3DPBA 4L9DA 5DD0H 2WVTA 2KZWA 1EZVY 1QO3B 2OCCB 4GXFA 4OAWB 1Z5YD 3BQUA 4PJ7A 3R19A 4HJIA 5FYKU 5C0RL 3KPSD 3KCPB 2Z92A 4I2XB 4XX1E 4CC4A 1Q1JL 4JFDA 1CU4H 3X3GH 1R3KB 3DJTA 2AAVA 3DMMC 4AGLA 1FO0A 1Y18A 2PW1A 4CMMB 4PJHF 1WLHA 2R4RL 5FM5M 4X7TA 4GMSH 5E6ZA 3NACL 2WSPA 4MXVF 5DHDA 1T21B 2QADB 1UWEH 2RQEA 2VLRD 1FQ9C 3WD5L 1V10A 1B4RA 1K4DB 4K5PA 2OSLB 4MXWL 4ZS6C 2VQUA 1BD2E 3RNKB 1KB5A 4M7JL 5H35B 2X4QA 1IKFL 1IL1A 3P0VL 1NGWA 1UT2A 3BSGA 4R2GC 1C9SA 4K5MA 1KMGA 1WFNA 5C09B 1BIIB 4L8BB 3NEEA 3QAQA 3HNVL 4Q56A 3M8OH 3E0GA 2ZCLH 2PCFB 3CAFA 2DQEH 1P6AB 1XGUB 5EH1A 4HHAB 5TE7L 4L37B 1IGJB 1VCAA 1ETJA 1I3RB 2Z8WC 3QPKA 3WMQA 3RUGE 3GXDA 1R3IL 4JZJB 1CLZH 1E4JA 4A2LA 2EDBA 3VWKD 2AXGB 1Z3GL 2R69H 4XMUA 5EIIA 3RTQD 1XGPB 2H3NB 4ICWA 1IEHA 3ASWA 3JT0A 2OMYB 4OCSL 3QORD 2UXFA 1RJCA 2ROXA 1HHHA 5FB8B 2DYSB 4LEOA 1U8CB 2WXHA 1ZE3C 4AQ8C 1KCUH 1FVDB 3T2QA 3A4EA 3VFMA 1YHPA 4ADJA 1MCQA 2V9TA 4LASH 1HFUA 3ZKXB 4FQLH 4OM0L 3GSOA 2BWQA 2B14A 4DQOL 4ODTL 5BZZA 2NX5E 3OLEA 3VI3E 1T7YA 3NCMA 4PWIA 1R75A 3D1MC 3IFNH 2MKWA 1BPLB 4OB5L 5CKGA 2W1NA 5KZCB 4NUPA 5I1HL 4DK3A 3CFNA 1RL1A 5G5DA 3HE6D 4LHJB 1RJLB 1F02I 5FM5O 3ESVF 3TT3L 1E2ZA 3KPOA 2VM3A 2VN7A 2TAAA 4IDJH 4L3CA 5GGRY 1TKWB 3T0AA 3RIFK 1BWMA 4XMKH 2YRPA 4L0PB 5M95B 1FZOB 1NGXA 1O5DT 4Y4KA 2B2XH 1KXTB 4X4KA 2ZUWA 5HGDA 3O9WA 1USZA 3WGUB 1I9RL 4JM4L 3Q0HA 4BE6A 5TE6H 1IAKB 3ULVL 3TYFB 2CA3A 1W2KT 4AGMA 1G43A 3B2UC 1UWFA 3ZSTA 1V3KA 2VR3A 1IQDA 1FSKB 3OKLB 4X6CB 3SKJL 5KVFE 2PP7A 5T3ZH 4NXSA 2CH8A 3IDJA 3QDGB 4H2CA 1HH9A 1N64H 1P69B 2UWEB 4X0KB 4WV1A 2R4SH 3VU2A 2GTZA 3PGDA 1UXWB 4OLVL 1P5UB 3QG6A 5M7QA 4NI6A 2Z91A 2EYRA 4YPGA 1SDAB 2SEBB 2P80A 3LEVL 2FT7A 5JHDD 3BE1L 4DUVA 2MQCA 2D73A 1I1AD 2XYBA 2WGXA 2AQRA 2VMFA 3L08A 2PPDA 5CZRA 1YEEH 4XX5A 3FONB 5TD4A 4AIZB 4YS4A 2AQPA 4X6CE 2AJ3B 4DN4L 3O4LE 5BO1H 2ED6A 4C58B 5CU9A 2YQBA 2XZQL 3T0ED 2Y24A 3B43A 4G82A 3O2VL 3TT3H 5I1GL 1LNUB 5DJAB 4W1TA 1AKJA 4X50A 5EC2B 4CBPA 1RHHB 4LB8A 4OJCA 2NRDA 3QVAA 4FHKA 4LCUA 5CNHA 2VN4A 1ZHNA 5FUOL 1XGZA 3Q1SH 1XD1A 2H0JA 3WS3B 3TNMA 5D1QC 2EE6A 4I48A 3DTDA 3ELQA 5E23A 3V4UH 4OM0H 2BVPA 1NEZB 2HT3C 2WBJA 4LQFH 2E8ZA 5EZOL 4BRVA 1EZUA 3ZRFC 5C09E 2H9GA 2YOCA 4G8FA 3NZUA 2VM4A 4OCLC 4HMEA 3TEUA 3A6CL 3N9GL 3ISWA 3VI3F 1A6TB 5CCKH 5JW4Q 2YXMA 1BVKA 2OMVA 2KPWA 1GPOH 4U7MA 2WZ5A 2PO6B 4JMXA 5DA0B 4E5XA 1U8MA 3RUGB 3DO4A 4OKVA 1QPPA 1CL7I 5TE4L 2K8QA 5JXEC 5TH2A 5ITBH 3MOBL 5FC9A 3BUBA 1U8PB 2XIBA 3QEUA 1OSPH 5KBNC 3BEVB 2E7LA 1HWHB 1AXSA 4J27A 2FO1A 2FATL 5I8KL 1NMAH 2NSXA 3T04D 1L9MA 1WEJH 4WDIA 3VH8B 4B7IA 1A47A 1IT9H 3BOVA 1U8HA 4TVUA 1MJJB 3L95A 1L5GB 4ODVL 4G8IA 3VRLE 1F6LL 2BSBA 1U58B 4KKZA 5D7LA 4AJ0A 5AVZB 4RIRB 4JHVA 1KYAA 2W88A 3HOGA 1HHIA 1NJ9B 1PW3A 5CGTA 4XAKD 3T71A 1JXFA 4NKDB 4DT2A 2ADFH 5BRZD 2JIXB 4FFTA 1IFHL 3ESMA 3MNZA 5DK3A 3RA7L 4Q52A 2F53A 3VFPB 5DRXA 2NXYB 1LEGA 5K1VA 1AXTL 3QEHA 3BDXA 1I8IA 4GMSL 4PTUB 1DEEB 4P46C 4KVCH 4RFNC 4ZUTB 1HEZB 1OE2A 5GGSA 3TYGL 1RULL 3TN0D 1LEKB 3QIUD 3QQ4A 3OV6A 4AWJC 1AI1L 1G7IB 4Y5VB 2IH1B 3HG1E 4MDRA 4Y19B 5KVMC 2FWSA 3ZE2F 1MJ8L 1Z9NA 3S37L 5IJKC 1TITA 2X1QA 2E7LC 3KLAA 4MD5B 1DBKL 4NI3A 2CD0A 3I9GL 4WK2B 3VXUE 1WBZB 1P9MA 2APBA 2CK0H 4XP6L 3SE3C 1UATA 2V5YA 2XN9D 3CPLB 3MLXH 5E94B 3ZKXC 1SHMA 4TSAH 1SVCP 2CHZA 5DK0B 2J56A 1QSEB 2W92A 3FFOA 4LQFL 2QMJA 4KV5E 4P8QA 3TO4B 3CQQA 1Q1PA 1WWAX 1LP9F 5FO7A 2JLLA 3ARFD 2RH0A 3D0VB 2EDQA 1ZT7B 3PU7A 5DWUH 5A2IH 1FLRH 4R3SB 4AT6B 1MCPL 4B41A 1DQQB 5AWNL 4M7JH 3WY4A 5KYXA 2AC0A 4IDJL 1J12A 4N25A 1E6JL 3HVDA 4XO9A 3U2IA 1MG2C 1GGCH 4IOFC 1KGYE 4RDBA 1QSEE 5E2WL 3NZHL 4BK5A 2DV6A 1MFMA 3EO1A 3QJFA 4QJ5B 3W9DB 3QXTA 1ICTA 4MQXD 4YIQA 3X3FH 4B97A 1TT6A 4N3TA 1YEGL 2HKAA 2AJUH 4LVHC 5GS0L 5EUOA 3K2MC 3TEYA 3TZVD 1WZ1L 3C5SB 1CFNA 2CDFB 3EJZC 1BOGB 5DQ9B 1DBJL 4KZ0A 1NUFA 5K9OB 5DWUL 1GW6A 4I7ZC 1BVZA 3RNKA 3T0VA 1PDKB 3VW3L 3ZHNA 3HZKA 3LYRA 1H3WM 1ES0B 1QBAA 4LQ1A 1KJVA 4QXTA 4EI5D 2KS0A 4X5XA 2ENYA 2GUOB 4PJ5D 5DJ6B 4UQAA 5D7KD 5D7IE 2YUWA 1YY8A 2WLIA 3D48R 4YXLH 5J11B 1A4JB 3NT0A 1J88A 1A0QH 2PW2A 3LIZH 4TSAL 5FLUA 5DUPH 3WKMH 3GMMB 1JFHA 2FD6H 3IFOB 4PRPB 5D7SL 4KZEL 4P4KD 3ULVH 1CF8H 1QA9B 3VG0L 4PSRA 1AIFA 4UT6H 3X11B 1MFCL 1S46A 2YMXH 4XHJC 4XN2A 5E2TH 1CD0A 1XCXA 3FL7A 4KDVA 3EAKA 2YK1L 5EZIL 1NGYB 2VDQL 4DN3L 5CLXA 1H9VA 5D5MA 1ID2A 5LXGH 1NCJA 3LKPA 4FYRA 4Q2ZB 2C1PB 3T0BA 4YDLC 5BW7C 2PETA 3EBAA 3LSOA 4PI2A 4YK4C 1LO3L 1J1PL 3CH8A 5KBKA 1MJ7H 2HRLA 1MVYA 1D7BA 3PV6A 1UJ3C 5KS9E 2CR0A 4OFPA 4QYOA 5E8DH 3PGDB 4F3FB 3HPLA 1ZOXA 2R1YA 3C87A 4JJHA 5I82A 1ZV2A 2CPCA 2GFBA 3EO0A 5CU5A 2QPSA 3HC2A 1DDHB 2FQEA 1YN6B 4BZ1A 4O51A 5AWNH 5HJGA 2IQAB 3HJ0A 3O0RH 3L3KA 4JHWH 2HAZA 4LESA 1CXFA 1INQB 5HHNA 4G8AC 4CU7A 4TUOB 1SXSA 3LD8B 5I1AB 5I1LA 3QS2A 4JG5A 5F9WB 4RISH 1RUPH 3MNVA 3GSNB 3OJMB 4UQ2A 2F7PA 4CW1B 1OEZW 2GSIA 2V6HA 2YC1A 3RDTD 1V3JA 3JYBA 3B1UA 4DFIA 5JHLH 5LGKA 5IJVA 4K7PY 2Y2TA 3R4DA 4X6CA 3QP3A 3OGCA 1P4BL 4B9KC 1QLEB 2NY7L 4S1SH 1FNSL 5D2LB 4XN1A 4UTBA 5F9JA 4DO4A 3MRFB 3ZRCC 5LLIC 1QSFB 2Q7YA 4KVNH 3VXRB 3ZMNA 2NLJA 1EXGA 3FFDB 3QEGL 2D31B 4RGMB 1F1GA 1RPKA 4K2UL 1UT9A 1HZHL 3JV6A 4Y8DC 3TYGH 1CK0H 2YUXA 3Q5OA 1EVUA 3KZ8A 4LEEA 5HHOD 3H42H 5E8DL 3FT2A 4M8VA 1J48A 2EDWA 3GGWB 1OCRB 4QGYA 3T2OA 3ULSA 1YEWA 4PW4A 3RWEA 1JZEA 1LVEA 2XA3A 3BPLC 2XOTA 4KWUA 3LNFA 2DQCH 1EK3A 2OULB 5H94A 3SY0B 1CU4L 5I75B 3ZE2B 2CJTA 3O6FD 5ANMB 4U6VL 1OK0A 2QVMA 1XEUA 4PJFA 3JWOH 3FO0H 3BDYL 3DI3B 1XT5A 3N40P 1KSRA 3F7YA 5DJZB 2WSDA 4X9HA 1DP0A 4YC2B 4JM2B 1J0HA 5BJTA 4D9LH 4HQQH 4RIRA 3KLDA 4XPHL 4IHOB 3QWRD 2UZIH 3NFSH 1NPUA 3PV7A 4Z7QB 1MNUH 2ZCKL 1UVQB 1TVDA 1FFPB 4LL1A 2PABA 4OZFG 4P5TA 4PBXA 3S37H 4PJ5E 1MHPL 2W0KA 3BO8B 3O0RL 1JGLH 4L23A 2YAEA 4TF4A 3FT9A 2NXZC 1CTNA 4XNYL 2I27N 3OJDB 3RL2A 2GHWB 1UA7A 3BYYA 5CAYB 1FZMA 2APFA 2CLZA 2MNUA 1F4WH 3QXVA 4G70B 3QNZA 4UQDA 5HDBF 3HMXA 3BD5A 4DCQA 3H9YA 4LVHB 2JNZA 3WIIL 2WO3B 3GDBA 3P9MB 3IGKA 3MV8B 1FH5H 3WJLA 3QUZC 5DS8A 3ABGA 4O2CA 5D2NE 4UM8B 2FB4L 3SGJC 1U8HB 4KROD 3KM2A 2OTPA 3BVXA 3CBKB 3MCYA 1CS6A 3S9DB 1WBZA 4UTCA 2IH9A 4E2OA 3CJJA 32C2A 5ADOH 5GISL 3KPLB 3O8XD 2EDYA 4U6HB 3FQ2A 3MUUA 1XBDA 3VRJB 1E9OA 4QHKJ 4OUOA 1KJ3H 3L9RA 4PWHA 3ZU8A 3L3IA 5EUKB 3MLTB 1KCSH 2DMHA 5DVNA 5E2TL 5SWSA 2ZP8A 5CBEB 5GGSB 1QNZL 3ETSA 3MRNB 5C0CB 3U7AA 4FFYH 5EZIH 1ADQH 1OZUA 1W80A 2A9ML 3MQIA 1AJ7H 2GJZA 4ZUUA 2IBGA 1NBYB 2GBAA 2NSMA 1OLZA 2IH1A 1BAFH 1L9SA 1WBXB 4AVIA 2UZPA 4OTXL 2VDKB 3QXWA 4AIEA 1VFUA 1CYXA 2NY1B 3OXSA 1KTKE 4HLJA 1OK8A 1RP9A 4IRJB 1OCCB 2XRAH 2E7BA 4GLRI 4TLTA 3QUXB 3EOBA 3S7GA 4AY0A 1A0QL 1HQ4B 3UCQA 5KSAC 4U1SB 2K9UA 2ZX7A 1EGJH 3CC1A 3S4SG 4J5VA 4U1MA 1HHJB 3BWUC 4JZOB 3IF1A 1S7QB 1A3RH 3NGBB 1I85C 3P4MA 4HF5L 4X8XA 1ZA6A 1U8NB 3H7BB 1DQJA 3F7RA 3GSQA 3LZQA 2GUOA 4IDLA 4JFXA 5I6PA 4WWKB 4ZUSB 3DI2B 3QRLA 3CE1A 1NUGA 5IBLC 3S35L 3OR7A 4NPKA 4J39A 4R90L 2WNXA 2QELA 4P46B 4PJCB 1UFGA 5F7AA 2ZAIA 5C6PB 1FBIL 2BPBA 1QTSA 3D7PA 3JQOB 4ZFZA 3WNJA 3LD8C 4ZS7H 3RIAK 2HFGH 3R18A 2WC7A 3EO1B 3SO5A 2ZPKH 2BP5M 4ZW5A 3RX8A 4XO5A 4NNPH 3AS0A 4E9SA 4KUCF 1WFTA 4ANKA 1RPUA 2XQYK 3K74B 2VR8A 4PJGA 1BZEA 3NJJA 4K8RH 5F72S 3NRPA 1MVUA 2KQNA 2B59A 3OKEA 4MZ3A 2ZXEB 1C5CH 4KUCD 4TV3A 3E6HA 4URKA 1RIVH 3IMBA 1IBHA 3UTPE 3DYPA 3ARGD 3G6DH 1UKTA 3UL4A 1PU0A 4JG0L 5CBAB 1QFUH 1EZVX 2I60L 3BIAX 3FRUA 3MBED 1CURA 1T2QL 2EAEA 1YY8B 1T4KB 2WLIB 3LRSA 3QIWB 1KTRL 5K9KA 5FUZL 1PGRB 3WSQH 1UADC 4N8CL 3TH2T 2LVEA 3VD1A 4GAYB 1OP4A 3FULA 5A6IA 5SWZE 1EO8H 1E27A 1G9HA 1MEXL 1S3KH 5DHEA 5HD8D 4NKIH 3APNA 5AKRA 1EJOL 3KD4A 2F8VA 1DVXA 3MGOA 3AWFA 4P2YA 3SN6N 4DIXA 2EDNA 4RDQF 2OBGA 4JVWA 5JOFB 3BVVA 4EEEA 4K7PL 2P5WE 4A38A 1QG3A 3C5ZC 1A66A 3ARBC 1U95B 3QQ3A 3RNQB 3EFOA 3RGVB 5HHMB 2BRQA 3TBTA 3T6VA 1VACB 1NGQH 3SPCA 4JFDB 3IDMA 1MCOH 1G7MB 3EOYG 2NTFB 2FJFB 3MLRH 3Q6FA 3QUYD 4FZEL 4M03A 4XT1C 5AENA 1QMUA 2AERT 3T0EE 3OPZH 3UERA 3IVKB 1OTTD 1T0NA 3CU7A 4F7MB 2EDKA 4E42A 2XWJB 3H42L 4XPGL 3L3JA 4OLWL 4Z7VE 4AMKH 4PBVC 1I1CA 3FN0L 3FQXB 4W9HC 3TF4A 1T5XB 3QH3B 2H1LM 5L0QB 3N55A 3US9A 3MRQA 2Z8SA 2NY6C 5FO9B 5J11C 4N0YH 3NG5A 4U6VH 3BVNA 3S6CA 5K9QI 5ITBL 2QSCL 1DO6A 1H3XA 1LLAA 4GY4A 4O51B 5D7IA 3RVTC 4HWUA 3WYRA 4NO3A 3V0DA 3ZT5A 1WJ3A 2D0GA 4X8CA 1SJHB 2A77L 5DZLA 4FNPA 4FLOA 1W72L 4OCXL 3T4YA 5FF6B 1H3PL 1VKXB 4J3OH 1R1CA 4MD4A 5BNXD 3VI4F 4TLSA 5K59E 2MSPA 2OYKA 2Q5BA 3FSWA 3LIUA 4ZMTA 2HMID 4D3CL 4RGND 4OLXH 2ZF8A 2ZWYA 3GMLB 3AQZA 3QFJB 3QWNA 3BKCL 3U9UA 4TULL 4I5BA 5FB8A 3HZYA 2CHXA 3V0HA 2GI7A 3FCUB 5BV7B 1HDMB 4CC1A 3LN5B 5DHVH 4JKMA 3SHSA 3DXAD 3TIDA 1TZIA 1WAEA 4LSVH 5E56A 3ZN6A 3ZQXA 2A73B 2EXTA 2ZP9A 4KJQC 2C3HA 3FQRB 4GW4A 3VSVA 1AR1B 3APMA 1TSHA 4AVJA 4QTIL 3FPXA 1JPSH 4GMTH 4K94C 3F62A 4U7SA 2J6EA 3NAAL 5EO0B 3Q43A 4IRZH 3ZE0E 5B3JE 3HTLX 4S1QL 1URZA 3CLEH 4NT6A 2LQRA 2BSSB 4NRXA 4JHWL 4I4WA 4WVRA 2XY1A 4CKQA 1N3NB 1X5LA 2GJRA 4N0YL 4HJEA 1HU8A 1CC3A 4MNQA 3RILA 3DDFA 3OHMB 4HU2A 1NBZB 1OM3L 3TESA 3HAEG 3X2QB 2MCPL 3VXRE 4EIGB 4MDJB 2CLZB 5BXFB 2D7PA 4AQAB 3V0GA 3F84A 2Y25A 1ZLWH 5F6HJ 3VDAA 1XR9A 2RR3A 2YZ8A 3KEHA 2HT2D 1AQMA 3L45A 5SV4A 4Z3FA 4ZFGH 3ARPA 1KZQA 5JQHC 3MR9A 1X5YA 3DIVA 4NERA 5T3XE 5E6UB 5JPMC 3V52L 4ZXBA 3UYRL 4FDWA 4XBGA 3RL1B 1DUZA 4XPFL 1AO7B 5IT2H 5CO1A 5FHBL 2LHAA 3GJEB 2Q6WA 1E9OB 3NTCL 4H25A 4XO3A 5GHWL 3RWJA 1OW0A 1QX1A 4M7KH 4IHBA 1VGKB 2CDGA 4AEHL 1T1WB 2TSBA 4X5LA 4CVXB 1P1ZA 3M1BB 3F12A 5TQ0H 3IMVA 1URLA 4UT6L 3AU1A 4XOAA 1S8DB 3BIKA 5KVGE 1CGWA 4JFFE 1X5IA 3FONA 3BPLB 3E8UL 3L5WA 1TQCC 2MJWA 2LTQC 3QUGA 2F19H 2ZSWB 4N8UA 3RTQA 4JG0H 4UM8A 1G87A 1FNLA 1TFHA 1AZBA 2YD0A 1N6QL 3VJ6B 1MREH 2E7HA 4LLVB 5C0EA 4GIPD 3HZMA 3V9CA 4DKAA 2NQDA 1A2YA 3N0PB 1XF3B 1J8RA 4UT7L 4UNVA 5DS1A 4JM2C 4DQOH 3P2TA 1HI6B 2QSQA 2WK2A 5D96C 5IIEA 4ZW8A 2WVSA 5CWSA 5T1MB 1XXDC 1LD9B 3UO1L 3VFWA 3ZYIA 3GZQA 3PGCB 4BK8A 4KKBD 3HMXH 4NKIL 3PG2A 3ULVD 5J5EA 4GMTL 1NM4A 4X4MA 2HRPL 5DGRA 3P54A 2RAMA 4YHIB 1XSJA 3I6KB 3UYOD 3DVIA 4ZMYA 1KCVH 5I19L 2R9HC 5EEVA 2Q86A 4UMSA 2EDTA 5HVFB 3RGVC 2JJVA 3NBNA 4YL9A 3M8OL 4AM0B 5F88B 5IQ7L 5LKNA 1ZGLM 4MQSB 3ZE1E 1G9EA 3V6FA 1UT1A 2J8UF 3BRGC 1KY7A 1BG9A 3F85A 4KRPC 4Z7VB 4E9WA 1XB3A 3SE4A 3QUZB 3IRZA 6PCYA 1RIUH 4ZMAT 4OI9A 1CGTA 3GZPA 2FX7H 4L3EA 2MQGA 3I85A 3ARTA 3QK0A 3ARUA 2FO4B 4Z7OF 2CO6B 2V5RA 5JR1L 3NFNB 4UU9A 4Y0GA 4EUPH 2Y1AA 3D9AL 5F7YC 2EUWA 5JHMA 4NZUH 3PWVB 5LG6A 1G9MC 2EC8A 5D7LB 2QHLA 3MOQA 1XF2A 5EV7A 1HH6B 2X1XR 2NY6B 4WWKA 4ZUSA 2OMBA 3BWAA 3WTYA 3WFHB 3WFCH 2NW3B 3DRTA 5T3XL 3PXHA 1JNHA 5EOQL 3VXNB 2MPVA 5JHDA 3PHOB 1I1AA 4DH2A 5BO1L 2WLLB 4DN4H 3KGUA 5D7JA 5CN2A 3PPSA 3TL5A 5I1CH 3RG1C 4C4KT 5L9DL 2GITA 2B8OT 3EJTA 4XNUL 1QD0A 3SPHA 2QLYA 3RDTA 4F20A 5C0RH 4NKOA 1P84K 5GS3A 3T3PF 2F58H 4TN9A 3OHXC 4JE0A 1EHLH 4F8PA 1OPGL 3DVNB 4NO5A 4O4YL 4ZNEA 5IFJA 4B5ZA 4POZD 1AKJD 4F80A 5FYJE 1KBBA 2N7BA 1KENH 3O45A 4X4ME 5EMYA 2H5UA 3UBXA 4HUVA 4TQEH 5I15L 2DQTH 5I1EL 2J8UA 3F5WB 4LCYA 1DEDA 1NAMA 4HH9B 4I0PC 4KDWA 5JW3H 3KS0J 3L3OA 1MHCA 4IGBD 2ORBH 4GP5B 4PGEA 1KNOB 4FCHA 4MZ2A 1RUQH 2EEAA 4APQC 1TETH 3JVGA 5DJDB 4B9CA 4M4RB 4AKPA 1AOZA 3R1GH 4YHOL 5FO7B 1X5JA 4JDZB 4KK8D 1QACA 3HC4H 5KSUB 1SJHA 4YDIH 3DETC 1DQQA 3HBGA 4HJ0D 4RQQA 4ZOEA 3IJHB 5KYWB 1QOKA 3M07A 2DI9A 3GUTB 1MSPA 3D69B 4J3OC 4DGYH 3L9YA 4LNRB 4MD4B 1G0XA 1A6UH 4AL8C 1FORL 4HKJA 4HQQL 3HE7B 4FHBD 2WO4A 4Q4IA 4XPHH 4NHCH 3NIGE 3D6GA 1WBYA 2NY4B 3EOAA 3WIHL 4X6EB 4JE4B 4XP9H 4LSSH 3I9PA 5LBVA 2ZG1A 2VDPL 1CK0L 1KV7A 4WWOA 3IXAB 3J8F7 1IGYA 1YNTA 3MROA 4KV5F 4XBPB 1A21A 2DI8A 2HJFB 2OI9C 3TA3B 3KLHC 3OG6B 1ASOA 3T65A 1OF0A 2E7CA 2R0KH 3QIWC 3QZNA 1TUPA 1WCBA 3QDME 1OGAB 3P0YL 5D7IB 1JZJA 2NZ1A 4LXFA 4KQ4L 5I6XB 1RZIA 1CICA 3WOVA 4GT0A 1BZ9A 4UV4L 4C83B 1OXYA 1XB8A 2X3AA 1PLGH 4DFHA 1NEPA 3B9KA 5D1XC 1CO1A 3HAEH 3HC0B 3VYOA 1O5PA 1KT2A 1EFXB 3N1FC 3VFGL 3BUPA 1CMOA 1YDPA 2YAOA 2Q3ZA 4UM9B 2RA1A 2OPCA 5EBWA 3H56A 3OGOE 3IAPA 4XPAH 4F2EA 1IKNA 2RFXA 2H0FA 4IOSA 1Q9OB 1D9KA 1YJDL 4PJAE 3T3PE 1JHTA 4H8WL 5IQ9A 4DUWA 1RZ7H 3F7PC 2DN7A 2A9DA 3MKGA 4YZFF 1FRGH 3VFRA 4RBPK 1P7HL 1G6VK 1N5YL 2XN9A 3DJSA 4NO2B 4JRXB 1VADA 5JDSA 2NUPA 4L3AA 4FFYL 5GRUL 2FEJA 3HMXL 1U8QA 3IFLL 3ALPA 4DESA 2VXUL 1ORSA 4MA3A 3QIBB 2ENPA 5ESAA 1OCWL 1DVFB 3Q8FA 4N6RA 3LKNB 3CQFA 4M8QB 1RVFH 2GSGB 4ZX6A 3H9HB 1KGCD 3WLBB 4L4TA 2BNQD 2IBZY 3HS0A 2BJMH 2QLVB 4AEFA 4JKLA 1NC4A 1KPRB 5F0MB 2IWEA 1AQDA 1JWSA 4CGTA 4KKQA 3DMMA 4Y4FA 5C2BH 3GBNL 2WV3A 4AQAA 3GLZA 3RZCC 4B50A 4HFWB 3D9AH 5D7LE 2OTWA 5LBSA 5DC0A 3UAAA 2X4UA 1QHQA 3GTTA 2ETWA 3QO1B 1X4ZA 3WKPA 1YPZE 1I7ZA 3IM1A 3HHSB 4MJ5B 2IWKA 4FS0A 3WFBH 5C3TA 4JUSA 3NSXA 1T66C 1U8IB 3O3BA 3FO2B 2OFQA 3VQMA 4JG1H 3UBFA 4BFNA 3BP5A 1T04A 5FUCC 4N2AA 3TEXA 2P8LA 5GGSY 1MXGA 5KYNA 3BZ5A 5DI8A 2NPLX 4ENED 3VFWB 1NCAL 7FABH 1BLNA 4ONHB 3V4VA 1BZDA 5L4MA 1IGCH 2IV9A 3NFSL 4RWYL 3ZL2A 1S78D 4NQVA 1G7PA 5C0AD 3QJTB 1I7UA 1AZZC 1IE5A 1XF1A 4FABL 3OKDA 1N68A 2DL9A 1H8LA 3U82B 4ZDHA 5LXGL 1TVHA 2P7TA 3MYJB 4CDHA 1PSKL 2AW2A 5FOBA 1EPFA 5F7NC 5KVEH 3NJGA 4ANUA 2QQNL 3C9NB 4ZQKB 5T3XH 2VUKA 4AW7A 4KK6D 3TJHD 3EJYD 4HUWB 1MLCB 1CE1L 3EH2A 5ABAA 3BVTA 2EDJA 2DKSA 1MFCH 2YMOA 1XGQA 3V5DA 4WNQA 3U0WH 3KBHE 1I8MB 4ISVA 4XOBA 1U3YA 4X4XA 4DERA 3BPNB 4MMZA 1XCQA 1RMFL 4RVBA 3WNLA 1RZKL 4ZFQA 2Z3FA 1HN1A 4G8EB 3QZMA 5T1LA 2P8MA 1N0XL 4W4OC 4HPOL 3AREB 2OL3L 4KI5E 4A6YL 2WLLA 1CVRA 1RIHL 5GHWH 1QFWH 2EECA 1KBGH 2OMZA 2ROYA 2VZ3A 3NCXA 4TUKL 4NZ8A 2DWTA 3RZWA 1OVZA 4Z3HA 4G6FB 4QHUB 4LSPL 1G1CA 1A1OB 2FHCA 5F6IB 1S3KL 4PRHE 2DQMA 3C08L 4PH8A 3Q48A 5D7SH 3BSZL 1FGVH 1JS4A 1OT1A 4HSCX 4N8CH 3FQTA 4TVPD 4L4TE 2Y5EA 3V6ZB 4KXZH 1QQDA 4R5TA 4KI5C 4ZX3A 3U4EA 3KPRA 5I18H 3UTSD 5G55A 3WO4C 2C4FU 1PL3A 2Y0SA 4AMXA 1N59B 2OI9B 1YMMD 2WXGA 2J7LA 2OXGA 2YKLL 3BGFC 3ZDYF 4JK0D 1WWWX 2R0KL 4EUPG 5BS0D 4PRIB 4HHAA 4O02L 1JGUH 5FA4A 4IRSD 1CFQA 2RALA 4U6HA 5FGCE 3FNKA 4LCCC 3G5WA 2XWTB 5D1QE 2E59A 1FL5B 1P4LA 4GQQA 4M1CD 2X89A 3UO1H 1JXJA 4Z7IA 4M3KB 5IMKA 2VLJE 1MRFL 4LSSL 1O6SA 1H9DA 1DQLH 1QVOA 4UAOB 4PJAA 3BT0A 3KW7A 3NQKA 5DUMH 2J5WA 1NFDB 4H5SB 3A4FA 2EIZB 5C86A 2JB5L 2W0FB 2J72A 3J07A 3LKQB 4JJOA 2CBTA 4JFSA 4URTB 4R2GD 3VGBA 4OAWA 1U0QA 1I1YB 1Q90A 1WAAF 2Q20A 2BZCA 3IXTB 3M6DA 4M5ZL 4XCEA 5GS0C 1OV8A 2Z65C 1IRAY 4FYTA 3GM0A 4N2LA 3R4RA 1ZTXE 2CLVB 1INDL 4Z7UA 2V33A 4JY5H 2AJVH 3EOBB 4OIFA 1IM9A 2YQ3A 3FCSA 3IKCB 1SN5A 2B1OA 1NFDE 1QNZH 4J6IA 1EHAA 2D03H 4Y5YC 3QAZB 5IGXH 1R5VB 4JRLA 1BGXH 2BSTB 2XY2A 2JFCA 3RTQC 2XIDA 3U83A 1JF1B 2WD0A 3OAZH 2X4PB 1DQTA 4AC2A 3JV5A 4G6ML 3OXRB 2HKHH 1ZLSH 2P49B 1KXTA 2WUCL 2HRHA 3CC5B 1A64A 1CICB 4WTQA 4LEOB 5F1NB 3P4OA 4MCZA 2BJML 3DV4A 3RTLA 2XFGB 3H4HA 2WQSA 4F92B 4NPJA 1U8LB 4NM4L 4ZMNA 4PCYA 4KI5F 1JHLH 1U41A 2EDDA 1BD2A 2O4EA 5AFAA 2AXGA 2BVYA 4EVNA