3X1GA

H294m mutant of copper-containing nitrite reductase from geobacillus thermodenitrificans showing two coordination geometries at the t2cu site
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTMQFNHAQKGAVAMLKVTETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Structural evidence of the flexibility of the CuM site
rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Oxidoreductase
total genus 99
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1gA00
1V10A 1IBZA 1NWPA 1ADWA 3X1FA 2HXAA 4GYBA 2JKWA 3IN2A 1E5ZA 1L9PA 3AG2B 4GY4A 5B1JC 4A2HA 5B1BB 1E67A 2EIJB 1JZGA 3NP4A 5PCYA 2DWSA 2X87A 2XXFA 1GY2A 1PLAA 2DYRB 4K9JA 4JKNA 1PAZA 4HHWA 2B3IA 1GY1A 1KGYE 2ZONA 1DZ0A 3FS9A 2HX7A 1JOIA 7PCYA 1NIEA 3X2QB 2BW5A 4A66A 2YAMA 1DYZA 3PXLA 1MDAA 5B1KA 2CCWA 1J5CA 1GR7A 3CDZB 4E9SA 1TU2A 1W6WA 2VMJA 2XWZA 5I6MA 1HFUA 1ASPA 1JZIA 4KNSA 2PPDA 5D4IA 1WA1X 1ZDSA 5I5MA 1AIZA 2YAFA 3X1EA 1A4BA 2WSDA 1J5DA 4GXFA 1FWXA 1NPNA 1PZCA 2IDQA 4QKTA 5EHFA 2ZXWB 4WTQA 3HB3B 3NSDA 2I7OA 3DKHA 2J56A 1A65A 2QDVA 2VW6A 3QPKA 1OV8A 4AKPA 3AW5A 4YSDA 5F7AA 3ABKB 4DPBX 1CURA 1JERA 2RACA 4A2GA 3ZDWA 4KOBA 1ET5A 2FQEA 4HIPA 2CJ3A 3SQRA 5TK2A 4BWUA 3OM3B 2Q9OA 3ASNB 1JZEA 5B7MA 2PCYA 3T6XA 2OJ1A 3G5WA 1QHQA 2PCFA 1OF0A 3HEIB 3WNJA 2AANA 1JZJA 1CYWA 3D12B 4DP2X 1AG6A 2YAPA 1NWOA 4PAZA 3GXUB 3N2JA 1URIA 1OCRB 2OCCB 4YVNA 4E9RA 4YSAA 2H3XC 3JT2A 2XLLA 3QJSB 1KDIA 4JHVA 4DP6X 1OE2A 3EF4A 3S8FB 3WI9A 1IC0A 1OOWA 1AZBA 4YSPA 4MFHA 3V9CA 1CC3A 1SFHA 2FQDA 4BWTA 3OMIB 4DP9X 1MZYA 4F7KA 5I6KA 3NJIA 2UX7A 3GYRA 3T6VA 3KW7A 4A68A 1WS7A 3TBBA 2FJSA 1IUZA 1GSKA 1PLCA 2BP8A 3UABA 1SDDA 1TEGA 2ZOOA 2PPFA 1XMEB 1L9SA 1AR1B 2GIMA 3NSYA 3S3DB 2IWEA 3NJLA 3FQYA 4WKXA 1YLBB 2GHZA 2QPDB 2R7EB 2XX0A 3TASA 4ENZA 3BVDB 1PF3A 1ZIBA 3FQ1A 1SF5A 4UAHA 1UATA 3V9EA 1SHWA 3FSWA 4N4YB 2BO0A 2VM3A 1A4AA 4DPAX 1KBWA 2VSKB 1M9WA 2QPEB 3NYKA 4AI7A 2VM4A 1PNCA 4YSOA 1OCOB 3WNIA 4DP7X 2WO3B 1TEFA 1AACA 2EIMB 4BXSV 3FPYA 1EZLA 2CAKA 3NSFA 4BDVA 1ET7A 2GB2A 2XV2A 1AS7A 1NTDA 4KNTA 2XUWA 4G7SB 1EHKB 4NB7A 8PAZA 4DPCX 4E9TA 2VSMB 5F7BA 1XB3A 4YSTA 1AS6A 2Q5BA 2YQBA 2ZWNA 4KNUA 1CYXA 5D4HA 3MBWB 3NT0A 5I26A 5TK4A 4YSQA 1BXAA 1KDJA 2YAOA 1RZQA 2GC7C 3NSCA 5D4JA 4CSZA 1J9QA 1ZPUA 1A4CA 2HRGA 3CVBA 3FU7A 5FC9A 4F2FA 5LDUA 3PAUA 3DTUB 2XX1A 1ZDQA 2GSMB 4TXVB 4G70B 1MG2C 1CUOA 2PPCA 4HALA 2BZCA 4A67A 3X1NA 1N68A 2TSAA 3FSZA 4A2DA 4YVUA 1KCBA 2QT6A 3EH4B 2IH9A 2P80A 4E9XA 3T6WA 4UF7C 1ASQA 2FT6A 3T6ZA 1AOZA 4P5RA 2H47C 1WS8A 1BQKA 2BHFA 4BWWA 1NIDA 3MX0B 2YAHA 3NJJA 3X1BA 1NIBA 1AANA 2BZ7A 1V54B 4DP0X 5I6PA 2VW4A 3H4FA 2DWTA 1QNIA 4KO5A 3SBQA 3EHBB 5I5JA 2UX6A 1ASOA 5I5IA 1WA2X 1X9UA 2TSBA 3PCYA 1TKWA 3OMNB 1GS7A 1X9RA 3TA4D 1R1CA 3ERXA 4E9YA 2UXFA 1GS6X 2GBAA 1OCCB 1OE3A 2IDSA 2YAEA 3WKPA 3FT0A 1E5YA 3H56A 1NINA 3SBPA 3AG4B 5A7EA 1AG0A 2N0MA 1WAEA 2HX9A 2AVFA 3AZUA 2IH8A 3PLYA 1JVOA 3FYEB 3X1GA 1L9QA 4E9VA 4M4RB 1AQ8A 1PY0A 3ABGA 2PP7A 5I28A 1ZIAA 1NIFA 2XU9A 1BXVA 2B08A 1RKRA 4GP8B 3NP3A 2BWDA 7PAZA 1V55B 4A2EA 1AAJA 2HLEB 2J55A 2VW7A 3C75A 1E65A 4GP4B 4KO6A 1JXFA 2JFCA 1BEXA 3PPSA 4YSEA 2PLTA 1BYPA 2PP8A 4G72B 2AZUA 3FPXA 4P5SA 3WKQA 2DYSB 2PPEA 5B1AB 3QJQB 2XXGA 1OCZB 1FA4A 3H4HA 5B7EA 3OMAB 1AZUA 3CVCA 3AG1B 2PP9A 1SDDB 4UANA 1SF3A 3QJTB 3T71A 1M57B 4PCYA 3GDCA 5E9NA 3JTBA 3NJHA 2FT7A 3S8GB 1T5KA 3EH5B 3NJKA 6PAZA 3PAVA 2EILB 3BQVA 2BP0A 2HX8A 3AY2A 1J9RA 2Y1AA 5I6NA 1NICA 1RZPA 3ABLB 4Q8BA 4DP1X 3PAZA 2CUAA 4HHGA 2W8CA 2AFNA 3ABMB 1I53A 2CBPA 3RYMA 1A8ZA 2I7SA 3S3CB 3UAAA 4DP5X 1L9RA 2J5WA 2VN3A 1NDTA 1MZZA 3CVDA 2FNWA 4E9WA 1A3ZA 1PCSA 5B3SB 1L9OA 4FAAB 4F2EA 4A2FA 4HCFA 3TU6A 1BAWA 3WIAA 4BDVB 1ET8A 2FQFA 1BQRA 2NRDA 2IWFA 1SFDA 3KW8A 1RCYA 3CDZA 1AZNA 2XVBA 4QLWA 5I6OA 5AZUA 3U25A 1ETJA 4RH4A 2H5UA 1AS8A 4AX3A 1J9TA 1F56A 1E30A 2UXVA 3NJGA 2YAQA 4G71B 4GP5B 1B3IA 4DP4X 2JXMA 4E9QA 1PLBA 1BYOA 2HZHA 1GW0A 4G7QB 4HCIA 2FQGA 4M3HA 4BK5C 2MTAA 2GI0A 3NJFA 4CSPA 2J57A 4DP8X 3FU7B 2LLNA 2A3TA 3UADA 4HCGA 5AKRA 1AZCA 4YSCA 2P80D 1NZRA 1GS8A 2IDFA 4N8UA 2IWKA 3QQXA 1W6LA 3S3BB 1IBYA 4W1TA 3OQRA 1QLEB 2XV3A 2XYBA 3TBCA 4HZ1A 5PAZA 2CALA 1BXUA 2IDUA 3IN0A 3NJNA 1ILUA 2XV0A 3OD3A 5B7FA 2UXGA 2YARA 4YL4A 3ZX1A 2IDTA 1KYAA 4X4KA 1NIAA 3FSAA 5AFAA 1N70A 1JXGA 3QJVB 1JZFA 2IAAC 2HRHA 3T9WA 3FU9A 3ZBMA 3QJRB 5ANHA 2UXTA 4EF3A 3FQ2A 1VLXA 2FTAA 1PZAA 1GYCA 1NPJA 1PNDA 1SJMA 2GC4C 1W8EA 3QJUB 5IY5B 4JHUA 1PZBA 4HAKA 3CG8A 6PCYA 1M56B 1BQ5A 1AZRA 2EIKB 1SNRA 3DIVA 2FWLB 3ZIYA 1JZHA 1WA0X 4NERA 1HAUA 2BWIA 2DY2A 1XB8A 1KBVA 2AZAA 1ZV2A 3NJMA 2MRYA 1JXDA 1SHXA 3AG3B 4AKOA 3IEAA 4W9ZA 2YXWA 3L45A 3IE9A 4BXVA 2EINB 2R7EA 3ASOB 4L0PB 3IBOA 1ID2A 1L9TA 5I6LA 2BP8B 1FFTB 4NAJA 2QDWA 3SBRA 4YSUA 4FA7B 2OV0A 1ILSA 4AKQA 2YXVA 1IKOP 2FT8A 1XB6A 3N55A 1KV7A 4YSSA 4YSRA 1HAWA 2Y69B 2I85A 1MG3C 3UAEA 3FU8A 1KCWA 1J9SA 4Q89A 2DV6A 4G7RB 3CZUB 4KO9A 3UGEA 4ZK8A 4AZUA 9PCYA 1JVLA 3UACA 3WG7B 2W88A 4KO7A 1PMYA 3EH3B 3FSVA 3FYIB 2WO2B 2BP0B 1OE1A 2BW4A 2X88A 4KOCA 5B1JA 2E86A 2PPAA
chains in the Genus database with same CATH superfamily
2W80C 1ZJAA 3SO5A 4WLCA 4GW1A 1NLDH 4I3GA 1YNKH 1DJYA 1FIEA 4WWPA 3IN2A 1U92B 3OGOE 3G08A 5KTEH 1CDHA 1YVLA 3O4LB 3OKNB 4GUOA 3F64A 2X87A 4YHML 4EZMA 2LU3A 4K9JA 4GW4B 4NKQB 5A3IC 2XZAH 4KVCL 1IAKA 1QQDA 2W07A 1S78D 4YQXL 3GRWH 2E7LA 4W4OC 3WGVB 4Z0XB 1Z2KA 3GSXA 3KXFD 3DVFA 1FGVH 1TQBC 3L2LA 3EYVA 5JXAL 1DBKL 1P2CA 1WA1X 4G7YL 4HBCL 2J21A 5CLTA 3S5YA 1CLOL 3QIBC 4J3TA 1UKSA 2W91A 4U6YB 1WFOA 4M4PA 1RZKH 1E90A 1T21B 3K71A 1T2QH 4OSUH 4NHUB 4L29B 4P2OD 2VW6A 3DTXB 2PO6D 3KWWB 1EJOH 3QVAA 4LE8A 4LBEB 2WVTA 5DJAA 2R0ZH 2APFA 1JERA 2P28B 3G04B 2YA1A 4PWJA 4M6NL 4PR5A 2WWOA 1ET5A 3L4WA 5TK2A 3C08L 3ZMEA 1R3KA 3GJFA 2A73B 5EO1A 4X0NA 2K6WA 3ASNB 1SEQH 5C0RL 1WQVT 3ZTNH 1CLCA 1MFBH 3LPOA 3RTQD 1BZ9A 2CLRA 3K4DA 3QEUA 4PWIA 4BQ8A 1P4BH 3EYSH 4DP2X 3L1OL 2ALAA 2AEPL 3T0EE 5ANMA 2ZCHL 5DHMC 3DX8A 2J6EH 2OMNA 3L6FB 7CGTA 3IJEA 2LVEA 1JNNH 5E5MB 2LR4A 1P4IH 4NBXB 5HJDA 4PY8I 2FJFB 2V2XA 4FNSA 1CFQB 1ZTXE 1JDCA 1W2KT 4FTVD 2EEFA 4LSPH 1CDCA 3QFDB 4H44C 1GH7A 3ULUD 3WIHH 2LGNA 3KEHA 3RFZC 2BVEA 2FQDA 4QXUL 2VERN 4DP9X 4F7KA 1GZHA 5I6KA 2M83A 5EU6E 5ADOL 3NJIA 1ODAA 1ZAGA 3I6GB 2PTTA 1U3HD 1WS7A 1HILA 1MVYA 4WFFD 3DETC 4YDJB 4HK3N 1HHJA 5D6DA 4IRZA 4NQQA 5JQHC 1IKNC 1N12A 2FZ3A 2ZOOA 2X09A 3RLSA 5I6XB 2A38A 3IDGB 1L9SA 4KH2A 3N41B 4WW1A 4XWGH 4OFKA 2NR6C 1A7NH 5JHBA 3NJLA 3IXAB 4OF7A 4NNXA 1QPKA 4OZFB 5FOBA 3VXRE 2WTPA 3LQMA 2ICEC 3LH8A 3QEQA 1ZVSA 1LDPH 4I9XA 4ENZA 4MNHB 3BSGA 4IMLB 3TGXA 4M7LL 5C0DB 4KQ4H 3N5AA 4PGEA 3D69B 4F2ME 4FF9A 1NGQH 3ZE1F 1U41A 1KGUA 3LIZL 1YPZF 1DN0B 3KJ6L 5LWYH 1QFUL 4XP5H 5KSUB 3ZMRA 1AHWC 1KGCE 3DVNA 5DHYA 1KGJA 2Z31B 1MCIA 4U1HB 3DJZA 1U3ZA 3W39A 1NM9A 3B2VH 3TEZA 2ICWJ 4FKEA 2G0LA 1ZSDB 2DQJL 4EUPB 8PAZA 4UT9L 3D0LA 4KC3B 4RNRB 2G2RB 1AS6A 2VZUA 3AXLB 2BHYA 4R8WL 4I3SL 4B9KC 5MI0B 3Q5YA 1UD4A 3WDIA 5AVZB 3CFBB 2OJZL 3BSHA 1FCGA 4GAJH 3GB7A 4JPIA 1F1GA 4Y4FA 4JDTH 5JLZA 1KOAA 1Q94A 2BVPB 2FH8A 3UAJA 4IBLT 4XN5A 5GZOA 2FYYB 2V3EA 1XGUA 1DVFD 3T0XA 5LDUA 2VDKH 3OQ3B 2E7BA 1Z9NA 2HUEA 2Z35A 5BS0E 1YUKB 3L5XL 3NCFB 4K7PX 5EBWB 3RTLA 2YQ2A 3T77A 4BCYA 3X1NA 1O7DE 3RZCB 3MU3A 4UYPA 1RIHH 4AIZA 2ZXAA 4Z9KB 1BVNP 1ZY9A 2AVGA 2WUCL 3H2WA 3MA9H 4QR7A 5CEZD 2D31B 4Z7OB 1M42A 2CR0A 3DVGB 4Y4KA 1NC2B 5K59F 2JKXA 3L4UA 2IBZX 2QFRA 1KN4H 2BHFA 3SOBH 2Q8BL 4PJ9D 1Z0NA 4A6YL 1OGTA 1SY6L 4DGWC 1FYTA 1LNUB 1NIBA 2IQ9H 4PP2B 1TYJA 4P59H 2XBTA 3U1PA 3GIVB 1V54B 3KYMA 3D3VB 4I2XB 4RMUA 5TF0A 3VGGA 5I6PA 3WOVA 2FECI 4LQ1A 1UACH 3VI3F 3UTPD 2JB6B 1G7LB 2AJUL 5EOQL 4G7VH 4G42A 4R7VA 3CTTA 5JHDB 3HHMA 1UM6H 2B1HL 1R1CA 3GSNB 4WJG3 1KTBA 4JM2D 4KKAD 4K8RC 4R9HA 1B0RA 3X3GL 1ND0A 3ARRA 1RUPH 3QUZD 3AG4B 5DYOA 3WXVH 4JE0A 5IW1A 3O0RH 4W81A 3ZGHA 2ZXQA 1ZA3A 2BLFA 2B1AL 3BWUF 5HD8D 3MGOB 4U7MA 4NIYE 4QXTA 4ZO8A 3RVXD 4DESA 1L9QA 3FL7A 2D3JA 2YMXL 4MZRA 3B9DA 4I18C 4ZX4A 1JGDA 1Z1WA 2WXFA 3L9RA 4UOZA 1KGXA 1CIDA 1S9YA 2EE2A 2EXYC 3KGTA 3QUMA 1N0XL 4HIXL 4HUWB 5ES4B 4PGDA 1E65A 2CHDA 2ZYRA 4HWEL 4Y5XB 6FABL 2MOQA 3APFA 1QUPA 4OZHF 1QYGL 2YPKB 4P46D 3MNZA 4ZFZA 2WYTA 1UXLA 1YN7A 3VFGH 4DEPC 4BFEA 1REIA 2DLHA 2PP9A 5KYWB 2R9HC 1BZDA 3BYTA 5E0FA 3EGDB 3BSZL 4KAQH 5KJRH 1MREH 2BMKA 1FO0A 3DV4A 1ES0A 5JIIA 1S7TA 3CFJB 4NO3B 1G1KA 4W9DC 5DQJB 5C9JA 2WIIB 3PAZA 2IALA 3BMVA 3A67H 3I2CH 4TVPH 5LB1A 4HPOH 4BH7B 1TQCC 3MLWH 3OKEA 3LQAH 3MO1A 2DBJA 4YHYB 2R2EB 5L7XL 4XMXA 1YPZA 4TLUA 4ODHH 3HW7A 3PHAA 4XN7A 1MAMH 5L88H 1KPUB 4R5XA 3LN4B 3FFCA 4FAAB 3PQYD 1YYLH 4P4KC 1TZOA 5GRWA 1XIWC 1AC0A 3N1FC 5J12C 2JCCA 5D2NB 2W0FB 4ZT1A 4B9IA 5I75B 1JPGA 4NO5A 4KGJA 4LGPB 5HGHB 5BV7C 3C8DA 4JJHA 4NQVA 3T3PF 1HE8A 1J0ZA 2R4SH 3C5JA 4HF5H 5I8CA 4KY1H 5HI4C 2G0KA 3B2UC 3ULVF 4IKKA 3BPOC 5FCUH 4OLWL 3RIAF 3UZEA 3WN5B 2GBTA 5GSRB 5TDOB 5TPWH 2WSKA 4DKAA 4PS4H 1PEWA 2L7QA 1HN1A 3QHZL 2DQGL 2VAAA 2AQ1A 2NW3A 4OM1H 3QZMA 4BK5C 2MTAA 4UTBH 3GGWA 2ZAHA 1G7PA 4YK4C 2GT9A 5HYQB 5J1AB 4K2UH 3KYNB 2IEPA 1HQ4A 3O6LH 3LRGA 4Z3JA 4Y1AD 3M1BB 3O4OB 3OX8A 4XMUA 3TYGL 1TPXC 4QHLA 2IDFA 4XN2A 4MB1A 4YHLH 3O3BB 4AYFA 2CD0A 5HJ3A 4HQQL 4JZOA 5SV3A 1OP3H 1DDTA 3EUUA 4RCAA 3P40A 1KB9K 5ESVA 3EOBB 3LDBB 4ZG1A 5B39A 3SBWA 3BC9A 1XF4B 3NCMA 4FDWA 1NCNA 1ADQH 3S36L 5F8QC 2KL6A 4J3OF 1KPVA 5H2BB 4PWHA 3VI3A 4PMEA 4NUPA 4BFJA 3VDBA 4UIKL 3EYUH 1S7XB 1PDKA 1MSPA 4XVOA 4LIQL 5ILTL 1XF2A 1BFVH 1PCXA 2DKUA 1C12A 1XH2A 4MSWB 2G75A 2V9RA 5D7IE 2AXJA 3UPCA 5IVZB 4C56A 4A6YB 4NRXA 4NXKA 4IGBA 1E40A 4Y19D 1AD0B 4N22A 2CDFB 1BEYL 3DETD 6PCYA 1RZJC 4ADIA 3QDJD 1SNRA 2X1QA 3FQWA 5TD4A 4NERA 1G9EA 3D6GA 1S5HA 4KJQD 1TQTA 1ZV2A 2NR6D 3OKDA 1S7WB 5E2UL 4ISVB 1D5MA 3QWRD 1CU4L 4Z8FH 4M7ZB 2XPGB 2X6AA 1RHHA 2JK5A 4DZBA 3B3IA 4AEIH 3GJFK 1DHKA 1GPOH 4LOUD 1V27A 2QFPA 3H9HA 4KHXL 5IFAH 1W0WA 4FFZA 5H37G 2YXVA 5EBGA 4HKXB 2EIEA 4MD0A 4OF8A 3EFFA 5F1SA 1YYMH 2DWYA 1JFQL 1QI3A 5D6CA 4RAHA 3IRZA 1OXYA 3MCLH 3QFGA 3BWSA 4ICXA 5ALCH 4TRPH 3PAYA 5CJQH 5C8JA 1FCCA 1WISA 1Z9SB 3TIDA 1U42A 4RFNC 4LHJB 2DEXX 4OFYA 5CP3A 4H20H 3T4AC 3JBG7 3CD4A 1BQLH 3TEYA 1NBZB 2GJ6B 2J88L 4LK4A 1BX2A 1JRHL 2ZAGA 4G59C 3C09B 5DURD 2QVMA 4IJTA 4JRYE 3MBWA 4L3FA 5JQ6L 2E56A 3WEXA 1XBDA 3HNVL 2JKWA 3B5GA 4ODUA 2OSLA 1KN2L 4LCWD 1YEIH 2H0PA 4B9YA 1MCKA 3IFOB 3ARFD 1Y6NR 2WJ7A 3V2AR 4GMSH 1QVOB 4H2AA 3OKOA 4XC3H 2DLFH 4TQ8A 2GQHA 1KLGB 2Y6SC 5C0AA 3EYOA 5EOCL 2CA4A 4G5AA 4QRUB 4HIJB 1EEYA 3TIEB 3IJHB 3MRCB 7PCYA 2GBVA 4AEFA 4LCUA 5C09A 3V4PL 7FABL 4NX0A 1KXHA 1JV2A 1OGAB 2M26A 4PRPA 4E9SA 4UQBA 1G7QB 4G9DB 3FTVA 3HMWH 1S7VB 4D8PB 4QAMB 4DF9A 5AKSA 1KACB 2E7LC 4XXDA 2XRAH 5C0EA 1RULH 4XPFL 3ZL4H 2NY0C 1FWXA 1A6VH 1OHQA 3LRSB 2Q3XA 3EH1A 1QHPA 1MHHA 2OPCA 2R29H 3FRPA 4LLMB 4RFOH 3BAKA 4X5WB 3GI8L 4ATTA 5F0JB 1DJHA 2DWDA 3BRFA 2EC8A 4PRHA 3MV8E 5E00A 1NM4A 4AY0A 3QEGL 2VLRA 4V2CB 2XN2A 1TT6A 4PTTA 2WQSA 1W8NA 3U6XA 3BEVB 2H32H 3TH4T 1E6JH 3O3EB 2BSTA 1YEGL 4H8HA 1AFVL 4FQXB 4XP1L 5HDWA 1CL7I 3FCSA 2OI9B 4XCNB 3S88L 1RK1A 3DK2A 4IRJA 1JHKH 5IMKA 1A9EA 4XO3A 5C71A 1K6QL 2VDPL 4APXA 4M5ZH 4DKEH 4X4YA 2ZCKL 1ZT4A 3D12B 1JZJA 3CUPB 3LSOA 4I8DA 2EDDA 4XMVA 1NCOA 2ZSVB 5GRUL 1N2RA 1VAHA 1Z3RA 2IJ0C 4F8OA 1LE9A 2LLGA 4OI8A 3F7VB 5D72H 4OJDH 3W57A 4HLZG 5EIQA 5GHWH 3RI5K 4KFZC 1Q38A 2QVKA 5E08H 1VKXB 2RMNA 3WD5L 2XZCL 1T0OA 1NCWH 5T5FL 4D9QE 4TS6A 3AQYA 1AZBA 4QCIA 3KR3H 4JFED 4M8UA 2KLSA 1CYGA 5G4OA 1IAMA 1ZSHA 3V4VA 4F8QA 4M61A 5IEHA 3QXDA 3RWEA 3HG0A 2A4ZA 2Z3FA 5IFJA 3NAAH 5JHLH 3GPEA 3B2XA 1J5HA 4AC4A 2BVOB 2QBWA 4NN6C 3JV4B 4ZPVA 1IAOB 1E9QA 4LFHD 1GZHC 1S7UA 4PD4J 5IQLA 2PPFA 4YX2H 1UHVA 2QGDA 2WBJA 3BH8A 1NGZB 5D6DC 2F7RA 2VZ1A 2QQNL 5I1IL 1DL7H 3NIGF 2BIHA 2BIIA 3OAZH 1H0DA 3TLRA 3VFSB 5I2IB 1RJLB 1T4KB 2G3ZA 5LHDA 2UZYA 4EZJA 3AT9A 1SEBB 3FQRB 5BVJA 1X6LA 1C08A 4IOSD 3FB5B 4N2KA 3ZTJG 3OXRB 4QF1B 4JGNA 2ZOUA 1BGXL 3V9EA 1AKPA 1D7CA 1JK8B 4LVEA 5LDSA 3MOQA 1WYJA 1B9ZA 4UCFA 3IU3B 4DKDC 2A6DB 1OCOB 2ZUTA 3CVHL 2WLLB 3B7TA 5DLLA 4P4KD 5J9PB 1OLZA 1FPTH 2YD8A 3V10A 1F58L 2B4CL 1KCVH 1UB5B 5HHMB 3IPFA 1JGLL 4XCYB 4HKZB 3QFJD 3PV6B 4UM8B 2FK9A 4TL5A 4KDVA 1WZKA 2CO1A 4NB7A 3JSSA 3SDXF 2PWGA 5BJTA 4S1SH 4ZFGL 2MEJB 3LZLA 3UBXB 4BGDA 4HIHB 2ZWNA 5HI4D 1MFVA 3PGFH 4JPWL 5F7FA 3JWDL 3NCJL 2VLKD 4K5PA 4NQDD 4X8JB 5T3ZL 3VXQA 1U8LA 1JNJA 2V9QA 2RD0A 2VSDA 2GJZB 1EZVX 3FK3A 1BXAA 3QO1B 4M8QB 5BVPL 2A9DA 3SZKC 4QRTB 2BNQB 2RCSL 3MREA 1T6VN 2WZ5A 3HAEG 1QKZH 2GPZA 4NRZA 3D2TA 3BWAA 1JXKA 4EO5A 4TXVB 2L7UA 3LMJL 3O9WA 4P4RA 4Y4FC 3QP3A 1HHHB 3UAJC 4H1LG 4A2DA 2GK0A 4O9HH 5DD5L 5GZOC 4YVUA 5C0CD 5GS0H 1SZNA 2P80A 1SDAB 1R33A 1ZVHA 5ID0B 4LQFL 1Y0LB 2BSCA 1HXYB 4O2CA 1JNHA 3HE7A 1FDLL 2NMSA 5T1MB 4M9OA 3QZBA 4MD4B 2G9HA 4K7PY 4WCYH 4F7TB 4LPTA 1UH4A 4HS8L 2J2ZA 4Y4KC 1A66A 4GKZA 2WCSA 5IQNA 5T1LD 3ZSTA 2F7IA 3OAYH 1NEPA 2ZXEB 2X1OA 3QWQB 5ICXB 3IMWA 2VW4A 3W0WB 3RAJH 2VXQL 2NX5E 2WQXA 3V4PB 5EU7E 1HQRA 1ASOA 2BFVH 3TCTA 3VD7A 1BVKB 1MFEH 3PCYA 3UJJL 1GS7A 2Y7MA 4JPKH 4L2LA 4JFYA 2YJLA 3LB6C 3RUGE 5EH1A 1AI1L 3CBKB 3OJDA 3U9UA 4N2AA 2R1WB 4NZUL 3ZW3A 1U2YA 4FGMA 1OTSD 2WLKA 4KJYA 1KIPB 4N25A 3ARBB 4G1EB 1MFCL 3P30H 4OZGE 5FOJA 1FZKA 5BOJA 1IC1A 1IV8A 2H8PA 2ZCLH 3X13A 1QEXA 4LLDB 1B4TA 3EH2A 4D0BA 2R83A 4LSRH 1J1OH 3UTTD 2ZUVA 3EOTL 3AS0A 2B08A 1RKRA 2A83B 1NKOA 1A4JB 5A2KH 2GFBB 4F24A 1V55B 2VDPB 4ZS6C 4EI5B 3PPSA 2CDEA 1UWEH 3B37A 2HT3C 3CLEL 4KJWC 1QEWB 1DCEA 1RUKL 4PH8A 2EH7H 5DK3A 3AC0A 4X5XB 3F2LA 1PKQA 5E9DB 4HG4K 5HHPA 1FA4A 4OCRH 1S3KL 2CIIB 1XVSA 2QEJA 2ZNWA 3KWXA 1MI5B 3HBZA 3ETBF 3AU1A 1ETZB 3RE0A 4N8VA 4OV6F 1MHPH 5KN5A 1GA2A 2AKRB 1ZWIA 4HWBA 4QTIH 1LWHA 2BSDA 3FQ4A 5E2WH 4FQHB 4G8GB 4Q6YA 3TA3B 5EZIH 4Y9GA 3RDTB 4K23H 1QP1A 2VLJD 4FZ8L 3L7FB 3VFMB 5GRXG 1B3JA 3JWNC 4NQEB 3JUZA 3KYOA 4RMTA 2Y36H 4GRWH 2P46B 4YHKH 3CMGA 4KXZI 4LF3B 1IAII 4HX1B 4JZJB 4ZXBD 2AJ3B 4F2EA 2VQ1A 5E23A 4PJXB 4HEPA 1F18A 3WY3A 4YHOH 2ESVE 2FQFA 2VC2H 5E6UB 2ILLA 3S37H 1R3LA 1RCYA 1QWNA 3RBSA 3CC5B 3VNYA 1OWWA 4AW7A 1XSIA 1F0LA 3IAGC 1BFOA 1I8IB 4XOEA 5EORH 5C6TL 1TOXA 3IJSB 1J9TA 1BXXA 1ZOXA 2IOOA 2DD8L 3DV6A 2F53E 2NY0D 2RTTA 4NWTL 4ZSOB 1F8TH 1A0QL 2HPTA 4IK6A 3D52A 2V8MA 1TTUA 2DKMA 4RGMC 4Z7IA 1YHPA 4HUVA 1OSEA 1E50A 5IHBA 2C3VA 2GI0A 3UZEC 2OX5A 4L37A 4IU3B 2YSSA 1ACYL 2JIXA 4U1SB 4NJ9L 4XC1L 1IC4L 3UADA 3VFPA 1OO2A 4FNPA 5BZXA 4IBTA 1T0MA 1BWWA 4DCQB 3FT2B 3CN2A 2FUTA 5DK2B 2P8PB 4RZCA 3LS4L 4X5LA 3VI4F 3V0IA 2WOYA 4U0RC 4ZMLA 5AYUH 3UCRA 4CW1B 2VYRE 4HZ1A 4DK6A 5IF0B 5L2KB 5JW4M 3EFDL 4N8CH 1LO3H 1TMCB 1XGYH 1OZTG 5HHOA 5IBTH 4PJCF 3UBXI 1O9VA 5AZ2H 1RV6X 1DBBH 3ULUL 2UXGA 3SDCB 3VGEA 3O4LE 2B15A 1KMGA 4R4BA 25C8H 3N3EA 4EI6B 3SBWC 1DCLA 1NMCB 1T5WB 3JWOL 4N2IA 1PL3A 3FQ2A 4JEGB 2CO7B 2Y07H 2Y5QA 3BPNC 4EN3B 2FL5A 2F5BL 4HFWB 4M8RA 3GHEH 4X6EB 3VFTA 3WFHB 3WLBA 3ZQXA 2Q7NA 3H9SD 3RIAK 1HKLH 3U9PH 1LO2L 4FC3E 2BXYA 1G7IB 2RIKA 1MCPH 1NCBL 2A9ML 2WKOF 1I1CA 4R26H 5TFSH 4LLYA 1ZRUA 2CKBH 3CDCA 4KVPA 4HDIA 2D73A 1OAZH 3EFOA 3MFFA 5AB2A 3DIVA 2HT2C 4ZUUA 2FWLB 5IK3A 4LASL 5MHSE 4IGBC 4MYPA 3D51A 3IDXH 4JO3H 4N6RA 4R0LB 2AZAA 1NCAL 3NJMA 2J5LB 3FOLA 4DHLA 1F00I 1Q0YH 5JA8B 4QTHA 1U8JA 4BQCA 4DQOH 3VA2C 2YXWA 4L3CA 4LDLB 5I15H 5EMYA 2EUVA 3BWUC 1IT9L 4DUVA 1HHIA 2R69A 3R8QA 3FCUB 4MWFB 1IM9B 3VWJA 1BVLA 2AEWA 3QNFA 3P3YA 5HYEA 4GSDL 4UT7H 5JXED 2E7DA 3HKFA 2I24N 4LPCA 2KPWA 5EPMB 3V4LA 4IBUA 3MA7A 4YSRA 3FUIA 1KFAL 2ZOWA 1LD9B 5L8JB 5HY9B 4AV4A 1L7IL 1TJXA 1C5DA 2DV6A 1M53A 2VERA 1M2VB 1FVEB 1YNLH 4WFHD 4Z7QB 1U91B 1YDPB 5LNEA 1J0KA 4OUUB 4ZK8A 1BZQK 3EW3B 3MLYL 4YE4H 5JUEL 1MF2L 2EKSB 4UDTA 4KITB 2MHAA 1QR1A 4CMHB 4Z77B 3C6EA 2W88A 2DB8A 3HBPA 4PJHA 4X83A 3BZ4B 3MMEB 1EV2E 4I7ZC 3L3KA 2BW4A 2GAZB 2ZKYA 3WU1A 4XP4H 2WXGA 5DJDA 2ZUXA 5DUPL 3QPQC 5DC9B 3S97C 4E5XB 1LK3H 3SPVA 4S1QH 1IARB 4P2AA 3FUNA 4OZ4A 4BZ2H 1BOYA 4AQ1B 5AB1A 5LGYA 4XMKH 5DD0H 4QKXB 5F6HJ 2ZXDA 3BKMH 3WFDL 5CEZL 3MRKA 1Y07A 2A1WH 5D96B 3B43A 4PJAF 3RU8H 3S3PA 3V6BR 4JKNA 4BFFA 1S46A 1EXGA 1E4HA 2HJFA 2X41A 4Y4FD 5DJZB 2DMKA 1K8IB 4QMEA 1VESA 1KGWA 5J3HD 3UAJD 3VFUB 1XX9C 1R5VB 4G6KL 1ZT7B 3N0AA 3ROOA 1L5GB 3VG9C 5EFIA 1GR7A 1OANA 4MXVF 3BEWB 1ZKAA 4LKCB 3KXFB 3MX0A 5I5MA 5F89B 4PJFF 1SYVB 2Y7SA 4JFOA 5IOPA 1KTLA 4ZTOH 1KV3A 1NPNA 2VN5A 4QXVA 3ULVC 2XNAB 2A7BA 4WTQA 5IJVB 1KLUA 2FH6A 2QDVA 4X9HA 3PHQB 1NFDE 1OSPH 4MNGA 1FYTD 1YYCA 3AW5A 4P2OB 1ZHNB 3S0PA 1CURA 3RWDA 4JRXA 2PO6B 3FHEA 2ORBL 4WQOA 2ZX6A 1U3YA 1UA6H 3NPSC 2B0SH 3ZL2A 3F7YB 3U79A 3PWVA 1FAIL 1NEZB 1XH3B 2ZP9A 2BJML 3EJCA 2PCYA 3QIWA 4BM7A 1GTNA 2P8MB 3WJLA 1X9LA 5A2AA 2YZ8A 3G5WA 4PJCA 3IE4A 5FYJE 2FE0A 4UT6H 4AXWB 3NTCL 1CTOA 3DX7B 5CGYD 5AVTB 4IRJC 5IV2A 3RTQB 4NZRH 1N59B 4K3JH 5DRZA 4YS4A 4N2OA 4EIBA 1C5BL 3HVNA 5I1CL 2CPUA 4NNYA 4TF4A 5CAYB 5ID1B 1IBDA 3DECA 2N1KA 4DP6X 4WHTB 4HJ1A 3MBEA 2D7QA 1P7KB 1EAJA 3VD2A 4E41A 3GF8A 1G1YA 1NLBH 4P2YA 4UQEA 1CC3A 4OM0L 2CXGA 3QAZB 4ZS6D 4FTVB 4M8VA 5F7UA 5HPMB 5DJ8A 3DURA 4Z7OE 1I1RA 4KJWD 2HT3D 5I9QB 4HSQA 2W59A 2KLTA 1DBAH 2AI0L 2O72A 2IMMA 4XPAL 4MJID 1FAKT 5IMOB 5I8OL 3GBMH 2FLRT 3IXTA 2NY6C 1ORSA 5E94A 3JUYA 3UYPB 1U3HB 3ARVA 1XMEB 1LEKB 1PD1A 2XFXA 4DFIA 3D50A 3L5HA 2IPTL 3QISA 3WY1A 1KBKA 3D3VE 4G6JH 4I2XE 2B1OA 3O3UN 1YNTA 1VERA 3O2DH 4HPHA 1H6EA 4KZEH 4B3EA 1YLBB 1UD2A 4HJJL 4PJ6A 3QCUH 1M9SA 1MUJA 3LHPH 2BY0A 4C4BA 2XX0A 2WBJC 1TDQA 2A6IA 2WW8A 5FCSH 5G4NA 3UTZB 5AVXB 1KFGA 1CDGA 4KRLB 2Q6WA 4ZAKD 5E8OA 2XTJD 4NO2A 4WTZG 1J7VR 3ILPB 1SMAA 5C97A 3KCPB 3NYKA 4XHQA 3L95A 1NJ9B 2MQ0A 1ORQB 1XO8A 1XGRB 2WWNA 4G43B 2EIMB 2EEBA 4GW5A 2X4QA 1U6AL 4BDVA 3RGHA 3P3SA 1QRNA 1H3GA 5E95B 1UKQA 3C2SA 1CDJA 3KPQA 4PWGA 3WO3B 5CZXC 2X12A 5J6HB 1AS7A 4RIRB 3UJTH 1R75A 1JGIA 3FFCD 5JIMA 4QRPA 5IEKB 4U6XA 4E9TA 1ZHLA 2VSMB 3N91A 4AGQA 3LH9A 5FA4A 3V6OE 5AB9A 4Q56A 1N8ZB 5GGSB 2F5AL 3MLSH 1N6QL 1S9XB 3EJUA 2WZAA 4OLUH 1CE1H 3MC0A 3RWIA 1T0NA 2X05A 2Z6FA 4X0KA 3B7SA 2EYRA 2VMEA 2LTQB 2MCG1 5E1GA 1ZLVH 2HFEA 3M1CA 4F2FA 1IO4C 1DANU 1WHPA 4OCMC 4Q6KA 1FG2A 2XSKA 1DVFB 4XRCB 4LMQE 4XNXL 4K0OA 1GCYA 1NGPH 2WQAA 4M3KB 4FZEL 1Y18B 1DP0A 3LKQB 3GNML 3I75B 2J8HA 3NA9H 4HIEA 1UOLA 3KGSA 4OFIA 2HTKC 3O9WC 3UEQA 1T7VA 1FVDB 3BKYL 3AS3A 5B8CA 2AXFB 4G11A 1QACA 3LQZB 1CLYH 1SMOA 1P4LA 2ZJSH 4JHBA 3ZHNA 3DX9A 3KLQA 4XO5A 3U0TA 1MCFA 1RZ7L 1U8QA 1PAMA 4N0FA 2DOCA 3U30B 4PJ9B 4YXKH 5I76B 2HRLA 5DUJA 1SXCA 1UM4H 1Q0XH 3I9GH 5J0BA 5HDOA 4AJVA 3MRHB 2YA2A 4R7XA 5TGBA 5HGDA 4O5LH 1PD6A 5D2NE 4B7LA 2ZX9A 1EJFA 2XY2A 5MENA 3APMA 4Y5VB 4Y2DD 4E9YA 3II1A 1A7OH 3VFVB 4JKKA 3W5NA 1OE3A 1T83A 1LDSA 4PG9B 3OV6A 4FQJL 4X6DB 1AXSA 4WUUA 1BQHA 3FUJA 4C56D 1MCNA 4WI4A 4JM2B 4Q4EA 4L1TA 2HT2D 2HX9A 2OSYA 2UZIH 3EJRA 3BZFA 2PCFB 1KB5L 5GJSL 4IGBD 3LKSA 3EXLA 3F58L 3QUZB 3OAUH 2GTQA 2Z91A 1JI1A 2WAQA 3G6DL 5IFHL 4WO4D 1U2HA 2OMYA 4OT1H 1P7QD 4M4RB 5GGUA 2MSPA 2NXYD 3CZJA 4AGPA 3UBXA 4QO1B 3CFTA 5FW8A 2JKIS 3TBSA 5TF1L 1RUML 2QKIA 1PIGA 5GRJH 1ZGLA 2OQJB 3BKCH 3OSVA 2D3LA 1D5ZB 4LL4A 3X11B 2HTLC 4GP4B 5K9KA 4OD1H 4ZMVA 4NEHB 3HLAB 1ZD6A 4KKZA 5AVWB 4UZSA 3S96A 3BCFA 3E3QC 2OR8A 1WAAA 3SKNB 4ZUTB 5L8LB 1I7TB 4TPRH 5IHUH 1IRAY 2OXHA 1Q9WB 4P46B 2WSPA 2AJYL 1SDDB 4J28A 3IRPX 5MEOA 2W65A 4OCWL 4Y2NA 3FB8B 3CXFA 1IL1B 3LZQA 3WSQL 3BH9B 3LS5L 4ZNEE 4QHMA 1WCBA 1Z3GH 4ZW7A 1T3FB 4ODXB 5J56B 2GBUA 5DTFA 5T1KB 2OULB 3AY2A 1WWWX 4YBQC 1TZ8A 4G8FB 5EU5B 1GZQA 2NTSP 3PUUA 3QPQD 4BRJA 1ZT1B 4QXGL 3BP5A 3MRDB 3U6RA 5EEZA 1OP9A 1EGJH 2V7NB 4HHGA 1NFAA 1CFTB 3SDAA 3MOBL 5FKPA 1CXIA 5BZDB 4JFDA 5DS8A 1JYXA 4XCFL 3COOA 4HZLB 2QSCL 5EUOA 3QUKB 5E6SB 2FWSA 3KD4A 3Q7JA 1L9RA 1P6FA 5C2BH 3BT2L 2IADA 3F62A 4PJBF 3NRFA 5F3BA 1MLBA 3PP4L 4HPYL 1JGEA 3RKDC 4YL9A 1RIVH 3P9LB 4FTDA 4XX1G 2ZAIA 3WIAA 3E0GA 5EIIG 4BZ1L 3PQYB 4P2RA 5T5NG 4MB4A 5EZJB 1KEMH 3L1FA 2EVGA 1HT6A 1JGVL 5AG9A 1MWAA 5DJXA 1GC1L 4GAGL 3GJEB 3IU4L 4WV1B 3VXSA 3OLIA 3OPZL 5HHNA 4IIQB 1QUNB 2VSCA 3CSYB 4C55A 4D0CA 4EUPH 1TQBB 3VGFA 3EUDA 3HNSL 4RBPK 3BHBA 4G6ML 4PRPD 2NUPB 3VXPA 1UA3A 3M46A 3H3PL 3QRLA 4K8RL 1UEYA 1BZOA 3D39A 1BLNB 1FN4A 5EN2B 4JDEB 4APQD 5D1QA 3OWRA 3ZE0F 1YEHL 2RJMA 1YQVL 1CGSL 5DMGC 5DVNA 5DMIH 5EG6C 4QJ3B 3VH8G 4Y1AB 2NW2A 2GJ6E 3PNRB 2VLRD 1MNNA 1B4RA 5IP4A 4FLRA 5DA0B 1Y1DA 4G8AC 1IGTB 1U3NA 1UJ3B 3K0YA 5PAZA 3U4KA 4K5LA 3QA3A 1BD2A 2XV0A 4MRBA 4N2GA 5I1LA 1UUSA 2PWEA 3U46B 2X6UA 4IRJD 1MFAL 3QDMA 2J8UA 4YHMH 3Q6FB 3CZKA 3FONA 4OGQC 4PHXA 3G6AA 1ED3A 4J3OD 4OLYL 5AOZA 2X9WA 1YRKA 4KVCH 5D5MA 3GSRA 5ECJE 3PDOA 1NCDL 3FAXA 4YLBA 3WIFB 3Q2NA 3V7MA 5SWSD 4OB5L 3QYNA 5IIEB 4RISL 2GC4C 3OC5A 1H3UA 5F1IB 2GYSA 5JXAH 1DBKH 2ITCB 3CIQA 3CG8A 3EDDA 1T66C 4G7YH 4HBCH 2EDXA 1CLOH 3HJEA 2NY6D 4Y19B 1JI2A 1OIOA 2VN6A 2B9AA 2WK2A 3HHRB 1X5KA 3QDJB 2VKXA 4K7PH 4N5ED 4AQAA 3KPSA 5EUKB 3T8XA 5ACMA 2Q76B 1H5BA 4G9FD 3IDJB 1ANUA 1Z32X 4FCHA 3Q43A 2WXNA 4ZS7L 2GY7B 3A47A 2BS9A 1ID2A 4WNQB 5I6LA 3OKLA 2H1LM 3SBRA 1IGYB 1KXQA 4M6NH 2MCAA 3ECBB 4N1HB 3K2MC 3TURA 3PNWA 3C08H 4OIFA 4AYGA 4TVPD 4XBPB 3STBA 1KB5B 1JZ2A 1KV7A 5C0RH 3RVWC 5BV7L 3VWJC 4QNPE 3C87A 4XNUL 2CO2A 1RIUL 3GMPB 3BFWA 1M7IA 2DTML 1PGRB 3SGEI 5E4AA 4P3WA 2CHZA 1J9SA 3N1QC 5D7KD 3UBGA 2CE6A 3IPBA 2F2HA 3L1OH 2AEPH 4GG8B 4GT7A 2ZCHH 5TH2A 2JKNA 4XX5A 5DUML 1ZMYA 4TSAL 5FWQA 2MCPL 1NFIA 3UACA 3HG3A 3FAWA 4KRPC 3L4CA 2WXIA 4OFPA 2E4FA 1MH5B 2ZOLA 2CDGB 3N44B 3MV9A 1MW3A 4MQ7A 3BLKA 1OE1A 3SB3A 4CU6A 2X88A 4LHUD 1IBGL 4PJEA 3ARDA 5LAXB 1HI6B 1KTKE 2AJSL 1SVBA 2VDRB 4ONHA 5EO9B 3I9AA 5F7DA 2DH3A 3GM0A 1AZZC 1CFNA 3JZ7A 4P5TD 4QXUH 1HSBB 4Y1TA 1I82A 4HJTA 2XWTA 3SDDA 5ADOH 4FJ6A 1EX0A 2PF6A 3DC0A 2O6FA 1I1FB 4OQTA 4PJBA 1FZOA 5DURB 5C6WH 4KZDL 5IW6A 4U1IB 5FAAA 1UUNA 3MRIA 5PCYA 2EDKA 1UVQB 4LCWB 3B4NA 4DNLA 1DUZB 2DYPA 5C0FB 3OGCA 1EDHA 3RBGA 3ARFB 4MCZB 1BQUA 3WKYA 2UUDH 3X2QB 4R7NB 1AXTL 3NCBB 2H3KA 3DX1A 4GLRH 4QOKD 4YZWA 2W9EL 3RZWA 3ASWA 1G5GA 3ZR6A 1J5CA 2HKHL 2DBLL 4PRBB 3RJQB 4KRMB 3DMMC 5DS2A 2NLJB 4EKXA 3E8VA 4KNSA 4M7LH 4XHJC 1A7RH 3AITA 4HJGA 1P4UA 1QFHA 5LKNA 1T7WA 1G7MB 3FUHA 1Q4NX 4HH9A 4Y9BA 2VISB 3QDGA 3HE7D 1AGBA 4TUJA 5J1SC 1OSZB 3L3GB 2ENJA 1UWXK 3NSDA 3KJ6H 3QB7C 5I0VA 1LMKA 2DAVA 4GRLB 4NZFA 4FABH 1IGML 1QFUH 1NGWA 2EDTA 4OKVB 5HXMA 4JM4L 4PJ8A 3CDFA 5HHME 4YSDA 5L8KB 1RZJL 3SPHA 2ZX8A 1E4WL 5DQDL 3MLPA 4Z3EA 3QJOA 3K6SA 5B38B 2DQJH 4KROD 1A9BB 2YD6A 2HRPL 1K4CB 4UT9H 1U8PB 1LP9F 1PQZB 4R8WH 5D1ZD 4I3SH 4IBQA 1KJ2L 1MHCB 3HZYB 1Z6JT 2OJZH 5L0QC 1OF0A 2AJZA 3CQQA 3HEIB 4ODWB 3QUYD 1CYWA 5B4MC 5LBSL 2Y1VA 3NN8B 4HIIA 1NWOA 5JOEA 4G5ZL 3QIWC 8FABB 2BNQE 3WJLC 2NSXA 3BP7A 4GO6B 1TTCA 3TWCH 3ARED 4F7PA 4P5MB 3HE6A 5IBLD 4JVWA 1KDIA 4U7SA 4UAOC 1CDIA 3ZZLA 3L5XH 5IJKA 5J11C 1YN6B 2JJTA 5DFAA 3U4EA 1JGUL 4I18B 4OI9A 4NPYB 4PJIE 4ADJA 2WUCH 4UDUB 3LCYA 3MBEC 1W72A 3EG9A 3KVPA 1D5XB 4JFEB 3QS3A 4DTGL 1MCEA 1IGJA 5SWZD 2VGLM 4ZYKA 3H85A 3W9DA 2Q8BH 5E8DH 1T1WA 2DICA 1Z5LA 4Q9QL 1FFNB 4A6YH 1SY6H 1CDYA 4FYRA 2WO4A 4CUCA 4XNBA 3QYCA 4B6ZA 5CLWA 5K9OA 4DEPB 1EJ6A 3NSYA 4AUYA 1HL4A 1OHZA 2XG4A 4Z7UF 4F93B 3W0WE 5DLML 2WP3O 1XR8A 5KYUB 1EMTL 4IKJA 5EOQH 2HT4C 4M02A 5AW4B 4YBQD 4HBQA 5CBEA 2B1HH 5GGSY 1DQJA 2FCBA 1SF5A 1XEUA 3HZ3A 3X3GH 5BQDA 3L1EA 4YFEA 3WY4A 3D30A 1SHWA 1GGIH 1U4FA 2VSKB 3GRWA 3ML8A 5AW6B 1B6DA 2YR3A 1SDYA 2N3JA 3QQDA 1UXSB 2IH1B 2B1AH 3NSFA 3SQBA 4NZDA 4W70A 2V9UA 4P4KB 3WNOA 4F8LA 1CFSB 5KYYB 1DJSA 3OB0K 3A24A 5F7WC 1CJYA 4NWUL 3FMGL 1MFDL 3BIKA 2AXHA 1BJMA 1W0VA 3QFJB 4QJ5B 2DM3A 3HMXL 1N0XH 2YD5A 4YFLF 1C16A 4HIXH 2R23A 2QR0A 3PABB 4XAWH 1JF1B 4HWEH 5CN2A 3CX2A 3W5MA 6FABH 2MJWA 4PRIA 4YSQA 2ADGA 1QYGH 3BPOB 4NQDB 2VLKB 3LXUX 1SN2A 2C4FU 4D7BA 3TO4A 4A7SA 2IPKB 2OTWA 4MA8L 2W0LA 4GKSA 1MI5E 3SJVA 1ZDQA 5F21B 3ILEA 4XVUC 1I8MB 1MG2C 2UWEB 3BSZH 2HG0A 2F7QA 3RNKB 4FA8A 5J6GA 1WFNA 5DMGD 3NCEB 2N0KA 2F1BA 1T1YB 4Z0BL 2K7PA 1BMWA 2D0HA 2JIXD 1TPXB 3WNLA 4G8GE 4WI0B 5KZCD 1AOZA 5KVEL 2D9CA 5C0CB 3QXWA 3A6BL 5F72S 1EAQA 1BIIA 5K1JA 5FGSA 3I02B 1DSFL 2G2NA 4FI7A 1RJZB 4FQQB 4M56A 5CIPB 4UQDA 4NQEE 2YAHA 5L7XH 5DI8B 3X1BA 4XNMB 4H0LC 3KYAA 5CEYB 4Q52A 3U2JA 3CPLB 5B8CC 4FQPA 3WIHA 3OHXA 2FJGB 1ZS8B 1WGVA 5HHOD 2NXZC 5DFWH 3G5XB 5I5JA 1OAKL 1KIUA 3UL4A 4IBVA 1OTTC 5T1LB 4PJXE 1P84K 3V6ZA 1ZLWK 1N67A 5C0GB 1TKWA 2AAAA 4LEBA 4RDBA 4JY6A 5ISZA 3ERXA 1FFPA 2Q86B 1J11A 3F7RA 3RVTD 3VXNA 3IKCB 3CZEA 4HEME 1QFWI 4K7FB 3ROLB 4DAGL 3QWOB 4B0MM 2HPOA 3T8MA 1IFRA 4ZSOE 1T83C 3QHZH 3VA6A 3LN9A 4HGWA 2DQGH 43C9B 1A4KA 2ZTBA 4X6BB 2PR4L 4N5UA 5CCKL 5IVXA 2WTRA 1R24B 1OAXL 4X7EC 4M7LT 2ODIA 5C0JA 2H26B 3JV6B 3VYNA 2ARJA 3VO0A 1CG9A 2A77L 4GQ9H 3H7BA 2WGNB 4OY9A 4XXCA 3TYGH 4F80A 3E1F1 3O8XA 7PAZA 1KJ2B 1E3XA 1Z9MA 4I3RL 3UTTB 5KJ7E 2MMXA 5T3ZE 2OZ4H 1Q8MA 2P24A 4R6UA 1BEXA 3CDGA 2CG9X 2PLTA 1BYPA 4HQQH 5C86A 5G5DB 2QKIC 3QHFL 5HGBB 2WGXA 3IETA 2FEEI 1MRDL 3BZEA 4QY8A 5L2KE 4FQLL 1NANH 2VCOA 3CVCA 3S36H 5KBMA 5DQ9A 2DQDL 2GEEA 1XTMA 5DU7A 4HUMB 1P53A 2XKUA 3D2UA 3MCG1 2F7PA 1FQ9C 4NUMA 1A7BA 3EH5B 3TNMB 3UXFA 4UIKH 1UH2A 3KPPA 4OBRA 5DD1L 1Z9OA 1S4IA 2XPZA 4LIQH 5ILTH 4RFNB 1IJ9A 2Z65C 2YA0A 2P44B 2LU4A 2X6MA 2CSPA 3P4OA 5IQOA 4GXUM 4BFKA 2G60L 4J3WA 4X6CF 3RPIB 4PIBA 3ABMB 3TJHC 4F8TA 3RYMA 2Y9RT 2GW5A 4O2EA 5ENWA 3U4BL 2VLJB 4F15C 3IDNA 1BEYH 3MJ9A 2EVJA 1OKEA 4JO5A 2O5XL 3SDAC 3OAWA 4A2FA 4IDJL 5GGRB 1CFBA 1EJ8A 2JI2A 4URKA 3F01A 4GW1B 5I0YA 1UWYA 4ZXBB 4MJ6A 1SLWA 2LABA 2RA1A 1CU4H 2IWFA 1SFDA 1VENA 2BVUA 2YGQA 4Z7VA 5I30L 4E5XG 1BZ7B 5CLXA 3LXCA 5DVMA 4KHXH 5EBLA 5AB0A 3QZWA 2AW2A 5ACLA 2ED9A 3N42F 1J05A 4X4XA 3VSTA 5CP7B 1IZKA 1IAKB 4OTXL 1RSFA 2OW6A 2OYMA 1PLBA 3MNMA 3VRJB 1NOFA 3V0JA 1DJWA 2AP2A 4Y89A 5F9AC 2NY0B 3GSXB 3FB6A 4YNYB 3VYOA 1DQQA 3D4ZA 4AV0A 2V2TB 5D2LE 2ZUUA 3VWKA 1MAJA 5C3LD 2Z7ZA 1U8IA 3EYVB 1JBJA 3BVNB 2CJUH 3HJ0A 2BM3A 3IWUA 2XWJA 4KK9D 4IOIA 1CZ8L 2E9JA 2NY2D 4IEFA 4UILL 2LHAA 1NZRA 5LGKA 3HG1A 4JO2L 4PB9L 4U31A 2CNZA 2J88H 2IWKA 2HH0L 3FZUD 3K71B 1DQTA 1IBYA 3NIFB 1JRHH 5FIEA 3O3DB 4PV9A 5D1QC 2XN9A 3BJLA 1CGUA 1YMMD 3PJNA 1EAOA 4FI8A 3N43B 5FPIA 2MPVA 1J12A 4CNIA 3TEWA 1CVRA 3DSNB 3HNVH 3DIFA 5I73C 5B4MD 1KN2H 1NAKL 2YFOA 4HT1L 1U8MB 4BFIB 2HFFA 3RNQA 2RFXA 1JHTA 4TQPA 4BSVA 1R3KB 1RQ5A 3GMOB 5JOFB 2MTPA 2QADC 3HI1B 3QUML 5E1AA 3II2A 4QHPA 1UCTA 5EF2A 2IFFL 1MW0A 4CVZB 3ZDZF 7FABH 4RWHA 3V4PH 4FYTA 5EU3B 4ELDA 4RZKA 4Z5RA 2O6DA 1U8KA 5CR8A 3JQOB 2MH4A 3H9SB 4YDLB 4WF7A 4H25A 1I8KB 2V2XB 3KXFE 2VN4A 3AB0C 4QWWD 4NM8H 1A6WL 4XPFH 1S9KC 5I1EL 4NKDA 5JQ6H 3ZQWA 1HAUA 3GI8H 3TYFA 4TLTA 5DFTA 4V1DE 2ROXA 2ZP8A 1QRKA 2CXKA 3AG3B 4AKOA 3QEGH 3DX6B 1V5JA 4I48A 1HILB 4P9ML 3ASOB 2HT4D 3ILQD 1EZSA 3DDGA 3ZE2F 3NZUA 5AENA 2Y3AA 3EBGA 1RP8A 2WBWB 1JYVA 2LAAA 1BIHA 2N59A 3D25B 1K8DB 2E3VA 1H5BC 1YEGH 4XP1H 1AFVH 3TWYA 4WW1B 4PBXA 3Q8EA 3S88H 3A21A 1HDMB 2XWBA 2PCXA 4JHZA 3SE8L 3GMQA 5DT1L 1K6QH 2VDPH 3ULAB 4AC2A 1KCWA 2FO4B 3L3JA 3QSKB 2ZCKH 5MEQA 1PJ9A 1ZVSB 5AAMA 1NDMB 2G3MA 4I1RA 3HIZA 5GRUH 1RI8A 4TUOA 3P0GB 5DZJA 1EQWA 1YY9D 4MS8D 4H88L 2JJSA 3FSVA 32C2A 5LGHL 4XCEB 3WD5H 2VXTL 2C9AA 3L2NA 3SZ6A 2D3NA 4Z7WF 1XSOA 5T5FH 5FO8A 4FN0A 4X6CA 2V5MA 4AE1A 2XVKA 1V10A 4JMXA 1QFPA 4JFXA 1F41A 5DEGB 2YPVA 2K45A 4UTBA 4FTVE 4ANVA 4NYLA 4I77L 3IDIB 4YR6B 1CXFA 3ULUE 3T0EA 3ARDC 2X2JA 4FG6D 1NUGA 1QBLH 3W39B 4ZUWA 2NZ9D 3LKPB 4A2HA 1TJIL 1GAFH 3TBVB 5CMAA 3HS8A 3WIIL 1QAWA 1X5GA 5E6IA 4MZIA 4ZTPH 3SDDC 3QNZA 4WFFE 1XSJA 1JWUA 4FNLL 1RZFL 1PZ5B 1PAZA 3E8UL 3RQ3A 4R96B 4RSYA 2AMUA 2HX7A 2XWXA 4O4YH 5CBAA 8CGTA 5I16B 4WWKD 4F58L 5I1IH 4JPIB 1NIEA 3MRFB 4Q6IA 1ADQA 4Y4FB 2CCWA 5EU6A 3VD0A 5FGRA 1IBBA 3VSUA 3L9EA 1V8HA 2EUXA 1OT1A 3ETSA 5LG1A 1FI8C 1JZIA 3PU7A 1ZDSA 4L5FE 1BGXH 3K5SA 5F93C 1E4JA 2CRYA 5E8EB 1W15A 1DUYA 3HPJB 1HL9A 3B5HA 1OQXA 4K71B 5GIRA 4WKZA 3VXRA 1KYOJ 2NXZD 4HJ0C 1F58H 3I6KA 2B4CH 4HAFA 3SE9L 1OTTD 4FFVD 5DR5L 2ITEA 1JGLH 3EO1A 5C7XL 4U2YA 2RACA 5AVQB 1OGTB 1CDBA 2ERJC 1FYTB 3LNIA 3QNYB 1FNSL 1M71A 2DJ4A 4JJ5B 4U3SA 4LVOC 5HGAB 4PJ8C 5HDBB 3KYMB 4JLRB 4ZFGH 1ACZA 1XCXA 3R4RA 4F2MA 3KBHE 1I75A 1N3NA 3V55A 3JWDH 3NCJH 5T3ZH 5MEND 3GBLA 5HHQA 1WE5A 5BVPH 4MXQC 3VRIA 3GBEA 3OJVC 4QT5B 1VACA 3GXUB 1EBPA 4WUUD 4AIXA 4YVNA 2APVA 2RBLA 5AEAA 5FV2A 1B0RB 5AWNL 4DQAA 5J4MA 2R1YA 4QRSB 2B59A 4XH2A 2A9BA 4FFZL 3LMJH 4M48L 1QSED 5DYOB 3T0BA 5EEYA 1SN0A 4WI2A 1WEJL 1OAQH 3GSQB 5DD5H 5DEFA 1EO5A 3HE6C 4PGBA 4XVTL 5I1HH 2VXSL 1MCCA 1MZYA 3OMZA 4LQFH 5I8EA 4H8WC 5IJKC 1CF1A 3D18B 2JJTC 2FEDC 2PW1A 4L8DA 3W1ZA 4NENA 3CGTA 3VB8A 5CEZE 3I3EA 1PLCA 1UD6A 1GOGA 3HHSA 3QUMB 4HS8H 5IBUB 2VR8A 4MJIB 2OFQA 4PGDB 2QV4A 4B9FA 5KBDA 2XQYG 3TO2A 3S3DB 1SHMA 2V0AA 1IEBB 2VXQH 4XO8A 1KBGL 1XF5B 2C9RA 1MRCL 1S7SA 4PQXA 1JPSL 2HWZL 4PMFA 1GMIA 35C8H 5DRNA 4WEBL 3UJJH 2AEQL 1YN7B 4EJ1C 1NBYA 3TASA 1KT2A 3BVDB 3W11C 4JKPL 1U95A 4Z3HA 2CO6B 1FP5A 3V6FB 3WAKA 1KIQB 3O3AA 5I71C 2X3AA 4PW9A 1EZUA 2F58L 2FX9L 2BMKB 5FECA 2X0UA 2YHGA 4NZUH 4AYEC 3DV4B 1KZYA 1S7TB 4ZAKB 5F7LB 1MFCH 2XTJB 4JFDD 1FHNA 4HUCA 4U3HA 1AGFB 3WHXB 4XMTA 1EZLA 2CAKA 4Q2ZA 1S8DA 2HJKA 3DHJA 3NCCB 3OKEB 4Z7AA 1KCRL 3ZE1B 2MWCA 4W9JC 4LESA 2H4EA 1YPZB 3ULVL 1AZVA 4LU5L 2R29A 2PN5A 3LV3A 2EDFA 3FFCB 2VZOA 1CICA 1XGTB 5AZEL 4DN3L 1ZANL 3RJOA 1I7ZA 3BE1L 3NZHL 4U49A 4ZFOA 1KC5L 4AVIA 3QQ9D 2VABB 4JY4A 1EFQA 3CLEH 4Y7OC 3L48A 4RFEA 4XNQB 1RZKC 1I3VA 1QLEL 1RUKH 2F8VA 2XDHA 4XOBA 5A16B 5HPOA 3MRQB 1IGCL 1HE7A 3C5SA 2H32A 4JFPA 2YGPA 3IB4A 1RZQA 4NQVB 4OJCA 4RAUA 1S3KH 3JVGA 4TNFA 5D4JA 1ZPUA 1UM5L 3DDFA 4FP8L 3RB5A 5I8CB 1SYSB 5IQ7L 1OOAA 4OU3A 4A67A 4KPHL 4PYGA 4JS7A 3T3MF 3TO4C 1FFOA 3D39D 3MHZA 2E46A 2VAAB 3U0PB 3PG2A 4QPEA 2P42B 1ASQA 1EERB 4UIMB 5D1QD 4X7TB 3T6ZA 2VWEC 1R5IA 4D3CL 3HUJF 3L4XA 1D9KD 3LKNB 1TU2B 5ITFA 1I7UA 1WS8A 4FZ8H 4JGJA 4OF3A 4HEPG 4WWOA 1II4E 3OX8B 3V95A 1KTDB 4OW6A 3TS8A 4GUPA 2QJDA 3H3KA 5LVEA 2BERA 5I0ZA 4JZOB 5I17A 5H4ZA 3BUDA 3DOSB 1JWSA 4A63A 1BD2D 2QADD 1RPUA 4JFWA 2UX6A 1VJSA 4OF5A 1F6AA 4J8RA 5B39B 5JHLA 3ZZ1A 2ADJA 4U4IA 1YC8A 1BOGB 1YEKL 1CS6A 3LNDA 3OHXC 4IS6A 1P69B 4M62L 3BPNB 4G83A 3Q3GB 3L4VA 5IR1B 3VI3B 2E9IA 4B50A 4EDXA 3ECUA 4Y2DB 4U6VL 2A4EA 3BN3B 4HKBB 1J48A 5CJ5A 2DD8H 4M7JL 3KNBB 5JDJA 4NWTH 2E4TA 1A0QH 2HA1A 1C12B 1R17A 3HI6L 1HL8A 4MGXA 4C56B 3L9BA 1BF5A 3KL5A 3PLYA 4YXLL 2FHFA 4IGBB 3N06B 3MRPA 4GRMA 1ACYH 1FC1A 2X4TA 3D4CA 5FUOL 1DJXA 5HI3C 4NJ9H 4WO4B 2ZT9C 1IC4H 4XC1H 3NP3A 1P7QB 1QLRB 3KLAB 2NXYB 3FQWB 4Y1AE 3NDZE 1JZ8A 2HFTA 1S5HB 2OMVA 2F0CA 3GKWL 3LS4H 3PHOB 3K72B 3OKDB 3BGFB 4XXCC 3GINA 3O8XC 3H7LA 4RGOL 5F6IC 1M6OA 5ICZA 4JFHE 1R3IL 3QJQB 3EFDH 3EGXB 1RHHB 2JK5B 1PYWA 1QOKA 2VXUL 1A7PL 2IO5A 3F5WB 3H9HB 3ULUH 1K2DA 1W0WB 5DMYA 1OY3B 3GDCA 3BIAX 2FO1A 2WV3A 5GGRY 3LTVA 3JWOH 4BKTC 6PAZA 4OZHB 2YMOA 3FH5A 3FULA 2EILB 2G5BB 2WZPA 3HRZA 2DW5A 2DIJA 3VE0A 3QCVL 4PS8A 2F5BH 3RWCA 2ZSWB 1S7QB 1PFOA 3LY6A 1SJHA 4X7SL 4Y5YB 2X1WL 1LO2H 1O7SA 3RB7A 3L17A 3IGUA 3OKKB 1NCBH 1UZ8A 2A9MH 2X42A 3S98A 3PGDB 1MZZA 3QWNA 1CF8L 1Q0EA 3VB9A 3MBXL 3VX0A 4EQ3A 4Y19E 4LASH 3SDDD 2YKLL 3O11A 4U1GC 4HG4J 2V2WA 4JKLA 3L3IA 3WEXB 1NCAH 1NCCL 3QDJE 4GKNA 5FB8B 1L3WA 3EIFA 5D7IA 1JWMB 4FNQA 2VDKB 2OSLB 1IT9H 5KSVA 2XVBA 3LRLA 1MCRA 1DFBL 2UZXB 4N2FA 3BP6B 3MDJA 3WFCL 1HZHL 2WD0A 4GFXA 4GSDH 1FLRL 3CFQA 3U1SL 4S1DD 3QS2A 1IIIA 2P47B 5ALBL 1H8SA 2C9XA 5HYJD 2IAMA 2PCPB 3V0WL 1S9WA 1EEYB 3MRGB 5D7JA 2FBJH 3T3PB 2CRIA 4LCUB 2FQGA 1L7IH 4LSQL 2WLMA 4LKXA 3K6NA 1E7VA 3VSVA 1T2XA 4PRPB 3VM5A 3ZDXB 3MLYH 5JUEH 1MF2H 4GNKB 1Q9KA 4F91B 4XXDB 1BW8A 1UOWA 4MNQE 4YLQT 4OZIF 2QQKL 2ZXBA 3VXUB 4APQB 3FFDA 4LAQL 1MHHB 3FRPB 3VWKC 1TCRB 3JYCA 3S3BB 4RQQA 4PJ8D 1MEXL 4DGVL 2DWDB 3DBXB 3QQ4A 5DUPH 4TQIA 1QLEB 5GZND 5KVDE 1L6XA 2FLMA 5E00B 4PY8J 4NRYB 4Y16D 5FLUA 3NPSB 2CALA 1BXUA 2VLRB 2X2YA 1TQUA 3RHWF 5EZPA 4PTTB 1WBYB 3SPIA 1TZGL 3CH1B 1OP3K 4H40A 3X17A 4HU8A 4L0YA 1QPPA 1KYAA 1XR9A 3S5LB 5KSBF 5IG7A 1J8HD 2OMXB 3FCSB 1AKJD 5CEZH 3RWGA 1F3DJ 3DRTB 1MJJB 4FMFA 3QXAA 3MXWL 2ZX7A 4LCWE 4IRJB 3QJRB 2E5EA 1A9EB 4ZMAT 4EF3A 4GIAA 4PD4K 2JI3A 4LDCA 3U36B 3UIZA 4JRYA 3HR6A 1JSYA 4G6KH 3VXTA 2HMIC 3LSOB 3FTGB 2WXLA 1NPJA 5H37A 1N2RB 3WDHA 3BLPX 1A6TA 2L0DA 3MKKA 5HVGB 4UB0L 5SWSB 1A6UL 3P02A 4HSAC 1CT8B 2B5IB 2Y24A 3FXIC 1RY7B 2X2IA 1WCQA 4N9GA 2NZ1A 1RJYB 4EIUA 4N8PA 4HKJA 1HWWA 2NY6B 4QLRA 4HWBL 4JRLA 5DJCA 4NC1C 1OM3L 2C1PB 4F3FB 3WTSA 4W9ZA 1DQVA 1OTUC 1SOQA 3CSFA 5EB9A 3S35L 1DANT 3AS1A 4UOQA 1VRSA 1H6TA 2Y5TB 4I5BA 3SGJA 4Z3GA 4FFYL 4G9FB 1ILSA 1DTUA 5A2CA 1GVIA 2ZNXA 1IC7L 2FT8A 1OGPA 4JFTA 5JR1L 1DLHA 1NAMA 4QAWA 1FAIH 4FKHA 2DLIA 2UY7A 2BJMH 3O6FA 1KCLA 3B9KA 1MPAL 1PJWA 3WUWA 2EXSA 3MV8A 4JAMA 1KPRB 4M03A 1H0DB 1JPFB 4MA7L 3QC6X 5JORA 2E8YA 4JG9A 3NTCH 3AT8A 1W8OA 3UPRB 4I1PA 2E6JA 1E9OA 2WXMA 5BVJB 1C08B 1CXHA 3NFPB 2LOEA 1C5BH 5I1CH 1KEGH 3QGVA 1EEZA 4H26A 1F3JA 5AAMC 4POZD 3RUGF 3V5HA 1BREA 3MROB 1F6FB 3UDWA 3KBFA 1A1NB 3KLDA 3L08A 3V0GA 4OM0H 2JJSC 3PWPE 2O61B 4LHUB 1R46A 1ZVNA 5IB2A 5FEBA 2F74B 1TJGL 4XN1A 3W37A 4P5TB 2AI0H 4PS3A 4XPAH 4ZUVB 5I8OH 3C8KA 4YHPA 2WXRA 2WLIA 6CGTA 3IS1X 1Y6KR 4R4NC 2GJRA 2KH2B 3GMNA 2X4PA 3ARGD 3GIZL 5LG6A 3T0EC 2IPTH 1DJGA 1T6BX 3QC5X 4MCYB 3VXQB 3LEVL 4NQXA 5GS1B 4XNYL 3MLTA 4HU2A 5E6IC 3TO4D 1D7FA 4HJJH 5KVGL 4CGTA 4OD3L 4FXGB 3BO8A 3BWZA 3OZKA 4ZFFA 4DKFL 3BWAB 4QOKB 1TTFA 4PLKC 3MUZ1 3KEDA 4Q6IC 1TCMA 4P4RB 1A4BA 2X4RB 2PXYA 3KPTA 1HIMH 3BAEL 4ELME 5GRVL 5CS7A 1KJ3L 2I7OA 1FNGA 4LDEB 5CWSA 3QPKA 2PWDA 4WK0B 4B9GA 2Q7YA 2HLFD 5IKCB 3HE7B 1F5WA 4NKMA 1T5XA 1U6AH 2SODB 3DGGA 3MRRA 1XV8A 2ROYA 1KJMA 3TT3L 4KXDA 1FH2A 3DGDA 2G9HB 2CKBA 1WIUA 3QFJE 2NQDA 2KQNA 2F5AH 4F37F 5IT2L 4KROB 3HFML 1TJHH 1A21A 1HQRB 1CL7L 4XPBL 2AV1A 5D1ZB 2QELA 5FF6A 1Z66A 2F9BT 2FATH 2WHVA 4YIQA 3GBNL 4PSPA 5KSBA 2VLKE 2ZUQC 5CSZA 4I0PA 2XQBL 3QUYB 3OJDB 2WBXA 5EEVA 4OV5B 3U9UB 5CHNA 5SX4H 3QRGL 3MCKB 4KJYB 5D7EA 3WEOA 2UWEE 4RDQG 3AREB 1DBJL 3S3SA 4XNXH 2WINB 5L4IA 1R34A 3HBGA 1FZKB 3NGBB 1JHLL 1IFHL 3S35X 4FZEH 3U7WL 3RA7L 3GNMH 3LEXB 2TAAA 3GBDA 1O75A 4U1KA 3X13B 3FUMA 1TFPA 3WN6A 3T6VA 3KW7A 2CGRL 3BKYH 4NM4L 5C0CE 1HOCA 2ADFL 3AMLA 4WFED 4BKLA 4FXTA 1EANA 4BV1A 4JY5L 1RZ7H 4ACTA 4KK5D 5SWZB 3KPRA 4GSXA 2WC7A 4J3VA 3CHRA 3EYQC 3B2MA 3TBYA 4Q97A 4JFSA 1SM3L 3ZT5A 3FU5A 4TNGA 2C9VA 5FUZL 1YEEL 3L3DA 1BQHG 1CFMA 4GMTL 1O7DC 1QBML 1XCTB 5B1CA 3DJTA 3CFMA 1ZIBA 5AYQA 1V3MA 2JELL 1D6EA 2H1XA 5DDHB 2GUOA 2R0KL 3WEAA 4NLHA 3D85A 4QI3A 2SEBA 4UAHA 5DO2D 4N8VB 5E99L 3ZZSA 5KN5B 4FQJH 1EFXD 3OAZK 4G80B 2C1OA 1Q9LA 3NIGB 1BJ8A 3UYRL 2ED6A 3IJ7A 2QPEB 2GK2A 4N1CA 4N24A 2NX5A 1QZ1A 3ZYIA 4PLJC 1KB5H 5GJSH 3UEZA 3ZUCA 2X4OA 4AEHL 3F58H 4XBEL 2EYTA 2YEVB 5I8KL 3G6DH 5DC4B 3SQOL 5IFHH 3MGTB 3QR1A 1KBBA 1P5UA 3RUGA 2W95A 5TF1H 1RUMH 3QORD 1MIEL 2IC2A 2O5ZH 2DIBA 4MMZA 5HHVL 2ZKXA 2A9AA 3UTTE 2VQ1B 4MMXA 1XH1A 5IB3A 4YOKA 3NACL 3P4NA 1PKOA 4OZGA 4IW4C 3NT0A 5F88A 3DI2B 5INDA 3QUXA 4YBLC 5ETUA 3SDXB 1CICC 4ZPTA 4P3CL 2R2BA 3R0NA 4RMQA 2E6QA 1VFAA 4K5NA 1J9QA 4AQEB 3TZVD 2F08A 2AJYH 2BS8A 1V3LA 3PAUA 4OCWH 3WSQH 1INQA 3LS5H 1HCFX 1XCQB 1CUOA 3DV6B 3IMTA 5EEXA 3X14B 5HVHC 2X4SA 3JVGC 5IROA 3LZOA 3K1DA 3PXHA 3VWKD 4GPVA 4KK8D 2HB0A 4ZD3L 3IFNL 3GDBA 1GCFA 3ELAT 4QXGH 1OB1A 3R8BB 3FH7A 3UTOA 3F7PC 3MOBH 3HG1D 1LO4L 2JIXB 3MUJA 1WFTA 2PKDA 4XCFH 1BMZA 2OTUA 2QSCH 4DFHA 3DPBB 4M7KL 5KZCB 2WZ0A 3BT2H 2VLJE 1AANA 2LQRA 3PP4H 4ZQKB 3WAJA 1LQSR 3CN3A 4HPYH 4P23A 4UQCA 4WSJA 4AT6B 3PRZA 5D9SA 2YUVA 3EDKA 3O2VL 5KYNA 3K7UA 3QNXA 3EBAA 5LXGL 3HOGA 4BZ1H 1E5BA 3KS0H 1EEQA 5HHOB 2FX8L 2IOMA 1L4IA 4BRVA 3VNZA 3F83A 4WRLA 5BUAA 1JGVH 4HZAA 1GC1H 4GAGH 2UXFA 3IU4H 2GBAA 4AWJC 3I9PA 2IAND 1F4XL 1MCWM 2VR3A 4R4BB 4UTAA 3OPZH 3B6SB 3WY2A 3KMDA 2IXQB 3ZR5A 4LMQI 2GJJA 3K80A 4JQVA 4L05A 1UJTA 2ZYIA 4HMEA 4MAYA 1WAEA 3HNSH 1FV1B 4G6MH 3MR9A 4PJ5D 3LJ3A 3VGAB 4Y2OA 1U8HA 1X7TA 1S9VA 2ESVA 3MRMB 1AYRA 1IE5A 2EABA 2VT0A 4K8RH 5ABZA 3UO8B 4CSSA 1MQKL 3L5WB 3S2AA 4KQ0A 1OTUD 2BINA 2Y0SA 4LLYB 3OPUA 1G7JB 1YEHH 1YQVH 1AIFB 1E8WA 1SQ2N 1CGSH 5GGTH 1I85A 3ZMNA 3L7EA 5IK3B 5IQ9B 4OJFL 3G5YB 1AAJA 1O6SA 1O5DT 5JZ7D 2BWQA 2F53A 3P77B 4GLRI 4KGLA 3WV0A 1FSKC 4OFQA 3NIFE 3ZDYF 2GTWB 1WC7A 1U8JB 4NKOA 4QDGA 2C3GA 3FPXA 4MD5A 2DYSB 4HWNA 4GBXD 1KJVA 5E4EB 2PPEA 4CL7A 1DQDH 5B1AB 5TE4L 3H9YA 4X8XA 1Z7JA 4M1GL 2VTFA 3QUGA 3ES6A 3MRJA 3H9ZA 5D55A 1BVLB 1NFDF 3NCYP 5DS1A 4AH2A 3QI9D 1MFAH 1VF5C 1NC4A 2WLNA 5F0MB 4AM0Q 4LNRB 3NJKA 2Q2LA 4HP5A 3PREA 3VACA 4HJEA 3BD3A 4OLYH 4PVLA 2JQZA 2XICA 5GGQL 1LHZA 2JJWA 1NCDH 1N10A 3OJMB 1AP2B 1URZA 3FT9A 3MJ7B 2W8CA 3HRZC 3LHAA 4NZTL 5T1DL 3G5VA 1U92A 2MHAB 4UDTB 5SX5K 3U48A 4HUUB 4B60A 1OP4A 2D2CC 4ONFL 2IH3B 2J5WA 3H9SE 3O4LA 3CVDA 3OKNA 1PSKL 4RX4D 2P49B 5I0XA 4GW4A 1LWJA 3ARZA 1L6ZA 4HCFA 1FL5B 3T0ED 3SPVB 1A22B 3WMSA 5AALA 1E8ZA 2GSGA 1NOLA 5E6ID 2QGBA 1E4XL 4QRQB 5GS0C 1GJIA 4ZS7H 4FNRA 4LOVA 4R90L 5T3XD 4IKLA 1X5ZA 1H8OA 4N2HA 3MLZL 4X6FB 4ACPA 2H5UA 2WWMC 1BAFL 1VADB 4BUGA 5A2LH 2AITA 4X99B 5I1JL 5B3NA 5C3TA 5C92A 1UXMA 3HC4L 4U6YA 4M3JA 4E9QA 5FFGA 1T21A 4CADA 5BV7H 5CXPA 1RIUH 4G7QB 2VR7A 4NHUA 4S2SA 3TVMA 4F8PA 3KLHC 2EVFA 1N64L 3MUHL 1N4XL 3DTXA 3Q2VA 4KFMA 3KWWA 3QDHA 4HJIA 4LCVA 1JL8A 4XPGL 1LGVA 2VR4A 4KUCF 4Y7MA 5E1HB 1S7RB 2BSED 4LBEA 2IAMC 4ODVL 4RMRA 5HYSB 2MCPH 5IHZB 3FU7B 4M43L 1JV5B 5DUMH 4TSAH 1JTPA 4F92B 3L8QA 5D7JC 3HB3C 5TDPB 3SKOA 3VQMA 5L9DL 5B3JE 4LCIL 3VXRD 5L4MA 5K39B 1S5IL 3IJ8A 1IBGH 1NL0L 2A73A 2NY2B 3K2IA 4UQ2A 4GG6B 2AJSH 1E8YA 5KWYC 3NZ8A 2IDUA 1EXUA 4U6HA 2VR5A 3RWDB 4KZDH 1YMMB 4A7VA 3Q05A 3L6FA 3VI4B 5CN3A 3B2DC 3FN3A 4G82A 1M2OA 2FJFA 5CIPH 1JZFA 3MOAL 1CFQA 3QIUD 1KGCD 1T22B 2DWEB 3KZ8A 4XMLL 4RAVA 3QFDA 1FHGA 1VLXA 4JHWL 4KJPD 1AXTH 3GWJA 2W9EH 2HKHH 2DBLH 5F8RC 1NH6A 3I6GA 5CCJA 2AMGA 4YDJA 1AXIB 1WIPA 4NQTA 1M05A 1UQSB 5DRXB 2XIIA 3X3FL 3OC8A 3IDGA 4N1EA 4OIIL 1FRGL 4GI6A 1AQKL 1XGPA 3FQUB 1XDTT 4ZW8A 1WBZA 1UGNA 5DJ8B 1EGJA 4H8PA 2C4FT 3DURB 3US0A 1IGMH 4OZFA 2EIZA 2CCLA 4Z6AT 4JM4H 3FRUA 4IOFD 1L0PA 4KKBC 2HG5B 4KTGA 1RZJH 1E4WH 5DQDH 1U0QA 4MNHA 4NAJA 2L04A 3ZRFC 5C0DA 3RHWK 3GQFA 4H0IA 2E74C 2HRPH 5HDBE 3D69A 3N55A 5LNGA 3MNWB 3SGJC 1U8CA 1KJ2H 4G8EB 1DN0A 1TFHA 2V5YA 3L3OB 5C7ZA 3R0MA 2V5SA 1UT2A 1EWHA 1NFDA 4LPUA 5BRZE 2WYHA 3PWUB 4H7VA 1BBJB 5KSUA 5LBSH 5CGMA 4KO9A 3O6FC 4K15A 3CFUA 4U1HA 3B9KC 3E38A 5IGXL 4L1DA 3T1FB 2MNJB 1MWAL 2Q6WB 3TP4A 3ISRA 4YO0B 5E8OB 1ZSDA 4EUPA 5AAPA 1E3FA 1WHOA 4RNRA 4AL8L 2G2RA 3AXLA 2YBRA 1JGUH 2PPAA 1CPUA 4GW5B 2C4XA 3CFBA 3RWJB 4NQCD 1ADWA 3II3A 5CEXB 2K0RA 2FX7L 3N85L 4DTGH 3KE0A 3UDWC 4M6OL 2BVPA 4FLOA 3TT1L 4XE0A 3PL6D 1GZPB 5F1OB 3G6JE 2O5YL 2XJLA 3QXTA 4ERSL 1TVBB 4Q9QH 5FA4B 2CBOA 4C83B 2DYRB 3OXSB 4F7EB 2CJTA 4QRRD 4MJIE 1JCVA 5EBWA 2P45B 2B3IA 2VN7A 4G6AD 4LP8A 3RGBA 3RZCA 4JCWA 5DRWA 5DLMH 1EMTH 3P0YL 1T0NB 1A02N 4R3SB 1DYZA 5CSBA 4EMZA 3SPCA 3CDZB 5M94B 1NC2A 2WBKA 1X5IA 2O4EA 3EJPA 4WWKB 3U1QA 4PJAB 4D2NA 2XWZA 1B2WL 5DD6A 2XHNA 2BSSA 3HN5A 1X5XA 4M1CC 1LNUA 4PP2A 2BNRD 3HC0A 4GXFA 1OT2A 4WJ5B 3GIVA 1OCWL 3D3VA 4I2XA 3EYFB 4HIEB 1F4WL 3WTVA 4E42B 2XTJE 2JB6A 1G7LA 1OV8A 2PXYC 4PJFB 2F8IA 4YHIB 5B8CB 5J13C 3ESVF 1MJUL 4A7GF 2B16A 2NXZB 5J06A 2E59A 1AGCA 3GSNA 3ZE1E 3U0TB 1U8QB 3E2HB 3LD8B 4NWUH 4HIPA 3FMGH 1MFDH 3QK0A 2KS0A 3HMXH 4AM0B 2X3BA 1SUHA 4TLKA 5B7MA 3T6XA 3NRPA 3C5ZD 4FE9A 5HGDB 1AR2A 4L1HA 1L3NA 3FOMA 2AANA 2EO7A 2VDML 4BJLA 5HVWA 3MGOA 5MENB 2EDJA 1ZLUH 4PJDB 1TR7A 1CBVL 2IWGA 3PF2A 3FN9A 1ZGLP 1AXSB 3F04A 4WUUB 3V6OA 2CH8A 2QL1A 3E9TA 5C08D 4I0PC 4HUWA 3V52L 4H8VA 4GQRA 3NFSL 2X2UA 4Z0BH 4HUXB 1QSEB 5F3FA 5IQMA 1H15A 2Z91B 3GMLA 3ZKQD 2YPKA 2ZCZA 4DW2L 3ECVA 5GGUB 2FSEA 4YDIL 2VZSA 3A6BH 3KM2A 1U36A 1JPEA 2IMNA 5DD3L 4HWUA 3TBSB 4Z7NF 1C7TA 1F90H 5D71L 3ARTA 4W6XB 3NA4A 4FLHA 4KNQA 2NNFA 2X1PA 2JB5H 3EGDA 3RVUD 1X5YA 2X89A 4CN1A 3G3LA 1G94A 3STZA 4F20A 1VB9A 3P3RA 3FQYA 4PJ7F 2BCKA 1OAKH 2KBGA 3KPNB 5AVSB 3CFJA 4EQ2A 4ZOEA 5T5NF 2W0PA 4NO3A 5DQJA 4L1BA 4Q58C 3GO1L 2WIIA 2ZQKA 3EAKA 4UMSA 4UQ3B 2OXHB 2P5EE 3VG0L 5KVMC 5MEOB 4OQTL 2WZPD 4Z95H 3T8VA 4QHMB 1WCBB 2H0FA 5F9WC 4DAGH 1G4RA 3WE6A 4W9CC 3FT3B 3ZT6A 1ZK5A 4DPAX 3G5ZB 3LN4A 5EU4B 3FUFA 2Q8AL 1MCLA 3TN0B 1J8SA 5F1NA 5JIDA 1TEFA 1AACA 4UV4L 5D2NA 4J1UB 2PR4H 5FKPB 5HGHA 5CCKH 4JFDB 3T0WA 1JMZA 1AY1L 2VRQA 1UKTA 1I9JL 5E6RB 1OAXH 3LNEA 4HK0A 5EU7C 5HTSA 5IJBC 2BVTA 2A77H 5CCGE 1MLBB 1BLIA 4BBWA 5AW1B 4FQIL 1JGEB 1XB3A 2P43B 3DHPA 3JV0A 4HFUH 4HGKC 4I3RH 1SBBA 2WWMD 4U1MA 1BFTA 1WFUA 1GSMA 1OAYL 1P5UC 3WN5A 3PWNB 5GSRA 5TDOA 2DQFB 1PG7L 5AVRB 3QHFH 1WVZA 5EF1A 1MRDH 4MMZC 5DJ6B 3KLHD 1MWAB 1K85A 5DJXB 3CZLA 4MMXC 4FERA 5D7LD 3TF4A 3DX3A 3QJFB 3KYNA 2HRGA 4UT9A 2XN0A 2DQDH 2IAMD 3LXAA 4JO4L 5FC9A 5HHNB 3QUXC 3D7PA 3M1BA 5C0BD 2WXPA 4D0CB 1A2YA 4I13B 2EDMA 1R19A 2WYZA 3ZY7A 1E0OB 4OZHE 3ZRSA 2Y7QB 5DD1H 4N0UB 4JHAL 3BHBB