3X1GA

H294m mutant of copper-containing nitrite reductase from geobacillus thermodenitrificans showing two coordination geometries at the t2cu site
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
b'IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTMQFNHAQKGAVAMLKVTETG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite reductase
publication title Structural evidence of the flexibility of the CuM site
rcsb
source organism Geobacillus thermodenitrificans ng80-2
molecule tags Oxidoreductase
total genus 99
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1gA00
3FQ2A 2B3IA 2QDVA 2FQDA 4N8UA 1ET5A 4K9JA 3NSCA 3PPSA 3ABKB 3NT0A 3OMNB 4YVUA 2OV0A 2YQBA 3TU6A 3ZBMA 2AZAA 5B7FA 4NERA 1TEGA 5F7BA 4G7SB 1WS8A 2YAEA 1CYXA 2GSMB 2P80D 2TSBA 5ANHA 3S8GB 1BAWA 1DZ0A 1URIA 2R7EB 3GXUB 4CSPA 3L45A 1KDJA 1RCYA 1EHKB 4A2FA 1ET8A 1SJMA 2YAHA 1JZEA 3SQRA 3HEIB 4Q89A 2DY2A 1AANA 3FYIB 3QJRB 3OQRA 4HCGA 3GYRA 1JOIA 2BP8A 3IEAA 4E9TA 2GB2A 5B7MA 3X1BA 2H47C 1MDAA 4KNUA 4UF7C 2LLNA 2XV2A 1KCWA 2XV3A 4A66A 3FSAA 1ASOA 3FPXA 4DP5X 3AY2A 1M56B 1JXDA 5LDUA 2AFNA 1JVOA 3CDZB 4AKQA 3QQXA 2BW5A 1QNIA 1KCBA 2CBPA 4ENZA 1L9PA 1AAJA 1AOZA 4P5SA 1AG0A 4ZK8A 2BW4A 3JTBA 3SBPA 4DP2X 3RYMA 3DIVA 3NJKA 3BQVA 1A4AA 1PF3A 3PCYA 1CURA 3WIAA 2PPAA 1OV8A 1M57B 2Y1AA 3PXLA 1GS7A 3CZUB 1WA0X 3NSFA 2WSDA 2YARA 2DYRB 3KW8A 2CJ3A 4KO9A 1JZGA 2GI0A 2WO3B 1GR7A 2BZCA 2PCYA 1NTDA 2GBAA 2E86A 2UXTA 3NSDA 2DV6A 2R7EA 3EHBB 4GYBA 5B1JC 2HX7A 3AG4B 7PAZA 1E5ZA 1ASPA 3G5WA 2ZXWB 1JZIA 2IAAC 3DTUB 1PZAA 1PAZA 4DP7X 3NJNA 3NYKA 2VW7A 3EH3B 3FU7B 3T6ZA 3WI9A 4BWUA 1ZPUA 3H4FA 1XB3A 3OM3B 2B08A 1BQ5A 1JZFA 1L9QA 1R1CA 2IDSA 1OE3A 2EIJB 5IY5B 1NWPA 1NICA 5PCYA 2IDUA 3WKQA 3NJIA 4MFHA 1ZDQA 1AZNA 2MTAA 4GP5B 1CC3A 1NIAA 3ABLB 3UAAA 5B1BB 4DP0X 1E5YA 1ZV2A 1A65A 5AZUA 4A2GA 2HZHA 2YXVA 4HZ1A 5A7EA 3X1FA 3FPYA 3WKPA 1J9TA 2FT6A 5TK4A 4E9SA 2FQFA 3ERXA 3OD3A 3T9WA 5PAZA 5I28A 4HCFA 4F7KA 2EINB 1E65A 3X1GA 5I6MA 2Y69B 3UAEA 4YSEA 1NZRA 2A3TA 1AZRA 1OCRB 5I26A 2FQGA 2XXFA 3ASNB 2Q5BA 2FJSA 4G72B 3QPKA 4KO6A 4G7QB 4DPAX 4BXSV 1IBZA 1BXUA 5B3SB 1PNDA 2FNWA 4X4KA 3ZDWA 1ASQA 1ILSA 2QPEB 3FSVA 1KGYE 1NIDA 3NJHA 4AI7A 2YAOA 1AS7A 1E30A 3CVCA 5B1JA 1V54B 2GC7C 3AG3B 4DPBX 2UX7A 3CVBA 4RH4A 3N2JA 1AZUA 2W88A 3N55A 4KO7A 2EIKB 2XVBA 3C75A 5E9NA 1NINA 2PPFA 3UGEA 1E67A 3WG7B 7PCYA 2CAKA 3FS9A 1FA4A 1HAWA 4HHWA 1PLBA 2PPDA 4GY4A 4YL4A 2BZ7A 2YAPA 4BK5C 4DP1X 1PMYA 4NB7A 1PLAA 4AKPA 1AG6A 1YLBB 4GP8B 4BXVA 1N70A 2EIMB 1WAEA 2HX9A 4HALA 1L9RA 1ET7A 3EH4B 2XXGA 3ASOB 4Q8BA 4YSPA 2VSKB 4E9WA 2IWFA 3FT0A 5I5MA 4YSDA 3UABA 5F7AA 1X9RA 2BO0A 4KOCA 4E9XA 1JXFA 2PP9A 1A8ZA 4NAJA 5D4JA 4DP4X 3FU9A 3MX0B 1XB6A 4HAKA 1CUOA 3AG1B 1FFTB 4GXFA 2I7OA 1KDIA 1KBWA 3T6WA 4FAAB 1SF5A 1TU2A 2VMJA 5FC9A 4E9RA 6PCYA 2IDFA 4QKTA 4M3HA 4YSRA 2ZONA 1SDDB 3S3DB 1W6WA 8PAZA 1J9QA 4HIPA 9PCYA 1BYOA 1L9TA 5B1KA 4A2DA 4BWTA 2N0MA 1B3IA 2UXFA 3TASA 4N4YB 4F2FA 3CG8A 1AQ8A 2FT7A 5I5JA 5TK2A 3S3CB 2XLLA 2GC4C 2FWLB 1OOWA 3DKHA 4EF3A 2BP0B 2FTAA 2BHFA 3WNJA 1IC0A 2BWIA 2IWKA 2FQEA 2XWZA 4YSCA 2I85A 1NIBA 3BVDB 1AZCA 1GSKA 3FU8A 4GP4B 1GYCA 3ABGA 3CDZA 1OCCB 2H3XC 3ABMB 1V55B 3NP3A 1WA1X 4YSOA 2PCFA 1SF3A 1OCOB 5I6KA 3IN2A 4A67A 2DWSA 3MBWB 1JVLA 1A3ZA 1OE1A 1I53A 1JZJA 1RKRA 3AZUA 4BWWA 3TA4D 2H5UA 1W6LA 3T71A 1IKOP 2AVFA 2PPEA 5I6PA 1OF0A 2FT8A 2P80A 2PPCA 1ADWA 2VSMB 2PP7A 3NJMA 4KO5A 1NPJA 2AZUA 4YSAA 1ILUA 2XYBA 1SHWA 3QJQB 1MZZA 4DP8X 1SDDA 3JT2A 5I6NA 1BQKA 2UXVA 1HFUA 1QLEB 3D12B 1M9WA 2QPDB 1BXAA 1AZBA 1GS8A 1TKWA 5AKRA 4QLWA 3FYEB 3SBRA 4YSUA 3EF4A 3T6XA 4G71B 4AZUA 1GY2A 1SFDA 3X1EA 3FU7A 4DP9X 1AS8A 2IH8A 3NJLA 3OMAB 1BQRA 1AACA 2YXWA 2RACA 2BP0A 2DWTA 3H4HA 2GIMA 1L9SA 3IN0A 1A4CA 4A2HA 4FA7B 4L0PB 3OMIB 1GY1A 1OE2A 1XMEB 2X87A 3HB3B 3NSYA 3V9EA 3S3BB 1SNRA 4BDVB 1GW0A 3WNIA 2AANA 1RZPA 3EH5B 5EHFA 3QJUB 4AKOA 1T5KA 3NP4A 2YAFA 4W9ZA 5I6OA 4E9QA 1BYPA 1HAUA 2XX1A 3H56A 1CYWA 1X9UA 4JHVA 2WO2B 2I7SA 1PZBA 3T6VA 3PLYA 2JXMA 1KBVA 2HXAA 2HRGA 2J55A 1NIFA 2HLEB 4HHGA 3QJTB 3PAVA 2J57A 1RZQA 3U25A 2HX8A 1L9OA 2CALA 2YAQA 1MG3C 4DPCX 3NJGA 1J5DA 4DP6X 4YSQA 2EILB 4HCIA 1AS6A 1XB8A 3UACA 2UXGA 1A4BA 3CVDA 2XV0A 3X1NA 1NIEA 4A2EA 3KW7A 1PNCA 4YSTA 2QT6A 4P5RA 2J5WA 1ZDSA 2DYSB 2QDWA 2W8CA 1KV7A 4G7RB 6PAZA 2UX6A 2J56A 3FQ1A 3ZX1A 2IDQA 5D4HA 4WTQA 4KNSA 2OJ1A 2OCCB 1WA2X 4WKXA 1J9RA 2NRDA 2JFCA 2MRYA 2YAMA 1NPNA 2XX0A 3GDCA 4YVNA 3TBBA 1FWXA 2JKWA 4BDVA 3IBOA 1PLCA 3FQYA 3IE9A 3AG2B 1KYAA 4UANA 1GS6X 5B1AB 1VLXA 1ID2A 2ZOOA 4JKNA 1DYZA 4M4RB 1EZLA 1W8EA 2Q9OA 4E9YA 4F2EA 3UADA 2VW4A 1MG2C 3PAUA 4W1TA 3X2QB 1IBYA 2TSAA 3FSZA 1AR1B 4A68A 1BXVA 2XU9A 1ZIAA 3AW5A 5B7EA 2IWEA 2CCWA 2GHZA 1PY0A 4PCYA 1F56A 4PAZA 1NDTA 3NJJA 4YSSA 1TEFA 1JXGA 2VN3A 1J9SA 2BWDA 2VW6A 3S8FB 2BP8B 2X88A 1V10A 3FSWA 1OCZB 1BEXA 1WS7A 1JZHA 2VM3A 4KNTA 3SBQA 2HRHA 1J5CA 1PZCA 4UAHA 2PLTA 3ZIYA 3PAZA 4TXVB 1QHQA 2XUWA 1AIZA 4G70B 1MZYA 2CUAA 3NJFA 2VM4A 3QJVB 1SHXA 1ETJA 3V9CA 5D4IA 2IH9A 1SFHA 2IDTA 1JERA 1PCSA 2ZWNA 3QJSB 1ZIBA 4CSZA 1NWOA 1IUZA 5I5IA 5AFAA 4JHUA 1UATA 1N68A 5I6LA 2PP8A 3TBCA 4KOBA 4E9VA 4AX3A
chains in the Genus database with same CATH superfamily
3EZJB 1MFBH 5F9OH 2RD0A 4B60A 4X4YA 4OZGE 1A6AA 4NYLB 2HFFA 5L9DH 1U8JB 2NY4C 3X14B 2FJHA 4PCTA 5E0QA 5T5FL 5A2KH 1TEGA 1AJ7H 1ORQA 3MUGA 2GSMB 3O4OB 1C7SA 2XDHA 4UT7L 1ZT1B 3SDYH 2BDNH 5I1IH 4F80A 3MV8D 5CJQL 5SV3A 1WWWX 2YAHA 2ZKHH 3IU4H 5JPMC 1S5IL 2FWSA 3OVUB 4U1JA 3IDJA 1UA7A 1RV6X 2CR6A 2AABH 3WYRA 1B0RA 2F53D 2BHUA 5EBMA 4BBWA 1T1WB 4JK0D 3QRBA 3QIBA 4LSUH 1GA2A 3VXPB 5J11C 4JQIH 5SWSD 2DKMA 2JCCE 1AFVL 3K6SA 2C7FA 5DF0A 4HJ0C 2EEFA 4HC1H 5LBVA 4Z7AA 1OXYA 1KTKE 3OAZK 3QDGD 4G1EB 4RISH 2DYPA 4F15B 2WWKT 2AJZA 1S78C 4KDTA 3LS5H 5IMOB 2DQTH 4PJXA 1JVOA 3I9GL 4JB9H 3N43B 1KCBA 2AV7A 1H3UA 1RPQA 4X98B 4DP2X 3EGSB 4H26B 3AMLA 4IEFB 4Q2ZB 2NDGA 3KBHE 4NDMB 3FH7A 5EF3A 5IVXF 2JKIS 3L9BA 1F0LA 4FJ6A 2GTWB 4MRBA 4BHUA 2EH8H 2LTQC 1WA0X 2Y3NA 3K3QA 4ATTA 3KW8A 3FFCA 4NWUL 4LOUD 4XO4A 5CD5C 3QE5A 5E95B 3CIQA 4N8VA 4XCNB 3RZCA 4KRPB 4C57C 1SLUA 4LPVA 4OIBA 4S0SD 1XF3A 2ZX6A 4U0RC 3SE8H 4ZMTA 3BPLB 3ESVF 5G5DA 3ARXA 2E86A 2JB5H 1AQMA 2Z91A 4HVBA 1ZGLA 2APVA 1GAFH 3FKUS 3AG4B 3K5RA 1IIKA 1E5ZA 1Q0XL 3QXAB 3K4AA 5E8EA 1MPAL 3MRCB 2EC9T 3T4YB 5KVFL 1HOCB 2NXZD 4GQZA 1H3GA 4L3EE 2N56A 1U6AL 4KFMA 2BSED 5E2TH 2K70A 5F7HA 3ARFD 4R84A 2CKBA 1F8TL 3VFNB 3LNIA 4XX1G 1CGYA 2VLKA 4PUBL 1NMCC 3ROOB 4EI0A 3QS2A 4KKLD 4D0BA 2B08A 2X2JA 2JTDA 4XN9A 3QUZC 3EYSH 4HKJA 3WKQA 4OIFA 4M7JH 3BZFA 1AZNA 5KVDE 1C5BH 4HS3A 5GS0H 1AGDB 2C9UA 1MFCH 4G9FD 4PRHA 1KXQE 1O5PA 4PRDA 3LS4L 3PFUA 3RWIA 3AB0C 3L3JA 4H1LG 1J9TA 2FT6A 4JY5H 2VM9A 4B0MM 1MAML 4WFFE 5L2KE 3FCSB 1TZGH 3ESNA 4KI5E 4H8WH 3IMSA 4OCSL 2Z35A 4GIAA 1S7QA 1L3WA 2DZEA 3QI9D 3T2OA 1GTFA 4JJ5B 1D5IL 1W16A 1QO3A 3MCYA 5GISH 5KYXB 4WJG3 3EYFB 2N0KA 2CO1A 5HP5A 5DTFA 1OCRB 1T83C 1VFUA 1CU4H 1XL4A 4QHMB 4B3VA 2GJ6B 5AB2A 3UDWA 1XEUA 2X10A 3MRIB 3REVA 1FO0A 5D7LD 5E8PB 4S1DD 2YEZB 5HHQA 3H0TA 4MJIE 1RIHL 2FNWA 3F7LA 4PS3A 1TU2B 1SXAA 3UTTE 4M8UA 4OZGF 1UGNA 4Y5YB 2XRAH 4MXVF 2YAOA 3QHTC 2WVVA 3P9MA 2QBWA 5B1JA 3U0PB 1T3FA 2NPLX 1XCQB 2E4FA 1P69B 3B7RL 5C70A 1A6VL 1P4LA 3INUL 4XZUA 4P4RB 3LXBA 1IZKA 1TJIH 3CDCA 4RLDA 3TNNB 1IGFL 2YPLE 1S6NA 4K8RL 4ZQKA 3IJSB 1GHFL 1KLUA 2RIKA 3HPLA 5INCA 1NMAH 1WZ1H 3AS3A 5F6IB 2HA1A 2BZ7A 1D7DA 5EUOB 1J88A 1FL3B 1PMYA 5C08E 3W11D 1U8LA 3SQOL 4ODHL 1XR8B 1UB6A 2AKRB 2GSGA 4PRPB 3EGXB 5EIIA 4Z7WE 2OYKA 5IBUG 4JE0A 3HUJF 4FEIA 1IM9A 4N2LA 4RDBA 3QFJB 4OCXL 1WISA 2VAAA 2IADB 1OGSA 5EU6A 2I25N 3OAYK 4K8RC 1M9SA 3L3OA 4XMUA 3JV0A 5BRZA 5DUPL 1PIGA 1HHGA 4F5CE 4NENA 1X9LA 2QQKL 3Q5YA 1U93B 3WDJA 2BHYA 2CBMA 3ILPA 1KBPA 4Z7QE 4L37B 3NCBB 3NAAL 4NAMA 3GSQA 2A4CA 1M2OA 2XIDA 1RZJH 1KBWA 5KN5A 3T6WA 3VNZA 1RH8A 2H2SD 3I6LD 3EOAA 4Y1AD 1CE6B 3U4KA 2YRBA 3GM0A 2FO1A 2IDFA 3TH4T 2AJUH 1IEBA 2WWMC 3DHMA 3U4BL 3JWNC 3SDAA 3QEQD 3ARPA 5GGSA 2HMID 1E4WL 3FQUA 4LHUB 5I66B 1IBDA 3WJMB 1B4RA 1Z66A 1F5WA 3KGUA 2NNAB 1JNJA 2W80C 3T0EA 4OLYL 1OSYA 5B1KA 4G42A 4ZTEA 2WXLA 4I9WE 2EXWC 4M7KH 1MQKH 3MBED 5HGBB 1TPXB 1ZLEA 4MQSB 4WCYL 1FVEA 5HYIA 2EO7A 5JOFB 4H25A 1NAMH 2A2QT 2Z31D 5DJ8B 5LVEA 4P46C 3AS0A 3T8MA 1H6UA 4HG4J 3BIKB 3WEOA 4MTMA 4EF3A 3OKDA 4JUSA 2BHFA 3AAZA 5T3ZH 3LHPL 2BSTB 4U49A 3S4SB 3FOLB 2YPKA 3ZKQD 1NIBA 3OWEA 4JLRA 3VQMA 2WWOA 1R33A 4ZFFB 4IGBD 2HFEB 4NRXB 5CILL 3RURA 3QWOA 1QLFA 3V0EA 3MTXA 1EO8H 3MI6A 4Z7NB 1Q72L 3S5ZA 3MBWB 5TGBA 4GAJL 3S88L 3WUWB 2B9BA 4FQXD 4JFED 4AGOA 3FB5B 4Y4FD 3WENA 4KJQC 4Y5XB 4NKIL 3E38A 3S0PA 1CICA 4KHTL 5HYSA 4G8EB 1KT2B 3DSFH 2R56H 1A6PA 3B7TA 1PBYA 4KI5F 4U1NB 4Y4HB 4J39A 1A3LH 3ARDD 2PXYA 3B2MA 4M4PA 3VQLA 4N0UA 2WOYA 3K1KC 5IVZA 1MFDH 2FX9H 4QRFA 3RTQA 3DO7A 1AQKL 3OJDA 5DJCA 3HZKA 5CBEA 4DP8X 4AYBA 4KVCH 1EAJA 2CHDA 2IANA 4NI3A 2MQCA 2CO7B 5TDPA 3HMXH 1HN1A 1OD9A 2P5WE 1FSKB 3MQIA 5CFHA 1YYCA 3KPQA 4GMTH 4NM4L 3WHXB 1EERB 1MI5D 1TFHA 5TE6L 1G1YA 2Q76B 3SE3A 1OB0A 12E8H 4QTIH 2RACA 3H4HA 4HGWB 1B2WL 1CTNA 4PVMA 1DP0A 4U6HB 3ULUF 3P73B 3ZQWA 3GBLA 4AL8L 4G9DA 4DZBA 3TO4A 5DT1H 1E90A 4Y9CA 2YA1A 1KPRA 1MCHA 4HSAC 3DGCR 4PWIA 3A6BL 1FYTD 5AAWA 3TPUB 3VD1A 1AHKA 1T0NB 2ZAIA 3FF7A 1ZS8A 3JWDH 1RFDL 5J5EA 1TTGA 4GSDL 2GTZA 3T04D 2WQAA 4GUQA 2E46A 2QMJA 2EAEA 2R1WB 5LCVL 5L8KB 3DGDA 1ZHBA 1D9KB 3BP5A 1UJ3B 3MLWL 5E9DA 3LZQA 2NY0D 3DOIA 5KTEH 1C5CH 1KEGH 1MIMH 1HEZA 2VXUL 3GSXA 4ADJA 3QC5X 3S36L 4DZ8B 4Z7WF 5CLWA 4AL8C 4LSSL 1QP1A 1X7QB 4LGSB 3QJOA 5GS1C 4C56B 2XA8L 3BKYH 2XN9E 3MODH 3ES6A 4AEIL 4ZO7A 3VYPA 3B34A 1L9NA 4YSQA 5SWQA 3BKML 4J6IA 1XB8A 4P3WA 2UXGA 4F7MB 5IVNA 4L5FL 4YIQA 2NY3C 4Z7QF 4OKVB 4NHCH 4PWKA 1FFNB 1HZKA 3GSRB 4KDVA 2PCPB 3Q7JA 4PI2A 2XBDA 1R5VA 2BSBA 5FYKL 4RGMC 1NFDA 1PX3A 3ENEA 4L8SA 2WUBH 3EG9B 4P9ML 4OGAC 5HY9B 5KSUB 3VQ2C 2BIMA 3NZ8A 5KVEE 3O6LH 1Z5LB 5CWSA 5K1NA 1T21A 4CW1A 3BSZA 1RULL 2WO4A 4M9PA 4XVSL 4JRXA 4Y5VB 2MRYA 4FABL 4RRPA 4UQIM 4IDJH 3B37A 2DQFB 1G1OA 3R0NA 2JKWA 1OGAE 3AXIA 4XMKL 2XG5A 1MCBA 4WQOA 2FZ3A 4QRAA 5HDWA 3KPRD 3VXMD 4XN7A 2XTJC 4CC1A 2V17H 1KYAA 4R3SA 3BUQA 4F93B 5I15H 2A73A 3MRQB 1WC7B 4ODWA 3MACH 2VLRB 2E75C 4RVBA 3M45A 5IKCA 5SWZB 3D34A 1TQTA 4MJ2A 1NGYB 4F1SA 1RZFH 1ZHKA 4U3XA 2R0KH 1ZANL 3DO4A 4KTDH 2V5TA 5FM8A 2VWEC 1QRKA 2FUTA 3MRNA 3LB6C 5EDXA 5DLML 3WKYA 2W0LA 4TPRH 5GGTA 1A3QA 3D0VB 1FNLA 5DQDL 2CCWA 5J1AA 3N1GC 5L8JB 1FFRA 1UASA 1CXHA 2X53A 4IIQB 2ZJSH 3DNKA 1FUNA 2QR0B 2D9QB 4UM8B 3II1A 2VN3A 2MWCA 1J9SA 2LAGB 5E4EB 2X88A 2XWDA 1X5LA 4E41B 1BEXA 2X0WA 3KYKH 5MEQB 1WS7A 2BPBA 3L3HB 3PXHA 1FFQA 2XBTA 3UERA 2ESVE 2VE6A 1SN0A 5FA3A 1VPOL 2G4EA 2Q1EA 4TXVB 2EIEA 3QORB 3V6BR 4NNXA 3LEXB 1DZBA 1FHNA 1AGCB 1R24B 3NJFA 3OKLA 4R4ND 5E5MA 2E27L 1JDAA 5GXBB 4MAZA 1EPFA 2L7EA 2Y5EA 1S9VA 2NY6B 4FL4C 1UATA 2P48B 4K9EH 4Z3IA 3SGEI 4RESB 1WFJA 2ITCA 3OJVC 2F5BL 5KSAA 3UPRB 4FNPA 5H37H 4XC1H 2YMXL 3SDCC 7TAAA 4AZ8A 3TWCL 1DVFA 1YMHB 4Z18A 1ZK5A 4HIJB 5AOZA 4ATWA 3WEBA 1FIGL 2VJ0A 4ZW3A 3T4AC 3BEWB 4JFYB 3ARTA 4PJ9C 3BRGC 2YAEA 5AWNL 5DFVC 1R0AH 4J3TA 3US1A 2PMZA 4FFZL 4IOIB 4L05A 4W9LC 5FEBA 3EO9L 2ED8A 3C6LC 3FTVA 4O2EB 1GL4B 3OLGA 4ODTH 4TSBH 3HG3A 3S37H 2X1PA 5AB9A 5AALA 3MLXL 1K5NA 4UTAH 3C87A 5J9PB 1LWRA 2XQ0A 5ESAA 1V3JA 2X3BA 3G5ZA 1G7QB 1QYGH 3FYIB 4IRSD 4Z3FA 4D7PA 3VDBA 3OPUA 3ZZQA 4M8QA 1YJDL 3IEAA 3OWRA 2D9CA 1I75A 2GB2A 3V8CA 2PR9A 4KNUA 3BRFA 1MHHA 3IF1A 1EV2E 5KVDH 4LEOB 5D6CB 5FYLL 1L7IL 3K5SA 4K5PA 3VI3E 4BZ2A 1T2QL 4IRJB 2ICWI 4RBPH 4JHBA 1XGRB 4AKQA 1QNIA 3HFFA 4B41A 1HNFA 4ZK8A 3VB9A 1D7CA 3Q8FA 2BW4A 2P28B 1E4HA 1FVDB 3FRPG 4BSWB 4NN5C 1YJDC 1RIUL 4IIZA 1UM5H 3BQUB 3MLUL 5IW3A 2VL4A 4TYUA 2MOGA 3EYOA 5DEZA 4XMTA 5FYKE 1INQA 3F01A 1FBIH 4NKMB 2Z64C 2B77A 2WSDA 2CJ3A 1K72A 3K4ZA 1Q9KB 2BH0A 5ESQB 5KUMA 2WNWA 4AQ8A 2PCYA 2I9TA 5FX3A 2CHWA 3MJ8A 2VDNB 1F1DA 3G6JF 4MYPA 1HE7A 4G8AC 3HS8A 3U6RB 1TZIA 3RL1A 5DEGA 4ZMWA 3OAUL 1EXUB 1YHPA 2AQ1A 4WK4B 3HAEB 4PLJC 4PRIA 5JOPE 4OLVH 1S9WB 1KTLB 2B4CL 4RQQA 2VABA 3QEHA 3UBXB 3A4AA 5AENA 3QG6A 5F44A 4I3GA 5CJOL 1IGIL 3F7RA 5F7WC 3LNGA 4D9RD 4MAYD 4LSRL 5T5FH 1KPUA 2F54E 2WQWA 3BT2L 4POZC 1ZXQA 4AEEA 5IW1B 1L9QA 5D1QB 2HSIA 4YPGB 2ZXDA 5MENA 3WIFB 4Z78A 2NW2B 4YDKL 3E8UL 3QORC 3UAAA 1S4IA 5B1BB 3VFRB 5CJQH 1NCGA 5I1GL 2QLVB 1JZ6A 3CH1A 4LCUB 1S5IH 2B4CC 4JRLA 4R97C 1DQDL 3G6DH 3D39D 3BN9C 4YHNB 1R3IH 5FKAB 5AKVA 4LGRB 3NIGB 2VISA 1KIPA 1PZSA 5F7KC 1AFVH 1GW6A 3QNYA 1E9PA 2I32A 4PB9H 5L2JA 1EAPB 4JM2D 4CSSA 2VXQA 3H9HB 4XPFL 1HYRC 1NZRA 2G60L 3I9GH 1WDAA 5DRXA 2YFOA 2CIKA 3BMWA 3S98A 4OV5A 3ZQ9A 4PJGE 2OXGB 3FN0L 3ZTJG 4WI2A 4EQ2A 1BJ1H 4HSQA 2EE0A 1XGQB 5JNYB 4H1LA 3GMQB 4M6NL 3G5XA 4NSKB 4F20A 1F45A 4F8NA 5ECGA 4ZAKB 1NDGB 3V4PL 3CXDL 1FH5L 2W94A 3BUYB 4H7VA 3PJSB 1A47A 4J4PD 2DQUL 5HGHA 3ZL4L 3GXMA 5GZNC 5KZCD 4PQXA 4L9LC 3KH3A 4JDEB 1NINA 1SRDA 1IBGL 5DC2A 1UXWA 5D1ZI 1MY5A 1MPAH 1FYHB 5LBSL 1DUZA 1M6OB 5KVFH 1EEYB 3QPQC 1U6AH 5EC1A 1G1CA 4PIRF 4EN3A 2F7RA 2IJ0C 1F8TH 5E6YA 5C0JB 1UGKA 4PUBH 5ISZA 5IFJB 1A2YB 1P6AB 4X5XB 2VZOA 3DJSA 4QRUA 3TM6A 2P45B 3DUUA 3X3GL 1RHFA 3ZHLA 1EHXA 1ACZA 4OI8A 1K5WA 5I5MA 2XPYA 1F4XH 4KH2A 3ZT7A 3LS4H 2PP9A 4X9BA 3V4VB 4I0PA 4K7FA 4I48A 4ZFZB 1DO6A 3E6HA 4HXBH 5DR5L 5LJYH 3HPJB 3B9KD 1A5FL 1CB4A 2JQAA 5JW5B 5AL0A 3GMOA 5E6ID 3GO1L 1MAMH 2HLFD 2X44D 4QT5B 4N1EA 3RA7L 2VC2L 4PBDA 1TVBA 1FZOB 1PY4A 2WYZA 4O2FB 4OCSH 5C0IA 4NQVB 1MCSA 1JCVA 1Q38A 1TG8A 1D5IH 3LN4B 3MR9A 2VDKL 3S3DB 3R1GL 1TLKA 1IT9H 5BOJA 2DLTA 4NQCA 3WNLA 4ZMOA 5AL8A 4LPXA 4LSTL 4X5WA 3L9RA 4MDJA 3DI3B 5IBLD 4XGZA 3FCTB 3OF6A 4GRLA 4FQHA 3V5HA 1RIHH 5IMLB 1N59B 4YEFA 2X6BA 1NBQA 4BUHA 1MCJA 3RWDA 1XAUA 1BVNP 3GMPB 2OS7A 2BP0B 3KLSA 4BFIB 4LL4A 1M7IB 1A21A 2X70B 3WO4C 1JL8A 1AZCA 4PWHA 3WN5C 3HE6C 1BIIA 1GMEA 3DX3A 1A6VH 3X12B 1CE1L 5ALCL 1KV3A 4PD4K 4N1HB 1UD8A 5KG9B 2KMWA 1IGFH 4K8RH 2Q6WA 4BQCA 1N0LA 1GHFH 4PJAB 4YC2B 5DZLA 2F7QA 3QIBC 5FM4A 4C4KO 4IKKA 2IOOA 4YNYB 2Y7QA 3OXSB 3RDTD 4BWWA 5I1JL 1HHIA 3R4DA 1EQWA 4WKZA 3Q13A 3SQOH 1S9KC 4ODHH 4ZMZA 2OMZB 3B2XA 3DI2B 5I23A 1IAKA 2P80A 3NA4A 2AQPA 4JM4H 4HX1A 2CJUL 4V2BA 5DK0B 4NO0D 4FG4A 2JI1A 3DPBA 2GJJA 3JTSA 4OCXH 4R4FL 3LZFL 1ZA3A 3JWNH 1TTUA 4PB0L 5G55A 1HSAB 3HZMA 5IWLC 5DUPH 5HI5D 3TV3H 3DVNB 3UTSE 1QLEB 1PS3A 4HUCA 4HK3N 2KI6A 4PJGF 4WNQB 4UV7L 1AD9B 1GS8A 1TKWA 2WQXA 3NAAH 1HINL 2CKBL 2EP6A 4F8OA 2OYMA 3O6FD 4H2AA 1P1VA 2WBJD 3O3DA 3X1EA 4BSVA 5KVEH 1U8OA 4KJYB 4XXDA 3SGDI 5AG9A 4NRYB 5IB3A 2LE9A 5C0FB 4MKMA 1OANA 1FNFA 4TLTA 2YXFA 3U4BH 4X4ZA 1NGZA 43CAA 2XKSA 4L0PB 3PREA 1E4XI 1GY1A 1VEOA 2CQVA 1MAKA 1XMEB 5C0BA 4AYMC 5DRWA 3TXAA 4EI5A 4ABWA 1H15A 1SNRA 3GWJA 4BDVB 5JORA 3KYMB 2DIEA 2DLFL 1NCNA 5A1AA 4WCYH 1J48A 1WTGT 4AKOA 3WLWC 3RUGF 5EU5A 3W81A 5HD8D 3W38A 4H20L 4HEMA 5JUEH 1SXBA 3F7YB 4JDVB 4R7VA 1BYPA 5E23A 5I6OA 3LHAA 1RJLA 4E42B 1NAMB 3AUVA 1GGTA 1W8OA 3HLAB 4IOFD 3LHPH 1KJ2B 1YDPA 4TUKH 2HVKB 2R9HD 2EXSA 2J55A 2OPCA 4UDTB 1ZGLM 2IBZX 4RMWA 5CILH 1ETB1 3FONA 2Q10A 4FHBD 3PP3K 4HJTA 4K2UL 1KFGA 1U33A 1J5DA 4EMZA 1RK0B 1UOKA 1FO0L 1R3JB 2FBRA 3VI4F 4GAJH 1AO7A 3S88H 2P5ED 2ZT9C 3BN3B 3X1NA 1C16A 3KW7A 5LKNA 3A4EA 4NKIH 2ZKWA 1TF4A 1HILA 3KXFB 4KHTH 4Q6IA 1MCWW 3KD4A 5DUJA 5BVJA 1OPGL 4QRRA 1CLOL 3NUKA 2ITEA 1YMMB 2D4FA 5C9JA 1NC4D 3ZX1A 3BZ5A 4BEIA 5IFAL 2EECA 3PV6B 4R7NA 2H4EA 4UU9B 1HQRA 3D3VD 3MFGB 4ZT1A 2OCCB 2XHNA 4EDWL 2FCBA 1AQKH 2GIYA 4CU6A 1J9RA 1M1XA 1UT2A 1UT1A 1QUNB 2V6HA 5I73C 5E94B 4K15A 3LDBC 1U3HB 4ICWA 4I89A 4BUQA 5D5MA 4MJ5B 4FERA 2FVNA 3AY4A 3C5JB 1AKJA 1FPTL 4NM4H 4LPTA 3RNQA 4N0CD 2PUQT 4NFCA 4WFGD 4W81A 5IVXB 3TN0A 5DHYB 5AVRB 5CSBA 2AJVL 3QDME 2C8NA 1XSOA 4EKXA 5IQLA 4AL8H 2O72A 3FSZA 4YHKH 3GZOA 5IMMA 4RA3A 3F84A 4PJXE 3A6BH 4PY8I 2WIMA 4RFOL 3UAJD 3O11B 1W0WB 1T1XB 1KN4L 2AJYL 3GEWB 4GSDH 5AW6B 5J57B 3BZ4B 1HZLA 2IALA 2VR3A 3FQRA 1F2XK 3MLWH 4JFFB 4XNMA 2E74C 5GPRA 2OCJA 3C9NB 5D1XB 5BZDA 5F6HJ 2DLHA 5DVMA 3CFBB 3CFCL 3S36H 1Z32X 4QUOA 4ACPA 4LSSH 1YEGL 3FFCE 3HI5H 2FGWL 4L23A 3VXNB 2XA8H 4U1LA 3L3OC 4PJ8D 1VZGA 3CUPA 5JHDD 4XNUH 2XA3A 3QDJB 1ZT7A 2CUAA 3W0WA 4CAGA 4AEIH 3LSOA 2G5BA 3KCWA 4TVUA 3I74A 3BKMH 4JO3L 1KENH 2CGRH 3CSGA 4JNXA 3FT1A 4PPTA 4WU7B 5GRJL 5I6LA 4E9VA 4KOBA 4MWFB 1TZ8A 3LKNA 3QG7H 4NQDD 5FYKH 4KROB 1MRDL 1S9XA 2QDVA 1NM9A 2VLJD 3T65B 4HK0A 5FOJA 1VB9A 4YBQD 1G7IB 2VLKE 4GFTB 1YUHA 4OGZA 3L8QA 3O8XB 1EFXA 2AZAA 2AJSL 5E51A 2V3DA 4NERA 4DFHA 4UTBL 4WHYH 4B7IA 3FTYA 1IAIM 1RULH 4XVSH 2XWTB 2RQ8A 3EDFA 4FP8H 4PRHE 3D87B 4HUUB 1GGBH 1C12B 2W60B 4XMKH 2VJ8A 3H6JA 3OLIA 5CMAA 4P2OC 1HDMA 3WE6B 5ACLA 1YG9A 5J3HD 2NUPB 4TLUA 3IU3B 2FJGA 3SE9L 1TQUA 4OZGB 3TZVD 3RTLA 1KIRA 4MMXB 5CEXB 2OSXA 3DUHA 2DWEA 4XI5D 4PLKD 4YHIA 5AEAA 1JUFB 4JMNA 1E6JL 1A1OB 3SJVD 1RZ8A 4Y7MA 5DLMH 5E00B 3QISA 1RUPL 3AY2A 1BD2D 5DQDH 4ZXBB 4ODUB 1CICC 1EZVY 3QQXA 1AOZA 1KZQA 4RETB 3WO3B 4F9PC 3FB7A 4XO5A 3L6FA 5EOCJ 3K2KA 1N9PA 2FX7H 3QHZL 5G4MA 3NJKA 1U3HC 2VN4A 2R1XA 3CDFA 5B39B 4X7TA 3RTQC 3WIAA 1DQJA 3UEZA 2JCCB 1BOGB 4EVNB 3NSFA 3PV7A 5JW3L 2XKNA 5GSVA 5BUGA 5DMGC 3HUJB 3BP4B 1FGNL 3NCJL 3B5GA 5J56B 2E27H 3RI5F 3P2TA 5HHXL 2A83B 1H6FA 2GBAA 2R51A 3HJ0A 1T5WB 3L4CA 3BGFC 3PHSA 1WFUA 4RDQF 3VRJA 2R7EA 2RTTA 4IMLA 1LO4L 2HX7A 1AOHA 3CXHJ 2V7NA 3D18B 2ZXWB 1EEZB 1HT6A 4ZX6A 2F5BH 3G6AA 4JFOA 2YMXH 4A6YA 2XFXA 3TWCH 2NY1D 5E8OB 1QI4A 4PP1D 1DEEB 1E8WA 1FIGH 1R34A 2FWUA 4MSWA 2VUOA 2VDLL 3TVMD 1T22B 4D0DA 1I1FA 3AACA 2A38A 1MHEB 1OQXA 2DIBA 4NUGL 2FHBA 2BC4A 2WTRA 5F7MC 5E08L 2FATL 1JZFA 1P5UA 3MUHL 1NWPA 4PJXF 4R0LA 4O00A 2IC2A 5EU6E 3OSKA 4TTDD 5BRZE 4XCYB 5KVGL 2VITA 2G3XA 5DEFA 2DKUA 1DJIA 5HHMD 1WD9A 3F85A 4GS7B 3MRKB 4JG9A 2WXFA 2L7QA 5I17A 1CFMA 4J6RH 4HJEA 1IE5A 4P49A 1B0GB 1KACB 2I07B 3GKWL 3VMPA 4JO2H 1Q8MA 1A4JA 2XNAA 4KK6D 4MD5B 4OLWL 1BIHA 1EEQA 2O1AA 5IJVA 2WLLB 5EN2B 2A9DA 2ZCHH 3UIYA 3RIKA 1L7IH 1IVTA 2ZOKA 4K3GA 3ZYIA 1AXSA 3KVDD 4LVOB 4ODXB 4ZW8A 3U2SB 2GEQA 1T2QH 2EDFA 4YDVA 3T0EE 2FRGP 4NJ9L 3L7EB 2F19L 4G6AC 3U48A 1AZRA 1WHPA 4FULA 4YX2H 4Z7OE 1AP2B 1VFAA 4F7TA 4GG8A 4UZGA 1A7OH 7CGTA 2YJQA 3CZJA 3MXWH 4PJHA 2ROXA 3N50A 5F3FA 3CLEH 3PGFL 1E27B 1SYVA 4U7SA 2YFNA 3S37X 2CM5A 3DHJA 4LCCA 3IDIA 5TDNB 4KXZI 2RFXA 1G0DA 5JHLL 1XSJA 4L18A 5C0CD 1IGJB 4Y8AA 1OWWA 1F4WL 4ZUUA 4P9HL 2UX7A 2ZYRA 2FR4A 4WO4D 2PWGA 3GB7B 4OW6A 3QIUA 4H8VA 4PRAA 1ND0B 1QBAA 4QYAA 1PG7L 1LE9B 5I1HL 1DVQA 3OAUH 3I6SA 2QTVA 4PJBA 4WWKA 1FGVL 3VXUD 4P2YA 1H3WM 2B4CH 3VSTA 4GY4A 3U7YL 4MJIB 5AVTB 1QOKA 1U8MB 2XQYA 3GZQA 4Q9RH 3LQZA 3UTTB 1VZHA 2CBTA 3BUTA 5CJOH 1UCTA 4NUJB 1IGIH 2ATKB 2OBGA 1NC2A 1N70A 4HMCA 1XF1A 1U8PA 3LRMA 4LSRH 1MFAL 3QNFA 3BT2H 2HX9A 4P9HC 4N0UE 1EDHA 4RRPM 3F7VB 5EO1A 2VCOA 2E7LA 4HJGB 4XOEA 4XH2B 4H0GA 5DQ9B 4YDKH 3E8UH 2AQRA 1CWVA 2MPVA 3GIZH 1WK0A 4IU2B 5I1GH 1ZJAA 2IANE 4LRIC 3TBSA 4U1MB 1ETZA 3DV4B 2FWOB 4MZ2A 1CLCA 1XGUA 3D9AH 3O3AA 1DQDH 2WOBA 3U7AA 4U4IA 1DQVA 4UQ2A 4YL9A 1A66A 1DUYB 4IBUA 3TBVA 3HRZB 5C08B 4QJ5B 4M1GL 3P30L 1OQOA 1FVCB 2H1LM 4HIEB 5B8CB 4GKNA 5EBLA 4DUXA 4QXVA 2DKSA 2E6JA 1YEEL 3K7UA 3UTPD 4E9RA 4BA8A 4Z7WB 3PWLB 5CJ5A 3DJTA 3GIVA 4OY9A 5CKAA 2IVFC 4ZUTA 3S5LG 3KPOA 1MJUL 4NBXB 2G60H 2HRLA 1BZ9B 1MLBA 4FJZA 4LLWB 3ESPA 8PAZA 2W9DH 4IOSD 3CSFA 1VEPA 5AW7B 3PY9A 4GO6B 5EH1A 5BVPL 1U9KA 1DVFC 4Z7QB 1VGKB 5E9DE 2PETA 3HC4L 2GC4C 2FWLB 2AEIT 4K5LA 4D7BA 3GSOB 4M6NH 3UTQA 1UADC 1D5BA 3L4VA 3WIHL 3U1QA 5L6YL 1M6UA 3V4PH 1JPST 1MFNA 2DLEA 3BXNB 4KI1A 1NKOA 4F9LC 2I85A 3L3GB 2P8LB 2AEOA 4ZI8A 1P7KA 3PU7A 1MELA 1IBGH 2K6YA 3PDOB 4JANA 4L48A 2V8LA 2YQ2A 1IEAA 1T20A 4KPHH 1Q1PA 3TA3C 5TE4L 3PYCA 5DHVH 1U42A 1J10A 2VZ3A 1KG0A 4V1DA 4BKLB 2Z1PA 2C4FU 1NFDE 4OFYA 3L7FA 2LV4A 4A2LA 4QTHB 2QZQA 2HWZL 2FT8A 1XR9A 4HV8B 2VSMB 3ZE1E 1NANH 4BE6A 3ARGB 1VRSA 3X3GH 2AVGA 1S5HB 3P3UA 3DJZA 5JPNA 4JRXE 1GZPA 2VB5A 4YFLI 2WQRA 2Y6SD 5AOMA 4TMPA 1D7FA 1O7DE 2FLRT 1BZQK 3CZFB 3OJ2C 2QKIC 3DJ9A 4M02A 4LPYA 4F37K 4KX7A 1GVIA 4OJDH 3IMUA 1A5FH 2BMKA 4OFVA 4MA8H 1USQA 1Z9MA 3GO1H 4PVBA 1NKGA 4AYEC 1KBGL 1O9VA 2ALWA 3RA7H 1XIWB 1JWMB 2JWYA 3EH1A 2A6JB 4AQ8C 4NN7B 3C60A 5BNXD 3QUKA 3QFDA 2EZ0D 4R4BB 3W9DB 1HSBB 1I85C 2GG1A 2CLZB 4DKDC 4NZUH 2E76C 3O3UN 3FH5A 2NQ3A 1AGEA 2WB7A 4FQIL 2K9FB 2VDKH 5K9QI 3MLRL 2JLLA 4WJKB 2WYIA 1OE2A 1KUMA 1FZKB 2IEPA 2X4UB 3EJCA 3IDMB 1FFOA 3MYJA 3R1GH 3V9EA 3ULUC 4TUJB 3WNIA 3I50H 4U1HB 1N5YL 1F6AA 2Y1ZA 4JGUA 2P5WB 4KRPD 1REIA 3TT3H 1KIQB 3WU1A 3SD5A 3ESUF 3ULVL 3O4LA 3B1TA 3N04A 2EDEA 2C3VA 4AEFA 4PJFF 5AOLA 2R0WL 3FOMB 4JS7A 1ERNA 4KK5D 1YNLL 4W9DC 3D85D 2D7PA 5B8CC 2VMEA 5KYNA 4GT7A 4D3CL 3ARBA 1CE1H 4Y2OB 1CVSC 5ALCH 4HBQA 2GSIB 4DPCX 4DEWA 4PV8A 1P2CB 4ICXA 5DFAA 5BW7A 1BCIA 1UT9A 2E7DA 3UYPB 1OHZA 3GMNA 4KFZC 3ULVC 2D3LA 3B7UX 1PQZA 2XBZA 2G75A 3K81A 5CEZD 1BX2A 3VUAA 3TO2A 4JDZA 4G7RB 1GOHA 3IDXL 3PHAA 5DD3L 2ETWA 5FIEA 3IJYB 3WS3A 1WA2X 3NEOA 2XN9B 4R4FH 5F7EL 3LZFH 2GUOA 4PB0H 1UXSB 3HRPA 3RRQA 4OTXL 4D8PA 4EUPG 3E6FA 1TCRB 2YAMA 1GRWA 4GJTB 3GDCA 5EIQA 3D0LA 5EOCL 1U8KB 2HTLD 2Y5TA 4UV7H 4MJ4A 4ELDA 4JKLA 5IG7A 1K4CB 3M17B 4MRCA 3PHQB 4Y2DB 3C5ZA 1HINH 1JGLH 2CRZA 1IM3A 2CKBH 1CFBA 1X5FA 2GITA 2HJLA 3AU0A 5GS2D 1ZVSA 4HDIB 4BJLA 2PN5A 5JIDA 4JKNA 5CN1A 5FO7B 5B3JE 1YPZA 2GJ6D 2YD1A 3DURB 3IJ7A 1L4IA 4XO8A 2BVUA 3BI9X 3FZUC 3M8OL 4TV3A 3FT4A 5JXAL 1MCKA 4P23B 4RIRB 1CGSL 1LP9A 4Y2LA 3ESMA 3F64A 1C5DB 4L3CB 3U2JA 3F04A 3NPZB 4YBHA 5FGBA 2X9WA 5DK3A 2EYRB 4EN3C 1OGAB 3I84A 4QRTA 1ID5I 4H20H 4QHKJ 2ATPA 3NIFE 5DRZA 3NFPA 2IH1A 4NHUA 1RZIA 3T6QC 4P5KB 3KLKA 1NFDF 2BWDA 2EDJA 4UBDD 3SYQA 3BEVA 4Z0XB 2E9GA 4NN6C 1U8NB 3O3BA 1Z9NA 5FAAA 5C2BH 3LH9A 4RZCA 4UAHA 2V2XA 3ZE1F 4PJEA 4U7MA 2K0RA 5DHDA 3O9WC 5INDA 2F0CA 4DCQB 3VO0A 5FO9B 1ZS2A 2VM4A 4JN1L 4UDUA 1ETJA 5LAPA 2CDEA 1TMQA 2HT3C 4K2UH 2VDQL 1QW8A 1Y7VA 2WMPA 1FO0H 3NK4A 3BISA 3W1ZA 1CBVL 4PRPD 1ZLUK 5SWSA 1ZIBA 5FUCC 4PRIE 2JQZA 2XG4A 5JO5B 4GBXA 4LVEA 1G9NL 3ZY7A 3K71B 2ZXEB 3QDGA 2BCMA 2GBVA 2CRMA 2HH0L 1G4MA 1OPGH 2HVJB 2LW3A 2UY6B 1CLOH 3FU6A 2V5YA 3GF8A 1AQHA 3HS0A 5CXPA 1YEIL 3EIFA 3QEUA 1ZLWH 1FNEA 4G43B 3Q2NA 1T4KA 4J3OC 5IFAH 3BVNB 3E9UA 3BGMB 2X9YA 3U4AA 2I5YL 2AEPH 1IFGA 1E0OB 3TH2T 2XACC 5MENE 3NGBB 4RFEB 1KTDB 3IXTA 4GRLC 3NRPA 4OF6A 1FZJA 3FO2A 3I6KA 3MRBB 2OYPA 1CF8H 1G9NC 3LZOA 5CLZA 2C4FT 7FABL 3ZJAA 3FT2B 3K8MA 1FPTH 2Y06L 2ZD0A 4LHUD 2Z34A 5DJDA 4M9OA 2BVPB 2D2OA 5DS8A 3IVKB 3GHPA 5C0GA 5KWYC 2AJVH 5B7MA 4W6WB 5F3BA 2P24B 4XX1E 1ZOXA 3JYBA 3QFGA 5A40E 1YECL 2YKLH 3HG4A 1CCZA 5DJXA 2FB4L 4QEGA 2UY7A 3FSAA 1IAIH 2XWEA 3BLKA 1KN4H 3T5WA 4NUPA 1MWOA 1VDGA 1FN4A 2YJLA 1YQVL 1CG9A 5CUSH 5E99H 4GSUA 3RY5A 4G7YH 3UFIA 2LLGA 4OJCA 1N3NB 1A4AA 1BVLB 4J8RB 4O2CA 1PX4A 2DQDL 3DX9A 3MRFB 3PS6A 3RWHB 4AOFA 4JN2B 3GUTA 4P5MB 2PPAA 4Y2DC 3BKJL 3IMTA 1YEGH 4G9FA 5BV7L 4P2RA 3UJIH 2FGWH 3EHBC 2Y4SA 2R29A 5I19L 2WVTA 2ADGB 5BRQA 3KR3L 4LSPL 2J6WA 4ABUA 1VGEL 4ZD3L 4AH2A 1HHKA 1AGBA 4Y4HD 1EHAA 2CO6B 2DV6A 1OTUD 1T7WA 1NUFA 2FBOJ 2CXKA 3EF7A 2YQ3A 5GRJH 1BWMA 1ASPA 3U30B 1CXIA 3UZQB 3NZHL 2ZP8A 3EOYG 2DMCA 5T3XL 5EIVA 2A6DB 3J8F7 1MRDH 4PHZA 2XY1A 5BV7C 5CN2A 5JIMA 3MKKA 4PJIE 1CQYA 5ISZE 1WBYB 3JYCA 3KZ8A 5D8JL 5CJBA 4EI5C 3EH3B 3NDZE 3FU7B 3BUIA 2AJSH 2D3VA 3OG4B 4RAHA 1B4LA 3DA0A 4P48A 4HZLA 2C1PB 4UTBH 1EHNA 4X9GA 1UD4A 1BQ5A 3U83A 4QXTB 5DYOB 3RWCB 2X4NA 3S36X 4U6TA 3RU8L 5IQOA 1H5BA 1CC3A 4ZMAT 1E5YA 4J28A 2YWYA 1F02I 3QUXC 4P3DA 3NIFF 3VWJB 4Y16B 5CGYC 3ZSTA 4K0OA 1T66D 5E1QA 4BK8A 3KWUA 2BJML 1FE8L 2A4EA 4UM9B 3M1OA 4ZX5A 5BOZG 4Y19B 3HC3L 4DKFL 2HPOA 4IU3B 2JIXD 3KCPB 4KJPC 1G5AA 2F54B 3OKEA 1O7VA 5EO9A 1D9KD 1G6RL 4G8IA 1WCBB 3KDMA 1RUPH 5DI8A 5BOPA 4ZUWA 2A6KB 4NQCE 4Q6IC 2ZG3A 2EEXA 1KB5L 3ARED 1E7VA 1UOWA 2XXFA 3IB4A 5C2UB 4C56D 4IKJA 5HI4D 4APQB 2XPGB 3OPZL 3BD4A 3QHZH 1NDMB 1VZIA 1WF5A 4DPAX 3DVIA 1R3KB 3ZMEA 5B3SB 1KLGA 1BQHA 3JTTA 3V6ZA 1M05B 1Q94A 3QZBA 1TZHB 3IPBA 4GW4B 4WW2A 4DO5A 4HOMA 5JW3H 5EF1A 3CZLA 1N6QH 4ZYKA 4O02A 1EO5A 2AJ3A 5I1CL 5HHXH 5HHOA 4ZSOA 4N1CA 5C0EA 3SZ6A 1VKXB 2Y36L 4N9OB 2EIKB 1JHLL 1JPSL 1A9BB 2A99A 2EDDA 5JDSB 4DFIA 1LO4H 4LOVA 4PP2A 2JKJA 3OZ9L 1P4IL 3T1WA 1PY9A 4PJGB 4U6VL 4ELME 1M2VA 4Z7VA 4EQ3A 5DLLA 4UILH 4N87A 4PREB 4XN2A 3BJLA 4UIMA 2WAHA 4P99A 2XWCA 4OZHA 2ZXGA 1E42A 4ZTPL 3P3SA 4NB7A 3F6IA 4ALAL 5JXED 4AKPA 1QPXA 4QHUB 4NUGH 4CN6A 4M7LT 1KF9B 5E08H 2OYLA 2FATH 4AIZA 1QLRB 2LU7A 4HMEA 1S7SA 2BOCB 4XPHL 1QSEA 4JY4B 3BPNB 2VLRD 3V5DB 5KVGH 5SWZD 3QZNA 4ZTOL 5IFHL 4RMBA 2JJTA 2WCSA 1BFSA 2X4QA 3HW7A 2VXTL 4PJ7A 3PGCB 2W9EL 4MB3A 3MX0B 3RUGB 1KZYA 4NQSB 1SYSB 1IKFH 1OP3H 4ALAC 2NOYA 5HYEA 2OR8A 1SY6A 5DD6A 1FFTB 4OLWH 3ML8A 4I9XA 4MBRA 4ONFL 3KMDA 1JK8B 5IM7A 5A16A 1S8DA 2PYEA 3L4UA 4YZWA 4W9GC 4FQXA 3QXVA 4RMVA 4TRPH 2YD6A 2PNDA 4Y4FA 5AUMA 1Y18A 4QKTA 3FTGB 4GKSB 4E41D 1JZ5A 3ZTEA 5GGVL 4FXKA 1CD9B 4N2MA 5I2IA 1RJCA 2F74B 2WXHA 2PO6D 5I0VA 3TASA 1CPUA 2EIZA 3NCXA 3FRUA 1V7NL 2KH2B 4HEME 4TVPL 2ZOLB 1WHOA 1U8HB 3MV7A 4MHHI 3H9ZA 4PJIF 4URTB 4GG6A 1JN6A 2BSSA 3DKHA 2LGNA 2FTAA 4PH8A 2NY6D 5BS0A 3L3IA 2X7LB 4J3VA 3ZGIA 2DQIL 4PVNA 2XWZA 4R2GB 1YY8A 5GGTH 3DK2A 3QA3A 2W81C 4BKTC 1J5IA 3MZTA 1QFWL 4PWJA 1E9OA 2H9GB 1PPIA 5DJYB 1I8IA 2APSA 1BAGA 1M71A 3T0WA 3A23A 1AO7E 1N2RA 4L1SA 2IQAB 2MKWA 4N6RB 1FGVH 4OF5A 2G0KA 2JKNA 3BRDA 2E9IA 1I53A 2F5AL 5FUZH 3TJEL 1OAQH 4XVJL 3QWNA 3CCHA 5IROD 4QRRE 1IQDA 4AIOA 2F8XC 3US9A 4XAKE 1FYTA 3KYNA 4FFWC 4ADIA 3LKQB 3HR5A 5GGRA 3LN5B 2XN1A 5AKSA 3VSUA 2OK0L 2GCYA 3KWWA 1MJJA 5HBBA 5EPMA 1N12A 1IAOA 2Y7NA 4YDMA 3DX6B 1X4YA 4JX0A 3LRSB 5E0FA 3V0VB 3LJ3A 1XZ0A 3JUYA 5CLYA 4IW4C 3HG5A 4HJ1A 1HL4A 5D5ME 4OZIA 1ZA6A 1Q4NX 3PL6C 3KBEA 3K6FA 5C9KA 1AZVA 5AKRA 4A6YL 2ICES 1EFQA 3VRIA 3TCLA 4M1GH 3P30H 2CBQA 4IRJD 1GKOA 2EIDA 4ONOA 1Z6JT 3ETTA 3HCVA 4AE0A 3WAJA 4QJ3B 4X8GA 4NO3B 1YEEH 5E6SB 4OD1L 3PWNA 4S0HA 1YYLL 3ZKNC 4RGNE 1QFWM 4O51A 5IESH 4H13C 2ADYA 1MJUH 3BQUD 5IGXL 1QFPA 2BXZA 3ALPA 4QO1B 1DQQA 5HDQL 1HHJB 1WLHA 1QHPA 4OUOA 4KXBA 5BVPH 4FYQA 4ELMF 3DJRA 1X5AA 1ZSDB 3H7BB 2VLLB 5F7NC 4FDWA 3BAIA 2WXQA 4WWPA 4Z0BL 1JDDA 2OR9H 3T3MF 1YAZA 3CVHB 2ZXCA 3OKMA 2XIIA 5D6DC 3UBGA 1IFRA 3UJTL 2HXAA 4WHTB 4I85A 5IHZB 4PS7A 2GBTA 2J20A 3KPRA 3VXMA 3W0WE 4WUUB 5AYQA 2VMDA 2CALA 4JZNA 1MG3C 2X89D 4P4KD 5C3LD 3CN2A 1UWXH 3H6AA 1VSCA 5I74C 1A4BA 1EJOL 1PD1A 5D1QD 3ZYZA 4N0FA 1BF8A 1NEZG 2A9ML 2QDWA 4X7FC 2A0LC 3UBXI 2HWZH 3SZKC 3LRHA 1QX1A 3AM8A 5E1HB 1A9EB 1XQ4A 4DOHE 3TBTA 3V4LA 1RJYB 5D4HA 3HNSL 1W0VB 1YNTA 2OJ1A 3VGGA 3C8KA 4Z7UA 1MHCA 3GRGA 2YUWA 5DD0L 2NRDA 5AW1B 5F1NA 2JFCA 4PJ6A 4KK9C 1FJ1B 4G3YL 4LCIL 5D7KE 4OF7A 3IM1A 1SUHA 1B4JH 3FQYA 1KBGH 3M88A 3GFUA 2A1WL 1ID2A 2IQ9L 2C1OB 3AT0A 5EEZA 4M93C 3BWAA 2HFFB 2R0LL 4UMGA 4V2CB 3L16A 4Q58C 3VW3L 4TNEA 2WVSA 1JBJA 2B5IB 5DURB 2TSAA 3MNWA 3EBAA 2MEJB 1LYQA 4M6OL 3REWA 1NJ9A 3FBKA 4JFXA 4U6YB 4UQ3B 2IDCA 1VHPA 1ZK9A 4ZAKD 2D0GA 4LOFA 1BM3H 4XMZA 4EUPA 1WVZA 1JNHA 5H8DA 2IGFL 3K80A 5I1KL 2E7MA 2ICEC 1OB1A 1XCTA 2Q20A 4J5VA 5A6MA 3VU2A 4ZJ9A 1XMWA 1JV5A 3K6SB 2R0WH 2AK4A 3BVWA 3NMEA 1JZHA 1YNLH 1WWCA 4JUTA 2HRHA 2VXQH 3QDMB 5AD0A 2COVD 5F7LB 1RURL 2E8ZA 4D3CH 1J18A 2GY7B 2DYPB 2AJZB 2ICWA 1TTRA 3UROR 2OTPA 4PJXB 3V9CA 1QPPA 4AK1A 4YDJA 4FLSA 5IF0A 4BHUI 2X6MA 2RH0A 5FK9A 5AZEH 4ANKA 1F11A 4A63A 3QZWA 4H1LH 3NSJA 4QWWC 4B5EA 2OP4L 1T4WA 1RZKL 2WNGA 1TZOA 3NACH 2FQDA 4BFJA 1BOYA 5JIQA 3IDXH 5GS0D 4MD0B 3WELA 1RSFA 5DD3H 3OMNB 3FFCB 4CMMA 1L9MA 3RZCB 3TYFA 1BPVA 4YHOL 1XF3B 1CYXA 4M7ZC 3LD8C 3JWOL 2TSBA 4OTXH 5G5DB 4YHZH 1BAWA 3GXUB 4PG2C 1DSFL 1ZGLB 3BFOA 4X4XA 3KLDA 3DXAD 4Z9KB 5E8EB 1SJMA 5GSRA 1OP9A 1RZKC 4Q89A 3P11H 4HJJL 2CNZA 5IB1A 2AXFA 2YEQA 4L8CA 3VQ1C 1PYWB 1U4FA 3OQRA 5C7XL 3UBFA 5F97E 5F3HA 2VLKB 3E8VA 3GSUA 5IBTL 4E9TA 2IFFH 4LKCA 5FW6A 3M8OH 5TE7L 5JXAH 2QGEA 5H94A 1SQ2N 5AW2B 1MDAA 4YBLC 3US0A 2IPKB 5AW0B 3JWOC 1RUQL 1JFHA 4HKJB 5IK3B 5IB5A 1KCWA 3VD0A 1WV7T 3BZFB 4GQ9L 4WO0A 4ZOCA 1A7NL 1LE5A 4HS3B 2A4ZA 5JYMA 3ZDYF 4NQTA 4PRDB 3CDZB 3RWIB 4MAYA 5C07B 4WTXA 4EXKA 4FI6A 4PJHE 4AM0B 2QPSA 1IBFA 3CLFL 1U0QA 3HZ3A 2I60L 1CURA 5IT2L 4N2IA 1KB9K 1TVHB 1TYRA 5FDWB 3PXLA 1D7BA 2Z35B 4PS8A 2KKQA 2BNQA 2BVYA 3D39A 3FUIA 4NRZA 4S1QL 5JIIA 2DH2A 1QO3B 4JN1H 3VB8A 3V52L 5CZXC 5DTFB 2G5RA 5I16A 4GKLA 1CBVH 2ODIA 3MV8B 2HFGL 4G8GA 4GYBA 2DDQL 4MMZC 4PJBE 3S7GA 1PGRB 4ELKA 3P4LA 4ZMQA 3ZKXB 1G9NH 2WQ8A 4H0LC 3TFKC 3H0TB 2V9RA 3ZPDA 4DVBA 1I1YA 2XIBA 4UQ9A 1LO5A 2VDRB 2P7TA 4KKAD 3MNZA 4UQBA 3X13B 3MLPA 2WVVB 3P9MB 3NYKA 4U0QB 3VFWA 5FO2A 2F68X 3ISWA 3L1EA 3LNEA 4GAYA 4PBWD 1ZPUA 4QY8A 1JF6A 1P4LB 3R18A 1LWHA 1NICA 2C9AA 3IJ9A 1QA9A 5D1ZA 4M7LL 5IQ9A 3TBWA 3ISRA 1JWUA 1KLUB 2VL5A 5INCB 4ODVL 1T1ZA 2OI9C 1QTSA 1H3XA 3IRCA 5D2NB 3QUMA 1RLBA 2CU9A 5TK4A 3ZRFC 3ARBC 2CUIA 2GSGB 3QXWA 1HYSD 1MCQA 1MCRA 3OD3A 3T77A 1KTJA 3RVWD 1YECH 5C86A 1IM9B 2CRIA 2QSTA 1P1ZA 5TF1L 3PJNA 3MNVA 3GI9H 2VAAB 4PTUB 1ONQA 1GSMA 3V10A 1PG7W 3B2VL 5LO7A 5BRZB 1HHGB 4TNVF 5I8OH 4UWQB 3MRLB 1ZLWK 1QQDA 1YQVH 4BFOA 5HJ3A 5T3ZD 2QQNL 1JGVL 2NXZB 5ID0A 5DD1L 2DQDH 5ICYA 5DHEA 1FC1A 1ULVA 2EDOA 3BKJH 5BV7H 3NESA 2NXYB 1R5WB 1OTTC 2JB6A 2DTML 1E30A 1J1XL 5LXGH 4BFEA 3SDAB 5IREA 3KR3H 4LSPH 1I1AC 1OTSC 2GC7C 3B9KA 4R9HA 5GGSB 3FQUB 5L0QB 2CM6A 4PR5A 4RMQA 3CK0H 1AZUA 2LVEA 4FNQA 4I87A 4KQ3L 3T0EB 1YMMD 2XVBA 4G42B 1HCFX 4CKQA 4JFTA 4F7CA 3MLZL 4H25B 3RJQB 3U7WL 4V1DE 3QIWA 4FTDA 4YK4B 5T3XH 4AVJA 4YL4A 1KPVA 5HHPA 1U91A 2CWRA 4TSAL 3E7JA 3H9SA 3K4DA 2APXA 1YLBB 5D8JH 4WLCA 5E2WL 4F33B 5HVHB 2YPKB 3RFRA 3QW9A 5BUPA 1B88A 3QI9B 5E1AA 5FGBC 3LRLA 3LH2L 3BLBA 3UYRL 3QWOB 4N68A 1QLFB 2ZAGA 4M43L 2NNRA 4JHAL 4Q6YA 1SOKA 1YVLA 1FI8C 2VXSH 5HYJA 2A77L 4KZEL 2FSDA 5D7LB 1NUGA 2V5MA 5JW4R 2ICCA 1N6UA 5HYSB 3IFPA 2DQJH 3QZMA 4JFZL 1A14L 1AVAA 1CUOA 3AG1B 3ML9A 1N0XL 3HC3H 4PJFB 4MD4A 3UG5A 4L3AA 5E2VL 3BH9A 5ACZA 1TO5A 2PXYB 2VMJA 1YEWA 4EN2A 6PCYA 4N0UB 1YQ2A 3Q2CA 2DI7A 4LQ1A 5DJCB 4UT6A 5D1XD 5CBEB 1IAMA 1G7HA 2OMWB 2X1XR 1UENA 3FCBA 3JZ7A 1KB5H 4PJBF 4A2DA 1CI3M 3RBSA 1J7VR 1OT2A 1JGUL 3QDJD 5E8NA 2A74A 3KPQB 3O4LE 4W93A 1Q90A 4FG6D 1P4UA 4Z23A 3N06B 4B9GA 1A0QL 3RKDD 4MAUH 4J12A 1WEJL 4LDEB 4PIBA 4LP4A 4EPSA 5D2NC 3V9FA 4KTGA 1XGPB 3BSHA 4OGXL 4ZPTB 4EBQL 3TO4B 5FO8A 2YO3A 5I1CH 4L4VE 4QNPF 2ENYA 1KPRB 1CQKA 4KROD 2Y36H 4GP4B 4LOUC 2Q86B 1JHLH 1JPSH 1V55B 3K2IA 3O8XD 1SF3A 1MXGA 1P4IH 2VDML 5EDSA 2LU4A 4U6VH 4DT2A 1KGCE 2DWSA 2O6EA 1F4AA 5D7IF 1K4DA 1JZJA 1ZHBB 3BP5B 4LVHB 5E9DB 2CLVA 3JWNG 5JIPA 3RVXC 2PTVA 4ZDHA 4ZTPH 5G4OA 1Q9WB 4K94H 5TD4A 4FQ1L 5FLUA 2CO4A 1E3XA 2YC1A 2NXZC 2RBLA 4Y1AB 3T71A 2R29L 2AVFA 2PPEA 1P5VB 3D1MC 2RALA 3AT9A 4G8FA 3ARFC 1M7DA 5I1LA 2B15A 1P53A 4LSVL 4BYHA 3CTTA 2ADJA 3SDDB 3ES6B 1E6OL 3KLAA 2XYBA 4KKLC 1GJWA 1XGYL 5D7JD 4NOFA 5EU3B 3WFEL 1NUNB 2R15A 3BAXA 1FNAA 4ZTOH 1LD9A 2QELA 5GS3A 3MBEB 4CC4A 4P59L 3B6SB 4E0RA 4KQ0A 4YIQB 5M95B 1SJXA 2Z31B 4XBGA 5HDLA 3MAWA 1DFXA 4Q4EA 4AXWA 4L29B 1U8CB 1NFDB 4ZXBD 5CN3A 2MNWA 4IBTA 4L8SB 1YPZE 4ONFH 4A7UA 3H53A 5BXFA 5DMYA 3DIDA 4NQXB 1L5GA 1SBBA 3CV5A 3TTSA 3NZ8B 3ZE1B 3WJLA 2EE2A 3VFMA 5EEVA 2N7AA 3CPUA 1LP9E 4CW1B 3W39B 4LB8A 5GGVH 4YAQB 4JRXB 2V5SA 5ICZB 1QRNA 1X4ZA 1V3MA 3SBWA 5F8QC 5CCHE 3LQAL 2XG5B 3QDAA 4JFEB 4LNRA 1V7NH 4XP5L 2F2HA 2FZ3B 4G6ML 2BERA 3NEEA 3AS1A 3LV3A 3MNMA 2OXHA 3D3VA 4R3SB 5FXCH 4CNIB 4JZOA 2A73B 4ODWB 4QRPE 3GJFA 4S1DC 1UD6A 3V5KA 3P4MA 4LAJH 5D71H 2DN7A 1CTOA 5IKCB 4WZ9A 3KPNA 1ZHKB 1ZVNA 4PJEE 2DQIH 3PLYA 3TIDA 2NZ9D 1CD1B 3QH3B 3HN8A 2HG5A 5B4MD 32C2A 1EO7A 1QFWH 2BFGA 4LCWA 1OP3K 2VR7A 4BGDA 3LQAC 2YAQA 5J1AB 2MCMA 2BVEA 1ANUA 1ROWA 3W3BA 4HCIA 4HIXL 5F9AC 3WFHA 4F3FA 4RFNC 1SOXA 4U7KA 3TJEH 3AS2A 1UWGL 4XCFL 4RAVB 1ZDSA 3NJVA 3MLTB 3N6YA 3P40A 4Y4KA 4CVXA 2R2HB 3EJZD 4I18A 1MUJB 2UVEA 4X6FB 3SOBL 5FA3B 3W11C 4EDXB 2J1ZA 5AOKA 3ZVVA 5LNGA 4FCAA 5E5MB 4AIXA 2X05A 1O5DT 4HKXA 3QQDA 1QATA 2EEAA 1CT8A 1ED3B 1UB5A 4GSXA 1S9VB 2XX0A 3TBBA 1UKQA 3S3SA 3VXSA 1PD0A 3BX7C 4A6YH 4ANWA 1H0DA 1KCRL 5DHXB 2PABA 1S7WA 3IBOA 1FNHA 1NFIA 1W72A 3KDPB 1P6FA 15C8H 4P0DA 1WWBX 5KSAB 4LO9A 3L1OL 1A7BA 1GS6X 4LHQB 3DYMA 3VDCA 4U3HA 1NEZA 1J8HA 4OD1H 3RWEB 5ENWA 1JZDC 3DMMA 5ALBL 4GLRH 4OH2A 1BG9A 2NR6A 2H2SC 1V3LA 3PIQA 5IGXH 5ERWA 5F89B 4WFFD 5L2KD 3VCLA 3Q9QA 5HDQH 4OVVA 4RMUA 5T1KA 3VWKA 1U8IB 4KI5D 3TONA 4I2XA 2HMIC 4CRPA 4IBLT 4CMHC 3HC0B 3MUJA 4FNRA 3EJUA 1K5NB 2L4OA 1SY6L 4Y89A 3NJJA 1TQWA 2Z4QA 4X80L 3MGOA 3G5ZB 5T1LA 1MFVA 2OJEB 3BAEH 3MBEC 3MOBL 1TEFA 1FZMA 2IV8A 2NSXA 2ZPKH 2E9WA 3VFTB 5GRVL 4P2RE 3FO1B 4LFHG 4YDIL 5DQJB 2AW2A 3UJTH 3V6OA 4P5TA 4KNTA 1UFUA 2QFPA 1CS6A 2WBXA 3IF1B 3PAZA 2ZSWA 4MJID 4EOWL 1DANU 3UTTD 2IAMD 4Q9QL 2GABA 4IGBC 5JZ7D 2Q8BL 2ITDA 4MS6A 3QR2A 3EJPA 2VDOB 2IPTL 4OJEH 1A22B 1YEJL 3NIFB 1DQLH 4FXGC 4W4OC 2HJKA 2R23B 4FQXC 4NQEA 3RGVA 3EYOB 4LKXA 4Y4FC 5K1JA 4FFVD 2OR7A 5CIPB 4XZ4A 1INQB 1U3NA 4POYA 2G2RA 1ZLVH 3NSCA 2YPLD 4PV9A 3ATEA 3QBTB 1WZMA 2NUTA 2WB1A 4B50A 2VIRA 2BNRA 4GXVL 2PR4L 3L4ZA 4IQHA 3ZBMA 1NGWA 5C08D 2I9TB 3ARDC 3MGTA 3ARVA 4XPTL 5DD0H 1TZIB 5F6HI 3RL1B 1URIA 2AITA 2D03L 4GMSL 5IHBA 4LGPB 2IGLA 4LCIH 4XWGL 3CFQA 3L45A 1KDJA 2Z1KA 1ET8A 2FHCA 2VABB 3QEHB 3QG6B 2A1WH 3N43F 5DFTA 1FG9C 3N3EA 4KUCF 3GK8L 2VR9A 4ONGL 3GI8H 2V7HA 4XP1L 3QJRB 4NXSA 2R0LH 2UYLB 4WEMB 3ZO0A 1KNOA 3PGDA 1R3LB 1R5IA 1UWXK 3FHEA 4JFPA 4TSCL 3RGBA 3KJ6L 5B21A 5CCJA 5MENB 4M6OH 2YA2A 3D69A 1YN7B 1KYOJ 1I7RA 3FB8A 2AFNA 3CQFA 2X2HA 3O41A 3HZVB 4YHYC 2BW5A 2VN5A 3P9WB 1FAIH 4N3TA 2IGFH 5I1KH 1M1SA 2Z7UA 1KXHA 3MLYL 4FKEA 4WFEE 4D8OA 2YZ1A 3LKOB 4JO4L 1G94A 4TULH 4I9WD 1CMOA 3L4TA 3QUZD 2AQ2A 4N2KA 4QR7A 1E9PB 1MCEA 2NY0C 4AV0A 4YS4A 3WFBL 5L2JB 1RURH 2ZSVA 2ZXQA 2L3BA 4YXHL 1JZGA 5HHOE 4PGEA 4ZSOE 5EZOL 5J6GA 1IC5L 4JRYA 5DRXB 1WZKA 3KEDA 4MASA 1TENA 3U36A 1PZUB 3DBXA 1KFAH 4OV5B 1A6TB 2K6ZA 3MRMA 1YEDA 3NZSA 1HH6A 1F41A 1ZTXL 3ARGD 3MV9A 1EMTH 4Z7VE 3BD5A 4NC0B 3HG1A 4QYOA 4HLEA 3VG9B 4JRFA 4OZHE 1RZKH 2V2WB 4H1LB 1QAWA 3B7YA 1AHWA 3G5XB 4HH9A 4LL1A 4DP7X 4R96B 6FABH 3DSNA 1LEIA 4AV4A 1YZZA 3SY0B 1UZ6E 4B9CA 2X5PA 2H32B 5JPMA 1QSEE 4GUOA 4PWEA 3BWUF 1R1CA 5AQ0A 1XIWD 1OE3A 1MWAA 2IDSA 4TF4A 1DSFH 3EFOB 2W0FB 4MFHA 4X6CA 1NIAA 4KITB 1UXWB 4UT9A 4NKQB 4WFHE 4PJ7E 1LDSA 2DF3A 3FHQA 3W5NA 1FNSL 4HJJH 5EC1B 1ECYA 3FPYA 4LLQA 3VGEA 4PJIB 1G7JA 1CGWA 5ISZB 3CFJA 2PYEE 4QMEA 5TE7H 5AAPA 4XMLH 3RPKA 2P5WD 3DX8A 4QRUB 5A6IA 4X50A 1CDCA 3DUUB 1BPLB 2QVKA 1RUQH 4N90E 4GQ9H 1KTCA 2YSSA 1A7NH 1CLZH 2BIPA 3MRDA 5F0LB 4YSEA 4FLHA 3CGTA 4FD0A 4I0PB 4HEPA 4K7FB 1QI5A 4I48B 4H5SA 2YS4A 3GMMB 3E2HC 3E6HB 4MHHG 4ETQB 2Q5BA 1G9MC 1EEUA 4QHNA 4AGNA 3IJ8A 3GMOB 2O26U 4FQPA 4KO6A 3PWVA 2C3XA 3MV7E 5T1JA 2OMUB 2I60H 4GG6E 5IT2H 3FTWA 5DC9B 3SPVA 3O6KL 3NJHA 3BH8A 1BZ7A 3VFGH 1HTYA 4X6BA 1RZ7L 5BS0E 3LKPB 3TBYB 2UWEF 3MOQA 1OL0A 4AY0A 3MR9B 2FX8H 4S1QH 5IBUB 1ZKAA 1J5OH 3V52H 3DO3A 1BFOA 1DHKA 4NQCB 1TUPA 1JFQL 4AGLA 4R4NC 2R27A 5DJ2A 2VZTA 2GAZA 1DDHB 5DJZA 1WYJA 2F6AA 4FQHB 3UGEA 3V5HB 5K39B 2J88H 2XN9D 4MDIA 1T5XA 4MCNA 2VERN 3ZHNA 1DANT 3BYTA 3AJ7A 1L6PA 5KSBA 1BQLH 3Q8EA 3QRFM 4YOKA 1QSZA 3QJZA 3L81A 1MIEL 3CVIL 1XZWA 1BIIB 1J0YA 4FNUA 3HN3A 4Q8BA 4BQBA 1YN6B 1OAXL 4M7LH 4AC2A 2Q6WB 3UG3A 1CTMA 5I71C 4K5OA 4ELMB 1WRFA 1WGOA 4OD3L 4G80B 4IK6A 5KOMC 4H8QA 2H8PA 5FWRA 3TOPA 4PJ5A 4WW2F 2V3FA 2EO1A 3H85A 2WZPD 4WUKL 1OGAD 4IRSC 1RUKL 1CGTA 1U8JA 3W37A 1JGEB 3X14A 4KGLA 1T83A 5TF1H 2WANA 1E4KA 1DBMH 3DPBB 3ME0A 3ROLA 1K6QH 3GT6A 4M3HA 1ZT1A 3QQNA 2AV1B 4AQAA 1W6WA 3GSWB 3CZEA 4RX4D 3ILQD 1TKWB 2N0MA 4WTZG 2QQNH 4N4YB 1X44A 1JGVH 1FLTX 3QZOA 3P3TA 1AQ8A 4OZHF 4ADGA 2V9UA 3L95B 3QAZB 3ZDZE 2FEEL 3I9PA 3ZKMD 1U8OB 4WNJA 1WT5C 4WV1B 3UAFA 2O5ZH 1KJ3L 3C2AL 2DTMH 4R6UA 1FDLL 1J1XH 3IJHB 1NGZB 3KPRE 5FCUL 3JQOB 3VXME 43CAB 4G1EA 4K07A 4PCKA 3BVDB 5EZPA 2MQ3A 5DFWH 4AG4H 5IMOA 4KQ3H 3ABGA 2D0FA 1H15B 5I75B 1URLA 5JORB 3DROA 2WXNA 2HT2D 2ESVD 1P9MC 1ZSHA 1BBJA 2WTOA 1YYML 5EU5B 3MLZH 1IB5A 3EGSA 4H26A 4UAOB 3U7WH 4S1RH 4IEFA 4OJAA 3ZDXE 1THCA 5E6IB 2LU3A 1T1YA 5CAYB 1IO4C 2Z8RA 4NDMA 1RJLB 3PRZA 3SD2A 4NIYE 1NQBA 2Y7SA 1G0YR 2DQEH 3RJOA 4K7PL 1YDPB 1DJWA 4LLDA 4CUCA 1E2WA 1UVQB 4ZO8A 3ZE0E 1LLAA 2DW5A 3LH2H 2JI2A 1E50A 5CJ8A 2PP7A 4Z7UE 3UYRH 1PKQB 1NPJA 2WZ0A 3FONB 4MAYC 3QJFA 4MXWL 4M43H 4ZMYA 4JHAH 4NPKA 2BOLA 2JKXA 2KT6A 2OLDA 3WAKA 3OKYA 2CMRL 4MA1B 1AO7B 2A77H 4KZEH 3JUZA 4HU8A 3T4YA 1HILB 2C9PA 3GHBH 3LMJL 3SBRA 4JFZH 5F1IA 4GG6F 4QRRB 4DKTA 4WI0A 1XSKA 3NIDF 2WV3A 4WY7L 1VCAA 4H8UA 3ROOA 3LXCA 4NP4L 4X5RA 2IH8A 3PPEA 2HJFA 4R7NB 1HQRB 4W4NA 4XMPH 2DWTA 1EZSA 4MGXA 3QNZB 2E7HA 2CPUA 2UVFA 3BWZA 4X2UA 1HXMA 4ZFOB 4JREC 1AGDA 3HB3B 4E2OA 4JM2C 4BFGA 2OL3B 1PCXA 1H3VA 2AANA 1RZPA 1JGUH 1JNLH 4G59C 1L0PA 3A4FA 3QUML 3RDTB 3RNQB 4TKWA 3HFML 4OI7A 5A2CA 3PNWB 1A0QH 3TN0B 1X9UA 2AK4E 4B97A 1WEJH 1F97A 4JHVA 4K3DL 1E7UA 3J2PA 2GJZA 4NO0B 2WZ5A 4OGXH 4EBQH 2IOIA 4RGNB 5IMMB 4O4YL 2IH3A 2RGSA 5ICUA 3OB0H 5DMIH 4HHGA 3EYFA 3FU5A 2R2BB 5E1IA 3RKPA 3U25A 1NAKL 4N8VG 5FYKD 3OHXC 1Q9OA 2VDMH 3MRIA 1P4BH 3F5WA 3RE0A 4OF0A 3FQRB 5K9KA 1UG9A 2YEZA 3WXWL 3ATBA 5CNHA 4YSTA 3FO0L 5BZDB 2X4RA 1LEGA 4FQ1H 1SHSA 2EYSA 2HT4D 4U2ZA 5KJRL 2NT0A 3BIAX 4B53A 1S7UA 2R29H 1DLHB 3LB6D 4R83A 1IC4L 2WVUA 1WP6A 2WKOA 3FULA 2VDPL 3P9LA 3QAZC 5JOPD 4Y16D 3IPEA 4LSVH 2WAQA 1ZT7B 3UBHA 3TEXA 3W0WB 1E6OH 5GZOD 3LSOB 5EO0A 3WFEH 4UM9D 3UPAA 5KJ4A 4GQQA 1TIUA 4KZDL 1VAHA 4P4RA 2X4SA 4M6ML 2MCG1 2XOTA 1MF2L 4P59H 1K85A 5E24E 4MNQA 2F54D 1T0OA 1FWXA 1HE8A 2OZ4A 3LKNB 5EUOA 1FL3A 2OMYB 4M61B 2ZUQB 2XWRA 3IE9A 4RZKA 4NKDA 1S9XB 3LYRA 2QZ5A 4UANA 4C47A 3CN3A 1I1CA 2GK0B 2XQBH 1RIVL 3B9KC 4OF8A 4L9DA 4AQ1C 5E6IC 5E03A 5CCKL 4KZ0A 3EGXA 2HLFC 4J23A 4DOHB 4MA3A 4APQD 1EFXB 2B1AL 2J8HA 4NGHL 3LY6A 1C9SA 1TSHA 3QFJA 4FMKA 2KLRA 2OFQA 5F9WB 4KU1A 2Z0UA 1AR1B 3LQAH 2FLBT 4XP5H 3EZ8A 5CMAB 4G6MH 1HDMB 3AQZA 4PCYA 4XNYL 3ZDXF 2X42A 2R1YB 2O30A 1X5HA 1CZ8L 5HPOA 4KGJA 5L4MA 3N41F 4YQXL 5GS1A 2FJGB 4PSPA 1JXGA 1A6ZA 1BBDL 4Q14A 1H3PL 1QFWI 3ZE0F 5I8KL 4Z5RB 4HFUL 2BNQE 3NDYE 3GZPA 5HJBA 3MBXL 2GPZA 3ZIYA 1DQML 4Z7UF 4ZW5A 1UHVA 3GMRA 1RZ8B 5EZIH 5LCVA 4F92B 2G4GA 1I7TB 5DZPA 4G8GE 4HIXH 2X38A 4JFDE 4Q52A 4AUUA 2OSYA 3FB7B 2JK5B 3QO0B 3ARWA 1UWGH 3L6FB 1CFNA 4N2FA 1G7MB 4XCFH 4DEPC 2AGJL 5DJ8A 2Q2LA 1N68A 2R1XB 3UPCA 3PABA 1JTPA 3MREB 5AYUL 4X7TB 3BIKA 4RA0C 4D9LL 1DQJB 4JR9L 3VGHA 4XT1C 1E4XL 4EIBA 3RDTC 2BSTA 4O02H 4KAQH 3FOLA 2XKNB 3EBHA 1JPFA 4JKMA 1RZGB 5GSVB 4QHKI 2YQBA 4LRNH 4NQQA 4ZFFA 2G9HB 1CD0A 1CFSA 2HFEA 5F7BA 5EIIG 3O2DL 4NP9A 3ZW3A 4JO1H 1BA9A 1FH2A 2OMNA 1JD7A 3CDGB 3HJEA 5EU7C 4N2AA 2R7EB 4IMLB 4NOBA 1LGVA 3RY6C 1TJGL 3NOIA 3H3BC 1KCRH 2YGPA 2Y3AA 3GXIA 5HI5C 2B9AA 3MO1B 4XNQA 3G6AB 1DO5A 1KT2A 3L1OH 4OQTA 2R2EB 4GLRI 3DUSB 4LEXL 1O6VA 4HCGA 4U1NA 4MSWB 1A1NA 5DO2D 4ERSL 1GGIL 3O6FC 1I1FB 4D0DB 5ALBH 1D5MB 2WBJC 5JHDB 2X0UA 3OKNA 5I0DA 4G1MA 5L7XH 1ICTA 4HT1H 4R0LB 4RMTA 1OSZA 5F1KC 1THAA 1UD3A 4U2YA 2QSCH 1QFUH 4PLJD 5HGGS 2VGLM 4P2CG 5DEFB 2CO7A 3TV8A 4QHLB 1KC5L 1DN0A 1LM8V 3ZTNL 3MJGX 3KPLB 1SY6H 2PCFB 1AG0A 4X80H 3JVGC 3GQFA 4DK6A 3MOBH 4YO0A 5K69A 3WHXA 3WY2A 4HETA 4J2QA 2Q76A 5HD8C 1A4JB 2AEQL 2XNAB 4POZD 1EXGA 3SYAA 3SO3C 2R4SH 4U6HA 5FCSH 1FP5A 1J8RA 5CU9A 4UOJA 3TWYA 4IOFC 3VGAC 2VXVH 4X5QA 4MXQD 5FF6B 2ZOKB 4EOWH 1MW2A 4XB8A 4RWHA 2GI0A 2R9HC 4YDVB 4WHCA 1GR7A 1TLMA 1NCUA 4NJAL 4Q9QH 2Z3FA 5FPIA 2Q8BH 3HE7D 3QEGL 1VFAB 2QEJA 2YMTA 5F9WC 3ZE2E 2IPTH 4GG8B 3SDCA 1YEJH 4PJHB 3SCMD 2XWBB 4FZEL 2WWNA 3QJHB 1E2ZA 3T4AA 5K9JL 1SYVB 1QKZL 2MHAA 3EADA 2GK2A 3H9SE 4JL1A 2Y7OA 4PJ9A 3TZVB 4LCCB 4NO5B 2D7OA 2H1PH 2IFGA 2VUKA 3B8YA 3EYVA 4QCIA 4GXVH 3C6LA 4MBOA 2PR4H 5I6XB 2HG0A 4ZUUB 4KVNH 2FR4B 2VSCA 4DVRL 4XPTH 5IIEB 1T6BX 4NC1C 3QIUB 1G7LA 3Q0HA 4PRAB 5B1CA 2D03H 4GMSH 3BPCA 3RFZC 4XWGH 5HYJE 4I13B 4PJBB 4WWKB 2IPUK 5F0JB 5J13C 5K5YA 3VFUA 1PFOA 1XVSA 4YR6B 3MA9L 3GEFA 1FC2D 3FQTB 5E5LA 4ONGH 4TUOA 4ZUVA 5T33L 4FFZA 4IS6B 4U1GB 3EG9A 1NC2B 3UTSD 4E9SA 5HY9A 1HCZA 1J1PL 4N0CC 2OAAA 4UUJA 1B90A 3K46A 4TSCH 4XNZB 4X9HA 3ELAT 2RA1A 3QXDB 5CZKA 1Z5LA 3SO5A 5EO1B 3T3PE 3JV5A 5I28A 5ITBL 3BJ91 3QNXA 2WLMA 4XCCH 1TYJA 1RUAL 3NH7L 3NCYS 4Y5VA 5DDHA 3OR7B 2F18A 3LPWA 3SPGA 4RMSA 3O3AB 5AOIA 1W72L 1FLRL 5I26A 4JFHE 3UAJC 5D7IB 1I8KB 1T2XA 2BRRL 3TBVB 1R17A 4AUJA 1QBBA 4C4BA 4JO4H 2YRPA 2VLRA 5EBLB 3DYOA 1ASQA 5SWZA 1NGYA 1KGYE 2J71A 3UC2A 2V4LA 2JJUA 2DTSA 2ZCLL 1KGUA 2G5UA 2XQYK 1P84K 3GIVB 4XXWC 1N10A 2C3GA 4DUVA 4YXHH 4LP5A 4ZUTB 3KPOB 1IC5H 3EJQA 2EDBA 2V3EA 4MMYA 3SPJA 1DSWA 1NEUA 1MLBB 1Q9LB 4PJ8C 1B4TA 3AITA 4A55A 1CFVH 3HBQA 2IMNA 4ISVB 1YY9D 1UACL 3KPTA 5HHMB 2QV2A 4IIQA 1DVZA 3KL3A 4G6KL 1NLDL 4HWEH 3FS9A 1HAWA 3N1QC 4JZJB 2NZIA 2P52A 3CMGA 3MJ9L 5MEQA 5IHUH 1DVSA 1AG6A 1RLWA 4XP4L 3DC0A 3QORA 4YBQC 4XTRD 3IDNB 2C26A 4ZOBA 5CBAB 5D72L 2NY2B 1P7KB 4D0CB 1SHMA 2IWFA 4XPBL 4JANB