3X1GA

H294m mutant of copper-containing nitrite reductase from geobacillus thermodenitrificans showing two coordination geometries at the t2cu site
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
296
Chain Sequence
IAAHKGVNQAPVPLKMERVGPHDVHIEMTAQITDIEIDKGKIYKAWTFNGQAPGPLVVVNEGDTIHFTLKNMDPVVPHSMDFHAVHASPSKDFIDVMPNKSGTFTYPANKPGVFMYHCGTKPVLQHIANGMHGVIIVKPKNGYPTDKEVDREYVLIQNEWYKYNDMNDFQNGVPSYVVFSSKALKPGDPNTNGDTFTLKEKPLLAKVGEKIRLYINNVGPNEVSSFHVVGTVFDDVYLDGNPNNHLQGMQTVMLPASGGAVVEFTVTRPGTYPIVTMQFNHAQKGAVAMLKVTETG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Nitrite reductase
publication title Structural evidence of the flexibility of the CuM site
rcsb
source organism Geobacillus thermodenitrificans ng80-2
total genus 99
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2014-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3x1gA00
4GXFA 1GY2A 3D12B 2XLLA 4YSPA 1JVOA 1W6LA 1PNCA 1BQKA 4RH4A 2UXVA 3QJRB 4DP9X 3NJGA 5F7BA 4NAJA 2VSKB 2GI0A 1SJMA 3HEIB 2DV6A 3QJUB 1OV8A 4M3HA 4YVNA 1NTDA 4E9VA 1M9WA 1HAUA 1EZLA 4DPAX 1A4AA 2HX9A 3ABLB 3NJNA 1TEGA 3NJJA 3OD3A 1IBZA 3H56A 2YAHA 2VW4A 2FQGA 1KDIA 5I6NA 3NJFA 3DIVA 1J9QA 4HHGA 1URIA 1OCOB 3BQVA 4K9JA 4DPBX 1SDDA 1RZQA 1ZIBA 2GHZA 2Q9OA 5B7EA 2FT8A 3GDCA 4BXVA 1X9RA 2GBAA 4KNUA 1JERA 1PLAA 1SDDB 2RACA 3CDZA 3FT0A 4NERA 1ZV2A 4CSZA 2PPDA 4YSEA 1E5ZA 2IH9A 4AI7A 3CDZB 1MZYA 3AW5A 3S3DB 4BXSV 2IAAC 4JHUA 1ASQA 1ID2A 2PCYA 3AG3B 4AX3A 1CUOA 3IE9A 4YSUA 3PLYA 4W1TA 3OM3B 1J5DA 2B08A 1NPNA 3FQ1A 4G70B 4UAHA 2FJSA 3EH4B 4MFHA 3FS9A 3H4HA 5FC9A 3NJIA 2GC4C 2I7OA 5PAZA 3SBPA 3ZX1A 3T71A 2PP9A 4A67A 1GYCA 4A2HA 2J57A 4YSCA 4G7SB 5I28A 2XV2A 1I53A 7PAZA 1BQRA 1L9OA 3TA4D 4N8UA 2H3XC 3T6ZA 3T6XA 2XYBA 3MX0B 4KO6A 1JZHA 2EIMB 1CURA 2QPDB 1ZPUA 3IN2A 2XWZA 1AANA 3IN0A 4KO7A 4E9XA 1A65A 1NIBA 2JXMA 1MZZA 2QPEB 3SBRA 4P5RA 4DP6X 3V9EA 2B3IA 3FU9A 1NWOA 3IEAA 1AZNA 4DP2X 3BVDB 3NT0A 1ET7A 1IKOP 2HX7A 3QJTB 4G71B 4BK5C 5B1AB 2MRYA 2AZAA 3S3CB 3PAZA 3CVBA 1M57B 3X1BA 2BW5A 1J5CA 4YSTA 1NIAA 1MG2C 2H5UA 3OMAB 3IBOA 1BYPA 3FPYA 3L45A 2XX1A 2BW4A 4Q8BA 3CG8A 3JTBA 3WI9A 2IDUA 1GS6X 1GR7A 2DYRB 6PCYA 2LLNA 3X2QB 3ABKB 2EILB 1JVLA 1L9QA 3JT2A 1GW0A 1OE1A 1PZAA 2BP8A 2IWEA 2CAKA 3ASNB 2EINB 3FSVA 2YAEA 3NYKA 5PCYA 2HZHA 1AR1B 4A2DA 2OCCB 1KCBA 2BP8B 1BXUA 1E65A 2R7EA 2WO2B 4GP5B 1TEFA 3PCYA 4GP4B 1BYOA 3T6WA 2Y69B 4HHWA 3MBWB 8PAZA 1AZRA 1A4BA 5LDUA 3ZDWA 5I6MA 4DPCX 4G72B 2HRHA 1PY0A 2YAFA 1CC3A 2H47C 2TSAA 1B3IA 4E9WA 4EF3A 4F7KA 5TK4A 1NIDA 1SFHA 1XB6A 3AG2B 1ADWA 3X1GA 2JKWA 1XMEB 3AG1B 2IDFA 3ZIYA 2OJ1A 3C75A 4TXVB 2P80A 5D4HA 3UABA 1HAWA 5B7MA 2AVFA 3FU7A 3KW8A 2IDSA 1OE2A 4FAAB 1KV7A 2E86A 1JZIA 2MTAA 2QDVA 3FU7B 4W9ZA 4KNSA 3AG4B 1ETJA 3QJQB 2VN3A 1WS7A 3FSAA 1XB3A 1BAWA 2IWKA 4YSDA 3EH5B 3ABMB 5I6LA 1CYWA 2XV3A 4UF7C 1ZDQA 5B1KA 5I26A 4BWUA 2VM3A 4KOCA 1JZGA 3QJSB 2OV0A 4WTQA 1PNDA 1VLXA 4GP8B 2GSMB 1CYXA 4HCIA 5D4JA 3WKQA 1FWXA 3ZBMA 2WO3B 1FFTB 1NICA 2NRDA 3S3BB 1KBVA 2W88A 3CVDA 2EIKB 2XXGA 4P5SA 5B3SB 4BWTA 3GXUB 1OCRB 1JZJA 4DP8X 1JXGA 3FSZA 1SNRA 4A2EA 2ZONA 3WNJA 3RYMA 2FTAA 3T9WA 1JXFA 1PZCA 2A3TA 1AACA 1ILSA 1ASOA 4NB7A 4JHVA 3X1FA 2FQFA 3UAEA 4A66A 1RCYA 4AKQA 4YSAA 1WS8A 3GYRA 4X4KA 1QLEB 4KO9A 4CSPA 3ABGA 4G7QB 4DP7X 3DTUB 4YVUA 1V54B 1TKWA 1MDAA 2IH8A 1NINA 2Y1AA 3CZUB 4WKXA 1OCZB 5I5MA 3OQRA 2PPFA 3NJKA 3TBCA 1KYAA 4A68A 2WSDA 2XVBA 3G5WA 3FU8A 2IDQA 7PCYA 2QT6A 2VSMB 3PXLA 2BP0A 3QPKA 1GSKA 2YAOA 3UACA 4N4YB 3QJVB 2FNWA 1ET8A 2GB2A 3WIAA 1AS8A 2BWDA 2YARA 1W8EA 4YSOA 2BP0B 2GIMA 2X87A 3AY2A 1PCSA 3FQ2A 2YAMA 3NSCA 5B1BB 1PZBA 5B1JA 4HIPA 5D4IA 5IY5B 4E9SA 2FWLB 3FYIB 2YXVA 1NDTA 2XX0A 3ASOB 4G7RB 1OOWA 3UADA 2IWFA 1AG0A 2TSBA 5I5JA 1JOIA 4Q89A 2FT6A 3DKHA 4HAKA 2XU9A 3SBQA 1AG6A 3WG7B 1E67A 3EF4A 1PF3A 4ENZA 1AZCA 2ZWNA 4KO5A 4HCFA 2YAPA 1DYZA 1NWPA 2UX7A 1E5YA 2IDTA 3FYEB 2J5WA 2BWIA 5I6OA 1RKRA 2I7SA 5A7EA 2ZOOA 2DY2A 3FSWA 1PAZA 1WA0X 2PLTA 4L0PB 4UANA 1X9UA 2J56A 1QHQA 3S8FB 2AFNA 3TU6A 4YSSA 1PLBA 3V9CA 2BZ7A 4E9TA 2PPEA 2EIJB 2CALA 1PMYA 1AAJA 2VW6A 4E9YA 1AS6A 1AOZA 5I5IA 1NZRA 2PPCA 3AZUA 3HB3B 1NIFA 1KDJA 2AANA 4GYBA 3WKPA 4A2GA 4QLWA 4ZK8A 1WAEA 4DP0X 3T6VA 1L9TA 2DYSB 2DWSA 1GS8A 3NJHA 1BXAA 1RZPA 1ZIAA 2YAQA 1KGYE 1SHXA 1A8ZA 3QQXA 2VM4A 1MG3C 1ET5A 1IUZA 1J9SA 3CVCA 2BZCA 3FPXA 3NSYA 1NPJA 5B1JC 1J9RA 5AKRA 4A2FA 1BEXA 1JZEA 5I6KA 4KNTA 2Q5BA 1DZ0A 2YQBA 3PAUA 5E9NA 4F2FA 1FA4A 3N2JA 3WNIA 1OE3A 2FT7A 2XXFA 4KOBA 2UXGA 3S8GB 2N0MA 4QKTA 2CCWA 4E9QA 6PAZA 1JZFA 1XB8A 2UXTA 1M56B 1IC0A 3UGEA 2HRGA 2VW7A 3NP3A 4F2EA 1GS7A 1SF5A 1A3ZA 1UATA 3NSDA 4YL4A 1N68A 2PP7A 2XUWA 1V10A 4HALA 1GY1A 1BXVA 4E9RA 4GY4A 3OMNB 1EHKB 4AZUA 3PAVA 4PAZA 3X1NA 4YSQA 5ANHA 3PPSA 3UAAA 2DWTA 4DP4X 3TBBA 3TASA 3NP4A 1AIZA 2AZUA 1KCWA 1E30A 1KBWA 1OCCB 1OF0A 1V55B 1R1CA 2BO0A 1F56A 2I85A 2HXAA 1HFUA 2HX8A 1T5KA 3N55A 1ZDSA 2W8CA 2VMJA 5F7AA 4BWWA 3FQYA 1W6WA 1L9RA 3NJMA 3NSFA 4JKNA 3ERXA 3NJLA 1ILUA 3OMIB 3KW7A 1SFDA 1PLCA 4AKPA 5AZUA 4DP5X 1N70A 1YLBB 2XV0A 1ASPA 5EHFA 5TK2A 3EH3B 5I6PA 4AKOA 2HLEB 2PP8A 1AS7A 2ZXWB 4HCGA 3SQRA 1L9SA 1NIEA 2YXWA 1SF3A 2CJ3A 3U25A 1L9PA 9PCYA 2UXFA 4FA7B 1AZBA 2FQEA 2P80D 1WA1X 4HZ1A 1TU2A 3H4FA 1JXDA 1IBYA 2CBPA 1AZUA 4PCYA 4M4RB 1A4CA 1QNIA 1SHWA 2FQDA 4BDVA 2CUAA 3EHBB 5B7FA 3X1EA 1J9TA 2JFCA 1AQ8A 1WA2X 5AFAA 2QDWA 4BDVB 2BHFA 2R7EB 2UX6A 2GC7C 2PPAA 2PCFA 2J55A 4DP1X 2X88A 1BQ5A 4YSRA
chains in the Genus database with same CATH superfamily
3S37H 1QLFA 4BA8A 5C0GA 1WVZA 2NY4D 3GZOA 3TVMC 3BVXA 4J3XA 3V4PH 5GPRA 5C8JA 4AQ1A 3P73B 2OTUB 5IQ7L 4JFEB 1GGYA 1KJ3L 5IGXH 3FFCE 2X4RB 5KUMA 1SJMA 4DO6A 4HULB 4TSBH 5AB1A 1FIGL 1JV2A 2AXHA 1OTSD 2WLIA 2Q6WA 5JXAH 2WXJA 5BO1H 1VADA 5LBVA 2PYED 4ZPTB 4ODVL 5DK0A 1ERNA 3BZFA 3DIVA 1OGAE 2CH8A 2Q3AA 3BQVA 4K9JA 3IGKA 4YZFE 2GHZA 5C6WH 1MY5A 1OQXA 3RTLA 5K9JL 1LP9F 4D9LH 3FSOA 5IG7A 1HEZB 5D7SH 5F0MB 2IAMD 3SCMC 4BD4A 5CLTA 1DVSA 3QEHB 3BVWA 2Q20A 1U6AL 4OF8A 4OIFA 4AJWA 1LWHA 1I7RB 1LDSA 3U1PA 2J1ZA 3VVVA 1IGFH 4UIMA 3W57A 4RMUA 4UV7L 1AKJD 1A47A 3U83A 4NQCA 4R90H 2ITFA 3RWDA 4W9KC 2AJUH 1ASQA 4WZ9A 3ZKXB 1RMFH 4Y4HB 1J9CT 1JGIA 2YXFA 1DUZB 2CRYA 4NQEE 3EGSB 1PSKL 4PGBA 5EZPA 3B2PA 1W9XA 4Z18A 1YNTA 2NOYA 3C5SA 1R5WA 3VI4E 2WMPB 3QVAA 5BPPA 1BQHG 1TUPA 1R3IH 3Q5TA 1CD1A 1ZRUA 3D0VB 3DDGA 1IZJA 4KUCF 4AC4A 4DTGL 3WAJA 2XV2A 4WGVB 1S9KC 3TA4D 1K4CB 1CBVH 3TCLB 4UQ9A 4JKMA 3CN0A 3UMNA 3T0DA 4RFEB 1G9ML 1MAML 3EH1A 3WNKA 1M42A 1JAEA 1G9HA 2IF7A 4HKBB 5IV2B 2J8UE 4WTXA 3NA9H 2ADGB 2JNZA 2QVIA 4M4PA 5E08L 4LEXL 2NY0C 4LLWA 1FNHA 2EDXA 3G08B 3V9EA 2AK1L 2CBOA 2LU7A 3IEAA 5JHDB 1GGBH 3BVDB 4FFVC 4N1HB 1ET7A 3MXVL 4RWYH 3QUHA 4BKLB 1GCFA 4QO1A 5CN1A 2VXUL 1JHLL 4LSVH 2WTPA 4X7TB 2LE9A 4BZ1A 1GTNA 1GSMA 4I89A 2A77L 1VKXB 1U2YA 1N2RB 4JJ5A 3AM8A 2NW2A 1OHQA 4HKZB 1LDPL 2WQ8A 3E8UL 5JXED 1EDYA 2GT9B 3IBOA 3OMAB 4N0YL 5EUOE 1ZLSH 5IHZA 1KLGA 3ARFC 3Q5OA 1RP8A 2HSIA 2NXZD 1USZA 4IBQA 4JY5L 5IFJB 1WFOA 3FPYA 4FFWD 3BUPA 1KYUA 4NM8L 2GPZA 2E7LA 4WIQA 1A1NA 2XTSA 2Z4QA 4OD1L 3Q1EA 1CU4L 4BIKA 3D85B 3ILPA 2FLRT 3PQYD 1SXAA 1UZ6E 2OYPA 2X70B 3S36H 2C9XA 2YPLD 3ASNB 3BSZL 1RSYA 1TMCB 2ZUQC 3ESUF 3P3YA 3QZWB 1SPDA 1THAA 5PCYA 1CVSC 1M53A 3V5DA 2EUVA 2BP8B 4HH8A 1E65A 3S3SA 1IAKA 4K3HA 1I3RB 1T4KA 4W9FC 1A6TB 3KBEA 4HHWA 1B3JA 1FNGA 5I8CA 1WBXA 4MZ3A 4UQIM 2ZYHA 3QR2A 1MN4A 3DX2A 1PZUB 3VWJC 3DXAB 4P49A 4H8PA 4YK4C 1NUFA 1DQJB 3WIHH 4GMSH 1I7UA 3EOYG 4M5ZL 1IEBB 25C8H 2X38A 1I8IA 3KPRB 4U3XA 5C08D 3TBSB 1QRNB 4FN0A 3V6ZB 2ZCLL 4DHLA 4Y89A 3S98A 4E5XG 4LLMB 1SFHA 5GGQH 1XB6A 1U8PB 4U1GB 2XN9D 1CICA 5DJXA 2H26B 4B9PA 3ROLB 3OZKA 3ZIYA 1TZHB 2DMHA 5HY9B 4JG1L 3K72B 5L2KB 2ZG2A 1UVQA 5HHOD 5J06A 2NY2D 4J28A 1NOFA 3UFIA 2P4AB 5L7XL 2JB5L 3HPLA 5T1LD 1MREL 5JHMA 2BVUA 1JZIA 3QXUA 1VPOH 3I75A 4W9ZA 3AG4B 1RL1A 2YEZA 2NY1D 1MXDA 2NUTA 4PS4L 1U58B 2VQ1B 1MF2H 4NSKA 4YGVA 5F9DC 4Q4EA 1DANU 1E9OB 4X9GA 3LEXA 3I3BA 3SYAA 3DTDA 1Q9WA 3NIGF 2RQ8A 2Y7MA 5DVOA 3BT2L 4B97A 4GXVL 4BWUA 4MCZA 1DBBH 4AW7A 2DLFH 1CLOL 1VLXA 3APCA 2VN5A 2WTRA 3VM7A 3BP6B 5D1XB 2QGDA 2BOBA 2CD0A 5GGSA 3UZQA 4QT5B 4ELKA 4ZUSA 2DTML 4BSWA 1JUFA 3FTWA 4LIQL 5DJYA 2WO3B 3M1BB 2ZF8A 2PXYC 2V2WA 1EJ6A 1LO0H 3Q6GH 5DD1L 3U36B 4BINA 3HE6D 3B7UX 4C56D 4Q2ZB 4Y8DC 4DK3A 3QIWA 3VB9A 2DKSA 3RJQB 3FQUA 3A6OA 4YDNA 3TNNA 3WKML 5F0JB 3TO4A 2K78A 3VI3F 4WWPA 4R26L 1RSFA 3N44F 3DURA 1ORQA 1NC2B 1TYRA 3MRGB 2WZPA 3NZHL 1F3JB 5DQDL 5HGDB 2NUPB 3OG4B 3QORD 3M07A 4O4YL 3T6QC 2P5EA 4Q52A 1IE4A 1ILSA 5E5LA 4KMTL 1RZKC 2B9AA 3O9WA 4NAMA 5CSBA 5GGTH 3X1FA 1S7RB 2BNRE 1KXVA 4GUOA 1E5CA 5IIEA 4I1PA 1FRGH 1E7UA 4F37F 1L9NA 5A2AA 5AVSB 2AITA 4NQSB 4NO2A 3PREA 1AD9B 3BSHA 4XOEA 1U8NB 1MY7A 3UG5A 2PMZA 2KKQA 2CM6A 3I9IA 3M88A 5DJAB 4TVPH 4P4KC 3GKWL 2V9UA 1FJ1A 2FJHB 1FVDB 4FA6A 1RUKH 2K70A 3R06A 4JR9H 4MMZB 5EC2B 5E6ZA 2IOMA 3AXIA 2XVBA 3IXTA 5IMMA 4Z9KB 3IDXH 4HJSA 3PDDA 4K7PY 3IRCA 4FQ1H 2D3JA 3MRCB 3RRQA 2FNWA 4RETB 1HXYB 3NABH 1MIEL 4G9FD 4LF3B 3D39E 4ODBD 2I5YL 3IGFA 4UZSA 1ZV5A 4JHAL 3DO4A 4HIPA 1DSFH 5HJBA 1QBMH 3O6ML 1OB1A 1RZGB 7FABL 3GC3A 1FLRH 3HG0A 1NDTA 3ASOB 3RBGA 4EUPG 1J5HA 2K6YA 3TURA 3OXRB 4U1LB 2WXQA 1OP9A 2JQMA 4NRYB 1FGNH 4ODWB 1ETZA 4KDVA 5E2VL 4AQAA 1DJGA 35C8H 1YN6B 4AE1A 1I8AA 3EF4A 5F3HB 3N0PB 3ZPDA 4PJAF 3VDAA 5FECA 4H7VA 4JFDE 3TZVD 4WO4A 3S4SA 5HGHA 2IDTA 1KBKA 3IJHB 3QUZD 2ZX7A 4DEPB 3VMOA 1P7QD 4CDGC 3CN4A 3GXPA 4KKZA 1AGDB 1WA0X 4HUUB 2P5WA 3CLEH 4YHYC 1NKGA 4D8PB 5EO1B 3H7BB 4OT1H 4P23A 5I1HH 5JO5A 4QRQB 4OY9A 1OT4A 4N0UA 1GHFL 4JY6B 4FYTA 3ZDXF 1IGCH 4K9EH 3BVUA 2ZCHL 5I5IA 4GG6B 1ZTMA 2VC2H 2E9WA 3L4ZA 3RDTA 1OAXL 2RFXB 4X6CE 1NIFA 4Y2DD 1EQWA 4XN1A 2WLNA 2X4NA 3WKPA 4ODHH 1T5XB 3RWHB 3EJTA 5CJBA 5BS0D 2Y5QA 2X9XA 4P5MA 1G7JB 4Q56A 1Z1WA 5F71A 2FUQA 5I1DA 3AY4C 1DBJL 3OHMB 2PABA 4KKBC 3QQ4B 3AROA 2MH4A 4HOZA 4TNEA 3WIHA 1BLNA 4DGVH 3EJRA 3QJZA 1BBJB 3MRRB 3QIBA 2ZCZA 2NX5A 5H4ZA 2P48B 3VXRB 4HUVB 5K39A 1CIDA 4QY8A 1UXLA 3QUMB 4ZX3A 2D31A 3VFPB 3UBXA 1OM3L 2XWRA 3JWDH 2UVEA 3BIAX 2X0UA 3ZHFA 1H6TA 4RZCB 5HVHC 3HHRB 4M6MH 5A16A 3MYJA 2OZ4H 4JZJC 4Z7VE 1TJXA 5IB5A 4XXCC 4F2EA 4L1TA 1YQ2A 3GSXB 5BO0D 1F11B 4HK3N 4YL4A 3QDGA 3TOPA 4YL9A 4FXLA 1DVFD 5JNYA 2HFGL 3CZFA 4DPRA 3FUMA 4K3EL 2A9ML 2BJMH 3M17A 1SYVB 4X9HA 3F3HA 4PAZA 4S1DC 2ZE0A 4ZTOL 3ETBF 2R1XB 4R8WH 5ANHA 5JIKA 3S35H 3WS3A 2VIRB 4DP4X 4H25B 4NKIL 3ECBA 3QNFA 1HINH 5G2NA 3V4LA 3NH7L 1OARL 4HV8B 3KYOB 1N64H 4ONHB 4C83A 3F62A 1KCWA 5T3ZH 1HJBC 1Z9NA 2Y5TA 4NBYB 3BUTA 2WZAA 5FV1L 1QFWI 3MRNA 2A2QT 4YC2B 3GBDA 3CC1A 3P3UA 2QSCH 1LEKB 1EZUA 4NWUH 5AVZB 4HXBL 3B8YA 4YDJA 3TJEH 4NIYE 3RVTC 4RMSA 4X6EB 3NJMA 2PW1A 2R29L 1OSZA 2OSWA 2OTWB 4YBLB 4PS3A 4DP5X 5E00B 5I0DA 3HLKA 5KW9L 3QR1A 4X5WA 4OZHE 1NMCB 1D5ZB 3QCVH 4PW4A 1E4XI 3T2LA 1PFCA 5GGTA 4PJ8B 1ZT1A 3CLFL 3LH9A 3PXHA 2YKLH 3IFLL 4H2AA 1TVDA 3O3BB 1BGXL 1SF3A 2CJ3A 4I5BB 3U25A 3ARWA 5KSAD 2DQGH 2UUDK 3NACH 2BOCA 4D2NA 1AGEA 2XG4A 1Z0NA 2EO1A 5CS7A 5KANI 3U2IA 2GVYA 2L04A 1DQTA 2G30A 4XPBL 4ADGA 2QADC 5I1CL 5H8DA 2F5AH 1UHVA 4WWKC 4LCWD 5BZZA 4UT6H 3EFOB 3F7QA 4LOUC 3CFJA 5AFAA 2BHFA 2CRIA 2GG1A 4TNWK 3IJYB 4GG8B 3OGCA 2FECL 2BSSB 1V3MA 3Q8EA 5DC4B 1T5WA 2MHAA 4LFHG 1GGTA 2A9NL 3LDBB 1T66C 2X1XR 1I1AC 3K8KA 3SPVB 1GCYA 4RH4A 4XVSL 2UXVA 4IHOB 1WZMA 2LVCA 3H9ZA 3NJGA 1QKZH 3P9LA 3SE4C 3JYBA 3US1A 1JZ3A 2F5BL 3PG2A 2K9FB 2OMWB 4LHUB 5GQBA 1H5BC 1Q9OB 1NTDA 3DPBA 4U6XB 2ODHA 4JO2L 3ZUNC 1KXTB 3C2SA 4G80B 2CXGA 2VXTL 4R7NB 4Z7UB 4XO5A 4DVBB 4Z8FL 4M8QB 4U3HA 5DUJA 3VXUD 1UJ3C 2C7UA 2OMXB 1YY9C 2YPVH 3KGRA 4JPKL 1AP2A 2EC9U 3CFEB 3ELQA 5KTEL 2ZYSA 5T1DL 2WZ6A 4KHXH 4B0MM 4DIXA 4MNGE 3RPIB 4OVVA 3K71A 1PDKA 2BSBA 4UI2A 4S1SL 5BRPA 2G5BA 4HWZA 5LNDA 1ZV2A 2ITEA 4L8CB 2PR4H 3BZ5A 3ZE1B 2XKUA 4ODSL 1C08B 2UZYB 3GK8L 1CTNA 4PJFB 2FO4A 5F7DB 3KH3A 4DFIA 1NCTA 3SKNA 2EO9A 2DIJA 3V55A 4P59L 1YNKL 4AX3A 3MRJA 4QAWA 1XSIA 5LGYA 5C6PB 3JV4B 1B0RA 3FQ1A 3IETA 3PV7A 4AWJC 3EH4B 4M7LL 4HX1A 3SKMA 3FS9A 1TJGH 1U0QA 1JI1A 4YDMA 4NHCH 3KM1A 3NJIA 2W95A 1S9VA 5HP5A 3V4PL 3FTGB 1M3JA 3E7JA 4G43B 2BK8A 1IGTA 4PJCF 5E4EB 4KKLD 1FL6A 5JQIB 4FGMA 4L3CB 4E42B 3TL5A 4MTMA 1SEQH 3F01A 4KRMB 2H3XC 5INCA 3CZNA 3PWVB 1R3LA 4G3YL 1EXGA 4TSBL 3ZZ1A 5IHUH 1ZPUA 4F7CA 1URZA 1A14H 2XWZA 4UQEA 4GUCA 4HS3A 1P69B 2XFXA 3BPNB 3RE0A 1FL3A 4Z5RB 2ZICA 4JFFE 4CRPA 5I71C 5CSGA 3MV7D 1IGMH 2C9RA 1BVKA 3PU7A 3DV6A 3ESOA 3D8MA 4M93C 2ICEC 4XN2A 3ZTNL 3S3CB 2BRRL 5HI4D 5JA9A 3GT6A 2OZ4A 1BJ8A 1DLHB 4V1DA 2AK4A 3GBEA 1J1XL 1F6AA 1IGFL 1T0NB 3GSNH 4EBQH 5FOJA 1RK0A 4JREB 5IROD 1MIMH 3QQDB 3HC3H 3AS2A 2ZSVA 5AKSA 43C9A 43CAB 2GAZB 4YHLL 2G2PA 4KTYA 4JHWH 1YEIL 3ALXA 3GXMA 1RMFL 1TVHB 4XODA 5KVDH 1J0HA 3HAEB 2WLLB 1H3PL 2DJSA 1MI5A 2VR6A 1QFOA 2FSEB 4JO4L 3LXAA 5JHAA 2EYTB 1JSYA 2C26A 4APQD 2X9ZA 1J8HB 3B2XA 4PP2A 1PD6A 4JM2B 3WUWB 3S3JA 1CDYA 3CHOA 1F58H 4IU3B 3WTWA 1HWGB 1ZLVH 5CGYC 5D7KE 1OO2A 3CUPA 4FHKA 5LWYL 2XZQH 3QWRD 2A99A 3C60C 3T1FB 5AVVB 4DPCX 3AWGA 3MNDA 5TFSH 4IJ3B 4LDLB 3FFCB 3IXAB 3LS4H 4JFEA 3POHA 1MW2A 3FMGH 4O51A 2L7JA 1NGPH 3QDJA 5DS8B 3RWIA 5I82A 5JPNA 3EOTL 3RGVD 4K0OA 4Y88A 2NLJA 2R59A 4MAUL 4RWYL 3WUWG 1VEMA 2DM4A 4IRJD 5CAYB 3ISWA 4KV5E 4LSVL 4Q9CA 5T3XH 4JFOA 2NCMA 4KRNA 3TYGH 1JZ6A 4I9WE 1KGWA 3O11B 5D4HA 1OGAB 2CIKB 1N3NB 5D1QB 1EEUA 3D18B 1R5IB 1INDH 2XG5B 4PS8A 1UWFA 4X6DF 4UNTA 4LSRH 1ZLSL 5EUKB 4HLJA 1T2QL 4PRHE 2Y9RT 5F0LB 2LAGB 4MMYA 1N59A 2FE0A 3F58L 2WANA 1CLZH 3VD1A 2BIIA 5E4IA 4YIQA 1UXSA 3EH5B 5E2WL 5I74C 5HYJA 3CZSA 1QNZH 2E6QA 3OPZH 5C09E 1T2JA 2DTSA 2IXQA 5FYKL 4UF7C 5D93B 4C4BA 3EJYD 1QATA 4KOCA 3V0DA 2C7FA 2VXQH 4LDEB 4LAQL 4KZEL 5HHQB 2AV7B 3PHSA 2D0FA 5JOFB 2X40A 4NZDA 2OMYB 5HYSA 4Q58C 1IC5L 3BUIA 4NWTL 5B21A 4H0GA 3JT0A 2CHZA 4YHPB 4NI6A 3FTZA 2V6HA 3DA0A 3U4EA 25C8L 2NY5C 3K4DA 1L7TH 3OKOB 1O5PA 4OZHF 4RQQA 1YEDB 3DVGB 5DEFB 3RA7H 4OZGF 2DMGA 3FB8B 4UOZA 3IGUA 5BUPA 1TSRA 1Q0YH 3N1PC 1ZLVK 2W0PA 2YPVA 4WW2A 2FL5A 3LTVA 1DFBL 2R0WH 1T1YA 1JPTH 4OBSA 1T7VA 1KOAA 3MR9B 5JW4N 2Z3FA 4I3GA 4Y5VC 3P0VL 3TLRA 5GGVH 4ZMTA 4PJDB 2AXGA 1K2DA 5FYJU 1T03L 5DHVH 3DMMD 1N2RA 4RDQF 1WZAA 1OCZB 5EUOB 3RWGA 4NQQA 5IW1B 4Z7NB 2HMID 2H9GA 2EC9T 4H88H 4Z3JA 5CCJA 3TVMB 3QCUL 2XQBL 2DS4A 3MKGA 3GSQB 1A9BA 3CX2A 1U8HB 3MV8D 1Q9LA 3VMPA 3H2PA 1JPFA 2AKRB 4MB4A 3HZMB 5F7HA 1F00I 4J3OD 1HZHH 4FQXA 4Y1AE 1DBBL 4OLWH 2DLFL 4Z7QF 2OCFD 2R0LL 1PZDA 1EJOH 4BE5A 2YAMA 5B1BB 1DEEA 2BNUB 4JM4H 3IJSA 3FN0H 3O4LE 3Q6GL 1LO0L 2DLEA 4FNSA 2RJMA 1I1FB 1QD0A 4F9PC 4G1MB 4MJ6B 1UACH 3LD8C 5IW3A 3LRGA 4QTIL 2WBKA 2XV6B 3QZLA 3LKSB 2Z8VC 2NDFA 3DK0A 2JKIS 3SCMB 1QWHA 5K9QG 2L4OA 2Z8WC 4WFFD 1AXSB 4N0FA 5K59F 3WG7B 1DQJA 5EFIB 2IGTA 3T0XA 2YR3A 4ZMXA 4A7VA 2AJ3A 1JZDC 3TTYA 4X5QA 3AU0A 1TTBA 1F0LA 3SD5A 3V6ZA 5D1ZC 4G2AA 4FLOA 3M8OH 2YRPA 2J5WA 2HN7A 1U8PA 3VFSA 1FRGL 1D7DA 5I6OA 5I9QC 3MU3A 1U8JA 3BFWA 2H26A 4I2XA 3QFGA 3OKYA 4XHJC 4HIHA 3ZMNA 3TWYA 1AJ7H 3GSNA 1A2YB 4A7GA 4EMZA 3HVDA 2C4FU 1E4XH 3V4VL 3BCFA 5KYYB 4XOCA 1RUKL 4IBZA 1XIWA 1DQLH 5DRZA 1KB9K 3V0VB 1DSYA 4ISVB 4V2CB 3WJJA 4PJEF 2WUBH 3IDXL 4PB0L 2C9AA 1IFHH 1P84J 2ZXGA 3NABL 3NDYE 4MNQA 2VR4A 3KPOA 4H1LB 1FAKT 5D6DC 4JFVA 5FK9A 3WLBA 1U58A 3KG5A 5GS1B 2DQDL 2AJXH 2ZXCA 3U46B 3QBTB 1DSFL 2NY0B 1W0WA 1ZVNA 4LL1A 3SZKC 2GJZA 4ZFFA 3ULVF 4WKZB 1AVAA 2HJLA 3EGXA 3V6BR 5D8JH 3BVTA 5D1XA 4AYID 1TJIL 1JF1B 4JMNA 4LRNL 1FZMA 3B7SA 4FXTA 1JDAA 4MJIB 3CVCA 3KWXA 4MVBD 3SGJA 2DBJA 4PGDB 3O2VL 5G4NA 4E41A 1JZEA 3L3DB 5I6KA 4OFKA 4Z77A 1Z66A 4PJXF 2C1OB 5I30H 4O02B 1NFDE 2CHWA 2ZWLT 4IM8A 2WBWB 5DS1A 3S8GB 2N0MA 2WNKA 5HGDA 4CKQA 5BZDA 1NEPA 5BRZD 5J11C 3LKOB 2BNRB 4FQHB 1HSBB 1NC4A 2X4SA 2W60B 2VAAA 2ZUWA 4Y4KB 2GSIB 2XFGB 2VABB 4WFHE 2UY6A 3UTSE 3BEWA 4E9LA 1NDMA 5I66B 3QWOA 3IAGC 3HG3A 4HALA 3WE1A 2QR0B 4DCQB 1VCBC 5BQDA 1YCSA 2WHVA 3MJ9L 3I3DA 5IEKB 1ZMYA 2Q3ZA 4ZQKB 2ENSA 3GMPB 1V3JA 4XNXL 4JGJA 4YK4B 4YHIB 1NCUA 2VXQA 2BSTA 4HYTB 4B6ZA 2EUWA 3B3IA 5I0YA 4LGSB 2DBLH 2WXOA 2C1PB 2Z6FA 4QRFA 2HLAA 3HPJB 4XRCB 3LKNA 3RX8A 1FNEB 1GC1C 1E6OH 3U30C 1P1ZA 3W11D 3PWPB 3E2HC 1EV2E 4ONFL 2V9RA 2OJEB 3DYMA 2PYFA 3TEUA 4X8CA 2DD8H 2OR7A 3ZGIA 1EAPA 4NKQB 3EYUH 3NJLA 3VA6A 2VLRB 4EVNA 1FFPB 2IAND 3OMIB 5ID1B 4U1LA 5F89B 3ESNA 5E95B 1KYOK 5AZUA 4HVBA 4YXKH 1XCXA 3EO9H 4DKFH 2MCAA 1JS4A 3JWDL 5IMKB 3EH3B 4I3SL 5HHXL 1D5BB 3L9YA 4OFPA 4M6ML 4NNPH 5ALCH 5HYQA 3MUZ1 3Q3GB 2N7BA 2D3LA 5AZ2L 5FB8A 2IH1B 3ARPA 3V0HA 3C6LA 5KOVC 4OJFH 5JW4R 1BX2A 5DHVA 1RH8A 3AREC 4HPOH 1ANUA 3FB5B 3LNHA 1MCIA 2NNFA 3I6KB 2NY3C 2XWTA 2IWGA 2X7LB 3IB4A 3DX6A 4BCZA 2HUEA 3AT9A 1K9TA 4FNQA 3QFJD 3WFHB 5DYOA 3S0PA 1WAAF 4HFWB 1BQLL 1QNIA 1KTBA 3GSVB 4QRRD 4GH7B 4NPKA 4QRQA 4R8WL 2R2BB 2VDPH 4QRPB 3BKCL 3LS5H 1CPUA 1OP3K 3S35L 3N42B 1JFHA 4BH7A 4WJG3 4GT7A 2UWEE 5DR5H 3GBLA 4BDVB 1HINL 4UTAH 3MRDB 2B1HH 4X6CB 3B9KD 3MV9D 4ZO9A 4YSRA 2PKDA 3IAQA 4TF4A 1ZE3C 5T3ZL 4P3WA 3EXJA 4QOKD 1I1RA 2WXIA 4XMPH 3ILQC 1A4JB 1DVUA 3D25A 4MX7A 2O61A 3ZRCC 5DMKA 2OBGA 3DROB 4GBXB 1F8TH 3BC9A 4MMXA 3S4SG 5D2LF 4MDJA 1DQIA 3T77B 3UO1H 2WO4A 2VDMH 4PJHE 3LMJH 3GNML 4R0LB 1ZCRA 3HC0A 5JQ6L 3CHSA 1V3KA 3CPLA 4G6AC 4TLKA 4HHAA 3CH8A 5EEXA 1JK9A 3L5WB 3H55A 1PZ3A 1I8LC 3OD3A 1IBZA 3QXAA 2WIIA 5ISZA 4YJZL 4XNAA 2EH7L 4A04A 3SKJL 1YNLH 1N6QL 1BBJA 1T0MB 3MRRA 5E6IB 4UT9H 2J88H 4O2FB 4RMTA 3VXRA 4PRPB 3ZHKA 3KL3A 4JRXE 2A1WH 3IDGB 1YEJL 1DJIA 1GJWA 3IDYC 3NACL 4P07A 4F7PB 2JJSC 4Z7VB 3CXDH 4Y19B 2V8MA 5DZLA 4QIRA 2DQ6A 1BOGA 4YDLB 1PPIA 4JLRA 4ONGL 4AI7A 3CDZB 4U6YA 5EO9A 4BXSV 4UT6L 3G7TA 2I60H 1LP9A 1T2XA 4N5ED 1H19A 4H4NA 3IE9A 1GGIH 4GSRA 1NA8A 4ZFOB 3PDGA 5FGCB 4W9DC 2UY7A 2E47A 1MFCH 2FNBA 3C5XA 2VIRA 1QBBA 1X7SA 4U6HA 3FRUA 3M7OA 1KYDA 3MNWB 4G8GE 2MEJB 4G7SB 1OOAA 3KYMA 3BJLA 1QKZL 3HMWL 1BQRA 1L9OA 1VCAA 2O72A 3A22A 4LCVA 4OB5H 4YDZA 1DTUA 3Q2VA 1P5VB 1TF4A 3UBXG 1WDAA 1M7XA 2XYBA 3QULB 1BIIB 3S3PA 3AAZB 2QHLA 4JO1L 1ACZA 2X4UA 5KSVA 2ZYIA 5T1KB 3NCYS 1LK3L 3QJFA 4OZ4A 3I02A 1NIBA 4ZMLA 2DQMA 2OTWA 1UOLA 3G3LA 3DX4A 3K0YA 5DEGA 4K94H 1XFPA 4ORZC 4IOSD 4LVNB 1S9YB 1WHOA 1LK2B 1KYFA 5EZLA 4JKPL 4MKTA 3K4ZA 3UTQA 4CVZA 2GTZB 1RHFA 4YSTA 3OHXB 3E6FB 1XGUA 2PR4L 4YDVB 2P24A 5BVJB 4PY7B 1DJHA 2CDFB 3KLDA 2XX1A 2WSPA 2GUYA 5E99L 4EIGB 4M7ZC 1A6UH 2MKLC 1PLGL 3HUJA 1UEYA 1QLRB 2EILB 5DJDB 3ETSA 1QTYT 1ZA3A 1FYTA 1MJ7H 2X9WA 5DRXB 5LBGA 1FG2A 3BZ4B 1PZAA 5D7IE 3VD9A 1TJGL 4D0BB 3VFVB 1E4KA 5K1NA 5MENA 4NHCL 5BV7C 4JFYA 1QWNA 4YHNB 1TTUA 1I82A 3BN9D 5GHWH 1T1ZB 3EO0A 5IJDC 2WQSA 3M45A 3IJYA 4PJ9B 5ITFA 2X4TA 4AQEA 4Q9QH 1VESA 3P77A 3S5ZA 5IJKA 4N8VB 2Y69B 4L4TE 2WINB 4GKSA 3U2JA 2B1AL 5IHUL 1Q38A 5HVHB 1R75A 4NQDE 1IGIH 2FEJA 3EDJA 3D2UB 4L8SC 2EIDA 4D9QD 2TSAA 4OUUB 1EDHA 3PV6A 4R96B 4E9WA 1C5CH 4BFNA 1IL1A 3VRJB 4KKPA 3VWKC 1IEAB 4FXGC 4M8QA 1DHKA 4MAZA 4J8RB 1XO8A 3DGGA 1JNLH 5D2NE 4ZAKC 1JGUL 3SDDD 3N6YA 5J1AB 4HK3J 3RB7A 4EBQL 3FUHA 3I9AA 4MNGB 3U0WH 5FW7A 4OKVB 1HHKB 3TTSA 3RPIA 2NNAA 3ARZA 4V11A 3LRMA 4HPHA 4N87A 4JHWL 1OAUH 5C3IA 2DLGA 3HNVH 4P2QB 1EUUA 5HHNB 3ZHLA 1XGQA 1WEJL 1KNOB 2VQ4A 3EYSH 1ADQH 3IMVA 1TQBC 3FHEA 3QPQC 3OC8A 4ZX5A 1JPGB 5TJWK 4UTAA 2AGJL 3FZUD 3WFBH 3GUTB 3GBMH 5C9JB 3FTVA 3VXSA 2P1YA 1KY6A 3ETBJ 3QUYA 5CIPB 4L2YA 4YMPA 2WV3A 4X0KB 1S7VB 2Y7NA 3S5LB 2CGRH 2F61A 1JWUA 1A6AA 3I50L 5TFSL 2ZWYA 1XTLA 3O6LL 4KX9A 1MDTA 2PW2B 2W88A 5SWZB 3FBKA 2XQYK 1XSOA 5CEZD 4G42B 1BIHA 3P2TA 3JWNC 3SJVB 1MCFA 5HHPB 4KRPC 2C3GA 4AL8C 3T9WA 3VD4A 5D6CA 1HSAA 1Q72H 3L5IA 4JFFB 3UCQA 5EMYA 3D1MC 3MUGA 3TYGL 2QADB 3V0IA 4JFHE 3CQQA 3EF7A 2R56L 3MNVA 4W93A 3HI5H 4NB7A 3RHWK 4ZZFA 2FQFA 3PJSA 5C0BA 2ZXAA 1WS8A 2BSRA 3ARBA 3MBEB 4Z7WE 2KS0A 5CCKH 4P0DA 4F1ZA 4XMVA 3OZ9H 4OCXL 5G55A 3UZEC 1PIFA 3GMQB 5KYUA 1S7UA 1NGWB 1GZHC 2Y1AA 1SDAB 4QAMB 4H20H 2PWDA 5GZOC 1OGSA 1RIUH 1SJVA 3NJKA 3DHPA 1YEEH 4NFDA 3VYNA 3O8XC 4ATTA 1I1AB 4MWFB 2YFNA 4OZIF 3QQDA 1U92A 43CAA 5EZIL 4A7SA 1CQYA 2OMVA 2DQEH 3KGUA 4C59B 1NBVH 5A2KH 1M7IB 1I9IL 4TSAH 4ZBJA 3G5ZA 2ADIA 2GSGB 5DTFA 1W8EA 5IKCA 3VGEA 3NPZB 4X5PA 5EN2A 3SD2A 5D72H 3L3JA 4M5TA 1MNUH 1NEUA 4P2YA 4G5ZH 4WDIB 3LHPH 4XNZC 1Q8MA 3OR6A 1UD3A 3KPRD 1QRND 4OSUH 2R23A 4DZ8A 5FF6B 2ID5A 1L7TL 4L9LC 5I76A 1OCWH 1KCRL 4GO9A 3PRZA 1IU1A 4JO3L 3VA2C 1H6FA 1H3UA 3QHFH 3SBQA 3VFRB 2V8LA 4PIRF 4LSUL 2HRLA 4IGBA 4ENZA 1FL5A 2X3CA 5EZOL 3H9SB 1DYZA 1NWPA 3F05A 4PV9A 1A6ZB 2QLYA 4EZJA 5JDSB 1NPUA 5IB4A 5E9DB 2BWIA 4JCLA 4O02H 1GMIA 3VX1A 4BFRA 1QACA 3ILEA 2CGZA 5IW6A 4NI3A 1OGAA 1FH5L 4PBWD 4PJAA 4KY2A 4PRHB 4MD0A 4QNPE 3HRZA 1LEGA 2ZOKA 4JAMB 2G5RA 4LGPB 5KYWB 4J3BA 4YPGB 1A5FH 5IVXE 4PBVC 5CJXA 5C07D 4EAEA 4MA8H 5I16A 1HZHL 3IGAB 3MV01 3HC4L 1IB5A 2X9YA 4IKNA 4E9YA 3EUDA 4G6ML 3SDCA 1WFNA 1WD8A 2XQYA 3ZW3A 3JWNE 2H3NB 2Y1ZA 5C09B 4WUKL 4HF5L 1XH0A 1U3HB 5LCVH 1QFHA 4QTHB 3FN0L 3H9YA 1MWAB 4WUUE 4XI5C 1NCJA 3B56A 4NQEA 3D0LB 3PWNB 4JRYD 1Y7VA 3SE8L 3VXMD 1UACL 4M03A 2OPCA 5HHQA 3F65A 3K6SB 3VI4A 3ABZA 1KGYE 1CXHA 1QSFB 4F20A 4JCWA 1NMAH 2HA1A 4M93B 1IUZA 2ICEB 1UFUA 3NIDF 4XAKD 1KTJA 5CINH 1NEZA 1X5LA 1YAIA 2BIPA 3FFOA 4XPAH 4LP4A 4LKXA 1U8CA 4WV1A 4O9HL 4Q6IC 1PD0A 4OZFH 2Y7QA 3IK2A 1DZ0A 2AMGA 1CZ8L 1G7MA 2J8UA 5DEFA 1JYXA 3W37A 2VDRB 1LM8V 4KFZC 2AHIA 1WWAX 4QKTA 3NRPA 1EZVX 1I1YB 3L6FA 4ZXBB 5GS0D 1PVHA 3RDJA 2X3BA 1HIMH 3O6FC 1LQSR 2HRGA 4HXAH 3VFUA 5K9KB 2QQNL 1ID5I 4UU9B 1AC0A 3DUSA 1DQLL 4H8UA 5E7FA 4QUOA 4I0PC 3S6CA 4G6KL 3F7LA 1JV5A 4HGWB 1CE1H 1IFHL 3APDA 5EUOA 2Q7NA 1UA3A 5HYSG 1ADQA 2E9JA 2CK0H 3C60B 2Y07L 3PAVA 4ELDA 1A7NH 3ALPA 3VXQB 4YSQA 4EQ3A 3VFTA 1T1WB 2DWTA 3NTCH 4LASL 4PRBA 1OK0A 4KKQA 4NNYB 4HQQL 2CO2A 3NP4A 4N8CH 4TN9A 4Y5YB 5CZVH 2AZUA 3FH8A 2XWBB 4GAFB 4KROC 1WPCA 2FUTA 2QQKH 4HUMB 1BEYH 2O6CA 3ME0A 2YBGA 2YRBA 1OK8A 5D8JL 2EIEA 1MCKA 4UOW0 4XVTL 1UYWH 1CGSL 2ILLA 3KHOA 4G8FB 1DE4A 3BAEH 2FJGA 5IZ7A 5DVLA 3CSGA 3LPOA 2VDNB 4Q9BA 5CU5A 4I3RH 3MTRA 1I7ZB 5I73C 5CJQH 5J5EA 3KPMA 5KN5B 4QHLB 1RZKH 1VGKB 4JANA 3RILA 4AYBA 1OZUA 1JGVL 4L9DA 4QRUA 2PWFA 4WJ5A 1UWEH 4XC3H 3VFMA 3LKSA 3LPPA 2NY4C 3PIQB 3SCMA 5DRNA 3RVUC 4W9IC 5L8KB 1XF3B 5CZKA 4PUBL 1D6EB 2HT3D 1N5AB 5EFIA 2HKFL 3UPAA 3A0OA 1ZT4B 4K4KA 1KIUA 3F8UB 4GFTB 2YXWA 4Y16B 5JIDA 1QSEB 2UXFA 5DRWA 2HLFC 4HJIA 8FABA 4CVWA 1QZNA 2WQVA 2XWJB 3MTXA 3R4RA 2MQ3A 2EICA 1HHIB 3TBVA 3P4NA 1TU2B 4MB3A 2I69A 2VSCA 4GI6A 4GQZA 1O7VA 4WGWB 3V0VA 3DIFA 2OMUA 1KWGA 2Y23A 4WI4A 2QDWA 3SO3C 2KLSA 5JOPE 1JHKH 2J55A 4FLSA 3ALWA 5LG6A 1VSCA 5A1AA 2IOIA 1GY2A 2YS4A 1YY8A 1RUAL 3PHQB 4GIPD 1N8ZB 2X4PA 4XCEA 3SOTA 3RY5A 1GYWA 3SQOL 1GTFA 1J5OL 4FA8A 2VUOA 1X4XA 2QZ5A 4JY4A 3WMSA 4DVRL 1ZT7A 3NN8A 4HH9B 3EYUL 4Z7OB 4OCRH 3WHXA 6CGTA 4MAYC 4QR7A 4RAUB 4J1UA 4KJWD 1M7DB 5E8DH 3NQKA 3HG1D 3OJVC 1GKEA 5JW5A 1OPGL 2F54B 2AABH 4X7SH 1S5HB 3ZZLA 1R3KB 2F74B 1DZBA 4PGDA 1JP5A 5FXCH 1Y18B 2ED7A 4Z7WF 2FQGA 2GTWA 1NFDB 3ARFA 3BCDA 1C7TA 3BIBX 1QLEH 2NT1A 1CJYA 1VFBA 2WWOA 4XWGH 4O02A 1YEGH 1SDDA 1TFPA 5IM7B 4PFEA 2WWKT 4OJFL 5A40E 5TTRA 1SJXA 4AG4H 2V17H 4HPOL 2AI0H 1S4IA 1KB5H 5ANMB 3Q2CA 2BNRA 1EEZB 2CO7A 2J8HA 1IKFH 1SLWA 4WEMB 4XNQA 3V7AG 2OL3H 4QRTB 4YSEA 3BWAA 4FFZL 2WW8A 2VABA 2WSKA 1SYSA 2XVGA 1O6SB 3AW5A 3QO0A 3B4NA 4P46B 4YHZH 3X12A 1JZ8A 4IQHA 4XH2B 1M2OA 1FFNB 3PL6A 2R4SL 4DCQA 1J8SA 2NCEA 4FI8A 2B1HL 5C0CB 1FC1A 1CDBA 4MFHA 5LCVA 3H4HA 4JHZA 1XGPA 4WEUD 2FEEI 3PF2A 3VWJA 5PAZA 4NT6A 4FFWC 2FHBA 1RULL 1KCLA 2C3XA 2PP9A 2WYZA 3P54A 3QIUC 3D39A 4MA1B 1K3ZA 1U8OA 5D1ZB 3UO1L 2C1PA 3T6ZA 2EQDA 2AQ2A 3FAXA 2JK5A 2EIMB 4IEFA 3WE6A 1AD0B 4J3WA 3GSRA 1UQSB 4OIIH 4RMBA 2ATKA 4PJ8D 4OZFA 3ES6B 2QPEB 4UM9B 3T09A 1J7VR 4J2XA 3SODB 1NWOA 2PYEE 2YJLA 3DSFH 1FFPA 4LSPH 5CEYA 4UT9L 1JZ5A 3H6AA 3H9HB 4JB9H 2DJMA 2C9SA 3O3EB 2EEFA 4PREB 1WGVA 2E27H 2CO6A 4JFXA 1UB6A 2B16A 3CVHB 4QNPF 5DDHB 4JFDA 4O58L 2C9QA 2VRAA 5F21B 4LVHB 2AJYL 4KY1L 4ZTPH 4P5KA 3A23A 2BW4A 2I60L 2VLMD 3BPLB 3CHRA 1QPPA 3G6JE 2DYRB 5ACZA 4XNUH 3VMNA 1J1OL 3R1GL 3V5KA 4CMMB 2NY2C 3JT2A 2J6EL 2PXYA 2IGLA 2BSEA 1MFCL 1X3DA 5AW2B 5GRVL 1SUHA 2VZTA 3QG7H 3KLAB 1VACA 3EH2A 4GSUA 4NRZA 2P8MB 1JNHB 4LHUD 3LKPB 4X6CA 2NY1C 3T0EA 4QYAA 4Q9RH 4X5XB 3KL5A 1MHHA 4X9YA 4J12A 2VDOH 1KFAH 2EYRB 2YGQA 2YK1H 5I6MA 3GMRA 4PRAA 4DGUA 5BOZG 1DQQB 3KHQA 4OI8A 5E2TL 4JFZL 4GO6B 3WTVA 1G9MC 4J5VA 5CZRA 4F7KA 4KQ4H 1U93A 4IMLB 2AV1A 1XCQA 2CKBH 4ZSOE 2CZNA 3REVB 3GXDA 3BAYA 2WLJA 1Q4NX 1B90A 2JKWA 3MRMB 4JN1L 3WIFB 3HE6C 4JDVA 3KJ6H 2IDFA 4WU7B 4P4KA 2QFRA 3C75A 4CKVX 4NUMA 4N2FA 5IR1B 2XTJD 5B7MA 2AVFA 1JPEA 4GAJL 4JRXB 4O2FA 4DT2A 1IC7L 1QVOB 3IFPA 5JIPA 1JNNH 1OE2A 2OJZH 2WZ0A 3HLAB 3MQIA 3LKQA 1BFOB 3UPRA 3QORC 2JI3A 3ULSB 4XP4L 4FMKA 5DK2A 1EPFA 4CADA 3CX5K 1UADC 2OM5A 4FXKC 4PLJD 4Z7VA 3U48A 1HDMB 1NMBH 2CPUA 2X42A 2IWKA 1XB3A 3WFEL 5KWYC 1MJ7L 3PQYE 1NOLA 3BVVA 2YPLE 4N1CA 4PY8I 4Q4IA 3QXDB 4IBWA 3KWWA 2W0FB 4N90D 5GHWL 2ROYA 4TTDD 3AABA 2YN5A 4BV1A 4ZFOA 2NQDA 3GEWB 1T7YA 2IPTL 2EDMA 3UOAB 2ZD0A 4GUPB 3PABB 3U0TA 4ECNA 1QMUA 3RZCD 1AR1C 4YHMH 3GSOB 1Z9OA 2QPFA 4HDIB 4N6RB 1RUQL 1MAKA 4HP5A 1C12A 1WQVT 5C08E 4LLAA 1BJ1J 3QULA 3LZOA 4OGZA 4MS6A 3AAZA 1C5CL 1FNLA 2BSDA 3DI2B 5EH1A 3HVNA 4LZKA 2XN9E 1MELA 2KH2B 5ALBL 4OR1A 3FQNA 5ETUA 5SWSE 2V5SA 4J4PC 2W0LA 4PJIE 3NCBB 4KH2A 1BJ1H 3QQ9D 3L4XA 1G4MA 4N2DA 2EDEA 5MEPB 3CFCH 1RV6X 4NKMB 1XAUA 5FUZL 2W38A 4OZHA 1HE8A 2CDEB 1KB5A 2RB8A 2VZ3A 4JPWH 2R1WB 4L3EB 4ZI8A 4WNSA 5KANG 1DQML 1TZGL 4JZOB 1TLMA 2X89A 1CL7I 1PZ2A 1OAUL 3U7AA 1EGJH 5I5MA 2OL3A 3HNVL 3TBCA 5LBSL 4B95C 3TF4A 2GK0A 4YDVA 1ADQL 3KXFE 3SB3A 5CLXA 4LLQB 3P4OB 2CDFA 7PCYA 2XT1B 1XMWA 3WFBL 2ARJB 3MRIA 3GBML 4WU5B 5MI0C 2XIBA 1KBPA 4NZRH 3AY4A 3MOBL 1QI4A 5EU3B 4XCCH 1SN0A 3FQ2A 1K72A 3CBRA 4NQTA 1GYUA 2C5DC 3MOQA 5BZWA 1A4KB 1ULVA 3DYOA 4LHQB 5BVPH 3DX0A 3EJPA 1R34A 1J11A 1E9PB 1I4FB 4Y2DC 5AW9B 1L7IH 3QA3A 1SMDA 3IDYB 4L29B 1E27A 3DHMA 4X5LA 1RK1A 4Y4FA 3T8MA 3SE6A 3APFA 5HHXH 3EYVB 1X5JA 3IS1X 4JZJA 4RMQA 4P57B 5D1QD 4HISA 4XXCA 1I31A 1ZLWH 1PU0A 2YAPA 4R96A 5E6YA 2Z4TA 5FHBH 1KT2A 3GSUB 4BFIA 2CBTA 3EGDB 1KPUA 2X6CA 5CCKL 3WDHA 4LT7A 4N0RA 4LEOA 3IVKA 4J8RA 5D2NB 1HQ4A 3HI1A 3IDNB 4K3JH 1A7PH 2Z34A 2VR9A 4OQTL 3N1MC 1CI5A 3EJCA 1RIUL 3O41B 3WTUA 3DDFA 1HHKA 1WWCA 2DQEL 5CKGA 1DUYB 4NGHL 3WJMB 1VZGA 4TSAL 4Z1PA 4KVCH 4FJYA 4G9FE 5DA4A 2FR4A 1T22A 1CDUA 1D5IL 1OSPH 3MGTB 4A55A 4Y5XB 3K6OA 3AGVA 4ZS7L 1KBGH 1OT2A 3IPFA 4OM1H 3V0EA 4DP0X 1DVFC 2BY0A 5DJZB 3KLLA 4BHUA 3TEWA 1G0DA 1PKQE 1RHHB 5ESVB 4YS4A 1PQZB 3NJHA 4MBOA 2ZKXA 5F1SA 1UM6L 4H0HB 1U8LB 1UXWA 3GIZH 4JK0D 2PTTA 3VD5A 5I0VA 1J9SA 3FHAA 3HR6A 1SRDA 1AOHA 4HZLA 3CVIH 3ECQA 1J9RA 1TZIA 4P04A 1NOAA 1ODAA 4OD3H 3TH4T 2CKBA 4CN4A 5GRJH 4RZKA 5JR1H 2QGBA 3FUDA 3QJHB 5CZXD 4WY7L 5A3ID 5GGSY 1U8QB 1Y0LB 3V4UH 4O02L 3D4ZA 5DJ8B 3V6FB 3L3KB 5EU5B 4D8OA 5IEHA 2CMRH 1XGRB 2DICA 1T20B 1CDCA 4WWKA 3PGFH 2JCCF 5IOKA 3G6JF 5TDNA 2DQJH 4GSDH 1UEMA 1AHMA 3ULUD 1YN7B 2XUWA 5CU9A 3IU3B 1AYRA 4XPTH 3VGDA 1QSZA 2VDLB 4Z3IA 4LIQE 1S5IH 5EBLB 1YZZA 1E5AA 4MWFA 3RX7A 3MXWH 1BAFL 4IHBA 1FGVH 5CLWA 3N44B 4R4BA 3SE4A 3HG5A 5BS0E 1M7IA 5IOPA 1YAZA 3DI3B 1H5BA 1WIOA 1JI2A 3UTTB 3F7VB 3QG6B 5HYIA 4JZNA 4XP9H 2NY5H 3QNYB 1MWOA 2H1PH 3IF1B 4NZUH 5D70L 4K3DL 3VXOB 1I85A 4S0HA 4BYHA 3AS1A 1UJ3A 2ORBL 4FEIA 2EDOA 1ZDSA 1U3NA 4PR5A 2YSTA 2RH0A 2X53A 1UFGA 4XPAL 1G7LB 1HXMB 2P26A 4I18B 5HSFA 3MLTA 1QYGH 3MLYL 1GA2A 1EERB 2G3XA 2PCXA 4MCMA 5IK3A 5IQNA 5L88H 1SEBA 2R69H 4OKDA 5FM5O 5FS5A 1N70A 2J6WA 1G1KA 4ABUA 3Q44A 4POUB 1ASPA 1CF8H 3AITA 3CMOH 4XMXA 5DZNA 1MQ8A 2JIXA 1HIML 3O3UN 3OKEA 5ICXB 4ZNEE 2KLRA 1HHGB 3J27A 3KPQB 4HXAL 3V0AC 4GUQA 1CICD 1TG8A 1YECH 2A6KB 4XCFL 5KAQF 2XZAL 1CDIA 3F12B 1T21B 3VNZA 1EGJA 2YMXL 4DKTA 5I8OH 3LIUA 2G4EA 4ZYKA 3K74B 1Z5YD 5CD3A 5IVXB 2CO3A 2HG5B 1SM3H 3QFDB 1YPZE 1J9TA 1TZAA 2ZP8A 4GS7B 5B8CB 1OQOA 1KTRL 3IPEA 2RAMA 4TKWA 4AUJA 3P3SA 2PCFA 1T83C 3WN5B 3C5JB 3NZSA 5FYLD 1ACXA 4I0KA 4ACPA 3KS0J 5C09A 1SUJA 1XWVA 4FQJH 5T33H 4BSVA 4EDXB 4MJID 2NYYD 1EHLH 1ZLDA 1BQKA 3BAEL 4QTHA 3T0BA 3TH2T 3IFOB 3QEUB 4N8PA 4OGXH 1E28A 3TYFA 4PV8A 4I3RL 1LMKA 1RY7B 3KS0H 4WSJA 4XPGH 5CJQL 4AK1A 2VSKB 4XO4A 1HCYA 1ED3A 3FFDA 4YVNA 2QKIC 4F8PA 2Z7WA 3AT8A 4FTVE 5FA4B 5BMFL 1EUTA 4FZ8H 4TSCH 2ICEA 1XF2B 1OSYA 2HFEB 1JYNA 4GW4A 4KKLC 1ZS8B 2D2CC 3O8XB 4Y4KD 3TO4D 2PO6B 1FNFA 4YE4H 1O6TA 3W2DL 1ACYH 2F1BA 3VSTA 3AMLA 3ELAT 4AK2A 5C0FA 2VZOA 2P5ED 4NX0A 4M1CD 1N4XH 3L95A 2GJ6E 3D5OF 1OAZH 3G6DH 3GIVB 2X1PA 2A6DB 1UWGL 3O9WD 1PLAA 4W6YB 4WCYL 4F2ME 1L6XA 5M94B 4HS8H 2H0EA 2BXZA 2KPNA 2BIHA 5K9KA 1CTOA 4L8DB 2KL6A 4W70A 2R8SH 1KGCD 4LCWE 1OGTB 5D96C 5HVWA 1MFBH 1A9EB 2I9LB 5EZJA 1CUOA 5HI4C 4IOFD 3OKMB 1KN4H 4L9LB 4W1TA 3R4DA 4WHTA 4A37A 1GZPB 4PY8J 2C3VB 1NEZG 4I48A 5C0IA 1PIGA 3VXQA 3PWPD 4ZFOL 1E6JH 5FFOA 5IROC 1QPKA 1T1WA 2A83B 3BP7B 3ZX1A 2BVPB 1G84A 4HC1L 5IB1B 4Y1AA 2J71A 1GYCA 3MX0A 4MXVF 2J57A 4ESKA 2VLRD 3CIAA 3CZKA 1KJVB 1HJCA 1BZ7A 4OCRL 1S9XB 4WWID 2O4EA 3O4LA 3JTTA 4APQC 4X7SL 1L0YA 4DERA 2FZ3B 2DL9A 1JDCA 1ZA6B 3MLSL 4PM1A 4I7ZC 2V7NA 4R97B 1HOCB 5IQLA 1VGKA 4NENB 1EFXA 4NFBA 1PJ9A 2N56A 4XWGL 3NCMA 3HR5B 5GGRA 1B0IA 4JGNA 4P4RB 1NCIA 4LMQI 1X7QB 2EE6A 1DBKH 1WFUA 2X4OB 2EVJA 3HG4A 3H3BC 1DN0B 3WY1A 1MG2C 1WT5C 1IKFL 3ARGD 1FORL 4HETA 4IS6B 4Q74A 4QRPD 3RGVC 3BN3B 4X4YB 4Z7AA 5IWLC 2OSLB 3VG9C 1HWWA 2FGWL 4IRJC 1ZHKA 4BQ8A 4UAOC 2P5WD 3QNXA 2P44B 3QEGH 2MKWA 2OR8A 6PCYA 1IJ9A 5TQ0H 5E03A 2Z31B 3MCLH 5IB3B 3OSKA 1MRCH 1GC1H 1CL7H 4P05A 1OE1A 1Z3GH 3SDYH 3AJ7A 1BZEA 4JG0H 3IPBA 4X98B 2GFBA 3HB3D 4ZODA 4GQ9H 1A3LH 2XPGB 4Q6IB 2YSSB 4PG9A 4XB3A 4N68A 3TFBA 2WO2B 3HN3A 3AWEA 4K5LA 3DO7B 1CFQA 3S96B 3PHQA 4N86A 4EEEA 1N8ZA 3Q01A 3EYOA 1MCDA 1SXZA 2HJFB 2IGFL 3ATEA 1T6VN 4OLZL 4YBQD 1MCBA 7CGTA 4D3CL 3VVWA 1ZAGA 2QVKA 1IM3B 2F0CA 5J4MA 1U3YA 4HH9A 4DETA 1FFOA 2R69A 2DRUA 4PG2C 4PRPD 4NN7B 5LXVA 4Y5VA 1P4LA 4TLUA 3MV7E 1AY1H 4I0PB 5H35B 4UUJB 3ZE2E 4D0DB 2XN1A 4F3FA 3NK4A 2C9PA 1S5HA 4J6RH 5E8NB 1MQKH 1BYNA 2E27L 1QA9B 1GJIA 3LXUX 2QELA 2FX7H 2P80A 2NX5D 4PQXA 2B4CL 1ECZA 5CFAA 1KC5H 1NFDA 5SX4H 2BINA 1P5UC 2V7HA 4FLHA 2XVLA 4LPCA 3NUKA 3TGXA 3NCCB 1A66A 3RL2A 1H3TA 5CCGE 4KNSA 3R18A 2VR3A 4W68A 2YO3A 3CZJA 1WS7A 3L5HA 1HS6A 2IIJA 2H8PB 1CN4A 1ZE3H 4KQ3H 3VGAC 4ZW3A 2GJJA 3UTSA 1WP6A 5KVFL 3QDGD 3IDMA 2O93L 3GKZA 4F9PA 4FKKA 1KN2H 1ZDQA 4GRWE 2O5XH 5G5DB 5CMAB 3TO2A 3I9GH 4U7SA 4CAGA 4PPTA 1DQVA 2YN3A 3DMMC 3ZE0E 5B38B 1PZ5A 2NY4B 3K6FA 5E5UB 1IZKA 4UOW1 3IU4L 3RIFF 2GCYA 5F1NB 3RTQB 3WKQA 3ZN6A 4IOIA 2F1AA 3C8KB 3W9EA 1NCGA 3CVDA 2A9CA 4GEIA 4NCC1 5D1ZA 2XXGA 3QQ3B 1N9PA 1F6FB 5LQBL 4NOBA 1OCRB 5IMLB 4G7YH 2E8ZA 2DMCA 2MPAH 1WBZA 2ZNWA 2FBJH 1MCEA 1UQSA 4JKKA 3D05A 4OLEA 4OBRA 3CSFA 4LOVA 2PYEB 3LPGA 2OX5B 3CSTA 2FH8A 3ES6A 4M6OH 1MCHA 5EIIB 3DUUA 4JHVA 3ECUA 2Q0ZX 3VXTA 4K7PX 3ZDYF 2IQAB 1YMHB 2IAMB 2CLVB 5GS3A 5SWQA 1QO3A 4LKCB 2Y5EA 3EIFA 4M00A 4PJCB 5D6DA 1NBCA 3CZUB 1MVUA 3MSPA 3OWRA 5HD8C 4LE8A 5DYFA 4YHKH 3P3TA 3MNZB 3INOA 3EO1B 2ED6A 2VRKA 4HBCH 3ZTJH 3C6SA 5EF0A 2LU5A 4LSQH 4UOQA 1YVLA 3EHBD 5HI5D 2BP0A 1F90L 4D94A 4NKOB 4PJ9D 2GITB 4M62H 1D9KA 3OAUH 1AS8A 1JRHL 3BGFC 2IBBA 4ELMF 1O7DC 5EC1B 2GIMA 4JJOA 4NM4H 1PCSA 2GK2A 2W91A 3O6KH 4OFYA 3SDXF 3UXFA 4YXLL 3K1KC 3IMTA 3CN2A 4OZFG 1BZ8A 2UWEA 3L8QA 5DFVC 3DSNB 4JCMA 3HJ0A 4OTXH 4XPHH 1VDGA 1QEWB 3VXPA 1L5GB 3WD5H 5JHLL 3QRLA 2Q8AH 2B0SH 5DO2C 1XCTB 3B37A 4MA7L 2YD6A 4BQ6A 4U1JB 1QW9A 1AMYA 1M6OA 1K5NA 4PGCA 2E59A 4W4OC 4A39A 3EBHA 1E8XA 3KGSA 3LNDA 4PJHA 3UYOD 5C0DA 4XR8C 1PF3A 3QQNA 1AZCA 3SPGA 3IKCA 3MO1A 4HPYL 3ZIMA 2CRZA 5HDRA 5KVEE 1D7FA 3OSVA 5C6TH 2FJFB 5EORH 4WHYH 2LOEA 1G6RB 1LE9B 4JPWL 3DOSB 4MVBC 2QV2A 1TVBA 5ADOL 2BDNH 2DY2A 1TCRB 3FSWA 1WZLA 4P2QD 4WU7A 3WIFA 1E4WH 1WCBA 2A9BA 2C3WA 3JV6B 1EGJL 5I18H 3KR3H 2NXZB 2Z35A 2JB6A 3MKKA 5ECJE 1OEZW 2A73A 2FX8H 3U6RB 3MV8E 3HLAA 5BV7H 2EDYA 3QAZB 4LQFH 4U0QB 1BFOA 3HBGA 4LESA 2XJKA 2CALA 3R19A 1PMYA 3PQYB 3EJJX 3BWUC 2R0ZH 4NZRL 3ML9A 5F96L 1O9VA 1G7HB 1A3RH 2VDLH 1NZRA 2WYTA 1DDHA 4KQ0A 1NAKH 4KZCA 3ORJA 1OF2B 1A6VH 2R1YB 2DYSB 4WWOA 3VQ2C 5I2IA 3VDBA 2DWSA 3B2VH 3SJVD 1S7SB 5I1JL 1B9KA 4N5UA 4TL5A 4BJLA 5JW4M 3PABA 3QP3A 3L1OL 4XB7A 4X6DB 5JIMA 4G8GA 2W92A 2NSMA 4X4ME 4WFFE 4YDIH 3VD3A 5TGBA 5C2BH 1OTUD 4H26A 4N6RA 5KSUB 1TTFA 3UP1A 4OH2A 3UL4A 5KJRH 5JIIA 3DJRA 2VUKA 4A2FA 5IB2A 4B53A 1B6UA 2FWOB 3MBED 4LAJH 2ARWA 4K5PA 5CF3A 4NAQA 5FHBL 3OLIA 3AREA 4XWOC 1Q1JL 1ZK5A 3W11C 3PNWB 3ZTEA 5IBTL 1YNTF 2LAAA 5HDBF 2VDRL 5J89A 2AEPH 5HHOB 3IS0X 1JZFA 2Q7YB 5I1EL 3HNSH 4Y1TA 2XXMB 5T1LB 1LO4L 1O7DE 2A6JB 5FYKE 4NKMA 3MUY1 1UT9A 2WQXA 3P30L 4BH8A 2DB8A 5J6HB 1U8KB 3NPSB 2YQ3A 1TETL 1ZTXE 4KNQA 3IDIA 3FQXB 1EXHA 4N2AA 2AK4D 3II2A 4P9HL 4JFQB 5AB0A 4QEGA 5GGUB 4EI5B 2Y36L 3PHAA 3O4OB 3CJJA 2LU4A 1YSOA 1KBGL 3FF8A 3P4OA 3OMZA 1BZ9B 4OZGB 4FNLH 4X4ZA 4JBSA 1BWMA 5D7LA 5FYJL 3TIDB 1MH5A 2ISDA 2A6IA 5D7IA 3JWNH 2AEQH 1F3RB 3HHSA 4GEJA 3N55A 2HX8A 4AL8H 2F8IA 5EO0B 3CDFA 1MCOL 3D4CA 3FQYA 4KKAD 3TPUB 1SBSH 1BAGA 1Z2KA 3CVIL 3H9SD 3SYPA 4AQ8C 1L0PA 2VDNL 4L4TA 3B9KC 2GBTA 4ZMWA 5LAPA 3D4GA 5E9DD 4OFIA 2EUXA 2Q8BH 1JBJA 4NQDA 5LNEA 2JJSA 3V4UL 4RAVA 5BRZE 1MCCA 3QDJD 2HVJA 2CMRL 5DHEA 3HHMA 5CP7A 3ESVF 2HLEB 2CWRA 1U4EA 5CJ8A 4YWGH 3PGFL 3TBTA 2YLKA 5DC0A 3FT2B 4L4JA 3LY6A 4GSDL 4RDQG 1DQDH 3IDNA 3NGBC 1WA1X 1K4DB 4N26A 4WENB 3SE3C 4F7TA 2MOGA 3X13B 3W5MA 4FD0A 1S7XA 1IBYA 1NAMH 1R5VA 4AYDC 1U3HD 1SHWA 5B7FA 1B6DA 3O41A 5ESQA 1J05B 1FGVL 3C9NB 4GRLB 4OFDA 1SXCA 2R7EB 4CU8A 3ZO9A 3ZKMD 5C0AD 5L9DH 1XQ4A 1QSFD 4YUEH 5E9AA 4JFPB 4D0CB 3E0GA 4HSQA 3KLKA 5IJCC 4KHTH 3VJ6B 3ZDZF 3HCVB 4N5EC 4QHNA 3VO0A 2DM2A 1RHHA 4DZBA 3MC0A 1G0YR 2VXVL 1HKLL 2IANE 2CPCA 3RVWD 5B39B 4TUOA 4QXUH 5DVKA 2DI7A 2R69L 4AQOA 4ZXBD 2ERJB 2O26U 3QNZB 2GW5A 4O2EB 2F19H 1E9QB 2BXYA 4ODUB 4PJEB 3H56A 2Y22A 3PDOA 1CF8L 1HHJB 3EUUA 3EBGA 1IAIL 4FI6A 3TZVB 4A1RA 2OCJA 3QUZB 5JPMA 4MJJA 2EXYC 1FNAA 1P7QB 4IU2A 1YEKH 4L05A 4M7KL 5IBUB 3IM1A 2OK0L 3N50A 3KLHD 1EMTH 4H5SA 2GBAA 5FO8A 5GZNC 4P8QA 1C9SA 3CDCA 4Z7WA 1I8MB 2PPDA 3LH8A 4NOFA 4XP5H 3UX9B 3VH8A 4BRVA 2IH9A 5HGAA 4QRRE 4C56E 4AYSA 5TDOB 3ZMRA 3AQZA 5AW4B 1THCA 1JGEA 3VXUE 2DEWX 3MV9E 4Y2DB 5IBUG 5MERB 3NCJL 4PJXB 5E94A 5AQ0A 1EHLL 2OYMA 4IRSC 4LCCC 2W81C 5A2JH 4FQXD 15C8H 1T3FB 3NRQA 4L8SA 1H15A 4TRPL 1A02N 4NNXB 1MJJB 3F7VA 3QG6A 4P3DB 4XPGL 4LBEB 1E2ZA 3V0WL 3NJVA 1RJYA 3GHEL 3VWKA 4FXGA 1BFVH 3F6IA 3V8OA 1BVZA 2VL5B 4N2NA 5BUGA 4GINA 3BN9C 4WEBH 4ZAKA 2IBZY 3VSQA 3LIZL 4DGIL 1ZVHA 3CZGA 1U3JA 4P5RA 4PJ7F 2DW5A 3GBNL 4G8IB 4CVXA 4S1QL 2FX9H 4XX1E 4Y16D 2ZXBA 1QSED 2E8YA 4LLYB 2CGYA 4NN6B 2OR9H 5IBLD 2HX7A 3MLZL 1JWSA 4JDEA 2WXNA 1HNGA 2DM3A 2EECA 2KERA 4KJYB 2W9DL 2AZAA 3QH3B 2ZKWA 1KELH 3STBA 1HXKA 4PJBE 3A4FA 4CW1A 4EPSA 5I1AA 4NO0B 3CVHL 3U1QA 5ICXA 3DK2A 2DKUA 2YMOA 1AIFB 2VN7A 2A6KA 2R8SL 4QXWA 1RVFL 5D7EA 2BVOB 1QFUH 5D71H 1T21A 4L3AA 4KMLB 5D5ME 5L0QC 3Q1SL 3ABKB 5EA0L 3SDDC 1XIWD 4QRAA 6FABH 1MLCA 5IVXA 1KLFB 1E6JL 1NFIB 1S3RA 2B59A 3FB7B 1ROWA 3JWOL 2A7BA 5GGVY 4XMLH 3ZKXC 2Y2WA 4JN2B 2NTFA 2R15A 4JUTA 4MNQD 2OI9B 3G5XA 4Y4HC 1KY7A 3NIFF 5BXFA 3VRLF 3L3OA 5TPWH 4YO0B 1BYOA 5FO9B 1CLYH 4EDXA 2F54D 4U05A 4WUUA 5F88B 1KIQA 3NFPB 1SY6H 2E74C 3L7EA 5HJ3B 3FZUC 5DJ0A 1BG1A 2KYIA 3KNBA 1X44A 1KJMB 5JA8B 2WWMC 5KS9B 1HILA 2H47C 4RMRA 4GXUN 4F58H 5AW8B 2MSPA 1P4UA 4JRWA 2Y06H 4NDMB 3QO1B 5TK4A 3D6GA 1YMME 2V5MA 3AG2B 3UZEA 1BD2B 3KCPA 1GZHA 2GUOA 3VFWB 1R24B 2X28A 3KPPA 2VNCA 3AG1B 1IGYA 1RJZB 3LZLA 3MACL 1UD6A 4L4VB 5GZOA 3O0RL 3VG0L 1P4IL 4NBXB 5K93A 4HWBL 3O8XA 4HJJH 3SY6A 1HQRA 4N9GB 5KYXA 3QDME 1HL4A 3P0YL 4DKEL 1H0DA 4P46D 5KSAB 3ZKQD 4OCNC 5C0EA 1IKNC 3EDEA 1HTYA 2IPKB 1UZ8B 4U31A 3FU7B 3GIVA 1QFWL 1NC4D 2WC7A 4HJTA 4G7VH 2A6DA 4TVUA 4XHQA 1NAMA 3FSAA 5D2LB 5TQ0L 2FB4H 3BLKA 4LU5H 1MEXH 1NCCH 1W16A 4KPHH 4YSDA 1GC1L 1UCBH 2O5ZH 4L8DA 3O2WH 3L3HA 4QJ3B 1HNFA 1A7OL 4TPRH 4TULH 5I17A 4KK6D 4GQ9L 1A3LL 5FUCC 3PFUA 2VLJA 3HMXH 5I26A 2CKNA 2D9CA 4Y7MA 5DSCA 3KGTA 4KUZH 5E8OB 4JPIA 1GZPA 3CK0L 3F5WA 3L9RA 2A83A 2BVPA 1M9SA 1NDGA 4UM9D 3JSSA 1UM4H 1LNUA 1DP0A 1VA9A 5DMIH 4D9QE 1KXQA 1HKFA 4LARL 1S9XA 3TT3H 3X11B 2CO4A 1AY1L 3KPLB 2ZONA 4CNIB 1KIRB 3D2TA 1FN4B 4RIRB 1W72H 5GIRB 1V7NL 4ODTH 4Y9GA 1CDJA 4EI6B 5ENWB 5EIVA 3BPOC 3UAEA 3MJGX 2PTVA 1NJ9A 1ZXKA 2UVFA 2XPYA 3HR5A 4FF9A 2DYPA 5EF2A 4FABL 4X4KA 5TF0A 4M61A 5DJ2B 1X7QA 3D33A 4M6NH 1KG0B 4YVUA 3K8MA 2X4OA 2DEXX 5F8RC 3TV3H 1DN0A 1BVNT 3IAPA 4X4YA 1E42A 2X6BA 1J86A 3C6LD 1SJEA 2KQNA 3MOAL 4A68A 2WSDA 3RIKA 2VM9A 1XD0A 3FU8A 4IW4C 2XNAB 2VSMB 3QZNA 5E0QA 3K2UL 3LQZB 4NC0B 2F9BT 2YAOA 3OQ3B 1EEYB 4EIUA 3BP4A 4PRID 4ZDHA 3FQ4A 2QKIB 2FBOJ 4KDTA 5MEQA 4BFGA 5IQ7H 3FOLB 3STLB 3MLWL 1KJ3H 4JO8A 2XQ0A 2V3FA 2F8VA 2EDQA 5IY5B 2F18A 4E9SA 2IFFL 4N25A 3BO8B 5F9JB 2QKSA 1U8MB 4LHJB 5CEZE 1OOWA 1UT2A 2IWFA 1JMXA 4HAFA 5F9AC 3RI5K 4ERSL 3MRLA 4HAKA 5DFAA 4S11A 2FBJL 1FH2A 3SPIA 4AUYA 5DFWH 4H0IA 5F1IB 3HFML 3O6FA 4MQ7B 3B6SB 5DMGD 1E67A 1S7QB 3GMMA 4M6OL 3HS0B 5DMJB 4X99B 5CBEA 4KO5A 2WVVA 5K33A 3ZE2B 4AENA 5FA3B 5D96B 2VJ0A 3TFKD 4I0PA 2QVTA 1U6AH 3LX9A 3D69A 3ARYA 3P9MB 5ISZD 1FI8C 3KEDA 5FUCE 3ARDB 4UV7H 5FM8A 3DBSA 4L0PB 2FCBA 2CBQA 2LQRA 3G04B 1OWWA 3MV11 3BEVA 3QT2A 1OALA 3MCKA 1H3WM 4Y8AA 2BZ7A 4E9TA 1RZFL 3II3A 4BUHA 5GS0C 2M26A 2H8PA 3KPNA 4MMZC 3WENA 2YD0A 3MRBB 1SXNA 4APQB 4DTGH 3O6KL 1EXUA 3BP5A 3SPJA 5E2UH 4GRWB 4ZUTB 2BFVH 5L2JB 1T04A 1OL0A 2P7TA 4YR6B 4YX2L 5EBMB 1FE8L 3BISA 2DWXA 5AD0A 1G9MH 1MAMH 3KPRE 3NFNB 4TQ8A 5ELIA 1QRNE 4RA3A 1MFUA 2BVTA 4FMVA 4UT7L 3VXNB 4FOMA 4ZMZA 4U3SB 3UJTL 5E08H 1TQVA 1SY6A 4LEXH 4U1KA 3SKOB 4LQ1A 4F9LC 2Y7SA 1NSNL 5B1JC 5L2KE 1NUDA 4NO5A 1WBYB 5CJOL 1N18A 1DO5A 2CR0A 1JHLH 2HFFB 1AFVL 2UYLB 2VXUH 3RGVB 5I1LB 5C2UB 1BG9A 1JJUA 5IMLA 4GT0A 4UAOB 2EUZA 4PWHA 2FT7A 2JJTC 4L3ED 1NGZA 5EORL 2JKLA 3OWEA 3TXAA 1TQUA 4KUCD 4N0YH 4X9BA 4AMWA 6PAZA 2PYEA 4JY5H 2HH0L 2OX5A 1A1OA 4N3UA 3FQWB 1E4WL 1SXBA 3P2DA 3U82B 1OD9A 4IIQB 4NM8H 4OJDH 5I18L 2FECI 4DEPC 4QF1A 3OKNB 2WKLA 2VZSA 4G1EB 1GZQA 2IQAA 1CU4H 1YMHA 5AVQB 1KEML 1SGKA 1EHNA 2VRQA 3BXNA 3LKRB 1D5XB 4LQFL 2OMZB 4PJGF 5C07E 3S7GA 2HT3C 4YEFA 3BSZH 2ZXEB 4LCUA 4J3VA 1AKJA 2WP3T 3BIKB 5FOBA 1A3QA 4AZUA 2VR8A 2VDLL 3VTAA 1FBIL 5FCUH 4GFXA 2LV4A 2JCCA 1NAKL 2HJKB 3D7PA 3G6JA 4LSTH 5D55A 3HMXA 5FM5M 3WGUB 4CC1A 3TBBA 2JWYA 5A2LH 4NKDA 4FERA 1XL6A 4JRYE 4MAYA 1FYTD 3TBWA 3VXME 1ES0B 5TH2B 1OCCB 2H32H 4AYMC 4TNWF 3E9TA 4WVRA 2IV8A 2ESVB 1GPOL 2V5TA 3DSNA 3HIZA 2ADFL 5DLLA 4XAKE 3PHOB 1R9FA 2ZCLH 1W6WA 4MDIA 1GVIA 5KJRL 1P5UB 1II4E 2KUTA 2NZ1A 4KJQD 3MROB 1I8KB 3QYNA 1YJDL 2ZSWA 4OZIB 3L7FA 1W72A 4JG1H 4QXVA 4U1JA 3H0TB 1XR8B 3M46A 4QJ5B 2ZX6A 3RFRA 4HUWB 3JVGC 4XMZA 5L7XH 3QI9B 1RZ8A 2JB5H 3LZQA 5F7FA 1R6VA 1HCVA 1MREH 2V3DA 3PWUB 2OMTA 4MJ5A 2EEBA 2I26N 4ZSOA 2OYLA 4YH6A 4KJWC 3TBYA 1AO7D 3GMLB 1DN2A 1QW8A 3DMMB 3UJIL 4PS4H 3CSYB 2OQJB 1TCRA 4HZ1A 3H4FA 4PWGA 5AZEL 1PL3A 5AW5B 3W0WD 3ZO0A 2G3NA 5TDPA 3BUYB 3BUQA 3MGOB 4PCYA 1MCPH 4DEWA 1A4CA 3BT2H 4PCKA 4GXVH 3EYFB 4ZD3L 2HTKC 1CLOH 3QIUA 2APWA 1FZOA 4QXTA 4FNLL 4A7TA 4ZS6D 4HIIB 2DQUL 2DTMH 5DD6B 3LRSB 3PQYA 4LIQH 4M6AA 3BGMB 2YPLA 2BPBA 4W6XB 2WOBA 5FM4A 3LZNA 5IF0A 2G2RA 4G82A 1U3ZA 1BVLA 3WKMH 3US0A 4K71B 3BRGC 2N3JA 1G5GA 2HTLD 3J07A 3Q9PA 3DV4B 5DQDH 4XVJL 3BPCB 1OV8A 4EI0A 4O4YH 3JBG7 1J1PH 3N40F 5EOCH 1HAUA 2JI2A 4KJPD 4A6YB 4ICXA 1TEGA 2W9EL 2PF6A 1R3HB 3CSPA 4KMTH 4TNVK 3NJJA 4QHMA 4U6VL 4OAWB 4YDKL 1B0WA 4TYUA 4I85A 4YBLC 5C08A 3L3GA 3B2UC 4LLUB 2BC4B 2BCKB 2WCGA 4FZEL 1KDIA 2XY1A 1ZHBB 1MRDL 2XN9A 5SWSA 1GGCH 4UQ3A 3F04A 4URTB 5EU6A 4AMKL 2OS7A 3PNWA 1NMCC 2FT8A 2MFNA 1K8DA 3A4AA 3FT3B 4PJIA 5CFHA 1NQBA 3BGFB 3REWB 3WXWH 4PJ8C 1DQDL 4WHDA 4IMKC 4P2RA 4N2CA 4GG6E 3GLEA 4PHZA 5C0BD 5SX5H 1P1VA 2EXWD 3BD3A 3ARBD 4JQVA 4ZUWB 4C4KO 4R3SA 1LO2L 1UB5A 3FTSA 4C55A 1MIEH 3GXFA 3FCSB 4W9GC 4YNYA 3MDJA 4J27A 4RDBA 3BZEB 3EFDL 3UAJD 2IAAC 1A22B 3NIDB 4JHUA 4JHAH 5TE7H 4AV0A 3GMNB 3KXFA 3O6MH 4UAHA 4WW2F 1MHEA 4IJTA 7FABH 5DHYA 3IJ8A 2ZUTA 1BZ9A 1F4WL 3IDJB 5FO7A 3GB7A 4FG2A 4U1SB 2GIYA 1H8SA 3T8XA 1UTDA 2K7QA 4WI0B 3LDBC 1U91B 3CBKB 2OP4L 3GLDA 4NO3A 4UOJA 4FADA 3HE6A 3QWNA 3QJXA 1TZ8A 4H8WC 4NQXA 3L3IA 4XZUA 3BQUB 3VW3H 4CC4C 4DP6X 1P6WA 3M86A 4N2GA 3D87B 4ANVA 5LGKA 3FU0A 1UOKA 2ICWB 5FKAB 3QORA 4NN5C 1INQB 2XSKA 2VUYA 4M29A 4FXKA 4HUXB 1EMTL 5FDWB 4QXGL 2VWEC 4UYQA 5D7JD 1VFOA 5IHLB 2BW5A 4GOSA 1XF4A 1U95A 4MZIA 4XP5L 4XCNB 3UCRA 1BYPA 5TQ2L 4BZ2H 3FT2A 1NFAA 2ZCHH 5E1QA 2H2PD 3BSZA 1XF5B 1CWVA 1OAXH 3O3DB 4U1HA 1MKFA 2BNQD 4WFGD 1QTSA 3B7YA 3X13A 1XEDA 1L9QA 2YGOA 5FFLA 3BW9B 2HKAA 3C8HA 3SPHA 5CN3A 5JTWA 3ZT7A 1F4AA 2ZP0T 3GTNA 4ZMQA 3ZK0A 2GI7A 3EDKA 3E80A 4G9FA 5SX5K 4ATWA 4GAYA 2R7EA 1BXUA 1DBJH 4GP5B 1M1XB 4PLJC 3UBXI 4B9ZA 1N67A 2EYSB 2H32A 1M2VB 2IH3B 3DX7A 4RISL 4B9YA 4OV5B 3FQTB 3FO1B 4RSYA 3FUFA 4QHKI 1A6WL 4OQ1A 3DPDA 5KBKA 1P53A 2W07A 4D0CA 5C0JA 2X2IA 4J4PA 5E4EC 3VJ6A 3MFFB 1N8OE 1PKQA 2X2HA 5E5MB 4EO5A 1OWRM 3SIKA 2HRHA 4TTDC 5HJGA 2PO6D 2E5EA 4JDZB 2XWEA 4MKMA 2EKSA 4EF3A 5CBAA 3GD1C 3U2SB 2OR9L 3DECA 3BPNC 2CK2A 4P5TD 3ZTJG 4AH2A 1XMEB 4HEME 4TUJB 1X9QA 4HLZ<