1QTYT

Vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
b'GRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR
molecule tags Hormone/growth factor receptor
source organism Homo sapiens
publication title Solution structure of the VEGF-binding domain of Flt-1: comparison of its free and bound states.
pubmed doi rcsb
total genus 15
structure length 94
sequence length 94
chains with identical sequence U, X, Y
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1999-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qtyT00
5IBLC 1U8LB 2PTTB 3O6FB 3O6KL 1RZ8B 3EOAB 3S34L 2CLZA 5L9DH 5FV1L 3MCKB 4Y19B 4Q58C 4URTB 3ARDA 3B5GA 4DCQA 3QDGE 1U2CA 4LSUH 5DD3H 5I1AA 5J8OA 3H3PH 3MBEC 2VITA 4EKXA 4L9LB 4G9FE 4APQD 5D1QB 3TO4B 4EUPA 2NZ9C 3MV9A 5H37H 3QCVL 1FYTA 1DBBL 1BFVL 3NGBC 1JF6A 4PJCF 2JTDA 3ZLQC 4QRQA 4DW2H 1TZIB 2EDHA 2CGRL 1F3RB 2CKBB 4WNQB 4MA7L 4JEGB 1A6WH 4TULL 3AREA 4R90L 4LPXA 1CZ8H 3OJVC 4Q6IB 1OLZA 2A1WH 1CFQA 5EZLB 1FC2D 1SM3H 4GRWH 1NBZA 3CFEB 4GG8A 4QRRD 1MCNA 1F02I 3S96A 1PDKA 2H9GB 2OTWA 3EJZC 4ZUVA 3UC0L 1N26A 3STLA 4JM2A 5FK9A 2NZ9D 1DL7L 3EO0A 4TQEH 3GUTA 1I3UA 2HKFH 3TCXA 3DROA 4XNUL 1W8NA 4BQCA 4FQLH 3SDAD 1F58L 1H5BB 4OLYL 1S9VB 4N68A 4HCRH 5GRYA 1I3GH 3V4UL 1X6LA 1MY5A 1VEPA 3NIFE 4JM2B 1DQDH 2VR5A 4PD4K 3W81A 4MHHI 4AIZB 2BOBB 2OBGA 4JFQA 5ICZB 3QAZB 1MCHA 3BKYH 4YUEL 3T08A 1I1AC 1RJLA 3ESVF 4EN3C 1RZKL 4IRSD 3SDDD 2NY6C 4HUWA 3WUWA 4R2GC 3KJ4C 2OR9H 5GISL 3QCVH 3MLRL 3QSKB 3T2NH 2CIKB 2CKBH 4G6ML 5FO7A 3VXSD 1C7TA 5IB3B 1Q94A 4PP1D 4ZXBB 1FO0L 4RFNC 4L3CA 4DQOL 2QQQA 5DGRA 1NC4D 5JDSA 4FXGA 1RV6X 3VFPB 3VXQB 4Y7MA 4KQ4H 2X7LA 1AGDA 5CP3H 1HHGA 4OCWH 5IESL 2X4TA 2O93L 3WHE0 4CVXB 2W0PA 3QHTC 3N85H 4RAHA 4YFDB 1T1WB 3CX2A 5HYSG 4I9WD 2FSEB 2J6EH 3EHBD 1VEMA 4KJPC 5HHOA 2APVA 2DMKA 4Q2ZA 5ALCH 3FO0L 4NN5C 4R4ND 4RFEB 5KVDL 1PEZA 5I9QB 4JPIA 5J7CC 3ZT5A 1BOGB 3NIGF 1PKQE 1DDHB 2MKLC 5E94A 2W59A 2NQCA 3GSRB 4UOJA 4XNMA 1URLA 1EFQA 2ZOKA 3KPLA 2DQDL 1CF8L 4LLQB 1MFAH 1QSFA 1QQDB 2M1KA 5CBEA 4XBGA 1LE5A 1J18A 3MRPB 1J0KA 5E00B 3QDMD 3QRFM 3TA3B 3GMNB 1OTUC 5HDQL 1OTTD 2NXZB 1IAIL 1KCLA 3X12A 5I17A 5DT1L 3FN0H 3IDIB 5T33H 3GMRB 4FP8H 1EVTC 1S7SB 1JGDB 1KPVB 4P2YA 1T2QH 1U8HA 1B6UA 3WIHL 2O5YL 3QEHB 1CL7I 4ZO9A 2GY5A 4M8QB 1FE8L 1ZE3C 3IDMB 3BPOB 5IHZB 1FAIL 1HSBB 4NC2B 4U6VL 1FLTX 2GJ6E 3LV3B 4X5WA 3Q3GB 3SKUD 1I4FA 2XI9A 1QBLH 3UYRH 5IR1B 1FNFA 4Z7UF 3TWCH 2UVFA 4R7DA 5KVDH 4OCMC 3T1FA 3VH8G 3PWPD 4KV5E 2ZCLL 4XCNA 2X1QA 1GGTA 4EN3B 3WCYA 5KG9A 4HJGB 4MD0A 4GRLC 3N06B 3RUGB 4HKBA 2AJXL 3KPQB 1N3NA 4YDJB 2Q3ZA 3DBXA 2QSTA 1XF5B 3IETA 1PSKL 4JDVA 2FJFA 4JREC 4RA0C 1YEJH 4UIKH 4U6HB 3C9NB 4MJIE 1NCWL 1F8TL 3PGDA 1NKOA 2IQ9L 4GRWF 2P8LA 2BFVH 1KC5H 4NO3A 2XT1B 4KRMB 2GCYA 3BEVA 4P3WA 3LQAL 4MMZC 3FFCD 4UQ2A 1A2YB 4MJ6A 2XZCL 3RU8H 2JELH 1NCBH 4ZUTB 1A02N 3VRJA 4JFDD 5F89A 3RKDD 5K9JH 2MWCA 2H32H 3Q5YA 3P4OA 3DRTA 3OHXA 4DZ8B 1NC2B 2YMXL 3NCCB 3EYSH 2HVJA 3VGDA 2IEPA 2CJUH 3CFIC 5C92A 5INCA 4RISH 3GJEB 2EDNA 3QCTH 4OB5H 4PJIE 1LMKA 2NX5D 2IAND 2W0KA 1N6QH 1G0XA 4KTDL 4MSWB 5KSAB 3DI2B 1VKXA 3PHSA 1Z2KA 1FHGA 3MUGB 3O41A 3OB8A 2WK2A 1X4YA 2E6JA 4I18A 1FNSH 3EFFA 4DGIH 4P9HL 3AAZA 5IK3B 4JKKA 3KYNA 1KENH 1FNEB 4GW4B 2IAMA 1YMHA 2R29H 1EX0A 4YHOL 1IE5A 3L9RA 1IAMA 4P57A 1EJ6A 4RIRB 4MNQE 4XHJD 3EHBC 4LCWB 5CZXC 1MWAH 4WW1A 4CKVX 2AQ3A 1Z3GH 3G5YB 3NCMA 5DJYA 1FFNA 3MBED 3TZVB 5C0CB 2AJSH 3KNBB 4HBCL 5EA0L 1FNAA 1FVEA 1LO2H 2ZP0T 3GBML 3NIDE 5C0BB 4Q7DA 4UT6H 3RZCA 3ARBB 2G9HB 5FUZL 4PG9B 5C0AE 2A2QT 2W9EH 4JFZH 1I8LA 5I18L 4X9FA 4ZNCD 3QIBC 1DLFH 1QUNA 4NCC1 2OMNA 2B1HL 2ZUXA 4D9QE 4U3XA 5T5FH 5BJTB 4ONOA 2DQCL 4J1UA 2BRRL 5F7DB 4RAUB 3BDBA 2CIIB 5E8NA 4NWTH 3KR3L 2QR0A 1MCBA 3NIFF 3MLTA 1PQZA 2YD5A 3DX9B 1X6NA 1T7YA 3LRHA 4HUXB 2VLLB 2VDMH 1AE6H 4TOYL 2EC9T 1U8QA 4RAUA 4DEPC 4ODTH 3GJFK 3C6SA 5F96H 4JFFA 2D31A 1I7ZA 1Q8MA 3MZGB 5HI3C 5BV7C 3PL6C 1A3RL 1MFCH 1V3JA 4MLSA 3QHZL 1DVFA 4HH8A 4U0QB 4NZUL 5E2WH 2RFXA 5ESAB 4G9FB 2WUBH 5SV4A 2CMRH 2BVTA 1KJVB 2GAZA 3EFDL 4GXVH 5E5UB 1FYTE 5HHPB 1DBMH 3PL6A 4UILL 5F88A 1GGIH 1SJHB 5J6HB 4QNPF 3VI3F 1ZHKB 3VGFA 4E41A 1L6XA 4HKXB 3RBGA 4NO3B 1UENA 4KROB 4M1DH 1G9NL 1C5CL 1UB6B 3TZVC 4WHTB 1IQDB 2D4DA 2DTSA 5HGHA 1LK2B 3EDKA 3RVUD 2UUDK 3SE4C 3D18A 3G6JB 2YZ1A 3SBWA 3WUZA 3B2UC 3I50L 2FH8A 2R1YA 3AY4C 3VFVB 5J6HA 5GSRB 2KH2B 2F19L 5I1IL 4MX7B 1NGYA 2QADB 4FQ2H 3O4LB 1U95B 4AEHL 1EXUB 3WFCL 3LEYL 2XN9B 4QXTB 4QHNB 1WTLA 5D96C 2K9UA 3WXWL 1LDPH 5DVKA 5HPMB 1KIRA 1H0DA 4MJIB 5IKCB 3CVHL 4OF3A 4B0MM 3BDYL 2BFVL 1T04B 3W2DL 2YPLB 1RSFA 4X7CC 3PWUA 4OT1L 4ELMA 5CIPA 4BSJA 3V4PH 2BC4B 1CICA 2BXYA 1TQBC 2FD6L 2X40A 3X14B 2IANA 5K9JL 1AJ7H 1BEYH 2GT9A 3E1F1 4Q0XH 1FVEB 5CWSB 1I9IL 1GAFH 5EUOB 4HULB 3QH3B 1JPST 4F80A 1S9KC 1BQUA 1FDLH 4PP1C 1W0YT 1AGBB 4LCCA 3BZDA 8FABB 1LGVA 3X3GL 1BWWA 5TE4H 3L95A 4HT1H 4Z7NF 2J12B 2ZCKH 4TULH 2DOCA 3MGOB 2XTLA 4MNHB 2X1OA 3ALPA 5IBTH 3KPRD 4JRWA 4DJMA 2WUCH 2AEWA 2J8UE 3HR6A 1CFSA 5IFHL 3RJQB 3GSUA 3MACH 1HOCB 4PJEA 3OKNB 2FJGB 4TOYH 1FL3A 12E8H 1EAPB 1KELL 1S3KH 3FT3A 5L88L 3L7FB 2QKIA 1FL6A 5CD3A 5JXEC 5JZ7C 5F97E 3PHOB 1NUNB 4PJIF 4NPYA 1QNZL 1RIHH 1RIVH 3HMXL 3I6KB 1RZFH 4LKCA 1YPZB 5M94B 1CWVA 4PTTA 5GS3A 4WI9A 1OARH 3P4MA 1J1XL 1JP5A 1TVDA 3T77A 2BRRH 2VABB 2FECL 2A6IA 3EJZD 5IBUG 5D72H 1A6PA 1ROWA 3M17B 3RL1A 3NVQA 3BSZL 5DK2A 1OQOA 4C4KO 2W60B 3VXQA 2X4UA 3KG5A 5IM7B 3EDDA 4NKIH 1K4DA 3S4SB 2L4OA 4WEBL 4HWBL 3RGVB 5EDXA 4ZAKD 4YBLC 4GS7B 5C08E 3SE9L 3HG1B 4KKLC 4HF5H 3C5JA 1PYWB 3QA3A 1A4KA 4PRAB 5E99H 1MLBA 3DYOA 5HHOB 5D7LE 4PJ5E 3QUZA 3MJ9A 2ZSVB 1DBAH 3PXJA 1UT9A 1CBVH 4YGVB 2FEDD 2R56L 5HGBA 1MJJB 4P2QD 1PG7L 4PLNC 3OWEA 1JWSA 1CLOL 3MRFA 1R6VA 3O2DL 5FOJA 5GS0H 4P2OD 1H5BC 4NQUA 5I16B 4NKMA 1JF5A 1WAAA 3K3QA 4HWNA 4J6RH 3ILQD 5BQ7A 3MRGA 4OT1H 4F37K 1H5BA 3BMWA 3Q0HA 4U1GC 4Z76B 4E9LA 1LE5B 5JIHA 5DJ8A 4ODTL 4PUBL 5CEXB 4WFGE 5C70A 4GLRH 4KK5C 5BCAA 4IIQC 3PGCA 3GSNH 2D7QA 3RWDA 4WY7L 5D2LA 3FN9A 1KULA 1UWXK 3CFJB 3BPCB 3QI9D 4X6EB 3IDIA 3BKYL 2YD8A 3DMMA 1RVFL 3EIFA 1JGDA 1KPVA 1D6EB 2H26A 4RRPA 4B50A 5GZND 5IFAL 4ZYKB 3RWHB 1VDGA 1FLRH 3MODH 1MFBH 3G5VA 3L3DA 4OJFH 4XP9H 4Z7UA 5DYOA 3TIDA 3DMMC 1MWAB 1MCCA 3ZDXF 4HLJA 4LOUD 4FQJL 5ID0B 1L6ZA 2V9QA 3IU4L 4PGEA 3CLFH 5FECB 2FX9H 2C3XA 1NAML 4L3CB 3MRIA 2APFA 1YEDA 3VRIB 3DX8B 2YXMA 5L6YL 1IKFL 4HFWB 1QFWI 1NAMH 3O6FA 4NJAH 2AJZA 4KQ4L 2GSIB 5D1QD 1IT9H 4GRMA 5FYKH 1CZ8L 5J11B 4NKDA 2WMPA 4HUKB 4V2CB 2KKQA 3MV8E 2CDEA 3HNSL 2C7UB 1QPPA 1QHPA 5C0CD 1HWGB 4FNLL 4L9LA 4EUPH 4OD3L 5KSUB 2PO6A 3LDBC 5KTEH 3P9WB 4GRMB 3QCUH 2ADFL 4P5MB 3TYGL 5GS1C 3ARED 4U7MA 1ZLSL 1R5VB 1IC7L 4K8RH 5KSBF 4F7EB 4BSWA 4HK0B 4RISL 5F8QC 3EJYD 4NNXA 5JO5B 3LKPA 3QIBD 1F3DJ 2W07A 4JO3L 4QYOB 2FB4H 1GSMA 1I1YB 5D1XD 1D6VH 1I8KB 5IHUH 4KJQD 2Z93B 3S34H 2I9TA 4LSRL 3ZE2E 1J0IA 4W4NA 1D9KD 5TGBA 2DLIA 1A4KB 4PRAA 3IS0X 2R0WL 2Y25A 4QRSB 4PJ7E 3CVHH 1TCRA 5DD6B 3VD4A 3TV3H 2WUCL 2XZAL 3MGTB 4N8VA 4LCYA 4ZUUA 5EA0H 1A7OL 3FT2B 4P2CG 1WV7T 1MAML 3Q2CA 3QXUA 2HJKA 1C1EL 1E4WH 1UWEL 3MXWL 4OSUL 2AV1B 3OKMB 5BQ7B 4PREB 1B4RA 3D25B 3MOBH 4MCYA 5C7XL 2KQNA 3BRDA 1NLBL 2YA2A 1LEKA 5JOPE 3UTZA 4KKBD 3GKWH 4HPOL 4LNRA 3BH9B 3F7PC 5EOCH 3MJ8B 4MD5B 4LMQI 2QLVB 3PWLA 5FV2A 2M26A 1D5BA 3ZT7A 4LAJH 2MTPA 3DROB 4KGJA 5C09A 1D5IL 4FQXC 3BZFB 3MRDB 1U8KA 2OP4L 5D7KD 3H2WA 5DMIH 3UTSB 4JRYE 2XTJB 3MUHL 3P40A 5F9AC 4JN1H 4P2RA 1UA6H 2ITDB 3SDDA 4F33B 1U93B 4LHUD 2AJ3B 3TA3A 4XBPB 1P7QA 1FIGH 3PWLB 4Y0GA 4HDIA 1IKNC 5ICZA 3LN5A 4V1DB 1BVZA 4MDIB 5DJDA 1UZ8A 4A2MA 4YXLL 3RVTD 3WO4C 4RFOL 1A9BB 2KL6A 2QHRH 1TJIL 3D0LA 3FO9B 4KRPB 1Q0YL 5ISZA 2EE2A 4PRNB 3DO7B 3O3DB 5JW3L 1NEUA 3G9VA 4YHKL 3AS0A 3L6FB 1IRAY 3OKKB 1MH5A 2HJLA 4OBRA 1U0QA 2WP3O 3V79C 4KI5F 4OZ4A 2IMMA 5D1ZC 3OJDA 4OLXL 1OP3K 3S36X 1HXMA 3OV6A 1P4LB 4OTXL 5ALBH 4GAGH 1F58H 1KIPA 1UH3A 1XIWA 1R24A 2OMBA 5EU7C 5BV7B 4GAFB 4RWYH 5BVPH 3FMGH 2HAZA 3NFNB 1G1YA 3MCLH 3RY4A 4WU5A 4U33A 1SVCP 1IGTA 3TO2A 1BBJA 5HGHB 4KJPD 1YEIL 4BUGA 4IDJL 1P69B 4TRPL 4PJBB 3RI5K 1F4HA 1HDMB 1NDMB 5F9OL 3MBEB 3RFZC 4XCCH 3GBNH 3R8BB 4LGSB 5KS9A 2P42B 3TBVA 4N0FA 1H3PH 2YR3A 4AQ1B 4LCUB 3DUSB 2R15A 4GG6A 5ITBH 5DUML 4F7PB 3WKMH 3KLHC 1BQHA 1RJZB 3MNVA 1Z9MA 3HHRB 3VWKD 2MCG1 2CLVA 1LDSA 1S9YB 1ZAGA 1MCOH 3MXWH 4OSUH 3U0WL 3VXSE 5D7KE 4JR9H 4ZOBA 5F7DA 1F4WH 3JWOC 5FKAB 2XZQH 4X6DB 4OLZH 3D85A 4A2LA 5L9DL 4Z6AT 5E6YA 4GKNA 2BC4A 4WU7A 1DANT 3O9WD 8CGTA 4NN7B 4XNQB 4PLJD 3QXAA 1WEJH 2VQUA 5FHAL 2FEEI 5GGQL 3H9HB 3FFCE 1FH5L 2XTJD 2X70B 4ZMAT 5ECJE 3MRKA 3PG2A 3V6FA 1FNEA 4GW4A 1OWRM 2JCCF 3WLBB 3FFCB 2BX5A 4TUJA 3QO0B 1IC4L 3ARYA 1WBXA 4FQCH 2R0LL 1MHPL 4G6AD 5I2IA 1R3IL 4BFBD 2HTKD 1N5YL 4M6OH 3BT2L 5DD5H 1OT1A 1D5XA 5GRJL 4GW1A 4JG0L 5CP3A 4OQTL 1YQ2A 5I75C 1A1NA 3PWNA 5DHYB 3UCRA 4OIAA 4DZ8A 1MI5B 4H88H 3U4BH 3F12B 4HWEH 3ZL4L 4ZDHA 1MRDH 4MJ2A 3TBSA 3IFPB 5D5MF 3S36H 3VG9B 3HPLA 2V7HA 4EN3D 2YMXH 4Z0XB 1S7RB 5EOQL 3PWNB 1AXTH 1CIUA 1T7WA 2BNRE 3FO1B 1KPRB 5D2NE 1BFVH 4Z7WE 1CXEA 5CJ8A 2A6DA 4JFHD 4HXBH 1L9NA 2XWTB 5E1AB 4YUEH 4L4VE 3BPNB 4UQ2B 3T0EE 2HWZL 5HY9A 4X9BA 4HW6A 5JORA 1FFNB 3TZVA 4HQQL 2RGSA 2VN4A 2EIZA 4LDOB 4RQQA 4EBQH 3KPSA 1MJ7H 1X9QA 2AJYL 4M1GH 5GS0L 1FN4A 5HHVH 1WSST 5K59E 4XNZB 4H0GA 4YPJA 4G8EB 5HYJA 3FQWB 3AMKA 4NN5B 5H94A 5AAMA 1MHHB 5E5MA 2DQIL 1CICC 4HIXH 2AGJL 5FO9A 5F3BA 1QA9B 4YZFF 1T5XA 3I75A 3MLYL 3TBVB 4QRPB 1NFDF 4GAYB 1LP9F 3RWIA 2HLAA 3MRRB 3B9KA 4LVHB 2DAVA 3QO1A 3OJ2C 4FNLH 3IDGA 4O51B 3TNNB 3GMRA 4LCWA 4GRLB 1HHKA 3GSOB 4KI5C 3OKEB 4AG4L 5FGSA 1T1XA 1BECA 2GTZA 1NCBL 1P5VA 4MLIA 4JZOA 4XI5D 5ERWB 1NSNH 4P59H 2VXQH 4TPRH 5BW7A 2YUWA 2NXZC 3JUYA 4WU7B 4WW2B 3VGHA 3JVGC 3TNNA 5EORH 2P44B 3WSQH 2APWA 2D7NA 1H15B 1L7IH 3P30H 1T89A 1WCQA 4ZD3H 43C9A 5AD0B 3GI9L 4GMTL 1VSCA 2FNBA 2Q76A 2HT3C 1VFAB 4K2UL 2F53A 3KPRE 2OZ4L 3SKJH 2UWEE 5JXEA 5MP6L 2EDQA 4NJ9L 1TJIH 1E0OB 1DE4A 5ICXA 3LIZH 2GJ6B 3HE6D 3BFOA 1FZJA 2B4CL 1LO3L 3RZWA 1AD0B 4HFWA 1FSKB 3RI5F 4IRSB 3F7VA 3CZFA 2F74B 5DHVB 4XCFH 4HGWB 3X11A 3P77A 2I25N 2NY6B 3U0PA 3FB6A 5EU4B 3SO5A 1A2YA 1ZGLA 3C60B 4WEBH 1LO0L 1D5MB 3MREA 4S10A 3GM8A 3I02B 4U05A 4GS7C 1UG9A 2AXJA 2LU4A 4MA8H 5DK3A 5K93A 1CCZA 2YPKB 1A0QL 5BV7L 4PY7B 5ACZB 5LXGL 2ZG2A 4EQ2A 3MLZH 1T0MB 1MHCA 2NXYB 4CUCA 3E0GA 3LKOB 5DWUL 4X4XA 3U7WH 5GRXG 4MYWB 2CKBL 4QRRB 2Y5TA 4L9DA 5D7LB 3AAZB 3CFKA 4UTAL 1E4XH 5AG9A 2AABH 4ONFH 4Z76A 4L4TD 4Y1AB 4M7JH 3PWJA 5C08B 15C8L 2Z93A 4AEFA 1Q0YH 1GJIA 4X8XA 4NQDA 5L88H 2I9TB 4PJBF 1BAFH 1XF4A 1P2CA 3HUJB 3TBWB 1HXYA 1F00I 1EGJL 2JJVA 4OFVA 4WW2C 1Q9LB 4QRSA 2ZUUA 2HH0H 1BX2A 4NQEE 2AEPL 2HFEB 3MV7D 5JW5A 4HKZA 3ULVL 3QNYB 2AK4E 4HXAL 2C5DC 4LCYB 5MEPB 4XPTH 5D6DC 1QO3B 3GHEL 5JPNA 5DRXA 5E2TL 1R5IB 4W6XB 4V2BA 3FB7A 3G5VB 4R4BA 3BYYA 1DLHB 4I9WE 3NFSH 5T3ZL 4Y5YB 3P9LA 1VESA 1T7ZA 2H41A 5I17B 3TO4A 4JM2C 1JZ8A 2YRLA 1LEKB 1A3LL 4OBSA 5CZXD 2K7PA 2ADJA 4YNYA 1RUMH 5EU5B 1QO3A 3MJ8A 1S7WB 3H0TB 3IB4A 4OCYH 4HF5L 4FQCL 3CIQA 4FS0A 1A6AB 1T5WB 3FRUA 4RZCA 5L8KB 1KJ3L 2JCCE 3IXAA 2MFNA 3DOSA 1FZOB 4PLJC 2CDEB 43C9B 3VH8B 2VLJE 1S7WA 3H0TA 2ZPKH 4AT6B 4MAYC 2ATPB 2AABL 4ONFL 5D72L 3HPJA 3RWFB 5FO7B 3W9EB 4DKEL 3EBAA 3P0VL 5HHQA 5JIIA 3L3HA 4WHYG 3RUGA 4P5MA 2PO6C 2VN7A 5JDSB 4KWUA 3D0LB 4R3SB 5EBWB 3HI6L 1HZHL 3GSNA 1JZ5A 5GJSH 1OLLA 2H26B 1IC5H 2YKLH 4LKCB 5EH1A 3T3PE 3TN0A 3F6IA 3QQNA 4Z7UB 3TIDB 4HGWA 1BIIB 2VDQH 4YBQD 3PHQB 3IJSB 4X80H 1DL7H 3IDJB 5AZ2H 2FECI 4BK5A 5TQ0L 2NY5C 3UJJH 3QJHA 4PJXE 5D5MA 4V1DD 1WWCA 2COQA 3EAKA 3UZEA 2AERT 1CLYH 3FOMA 4QOKB 5J13C 1NGXB 2UV3A 3HRZB 5FK9B 4KROD 1H3GA 5DRWA 4H0HB 3H9SA 2D9CA 5KS9F 5J0BA 3D25A 2NY5L 2EDYA 5C6TH 4QO1A 2LVCA 3EOAA 4BQ9A 5LBSL 4G9FD 4NQTA 3MRHB 3O3EA 2AXGA 1JWSB 4Z7VA 1RZGB 1J9CT 3U83A 3L3DB 5DYOB 5DSCA 1KCRH 2I26N 4YHKH 2QSCH 4HBCH 3WLWC 4O58H 5C09B 3CU7A 2DJSA 1BFOB 1X5GA 5D1ZD 4EIZC 3SE3A 1FGNH 4FFVC 2BSRB 4LEXH 1YQVL 3OG4B 2EH7H 1P4IH 2NW3B 2V2TA 4XNYL 5DJZB 2F58L 3I84A 3CFBA 1V3MA 3LKQB 3WFEH 3E8UH 4TVPL 1QTYT 2ICWI 1G6RL 5D2LF 3DTXA 1RUAL 2QBWA 2X4RB 3D2UA 5CJQH 4XXDB 5C07E 1IAOA 4UU9A 1MCPL 3BKJH 4G80A 5FKPA 3K4DA 3LN9A 4R9HA 5EO0A 5EUOE 3WFDH 2EZ0C 4L8BA 3VGAC 4MNQD 2F54E 1T83A 3PABB 5DRZB 1IGFH 4N0CC 2P1YA 2HVKA 1NBQA 3Q5OA 4TUKH 1AHWB 2A73A 4HX1A 3WIHA 1UM5H 4X4MA 4AIOA 4WFED 1RQ5A 4ZFFB 1YMME 3QUYD 5D70H 2XOTA 5GRUH 5DK0A 3HZMB 2V2XB 3T4AA 3ARTA 4N9GA 2FBJH 5IB2A 3IF1B 4YDIH 3ULUF 1YYLL 4ZPVA 5DQ9B 4A6YA 2WUBL 1OD7A 3UPRA 5DVLA 1FAIH 3L3HB 3C6LC 3M17A 3LPGA 3K2UL 1WBYB 4U1KA 2EO1A 5HYSB 3ZDZF 3VXMB 3ZKQD 5C0CE 3WEXB 4LAQL 3C5SB 4M03A 5BZDB 5D1ZA 2NX5B 2PO6B 2F15A 3S5LA 4QRRE 1XR8A 3MRBB 5DMGD 5H35B 5SX5H 1QRNE 1KN4L 2VISA 3P4LA 4XNYH 5E2TH 4HEPG 2ESVE 1U2HA 43CAB 3G6JE 3BN3B 4WV1B 2DF3A 2VDPL 1RK1A 3ARDC 1J8HE 5HPOA 5FYJU 2BSTB 4JHZA 1XCQB 3ETBF 3L5IA 4YK4C 1MRDL 3OJMB 1GZQA 5DZLA 2R69L 4N0RA 4LRIA 3ZDYE 2CR6A 1KEML 2VWEE 4WUUE 2CXGA 1UKTA 4K71C 1KGCD 1TIUA 2EC8A 2JKXA 3OL2A 2B7DT 5F1OB 5HI4C 3UZVB 4JZNB 5LJYH 3T0BA 1QBMH 4L4VB 4QXGH 2CQVA 1OSZB 4Y4HA 1DQTA 3ET9F 5E5MB 4M4RA 2YZ8A 5EUKB 5IBTL 4XHQA 3NN8B 3KPMA 1LD9B 4J4PD 1UADC 3OG6B 2YRZA 1FH5H 4F7TA 3I50H 4JO4H 4Q9CA 1IAKB 1I85C 4YHML 1ZANH 1FE8H 2Z92B 4OZHA 3WJJC 4HGMA 2YOCA 3HMWH 4X99A 2JJSC 5AZEH 4BM7A 5I76B 5JPMA 3F7YB 1SMAA 1D5XB 2H45A 2Z31D 4NC1E 3CD4A 3QIBA 2CXKA 4M6OL 5DD5L 1DN0A 5KZCD 4AM0B 4ZPTB 4F58L 1B90A 1JGEA 4UV7L 5HGDA 3DGGB 5C6WH 2DM2A 3O8XC 3L3GB 4KJWC 5HHMB 1C8PA 2XY2A 3MA7A 4MQXD 4LPWA 4AL8L 5DDHB 4XWOC 4YHLH 1U93A 2BVUA 3NA9L 3OKOB 5F1NB 5CIPH 4UT9H 4PJHE 1EGJH 3EYQD 1JE6A 4IMKC 4IS6A 4AM0A 1CS6A 1BM3H 3DVFA 1NMAH 3UDWC 3QDJE 4L4TE 1HOCA 2HVJB 3KHOA 4W6WB 4O02L 4XXCC 4GQPH 1JZ6A 4OLVH 3SDYL 3N1GC 1UB5B 2NXYD 3FT3B 4ZOEA 4KZEH 1LEGB 3RTQA 3MLVL 4GO6B 4TN9A 5E6IB 5KS9E 1JPTL 4JDTL 1HQRA 4K3JL 1EO5A 4C56D 3K81A 2AXHA 5MEOB 3C6LD 1JYVA 3PGFL 4NM4H 3RTQC 2WWMC 4OIIH 3UJTL 4HFUH 2AI0H 4M62L 2J6EL 3DBXB 2AJUH 4P59L 5IW1B 3ZYZA 1UACL 4F7PA 1FN4B 3G08B 5BXFB 3C5SA 5HGAA 3IFOB 1JGLH 3WD5L 5HYJE 2AJYH 4S11A 2XWJA 1CVSC 1SEQH 3GIVA 2Z0BA 2P5EE 5CSZA 4X9HA 5HBBA 1RIUL 3WKNA 4LLDA 2CDGA 5F3BB 1MHPH 1T0NB 5E99L 1NGQH 3RZCB 4G8GA 5MERB 3A6CL 4XAWH 5GS1B 3LEXB 1MCDA 1RUAH 1R3HA 1INQB 3QWQB 4PY8J 3VXME 2VZUA 3HC0A 3CH1B 4NQCE 5D2NB 3LAFA 4MD4B 4XP4H 5EU7E 3T2NL 4YIQA 4MHHG 1T1XB 1S5HB 4J1UB 4LSQL 4AG4H 4G8GB 4WHTA 3QO0A 4XNXH 1E27A 4D9QD 2VZOA 3PNWB 2OJEB 1KTKE 5D1QC 3ARRA 4FXKB 4Z95H 2WWKO 4RDQG 1NGWB 4XP6L 5DWUH 1E6OL 1DQDL 1X5HA 2VR9A 3CNKA 4K94C 1S9YA 5JLZB 3NN8A 5EORL 3O4LA 4QWWD 1BOYA 1UM4L 1HQ4A 4FQHB 5GS0C 4WWKD 4PJCA 2EYRB 5J57B 1CGUA 2VL5B 1KJMA 1A14L 3U46B 1RUQH 1TXKA 1B6DA 3CSYA 4XRCB 3KNBA 4NKOB 2GK0B 4CN1A 5IWLA 3SE8L 5HHPA 3V6FB 4X9GA 3QUML 4RMWA 4P2QA 2APTA 2B20A 3QI9C 4Y5YC 4M1CD 1YYMH 2D4FA 2E5EA 2YD6A 1MSPA 5DO2D 3RPKA 1H3XA 4PJ9B 1LO3H 3STZA 2FEDC 4KI1A 1FC1A 3RX7A 2HT4C 1MEXL 4JRYB 3OAUL 4LQFL 4X83A 1PY9A 2XWBA 1P5UA 2KZWA 4EI5C 5GSRA 3S9DB 4JR9L 3O3AA 5HYQB 1K8IA 1CT8A 2ATKA 3F12A 4RMSA 2R0KH 4XPAL 3TYFB 3MLVH 4JANB 1ZVSA 4K3DH 2FD6H 3PF2A 5IQ9A 3VGGA 3U6RB 1ZTXL 4ZTPL 1NMBH 2AK4D 4KK5D 2C7UA 4Y4FD 3HKFA 4U1NB 4LLMB 3N50A 2O5YH 5E8DH 1C16B 4XMKL 1J88A 3JV4B 2VE6A 3RX8A 4LCWE 3TH3T 1BFTA 3VXRD 4AEHH 5F7KC 3S88H 2ED8A 4JO1L 4PP2B 4YHYB 1VKXB 4N8CH 1QLRB 1HZHH 3EDJA 4MNGA 5I19H 1AFVH 4CNIB 2EO9A 5D70L 3SGDH 1CD1A 4HC1L 1AXIB 4LSPH 3ULUC 3QEGL 2NY4D 2P7TA 5T3XL 2GUOB 3TH2T 1UZ6E 1RUPH 5I9QC 5TDOA 5I1EH 3BESR 3H7BA 5GGRB 1JTTA 1YNKL 2ED7A 4YDLC 3ULVD 3QNZB 3IAGC 1VA9A 3MUY1 1H3UA 5JQHC 2Q7YA 4M7LT 1Z0MA 5BS0E 2F53D 3FMGL 1D9KA 5D4QA 1ETZB 4F15B 2D7MA 5E03A 1X7QA 3UTPD 1Y18A 4ZFOB 2X9XA 1MIEH 3GJFB 4WO4B 3SPVB 3VXNA 3RGHA 3MLWH 2BMKB 5J12C 1CDHA 1S9VA 2E6QA 3HZKA 4ZQKA 3MLWL 4IRJA 4G43B 2DQJH 3WFHA 2JB6B 3NCBB 1A6ZA 4JFFE 3ROOA 3K2MC 1MRFL 1YECL 4WFFE 4EXPX 2XQBL 4G3YH 2EXWD 3RUGE 4FG6D 3QBTB 3VE0A 4OCRH 4M8VA 3V6OC 3UPAA 5CLWA 4G43A 1MOEA 4U0RB 4RBPH 5TF1L 2NY2D 3QIUA 1G7JA 1VFUA 1DBJL 1MCKA 3JTTA 4WJ5A 3S4SA 3UDWA 3IYLW 3WFBL 5FOBB 5I30L 1T0MA 3RVWD 4FQIH 4DWHA 5KVEL 4MAYA 5AAWA 3O6FC 3ORJA 4DVBB 3FQNA 1NH6A 4MA3A 4ZOAA 4KUZH 2NY3B 4XPAH 1D5IH 4Z5RA 5ANMA 3ILPA 3DVNA 4J3XA 1T5WA 3FRUB 5CZKA 3JTTB 4JLRA 4WJ5B 5F7LB 4JHAH 2R0ZL 3N1MC 5LKNA 3V6ZB 2EH7L 4F7MB 3TVMA 1YC8A 3MRIB 5L6YH 4XPGL 3O3BA 4PLKC 2DM4A 3G5XA 3SBWC 2CRMA 1AP2B 4I0PB 4LSRH 1CBVL 1N8ZB 3AS1A 3HLAB 4QYOA 3WO4B 1VERA 2P5WE 1HI6B 4P3DB 3V5HA 3VJ6A 5KVMC 2L7UA 3TT1H 1DUYB 3MODL 4BQBA 3TVMB 2CR3A 4OKDA 2IGFL 3FOLB 5DVNA 1QFUL 3CFJA 3WL9B 4G5ZL 3LQAH 2WNGA 4X6BA 1K4DB 2HLAB 1JF1A 3OPZL 2DDQH 3VJ6B 4YNYB 1J8KA 1T2XA 1Z9SA 3RVXD 5KOMC 5FCUH 1G1CA 3VFOA 1VGKA 1XMWA 4PD4J 4R8WH 1EO7A 2IBGA 2ENSA 1G9NC 3IXAB 3BE1L 1CU4H 5LAXB 3ARZA 5L8LB 4OZFA 3D87B 5IVXA 4HZLA 5MEPA 2R23B 4XB8A 5DUBA 1GOGA 3N0PB 2HRLA 1YPZE 2V5RA 1DSFH 5KTEL 5DMKA 4PJ5A 3WIIH 4KTEL 4I2XB 1JI1A 5ESQA 3P9LB 4NKDB 3IDNA 1S7VA 1WFNA 4DGYH 4WGVB 5CCKH 4MCZA 2H9GA 2AXGB 2OTWB 3OKYA 3CFCL 3HE7B 5IOPA 5FDWB 5IVOA 3KLDA 4KHXH 3AU1B 2E7LC 4YO0A 1CI5A 1BQSA 5JNYA 1GOHA 2XNAA 4K07A 3MO1B 1XT5A 4R0LB 2AQ2A 4PJCE 3ULVF 3RQ3A 4DFHA 1A5FL 2Y72A 1KEGH 5DD1L 1DBJH 2DBJA 5LGKA 4ZYKA 1ITCA 2YBRB 5DJ0A 3RWFA 1MFEH 3E6HA 1MIML 3IU3B 4LHUG 5AUMB 2PYEA 5FECA 1VENA 3C60A 5T1MB 3U7YL 4ONHB 5BRZE 4HUWB 4M5ZL 5HYFA 4NN6C 4Q2ZB 3MLRH 1X5IA 5A2KH 1WFUA 3N1FC 1S7RA 4GSDL 4FFYH 1IILE 2ZSWA 1G6VK 1RI8A 1CDYA 3BPLC 1MIEL 3TF7C 4NQVB 1NFIB 4AH2B 2H8PA 5E2WL 2X4SB 4PRHA 1WZKA 4IOFD 5MHSD 4YEFA 5CCKL 4X9IA 1Z9OA 1I9JH 3LQZB 3B8SA 2I9LA 1A4JB 1BVLA 4G42B 1F97A 3GSXB 2YEZB 4MDJA 4GXUN 4JG1L 1RUPL 3LKRB 2IPTL 2Y07L 1KJ2A 2ADIB 3UROR 1A47A 5DJAB 4AENA 1K85A 4RMVA 3FB8B 4YIQB 1ZT4B 4MZ2A 6FABH 1EMTL 3HI1B 3WNPA 3WJJA 1I9RL 1KCSH 2GKIA 5T1LA 3ZE0E 4M93C 3J8F7 5BV7H 3MJ6A 5SWZB 2B4CC 4RCAA 3IRPX 1MLCA 5H37G 4POZC 1V3LA 1V7NL 5KN5A 5FF6A 3BZEA 9CGTA 4HAFA 5IB2B 4Z7NE 2V5TA 4HS3B 3LRSA 2Z31A 5DLMH 5F7MC 5FM8A 3HZVB 4UNVA 3MV9D 3HAEA 5EU3A 4KKNA 3H7LA 3L5JA 3CSYB 3MLTB 4XRCA 1PQZB 4APQA 3ARUA 3OF6D 5IVXE 3MLSH 1ZGLM 4P2OB 4DTGH 1CLZH 1OAZL 5FYKU 1E4XI 3G6AB 4HIIA 4P2QB 4FQ1H 2BNQA 4QCIB 2P5EA 4BKLA 5IP4A 5IB5B 2Z9TA 1A5FH 1KEGL 4OCNC 3RL2B 3Q6GL 5EZOH 4LSTL 1G0DA 2PYED 2BDNL 4M6NH 2R4RL 3WIFA 2UVEA 1H3TA 3S7GA 1DEEB 4TTGA 1JHTA 5I6XB 2RCSL 3IKKA 2WLZA 1ZT7A 1Z6JT 1S7QB 3VMNA 3LN5B 3FFCA 4XXCA 3S5LG 3HE6C 1DVFC 2AV7A 3E8UL 1BLNA 4N0UB 3MCLL 4G8IB 2OM5A 1DUZA 4NT6A 4XC1L 1T7XA 1N64L 3CLEL 4UAOB 1OTUD 4PJGE 4OAWB 4P9HH 4Y4KC 4MSWA 4PR5B 2OZ4H 3SKJL 2IQ9H 5CGTA 1DQLH 1G7IB 1HEZB 3N9GH 5KVGL 2E9JA 4Y16D 3BKCH 1IGFL 1MNUL 5FKAA 3CXHJ 3GMPB 1OF2B 1IGIH 3D69A 4MVBD 2B8OT 4QKXB 1TFHA 5CEZH 4PJIB 3VDCA 3HAEG 5C0CA 4XMLH 2FBJL 2FHFA 3OHXB 3DRTB 3DHMA 3MBXH 3DURA 5LGJB 1H3VA 4KI5D 3BD4A 3BKMH 4PGZA 3MRNB 4M02A 3MRRA 4WI4A 3UYPA 1CICB 1F6LL 4KUZL 1KJ2L 1CL7H 4RX4A 1P53A 3SJVE 2E9BA 2BRQA 3MUGA 2JCCA 3O41B 1BZ9A 3K8MA 3WUWG 4V1DE 4PRPB 3CFBB 3FQTA 3GK8H 3MV8D 2X89D 1K4CA 4M7KL 3QPXH 3RVXC 1I1AD 1BP3B 1MI5A 5E8OA 2RJMA 2OTUB 5GRZA 2A9NL 4U1GB 5E4EC 2DKSA 3DV6B 1PZ5A 5HHXL 3OKDB 5F7EL 4PJAA 1J05A 3QUYA 4M5YH 3OKLB 4JQXA 1QBBA 3FL7A 3MRJB 2ZG1A 5GS0D 3A6OA 4O2EA 1U8QB 5IF0B 3QG6A 1P1ZA 4PRBA 1HILA 1YEEH 1T21A 5CEYA 1T83C 5IHZA 4JQVC 1KPRA 1IGYA 1WZLA 1DANU 3U0TB 5E7FA 4KAQH 1I4FB 5DJXA 1DVFB 3ULSA 5GGTL 3BGMB 3O6KH 4S1SH 1OGTB 2Q8AL 3MV7A 5ADOL 3WN5A 3BZ4A 3PL6B 4NDMA 3T09A 1ORSB 4YR6A 4OZIF 4ZS6D 3VA2C 3V0VB 4JN2B 4AIXA 2HMIC 4F9PA 1OTSD 2X2YA 3RL2A 3HC3L 4OCXH 2HT2C 3OSKA 4E41D 4YXKL 4LARH 4QEGA 5GJSL 1WCBB 4ETQB 1KJ2H 5FO8B 1LNUA 4GW1B 2FB4L 4X6FA 4EI5D 4NZRL 1M05A 5FYLL 5ADPH 2B1HH 4U1SB 3V7AG 5IMOB 4NQXB 1UXSA 1G7MA 1LILA 4DGIL 2GSGA 5TQ0H 3X3FL 4JFDE 1BIHA 1CICD 3PE9A 4YBHA 5L2JA 3TO2B 3BQUD 1W72L 4IMLA 3MUJA 3VCLA 3P9MA 4B7IA 4L5FL 5CHNB 1EFXB 1GGIL 4MMXC 5KSBB 4BH7B 4XCYA 3QT2A 5EU6D 3VWJA 4WTZG 2QV2A 1JMXA 3LRGA 1MRFH 5K9OA 4GT7A 1SJEA 2EEDA 4R26H 4WWKA 5EB9A 5FCSH 3FQUB 1YNKH 1PKQB 1UWGH 4LVNC 5F96L 1PLGL 1XH3B 1Y6KR 4NFCA 5MP6H 4A6YH 3DX7A 2YUZA 4Y8AA 4M48L 4XH2A 5A2FA 3INUL 4C58B 1AGCB 1FVCA 2GQHA 1S8DA 4HUMB 5I1CL 2PTUA 1EEZA 3AB0B 4RIRA 2BK8A 4UUJA 4NWTL 3OBAA 1EIBA 2JB6A 1T66D 1IZJA 1Y6NR 2DKUA 1I85A 5DQDH 5DSCB 4JO2H 4QNPE 3QFJB 4NRZA 1JMZA 4RWYL 5BVPL 3ULVC 1IEBB 4NHUA 1RUML 1Q72L 3TLRA 2JJUA 2ZZUT 4ONGL 2NNAB 5ESVB 1NEZA 3DMMB 4JCMA 4OZFB 5IVXB 3TCLB 3S96B 4GW5A 4PIRF 5B8CB 1AO7A 2IBBA 4KDTC 3TZVD 2PXYD 4H20L 3SCMA 1E4WL 4MQTB 1KB9K 2RIKA 4KY1H 2X4NA 3PQYA 4GKZB 4QGYA 2FLBT 5IF0A 4LQ1A 3BRFA 4WUKL 4OGAD 4LSQH 1MCEA 3U4AA 4L8BB 4LPYA 1XGRB 3KXFA 5GSVB 3NCYP 4NQCD 3AU1A 1DLHA 3ZMRA 3WIIL 3F65A 2DWEB 2HN7A 4XBEL 2BERA 4IOIB 4KJYA 2VZTA 3LVEA 1E6OH 2Q20A 3WJLA 2XZQL 5EU5A 1B9ZA 2I5YH 3GSUB 2PR4H 1AC0A 3AM8A 2VUYA 3MV9E 2UWEF 4K3HA 5E2VL 4KJWD 4ZFGL 2NY0C 3EZJB 2XZZA 1MUJB 3RTQD 2OJZH 4U1SA 1LK3H 2QHRL 3QJHB 1IL1B 4N0YL 4X6CB 3H7BB 1F11A 4UT7H 2VOTA 4LDEB 1OSPH 4K2UH 1Q0XH 1IAIH 5DHVA 3FOMB 4QOKA 4OGZA 4EEEA 1ADQA 2J8HA 35C8H 1LO2L 3GBMH 3WDJA 4DN4L 3ESUF 4PJFE 4L8DB 4XP1L 2F5AL 3HI5L 4DVBA 4XCYB 3GSNB 1MFDH 3MX0A 3OF6A 4JY6B 1TCRB 1WIUA 1K8DB 2YPKA 3QHFL 2ICEA 2JIXA 2AKRB 4WWKB 3LSOA 4G8FA 1OPGH 1I3RA 1I9IH 4JB9L 4FN0A 1J8HD 1MCIA 4XTRD 1I1RA 1T22A 2FX7H 1YN6B 2ILLA 2VO5A 4NM4L 3LH2L 3NCEB 5B38A 1FFOA 3SOBL 2EKJA 2VSCA 5FGCB 1AGCA 1MRCH 2RBLA 2J5LC 2VXUH 5E0QA 4HBQA 1G9ML 4X5XA 1T2JA 3QIUD 1RURL 4OZGF 5GGUB 2F53E 3KPRA 3KHQA 3WDHA 4ODBD 3ULUL 2IANB 4OIBA 4KGLA 4DW2L 2VNCA 4ZFOA 3C8KA 1DR9A 2MNUA 3LQMA 4JFEA 3UTOA 5JW5B 5TF1H 2C3WA 3V4VH 1EEYA 2AEQH 4J3TA 2BNQE 1DFBL 3CUPB 4NQDE 4ELME 4X0KA 3O2DA 2UZYB 4UDUB 5EBGA 5EZJB 4KU1A 1M7DB 1P9MC 5B3JE 4I2XE 4UINL 1HHHB 1JPFB 1FG9C 4O58L 5CZVL 1BWMA 4JVWA 3I2CH 4QT5A 1QACA 4IBLT 2Q6WA 1JHLH 5IGXH 2HKFL 5C0EA 2R4RH 3MOQA 5F7WC 3M8OL 3O81A 4C56E 5DFWH 2BVQB 2KBGA 3PDDA 4L3EB 3C6LB 2Y07H 1AO7D 3OKOA 5F1NA 1XR9B 3JUZA 1AQDB 2APBA 1OM3H 2RQ8A 3C87A 4WFHD 2MKWA 4J3SA 3U0PB 4R2GB 1IC4H 2P8MB 1NGPH 5K9KA 3BP6B 2LABA 1A8JH 1QD0A 4Q74A 1Q9OA 3WIFB 3MXVH 4AT6A 1CN4A 5C0ND 4DKAA 2NY0B 1NCDL 3JV4A 4PY8I 5C2BL 1KB5B 2PCPB 3GSQA 4LGRB 1NFDA 1QFUH 5GZOD 3QDGB 4ELKB 1H3WM 2BVPB 4GG6E 5IG7B 4RMTA 3U7WL 2FX9L 4K3GA 1JPGB 4M3JA 3FAXA 3QDJD 3MSPA 1TCMA 4FFVD 2JIXD 3NACH 3CFEA 4GG8B 1T4KB 1NDMA 4I48B 2R4SH 1QYGL 4MQXC 4E0RB 4KROC 3LPFA 3P11L 5H2BA 2X4QB 2IJ0C 1WZMA 4Q6IC 2VLKD 4PJAE 1AGDB 4BZYA 2MHAA 2ZSVA 1XEDA 1NSNL 4HXBL 2W38A 5GZOC 1I8MB 4N90E 5T5NF 3WXWH 3T0EB 3GNMH 5FYKD 5C1MB 3T0WA 5DXWA 1FNGB 4JG0H 4M3KB 1BJMA 5CJXC 4PJFA 4NFBA 1FYTD 2RCSH 3K1DA 3RKPA 1JFQH 1XCQA 1HE7A 2I24N 5BMFH 5DJCA 3ZL4H 5JW4Q 5IJVB 4MA1B 3L3IB 5DS8A 1NCNA 5F7EH 5I76A 1BZ9B 1H8OA 1W72H 4QF1A 1ZHBB 2DBLL 5CMAA 5D7IE 4HS6B 3ZHLA 2EIBA 2DS4A 4PG9A 1CDIA 2IADB 4CVZB 1L0QA 3VD9A 4P9HC 3CVHA 3QUXA 4FFWC 4K7FB 4D8PB 4JRXD 1JHKL 3S37H 3IGAB 1KCKA 4K94L 1BD2B 4K9EC 5E95B 5BJTA 2R69H 4QF1B 2J1KA 3MCG1 2FX8L 4PV8B 3TBTB 4HJJL 3IXTA 4XCEB 2VDKH 1JVKA 2GJ6D 1YY8A 2HKHL 5TQ2H 2Y06H 4LLUB 3QG6B 4AQOA 5D2LE 3U9PH 1P7KA 2PO6D 5FCUL 5MI0C 2IADA 4CVZA 4GKSB 3THML 2VDOL 3HNTL 5GGTA 1KC5L 1OAKH 4IMKA 2H8PB 3HPLB 4UMGA 5T1KD 1J0HA 4K9EH 1HKLL 1WVZA 3BEWA 4HS3A 2VWEC 1NFKA 3LOWA 4JPKL 2R9HD 3MRLB 1DN0B 5DD3L 1LO5B 4M7LL 2Q7NA 3GGWA 1CE6B 1QFOA 1KB5L 4I5BA 5I8OH 5FA3B 4BFEA 5C0RH 5ISZB 2RFXB 1KPUA 3HAEH 2VLRE 5T3XH 3VGBA 5IQ9B 3D69B 3O3DA 1W72B 5DQ9A 1I7TB 1RULL 2ESVB 5CSZB 4PB9L 2VTFA 4AZ8A 4ZNEA 3SDAC 4E41B 2EIZB 5ENWB 3PIQB 4I0PC 3KPQA 5A2JH 2NX5E 5GHWH 1ODAA 2V17H 4NZUH 2CRYA 1A7NL 4MQ7A 1UB5A 2B2XH 4KQ3L 4N0UE 3ULVE 5E1HB 4PJBE 3VFVA 5FF6B 3BZEB 3DXAE 2I9LB 1CVRA 1UM6L 4PRPA 5IT2H 3UTTE 4UT9L 4S1SL 1U91B 1OAUH 3VXRB 3WMSA 4X6DA 1LE9B 5T3ZE 5I0DA 5IW1A 3BSZH 3W82A 1EXUA 3QO1B 4OAWA 1EUUA 4FXKA 4JGMA 5CJBA 5C09D 3BVNA 1C08B 4LPTA 3HC4L 1YEHH 2XWJB 5EUOF 1QRNA 4P3CH 1HEZA 5I1DB 1JFQL 1LO4L 4K7PX 4J7RA 4X7SH 4XVJL 2GITB 5ICYB 4TUOA 3QRGL 3KYMB 1A3QA 4HIIB 32C2A 2XPGB 1T21B 1IAII 1MJ8L 5J1TC 1S7VB 5GRJH 4RFOH 1BJ8A 3QUXD 1U8NB 2K1MA 3D5OF 5MEND 4GBXC 4MXVE 1GL4B 2RHEA 4HV8B 1D5BB 1KYOJ 1JYXA 5D7JB 3LRSB 4QOKD 4H25B 2JJWA 1GH7A 3HNVH 5E4EB 1A7QH 3VXTA 1CIDA 3SKMB 3SDXB 4QXGL 2ARWA 2EDWA 2BCKB 3QXAB 4HEME 5C3LD 4JKPH 4Q6YA 2UWEB 1Q1JL 4ZSOB 5LGHH 3ARSA 4JFYB 2VC2H 1HKFA 4N9GB 4JQVA 2YBRA 5DJ0B 2EDDA 4TUJB 4YGAB 2XA3A 1E4XL 3CX5J 4FQ1L 4LLDB 5HGDB 1NCTA 1F4WL 4Y16B 1YMMD 1R3JB 1QSEB 3EYOA 1UCBH 2HT3D 4LLVB 4JCLA 3UJIL 2ZJSL 4DK3A 1BZQK 4F9PC 4I0CC 4MAYB 1CQKA 2H3NA 4QRTA 1BQLL 3GFUA 3C9NA 4IS6B 4RRPG 4WUUA 1J11A 4XC3H 2LQRA 3VI4E 4B7LA 4NZTH 3MRCB 4HLZG 1WLHA 2ERJB 5DJ2A 4I3GA 4MXQD 3ZSSA 2X4PA 4P4KC 4G8GD 1MJ8H 2YD7A 5FHBL 4F7MA 4WW1B 1KIQB 5TPWH 4YHPA 2IH3A 3TT1L 1RIVL 1T0PB 3NFNA 3SE8H 4ACPA 3U0WH 3QPQD 4HJ0D 2IQAB 4WU5B 2H1PL 1KT2A 4QTHA 4F2MA 4PGDB 1CXFA 2X9YA 5GIRA 3Q6GH 5EZOL 3W0WE 5A2LH 2W0FB 2MQCA 2DQTL 4I4WB 4Z0BH 3RP1A 3VD5A 1WISA 1TNMA 5I71C 1KB5H 3BP5A 3BRGC 4IHOB 3KPMB 1JGUL 3TFKD 1NEZB 5CAYB 4JDZA 4JFHE 3CLFL 4JZJA 1BQHB 1EHLH 2A6JA 5CHNA 2R0LH 1JN6B 3FB7B 4R4BB 4U1HB 2JE8A 1VGKB 4D0CA 2KPNA 2BSSA 4P23A 5L2KA 3PL6D 4PJHA 4PJ9C 3CC5A 3UTTA 1CGWA 1DP0A 1PD6A 1M1SA 1A7RH 3HZVA 1G9EA 1J1XH 3MLXH 3QQ4B 4JPWL 4NQED 1A6AA 3KXFB 5GSVA 2A9ML 4L3EE 1C12B 4IRZL 3HB3C 3QUXC 2HA1A 1HNFA 3H9HA 5GGRA 3TP4A 4OFKA 4P23B 1GRWA 5L2KB 1GIGL 3BGFC 4KJYB 1FQ9C 1N0XL 1A21A 1KTDB 5AYUH 3LZFL 2QADD 1YNTB 4ISVA 1YNLL 2DQUH 3CMOL 4L8SA 2ATPA 5GQBA 3BGFB 3QQ4A 1IVLA 1GCFA 3HPJB 3WFEL 2FCBA 2XZCH 1OGAB 1BGXL 2BMKA 2QJDA 4OZHE 3AM8C 4OM1H 4YXLH 2NNAA 4PP2A 3MXVL 3WS6C 3DX8A 5ILTH 2XKNA 3ZDZE 2EDBA 4NBXB 3TN0B 1PZUB 1OAQH 4PJ7B 2NW2A 4KHTH 1JV5B 3P73B 3SJVD 3F6LA 3FHAA 4XMPL 3ZKND 1EHLL 4MB5A 1FZMA 1YEFH 3KJ6H 5IEKB 1NQBA 4L9LC 4L8DA 3C5JB 4GSDH 3M8OH 3O3BB 2Y5TB 5D7LA 1AD0A 3JWOL 2XRAL 2DQIH 2N7BA 2YD4A 4X7TA 1BHGA 4HKJB 3VA6A 3PV7A 1MJJA 3V5HB 2O61A 1EEZB 3MV11 3S35H 3ARDB 3B9DA 4IMLB 3CDYA 4IOIA 5J12B 3WYRA 4NQEA 4CAGA 2VR4A 4BSWB 5FEBA 5I73B 1Z0NA 2VITB 1FFOB 4NNXB 4WVRA 2Z35A 4H1LB 4XPFH 2R1XA 4ZO7A 5CINL 4X6BB 1KT2B 5DD0L 2IPTH 2VE6B 1I8KA 3QH3A 1A6TA 4OLWH 4X5XB 4XBEH 1UWGL 2J5LB 1J0YA 4IJ3B 1QEWA 1HCFX 4JKPL 4QLRA 5GGVL 1YQVH 1OGAE 4XH2B 4MZ3A 5D1XB 5EO1B 4JFEB 5ABDE 4NFDA 4U1JA 5FUOL 1N8ZA 2NLJA 3HLAA 2BY3A 4DFIA 4F7CB 5A3ID 4P5KB 5B3NA 4YDIL 5I1CH 4PG2C 4POYA 3RWHA 1AY1H 5TDOB 2AS5M 4PPTA 4LSTH 3PWPE 3BD5A 2NTSP 4D94A 4TSCH 3PDOA 5EU6A 4JQXC 2ZCHH 3TCLA 4XC3L 5IWLC 1JZ4A 3KDMA 5ANMB 2DJ4A 1NUFA 1INDH 4X7FC 2H2PD 2WIIA 5E9DD 4RGOH 5FYKL 2ARJB 2IPKA 3QUZD 2HRPH 1NBZB 3SGKA 3V7MA 3INUH 2NXYC 5DA4A 3SGJC 1J0ZA 4FZ8H 5DD0H 5C0GB 1AR2A 1C5CH 1N6QL 1XGRA 4HC1A 4Z7OF 1FL3B 1CXLA 1PJ9A 2R2BA 4J23A 1UKQA 4CDHA 1GGBL 1X5LA 2DQFA 5F71A 1JK8A 2CUHA 4XVSH 2F19H 4FOMA 1FV1B 1M71B 1MVFA 5HHXH 4XWOD 4HUVB 3QI9B 1A6UL 1S7QA 1U3YA 3LY6A 1RJYA 3DIFA 5CP7A 4OI9A 1LO5A 1MQKL 1DSFL 1P84J 3QUKB 4PLKD 3UO1L 1EO8H 2YPLE 3CDGB 1EK3A 3C5ZD 4Z8FH 4OCSL 3BQUA 1QP1A 4KVNH 1VGEH 2X10A 4Q6IA 2CIKA 1UYWL 2SEBB 2ZCKL 4JPKH 3QFDB 1VGEL 4FMKA 3RWGB 1XH3A 1T3FA 2QQLL 1G7HB 2P8PA 4NKIL 3AFLA 3PP4H 5JOFB 1K6QL 3VWJD 5HXMA 1RMFH 2AJUL 1PG7X 3F7QA 5CJXA 4F37F 2A9NH 1FVCB 1RZKC 4UBDC 5IJVA 1ZOXA 3AREC 3MBEA 1WFOA 5CD5C 5HHOD 3KVQA 2XG4A 4YQXH 1IC5L 1AGFB 3TWCL 3HUJA 5GRVK 3TBWA 5KSAD 4ZD3L 4FFWD 4KMLB 1KBGL 1V7ML 3SGDI 1XF2A 1RIHL 1TZHB 1P7HL 3IVKA 4DUXA 1Q9LA 1D9KC 4NUJA 3VWKB 1GGBH 3N9GL 4IIQA 1M7XA 1MWAL 1A6WL 4X99B 3UJJL 2UZIH 4OF7A 4G7VH 3VWKC 5I1DA 1CFNB 4OZHF 4CU8A 4ZXBC 1AGBA 3FQRB 1CK0L 3UZQA 4XVUC 3NPZB 1OAUL 4LLUA 4C4KT 4J2XA 3R06A 1YN7A 3CAFA 4OTXH 3UBXA 5TQ2L 3NACL 5JQ6L 1DTUA 4FQXD 5DDHA 1R5WA 4UV4H 4CJ1A 5IEHB 2V2WA 3O8XA 4C56B 3QP3A 4N1HB 5HVWA 1C5DA 5E6ID 2CSPA 5C0IA 4D9RD 3QEQB 4LASL 5CKAA 3X3FH 1O7VA 5HDLA 2QKIB 1A0QH 3GGWB 2X4RA 3LN4A 2ARJA 4YH6A 3BIKB 1JWMA 5IHBA 2IF7A 5CFHA 2A0LD 1F5WA 2HFGL 5ALBL 1LEGA 2VXSH 3HE7A 2VXTH 4PJ8D 3WJLC 5IOPB 2B0SL 3PP3H 3OR7A 5BVJB 4OZGE 4JN2A 2OXGA 5JIKA 1PGRB 1R3LB 5CJOH 1A6VH 1MPAL 5FYJD 3KPNA 5KAQF 2C1PA 3TT3L 4W6YB 5EBLA 7FABL 3KPSE 3IXTB 5DZNA 3IFOA 2X1PA 4RMUA 5IB1A 1CXHA 4PJDA 3ABZA 1K5NB 3F58H 2P5EB 4OLZL 4PRID 1KB5A 4HKBB 3ULUD 5T1MA 5CZVH 3ZDXE 3KPNB 3MNWB 4H5SA 3Q5TA 4JZNA 1UCBL 1L0XA 4DKDC 2NY0D 3QZWA 3IFLL 4HZAA 4LLWA 1AC6A 2SEBA 2P5WD 3QISA 2EDTA 4LBEB 5HJ3B 4HH9B 4AEEA 2DWDA 43CAA 1JIBA 4MX7A 1G7HA 3C08L 3HA0A 2XN9D 5HHOE 3HMWL 4AMKH 4F7TB 4QHLA 2YS4A 1N5YH 1E27B 1F90H 2HMID 4ERSL 3VW3L 1IGCL 2ZNWA 4LFHG 2O26U 4JFED 4YX2L 5IROC 3O11A 3VXOB 4PR5A 4DN3L 2H2SC 1G84A 3K1KC 2FIKB 4NO2A 1EHNA 4WDIB 4YX2H 3M45A 1VHPA 3WLBA 2R2CA 1EVUA 4BKLB 4KTEH 5I73C 1S78D 1NGZA 2E8ZA 3L3IA 4RGNE 4TQEL 5CBEB 5KSAA 1T03H 4FQXA 4YAQB 3T2PA 1RZJH 4FQQB 1DBKL 4LKXB 3JWDH 2E7BA 3QDJA 4ZFZB 2XACC 2VLJA 4M7ZC 5T1KB 1PG7W 1IAKA 5HTSA 3JSSA 3GI8L 4XPBH 4YO0B 5FM5M 3FCTB 1H8SA 2H32B 1D6VL 5IHUL 4KJQC 3SGEI 5C0EB 3LS4L 3ULVH 3FO0H 1PW3A 5T5FL 4PJ7F 4JO1H 1BGXH 4P5TD 4WTWA 1FFPA 1MVUA 5DD1H 1I3VA 3RNQB 1KFAL 2J8UB 2G9HA 3SDXE 3QPXL 4V1DA 4Z7VF 1YNTA 4ISVB 4FQPA 5I8KH 1TZGL 3AROA 1JYWA 2ZPKL 1V7NH 3MA7B 3ULUH 3ROLB 2I5YL 1ZSDA 1AXSA 3NOIA 2XWTA 3LMJH 2X70A 3WXVH 1T1ZB 3OAYH 2FO1A 1UGNA 2WBJC 3K8LA 3O3UN 5JXED 3BEWB 3MYJA 1YZZA 4P4RA 3L3KB 1EEUA 1W0WA 4FQLL 2HTLD 1XIWC 2PCPA 4ZUSB 1WBYA 4U1KB 4BQ6A 5F3HA 2DYPB 3QDHA 1NFIA 4UB0L 2EXYC 1ZVHA 3ALXA 1HHIA 5C0RL 2IBZY 1JPGA 3ZTJG 3LKNB 1NCAL 2X6MA 2CLVB 4HC1H 4XWGL 1BOGA 1EHAA 5IGXL 3IDXL 1AKJA 3Q1SH 1F6AA 3OAYK 3OR6A 4U6XA 1CDCA 3P4NB 2VXUL 2Y6SC 5EC2A 4PJGB 2OSLB 2VRAA 4UNUA 5JOPD 3D85B 4I18C 5DC4B 2V17L 3V9FA 3QR2A 4U1MB 2B0SH 3LD8C 4HCRL 4LHQB 2XN9E 4G6MH 4XNQA 2GUOA 5DJAA 4CW1B 1U41A 4MAUL 2HT2D 3KLSA 2VIRB 4Y4FB 5IHLB 3MFFB 3RPIB 2A83B 3A0OA 3CPLB 1J1OL 1KCVL 3TO4D 1ZWIB 2H6PA 4PFEA 1E28A 4Y4FC 2UYLA 4XVSL 5I71B 4IEFB 4FFZH 1KNOB 2VLRB 5E4IA 1XGQB 2VUOA 4NOFA 3DX6A 4P2QE 2VIRA 5I1LA 1IEBA 4NHUB 1JPSH 4MD5A 5BRZB 1T1YB 5J13B 3RWJA 1N5AA 3MFGB 4F7CA 4P5KA 1JTOA 1PKQA 2HP4A 4XNUH 1B0GB 1IJ9A 4JHAL 5JW4N 3G04B 3Q3GA 1DQMH 2GJJA 1OPGL 2GYSA 3SCMB 1S9XA 1I9JL 3VRLF 1HH6B 1UVQB 4WUKH 1P7QB 4JJ5B 5IIEA 4HIHB 4JFPB 1IFHH 1G9MC 2J8UF 2K7QA 1X5ZA 4FRWA 1G0YR 1HNGA 1ONQA 5AWNH 1BBDH 2ORBH 5CSGA 4BZ2H 2CUMA 4NRZB 2BDNH 4PYGA 2VZVA 4PGEB 3EUUA 1CDJA 3D2UD 3QXWA 4L4JA 2JK5B 2IPKB 4PRHD 2XKUA 1JZ7A 5ADPL 1KCSL 1C16A 1OW0C 2CMRL 4Y2DC 4L3EA 1GZPA 5DEGA 4X7TB 1GOFA 5JW4M 5HVHB 5C0AD 1OAYL 2CK0L 3W9EA 2VABA 2XXMB 1KIPB 2XV6B 5CD5D 4PLOB 5F1KC 4O2CA 3UTQB 1RY7B 1OP5K 3NMEA 3TN0C 2W60A 3AB0C 5C0BE 4I8DA 3MLXL 3O3AB 4L8SB 3SDCB 1T5XB 3I75B 5DVMA 4UTAH 2DYPA 5FA4B 1U3HB 3TYFA 3GO1H 1EAPA 4AY0A 4LSVL 3VFSA 3JZ7A 1FZJB 3KLAB 1IEAA 1EPFA 5F9JB 2L7JA 4H26A 5IB4B 5HDOA 2GSGB 3MV9B 2FX7L 1U92A 3NH7L 3MRMA 2EDLA 3B2UD 4AMKL 1CR9H 4PJDE 3PDGA 1BBDL 3DVGA 4EI6A 2CKBA 5DRWB 2YPVH 4E42A 4J4PC 2ADGB 5I8OL 2VDLH 1S5IL 3QDGD 5B8CC 5I15L 2B1AL 2X4NB 5A40E 3FZUC 3KYKH 5EFIB 2WBWB 5KW9L 1NFDE 3HZKB 5BOPA 4ZQKB 2CH8A 3D85D 3U9UA 5E8EA 5ELIA 2GW5A 3SDXF 1NGWA 3WLWD 4MJID 5D2LB 3B2VL 3FTGA 3I6LE 4X6CF 4JFXB 3CFKB 1AD9A 2VMFA 1WIPA 2AKRA 1FL6B 1EEYB 4OZGB 5A1AA 2MMXA 4MQSB 4H8WC 1MCQA 3CGTA 4NBZB 1YEEL 4RA3A 3PP3K 5L0QB 1J5OH 3HMXH 4F9LC 2QSCL 4JY4A 1QSZA 3SPVA 5HHQB 3MRGB 1QR4A 2E7MA 3D1MC 1J1OH 1KCVH 4HKZB 4H8WL 1XFPA 4J8RB 1JNHB 3I02A 3BKML 3KYOB 5DJ8B 1TTUA 5AD0A 2VDPH 1IKNA 3THMH 4BYHA 5IVNA 4JFFB 5KJRH 3U30B 8FABA 4Y16A 4M9PA 3NAAL 1AE6L 2DKMA 1TTGA 5EIQA 3QWRD 1BIIA 1A9EB 5GRVL 3B83A 2GI7A 3ECBA 1U8JB 2FBOJ 4AYFA 2H3NB 5GJTH 3SE9H 4LPCA 5IJKC 2WBJA 3LDBB 2DTML 1L4IA 2V7NB 3GIZL 1QZ1A 2GY7B 1OAYH 4YGVA 3V52L 4NRYB 4JM2F 3QIUB 2R29L 4Y1AA 5I30H 2NW2B 2VYRE 4OM0H 1NCUA 2K3TA 3W39B 5I1JL 2XFXA 1QBML 1NGXA 1R3LA 4NUGH 3U6RA 4TSCL 5C0DA 4G5ZH 4JRXA 5KSBE 1MCLA 1BVKB 4O5LL 2AP2A 1SEBB 5DRNA 4MAYD 5AWNL 4XVTL 1WZ1L 1I7TA 1P6FA 3BN9D 2Z8WC 4U6YA 1K5NA 2XICA 4HIJA 4NBYB 1JWUB 4JKLA 4XVTH 2XA8H 5F6HJ 1NUGA 2CD0A 3BE1H 4EVNB 3FQWA 3PWPA 5FUOH 2BVOA 2R1WB 2YSSA 4FTVA 1BBJB 1U36A 3ARDD 5E6IC 4Y5XA 4MNGB 2GFBB 1JRHH 4TPRL 3DGCR 4QRPA 2DD8L 3G9AB 4YHNB 4FZEL 4U31A 4Y19A 2NMSA 1PX4A 4HH9A 4KXZH 1KUMA 4LDLB 3KLHD 3IDGB 3EYUL 1OTTC 2N4IA 1U91A 1HHKB 3GSOA 1FCCA 4PBWD 3HNSH 4Z78A 3CX5K 5GJTL 4HWEL 2IPUK 3CFCH 3BVNB 3MLYH 1QNZH 3O11B 2FZ3B 2NCMA 1QLEH 3RZCC 5KOVC 1UCTA 2ZNXA 3QCUL 3QIWC 1FRGL 3LEVL 4AIZA 4PRIB 4TSBH 1EH9A 4I77L 4IRJC 4ODXB 4BFGA 3GMQA 3W9DA 3PV6B 1CQYA 3DO3A 1RHFA 5J3HD 4M61B 4XP9L 4XX1G 3ZYIA 1IARB 4XCFL 3V95A 2VLJB 4Z95L 4J3WA 3L7EB 4Y89A 3L5WB 4GJTB 2D0HA 3TBYB 2KDGA 5FM4A 2VDML 3OXRA 3FO2B 4MB4A 2P49B 4HS8H 2RAMA 4WFHE 3NAAH 4JFYA 4S0TD 5LQBH 4EIGB 3CFDA 4DAGL 4FQ2L 3GB7A 2W65A 4NHCH 4YE4H 1MCJA 3MRLA 1JNLH 1N4XL 4JAMB 1CYGA 4XXDA 3S35X 1BLNB 4N0UA 4LRNH 2MSPA 4N5EC 1S5IH 3BW9A 2F54A 4MJ6B 3QZWB 4Z0XA 4XWGH 1OAXL 4IRSC 3MR9A 1WBZB 3STBA 1YY8B 1ZLSH 1B4JH 1QFWM 3LQZA 1BM3L 1AGFA 5AUMA 4A6YL 1JHLL 2IMNA 4YHMH 3HG1E 4GBXD 4PJFB 4KHXL 4LL9A 3SE4A 1HYSC 2F5AH 3HI5H 4CADA 1KJ2B 1OF2A 2ADIA 4L3AA 4JJHA 5HYJD 1D3CA 1KJ3H 4L1HA 4OFYD 1PAMA 1NUDA 3QB7C 1OSZA 1PFCA 4ERSH 1L7TL 2XQYG 5IK3A 4NO2B 4WDIA 4X7EC 4EVNA 1LD9A 1T6VN 1TQBB 5T3ZD 5FA3A 5LCVL 5LWYH 4HK0A 1HINH 3QUMA 4D9RE 1YN7B 5FYLD 5HYJB 2NLJB 1C08A 3I3DA 4PJDF 3UTSA 4QGTA 2ESVA 1X5YA 2CK0H 3RUGF 2OL3H 5FO9B 2J7LA 4WV1A 1VFBB 1I3GL 4M5YL 5C0IB 4GKNB 2EE6A 1AHWA 2A73B 4OLVL 3HC3H 3SDYH 2HH0L 3VGAB 3BIKA 4TTDC 5M95B 3GMLB 1UM6H 5J1AA 4I3RH 3OKLA 1LO0H 1NKRA 4R97C 3OR7B 2PKDA 5INDA 3S8WA 2X9WA 4JN1L 3DLQR 3DTXB 4ZTPH 1OAQL 3GMQB 2EECA 4GBXA 5I75B 3MLPA 3KXFD 2M2DA 4K23H 3EYUH 3O4OB 3ARFC 5CMAB 3MQIA 4JDVB 1BJ1J 2FIKA 4H1LH 1ZLWH 4OCYL 3RTQB 5HHME 5IB1B 5FDWA 4KVCL 2V2WB 3O8XB 2WANA 4U2YA 4LLAA 4ONGH 5DHYA 5MEOA 3TBYA 1ZHLA 3T8XA 2DLGA 2V5SA 5ENWA 3U79A 3CVHB 2D31B 3QUXB 4D8PA 3U1SH 4WI2A 1CE1L 2HLFC 1RZKH 3N85L 2BSTA 5C9JB 4WWID 2V2XA 3HZMA 3GIZH 3HB3D 3IJYA 5C07A 1SM3L 3MRKB 4D9LL 2VXVL 3G6AA 5D7SH 1Z3GL 4ZPTA 1UJ3A 3I9GL 1ZHKA 1GC1L 1GZPB 4PJHF 1KCUH 1NAKL 4ONHA 4FXGB 3BP4B 1TJHH 4PRPE 3FO9A 4PJ7A 3H42L 3BMVA 4XPHL 3RAJL 2CPCA 4M9OA 1CFBA 4PJ8B 1WF5A 2QTEA 5IMMA 2G2RB 4R6UA 4Y4HB 4U6HA 2NTFB 3HZYB 2CDFA 4F3FA 4QRPE 4EQ3A 4D2NA 1WAAF 1FYHB 1XIWB 4Q9QL 4KTYA 2FYYB 4HPYH 3FQXA 5DJYB 2HFGH 3QFJD 4G7YL 2QADC 2VZ1A 1WQVT 2BOCA 2HJFB 2VLME 5A16B 1NAMB 5LWYL 2R1XB 3O2DH 3A6BH 5C0BA 2EDKA 1CXIA 4JHBA 4XCCL 3NTCH 1CTOA 2C4FT 2YUXA 1KF9B 1QEWB 3BO8B 1F6FB 2J6EA 4R7NA 4PJHB 3RRQA 2V2TB 1Q9WB 4UIMB 4WFEE 4H20H 1VEOA 3T65A 4P9ML 5KAQG 1WEJL 5KVEH 3U9UB 3KGRA 3RNKA 3UBXB 1F3JB 4Q97A 3E6FA 5B39A 3WNKA 5BZWB 4M7ZB 5HVFB 5M7QA 1ZMYA 1B2WH 1S7UB 3MRQB 3SEPA 5EPMB 1AXSB 3B3IB 5D71L 4PRIE 5I1KL 1XF3B 5CEZL 5KSVB 1YNLH 2DQUL 1QVOA 1BMGA 4U0RC 4BH8B 3T04D 4Y19D 5FAAA 1ES0A 5I1KH 3KPOB 4AK1A 4K8RL 1A9BA 3MTRA 3VFUB 1KNOA 2VLRA 5F1IB 1CF8H 4FTVD 4CMMA 5C8JB 5ICXB 1TQCB 3T4AB 3DV4A 2A74B 3B3IA 4DK6A 2GEEA 2XTJC 1T1YA 2YRPA 1CLCA 4OGXH 2ZWLT 5JZ7D 4YHPB 2ICWA 4PBXA 3OR6B 1HILB 3EO1B 3PJSA 1G7MB 5JHDB 5F6HI 5FOBA 2FGWL 2R2BB 5CBAA 1T1ZA 5SWZD 1KGCE 4QHUB 3IAQA 4WHYH 5HGGS 5J4MA 4HIHA 3BUYB 3FJTA 1E6JL 3MC0A 2UUDH 5FGRA 3PXHA 1Z9LA 4PGBB 3O9WC 3DRQB 3MNZB 4JREB 1F11B 4I0KA 5EOTB 4Y4HD 2P5WB 4CRPA 3TYGH 4P9MH 2O61B 5DQJB 1PEWA 2UYLB 5IFJA 4M7LH 3CCHB 2JK5A 3IDJA 5IMMB 4QHUA 1CGYA 2PYEE 4U1HA 4QRTB 1MLBB 3V5DA 4PRDB 4ZFOL 2R8SH 3LD8B 5CJQL 2ICEB 2JIXB 3CC5B 1CLYL 3UTTB 4X98A 4I3SH 4FQHA 2A77H 4DCQB 3VCLB 1YJDH 3O45B 1ETZA 2FATH 2YN3A 1KIQA 2E9WA 3C8DA 3V6BR 1S9XB 2DB8A 3A67L 5D1QA 5I74C 4PRHE 3AS3A 1L7IL 2JJTA 5D93C 1ZWIA 2VQTA 3BPLB 5ACZA 5DRXB 1QYGH 4MXWH 1C7SA 5K59F 1MHCB 3M07A 4LEOA 3RDTC 1VFAA 4HK3N 3IAPA 3JV0A 3QEQE 1XGQA 1RUKL 5F9JA 3P0VH 4CVWA 2ZCHL 1ZVYA 3VD7A 4X6EA 3RGVD 3RDTA 1FCGA 5EZLA 5T1KA 3Q6FB 1KXVC 4MWFA 3PP4L 3K46A 4NQDB 1AQKH 4W4OA 4GXUM 3RVTC 3O6MH 1NLDL 3HRPA 5B39B 1BD2D 2KUTA 2F8VA 5DMKB 2HFFB 1OY3B 3QJFB 1TITA 1JUFA 3QNZA 1D5MA 2E8YA 1A1OA 1U8IB 3KYAA 5CGYD 1H8NA 3LPWA 1A3RH 1MFCL 4I13B 5E8NB 5JPNB 4O4YH 4KK8C 2AK4A 3KPTA 2P47B 3UEZA 5JHLL 1D9KB 3U0TA 2OLDA 4YHOH 2AI0L 2BHZA 4S1DD 2YK1L 5J11C 4IDLA 1U3HA 5C2UB 3R0MA 5DI8A 4TSBL 3WNLA 4G7VL 2FRGP 4ZTOH 5DUPH 1SY6L 2BJMH 3T0AA 1ZA3A 3C5ZA 2ADJB 4NO0B 2YUVA 2VXVH 1JPSL 4S1DC 1T20A 2Q86A 3FO1A 2ITCA 2PTTA 5DLML 3JXAA 2EEBA 5L7XL 3GKZA 4IRZH 5TE7L 2MJWA 5BVJA 1FBIL 1HSAA 4U2ZA 3RZCD 1DUYA 3TN0D 1DQML 1FZOA 4LU5L 3EJYC 3BW9B 5LG1A 4ZAKA 2EEAA 3LQAC 5JO5A 3NFPA 3F7VB 2VLMD 1BX2B 3CZFB 1T0NA 4EI5B 3ZYOA 4H1LG 4QTHB 1HH9A 1KACB 3ALWA 5LVEA 1FGVL 1IBGL 3LEXA 1M6OB 1FGNL 3QG7L 1FG2A 5F7FA 3SQOH 5TDPB 4Y5XC 5EZIH 3ZKMD 2C3VA 4XP6H 5I16A 4NYLA 1MRCL 3E3QE 3MNWA 4LRIC 2R1YB 1NANI 1XGUA 5DK2B 5DMIL 1QLRA 3WIHH 3IKCA 5T1LD 2VDRH 1T03L 4LLWB 3JWDC 4P23D 5L2KD 3LKSB 1OD9A 1CE1H 4Y1AD 3V7AE 3VFTB 4BSVB 3NA9H 4Q0XL 3IFNH 2P24B 4ZOCA 4L8CA 1I7UA 3UXFA 1QSFD 4ODHL 4Z7QF 2Z8RA 3QUMB 3HI6H 3V52H 3ZHKA 3SY0A 3OB0K 3PV6A 4OGAC 3V0AC 3VFNB 5I0ZA 3BOVA 1KIUA 3O4LD 4LOUC 4P2RE 4KKCC 3TIEB 1CFNA 1KN2L 4HT1L 1NBVH 4PJCB 2LU7A 4S2SB 3HI1A 1ZK9A 3MA9H 1VFBA 4MXVF 5D93B 2FEEL 5LCVH 1G7PB 2O5XL 4OZIB 3MV8B 5E24E 2WV3A 1X5JA 5MEQA 5E8PA 4OIIL 5SWSA 2EXYD 3CVIH 3FO2A 1R5WB 3RWEA 3GMLA 4P46A 5J1AB 2VJXA 3NCJH 4K8RD 1F45A 1FIGL 2PNDA 3LZFH 1TJGL 3TO4C 1J86A 3NZ8A 3B5HA 3MLZL 1HK6A 4H0IA 4JRYD 3SKOA 1G7PA 3QEQA 3UBXG 4DAGH 5C0JB 1IGMH 1SMOA 4IIQB 3VFWA 1RU9L 4GKSA 3VFGH 5GISH 4Y5VC 2DQJL 1YEKL 4NQSB 4OUOA 1A1OB 4N5UA 2Z8VC 1N6UA 2VAJA 3QEGH 1TZGH 2JB5L 3DXAD 3FRPG 4FMFA 1CFVH 1ND0B 1RFDH 5J9PA 4NUGL 4WTXA 1XCTA 3MACL 4PRIA 4MS8C 2A77L 1N7MH 3R06B 5I8EB 5BO1H 4JE4B 3GSQB 5JR1H 1ZT1B 4DN4H 3TESA 1UKSA 3QNXB 3TNMA 5FGBC 4NO0A 5DMGC 4BELD 4KZEL 4QY8A 2R2EA 1ED3B 1W0VA 4BFIA 2LU3A 5T3XE 1NCCH 3W39A 4LU5H 2LE9A 1G6RB 3PIQA 4NIKB 3EOBA 4KMQA 2DQFB 1AR1C 1DUZB 4NT6B 4H5SB 3VMOA 4HAGA 1RUKH 1FORH 4FFZL 5BXFA 5HGAB 5DQDL 2N1KA 4LVEA 5F89B 3ZTNH 1WC7A 1FO0H 3KJ4B 4QRPD 1TJGH 2C1OA 3IRZA 3U4EB 5KS9B 3TGXA 2VKWA 3S88L 4NYLB 3GMOA 1IGCH 4MA1C 2F58H 4LCUA 4PJXA 4UQ3A 3FOLA 1R3HB 1DQQB 5L0QC 5SWZA 5JXAH 4RFNB 1DBAL 5DS8B 4M61A 3PWVB 4I48A 4QOKE 2WBJD 3EFFB 4RAVA 1KSRA 2P46B 5IEHA 1JZ3A 4KAQL 2P24A 2NY7H 3VXUA 1YEGH 5CILL 2PYFA 3EOTH 5E70A 5T1DH 1LEIA 3IDXH 5DC9B 2X4OA 2QEJA 3UTTD 3VGEA 2MQ3A 4Z7UE 2HTLC 4M93B 4XCNB 4OFPA 2AAVA 4DTGL 5KG9B 3IU3A 4KRPC 2CO6B 2VDRL 3KXFE 4LASH 4ORZC 3C2AH 5HYSA 1IQWL 4TNWK 1JNHA 1KEMH 1HKLH 4HHAA 1OP9A 1U8OB 4PJ9D 2WAHA 1B3JA 1DQLL 5FHBH 3R8QA 1MI5D 1N4XH 3K8KA 3R1GH 5DJZA 5D1ZB 1M7IB 3GNML 1G7JB 5GZNC 1HHHA 4CU7A 2VXTL 4RNRB 4ZUWA 2XYCA 2AV7B 2P8LB 4GKOA 1U8JA 1QHOA 2DDQL 1RK1B 4I5BB 1IAOB 5CKGA 3BAEH 2OS7A 4YHLL 1GC1H 4NQVA 4HJJH 3IFPA 1BZ7A 5SWQA 2AJ3A 4OCLC 3PABA 5DRZA 2NY6D 4JLRB 4PRPD 5ISZD 1RJYB 3DIFB 1UZ8B 3CSBA 1RZFL 1KLUB 25C8H 5JHDA 2NY2B 1KCRL 5CLTA 2Q1EA 1WICA 2QSQA 3LV3A 3W0WB 2G5BA 2PETA 4JQIL 5KSUA 4MNQA 4UTBH 2WSKA 1CDGA 3ULUE 2JLLA 5DEZA 3OKKA 4FA8A 1MH5B 3BQUC 1P4IL 2H2SD 4PGBA 2VXQL 3EYQC 2QL1A 3MRPA 5E00A 1SYVA 2VAAB 5FYJL 2FO4B 3KYNB 2VDKL 1T3FB 5HYEA 1R5VA 2E27L 1UB6A 3O2WL 3DUSA 1EFXD 1HYSD 1GGUA 5BZDA 3O2WH 3BP7B 5E6IA 1MAJA 4X7DC 4YWGL 1P84K 4Y1AE 4WO4D 3X3GH 2VISB 4TNVF 4PJGF 3NIDF 3LHPH 4KKAC 2RB8A 2YEZA 4MDJB 3WNMA 1IGTB 3P0YH 1FNSL 3QZWG 1P4BL 2YKLL 1MF2H 3CZJA 1N59B 4K7PH 1YC7A 1YMMB 3DVGB 1MI5E 4EI6B 3WE6A 4WI5A 5KVFL 4XBGB 1IGIL 3EYFA 4R7DB 4WRLA 4K3JH 5ETUA 4NQDD 5E7BA 5D5ME 5IMKA 4CMHC 2HJKB 4NO5A 1OWWA 4C55A 4KK9C 2FWOB 1EBPA 4XHJC 4MCYB 4OLWL 2W1NA 4YQXL 1YMMA 1DVFD 2V9TA 1ZANL 3FTGB 1FO0B 2QSVA 5EOCL 3QPQC 5D7JD 2DMCA 1KTDA 4TTDD 5BRZD 4S0SD 2XG5A 4POZD 1E28B 4GW5B 4KDTA 1QSVA 2ARJQ 2Z92A 4OZHB 3QQ3B 2EYTB 2VLRD 2YN5A 2WQRA 1U3JA 2GCYB 2OP4H 3ARGA 5HHNA 4POUB 5IR1A 1FORL 2HFFA 3QXDB 3B6SB 2Z4QA 2JB5H 2IWGA 2XZAH 1IM9D 5E9DB 3VXSB 4U4BA 2ZUWA 2DRUA 5GGRY 3KJ6L 5CINH 3DRQA 3MNZA 3SKMA 4YHZH 3QRGH 4XZUB 3P4NA 1EBAA 1NC2D 1CLZL 1Q1JH 5LGHL 1DBML 3MOBL 4UILH 1KOAA 1AJ7L 3DO7A 3B6SA 1RZIA 2NYYD 2VKXA 3M1BA 1XF3A 5KSVA 4MXWL 2IALB 3BDXA 1NGPL 2J8UA 1ULVA 4YLQT 4BH7A 2VQ1B 2X89A 2YC1B 3MJ7B 4OUUA 3RBSA 3CMGA 1ITBB 1MCRA 1UJ3B 2O5XH 1MCSA 3KPOA 3GO1L 1SJEB 5TDNA 3QEQD 4HCRA 3P4MB 5HD8C 1TJHL 5F9OH 3V6ZA 3T2OA 2P43B 1ORSA 2IFFL 2X41A 1LP9A 5DJ6B 1IL1A 2WZPD 2G75B 4N0CD 2DQEH 1RK0A 3K74B 4IJ3C 2YD9A 1LO4H 4LVNB 4DGYL 2BY2A 4N5ED 3DSNA 1I8IB 1CD1B 4HWZA 3AY4A 3DYPA 3V4VL 5I15H 1PG7H 5I1AB 3DJ9A 5D9SA 3B9KC 4CDGC 5I1JH 4M1DL 1HH6A 1UVQA 2HFEA 3GBNL 4ESKA 2A6KB 5FUZH 1NBVL 4WV1C 4HWZB 3ZE1F 5B8CA 1QRKA 5TE6H 5B22A 3G6JA 1YN6A 4WI8A 3STZB 1J8HA 3U82B 1JGVL 3GJFA 4WO4A 4DVRL 2G60H 5IMKB 5KSAC 3PQYE 2E6PA 1FL5A 4GKZA 5FYJE 3KYMA 2QHLA 1L9MA 4S1QH 3U36B 2AVGA 2YA0A 3IDMA 1A6UH 5A3IC 1T89C 2XY1A 4GBXB 1XF1A 3EO0B 3ROOB 2LV4A 4L29B 1BFSA 5BOZG 4Q9QH 3QIWD 1N0LA 2GTZB 2I60H 3JVGA 1VFOA 3BUYA 3D39E 5D7IB 1VACA 5HSFA 4G6KL 4F9LA 5DUPL 4RGNB 4JPWH 4GRLD 4U1IA 2Z8SA 2EYTA 12E8L 2Y5EA 3WN5C 1GYAA