1QTYT

Vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
GRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor receptor
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR
publication title Solution structure of the VEGF-binding domain of Flt-1: comparison of its free and bound states.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 94
sequence length 94
chains with identical sequence U, X, Y
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1999-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qtyT00
1G7PA 1O7VA 2DD8L 1TJGL 4HJ0C 5J11B 1NLDL 4M03A 3DUSA 5T1KB 4Y4FD 1KLUB 3W11C 2GCYB 5GGRY 1FO0H 5HTSA 1FL6B 2F54A 1QBMH 1X44A 3NPSB 1F90H 4DAGH 1UYWH 3GMMA 1A9BB 2YWYA 5JXAH 5CLWA 5KJRL 2JB6A 3K4AA 4QCIB 2PUQT 1MFEL 5DJYA 2YA0A 5AYUH 1EFXA 2HWZH 5T5FL 3UZVB 2HTKC 1JGVH 2OS7A 1AO7E 2IH3A 3HC3L 4LDOB 4JY5L 1S7VA 2V2TA 1F3DJ 2WSKA 1PKQE 4R7NA 1JHKH 2H2SD 6FABL 3HNVH 4PG2C 5ILTH 3G5ZB 3U1SL 3LDBC 3KR3L 4JHWH 3T09A 2EE2A 5BV7H 3CX5K 4K9EC 3K74B 4JKWA 3U4BH 2VC2L 4LSVH 5IW3A 3VRJA 2ZPKH 4M1DH 3OAUH 3TBVB 3HI5L 5CSZA 3IDGA 5M95B 1DZBA 3Q3GB 3OGCB 4YXHH 4DN4L 1DEEB 4PJGB 3U46A 1ZWIB 2F74B 3P2TA 4RFEA 5GS0D 2O93L 4H1LG 2I9LB 5D1XD 5BVPH 5ID0A 1A9EA 4KMQA 4XMLL 2DLFH 3LS4H 4K23H 3ZHDA 2WMPA 5IF0A 1JTOA 2ORBL 3MBEC 4XC3H 3GFUA 1KLFA 3RY5A 1DL7H 1ZHKB 5INDB 1JF1B 2X09A 4QF1B 1MHCB 3CFEB 5JHDD 4XCNB 1XR9A 5IBUG 3RNQA 5BS0B 3CGTA 3V0AC 2HG5A 4PJHA 2Y7QA 3E6HA 4XPHH 1A3RL 4NFDA 3O4OB 1JJUA 4YHNA 4EQ3A 4GMTH 5F70A 2O61B 2VAAB 5JHLH 2B20A 3BWAA 3W9EA 2YS4A 1YN6A 5EU4A 3ZYIA 1X5YA 1BBDH 1XH3B 3U36B 1KTKE 3VH8G 3ROOA 4H0IA 1Q0XL 4NKOB 3KPPA 4HCRA 1HZHL 5FXCH 4TNWF 4HKJA 2AXFA 1MCDA 3X14B 1MJUL 3L7FB 4IMKC 2ADIB 2C4FT 5IP4A 2QQQA 2VZ1A 1G7IB 1IARB 2NY4C 5GS1A 4GQ9H 3DBXA 3TH2T 4OQ1A 1U3ZA 1CDGA 2VKWA 5SWQB 3FN0H 1X5IA 2C3GA 4TVPL 3RGHA 2BC4B 3RTQC 3SCMD 2DYPD 4Y4KC 4MDIB 3W0WB 5F6HI 4NWTH 5FM5M 1C12B 4OGXL 3KPOA 4F15B 1NGZA 2GJ6B 1OAUL 4HK0B 2PETA 2VE6A 3QH3B 3VXSB 2XTJB 3ZMRA 1M05B 2ZUSA 4ELKA 1BIIA 4NYLA 5FUCC 5E03A 4KKAD 4OM0H 1ORQB 1U8MB 2E8ZA 2J4WL 2R0KH 1D9KA 1RIHL 1TIUA 1U8HB 3U7YL 2AEPH 3TN0B 3BVNB 4Y16A 1S78C 5TJWK 3CH8A 4CW1B 3ARTA 3V4VH 1I1YA 5TDNB 3VWKD 3CC5A 2R29H 2JJSC 1HKLL 1NAMH 3EW3B 3LS5H 2ADFL 1AQKL 3RWEB 3MCLH 2HJKA 4M8QA 4TPRH 4NJAL 3BPNC 1MCOL 1UACL 2VH5L 2PYEA 3BDYH 1RI8A 4XNUL 4LSTL 3WS6A 2D4FA 1IEBB 4GAGH 5HHQA 1UXSB 1ZHLB 1AR1C 5J4MA 4HJJL 3CFIC 1BX2A 4KJQC 2AJZB 2AAVA 5DJXB 3BISA 2ICES 5IEHA 4LSRH 5IB3B 2ZCLL 2VZUA 3E0GA 3VXUD 2QSCL 5FUCE 1BJ8A 1LVEA 3K1DA 2CXGA 1RSFA 1WEJH 4UT6H 5FHBL 1VFAB 4ODVL 4WJ5A 3O11B 3TA3B 5T1DH 4YE4H 1H5BC 3V52H 3ZKNC 4N0CD 1NFDE 5HYSA 2BVTA 4ODWB 4L8CB 1EVUA 4F8TA 1J05B 2NZ9C 3MQIA 25C8L 3OWEA 4F9PC 4HUVB 1RZFL 3ZT5A 4X83A 5GZOD 1VACB 4JFFB 1T0MB 2PXYA 4I2XA 4PYGA 4WI5A 5L88L 2UV3A 3V0VB 4NQUA 4O5LL 3VGAC 5DMYA 5T5NG 4WTXA 4DOHB 3BYTA 3DTXA 4P3WA 1TQBB 3DVNB 1HSBB 2JCCF 3QFJB 2DM7A 3L5WA 4U2YA 5K93A 5FAAA 1TITA 3MRLA 3TYFB 4DZBB 1X5GA 3WIIL 3LY6A 4UQ3A 1CN4A 2F8XC 4XPGH 1N0XH 2XWBA 3KPLA 3IGAB 3PL6A 5CP3A 4Z78A 1WQVT 3WE6A 1S9XA 2DLIA 4TVPD 5LGKA 5EZLA 1NMAL 5J12B 2UY6A 4JO2H 1GYAA 4H88H 1J1PL 4LF3B 4DGYH 4HIXL 3ALPA 3QUKB 2APVA 2HVKA 4P5KB 4XMPH 5MP6H 4Z7VA 2V9RA 3EOTL 4MNQB 4H1LB 1ZA3A 2IPTH 4PBWD 1EXUA 2K7QA 2FGWL 1FZOB 5KSAB 4FABH 1F4YL 1QBAA 1B0GA 1QKZL 3GMNA 5DC4B 5IBUB 1QZ1A 1F3JB 3EHBD 3IS1X 3LN5A 3BKJH 5HHOD 2GAZB 1D5ZA 1CXIA 2MOVA 4UV7H 3DXAD 2FEEL 5HDOA 2X4UA 3NCYS 4GXUN 4G8GE 3LB6D 4XVSL 3MROA 2CK0L 4Z7UA 2VDKH 4G9FB 5F7DB 4XNQB 4RMSA 1VERA 3VH8B 5JW4N 2EXYC 2B5IC 3QSKB 2MFNA 1D6EB 2F53D 3WO4C 3PHQB 4TUJB 4U6XB 3EOAB 3I3DA 2QADD 1PZUB 3QA3B 1LO2H 3T2PA 1KGCD 3IJHA 3CLFL 2PF6A 4X0KB 1H8NA 2CR3A 4MNHA 4PBVC 1YZZA 5MEQA 2DMBA 4G80B 1WTGT 1CS6A 2P46B 5ACZA 3O3EA 5CUSH 1C5BL 1Q9KA 3F58L 2VQTA 2A1WL 3DECA 3LH2L 4QT5B 3GHBH 1Q1JL 2ZOLB 3NBNA 4RRPA 1OLZA 5DK2A 1CGSH 3VG0H 2DQFA 3V79C 2XACC 3QIWB 1CE6A 3S35H 1IC5H 2ENSA 3T2NH 1EPFA 4DZ8A 1BM3L 2J7LA 3EJZC 4TULH 3RWCB 2ZSWA 1G7JA 1QA9B 4KPHH 4KZEL 1OQXA 4XCYB 1KPVB 3QI9C 3UZEA 3A6BL 3L3GA 4H20L 3X11B 5CJXA 2Y36H 2G5BB 3NOIA 4U1NA 4KRMB 3O0RH 3EFDL 3CXDH 4JY6B 2FB4H 4PJ7F 1QVOB 4K94H 1IZKA 1E4JA 1I8MB 1OWRM 3U83A 4KKBC 4GMSL 2W9DL 2F5BH 2J8OA 3MLTA 2NYYC 1IJ9A 1H8SA 1FAIL 3MZTA 1JWMB 2CRYA 3H0TB 3JV4A 3UTSE 3RGVB 1JBJA 3QDMD 1I85C 4YIQB 5E8DL 2AJYH 1TCMA 1P7HL 1QFWH 1IAKB 2DKMA 3O8XD 1II4E 1OW0A 1UJTA 3UTTE 5BV7B 1KCSL 3PWVB 4ZAKC 4MJ6A 1W0WB 1IC1A 1OAYL 4NKMB 1U3HB 3K80A 4JDVA 4BSVA 2KL6A 3O4LA 4ZO6A 4M4RA 5EULV 3LKSB 3QRGL 4C4KO 2VIRB 4I4WA 3BAEL 1UCBH 1UWGL 3VXRD 5C2BL 5ERWB 4YDKL 1YEKH 3C6SB 2IG2H 2LE9A 2C9AA 2VDRL 3BUYA 1ZT1B 3KHQA 2OR9H 4YUEL 4NBZB 1J8KA 1NJ9B 2BY0A 4HWZB 5I71B 4TTGA 2ZG2A 2JTDA 3NN8B 1CXLA 3MLRL 1FPTH 3JWDL 5J1SC 5FUOL 4MD0B 4WTZG 4Y88A 5HHXH 4QTHA 3BJLA 4D3CH 4G8IB 1SBSL 1E6JH 2D7QA 4P2OB 1DQDH 2H8PB 1G9MH 3ZSSA 4AIOA 4YHYC 3IF1B 3OBAA 3TESA 3MFFA 4HGWA 3STBA 1DUYA 4B7IA 3OAZK 4P4RA 4IRZL 2CUIA 2Q7YA 4OFIA 2IALB 1KCKA 1MQKH 3H3PH 4ZPVB 2FLBT 1A4JB 3OKLA 4Y4FB 3NCMA 4L4TD 1O7SA 3QWQB 2XICA 3NCJH 5CEYB 3C09C 1UQSA 1DBKH 2P7TA 2V17L 5IIEA 3MBXL 1RD6A 2HT4D 1J0ZA 2Q1EA 4P46C 4PJDF 4WW1A 5JPMA 3FO0L 2MHAB 3HZKB 4F80A 3D9AH 4NQCD 4TNVK 1PJ9A 3BKYL 5EBMA 3O6ML 3Q2CA 4OCXH 4S11A 4HC1L 5JLZA 4HKBA 4WUUD 5A2IH 5LCVH 2DBLH 4FQXA 2QSVA 4Y1AD 5IGXH 4L4VE 1OARH 3R8BB 5ENWB 5ANME 4BQCA 4K3EH 3GSUB 3FRUA 1RVFH 1MCEA 2VLKA 1NMCB 4GXVH 4MNGE 3LEYH 4KK9D 5I1AB 1QSEE 2DQEL 1UCTA 3WFCL 3W5NA 4R97B 1F58L 1CGYA 4CGTA 5CHNA 3O3DB 4NN5B 1CDYA 3GSWB 3UJTH 4Q9RH 5HXMA 3DRTA 5FYKL 5HBBA 1CF8H 2O5YH 2H3NB 1FORH 4G8EA 5JO5A 4NRXA 4XGZA 3U2SA 2XA8H 1EZVY 4OB5H 3HPJB 5DD1L 1GAFH 2ICEB 3L7EB 5D1XB 2P5WA 3O3BA 1I3UA 1JIBA 2FR4B 2CIKB 3I50H 1AP2A 1BZ9B 4KTDH 2PCPB 3LMJH 2YN3A 3IDYC 1X6LA 3NGBC 3DYPA 1QEWA 4LNVA 2WQ8A 4QRUA 5JHDB 2MCG1 3FB8A 4MJID 1JYWA 3Q0HA 5DURD 2CUMA 1T1YA 5ETUB 1NGPH 3NCEB 4HGMA 3SDCA 1REIA 1TLKA 3PGDA 1BMGA 1DE4A 3EO1A 3MLZL 1RIVL 3G5VA 4J3XA 3T65B 4J1UB 5GS2H 4HPYL 4NNYB 4DGVH 3DX6B 4FZ8L 1B3JA 1PAMA 2CJUL 3QG7H 3QULA 4TOYH 3KLHC 5KS9E 3BP4B 1YN7B 4X99A 5IBLC 4OZFA 2FH6A 1QSFD 5IMOA 1N64L 3S37L 2XY2A 1ODAA 2AK4D 4XX1G 3C5JA 5KVGL 3O9WD 2L0DA 5I1CL 1V7MH 3CFDB 1T6VN 4UU9B 5GGTL 2ESVD 2Z31C 2OP4L 5I18L 3G6JE 3GMPA 5F6IC 2EE3A 3CSBA 1T20B 1ZEAL 4P2RD 3RDTA 3V7AE 4F37K 4KKCD 3DI3B 3EJJX 4S1DD 3ULSB 4HIEA 2AJSH 4UQ2B 3I6LE 4YJZL 4RISH 3O45A 3GSQB 1XF5B 2QSQA 3SCMB 2DYPB 5TDOA 3HMWL 1JUFB 4P5TA 3KJ6H 3RWDA 3KYMB 4LCIH 3S88L 4RGOH 3X3GL 2MNUA 4HXAH 1R3HA 3HMXL 5FA4A 3BDBA 4MWFA 1RPQA 4LDEB 4YQXL 2OTWB 3FT3B 2CLRA 3B6SB 5D2LA 1FNFA 2Y23A 3ZL4H 1AD0A 3O2DA 1WK0A 1HQ4A 1BZ7A 1XMWA 1OAKL 1UXWB 1WBYB 1RFDL 4ZDHB 5F96L 1E28A 1TJHH 4OV5B 1E4XL 2DOCA 3DROB 3OKEB 1EIBA 5DK0B 2CUHA 3P0YH 4U4BA 3UTOA 4R26H 4L8DB 5IB5A 3BQUD 1FQ9C 5FDWB 3VWKB 1A4KA 4RDQF 2VDNH 4FQLL 3GMRA 5AG8A 5L8JB 1NL0L 2Z8SA 3FHAA 3ZDYE 1YYLL 5CCKL 5HGGS 1CG9A 5DMIL 5I15L 4L4JA 3OKOB 5I30H 3SE4C 1DBBL 1MCWM 1PVHA 5DA0B 2FX7H 2GW5A 3FB5A 4PBXA 1M1SA 5FYKD 2EC9U 5FB8A 1QRND 1CICC 5CSBA 3T3PE 3L9RA 3KPQB 3NABH 1FAKT 4TTDD 3LQMA 2C1PA 4P3CH 2OXHA 3TNNA 4QO1A 3QG6B 2BMKB 4XP9H 5D6DC 2VZSA 5F44A 2EXWD 4R0LA 4S1QL 3VXUB 4L8BA 3CDCA 3KLAA 1MHPL 3C6LA 3HA0A 1CE1L 3OTTA 1HIML 4X6CF 1FNLA 4EBQH 1C5CH 4JM2A 1U0QA 5TE7H 5DDHB 1ACZA 5HJ3B 3EOBB 3BN9C 2PO6C 1S7XA 4FQ1H 3VJ6B 1JMXA 4QWWD 4QHMB 3O6FC 1F3DH 3KPSD 4UTAH 4HUXB 4PJDB 4BQBA 5D5MB 4EOWL 4U1MB 2JJTA 2ERJC 3OKNA 3P30H 3T3PF 1IE5A 3VI3E 3P4MB 3OKMA 4NDMA 3OAYK 4N9OB 2YRLA 1J86A 5I76A 1AKJA 4IJ3B 3WFZA 1KN2L 4LPCA 3NAAL 3RNKA 1AI1H 5GGRA 4JCMA 4FQ2L 2FATL 4WFGD 1N59A 4GAYA 1IM3A 1ITCA 3HCVA 3L3KA 3G6AB 3L3HB 4FQIL 4Q58C 4UOW1 4LNRA 2FWOB 4POZD 4XBPB 2CK2A 5E9DD 2UY7A 4JZJC 5I1EH 3QEGL 4KKLD 1JGUL 2IANE 1AGEB 3BP5A 4U6YB 4BSWB 4CDHA 1GOFA 1S7WB 3OAZH 3IVKA 5DUML 1Z5LA 2EIZB 5E5MA 1UWEL 2IFFL 3KJ4C 4WI7A 5EBLB 4HWBL 5EU6A 4F57H 2YK1H 1YEEL 3RL1B 1I8IA 4MXWH 1T7ZA 4HX1A 4J4PC 5FOBA 2A6KA 1VKXA 4HKXA 5KZCD 5MEND 4PJ5D 2EH7H 5DYOB 4EN3D 4NWUL 3WV0A 1NCCL 1U8JB 1HHKB 1GHFL 4O00A 3O3AB 5GGUB 3OXRA 5SX5K 1QRKA 4PS4L 5HHOB 2GTZB 1AC0A 2C7UB 3DXAB 1HYSC 2ZG3A 3SGEI 3SDXE 4ZG1A 3BPLB 2NNAA 2FX8L 5DR5H 1CI5A 2OK0H 1LDPH 5HHVH 3QQ9D 4LLQA 4IDLA 4JRWA 1A14L 3QJHB 4ZO9A 3IFLH 4RAUB 5D96C 2F53B 3B5GA 4OLYL 1YNTA 4QXGL 3V4UH 4DKFL 2QADB 3LZFH 3ARZA 5T1KA 4WFFE 1KLUA 4NKQB 4H25B 2GCYA 2ZJSH 2VRAA 1FL6A 2G75B 3T0EB 1YEDB 2BNUB 2FDBP 3VGFA 4M93C 3HN3A 1QBBA 1G6RL 1C1EH 4PLNC 1WFTA 1J0JA 4QCIA 1M71B 2EEBA 3T4YB 3REWB 1KIRB 4TSCH 1VFMA 1VESA 1XF4B 4DJMA 4CNIB 3NFPB 5L2KD 1GGIL 4XCEB 3V0WH 5I66B 5C0AD 1DBJH 5JDJA 5EOCJ 1QFHA 3G5ZA 2WW8A 4NC1E 2X9YA 1FO0L 3GGWB 3BE1L 2B0SL 3MRNB 5CJBA 1QNZH 3CIQA 2BVOB 4OCYH 4FFVC 5DSCB 4P48A 3MA9L 3Q3GA 5HI5D 3OGCA 1FLRH 1P7QB 1CK0L 4DEPC 2EC9T 1ROWA 5IW1B 1DEEA 4R8WH 1LO4L 4PJGA 5HD8C 2Z93B 5CGYC 3RVWC 4ENED 2F74A 5ADPH 5D1ZC 35C8L 3QDMB 3HNVL 3ZYJA 1TPXB 1OVZA 5ILTL 4N68A 4PY8J 2I9LA 1PGRB 1GOGA 4OQTH 4BUGA 3O8XB 4M1CD 1ZMYA 4LSVL 2ZPKL 4M1DL 3HR6A 1E6OL 1K5NA 1JF1A 5DFTA 5INDA 4QF1A 1MHCA 3VFMB 3CFEA 5C0BD 5C1MB 2E7MA 1LWRA 4LP4A 5KSBB 3DHJA 4FFYH 4GS7C 5HVFB 3P0VL 1KEGL 1KCVH 1AGCB 1I7UB 4ZNEE 5BS0E 3BZEB 2CLZB 3B5TA 3VXRB 1MWAB 4MA3B 4X6CB 2VAAA 5ITFB 3MACL 2N1KA 2E8YA 2E6QA 1HINL 2DLFL 3BIKB 4R96B 5TE6L 1XH3A 3IJSB 2YMXL 4LKXB 3IDJA 1YNKH 5JQHC 2A9MH 4NKOA 4HF5H 1X9QA 4B50A 2P5EE 3ULUL 3X14A 3MGOB 4LLMB 4APQC 1Q0YL 1N6QL 2ADIA 4J3OC 2Z8VC 4KV5F 5FYJL 2V5YA 4GMTL 3QPXH 3BP7B 1T80A 1CU4H 3VFPB 5SWQA 5I0ZA 2OZ4L 1LGVA 5CS7A 4IOIB 1RZ8B 5E8EB 3WCYA 4KTEH 2FEDC 4MDIA 3W0WA 5C70A 5GGQH 4L4TB 2CKBH 3IAQA 2UWEB 5D7LA 1GZQB 1C12A 4JVPA 2GJ6A 5GS3A 5DK3A 4OF6A 4HK0A 5L2JB 5CJOH 5IHLB 5DJ6B 1X5AA 4LCUB 3DVFA 4NP4H 3QH3A 2HFGL 4ZOAA 5C3TA 1GPOL 2ADJB 1ORQA 1UM4H 4NQCB 4YBQC 4AH2B 4R4FH 4ZOCA 4JG1H 3VXSE 3ARRA 4ERSL 3F7RA 1AXSA 3BVNA 4WUUB 2PTVA 4CW1A 5C3LD 4O58H 4Y1AB 5TDNA 2RFXB 1UVQA 4UIMB 4MYWB 1Z3GL 1C08B 1IKNA 2HRLA 3MV11 3RWEA 1DVFC 4GKOA 4GW1B 5EZJB 4YPGB 4P5MB 4G8FB 4ORGA 1IEAB 2JJUA 3ARQA 4ZUVA 1G7LB 1WBXB 4OM0L 2QHRH 2VL5B 4XVTH 1T89A 8FABA 4GRLC 3ARFD 1AXIB 1NGQL 4YHZH 1IAII 3P4OB 3OAYH 5EG6C 1UXSA 1ZHLA 3QPQD 4X5XB 2XFXB 4MS8C 3QDJE 5CGTA 2AJZA 5DJXA 5EORH 3DWTA 1DBMH 3HZMB 1JYXA 5IB3A 2FHBA 3WIHA 4RGND 3MCLL 1KC5H 3CSGA 2G60L 3LHPL 1QFPA 1VFAA 5DLMH 3O11A 3TA3A 4MJIB 2J8UE 5DURB 2WINB 2PYFB 3CD4A 4ODWA 3V6OA 3R0MA 4L8CA 2ADGA 2NXYD 2UYLB 1KEML 1XGPB 4UNTA 3O2WH 3TFKC 4HUVA 3AM8A 5JW3L 1PBYA 1OGAA 1F4XH 4X9FA 1ADQH 5KOMC 1VACA 4WDIB 3MNZB 1FBIL 4X7TB 3T1FA 3V0VA 3TGXA 1QSFB 4JFFE 2AK4B 1QLFB 5JOPD 4NOFA 1NDGB 4FG6C 3O9WB 3ULUD 4DTGH 2VZ3A 4XAWL 3RY4A 5T1DL 4DOHE 3DVNA 1HSBA 3V52L 5D8JH 1QPXA 3QFJA 4Q9QL 2ESVB 1T5XB 1TQCB 4MAYD 3TYFA 5SX5H 4DZBA 5IQ7H 2V2WB 5L8KB 4PJ9D 4WO4D 5FYJD 3L3DB 5TQ2H 3SBWA 3VCLB 2CRIA 4P2RB 4YR6B 5EA0H 1BEYL 3DX7B 5EN2B 1IGFH 3B9KC 2X6MA 3GJFK 4PJBF 4UIKH 3TT1L 3VMPA 4DKEL 1D5MB 5BRZD 2A74A 4LCYB 4HS3B 1U9KA 3VRLF 3MOAH 3VFGL 4OFPA 1CDUA 1VENA 4LF3A 4CMHC 3KYKH 8CGTA 1WSST 2BNQD 4P5KA 4MNQA 4H1LA 3H9YA 4C55A 2EH8L 2VABB 4FS0A 3CMOH 4GRWE 3IETB 5D70H 3DURB 1MI5B 4QXTB 1RJCA 1FZOA 2FHFA 2DIBA 2AQ1A 4HUUB 4LPUA 2J6EA 3BQUB 1G9NH 5D71L 1B0WA 1ZGLM 3SE3A 1N3NB 2GAZA 5DO2C 5HHMD 4JDTH 4OTXH 1N8ZB 1YDPB 5LXGH 1PQZB 1DUZB 4N8PA 5F7DA 5CBEA 4XNQA 2CR6A 4G9FE 1QRNB 1RZGA 4RNRB 4D9LL 4U2ZA 5HDLA 3PHQA 4TUJA 4YFDB 4OLWH 4U6XA 3EOAA 2VDPH 4HAGA 1CFTB 1PY9A 3QA3A 4D2NA 4CN4A 4XXDA 4X0KA 2C3VB 5F9WB 3QWRA 3SGEH 4M48L 4PTTA 1PSKL 4G80A 5C0IB 5HHPB 5L0QB 2OL3L 3EUUA 3QPQC 4Z8FL 4XP4L 3U82B 2DLHA 4FXLA 2ZOLA 3K8KA 1YNLH 5D7JD 2P47B 5KW9H 4H0HB 4PY8I 3QIWA 2WBJD 4GBXC 1I1RA 1K8DB 4XCCL 3PIQA 1QA9A 4NQDE 5D93C 4XCYA 3AAZB 1KPVA 2KQMA 3P40A 2P48B 3X11A 2WP3T 2G5BA 2E6JA 5ID1B 5CUSL 2NXYC 3SE8H 1A5FH 4JY6A 3GHBL 1QVOA 2DM4A 3E2HC 1I3GH 1I8MA 5I8KH 2ARJB 3RHWK 4MHHG 4XBEH 4WU7B 2LAGB 3VG0L 1JWMA 3H0TA 3JWOH 4XMKH 3S35L 1IC5L 3T2NL 1PDKA 3AS1A 3NA9H 4HDIB 1IAKA 2Y06H 1NBQA 3RVUC 4Y2OA 3C8KB 2DMKA 3GBMH 2WNGA 2Y36L 3PWVA 3MRDB 4KUZH 4FN0A 5E9DB 4LU5H 1UGNA 4X7EC 4NKMA 2HKHL 1U3HA 4LSUL 3SDYL 2IH1B 2FB4L 3OX8B 2AEWA 4D9RE 1WT5A 3UTPD 4QHKJ 1EK3A 3STLB 3LKSA 4JZNB 5TF1H 2VIRA 2R0ZH 3G9VA 3S37X 4NJ9H 4Z7QF 5DHYB 4I9WD 3MODL 5GZND 1UH3A 3I3BA 3PGCB 4ZUTB 1CXKA 5ERWA 5KZCB 5MENB 4PJ5B 4EN3B 2BOBB 3C6SA 4KJYB 4OUOA 4XCFL 5GIRB 1PX4A 4GKZB 1ZT1A 1QFWL 3EFFB 4XBGA 2Q6WA 1NJ9A 4MAUH 1FV1B 3U0WL 3NN8A 5ICXB 1GC1H 3D3VD 2O5ZL 2E27H 4MD0A 5DUPL 3MCKB 4G8IA 1IC4H 3R1GL 5FHAH 5FV2A 1CLCA 4Y4KA 1IAIM 3F5WB 1RUPH 3HC4L 4L5FH 3S36L 1EEUA 4A2LA 3IF1A 4KUCD 3IDMB 3QAZC 1R24B 4GLRI 1XF3B 5EOQL 3UMTA 1M7IB 1YEKL 4BZ2H 2JCCA 1A6WH 2IG2L 4N90E 2IALA 4ZPVA 1HOCB 1S3KH 1JHTB 1A4JA 1WZMA 4Y4FA 1CBVH 5KTEH 3ILPB 1WZ1L 1YY8B 3MUJA 4H8WL 5CEYA 1V5JA 4U1GB 4O9HH 1ZANH 3MV9D 5HDQH 3KS0J 3QHTC 3X17A 3IFOB 5F71A 4EEEA 1NCWL 2AS5M 1Q94B 4EZMA 2X89D 5E2TL 2MHAA 3ET9F 5L2KB 3VXTB 1QTYT 5F72S 5C0AB 1FYTE 3HB3D 3H3PL 1EBPA 3QIUB 4BUHA 4LMQI 5SWZD 3KYAA 3RI5F 4EDWL 1D7FA 2R9HC 3ULVH 2MJWA 1LDSA 4GFTB 4MA1B 5EO1B 2UZYB 2BCKB 5I1AA 2I26N 2AABH 5TFSL 4PGCB 5H37G 2BVPB 3BH8B 2M2DA 3GSWA 2NY6C 1P7KB 2N7AA 1TXKA 2H3NA 4QRSB 2XZQH 4KKNA 5HHNB 3HPJA 3QDHA 1CXFA 3MX0A 3L7EA 2DBLL 4HULB 5D1XA 5IGXL 4OF5A 4HPOL 4WI3A 2FR4A 4ALAL 2CIKA 1MRFL 1SYVB 1BZ9A 2PCPA 2N4IA 4M43L 3U7WL 4W6XB 3S3SA 3FB7B 4PRIB 7FABH 5C0BB 3GJFH 5BXFA 4XHJC 3O6LH 5C08D 2WIIB 5ETUA 2IQ9L 5GRUH 5JHDE 3CVHH 1SY6L 1B2WH 4NZRL 2BJMH 4JFHD 4PGDA 5E70A 5CGMA 3T65A 4J1UA 1IAIH 4G7VH 2YD4A 5E6IC 4NNYA 3NTCH 3DX6A 2ZNXA 5D1QD 5EB9A 2A9NH 3BP4A 1YN7A 2XZCH 3ARGB 2HYMA 1ZK9A 1T03H 1YY9D 3WFEL 4XP6H 1T7YA 5SWSD 5J56B 4JEGB 3EZJB 1AFVH 1P4LA 4UU9A 1MRCH 1EAPB 2QQNH 4LPWA 2X4RB 4IIQC 1T20A 5DD3H 2EEDA 1AGFB 3SEPA 4RA3A 3D69B 1A1NB 4PJ7A 3ZT6A 4HG4J 3ULSA 4UQ2A 5E4IA 3GSQA 1XF5A 1Q38A 3UC0H 1CFBA 3SCMA 2DYPA 1FE8H 1JUFA 1EFQA 2RQ8A 3KYMA 2CSPA 3RIFF 2Y6SC 4WU5B 4WWKC 2H6PA 1G6RB 1V7ML 4K55A 2FGZA 4WI2A 2DMCA 1S5IH 1AJ7H 4DUWA 4ONGL 2OTWA 3B6SA 3FT3A 2YXFA 4WEUD 2O26U 3BW9B 2H32B 5E4EC 4V1DD 4PRHE 4U0RC 1Q72H 1UXWA 1WBYA 4X6EB 4ZDHA 4BQ9A 4OV5A 3V7MA 3DROA 1IILE 3JWNC 3OKEA 1HHIB 4BH8B 1NEZG 3LQAL 4L8DA 1KPUB 3QXTA 5FDWA 5JUEH 3O41B 3VWKA 5MI0C 4Q9BA 4LCIL 1J10A 2IBZX 4RGOL 4A6YL 3FL7A 4CVXA 5F9OL 4UOJA 3V8OA 4RFNC 4V2CB 1NC4D 1JNHB 3AB0C 3VE0B 3OKOA 1CD1B 2IWGA 1R5IA 1A64A 4LOUC 1L6ZA 3IXAA 2Z8WC 2HA1A 2G9HB 1MCKA 2DLGA 2ZNWA 3CNKA 4NRZB 3SDDC 5ICZB 3MLVL 2J8HA 4M7KL 2NZIA 3ARFB 3L3IB 4IHOB 4WTZA 3N06B 3DLQR 4YGAB 3KPQA 3P0YL 3HZVB 2IAMD 1IGYB 5F88A 3LEVL 3G6DH 5L6YL 4BK4A 3QG6A 3RWFB 2BMKA 4NN6C 3MLYL 2IPKB 4HLJA 3SGDI 2ZCKH 4IOSD 4RGNB 3QO0A 3VXUA 4HLZH 2CQVA 3CXHJ 1CFVH 2FX7L 4L3CB 2D31B 1AHWC 5DDHA 5HJ3A 3EOBA 3VJ6A 5IR1B 2VITA 4QHMA 1EHLH 3NABL 4HUXA 5TDPB 5C0DB 4PJDA 1Z0MA 5EOCH 4JZOB 1F4AA 2VLLB 3JV0A 5D5MA 5F8RC 3EYUH 4U1MA 3M07A 4GAJL 2VKXA 1A7PH 3P4MA 4F7EB 3IDNB 3FFCA 5IROA 12E8L 3FO2B 4CVZB 2FO4B 5F93C 3L3OB 4KUCF 2J1KA 1YPZF 3RPKA 1CLOL 4QHKI 2ITDB 1C5CL 2A38A 2XG5A 3QHZH 1OT2A 2ILLA 5ECJE 3I75B 3RVTD 4MAYB 3WJLC 4I1NB 4PJ9B 1JK8B 2W1NA 5BO1H 4WO4B 5DVLA 4UTAL 1A3LL 2AEIT 5I17B 1K8IB 1MVUB 1RZJH 2DL2A 3WUZA 4XPFL 1P4BH 4ZYKB 3G6AA 3L3HA 5D7IF 3SE9L 5BRZB 1OCWH 4S1RH 3P30L 3HFML 4L9DA 1AR2A 4OIIH 3WNMA 3WFBL 3VFOB 4U6YA 1AGEA 5DD0H 1UJ3C 4BSWA 3L1OH 1S7WA 2EIZA 5I8OL 2BNQB 4DVBB 1NGYB 5EBLA 5FA3B 2BVYA 4ODSH 2VLME 4ZFZB 3MMEA 3MGAA 4Q0XH 1VFBB 3RL1A 5E2VL 2EICA 1YEHL 3EO0B 5DYOA 1FNSH 1U8JA 1HHKA 1QFUL 3QIBC 4QGYA 4D9QD 3O3AA 2YWZA 5GGUA 1EJOH 1OSZA 1G9MC 5HHOA 5I1DA 3IJYB 1P53A 4K3DH 3UJJL 3CDGA 2C7UA 3DXAA 5HHMB 3U0PB 1KTRL 4FFWD 1NDMA 4NN7C 3OKDB 4JVWA 4HKZB 4WRLA 4F7MB 1YYML 2YK1L 3HTLX 2R8SL 1ZGLB 3TLRA 1T7WA 4U1KA 3WDHA 3QJHA 2MPAH 4RAUA 2F53A 5ALBH 3GI8H 1FFOB 1OGTB 2AJUH 1RUQH 2VZOA 1BQSA 1CFQB 2VYRE 3U30C 2IQAB 4IMLB 5I9QB 4H25A 3RUGE 1B0RB 2G75A 4YHPB 1YEDA 2BNUA 4YDVB 1J8HD 4PJFB 1P84J 4MJ4A 2YKLH 3GI9H 1WIOA 5HGHB 3T0EE 5IVNA 1N5YH 3LEXB 1M71A 2NTFA 3NCYP 1T1ZB 4X9GA 5HHVL 5C0CE 3REWA 3T4YA 3TZVC 2IAMC 3FHQA 1XF4A 4XWGH 2FJGB 1JPTH 4CNIA 3NFPA 4GLRH 3PP4H 4PJAF 3BPCB 5D7JB 2IADB 4XAKD 5DMKB 4ZQKB 2WBJB 3ARDC 3OJVC 4JE4B 1E4WH 1DP0A 3INUH 1I7TB 2EE6A 3LZFL 4P4KD 4CBPA 4JPWL 3H9SE 2ZJSL 4UV4H 4KY1H 4OCSH 5FGRA 3GGWA 5JA9A 4HCRH 3EYSH 4HEPG 4Y5VB 2YPKB 3ARED 3MRNA 3RVXC 2BVOA 2Q86B 4Z7OF 5D7SL 1RZ7H 2R56H 5DSCA 4B0MM 1NEZB 3RUGF 5B8CC 1G84A 1D6VH 4U1IB 1HQRB 3QCUL 5BMFH 5IW1A 3SKJH 4OM1H 5IFJB 3QDMA 4JRYD 3TO4C 1EMTH 4Y19E 1IM9D 2EDQA 3O8XA 4PLKD 5F7EH 3SGKC 5I6XC 5BZDB 4HV8A 3VFMA 5C0JB 3RVTC 4X6DB 4PJ8C 4UT7L 1AY1L 2PN5A 1GIGL 2R23B 4OCMC 4CDGC 3DV6B 1RY7B 2XN9E 1GGYA 1AGCA 4DGIH 1IVLA 2CLZA 2R0LH 3VXRA 2XTLA 4MA3A 4X6CA 2AJVL 4M7LT 4MA8H 3PWPE 5A40E 3BIKA 4JN2B 4LARL 3EDEA 4R96A 1L6XA 1FFPB 3IJSA 3OXSB 3DMMC 4JLRB 1MEXH 4LKXA 1PEZA 1CFSA 4G6KL 4Y0GA 3D3VB 1FVCB 2GIYA 4YHIB 4OZIB 4AY0A 1TCRA 5GRYA 3VFWA 5HI4D 2XQBH 2YD5A 2VLRD 3MGOA 3GJFB 4LLMA 3KXFD 3IDUA 4C57C 1F3RB 2HLAB 1HI6A 4JFYB 5C07D 1K6QH 1YPZB 3CVHB 1MFDH 1UB6B 3QUYC 3BP7A 2Z91A 3VFPA 5E4EB 1R5WA 4IOIA 4CJ1A 1RZ8A 5E8EA 1JZ3A 3A67H 1WZKA 1S9YB 1IQWL 5J1TC 4L4TA 4YGVB 1GZQA 1BFVH 2CDEB 3I6GB 4CMMB 15C8L 5D7KE 5D7IB 4JY4A 1FVDB 2UWEE 5HVHB 3MV9B 1T7VA 1LO3L 3V5KA 5L2JA 5ALCH 2DTSA 5DJ6A 4LCUA 1LILA 1YMMB 3ZKXC 2OL3B 3X3FH 4HAFA 4FOMA 1QUNA 2E7HA 2HFEB 4TSBL 1G7QB 2ADJA 4AH2A 4NQCA 3MRKB 5IFAH 1YEIH 2W0LA 4W4NA 4MD5B 3Q5OA 3SO3B 1HE7A 4WUUA 4LL9A 4ZXBC 3VD7A 4GRMA 1CICA 4Y1AA 5SWZB 3KYNB 3QDGE 2RFXA 1J1OH 1A22B 5GGQL 2CKBL 2P8PB 3BT2H 4UIMA 3WEXB 1C08A 1RUKH 3D0LB 5CLTA 3TYGL 4GW1A 4MJ2A 5EZJA 4WFED 5CJOL 4YPGA 5C6WH 4XPAH 3P9WB 4G8FA 2HMID 4X8JA 4Y4HC 3PABB 2HTLD 3KPRD 2NY3D 1CDHA 1G7LA 1MCHA 1WBXA 1E0OB 2VL5A 5AZEH 3BDXA 4R4FL 4XNZB 4JQVC 3P4OA 2XFXA 4YO0B 3ARBD 4O58L 4YFLF 2VXVH 1FN4B 1BBJB 3IDXL 1F6FB 1A2YB 1MHEB 3PGFH 3HZMA 4EVNB 1F4WH 2OCFD 1EDQA 4XP1L 1X6NA 3EYFB 5JDSB 4MJIA 4X4MA 5C08B 1AQDB 2WINA 1EO5A 1V3LA 4MJ5B 1SVZA 4M5ZL 2UYLA 4YHOH 5E0QA 1TETL 5JW4Q 5JPNB 5T1MB 2ATKB 1XGPA 3O6KL 2LAAA 5DGRA 2EKSB 4X4YB 5JMOC 4NQED 2X5PA 5D1QB 4AK1A 3UYRL 3MNZA 4X7TA 4PJAB 3HI6L 2MCPH 5KVFL 2BNRD 1QSFA 3SGDH 5D2NB 1HYRC 4HT1L 3S34L 3S35X 2AK4A 1QLFA 2CO6B 3O4LD 1NDGA 3LPWA 5EZIH 3O9WA 1OAZL 3JVGC 5GRVL 4WY7H 3FT2A 5SWSB 2VXTL 2COQA 2ESVA 1T5XA 4KK8C 1FSKC 4YHKH 5E8NB 2NR6D 3HRZB 1A7QL 3L3DA 3VCLA 5F1KC 4KRNA 4P2RA 4Y5XB 1MPAH 4YR6A 3CXHK 1Q9LB 4PJEE 3W81A 3VFTB 5GQBA 2HJFB 1S5HA 3EDDA 1D5MA 3LV3B 4UBDD 1W72L 4OLUH 4LCYA 4HS3A 3QUZD 4QNPE 5JW4R 3WNKA 4LSPL 4PJIF 4G9DB 4I0PC 3UPAA 4Y89A 3PWJB 1YUHB 1DEDA 5C09E 5KVEL 2JE8A 1L0QA 2VABA 1CT8B 1WV7T 3WFDL 5I16B 3WFHB 1FDLL 3IETA 2QQKH 5J89A 3DURA 1G7PB 3MRJB 1EV2E 4YDLB 1UWXH 4QXTA 1RZKH 4U1JB 1FL5B 2AI0L 3DYOA 3NFNB 3QP3A 2J88H 1MI5E 4HC1A 5BOPA 4HUUA 3S36X 2DTML 1URLA 3BQUA 4KGLA 2O5XH 4X6BB 4ACPA 4HMDA 3B2VL 3MRGB 4X8XA 4CU7A 3GMMB 3UTQB 1BAFL 4U7SA 1N8ZA 1YDPA 2X42A 1NC4B 1CLZH 1DUZA 1LEKB 1PQZA 3ARUA 4OZGF 1X5ZA 1EFXB 3BN3B 4QNPF 4PJCE 3B9VA 3FO1A 2Y4SA 5D70L 5CZVL 3HE6D 1QRNA 1Z0NA 4RNRA 5AZ2L 3CH1B 1NQBA 4LSDA 1KLGB 3FZUC 4LSSH 4OZHE 3UPCA 1CFTA 3JXAA 5JQ6L 4P23C 4LQFH 1NMBH 5EOTB 1HXMB 2XQYK 1MCFA 2JB5H 2C3VA 3V6BR 5KANI 3GIZL 2LVEA 5E2UH 4GOSA 5C0IA 3KS0H 4BFGA 3Q6GL 1JF6A 3ZTJG 4MCYB 5FGSA 5ICYB 1I1AC 5FCSH 3LRGA 2ZSVB 1XIWC 4RFEB 1G7HB 1M7DA 3KPSA 2JF1A 3ZKSD 5F7YC 2VLJE 4PJCF 4ZSOB 1K8DA 4N5EC 1DQQB 3AAZA 4LGPB 5IF0B 4NCC2 5AAWA 4ZS7L 4QXUL 3QHFL 4FQCH 4KMTL 4YXKL 5ID1A 3QEQD 4PJHB 2Y7QB 5ISZD 3DO7B 3E6HB 5GGTA 3E6FB 2ARJA 5F7HA 1P69B 4WU7A 1D5BA 1P84K 1UKQA 4F8QA 1FNGB 5KVDH 4ELMF 4Y5YB 4PRDB 3R0NA 4HDIA 5EU4B 1CDJA 2E9WA 1CWVA 2BXYA 3STZB 4JREB 4MA7L 4MQXC 4NQSA 5CEZL 4LPTA 3C8KA 2MQCA 1EUUA 3MRDA 5E9DA 4PIRF 4EI5C 2H2PD 3H6JA 4M6NH 4HBQA 4B41A 2R0WL 3MV7E 3HMXA 3OX8A 4Z77A 4Z9KB 3IFPB 2V6HA 3STLA 3TJEH 4JZNA 4HK3J 2ZKHH 1Y18B 3VWJD 1H3PL 5DHYA 5IWLC 4DN3H 4XMKL 4N0YH 3DBXB 3PGCA 5EO0B 4ZUTA 4XVUD 5MENA 2Y9RT 5HYJE 4PJ5A 4EN3A 2BOBA 4ZTPL 5GIRA 2VL4A 3JSSA 3EFFA 1NBVL 4YC2C 3D18B 4I0CC 2OM5A 4PB9H 3WN5C 1FV1A 4RRPG 5ICXA 4LU5L 3KPOB 3IU3B 3MCKA 1QR4A 2G5RA 2B4CH 1CD8A 3AS3A 5SX4I 4ODXB 3F5WA 2FJHB 3B9DA 1G9EA 3R4DA 2WZPD 1FVEA 3HNSH 3I6KB 4NYLB 3IDMA 1I4FA 5JXED 1WAAE 1XF3A 5FYKU 1H3GA 4U1SA 1M7IA 3TV3L 1I1FB 4P2QD 2LQRA 5E5UB 4XRCA 3QUXD 1LK3L 1HOCA 1EHAA 1JHTA 4ONFH 3C5SB 4OLZL 4DW2L 4I77H 4KRPC 3ILPA 1YY8A 4PJBA 1J8HB 3RJDA 2FIKB 4M8QB 3S4SG 5IM7B 5A3ID 1JRHI 3IFOA 2BSTB 2PYEB 1WJ3A 4PJXF 4QY8A 1Q94A 3V4PL 1MCPH 3JBG7 4P99A 4KJPC 4XT1C 2DLEA 4YX2L 3EO9H 1CLYH 4BZ2L 5IEKB 5L2KA 5FYLL 1I8LC 1A6WL 3NACH 1BIHA 1Y0LB 5LKNA 4OCWH 3H9HB 3TP4A 4HFUH 5C0AE 3FMGH 4KDTA 4P4KB 4KK6D 5B22A 1CBVL 1PW3A 1R5VB 1WTLA 2EIDA 3TPUB 1CL7L 1DTUA 2DQHL 3AREB 4O9HL 2VUYA 3ARPA 5EO1A 2V9TA 4NPYB 3F7YA 1IGJB 1GJIA 2VXQH 4HHAB 1ZSDB 2BVPA 3BH8A 4JG0L 4O02H 3QDAA 1P7KA 5IOPB 4QRSA 4ZTOL 1INEL 2F19H 1XAUA 1TZHB 5HHNA 1QLEH 1B4RA 4RGMB 4JRYB 4OJFH 4W6WB 5BOZG 3MRPB 5CEZD 4WFHD 1IM9B 1J0YA 1SYVA 3FQWA 3ME0A 3FB7A 4KFZC 1GGCH 1XZ0B 4K71B 4KC3B 5FIEA 4F7CB 1J1XL 1NUGA 1MQ8A 3DUHA 2DQTH 3O2DH 4HWBA 5CINL 5I1LA 2WIIA 4PRIE 1K4CB 3SKOA 5C0BE 4Z0BH 4UQ3B 5B4MC 3HUJB 5EFIB 1X5FA 5D6CB 5GRJH 3HE7C 4OFYD 3MYJB 1PG7H 2GY5A 2X44D 1NAKL 4X9BA 4LCWD 3DX8B 3GK8L 3VFRB 4PD4J 4KROC 5DD5L 4PGEB 1IGMH 3C5ZC 4M4PA 2DN7A 5T3XD 3O6LL 2VLRB 3MLSL 4ORZC 3VXMD 5GRUL 4FQQB 1EAPA 4NNXB 1EXUB 4OKDA 5IUSA 5C07B 4Z95H 1AGFA 1G0DA 3SN6N 1GSMA 4JM4H 3D69A 4LVNB 1A1NA 4QRTB 5EZOH 4M6MH 1WCQA 1U3JA 3NMEA 2E7CA 1TTFA 4S1SL 5C92A 3RAJH 4ELMB 5T1LD 1ZTXL 3SJVE 4XTRC 3ZKMC 4WU5A 3P4NB 3UDWA 1JZ2A 4XP6L 2NLJB 2HFFB 2C5DC 1G6RA 4XPTL 3H42L 4C56E 1AFVL 5DQ9B 1MRCL 1J0KA 2QQNL 2H32A 3TCXA 1S7QB 4QOKE 1G9NC 2D3VA 4JRXE 4X6EA 3K81A 1BQLH 3NH7L 3LVEA 5FYLD 4IRSD 4WI4A 4ZFOL 1HHIA 4BH8A 4ZFGH 4P9ML 1I9JL 1KPUA 3PV6B 2OTPA 4JQIH 2AP2A 3TM6A 3UYOD 4M1GL 1NCBL 5A3IC 1YJDL 4JFDD 5CD5C 4E41D 5MEQB 5DMGC 4NZTL 4QRPE 3V5DA 5ACZB 3VE0A 3AY4C 1Q9KB 2EO9A 4YBLB 1CD1A 1BFOB 1QLRB 2H1PH 1DANT 3KPRB 4OZFG 3UBXG 2NY3B 4M5YL 2FD6H 1JNLL 2G9HA 1L9NA 1LD9B 1KIUA 4NRZA 5DK2B 5ICZA 1UC6A 2X2YA 3ARFA 3E8UH 3VMNA 3L3IA 3ALWA 4IHOA 1FGVH 4KH2A 4WEBL 1W0YT 1IGYA 4JAMB 5HVWA 3MUGB 4DZ8B 3ARBB 3HNTH 4FTVD 3THMH 3RWFA 3FN3A 4LKCA 4MB5A 2IPKA 1A1MB 4MMXC 3ILQC 2X4TB 1WITA 2OJZL 3N1MC 5DEGB 5DWUH 5T3XH 3WSQH 43CAB 3KG5A 4QRRD 3WKMH 1IBGL 4NGHL 1LO0H 2D31A 2UVEA 5GHWL 4AT6B 5MHSD 3MLTB 5IR1A 1UT9A 1CFNB 1MHHA 1SHMA 1ZHBB 1GGUA 4PJXB 5TDPA 5C0DA 5TE4H 4FNLL 3FB6A 3S4SB 2VLLA 4RFOL 4NQEB 4E42B 4ZOBA 4EXPX 5E2JA 1X4YA 2LU7A 2BFVL 4JQXC 2XZZA 2JK5A 4F7EA 3IDNA 2BNRB 3N1FC 3FO2A 1FC2D 4CVZA 2FO4A 3D25B 3L3OA 3QBTB 4DQOH 1T83C 1YQ2A 4BSVB 4OGYL 3O4LB 4YWGL 3JWOC 4PUBL 3P77B 2ITDA 5BW7C 5JOPE 4OGAC 1FZMB 4LASH 1AIFB 1MUJA 2ZUXA 4MAYA 5FFLA 3FQNA 4JFEE 1JK8A 4WO4A 5I17A 1ZLWH 3TVMC 1K8IA 1MVUA 3N0PB 3N50A 2XOTA 4KZDL 4P0DA 4ZYKA 3EYUL 1T66C 2OZ4A 3MV8E 2EDFA 1X5HA 5EC2B 2EEAA 5BRZA 3QQ3B 3QUZB 5ITBH 3VFOA 5BVJB 4QTHB 3L5XL 4LCCC 4Y2DC 1PX3A 2BNQA 1V7NH 5FA3A 1YEFH 3QHZL 2KZWA 4G6FD 1VFBA 3G5YB 1HNGA 5LGJA 1H3VA 3MXWH 3EO0A 1HXYB 3CLEH 4QYOB 1P6FA 5EIVA 3QNXB 3TJHC 4TNWK 4M61B 4S1RL 5EBWB 4JO1H 5C0ND 5LQBL 4OCRL 5D7LD 5DD0L 4XNXL 1KJ2L 3U0PA 4KAQH 3OKDA 3VG9C 5JA8B 4HKZA 4F7MA 5CD3B 2VDOL 1ZGLA 4PRPD 4PTUB 1FH5L 3HE6B 5EBMB 1P5VA 3MJ6A 3D39D 4PYHA 1FNSL 2C3WA 2IGFL 3RZCD 5IMLB 1ETZA 5IW6B 3WJJA 1CFQA 2X4NB 3C87A 5FK9B 2IQAA 3GMOA 1DLFH 4IMLA 5D72H 4AL8L 1XF2A 1D5IL 2NY0D 3E1F1 5EUOE 1RURH 5C2UB 1B0RA 4YHPA 1R3IL 2LTQB 2E9BA 4JHBA 5K9JH 2EDHA 3FRUB 1EERB 5CJQH 1Z9OA 1DJSA 5HGHA 2GK2A 4NIKB 1YEJH 2K9UA 2P1YA 3LEXA 4KK5D 4PJFE 5CWSB 2EZ0D 4E5XB 3GRWA 4LLVB 1T1ZA 5DZLA 3HHRB 3DRTB 2ZUYA 4IRJC 4Y7MA 2R1XA 5DRNA 4Z5RB 3GI8L 3BPCA 2AJUL 3BHBB 5D7JA 2IADA 3SPVB 3ULVC 5DMKA 1M7XA 1XGYH 4UDTB 1U91B 4XI5C 2WBJA 4ZQKA 1RUAL 3S6CA 1MREL 2J12B 5DZNA 5F1NB 3VDCA 4D94A 3W2DL 4HXBH 5LWYH 2YPKA 1E27B 3GI9L 3GKWL 2WV3A 3HC0B 4K3HA 5J13B 2Q86A 2D0GA 4AMKH 4K9EL 3N9GH 1KB5B 1NEZA 4IBLT 3QEQB 2R4RH 4ZD3L 1JRHH 5I19H 2VZTA 5ISZB 4XWGL 4U1IA 1HHJA 1HQRA 2J3SA 3P9MB 2G2RA 3CFJB 3SDCB 3PGDB 4PV9B 5I1GH 1DE4B 1D3CA 3PP4L 1OTUC 5JOEA 1FG9C 3GM0A 5IFJA 2J5LB 1A6ZA 4K7PY 1G0YR 1MCLA 2VR4A 5FYJU 1FG2B 3SGJA 2RAMA 5DT1H 5E7BA 4UV4L 1F8TH 1W72B 3P11L 4XC1H 4OZFB 3T3ME 2BP3A 3UBXB 4RBPK 4N0UB 5DHXB 4AEHH 3CSYB 5HYIA 2DLTA 1IEHA 3WO3B 3DETC 5C0JA 1ONQB 4X6DA 3ULVE 3OB8A 1UA6L 1CVSC 3QUMB 2R23A 4I48B 1D6VL 2CO7B 3DV6A 5BMFL 4YDIL 1KFAL 3VWJB 1I7RB 3RVVD 3VD5A 4EKXA 5H8DA 4XVJH 4R2GC 2WWMD 1MIEH 4B53A 1BD2E 2EO1A 1YQVH 3U79A 1YA5A 4IIQA 4JN2A 1FFPA 2XWJA 4JLRA 4NO5B 1CDBA 1VGKB 3D3VA 1FVCA 5F21B 2IBGA 2KDGA 3QO1B 4I3SL 1AO7D 4OD3H 3GHEL 4YHIA 3LSOB 4OI8A 1I9IL 4BK5A 4HIIB 2AW2A 4OZIE 1V3MA 4FZEL 1U95B 5FCUL 2HLAA 3N1PC 3LIZL 4JFYA 4AZ8A 3SKMB 1YPZA 2FBJH 3RU8L 3BGMB 1UB6A 1A6VL 4MA8L 4O51B 4P2QB 5LBSL 2YHGA 1YJDC 1C8PA 3QUXB 1FIGL 3TWCL 2BDNH 4WV1C 2NW2B 2Y72A 1CZ8L 4GG6E 2V2XA 4HJ0D 3WIHH 1MEXL 1S9YA 1RIUH 1T2JA 1A4KB 2FECI 4NUJB 1LK2B 3GMRB 2I27N 4YGVA 3HZYB 1OAQH 2CDEA 3Q6FB 3I6GA 5F8QC 5D7IA 3W11D 4F33B 1FVDA 3MV9A 2NQCA 2Q8AH 2EDKA 4Q6IC 1R3KA 2OL3A 2X89A 2HFEA 2CKNA 1YMME 1G7QA 3EKCA 1ED3B 1NFIB 4URTB 3MRKA 2AQ2A 2HTKD 4MD5A 1BQHG 2X1OA 3BKCL 1ZGLP 5DQJB 2NX5A 1OT1A 3QXVA 3BSZH 1BFVL 3WEXA 3D0LA 3WLWC 4LRIA 4L8BB 1Z9LA 1SVCP 1MAMH 3C6LB 1ZS8B 2P49B 1K3ZA 2VUOA 1A7BA 3BKML 4HQQH 3PABA 3SDAC 1UZ6E 4QGTA 3OPZH 5BQ7A 4RZCB 4I5BB 4LAQH 1YEIL 3JV6B 4AG4H 3DUUB 4YO0A 3C60C 3QNZA 4X80H 4JO4H 3LOWA 1FN4A 1BBJA 3OKNB 1A2YA 4EVNA 1MFBH 4L9LC 1RMFH 2AEQH 1CGUA 2YPLE 3BZFB 3B9AA 4H1LH 4FQHB 1N4XL 2M8XA 5IVXF 3MBED 4G6JL 1AXTH 3EYFA 3ZHKA 4RWYL 5C08A 1AQDA 2IPUG 1VGEH 3EBAA 1XGRA 4XP5L 3MJ8A 1U8NB 4MJ5A 3S3PA 3D0VA 1LP9E 3QRFM 1RV6X 2J6EH 2ATKA 1EHXA 5E08H 2EKSA 1UZ6F 2VXVL 2YZ1A 4X4YA 5L9DL 4TSAH 4L3EE 5IKCB 4PJAA 1KG0B 1GL4B 4LCWB 3IXTB 2YD3A 4MB3A 5K59E 5H35B 3IVKB 2CD0A 2IC2A 5E5MB 5D2NE 5T3ZD 1XFPA 1J0HA 5SWSA 3WDJA 1RZJC 5FM5O 1O5DT 2WWMC 1JZ6A 3VXMB 1I8IB 5E8NA 4M62L 4CU6A 4M7LL 4Y5XA 5DZOA 3KHOA 1Q9LA 1NCDH 3VFTA 3HR5B 2NY4D 2HJFA 1LE5B 4HUWB 1LP9F 2DQDL 1MJ7L 1QYGL 3DI2B 3CPLB 5T1LB 5A16B 4G9DA 5EZIL 5MEOB 3RTQD 4Y4KD 2V5RA 3PWJA 3ECBB 5D4QA 1YUHA 3O2VH 3UAJC 5ACMA 1OF2B 3TH4T 5GGVH 1CT8A 1ACYL 3WFHA 3X13B 5K59F 4V1DA 3MRJA 1BVZA 2VDLL 4XNYH 2DQCL 3EZ8A 1X5LA 4U1JA 1FL5A 4IRSB 4JANB 2NY5H 3NFNA 1YNTB 1MFAH 4I18C 5ADOL 2XRAL 4NT6B 4OLUL 5EWIH 4PG9B 1KJMB 2QTEA 2D7OA 4X6BA 2NY1C 3A6OA 2X4SB 5I1IH 4Z7NE 4JFDB 1S78D 1JZ7A 3NIGF 1MRDL 3MRGA 4E41B 1SMAA 5TH2B 2F54E 3UTQA 3T08A 2AKRB 3VD3A 2BRRL 1EBAA 1NC4A 4PR5B 1LEKA 4OGZA 2W0PA 1K9TA 3B83A 3RKDC 3K1KC 4DCQA 5DC9B 2DDQL 2R69H 1KJVB 2X7LB 3CH1A 4EDXB 1KENH 3PQYA 4JJ5B 4XWOC 1KLGA 2IAMA 2JELH 3UEZA 3F65A 1KELL 2YUVA 2R1WB 4FTVB 4OF3A 4NQXB 1AR1D 5FO9B 5EOTA 1BGXH 3NCFB 1HXMA 4KJQD 3BGFC 1MFCH 4HGKC 4KVCL 4JO3H 2A0LC 5T3ZH 3VXQB 1L7TL 3C8HA 1SQ2N 4QRRB 5K9QI 4KHTH 4UILL 4MCYA 3U9UB 5ICYA 2VAJA 2WM0A 2X70B 2JKXA 1SY6A 1T2QH 2ZSVA 1G7HA 3MR9B 4U6VL 3ZKND 4JN1H 5B8CA 5F3HB 3ABZA 3NIFE 2DIJA 4ZSOA 5JMRA 3C08L 2NZ9D 5C6TH 1DQQA 2BHYA 2DQIH 1BFSA 4PY7A 7CGTA 4HMEA 4JHAL 1Q9OB 5IHUL 4Q2ZB 1X4ZA 4KHXH 1R0AL 5GS1C 4NM8H 1K5NB 3CK0L 4LHJB 3CFBA 1BQHB 1DFBL 3SGKA 4X4XB 3DO7A 3E6FA 1EO8L 5CKAA 5TPWL 1CR9L 4PJHE 3OZ9H 3H2WA 1FNGA 4Y5YA 4PRDA 3PDGA 4TRPH 3BOVA 3STZA 3QYCA 3EYQC 1NSNH 3GBNL 2D7NA 4AM0B 3QB7C 3IDJB 3DJ9A 3QCTL 4MXVE 1FHGA 5IT2H 3QXAB 4Z7WB 3NIFF 4KQ4L 4I0KA 5C7XH 1D9KC 3DMMA 4Y16C 3IFPA 2MMXA 3RL2B 4F58H 5T33H 3MRIA 4G6FB 1Y18A 1HHGB 2YUZA 5KVDL 1WICA 4P2YA 5EO0A 5IVXB 3NCBB 2SEBB 4RA0C 5EO9B 3SQOH 1G1YA 1PZ5B 2HLFC 1KIPB 3NFSH 3D18A 3RX7A 3KLSA 5D7LB 3PWLB 2Y07H 1A7RL 4RIRB 3WS6C 4A6YA 3IU3A 3DSFH 4LMQE 4BQ6A 4D8PB 2JJVA 3ORJA 4ODXA 1W8OA 3MRCB 3RZWA 2FJHA 5J6HB 4MXVF 4PRPB 2PW2B 3I6KA 2FX9H 1OTTC 5GS0H 5K9KA 4O2FB 4N9GB 1I1FA 5I74C 1AXSB 4ISVB 4L8SC 3D39B 5I1KH 4M7ZB 3RZCB 2EXYD 4JPKL 3C5SA 5F1IB 2FEEI 1UVQB 2NY0B 2YOCA 1TTUA 3WNNA 1IC7L 1MF2H 1J8HA 4J6RH 2FIKA 1FCGA 2X4QB 3UTSD 5IM7A 4OCNC 4ORGB 2BSTA 1HCFX 4ZUVB 4BH7A 3W39B 2QQLH 2EDOA 2PXYC 4PJIA 4PRAB 3VFUB 8FABB 2PYEE 5I73B 5IEKA 3UTTD 1C7SA 5I8CB 1G0XA 1NKOA 4LVOC 5E24E 1Y0LA 3H9HA 4UDUB 5FUZH 4P4KA 2GUOB 1R5VA 3TPUA 3VW3L 2A77H 4HWEH 1P4IL 3EJZD 3AREA 2Z9TA 2VXUL 2ZUQC 3QI9D 4A2MA 4NPYA 5DA4A 3PL6C 1IGJA 4OSUL 4KQ3L 3BPOB 4HHAA 2B1HL 1ZSDA 3QXWA 4UINH 3TC9A 3EO9L 1N2RB 2DD8H 2ADGB 5IOPA 1TJGH 4H26B 3NACL 1TTGA 1TZHA 1L7IL 1NLDH 4OZGA 4KKBD 1TVHB 4JRYA 1OGAB 43C9A 3I85A 1UENA 5E8OB 2NYYD 3RIAK 4NZDA 4FA8A 2CXKA 1PD6A 3MRPA 3T1FB 1NBZB 1IM9A 4OIBA 1W2KT 1KTLB 1KCUH 3FFCD 3NZ8B 3RX8A 4I2XE 3TPKA 2HT2C 3CJJA 2ZWLT 3QCVL 1IFHL 5CJ5A 5KJRH 1XZ0A 1MFEH 4X7CC 5HDBE 3LD8C 4ZAKD 4F7CA 5T5FH 1VEOA 1ITBB 3DVIA 1K4CA 3HC3H 2GFBA 1B4JL 3M8OL 3TO2B 2WBKA 3WYRA 5EC1B 3HUJA 3SKNB 5EFIA 6FABH 5D6CA 1EGJA 3U1SH 1UKTA 3KR3H 2Z0BA 3MYJA 1NFDF 3GSRB 1KV3A 4MB4A 2A74B 4NFBA 5BJTB 3KPMB 2NMSA 2VC2H 4J23A 3T77B 3DX8A 3VFRA 2IMMA 3HI5H 2J2ZA 1AO7B 4PGEA 4UAOB 4MD4B 2AK1L 3O2DL 4DN4H 2DQTL 3NIDE 2VLRA 1PKQB 4Z7VE 3KXFA 4Z0BL 4FQQA 4NNXA 1SJHB 4L4VD 1F02I 5C07A 2RCSH 4QRTA 3BD3A 2NY7H 4M3JA 1IT9L 2P45B 3I02A 3ISWA 2XZAL 1QSED 2WUCL 2B2XH 4E9LA 4WI8A 1VCAA 1E4KA 4ELMA 4WW2C 5IB2B 4HS8L 3P4NA 4XB8A 2NLJA 2HFFA 1KCRL 1RZKC 1QHOA 1KUMA 3AS2A 4R90H 4X7SL 1A3RH 5DQ9A 5CBEB 3BX7C 1JCKA 4Z7UE 1AH1A 4HD9A 1S7QA 1RZGB 3NZHL 4JM4L 4L29A 5CJXC 1RJLB 4P46D 1O0VA 4MXQC 1CGXA 2FHCA 2DRUA 3PV6A 1MIML 2RGSA 3P9LB 1HZHH 2WUBL 2YD6A 4XXDB 4NZUL 5H2BB 3LDBB 4PTTB 1V8HA 5E8PB 1MJUH 2UZXB 5CMAB 2W9EH 5DFVC 2MWCA 4AEIL 1BFOA 2DQGL 1QLRA 2K7PA 1T22B 3KPRA 5AD0B 1OW0C 1JI1A 1RULL 1LD9A 1BQLL 2AXJA 4BZ1L 1N7MH 4ZFGL 2OMBA 4GW4B 4JAMA 3MUGA 4TVPH 3ARBA 3BYYA 2DQUL 1KCLA 3EYVB 4JQIL 4YK4C 4BM7A 4M02A 3PIQB 1XIWA 1A1MA 4GG8B 4OGXH 1S7SB 1I9RL 5INCB 3MLXL 3TBYB 3FONB 3BMWA 2X4TA 4AENB 5DEGA 3KAAA 43CAA 4N8CL 1UEMA 3MBEB 1A7OL 1AE6L 3DHMA 1INQB 4AT6A 3I6LD 5A2JH 1NEUA 2J4WH 3B2UC 4KDWA 4ODBD 1CFNA 1RIHH 3U7YH 1ZHBA 4PJXA 3THML 3S4SA 3SOBL 5A1AA 4NQEA 4E42A 5DMJB 2XKSA 1HKLH 2FNBA 1ND0B 3VGBA 2ADFH 1AQKH 4WW2F 2BNRA 3KLHD 3D25A 3IU4H 5IBLD 2ZOKA 1MCOH 3WSQL 4K3JH 3U6RB 1UACH 1NGWB 3P77A 4XNUH 1LO0L 3O4LE 1FZMA 5EU5B 3RA7L 1AIFA 2D0FA 5I75C 3DOSA 4HJJH 2NXZC 1AC6A 2QR0A 2VQ1B 2Z31D 5DJ0B 5IG7B 3GBLA 3IYLW 1LEIB 2NY4B 4XBGB 1A6PA 2I5YL 5EC2A 5GGVY 1IGCH 2Q6WB 1M6OA 3QQ3A 2ZCLH 3QUZA 2QSCH 4X6FB 5AG9A 2CPCA 5BVJA 4HSQA 5TGBB 2YBRB 5KAQG 3RTQB 4ODVH 3BEVB 4Y4KB 4FP8H 4HH8A 1SJEB 4OLEA 1MCNA 3OJDB 5KAQF 1PG7W 4FQXC 1JZ4A 3GMQB 3BRDA 2Q8BL 3G5YA 2N7BA 4OAWB 25C8H 4KJWC 4LLUB 2JCCB 1HXYA 1RZFH 1PY4A 3EGSB 4QYOA 2WLZA 3QNXA 2B4CC 1JNJA 4M61A 5EBWA 1TFHA 3C2AH 2H45A 4O5LH 5ITBL 1OM3L 5AWNL 1NFDB 4IS6B 3SHSA 3TBTB 3WXVH 1FZJB 5CD3A 4NKIL 2F8OA 1A8JH 1ZLSL 4PTUA 4S0SD 4HK3N 3WIIH 3HE6A 3GZKA 4JDZA 1JGLL 3BPNB 3S7GA 1OQOA 1JTTA 1S7RB 2XWTA 2BHZA 1Y6MR 5IMLA 5IW6A 3R8QA 2X4NA 3MFGB 4JO1L 1CICD 5FK9A 1NMAH 1QBLL 2AXGB 2C3XA 5HGBA 2GSGB 2WIMA 1J1PH 1KXVC 4HIXH 1QG3A 3ZE1E 3LCYA 2V7HB 3GJEB 2X1QA 3G08B 1BP3B 3QJFB 3UO1L 5CWSA 4E5XA 2VLKE 2D2OA 4LLVA 4NUGL 2AJXH 1MWAH 1F6AA 4Z5RA 2BVUA 3BHBA 4UT9L 1F4YH 1H5BB 1YECL 3SPVA 2X9XA 4UDTA 1QKZH 1U91A 4O4YL 3B9EA 1NLBL 3MRBB 4E0RB 3BN9D 2PO6D 5D72L 2CIIB 1Z9SA 3O6FD 3JUZA 3SKUD 3A6CL 5F1NA 2P5WE 3RQ3A 1A6UL 1E27A 5JORB 3HC0A 4POUB 4U1LB 3RDTC 5F9AC 2CK0H 2VWEC 4XPBL 1KB5A 5BXFB 4GQPH 5I1JH 3QEQA 3VGAB 2YUXA 3LRSB 5ISZA 3S96A 3P9MA 3CFJA 1WVZA 4PV9A 4NHCH 4P5TC 4PGDB 3TBSB 2YZ8A 1FG2A 4XZUB 4G7YL 2NY2C 4KI5C 1J5OL 4M00A 1W72A 2VDQL 3UBXA 5K9QG 2I07B 4N0UA 4HXBL 1HCVA 3CSYA 3G04B 4XXCA 4AMKL 4ZNCD 5C6PB 4KRLB 4LEXH 2A73B 1ONQA 1C5BH 3F58H 5CAYB 3LH2H 3QUMA 3C2SA 1Q1JH 1P4LB 4I48A 4RWHA 3IRZA 4C4KT 2OI9C 3GNML 5I1GL 1BOGB 4WVRA 5J3HC 3VWJA 1I7RA 4WFFD 1JPFA 4ZODA 4JR9L 3W5MA 4POYA 4PJ7B 1BM3H 3QNYB 4HH9B 2VWEE 1F8TL 4J4PD 5CIPB 4XC1L 3A6BH 4H20H 1HN1A 4AEHL 1LO5B 3MJ9L 4NBYB 4NO5A 5JIHA 1VGKA 2HKFL 1EHNA 1KJ3H 4J3TA 3QO1A 2H6PB 3EFDH 3LSOA 4Q97A 5KS9F 4MQTB 4HIIA 1Z2KA 2RBLA 1HYSD 4KI5E 2AGJL 3Q1SH 1U95A 4YNYB 1FAIH 5FKAB 5D2LE 5JXEA 4R0LC 3SKMA 1U42A 1CD9B 1MIEL 3BGMA 2AQ3A 2FSEB 5E8DH 4JVUA 4O51A 4P2QA 4CADB 1YQVL 3QUXA 1TJIL 2F5AL 3V7AG 4RDQG 4ODHL 2B5IB 2NW2A 3G6JF 5DS8B 3WLBB 3OQ3B 3WO4B 4P59L 1KCSH 4JM2C 4OD2B 4YXLL 4NUJA 1LK2A 3BD5A 1OAYH 4CVXB 1K2DB 3HZYA 4K3GA 3Q6FA 3LPGA 1W0VB 4F33A 5DHVB 1EEZB 3HG1A 2EYRB 1FGNH 4U0QB 3UTSB 3QRGH 3H8NA 1JHLH 1R5IB 2EE9A 2JJTC 3IXAB 5F89B 1HHHB 1UWGH 2BERA 5H94B 3W9DB 1KXTB 4Q7DA 1ED3A 1U8LB 1TZGH 1NFIA 1P2CB 3UTTB 2BSRB 2VDRH 3EYOB 4OFDA 1QOKA 5F88B 5DQJA 4MHHI 4YUEH 3DIFB 3D85D 5GPRA 5D2LF 1A0QL 2D7PA 3JWDH 5HVGB 1TVDA 3U9PL 1OAQL 3SY0A 4JB9L 3OV6A 3I2CH 3L5IA 3QO0B 1SBSH 5L7XL 1B88A 3QI9B 4YAQB 2Q8AL 4WNQB 1ZS8A 3ZE0E 4OBRA 5DQDL 4R4NC 4FFVD 3FFDB 4CJ0A 3ZDYF 4RZCA 4I5BA 2WANA 2VITB 1JNNH 4IRZH 3JV6A 3DUUA 4AEFA 5GSVB 5HD8D 5CGYD 3RVWD 2P5ED 5D1ZD 2YUWA 3B43A 3FFCB 3ZO0A 2V17H 4WFHE 3BZFA 4TQEH 4FQHA 3MBXH 5CZXC 1U6AL 4YHLL 1B6UA 3H7LA 4ZOEA 4ZAKB 3FO0H 3TT3L 3OPZL 2I9TB 4LVHC 5DGQA 4C83B 3BKYH 1KNOB 3O6MH 4LAQL 1U8NA 4KU1A 2NW3B 4OLXL 4HC1H 4DVRL 3IB4A 1U92B 4X80L 5AYQA 5IFHL 4OFYA 2Q76B 2KQNA 5IKCA 2W60B 1KG0A 1OAXL 2JLLA 3LKPB 1RMFL 4LCWA 1MNUL 4MQSB 3IXTA 4EUPG 1AGBB 4W70A 2B1AL 1XT5A 5H35A 2DBJA 1F11B 2DQEH 2XV6B 3WFCH 5J11C 4LLDB 2L7UA 3VI3F 5B3JE 4EIGB 5FYKH 3MMEB 3VXMA 5EU6E 5FDYA 4JGMA 5T3XE 4L4VB 3CVIL 5LVEA 1UM6L 4YHYB 4APQD 1PEWA 3ARVA 3NPSC 1RUMH 3HR5A 1LE5A 4HUWA 4IOFC 1OTSC 1S7TA 4MNGB 4HWUA 1OSZB 4CN1A 4LQ1A 1QSEB 1I9EA 4NHUB 3W82A 3HAEG 5E99H 5I1DB 3GSVB 3CDGB 3CPLA 2VR9A 5T1LA 1NDMB 5A16A 2FEDD 3BI9X 5MEOA 5DVKA 3GSNL 2KH2B 2R4SL 3ECBA 4NC1C 4BFIA 4YEFA 5K9OB 5KG9A 1OF2A 1EJ6A 3C09B 2Y5TB 3QDJD 4U1KB 3MLZH 3X13A 1RIVH 4FQPA 2W65B 1T4KB 3ETBF 1JWUB 4FZ8H 4P46B 4IRSA 4JANA 5C0RL 5B3JF 2CJUH 2PW1B 1NCNA 1A3QA 1KACB 4YBQD 3GSOA 4NT6A 1SBBA 2D03L 4PG9A 1KJMA 4K8RL 1TZIB 4CU8A 1N64H 3S37H 2X4SA 4QHLB 1VSCA 1VPOL 4JFDA 4M6OH 5KVGH 3VGGA 3OR6B 4E41A 2DWDB 1NCAL 1OSPL 5TH2A 2AKRA 5I1CH 3ELAT 4I3RH 2NTFB 4PR5A 5GGTH 2OP4H 4WHDA 2ID5A 1DVFD 2VQUA 3SDXF 3GB7B 4QLRA 4XNYL 1ZEAH 1KJVA 5KS9B 2X7LA 3L95B 3CFKB 2NY5L 5B21A 4EDXA 2D7TH 4JFFD 3CAFA 4JJ5A 1J11A 4GRLD 2C1OA 1U93B 2XKNB 2R1WA 4FTVA 4ODUB 4NQXA 3VXNB 3HMWH 2IMNA 5FO9A 4MS8D 4JKMA 1QBML 3O4OC 3LN9A 1WCBA 5JR1H 1F90L 4DAGL 1UYWL 1XGQB 2R2CA 1WIPA 5JXAL 3M17B 3HMXH 2EIEA 3G6JB 2LVCA 3VXQA 5AYUL 2HWZL 4QRRA 5HYFA 3IDYB 1JGVL 3NGBB 3U9UA 4MDJB 5A43C 1RFDH 5F96H 3K0WA 1JV5B 2CDFB 2X70A 2W0KA 4U49A 5HI3C 1KENL 3MR9A 4JFZH 4PJGE 3RI5K 1JHKL 5IJKA 2GT9B 5F3HA 1ZKAA 4JHWL 3WD5H 5BV7L 5F7FA 3V5HB 4F7TB 3U4BL 4FQLH 3TFKD 1NL0H 1LE9B 1Q9OA 1CVRA 3OAUL 4Q2ZA 3TNMB 4JO3L 4HV8B 5CCKH 3VI4E 1BQHA 4YXHL 1DBBH 4PB0H 4GUPB 1R3LB 4X4XA 2FZ3B 9CGTA 4OF0A 4FG6D 1MJ8H 3MUZ1 2RR3A 5HY9B 3GMLB 1KOAA 3ZZ1A 4F15C 2Z31B 5BVPL 4OFKA 2IJ0C 5F6IB 1DQJB 3LS4L 4K23L 1FFNB 4HZLB 4OF7A 2AJ3B 4S1QH 4AM0A 3B9KD 1CFSB 4NBXB 2XTJC 4XC3L 1DL7L 1WZLA 2XXCB 5I2IB 1MHPH 3KDMB 3QXAA 4Z7WA 4G9FD 1CE1H 1TCRB 1JYVA 1HIMH 3VFWB 4LFHD 3TN0C 4XPHL 3RL2A 4J3VA 3BO8B 1HI6B 1N0LA 1CQYA 1HHGA 5JHLL 1IKNC 2CRZA 2Z91B 5IVXA 2YSSB 2A83B 2SEBA 5EO9A 1L0YA 1R5WB 1S9VB 1BBDL 5IMMB 1NSNL 1PZ5A 2VSCA 4LPYA 1DQLH 1KIPA 2R2EB 4FMFA 4K8RD 2HFTA 4HBCH 3B4NA 3PWLA 1T89C 4FMKA 4RIRA 3W0WE 1KN2H 4D8PA 4JY4B 4NO2B 5I8EB 3MRCA 3V5KB 1FNAA 3NAAH 2GJ6E 5DO2D 4OI7A 2VOTA 5J6HA 2APTA 4PRPA 2PW2A 2BOCA 2DJ4A 4FQ2H 2YA1A 3BRGC 2FATH 4GQ9L 4NQDD 4EUPB 2XTJE 4O2FA 4N9GA 4Q6IA 3VXPB 3FN0L 5JZ7C 4ISVA 3D39A 4FQIH 3RZCA 3RIFK 4GRMB 1CICB 3NFSL 3TA3C 4NWTL 5F1IA 1J0IA 3QEGH 1JGUH 4G5ZH 3V6OC 3DSFL 3P73B 2VISB 5DUMH 2UZIH 1UWEH 2IFFH 3CMGA 3T04D 4HWBH 2APBA 2X4QA 1S9KC 5E00B 4X8JB 3AM8C 3NVQA 3M45A 3ZDZE 4FFZH 3V95A 2BVEA 2FX9L 4X7DC 3W39A 3RGVD 3HAEB 4PRAA 3VFUA 1MCIA 5GS0L 3MRFB 2R0KL 4NWUH 2AEPL 1CQKA 4OUUB 5I8CA 4K7FA 1GHFH 3V4VL 4UDUA 2PO6B 1UZ8B 2QJDA 1TQBC 4PS4H 2GUOA 3O6FB 1P9MA 3FQTA 2R29L 1NAML 4GBXD 4D9RD 3LS5L 2DJSA 1IGTB 4TPRL 3BFOA 3KYOB 3FQXB 3FOMB 2ERJB 3SBWC 3TEUA 4BSJA 2QEJA 3AS0A 3BDYL 4PLJD 5AUMB 2QQLL 1A14H 2CLVB 1N2RA 4OZ4B 2ZZUT 5J12C 4GAGL 5KVMC 4NC2B 4ZPTA 4H26A 3V6OE 4OLYH 4DKFH 1TVHA 4MVBC 5E8OA 3SDXB 5FUZL 5HGDB 4LSRL 1OGAE 1NBZA 2E7LA 1KTLA 2LFGA 4HWEL 5MEPA 2PR4H 1F2QA 4P2OD 4NFCA 3NZ8A 1WEJL 1G6RH 4UT6L 3RVUD 3FT2B 5KSAC 4YE4L 1HWGB 1ULVA 4JZJB 2H32H 4UINL 3IAGC 3OKKB 1GGIH 3SE3C 3QFJE 1OY3B 3KJ4B 3TO2A 5EC1A 3LKRB 3SKNA 1YMHB 4N1CA 2J8UF 2Q87A 3K4DA 1S5HB 3GSRA 1GCFA 5DRZB 3PWNA 3BE1H 5BJTA 2B0SH 3KPMA 1KCUL 3RY6C 3DVGB 3QEUA 3T77A 2EDRA 2Q3AA 2GHWB 1KJ2A 3MA9H 1QPPA 1AO7A 2GKIA 4MD4A 1CK0H 1ZHNB 1FYTD 1PKQA 1LO4H 4U3HA 4R3SB 4UUJB 4MNQE 4YDJA 3BRFA 1SJHA 2IF7A 4XPGL 1N0XL 35C8H 3IKKA 5IV2B 4K8RC 1QFWI 4TVSa 4IDJH 1J87A 1R6VA 5D96B 3QISA 4JO2L 5F1OB 4H88L 1E6OH 4DGYL 4I18A 5IB2A 4DWHA 4XMPL 5MP6L 3MGTB 3QIWC 4RCAA 3IT8D 1MLBB 2NY5C 2IPTL 3FO1B 3P0VH 4M93B 1PYWB 3DGGB 1KEGH 4WHYG 3I9GH 2HP4A 1RJLA 2RCSL 5FGBC 4FABL 2OMNA 3MACH 2NY7L 1HINH 1UKSA 4NZJA 4B5EA 4GRWF 5TE6H 2YMXH 3D85B 3BKJL 2B2XL 4FRWA 4UV7L 3BWUC 3P9LA 4PG2A 5H2BA 3ULUH 3JV5A 3RGVC 1JFQH 5E8PA 5IK3B 1Z6JT 4R90L 1U58A 2R9HD 2VDKL 1A6AB 5CMAA 1Q0YH 2VN4A 1N6QH 1T22A 5AD0A 4JHZA 1WC7A 5I0DA 3CDFA 5FYJH 5BV7C 3Q5YA 2C4XA 1J7VR 4LVEA 5IB4B 1M7DB 1U2CA 1P1ZB 1QR1B 4DEPB 3KPSB 2OZ4H 5DJDB 4GW4A 1U3HC 2NY6D 4LFHG 5H37H 3EYVA 2P5EB 1LO2L 4WEMB 1WT5C 5D1ZB 4I8DA 4UNUA 4GG8A 1ZLUK 1S7SA 4G43B 4PLJC 5INCA 2DM3A 3TBYA 3FONA 4AENA 1OHQA 2W9EL 2E7BA 2HFGH 3MBEA 4JFXB 1EO7A 5J06A 1ZAGA 1GPOH 1INQA 4J12A 1DN0A 1D5BB 1CGSL 4ERSH 5I71C 1N7ML 4XHJD 4Q6YA 1DQMH 2VO5A 4GS7B 4LK4A 4TULL 4P2OC 4KPHL 3K8MA 4NQSB 1Z3GH 5E6ID 1ND0A 2H26B 3VFVA 2P44B 1GGBH 1OP9A 4PRHD 3O0RL 2VN7A 3CXDL 3U6RA 4Z77B 1NGWA 4K94L 3FAWA 2HH0H 2YEZB 2FLRT 2F5BL 4QHUB 5EU5A 3TBWB 5T3ZE 1NGQH 4Y4FC 4PGJA 2CGRH 2PTUA 2V5TA 1CXHA 3F62A 4IMKA 2VQ1A 4APQB 1NBYA 2AJYL 1JGEB 5DJ0A 5IG7A 5JOFB 3VU2A 1LEIA 3WUWG 1P5UA 3L6FA 3QWOB 1ORSB 3MA7B 1F4HA 4X6FA 1DLHB 3IU4L 2G60H 3LHPH 4OT1H 5TGBA 2YBRA 5DVMA 4K3JL 3T0XA 3RTQA 3GRWH 3BEVA 4EJ1C 1SJEA 2H2SC 1HDMB 3OJDA 2Y6SD 4W4OC 4LHUD 4WWKD 1FVEB 3GMQA 1I4FB 3QDJB 1UCBL 4RMRA 3VXOB 5FECB 4OAWA 1KEMH 4U1SB 3K8LA 4LLUA 4XRCB 2K1MA 5JW3H 1NMCC 3EGSA 2OR9L 3T0BA 3MRQB 1FBIH 1IGCL 2A6IB 2JCCE 4R97C 3PDOB 4LLWB 2Q3ZA 1FPTL 4NN5C 3X12B 4L8SA 4YFLI 5HHXL 4PJBB 1ZT4B 2V7NB 1UG9A 2J8UB 4D3CL 1E6JL 1NFDA 2GJZB 4U7KA 1C7TA 1DQDL 4FP8L 4IS6A 4XAWH 1G9ML 5GS0C 3TBTA 1EH9A 4Q9QH 5DRXB 1FZJA 2JJSA 2FRGP 4QY8B 4NCC1 5D1XC 1DVFB 1BEYH 3S3JA 3QR2A 4LOUD 3TT1H 1S7RA 1MQKL 4DKEH 3SDDD 2AVGA 2NX5D 4LBEB 4GRLB 4OV6F 4CKVX 2OX5A 3C2AL 3MYZA 3MO1B 3NCJL 2AXGA 3VFGH 2RB8A 1JI2A 2KBGA 4MQ7B 2GSGA 3LRHA 4OKVB 1QQDA 1DBKL 2V7HA 5T5NF 3GJEA 3WXVL 3G08A 3QJFA 4J3SA 5DRWB 3F7YB 2EH8H 3BZDA 3VFSB 5B38G 3D9AL 5E5RB 5DJ2B 4OCXL 1U3YA 1HSAB 1H5BA 5F7NC 5LCVL 4JKLA 1TNNA 4RAVB 5D71H 3MRBA 4E0RA 1OARL 4WIQA 2CIIA 3WNOA 3IAPA 5E7FA 4K3EL 2P24A 3FQWB 1KTDB 1OLLA 1BECA 4F9PA 3GUTB 2VLMD 1RVFL 2ITCB 3CDYA 3PDDA 1ZOXA 4GXVL 4GRWB 3LEYL 3WNLA 5JORA 4U1LA 2P42B 3RBGA 2QHLA 5I1LB 1QFWM 3UJTL 3LRSA 4Q9RL 3SKOB 2AJXL 5MERB 1CF8L 2O5YL 1FORL 1MWAL 3REVA 3SCMC 4RMVA 1UH4A 4RSVA 2XA8L 4D9LH 4OB5L 3MV01 1GAFL 1AGDB 3TBSA 2Z35B 3FQRB 5F97E 4XZUA 5B39G 1GZPB 3V6FB 1NUDA 4G8GA 3I50L 4KTDL 3WHE1 2EC8A 3WHXB 3S8WA 2I07A 3B9KB 2FCBA 3LMJL 3G04A 2MQ0A 2ZP0T 4MZ3A 4KKAC 4M48H 1PSKH 2ICWB 3GSNB 2A73A 5I1JL 2OL3H 4Z8FH 4XP4H 4RMWA 1NGPL 3U7AA 2APWA 5FGCB 1BOGA 4CMHB 4J3WA 3VWKC 4NHCL 5J8OA 1B6DA 5F3BB 4DGVL 5KBNC 3QG7L 3QNYA 4TOYL 4XCCH 4HH9A 5J9PB 3T0ED 4PJ7E 5CIPA 5JIPA 1FFQA 3BEWB 2HN7B 1FJ1B 1MLCB 5EUKB 1LO5A 5C0CD 3KLDA 3QIBD 4LIQH 4LEXL 3RFZC 5ELIA 3BMVA 1L4IA 4LRNH 3ZYZA 2EDEA 4WTWA 4WW2A 1H15B 3U4EB 3LKQB 5IQ9B 1I75A 4YNYA 5FKAA 2BVQB 3H9SD 3S9DB 3MXVH 4NQDB 4CADA 2FSEA 2AJSL 2CH8A 2EIBA 4RISL 4N1EA 5DS8A 3WLBA 1FO0B 4G6AD 3KJ6L 4OD2A 4N0CC 3LKOA 5CILH 1KJ3L 1K2DA 2HKHH 4LSUH 3SDYH 4NKDA 4HXAL 4RMUA 1B90A 1P7QD 1W0VA 3V5DB 5DHVA 1EEZA 2EYRA 4M9PA 4I3GA 3UTSA 3ZL4L 3WUWB 3P3YA 3Q1SL 5GZOC 5F89A 1HHHA 4NO3B 3MODH 5H94A 4Y19D 1TJHL 3W9DA 2LABA 2ZUTA 1ZLUH 1U8LA 3TZVD 4JCLA 5IROC 3PQYD 1P2CA 1BJMA 2DB8A 4XCFH 3UTTA 2BSRA 3EYOA 4R26L 4IJ3C 3IKCB 1BVKA 5C8JB 2Y25A 3DIFA 3MLWH 2GI7A 2ZUVA 3U0WH 1XGUB 3DO3A 4LKCB 5J6GA 2VDNL 2O5ZH 2X10A 3ARDD 4GBXB 2IBZY 5DUPH 1WFUA 4DFHA 3R1GH 2RJMA 2XN9D 2YPVH 1MJJB 1NH6A 1I8KB 5D93B 1FGNL 1DDHB 1QO3B 5I30L 1WIUA 3HC4H 3QI9A 3S36H 4YAQA 3G5XB 3VXUE 4WNQA 1JHLL 5B3NA 3BZ4B 4G6MH 3RVXD 3FFDA 2PNDA 3PWPD 2L4OA 5EOQH 1TZGL 2NXYB 1MHHB 5E6YA 3UPRB 3E2HB 4P3CL 5GSVA 3FB6B 1CIUA 5KN5B 4NC0B 4XP9L 4LHUG 4PJDE 1WZ1H 2JK5B 5D5ME 1I85A 3GSXB 3TO4D 4K94C 3I2CL 3V6ZB 4H8WH 2P4AB 3QQ4B 3FFCE 2B7DT 1NCWH