1QTYT

Vascular endothelial growth factor in complex with domain 2 of the flt-1 receptor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
94
structure length
94
Chain Sequence
GRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR
publication title Solution structure of the VEGF-binding domain of Flt-1: comparison of its free and bound states.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor receptor
total genus 15
structure length 94
sequence length 94
chains with identical sequence U, X, Y
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 1999-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qtyT00
2ICEA 2X1OA 4KVCH 1FAIH 5L9DH 1FN4A 1EO7A 3MNZA 1QFWM 5EORL 5LGKA 2XICA 3WFZA 4Y8DC 1AD9B 2OTUB 4IRJA 3ZDYF 3DO7A 2FECL 4M3JA 1AO7E 2V7NA 2W0FB 4WGVB 3NCMA 3Q5TA 5TE6H 5JW4R 3KPMB 5DJZA 3PNWA 5JW3L 4GKZA 1MRFL 4XCFH 5DEGB 5KAQF 1T04A 2NW2A 3BP7A 1OGAE 3MJ8B 3V6OE 4YQXL 3L3JB 1ED3A 2E6QA 2HFFA 1H3WM 5K93A 3RIAF 1FVEB 1A02N 2I9LA 5JQHC 5C7XL 1EHLH 2HRPL 1QLFA 4HSQA 4JFQB 2NY0B 3VXMA 5L2KE 2C3VA 4HZAA 4TSBL 3TFKC 2V2WA 3GJFH 1XF3A 5DC9B 1BZ7A 2RQ8A 3N50A 4OBRA 3TA3D 4WGWB 1ORSB 3WLWD 4BH8A 4CVXA 4OKVA 2VLLB 1Y6MR 4G8IA 1ZVYA 3RWIB 3LS5H 1E6JL 4NDMB 3EYSL 1V3LA 1KT2A 5IHZA 3CU7A 4WV1B 4PUBL 4LLAA 2EIEA 1QRKA 3DV6B 1ZTXH 2DIJA 4KVNL 3KDMA 4LLDB 5BZWA 2XN9D 1MCPH 2DLTA 4JM2A 1AIFB 3MOBL 1R3IL 3BUTA 3DYOA 2DQDH 2MHAA 1MHHB 4NQCB 3GSVB 1G1CA 2UZYB 4L4VB 5DXWA 5IB1A 2BOCB 2VNCA 4ENED 3BXNA 1A6TB 4EQ2A 1IILE 5HHOA 3QI9A 4QTIL 3FQXA 2CUIA 4NN6B 1A6ZB 1I1AB 1EV2E 4E5XB 1NMCC 4OZIE 4JPKL 2EEDA 3EOAB 4LRNL 5DT1H 5SWQA 1Z9MA 1JCKA 5D1QC 4KTDL 2XACC 4QY8B 4X9BA 1C16B 3BH8A 5JW4Q 2BY0A 1JFQL 3KXFA 4TPRH 3BVNA 4WW2B 4NQSB 4YHNA 3BGMB 5GGQL 1KTLA 3O0RL 2V5YA 4Z7QE 2ITDB 2WIIA 1M4KA 2WK2A 1XR8B 3EFFB 3QUMH 5IMLB 2FJGA 2X4PA 1UACL 4OLYH 2EYRB 4RQQA 3MCLH 2QQKH 4N5EC 5HHVL 4Y16D 1XGQA 2X05A 3DX8B 3BUYA 4NO5B 2P47B 1SVCP 1X7QB 4YXHL 4YIQA 3MA9H 4HPYH 1KCLA 5DS8B 1CFQA 5F9JA 5ICYA 3WFEH 4EDWH 2A6IA 3TF7C 5JPNA 2FHCA 3MREA 4GRLA 1OWRM 3H3KA 1S9YA 3O8XA 4DWHA 1CXKA 4IEFB 2HTLC 3B2UD 1II4E 5KN5B 1GZPA 4LVHB 5E00B 3D0VB 1JE6A 3K8KA 3K7UA 5CP7A 3VE0B 4FQLL 1T2XA 3HZKB 4Q9RL 4WU5A 5HI3C 4XNUH 4F15B 4S2SB 4RCAA 1OP3H 5I1HH 2DYPB 4Z7NF 3LH2H 4Y5VA 4FQ2H 5BO1L 3QEHA 5KS9F 2GUOB 2DD8H 2QLVB 3GBLA 4LGSB 4XPTL 4Y1AD 1NDMA 4MNQE 2VISA 3FB6A 3ZKND 2CMRL 1NDGA 3FQTA 2EEAA 5F7KC 4QRSB 3WS3B 2HFGL 1TPXC 2R56L 3L3KA 4LLWB 1QG3A 2QQNL 3QFDB 4ZYKB 4Y4FB 5TDNA 5IFHH 3STZA 4ZQKA 3HPJA 4PJ7E 4NO3A 2E7LA 5E8DH 2FR4A 3BN3B 4XPAL 5KG9A 1YMHB 1F4WH 4PJGF 3RDTC 3QHZH 2Z92B 2YKLL 4JO1H 2B1AH 3H9SE 3MO1A 1FPTH 4PRHE 2XOTA 3HNVL 5FYJH 4RWHA 5GGTA 4IMKC 2V2XA 3JXAA 3KYMB 4YHZH 3ZKXB 3GSOA 3IRZA 3MLPA 4FZEL 1RURL 1OGTA 1MFCH 1ZWIB 4M7JH 4D9RD 3THMH 3QXVA 3CH1B 1OVZA 4JRXD 3DVGB 4UUJA 1G1YA 4ONFH 4S1SH 2WUCL 3VGAC 1VFOA 3RWJB 4HH8A 4BSJA 3L3HB 4I77H 4AEHH 4F33A 4S10A 5F7YC 2WSKA 3ULUC 4MXWH 1UA6H 1P6FA 4KDVA 2DOCA 4L4JA 5I16A 1AQDB 1U41A 3NCYS 5GRYA 1R5IA 3MLWL 5EIIB 3QZWB 3WHE0 5FGBC 1F2QA 3DV4B 3FT2A 3VDBA 4ZTPL 4JFEA 4UMGA 5GRZA 5EU7C 1ZGLA 5DJ2A 4WI9A 5EUOF 2WINA 1I8LC 1PAMA 3QDME 4H25B 1MRFH 5JW3H 1W8OA 3GSWA 3NN8B 3K81A 3T0EA 4R2GC 3BGFB 2PO6D 3LVEA 1OSZB 4EIGB 1JUFB 1PKOA 2HFTA 5DSCA 4N0UA 4RISL 3S3SA 3QQ3B 2HRPH 3D3VD 1CS6A 4TSBH 3OKLB 1S9KC 5MEPA 4D0DA 2VXVL 1H3UA 1UM4L 4YC2C 5AUMB 5JORB 4LCYA 4HKBA 3KYNA 1E6JH 3EYSH 5JOFA 5ETUA 1M71B 4OFYD 1KPUA 4U6HA 5JIKA 3RWDB 4HJ0D 2C3WA 3RTQB 4PUBH 2VWEC 3VWJA 2FH8A 2QBWA 2YPLA 2FECI 5GRUL 3BPNC 1FL3B 1XF5A 4PJEE 2XTJE 1T0MB 4CDGC 4KVNH 1KV3A 3MOBH 1R3IH 2CIIB 1PKQB 3HE6B 4TUOA 2YZ8A 4DGIL 5JHDD 4KZDL 4LSDA 3TVMA 4EOWH 3BOVA 2H26A 3QXDB 4ZS6D 2VABA 3NFNB 4XP6L 12E8L 5MEND 4QTIH 3B83A 4LGRB 1VA9A 5ESAB 2UY6A 1NEUA 3T4AA 4PJ9C 4QRTA 1XGPA 4JPKH 1KC5L 4AK1A 5IB2A 4KTDH 4P2RE 3S96B 3INUL 2Y4SA 1MWAA 3EO1B 2BFVL 4KKLD 4YEEA 1LNUB 4YJZL 5MI0B 2OSLB 3OAYH 4G6ML 2VOTA 2FEDC 2EH7L 4Z7UF 4X9HA 4R4NC 3O0RH 5GGQH 4ZFZA 5F3HB 2VL5B 1TLKA 4B7LA 4KI5D 4I3GA 4HUWB 2ED9A 1ZT1B 1SJXA 5EA0L 3HMWH 1UACH 1MQ8A 3AFLA 4BSVA 3BPLB 1A6VL 1K8DB 1F3RB 5HHVH 3DARA 4XNYL 5GGRY 4C59B 5I17A 1GPOL 3M45A 2JB5L 3VG9B 3JZ7A 4LPVA 3ARFB 4LSTL 3ARGB 5EOTA 2KQMA 3I3BA 4YXHH 4FOMA 4L1HA 4J3VA 2OR8A 4DOHB 4GKNB 3C08H 3WHXB 3HNTL 5DRWA 2MTPA 3B5TA 4POYA 3CSGA 4HK0B 4U4BA 1IE5A 1JN6A 4PJFA 4BELD 1OTUD 2LV4A 1FYTD 5IOPA 4HMDA 3ARYA 2VLRE 3OPZH 4MJIE 2P49B 4GJTB 1GGBL 4U1MA 5DFVD 4TRPL 1B9ZA 1B0GA 4FS0A 5CBEB 1G7LB 3ZDZF 2R2CA 4K7PX 4LLYB 3RGVA 1FL6A 4FQLH 1AH1A 5JQ6L 2XZZA 2ARWA 4WI8A 2Z93B 1CIDA 1QLRB 4Q9RH 4U7MA 1MCLA 2ZUYA 5IVXA 4XP1L 3IYLW 1AGEB 3AS1A 2NY0C 5IJVA 3P9MA 1GL4B 2MKWA 1NUGA 2VE6B 1UWEL 1OQXA 4ZUWB 1WBYA 4QXUH 5HI5C 4XPTH 4XHJD 1EEYB 5IQ7L 2HFGH 2Q8AH 4GKSA 4QRPD 2QQNH 2BVPA 4Z0XA 3UTQA 1EEQA 4XPAH 3PP3H 1GGCL 1HILB 4KFZC 2ICES 4ZUSB 2YKLH 4ELKB 5IIEA 4PD4K 3MJ9L 3HNVH 2XNAA 1FFQA 2FCBA 3FT3B 3EBAA 1DQLL 4M43L 4U6YA 2R15A 2IPTL 4FZEH 1RURH 4M4RA 1KCUL 2YUWA 2VIRA 5C9JA 4NN6C 1TCRB 3U30B 1I1AC 2WUCH 1BMGA 2DF3A 2HVKB 3VFPB 5CD3B 3KYOB 4ZPTB 1S5HB 1T7YA 1V05A 3MV9E 3TNNB 2R0ZL 3BZFA 5F9AC 5HDQL 4N0CC 4JKLA 4WFHE 3P2TA 4H26A 2A73B 3UROR 1FNLA 1I8MA 1ONQB 3MLWH 4TUJB 4HKXB 4GRMB 3OKKB 4WW2C 4OZHB 4XNQB 1T1YB 5EBMA 5A43C 2P46B 2KKQA 2WW8A 4ZTPH 3W5NA 3MR9A 2EKJA 3G04B 5L2JB 5EC1B 3DMMD 3LPWA 4C54A 3AREB 3DSNA 5T1LB 1WC7A 4HIEB 4PJXE 1A4JA 5KSAD 3VWKA 4RISH 4E0RB 3EO0A 1ZA3B 1MAJA 2WBJA 4OF0A 3IDJB 4PP1D 2FIKB 3RZCB 3BZEB 4FQCL 1DBAL 5IVZA 3S5LA 3HAEA 4NBZB 5D7LE 4WDIA 2HJLB 2VXVH 1AGFA 5IROA 1UM4H 1OLLA 2VN7A 3NIDF 5EZJA 4MS8C 3ILPB 3OKEA 3QA3A 5ANME 1CWVA 4JKKA 4QWWC 1FO0B 2CUHA 5TPWL 4RFEB 1G7QA 1W0YT 4RWYH 1IRAY 4M9OA 5KVMC 5CJBA 5E4EB 4LVHC 5CEXB 1ZSDB 1S7TA 4OCYL 3UPCA 3V4VH 4Z78B 3QAZB 3CMGA 2ZCLH 3H42L 4KRPD 5INCB 4HGWB 1U9KA 2IGFL 4ZUTA 1KCRL 5I0DA 5D5MB 1PFCA 5GS0C 2C1OA 1KELL 3DX7A 5F7EL 3DO7B 4DGIH 2E7CA 4EN3A 3LOWA 4ZFGL 5BV7B 4NQVB 4HV8A 4F15C 1NKRA 1EGJH 2F54E 4X0KA 2BC4A 4FHBD 2R9HD 5JO5B 3PNWB 4GKZB 1P9MC 12E8H 3PWPA 4XP6H 4EJ1C 1Y18B 3PWVA 3BISA 3RUGB 1YEGL 2A77L 1LK2A 3MMEA 1FFOA 3MNVB 3U1SL 4KJWC 5SWZB 1DEDA 1KC5H 3WN5B 2QJDA 4NNXA 4LFHD 1J0HA 3CSYA 4J4PC 4MZ2A 4EXKA 4Q6YA 3BO8A 1XR9A 3N9GL 4Y4FC 2BFVH 2V2WB 3MRJB 2X4OB 4G6MH 2EH7H 5C0CD 5TF0A 3C2AL 1IEBA 5DMYA 2AXJA 1N7MH 4L5FL 3DGGA 1JGEB 3WIIL 5EA0H 3JV4B 3HRZA 2VAJA 4F58L 5FM8A 1CU4L 1A6VH 3IF1A 4L3EE 3WKML 3KPQB 4K23L 3ZKXC 3ULSA 4XNYH 3LRSA 1GPOH 1NANH 5DVNA 5BZWB 2JB5H 4V2BA 1NC4D 4LSTH 4QRRD 3W2DL 3P9LA 3OR6A 1T89C 4OCWL 4LKCA 5FGRA 3QUYA 3HNTH 4W6YB 5DHYB 1KNOA 2AQ2A 2F5AL 5DZNA 1A6AB 5KS9A 2HT4C 2HLFD 2LTQB 3UZQA 4B50A 4P4KD 3HG1B 1YEIL 3Q5YA 3HB3D 3VXRA 1A9BB 1CLCA 5IG7B 2DKMA 5KZCD 1GGBH 1JF6A 1YY9D 4TRPH 1QSED 3BH8B 1K85A 3RWFB 1RUKL 5I0ZA 4MYWB 4PJGA 1XH3B 2O26U 3JWDC 4NHUA 4ZUVA 1WCQA 3KXFB 1HSAA 1G6RH 4PGDA 3BGFC 2AP2A 1WWWX 5JQ6H 1LO4L 2OMBA 1NANI 1HQ4A 4XP1H 5JOPE 1XT5A 3VFRA 2C4XA 5JLZA 5LGHL 2YD6A 1UWEH 5D6CA 4D0BA 2XRAL 3VXNB 5IQ7H 1QSFD 5F89B 1BD2B 3RTQC 4ZG1A 4GQ9L 4X6CE 3BMWA 2RCSL 4HMCA 3QHFL 1GGCH 4P2OD 2F9BT 5J6HB 2WWKT 1OB1A 3C5ZD 3OL2A 4GRLB 3HE6C 4NRYA 3MJ9H 3TN0C 5I76B 3BZ4B 2E8YA 5EUOA 2IBZY 3HI6L 4X7FC 1EEZA 1DQLH 4M43H 4ZAKD 1IGTB 2IPTH 3LEYL 1GZPB 1YUHB 2PUQT 3UJIL 2Y5TB 1J0KA 1KCUH 4J7RA 4WTZG 9CGTA 1BFSA 2G9HA 1OAUL 5C0AE 5JA9A 3DGCR 4GOSA 3DETC 2R0LL 4XVJL 2H32B 4Y88A 4RMUA 4AENA 2PXYC 3ALWA 4A2LA 2DQCL 5HDQH 2X4TB 3P4NA 5EBWB 1DQML 2V6HA 1NUNB 2R0WL 2P8LB 4HWBA 5MI0C 3RP1A 4S1QL 2XG4A 5AYUH 3HC0B 1CICA 2Q6WA 1UCBL 3F7VA 3PDOA 2O93L 5H2BA 1OF2A 4EQ3A 4AIZB 3BPLC 3TCXA 4CN6A 1KXTB 4OI9A 4ZQKB 3DVIA 3KPRB 2FRGP 4F2MB 3ZSSA 4LSUL 4P9HC 4TULL 1RK1A 3OR7A 5CIPB 5TFSL 4DAGL 3SEPA 3VG9C 4WI7A 2X4RA 3MO1B 5DRNA 5SWSB 4F57L 3CX5K 4WWKA 5DTFB 3X14A 3ARGC 4OF8A 1A5FL 4DGVL 3C6LB 3ROLB 2NTSP 1D5ZB 1LDSA 1DQJA 4HULB 1BGXH 4X6BA 3OKOB 2AERT 1N6UA 3GSOB 1MCBA 3O3AB 5EBLB 5D2NE 1U58A 3S3JA 1BX2A 4ZFOL 4Z9KB 2BCKA 5TPWH 4C83B 1R3JA 1KENL 5KOVC 2YWZA 4OCYH 1NPUA 4FG6C 4X5WB 4Z7UA 5I16B 3H42H 4GW4B 5E6ID 2IGFH 1MCKA 3KPSE 2G60L 5F21B 3SGKC 1KELH 5F7EH 4LPTA 3SDDB 1FE8L 4HS8H 4ZFGH 4WO4B 4YHML 3TBYB 3EYQD 4B0MM 1OSPL 2R4SL 2WINB 2CIKA 1I85C 3A6OA 1BM3L 4MLIA 1BECA 3EHBD 3D39A 3ULVE 2A77H 2P45B 3T0EB 1AD0B 3CXHJ 3RIFF 4UQ2B 1J12A 5C0IA 4L9LA 1H3GA 2BXYA 5F1OB 3PGDA 4OFPA 1H5BA 1G9EA 5C0ND 4UDUB 3N9GH 2GITB 3N1QC 3B4NA 1FLRL 5MEPB 1GC1C 1VFUA 5DUPL 3M07A 5EIVA 3C2AH 2XY2A 4R7DA 3ULUE 2E9BA 4UU9B 5I8OL 4G8GD 4L5FH 5JOFB 5ETUB 3WIIH 4U6HB 2H9GB 1EXUA 4XBEL 1CU4H 2AJSL 4KKBC 1RIVL 3WKMH 3VXUA 2ICWI 1X5GA 4K23H 4LQ1A 4DKAA 3LKNB 4FTVD 1XF5B 4QHMB 4ISVA 4DKEL 3U30C 4QCIA 3W0WB 5E2JA 3DUSA 4OCWH 3V6ZB 3VFSB 4Z7VB 3D18A 3QIWB 3PL6B 5ESVB 1FNEA 4PJAA 2F5AH 3IFNL 4OI8A 3IT8D 3WMSA 5IHLB 2YD7A 2A6KA 3L5WA 4OUOA 4GBXA 3MRMA 4QRTB 2GKIA 1YEIH 3MJ6A 1AHWA 2YA1A 5IB2B 2I07B 1YMMD 4G6JL 4KK5C 3TH2T 1RUKH 4FFYL 3LKQA 1JIBA 3AREC 5A16A 3O2DL 5CFHA 3H7LA 5J9PA 3T77A 5H37H 4ZFZB 1LO4H 1NAMB 2UVEA 3CMOL 5CSGA 2EDKA 3RBGA 4R4BB 4M1GL 4WUUD 3D9AH 3FRPA 3RZCC 1INQA 4PLJD 3F58L 4Q7DA 5AZEL 5LGHH 3JUZA 4Y2DB 1BIHA 3V0WL 3WIFB 4X5LA 1O7VA 2VTFA 3D2UD 3WL9B 2XRAH 1JGDB 1DLHB 1ZLSL 3IJHB 1KIRA 1N5AA 4OTXL 5EOTB 2BDNH 3DBXA 3VXQB 4GQ9H 3UDWC 1SJHB 3KAAA 3PWLB 4X7SL 3R0MA 4OZIF 3KPLA 5E4EC 1DVFB 5DRWB 2RCSH 3QHFH 3QAZC 1T7XA 2HTKC 2P7TB 5DD3L 3ULVL 1JN6B 3B8YA 2DKUA 1U8KB 4NP4L 4X6DB 4ZNCD 2WQ8A 4RMQA 5CSBA 4NKIH 3HI6H 5ESQA 3NCFB 5BV7C 1J0IA 3TBVA 5I74C 3VFMA 3LEYH 4A2MA 2NX5D 2P8MB 4Z7QF 3UJIH 3JTSA 3QPXL 4HHAA 3E2HB 1OAUH 3GJFA 4LSRL 2R0LH 4XVJH 4LMQI 1ORQB 3ULUL 3N1MC 1D5BB 2M8XA 1XGTB 3WN5C 4RIRA 1I7UA 4J12A 3RWEB 2DQCH 4NZRL 4GH7B 5IJVB 1DQMH 4KMQA 5FM5M 4AM0B 3HTLX 2R0WH 2VITA 5ICXA 1JL8A 3S8WA 5E1AB 1JNNL 4S1QH 2XKNB 3O3EB 1AR2A 1UCBH 5GGSB 2VQ1A 3MYJB 2Z31A 3FCTA 1F00I 3BIBX 5IKCB 3V5HA 3HLAB 5I18L 3RVVC 4LSUH 1YN7A 3GMNA 4TULH 3GMPB 5GJTL 3UTQB 5C2UB 1NGZB 5TFSH 4DAGH 2XV6B 3I75A 4Q2ZA 1ZLWK 2PTTB 4F57H 1G7HA 1A5FH 4DGVH 2VLKE 3QISA 4WFEE 4H1LH 4U6YB 1NEZG 4NQED 1IAIL 2NY2D 5FOJA 4P3DB 1ZLUK 1J8HA 3GI8L 2VIRB 5C0DB 1VADB 4C56D 1CG9B 3UBXA 1P7QB 5HYIA 4PJHB 3AY4A 2LTQC 1ZKAA 2B5IB 1EEUA 2OLDA 2Y6SD 4ELMB 5I8EA 4LOUD 4PRPA 3T8XA 2GTZA 2Z91B 3F12B 4H0HB 1MCHA 1QRND 3FOMA 1CXLA 3RWCA 4Z7WB 5E9DB 3H9HA 4OGAC 1JZ5A 2F58H 4H26B 4KK8D 2AV7B 5GSRA 1L4IA 3ALPA 5FGSA 1EO8H 2G60H 1TXKA 5C9KA 4NWTL 5EBMB 4P23D 25C8L 4PJ7F 4U3XA 4JZJA 3IU3A 4W4OA 1FE8H 4NT6B 4QOKD 1DDHB 4RX4A 5HHPA 1M6OA 4YHMH 1IC4L 1OSPH 1X6LA 3SE4A 4L8CA 5I1LA 1BM3H 3S6CA 2X2YA 3RNQB 4UOJA 4IJ3B 1NC2A 2AEIT 4NQCE 1MI5A 4M5YH 1EIBA 4HDIA 4FP8L 1DE4A 3VWKB 3EIFA 1HNFA 1KEGL 4UQ3A 4G9DA 1HEZA 1S9VA 4R2GD 1FLRH 2FNBA 3GSQA 5DUPH 3GUTA 1AGFB 4MNHA 4LLUB 4CRPA 3L3GA 1GVIA 1RZJC 4GXUM 3QA3B 3OHXA 3SN6N 1HHJB 2FBJL 4NKOA 4XBEH 1G7QB 2H2SD 3EJYD 3GEWB 4PRIA 4U3CA 4CKVX 2XG5A 1JWMA 4JJ5B 1YJDC 4OGZA 5TQ2L 1PG7L 4WFFE 4DKEH 4ZUTB 1QPXA 2I25N 4YHPB 5I75B 2PYFB 4X7DC 3X11B 3MACL 4RA0C 3GMRA 1FG2B 3HZYB 8CGTA 2AEQH 2DIBA 5GGUA 4X99B 3RWHB 3IFNH 1ZANL 5FEBA 1T20A 3GSNB 2WP3T 4LCIL 2CLZB 5MHSD 1MHCA 4OJFL 3E0GA 2X4QB 2X4NB 5HHXL 3UTTE 1OAQL 5GS1A 3FFCA 5K9QG 2FHFA 4W68A 1MHEB 4Z6AT 3CSYB 4JPVH 5CJOL 2FO1A 1E28A 1XR9B 1NGYA 3A6CL 1TZHA 3SE3A 3AS0A 4FFYH 3SQOL 2FJFB 2KZWA 3EGSB 3MRHA 43CAB 3PHOB 4PJ9D 1EAJA 1JPST 3FOLA 2CQVA 2XN9A 3CMOH 3KPTA 4QTHB 2QQQA 1ZHNA 4PJEF 4P46D 4Z95L 4M1GH 1KXQE 3C6LC 3WJLA 3ZE1E 2FEDD 5T1KD 5AZEH 3V0WH 1NCUA 4LHJB 3MV7B 3LRSB 4ZUUA 6CGTA 3RAJL 3TT1L 3BQUA 1EZVY 1ZLSH 3UYOD 1Q9WB 1E6OL 2GCYB 4G9FA 1A6PA 4OTXH 3OR6B 1U3YA 3GIVB 5FHBH 1YC8A 2O5XH 2VDQL 4AIXA 2GJZA 5DEZA 5HYQB 2WWMC 3QUKB 3KPPB 2IAMA 4X7SH 3UCRA 3QUYB 1RVFL 1UQSB 5DD3H 3WLBA 5DJAB 3ULVH 4IMLB 4LCCB 4NP4H 3RRQA 3LRHA 2V5TA 3TZVD 4PJ5A 3SDDC 4WWID 1HH9A 4WO4C 1HXYA 4YDKL 3QPXH 3SDAA 2BVYA 1LO0L 4I0PB 1AXIB 2F53D 2BNQA 2D0FA 4DVBA 5EC2A 5EO1A 5IEHA 4LSRH 1HSAB 3MTRA 2JB6B 3BH9A 4Y16A 3ULUH 3LCYA 5HGGS 5F1IB 1A7BA 4I18A 4NQDA 2IPUG 3VRIB 4YX2L 1TJIL 4NZRH 4OLVH 3VFRB 4RMVA 4LHQB 1EFXA 5E8PA 1MREL 1MIML 2F8OA 1ERNA 1JNNH 4QGYA 3DRTB 4HUNB 4D0BB 1BIIA 3RKDD 1NEZB 3MLYL 2ADGA 4PR5A 5F7UA 3QRFM 1LO5B 2NY0D 3MROA 3U46B 1RHHB 1JWUA 1Z2KA 3BPOB 1RI8A 2XI9A 5I18H 4PGCB 5F93C 1L7IL 5GJTH 5IMKA 3AS3A 1T83A 3CFKB 3O3DA 1CIUA 1ZT7A 2QQLL 1AC0A 1ZHKA 5C0BB 3DSFH 1X9QA 5GIRA 3F5WA 2P5WD 3GRWL 5DMKA 3ZTNL 4ETQA 3QIWC 1BFVL 3U0PB 4LU5L 1IGJB 1IAIH 1Q1JL 1XIWD 3PL6C 1OHQA 1EX0A 2CRMA 1HI6A 3GI8H 1MH5B 3LQAL 1CFSB 2YRPA 5EZLB 3RY4A 1WUNT 5IBTL 2VQTA 4NC2B 5C07B 1JK8B 3H0TA 3VFUB 4L4VD 5BRZA 5FYKD 4JFDA 4IIQA 4U1KB 2BNRA 4X4ZA 3FQRA 4OSUL 4PJIA 2CXKA 4NPYA 4CGTA 4JKMA 3VXPB 3OGCB 3ARXA 4NWTH 1CICB 5CZXC 25C8H 4WFGE 1AKJB 15C8L 4LSQL 1ZHBB 4MGXA 1TIUA 1A3RL 4G6AC 2JF1A 4WI2A 1AO7A 1PKQE 1TVHA 4RDQG 1MFNA 4Y2DC 4Z76A 4XBGB 3WNMA 1TTFA 3WEXA 1IAII 4FP8H 2O61B 3CCHB 4NRXB 4D9LH 1KEGH 3MBED 5I71B 4C4KT 1U95A 4XZUA 32C2B 1MLCB 3DOSA 3QJHA 2JIXD 4X6BB 1DVFC 3BMVA 1EDQA 5CJQL 5L2KA 2ILLA 3L3DA 3ARSA 1QLEL 1U58B 3RX7A 3W81A 5KSUA 3VFNA 2BCKB 4QT5A 1MCWW 2FBJH 5J7CC 3L7FA 1U8NA 3C9NA 1W0WA 3VFGH 3M17A 4U7KA 5B39A 2DQEL 2R2BA 4G6FD 3WXVL 4PJ8D 3E2HC 1FIEA 1PG7H 2P24B 2Q87A 4QWWD 5SX4H 3WE6A 1RZGB 2PO6A 4K3HA 1BVLB 5MERB 3VFVA 2CDGA 3HPLB 4PJXF 1P5UA 3MGOB 2Y25A 4JFYB 1ZANH 5EU6B 1RZ7L 5GS0D 4OGXL 4LCIH 5L8JB 4KU1A 4OJFH 1XZ0A 4DOHE 4KUCF 4LNVA 5HHXH 1OAQH 5DR5H 3M1BB 3T3ME 2KL6A 3QDGB 3JWDL 1H5BB 4OFYA 5CJOH 1A0QL 5IJKA 1U3JA 1WBXA 4P57A 3A6CH 4XPBL 1UVQA 3QO0A 3T1WA 1WZLA 4JHZA 3QFJE 5B8CC 3S35X 3BYTA 4KJWD 5ERWA 3GKWL 4J4PD 3U2SB 2BVOA 2DQFB 4Z95H 2BHYA 3FQWA 4DQOL 1YPZA 4BUGA 1N59B 5JHDA 3DX6A 3N85L 1YEHH 5ADPL 3CXHK 3REWA 1JP5A 5CHNB 4U7SA 2CKBB 3RAJH 5MENA 4Z0BL 3TT1H 4ISVB 4K7FB 3B2VL 2W59A 1E6OH 1UKQA 1JNHB 2B5IC 4NNYB 5CLTA 1O5DT 1DN0A 5EWIL 3BESR 1BF8A 2JCCA 1U8LB 4BQCA 5IBLC 1CD1B 4OFKA 4EKXA 5DJCB 4J3UA 3L5WB 3TO4B 4MA8L 1CFVL 4PPTA 1KLGA 4DCQA 4YDKH 4NYLB 4DKDC 2UYLB 2HT4D 1T5WA 3DROB 4PTUA 1LO0H 2E7BA 3JWNC 3SE8L 4IJ3C 1S8DA 2EIBA 1S7VA 3LKSB 3LIZL 3B3IA 3Q6FA 4FQIL 5J9PB 1KTDB 2CUMA 2PW1B 2B7DT 1TTGA 1TJIH 3B9KA 4YX2H 5J6GA 1W0VA 3QNXA 3JV6A 1ZOXA 3O6KL 1MREH 4IOFC 1MIMH 1MCIA 3I6KA 1CL7L 3RY6A 5DD6A 2PCPB 1HSBB 3VGHA 1V8HA 3MLYH 4PB9L 3DURB 5HY9B 2FSEA 1N5AB 4P9HL 4RA3A 4MNQA 4OZHE 1L7IH 4FXKA 3KPLB 3TC9A 5BZDA 5IWLA 4K9EH 4PJ7A 3QG6A 3E6HA 2IBZX 5DI8A 4AEIL 2QQLH 5I75C 4OGYL 4DVRL 4PRDB 1F4YL 3IDIA 3GRWH 4EUPB 1UB6A 5GHWL 5ESQB 1JZ6A 3ZTNH 2K9UA 4HCRL 4OZ4A 1SHMA 5J12B 5EO9A 1BFVH 3LPFA 1Q1JH 4LU5H 5I2IA 3JTSB 2A9ML 2NZIA 2WNGA 4EI5A 1CI5A 2PF6A 3LQAH 5GSVB 3TN0D 2ARJQ 5IBTH 1T6WA 2EYTA 2EDHA 3P3YA 1WIPA 1WZMA 1FCGA 4RIRB 2AJZB 5E94A 4KHXL 1JPSL 2AJYL 5C0GA 3WIHL 1I3RA 1WIUA 2PXYD 2NPLX 3H9SD 4IM8A 4X6CF 3D85A 15C8H 2DTML 2BERA 2Z31B 5DJ6A 5D1XB 2C7UB 1A3RH 4HKJA 2VR4A 2YUXA 3QP3A 3KG5A 1QFUL 1F4HA 4KKCC 3VD3A 1QBAA 1XAUA 1X3DA 4HBQA 5GGRA 3L7EB 3DIFB 2FL5B 4HFWA 1QSZA 4MD4B 2EIZA 3O6FD 4PLOB 2ZP0T 4N1HB 3FN0L 1CGUA 1KJVA 2CDEA 4RRPA 1BLNB 5GS3A 5CJQH 1XCTB 3WUWG 5SWZE 4OKDA 3EYUL 1QLEH 3GHBL 3ARGD 4LCCC 4WHTB 1S7RA 3ZZ1A 4QRUA 3STLB 4PRAA 1SEQL 3QDMD 2XZAL 5ELIA 3NZ8B 1LP9A 2GTZB 3QIUC 4BM7A 3H8NA 3RWCB 4AIOA 2DQEH 3DMMA 3WXVH 1QVOB 4I0PC 2ZUWA 1VFAA 2DLIA 2LE9A 2LU3A 3K4ZA 4PJEA 3X3FL 5ID1B 3RWGA 1AP2B 3QUZD 1QHPA 2IPKA 1N8ZA 1IM9D 4YUEL 2HLAB 2R2EA 3DVFA 3T09A 4MVBC 1OCWL 4G6KH 4XMKL 3ARDA 1RZ7H 2K7PA 4OGXH 1B0RA 1P69B 5JNYB 1UFUA 3MRLB 1JMZA 2AQ3A 4Y4HA 1B3JA 3G5VA 1FGNL 2XWTA 1A0QH 4D2NA 3MJ9A 3NA9L 3BPOC 1BOGB 4XPBH 1HHGA 4OV5B 2Z35A 4OZFB 4P2RA 3PV6B 5E8EA 2EO9A 3GKWH 3MGTA 4UOW0 4MNHB 3HG1E 3EJZD 5K9QI 3PABA 4GW5B 4OCMC 3L3GB 2MOVA 5E5MA 1IKNC 1G6VK 3OHXB 4GXUN 3OKMA 4NOBA 5I1JL 4DQOH 1T03L 3KXFE 3N85H 5ADPH 3I85A 3UJTL 1DBJL 4OUUB 1JWMB 4DZ8A 1FO0L 4Z0BH 3B2VH 1ZS8A 2VDML 1WT5A 1T7WA 2AS5M 5FM5O 3ULVF 3GMLA 4JB9H 1CGSL 5EWIH 3MRNB 4F80A 1T20B 3VFOA 1DBBL 5C0CA 3TA3B 5B21A 4O5LH 3SDXB 4NM8L 1E4KA 1UEYA 4MA8H 1CFVH 4FQHA 4GG6B 5JXEA 2KZ1B 2P8PA 4G42A 3IGAA 3ULUF 4FFWC 4MD5A 1E28B 1NGYB 3JVGC 3SE8H 5HHQA 1RJZB 3QXAA 4JY5L 4MJIA 1HYRC 2IJ0C 3C6SB 3QPQC 3G6DL 4FQIH 4ZNEE 4OCSL 1T0NB 4F9LC 3ROOA 1T22A 5HVFB 4HIIA 5I71C 3S97C 2VAAA 3SJVA 3U82B 4YNYA 5T1LD 3O6KH 4MAUL 5T5NG 5ACLA 4P2QD 1MCRA 1PSKL 4MX7B 5HVHB 1MPAL 1CL7H 1U36A 2P1YA 3MLTA 2V9RA 2RGSA 4MA1B 1RUML 4ZUUB 1A1NA 4PB9H 3QXWA 3RZCD 1TJGL 4P9HH 1N6QL 5K9OB 2CO6B 4P4KA 4NRZA 2GJZB 1XCQA 5HJ3A 4JM4L 2A2QT 2LFGA 5E4IA 5E0QA 5IQ9A 4AEIH 4OGYH 4DVRH 3KPRE 4FQXD 5HGHB 4YWGL 5HDLA 1F4YH 1ZT4A 4IS6A 1HH9B 3P0VL 2XPGA 4U6VL 3MV8B 1LK3L 4YDLB 5F71A 5GHWH 2V5RA 3IFPB 3FONA 2X7LB 2OK0L 5SWSE 2A9MH 3V5KA 4YAQB 2HA1A 4XI5C 3U36A 4G8EB 1JV5A 1CL7I 3PJSB 3NOIA 4OCRH 1XGUB 1JPSH 1ODAA 2AJYH 3WIHH 3V79C 3MV9A 3FQNB 1NSNH 1K8IA 1BIIB 5ACZA 1VKXB 5B4MD 2DTMH 3DYMA 1LMKA 4JQIL 3IDMA 1U8MB 4PJDA 1QFUH 2IPUK 3QNZA 3BEWB 4Z5RA 5IMKB 1XF4A 4TSAH 2IADB 3KJ4B 3NFPA 1WK0A 2DJ4A 5A2IH 1I7TB 5F96L 3RVVD 3FN0H 3L5IA 2GJJA 3F5WB 4WFHD 3T0EE 2EXYC 3AROA 5DMKB 5LGJB 3FQUB 4YHKL 1KLUA 4N0UE 5B38A 4FABL 1U93A 3RGHA 2R0KL 3GHBH 1HI6B 5D7LA 4KRNA 1SEBA 1P2CA 2R1YA 4F7CA 1IC1A 4Y1AB 3TO4C 3IAGC 5FK9A 4M61B 1SEQH 1YJDL 2XZAH 1KN2L 3FO9B 3VGDA 4LAQL 4HGKC 2H2PD 3LAFA 3ARPA 1OPGL 2DL2A 1QEWA 3G9VA 2F15A 3H9ZA 3RQ3A 4LF3B 4EI6A 3X3FH 5DQ9B 2DI8A 1IL1A 3PV7A 4JZOA 4DEPC 4NKQB 1J11A 4XPFL 2BRRL 3ALXA 3LHPL 4QHLB 1TVBA 5D2LB 4YUEH 1OCWH 4XMKH 4P5TD 1JRHI 3ELAT 5DRZB 1SY6L 3W0WE 1TVHB 3BP6A 2F54A 4XCYA 3OJDB 3VU2A 1HYSD 4F8QA 4OCXL 1JJUA 5ICZA 1WQVT 4JRXB 5C0RL 4HF5L 1FGNH 4GW1A 2VXTH 2DLHA 3OB8A 2UY7A 1EUTA 3NA9H 3PF2A 5DJYB 2EZ0D 2AXGB 3MUHL 1OAYL 3WJJC 4EBQL 4L8SA 2WQRA 2PKDA 1MY5A 3NH7L 5A2FA 2GTWA 5IESL 4MXQC 1BD2D 4HWNA 5KSUB 3PWNB 1DLFL 4DZBA 2HMID 1PYWB 5I1JH 1T03H 2AW2A 1U8NB 4UINL 5AD0A 2L7JA 3UJTH 4D0CA 1W72H 5J12C 4KUZL 1DBJH 3V6FA 2E5EA 4YFLI 1ZVHA 1FO0H 1FH5L 1GOFA 3HC3L 5IMMA 5D7JD 3B5HA 2PO6B 1RV6X 4ZOBA 1QR4A 2A83B 4NZJA 3MGAA 3D3VB 4WHYG 2J8UA 3BKML 1FRGL 5C3LD 5KAQG 1BAFL 1MFDL 4X4YA 5IUSA 3U0WL 5GS2D 3IAQA 1DBBH 4O00A 3MRRB 2W1NA 1WBZA 2ZSWB 2YD1A 4NM8H 5K9JL 4G8GA 3KNBA 2IF7A 5D1XC 4HIJB 5C08B 3AC0A 4HS6A 1INEH 2IBBA 4X6DE 1JHKL 3QO0B 3RL2B 4JY5H 1JHLL 3CSPA 4WW2F 3G6DH 3MLSL 4OCSH 5H94B 1HINL 4XXDA 3KLAA 1L6XA 4ZFOA 1DTUA 1MSPA 2DJUA 1B90A 5JHDB 1Z5LA 3S4SG 4MAUH 4QF1B 3SPVA 3DVNB 2DLFL 1MPAH 3REWB 3B8SA 2Q7YA 3VH8B 4GAGH 5MENB 5IVXE 1JZ4A 3ARWA 1TJGH 4ZOCA 3IDGB 4DN4H 1N6QH 4ZDHB 1FFNB 1R3KA 5DRXB 3LDBB 4TN9A 5DJDA 4JM4H 2ZCKL 1WWAX 2YEZA 2FZ3A 2JCCB 3BEVA 3DXAD 3A6BL 3WSQL 5D7SL 2Q76B 1U8OA 4PP2B 4D8PB 4AT6B 4YWGH 2VYRE 5D1QA 3P0VH 4U6VH 1BZQK 1LK3H 3L5HA 3TV3L 2VZUA 1KEML 2OK0H 2JJUA 4PLKC 4XRCB 4YHIA 5FKAA 3BFOA 5JW5A 3DHJA 1MAML 2GSIB 3ZE1F 1ZLWH 1AGDA 4PTTA 4LFHG 3GDBA 5DGRA 3HUJB 1E4JA 1MWAL 1HXMB 4KQ4H 5I30L 3OF6A 4PJHE 5DYOA 2EH8H 4LLQA 1NAML 1X5XA 2VZ3A 1ZLUH 4K55A 1P7KA 3MPCA 5KW9L 2EE2A 2X6MA 2Q86A 2O5YH 3O6LL 4JQVC 4Z7WE 3GMOB 1FYTB 1JWSA 4JQIH 5D7IB 4F7MA 3ZTJH 2ADIB 1G9NC 4XP9L 4MQTB 2D31A 4C55A 3VGBA 4UV7L 4EEEA 3O41B 1WISA 5C0AD 2VLJA 2L0DA 2Q3AA 2XA8L 1CLYL 3GGWB 1GGIL 4ZXBD 5F96H 3MCG1 4LP5A 3GK8L 4Y5YB 4B53A 5C0FA 5I66B 4OZ4B 1NFIA 4YGVB 4ODXB 1P4LB 4FABH 4U1JA 2R0KH 1PW3A 1J88A 2BSRA 3O2WL 3TA3C 3O2DA 2EYTB 4O2FA 5T5FL 1RMFL 3O9WD 1U8QA 3Q6GL 1X4YA 1YJDH 5INDA 1KN2H 3VXTA 4JRYA 4LAQH 4QRPB 4QHUB 2FX7L 1OPGH 3ZKSD 4BH7A 1UJ3B 3W5MA 3RHWK 1TVDA 1M05B 4FQPA 1JMXA 3QWOB 2Y9RT 4XPFH 1YN6B 3KPSA 3LHPH 3OB0K 2OI9B 2DIAA 1MCFA 5HPMB 3MRQB 1F5WA 1NBZA 3RDTA 2IAND 3MRDA 5CZXD 5FO8B 3IFOB 5HVHC 4ENEC 1HHKA 2HN7A 1TMCB 4MA1C 1QO3A 4OCXH 4OIIL 4R7NA 3SGDH 3ZT7A 1GCFA 3EDEA 4C56A 5C0RH 4HF5H 4IMKA 3PWPE 3HR6A 5CIPH 3O11A 3KPNA 5DUBB 1ZLVK 3K2MC 1S9WA 5GRJL 3BDYL 4N0RA 1VFMA 3CD4A 3VG0L 4EBQH 1IFHL 3NH7H 5F9OL 1XGRA 5IESH 1D5MA 1S7RB 3TBWA 1DLFH 1J5OL 4PFEA 3S37X 3IDXH 4XP5L 5DDHA 1A6WH 4QOKA 4UINH 4PY8J 4YDLC 3DTXB 2AJXL 1LP9B 2BOBA 4KUZH 2P4AB 4GAFB 5E2VH 4I1NB 4XP4L 1FH5H 2A74A 2IQAA 1VFAB 2FLRT 1KPRB 5FGBA 3HC3H 5KSVB 4JFFB 5A40E 2COQA 1AFVL 4MWFB 5KSAB 2ZSVA 4YH6A 3RWGB 1QFOA 3SGDI 1I8LA 3MV7E 5GRWA 3O4OC 2BX5A 3MUGB 1FRGH 2CO7B 1N3NB 1BAFH 1MFDH 5BOZG 3VCLB 4KI1A 5J57B 5K9JH 1NCCL 4PGBB 4NKDA 3AAZB 2JKXA 4HH9B 4DUVA 1BFOB 1JHKH 3FFDA 1LE9A 1FVDA 4HIHA 1AI1L 1JHLH 4O2EA 3TYFA 4PG9A 3AXLA 5E8EB 5T33L 3MLSH 1KIQA 3U7WL 3W39A 3FAXA 3KJ4C 3LSOB 1HINH 2CLVA 4K3JL 4RSVA 4EVNA 2XZQL 1I7RB 4PJGE 3UC0L 3RVWC 3V0VA 5JR1L 2JK5B 1PGRB 2DLFH 1WZKA 1A3QA 3G5XA 2W07A 3AB0B 4HX1B 1YQ2A 5J13B 1H3VA 3MLRL 2VZTA 2ZOLA 5HHNB 1WTLA 2V7HA 5JPMA 3QEQB 1Y6KR 5CJXC 5FB8B 3T3MF 2ZCKH 4LHUG 2AKRA 4GXVL 3TPUA 3DLQR 5D7SH 4PJ9A 5JUEL 1QD0A 4NSKB 5FO9A 1G7MA 5TH2A 4AG4L 4HS3A 1MJJA 3MLUL 4FQHB 1YZZA 5E9DD 3TV3H 2BVTA 3GSNL 1RUPL 4CADA 2IH3B 5IBLD 5CLWA 3NFSL 5T1KA 5DEFA 4RAVB 2VDPL 1MAMH 2AV1A 4YR6B 5HDOA 1P53A 5E95B 4QRQB 3B6SA 2K3TA 3R8BB 3N1PC 3B9AA 1NC4B 4QRRB 1MWAH 1FVCA 2X42A 2ZOKA 5I30H 2VAAB 5F97E 3BD3A 1NAMH 1F97A 3L1OH 3MC0A 4JKWA 3MNWA 4LSVL 4YHYB 8FABA 5KW9H 5DVLA 3O6LH 3E1F1 1CTOA 3UTSD 1JZ2A 1N26A 1Q9KA 1F90H 3FZUC 2GFBA 4NRZB 4XP9H 3CFBA 1HHIA 4UV7H 4GRWB 5KZCB 1QSEB 2D7PA 2XA8H 1AD9A 2OTUA 1GGIH 2W0FA 3ARBC 3GK8H 1FZMB 1ND0B 1HK6A 3T2PA 1ZT4B 3KPMA 4JANA 4U0QB 3SHSA 2ICCA 5DEGA 1E4WL 5LCVL 2WMPA 1DQQB 3MJ8A 2ZUTA 2APXA 1OM3L 3ZSTA 3ZMRA 5D9SB 2VKXA 3MA7A 4Q9BA 3O2WH 3KJ6L 4LSSL 5T5FH 1FVEA 1EMTL 1RMFH 2WV3A 3Q6GH 1QFWI 5F7WC 4JFQA 1OWWA 3RU8L 1QSFB 2FX7H 1JGVL 3B9DA 4JZNB 1ORSA 5FDWB 4LCWD 4U49A 1SYSA 2Q3ZA 3RWIA 2YRZA 5DA0B 4OZHF 4NDMA 4P2OB 4MA7L 4MZ3A 5ACZB 1K6QL 3C5ZB 4R97C 4FRWA 3U9PH 2AXFA 2VLKD 4LLVB 1WITA 5IK3B 4P3WA 3DV6A 4Y4KD 2XQYK 4J1UA 2J2ZA 3PP4L 4LLDA 4ZAKB 2LU4A 4Z5RB 1AIFA 2E3VA 4DFHA 2D9CA 3BPCB 2GAZB 4K8RH 4MAYB 1MHHA 4UT7L 1VESA 5EU6E 4HZLB 4KKCD 4YEFA 5JDJA 1AQKL 4L4VA 1G7JB 4GAYB 1P4BL 4M7KL 3LN4A 2BOCA 1A6TA 35C8L 5EZIL 4WUKL 3LDBC 4URTB 5DJ8A 3BDYH 5GRJH 4HG4K 3UPRB 3VG0H 4LPCA 4TNWK 1H3XA 1IFHH 3JTTB 1H3TA 3QDGE 5F9OH 1I1AA 2AJ3B 3FJTA 4E5XA 1FNGB 5EFIB 4D9QD 4KKAC 4XP5H 1DCLA 4KI5C 4NFDA 4QY8A 1BBJB 1P4IL 1HWHB 3V7AE 4XP4H 1MUJB 3VMPA 4WW2A 1FBIL 2C4FT 2PW2B 4NQSA 3BGMA 1D5XB 3L5JA 2DQJL 1AFVH 3LN9A 2ITDA 3CPLB 1XR8A 3EFFA 3QIUD 2GJ6D 5IMLA 2AABH 4OLEA 2AJUL 4YBLC 1JI2A 4LPWA 3NCEB 1R5VB 1IARB 2IC2A 3SOBL 4KKNA 2JIXA 3RUGF 1DUZB 3DX8A 4XCYB 5A3IC 2F19L 3FO2A 1HZHL 3BIKB 4NO5A 5H8DA 5D1ZC 4UT9L 1X7QA 1NCCH 3QCVL 4ORGA 1OTUC 4MVBD 5DS8A 1MIEL 4PJAE 3B43A 4U1HB 2FX9L 5T1MA 3ZKMD 4J8RB 4MJ6B 1EERB 3MRCA 5E70A 3GRWA 1AI1H 1F11B 3QT2A 4WFFD 1JNLL 5DFVC 5T3ZE 1CR9L 5HBBA 5E6IB 3BI9X 4LHUB 1ROWA 2XZQH 3HAEH 5KN5A 1KN4L 2DQHL 4Y5YC 5E00A 4E41D 3UC0H 2ENSA 5JR1H 3D0VA 2NXYD 1DUYB 3V6FB 5LJYH 5F6HI 5ADOL 4TOYL 1JZ8A 2F5BL 3NACL 5C0BD 3UTTD 1CT8B 4K7PY 5EU5B 3MLRH 3HFML 1A7OH 3OXRA 1NUFA 3PWJB 5FUCE 1P9MA 2DYPA 2B4CC 5GRVL 1PZUB 1F8TL 4YO0B 1UJ3C 3C8DA 4GXVH 4HWZA 5C07D 1KJMB 4K7PL 2GUOA 3BKCL 2D7NA 3LRGA 2FO4B 3MCKA 2N4IA 3WS3A 4AG4H 4J4PA 1G0XA 3MLUH 4LLWA 3G5ZB 3OAUL 3UBXG 3QFDA 2FATL 3GSNH 4ZYKA 4Y4FA 1RUPH 2APFA 2OI9C 3MV11 4MDJB 1MFEH 5E08L 4H20L 1V3KA 2D7TL 1ADQL 1YMHA 3VXSB 1BQHG 2A6DB 4KQ3L 1ZA6A 3NFSH 4PG2C 3H3PL 2Z92A 1IAKB 4OBSA 4FTVB 2YR3A 3QH3B 2Q1EA 3O2VL 1TENA 2V5MA 4Y2OA 2YA2A 3CDGB 3KYMA 1PD6A 4X4XB 1DBKH 4HBCH 4Y19D 1ZWIA 3QNYA 3QPQD 4K3DL 2H8PB 4U1GB 5C86A 4LSVH 3RNKA 4U6XB 4N68A 1JF5A 4Q97A 4XX1E 1T89A 2RFXB 4HUUB 2W9EL 3L3HA 4XNMB 5HYSG 4JE4B 2X4SA 2ATKB 3EYOB 4P99A 1R3KB 5B3JE 1UCTA 4MCYB 1AQDA 5L6YL 5JMOC 2W9LA 4X9IA 1YMMB 3L95B 4FFZL 2P5ED 4BZ1L 1I7ZB 3BEVB 3RI5K 2FWOA 3LY6A 1UC6A 3DV4A 2MWCA 5KSAC 5JHLL 3EW3B 1UXWA 4H25A 5F1NB 5CP3H 3T0XA 1E4WH 5LCVH 4WUUB 3NN8A 2GQHA 2NY4D 1CD9B 4L4TB 1OM3H 1CFNB 1OSZA 2Y72A 1JUFA 3KJ6H 5T3ZL 2ARJB 3K46A 3D2UB 4QXGL 1X5YA 5BS0D 1A7QL 3D87B 3QQ3A 5HHME 4CN4A 2CRIA 3RU8H 3OKLA 1J8HE 3IJYB 4XI5D 1JGVH 5DYOB 5D96B 1F6LL 4LLQB 5AUMA 5JORA 2EDBA 1F6FB 2VQUA 5C09D 3IETB 3PUCA 3SO3B 2JTDA 4MA7H 4PRPE 3CC5B 1M71A 2Q86B 5HYJD 1K6QH 1Q8MA 2WWKO 2XA3A 4PIRF 3RWDA 4Y0GA 3RTQA 4X7TB 5AYQA 4NN7B 4UILL 4F7MB 1U8PB 1FL3A 3PP4H 1T0MA 2NX5B 2R9HC 5I1AB 3IVKB 2CIIA 1PKQA 1FORL 3AB0C 3HE6A 3TN0A 2LVEA 3QXUA 5J13C 1KJ3L 4UT7H 2E7HA 4MB4A 4ZSOB 1A14L 1AQKH 1KB5B 3EFDH 3ECBB 3QXDA 5CSZB 1P4BH 3EUUA 1A9EB 4WI5A 5EZIH 4X4ME 4WUKH 2PR4L 2UUDK 3QO1B 4N0FB 3BWAB 5ESAA 2CXGA 1GZQB 2PXYA 1OP9A 1EAPB 3MLVL 2YD9A 5C0JB 1F6AB 3QCTL 5ALBL 3S96A 3HI5L 1B88A 2VLME 3EO1A 4HAGA 4MA3A 1LNUA 1HH6A 2OSLA 1FBIH 3NVQA 4LQFL 5F3HA 4HUKB 2VL5A 5DWUL 1JYWA 3TP4A 4FQ1L 5IFAL 1ZT1A 5L88L 3K4DA 4TVPD 4UV4L 4HC1L 1K8DA 2X70B 3RVTD 3RJDA 1YNKL 4ODWB 3SOBH 2N7BA 2DBJA 3QRGL 4NQEB 4YHYC 2NY2B 2F19H 1L9NA 1HHKB 1H15B 2HN7B 1HZHH 1NCNA 3ARGA 4UT9H 1MFAL 3QCVH 4C56B 2OTWB 1MIEH 4GKNA 3WHXA 3BDBA 1NCBL 2FX9H 2OQJB 3MRIB 4ZPVB 3T2NL 3QEGL 2G2RB 2UWEB 4JDTH 1QRNB 4HCRA 3SDXE 4HK0A 5BQ7A 1YY9C 3FFCE 1CR9H 4GG6E 4KXZH 4XAKD 2VR9A 5ISZD 4P23B 3NIGE 1KN4H 2DQHH 4F37F 4CN1A 2BOBB 2J5LB 5TQ0L 1SQ2N 2XN9E 5CBEA 1G7LA 5ADOH 4OD1L 4ODBD 1T7ZA 2YBRB 4LLYA 5E2WL 2HT2C 3ISWA 3WIHA 4TOYH 3SGKA 2F5BH 3NACH 3WNKA 4P59L 2Z93A 1QLRA 3P30L 2BY3A 3HFMH 3L6FA 4M48H 2W60B 3SCMD 3QUMB 3ET9F 3OZ9L 1AGEA 2PYED 1BP3B 4OD2A 1I85A 4UI2A 1F8TH 3QFJD 2VE6A 2V2TB 1VGKB 3TT3H 4R2GB 4ZUWA 4N8CL 4BSWB 4Z7OE 3BKCH 2YXMA 1EEYA 4P2OC 1IGCL 1FZOA 3C5ZC 3KPOB 3OAUH 2FATH 1MLBB 4M6ML 4PRNB 2NLJB 4NM4L 5F88B 1VPOL 5E08H 4H20H 2D7TH 4DK6A 5HYSB 3EOBB 4KQ3H 3FL7A 3WYRA 4YC2B 3H3PH 4ZAKC 4PJ5E 2Z4QA 4ZUSA 5E8OB 4ELKA 4L29B 5IHUL 5D1XD 3O2VH 4F7PB 4C57C 4MAYC 4EVNB 1NCDL 3TH4T 5I6XB 4TNVK 3BPNB 3TBTB 1BVZA 4K3DH 4V1DD 3R4DA 1F58L 5CJ8A 1TCRA 1R0AL 1VB9A 2X89A 4U33A 3VFPA 5CD3A 1G9NL 3KYOA 4L8BB 3CZFA 4ZPTA 1S5HA 5LQBL 3TNNA 2ZOLB 2QKIA 4NO0D 3TM6A 5ENWB 2A73A 5L6YH 2UV3A 4TUJA 1JNJA 4HKXA 4FFZH 2GY5A 4BZ1H 4GRMA 5ECJE 4OZHA 1T1YA 1A4KB 2AK1L 4MXVE 4PJ9B 3MSPA 4X6DF 3U4EB 3S34H 1NLBL 2VERN 3GBML 2VXSL 5EC1A 3SE9L 1UG9A 3LKOB 5HVWA 4P46B 4F7EB 2DQTL 3AREA 5T1LA 1J1OL 1KF9B 4QXTB 1OW0C 4HAFA 4HIEA 2NR6D 5T1KB 5B39G 5T3ZH 1RJYB 1MQKL 3LS4L 4JY4B 5DK3A 4QXGH 4E0RA 1ZA3A 1A7QH 3I02B 3IDJA 2FIKA 1CQKA 3RZCA 3BZEA 1D6VL 3O4LD 3VW3H 5IVXF 2P43B 3LZFH 2XZCL 2HJLA 2NNAB 5CGYD 2UZIL 4Y1AE 4JG0L 2OP4L 1JZ7A 4PJIE 5E6IC 1FO0A 5ID0B 1QBBA 2OMNA 4RFEA 5C6PB 3UDWA 4UILH 3TZVB 1Q9KB 3W9EB 3S88L 5CEXA 1ZSDA 4MQSB 4Z78A 5F72S 1HHIB 1LO3H 4M1CD 3EYQC 4HGWA 4XVUD 5INCA 5D5MA 3B5GA 3FKUS 4ODTL 3K0WA 1FORH 2F53B 5D2LE 5GISH 5F1SA 3EHBC 5DD0L 1KJ3H 3VRJA 4NQVA 2V5SA 5JO5A 4JANB 3I6LD 4D9RE 2E27L 2PR4H 3KLDA 3SKOB 5F7NC 1Y18A 5C0NC 3MLZL 1KYOJ 4JRXE 3WFBL 5TGBA 3RUGA 1MJ7L 5TE7L 1OARL 1H8OA 1H0DB 3MNVA 3MA7B 4EUPH 3MLVH 1NCAL 4PJHF 5SWZA 3WN5A 1AXSB 4MNGB 3QCTH 5ALBH 5C70A 2J6EA 3HI5H 4OF7A 5CD5D 3OQ3B 4IRJD 4CBPA 3GSXB 3MRJA 2X4OA 4Z7WF 3UTPD 4IDJL 4LQFH 1SYSB 1A2YB 1JYVA 5DWUH 4L3AA 4FQ1H 2GY7B 1JGEA 3G5YB 3GI9L 3JV4A 1F2XK 3I50H 5D93C 2AXFB 4HC1H 2NYYD 1NKOA 2EE9A 2VDKL 3KPQA 1YNKH 2P5WB 2EE3A 4J1UB 4CVWA 3QRGH 4U1GC 1XIWB 3F7QA 3VXMD 2ZG1A 2MFNA 1MFAH 4JY6B 5KTEL 3EAKA 3FO1B 3UPAA 1KG0B 3Q1SL 2G5RA 2D3VA 3LN4B 3T2NH 3QEGH 4E42B 5DHYA 1X5ZA 3EO9L 3KS0J 5DJ8B 1A6AA 1B4JH 1BVKB 4LPUA 2XWBA 1K4CB 4QYOA 3U7AA 1OY3B 3HG1A 3C8HA 1XEDA 4P3CL 1A9BA 5IG7A 1I3GL 2ED7A 4JM2D 3RWFA 3OKYA 1WSST 1XH3A 1VDGA 5TQ0H 2DICA 2FEEI 4BK5A 4OD1H 1CDGA 2FBOJ 4KZEL 4PLJC 1HOCB 4P59H 1NAKH 3EOYG 1YPZE 5JHDE 1JTOA 3P30H 3MV8D 4LAJH 5IW1B 1G84A 2FGWL 4KGLA 1OAKL 5HHOD 3QI9D 2AI0L 3MBEB 4JFXB 5MENE 4ERSL 4HT1L 1MEXL 1F3DJ 2VXQL 5D96C 4TUKL 4N8CH 5L8KB 4Y5XB 2DQGL 2IG2L 2JIXB 3NCJL 4OQ1A 1XF1A 1CFTB 3SO3C 1IGCH 3FO2B 3VXNA 5F89A 4ORGB 1BD2A 2XWJB 4M6MH 4NN7C 4LL9A 2JCCE 3LEXB 5T1MB 1VPOH 1WIOA 2X10A 1YNLL 5EIQA 3MRCB 5DA4A 4PJCB 2DRUA 1DP0A 5J6HA 2EE6A 4G6FB 4KI5E 4PJ8B 5IHUH 3UBXI 5AG9A 3LEVL 3T1FB 5CAYB 3V8CA 5I76A 4P0DA 3BZ4A 1NCDH 4MLSA 1IAOB 4ZNEA 1VEOA 1SJVA 4OZFH 1PG7X 1IGTA 1YUHA 2Y5TA 1F58H 3HUJE 5J89A 1R0AH 2H32A 2WP3O 2IALB 1ITCA 3F7YB 3PDDA 4FQQB 1G9NH 3IS0X 1MJ8L 4OFIA 5LQBH 2HFEB 3RVWD 3OXRB 2X4TA 5C3TA 5EBWA 3CX5J 4N8VB 4BFBD 3O8XD 4Y89A 5CMAB 2P8LA 1B4RA 3G6JB 1PEZA 1RHFA 2F8XC 4MJ5A 1QACA 3HC0A 4OF3A 5D7IE 4HWZB 2AK1H 1SY6A 3MCKB 5DHXB 4Q0XL 3VGEA 1NLBH 1IGYB 2VXSH 1LEGA 4AIZA 1X5IA 3SE9H 5GZND 5E2UL 4I48B 3KPRA 4NJAL 4F2MA 1K5NB 4Z77B 5CIPA 1ZA6B 4BJLA 1QBML 3GBNL 4PGEB 2NY2C 3LS4H 5SWSA 4F9PC 2Z8VC 5DTFA 5J3HD 2Y07L 4ACPA 3C6LA 1D6VH 3ROLA 1MJUL 1VHPA 1D5ZA 2Y6SC 3OKOA 1J10A 2NMSA 4LOUC 5EBLA 3O3AA 5L8LB 1ES0B 2BVQB 3IJSB 1OL0A 2VR5A 3QNYB 1Q9LB 4KJPC 4P5MB 4ALAL 5TDOB 5KJRL 4JG0H 3FMGH 2OP4H 1ZVSB 3RNKB 4KK8C 3DXAA 4MQ7B 4QRPE 4PGZA 4LRIC 4RNRB 4C83A 5JW4M 5E5UB 1GJIA 4P23C 3S88H 2X4SB 4CU7A 4KMLB 2EXWD 4X5WA 2J5LC 1OT1A 1BJ1J 1UH2A 4GW4A 3MODL 4ODTH 5EORH 5DD0H 2HYMA 2FWOB 3SDDA 2E8ZA 3FZUD 4U05A 4WO4A 3TEUA 5I73B 4JAMB 1WFTA 1J0YA 3N1GC 3UMTA 3TBYA 1UXWB 1FFPB 3V52L 3MLZH 3WFBH 5E56A 2CR3A 4YQXH 5ITFB 1MJ7H 5TE7H 4A6YB 1BEYL 4PS4L 3BJ91 1AD0A 1OARH 3WFHB 2LQRA 3ARBD 4UQ2A 1NCAH 2C5DC 1SBSL 2DQIL 3TPKA 4LLMB 5C7XH 4G43B 4NWUL 4P5KA 4UDUA 3DPBA 4ZFFB 1LO2L 5J11B 2GITA 3AU1B 5DC4B 1ZLVH 2YSSB 2H2SC 3EJYC 4IDJH 4XVTL 4N0YL 4U1NA 4JFED 2DM7A 4MQXC 4UU9A 1LP9E 3W82A 3GI9H 5C08D 2H9GA 5I15L 5I9QB 5DQJB 2AEWA 1NQBA 4NGHL 3OXSB 2X44D 3BP4B 2VDKH 5I6XC 1JPGA 3JSSA 3K3QA 3LKNA 4M4PA 3CFDB 1ULVA 3G6AB 3V0AC 4QHMA 1MAKA 1J8KA 5E2TL 3I6GB 3W0WA 5JIIA 3TN0B 2AXHA 5KTEH 5L0QB 3V6ZA 4QO1A 3TIDA 3PXHA 2EDQA 3VFSA 3VFTB 1C8PA 4Z7VA 3Q1SH 2JLLA 3QIWA 1RK0B 1ZGLP 3PL6A 4NKMB 4I5BB 5ESVA 2W38A 4QHNA 3EO9H 3U4BL 4PRBB 4X8XA 3VD4A 3CVHB 3VWJD 2PXYB 2YPLD 4TYUA 4X8JB 1RZIA 3QJFB 3H9SB 1A6UL 4JPIA 3CDYA 4PRHB 4LRNH 4P3CH 1KJ2B 1I3GH 2I07A 4P46C 1JFQH 3K4AA 4MA3B 1HH6B 3TVMD 3ZE0E 5F7LB 1NAMA 4KKAD 4Q58C 3OTTA 4R4BA 2FGWH 5LVEA 2ZJSL 3EDKA 1OAKH 4NUGL 3O6FB 1X4ZA 2AI0H 4ERSH 4HT1H 3BW9B 4KJQC 4C4KO 1MEXH 4Y2DA 2VXQH 3WIFA 4ONOA 4U1SA 3U9UB 2DQGH 2IG2H 3NCJH 3WL9A 4N90E 1JGDA 1DLHA 2ID5A 5IEKB 3IJHA 4RMTA 1R24A 5FHAL 2OYPA 3VXQA 1T1XA 4NUJB 4Q6IB 4NQTA 1SJHA 3TZVC 4CMHB 3PWLA 1IC7L 4H8WC 1YNLH 1DVFA 3W9DA 3QDMB 5C0CE 5A3ID 2BRQA 4JN2A 2P7TA 4OZGB 5D1ZD 5BQ7B 1UZ6E 2VC2L 1U8KA 4X6DA 5CZVL 3IFLL 3LEVH 1R3LB 5IW6B 2NW3B 2R1XB 3QUZB 1T6VN 2P8MA 3PWUB 1IM9B 3LKPB 5FGCB 1J7VR 2X1WL 4QRRE 1FC1A 1X4XA 3AMLA 3FT4B 5GGVY 1ORQA 1G6RB 1LDPL 3SJVE 5DJXB 1MJ8H 1KCSL 1D5BA 4UBDD 1XGTA 1MHPL 3L6FB 3RKDC 4H0GA 3RWEA 3OV6A 5KVDL 4OD2B 4AM0A 5KVEL 1MVFA 1CDHA 1HWGB 2DJSA 4R0LB 5E1AA 4PJAF 2XKNA 3O3EA 5BO1H 2XTJB 1UM5L 5MEOB 5GGSA 3UTZB 3MYJA 4Q0XH 3VFWA 3S98A 2CMRH 5B38G 4HMEA 1IM3B 5IKCA 1FZOB 1Q9OB 2YC1B 2R56H 4GRWE 1QSEE 3V6BR 3HLAA 5E2UH 2CGRL 4NJAH 1DZBA 5CGMA 3GMPA 1TFHA 5H37G 3K74B 5B8CA 1NGZA 2FB4L 1QBMH 2H6PB 2Z4QB 1XIWC 2K1MA 3GBNH 2PTTA 4AMKL 3O45B 4NN5B 4S0SD 2Y07H 4CU6A 5DD5L 3RIFK 1MJUH 1S5IL 4X83A 2D0HA 4P3DA 1RU9L 4ALAH 3QWRD 5KJRH 1TQCB 5C0DA 1VADA 1CG9A 1LE5B 4K8RD 1P7QA 4PJHA 4N9GB 1QSFE 2J7LA 1U8HB 1N4XL 4RZCB 4ELMA 3CZFB 3FB5B 2R23A 3S7GA 2R8SL 2Z91A 3F12A 2RAMA 1Z6JT 3S36L 2QKIB 3HKFA 4Z7WA 5E9DA 3UTOA 2AV7A 3MODH 5FKPB 4P9ML 3HNSL 3X3GL 4NT6A 3CXDL 4PJDE 4TQEL 4WNQA 4BUHA 1DDHA 4W6XB 2BK8A 1F3JB 5H35B 5IFJB 3MBEC 4GAJL 3V52H 3K2UL 5FOBB 2VDRL 3RNQA 2R39A 2XKUA 4YXKL 1BEYH 4JFFD 4PS4H 3MRKB 2X1PA 4Y5XC 4P2QB 3QSKB 2CSPA 1LEIB 4BQBA 5AZ2L 3NMEA 1SBSH 2DQIH 4OFDA 3SQBA 4NWUH 3BSZL 1LO2H 2VLRB 1L9MA 3DWTA 4DW2L 1QA9B 2GEEA 4XVTH 4LLUA 4N0YH 3ETBF 3V6OC 4PJ8C 4I2XB 5B3JF 2D4DA 4WTWA 4MDIB 1HHJA 3LMJL 1LEKB 5I15H 1QQDB 3HZVB 4NGHH 4FQXB 5GRUH 3HS0A 4JJ5A 4HKZB 2WBJD 4NC1C 5E2TH 4YHPA 2PYFA 3X11A 4H1LG 3VRJB 1FG2A 4KZDH 3AUVA 3HZYA 2ICWB 3K8MA 5DD1L 2GK0B 4KJYA 5I74B 1WEJL 2APVA 1NBQA 3RWHA 4X99A 3UP1A 2BY2A 3U4BH 2YRLA 4FQJL 3GSNA 3HI1B 1EVUA 1C12B 2CLZA 5TGBB 1E27B 2X4QA 4LDLB 5DURD 1P1ZB 1RFDL 2NZ9D 2X4NA 3IXTB 1J18A 3QCUL 5MEQB 1KUMA 3TIEB 1MHEA 1SYVB 3QEQD 4R26L 3INUH 3R06B 5EH1A 4AQ1B 2FJFA 3DHMA 5HXMA 4M6OL 3WCYA 3EGSA 43CAA 2WBKA 3PHOA 1KCKA 1CDBA 5IB4B 4EN3D 5CKAA 1K2DB 4O2CB 1QBLL 4OCLC 4QTHA 3MXVL 2ZJSH 3PWPD 1F45A 4NUGH 1KYOK 1JF1B 1JYXA 5EN2B 2KUTA 1CXIA 1IQDB 1FJ1B 3F7PC 1C08B 3MV7A 5DUML 2WAHA 1JPFB 3GSUB 3S35L 4GSDL 4K94L 1MCWM 1QOKA 1IEAA 1KACB 5FHAH 1Q9WA 1I9EA 2GCYA 2O5ZL 2J8UE 3GIVA 1J0JA 2ZWLT 5HYQA 1I1YB 3MXWL 3KPPA 3QUKA 1IC7H 4UTAL 3FB8A 2BSSA 1G7PB 2OTPA 1TNMA 1A22B 1UQSA 5DJAA 5CP3A 3H7BA 4X7EC 4IMLA 4LCCA 3HE7C 2X9XA 4G8GE 5CZVH 2Y06L 2ZNXA 3F6LA 2XWBB 2HWZL 4QYOB 3RBSA 2NTFB 3IFLH 5DK2B 3FB7B 2EICA 5I73C 4XCEB 4YBHA 3QIUA 4X9FA 4RFNB 4M7LT 4UIMB 2ESVD 3P4OB 4FTVE 5HGAB 4I0PA 4YDJB 4U1LB 4M93C 4P5TB 2MPAL 2JB6A 2A1WL 4JFPB 1LDPH 2JJSC 5F1IA 5DVKA 5HGDB 5J1SC 1MHPH 5ANMB 2H45A 4NCC1 3VRIA 4JDVB 5BCAA 5J11C 3QQNA 2HT2D 1Q72L 2WIMA 4XGZB 4LCUB 1N2RB 1UM5H 2BSED 3ARTA 3DRTA 1FYHB 1NEZA 1S78D 4LEOB 3VXRD 2V9QA 2VZOA 1LO5A 1MF2L 1UWGL 2PNDA 3U46A 1RHHA 3SDXF 5K9KB 2NY6D 1YMME 5I9QC 4YDVB 4GG6F 3LQZB 4PGCA 2CGRH 3B9VA 1CGWA 4BQ6A 3K1DA 2FB4H 3NIGF 3CFKA 4NBYB 4XB8A 3BKYL 4ZO6A 3SDCB 4AMKH 1IKNA 4XC1L 5KSBA 1TNNA 5C0BA 5L0QC 3CLEL 5D7JB 3P0YL 1E4XL 4OFVA 5DD5H 5E1HB 1Z9LA 1S5IH 1I9JL 2ED8A 3U0PA 1IGJA 2A6JB 3BRGC 1RU9H 1RJLA 4EXPX 1MH5A 1CFSA 5EZLA 2NY3D 4MAYD 4BFEA 2N7AA 5C07A 1JK8A 3VFUA 43C9B 2OR9L 1N4XH 3RHWF 4U1KA 2R8SH 4Z7OF 2R0ZH 3CZJA 3S36H 5T1DL 3MRGB 2X1XR 3VXPA 3OGCA 4ODHL 3DX9B 4S0TD 4P9MH 1LHZA 4MJ5B 3HNSH 1T3FB 5CINL 3X3GH 3MUZ1 1AKJA 3CXDH 4TQEH 5F9DC 1ZHBA 1FNAA 3B9EA 2R69L 1LEGB 4X9GA 3O6FC 5I8CB 2VLJE 3CFIC 2H3NB 3NPSB 5FYLD 3JVGA 1DFBL 4GAJH 3K2UH 2VDRH 1S9XB 4YXKH 4XBGA 4Y19A 4FA8A 4ZSOE 2ZZUT 4U0RB 5AZ2H 2O61A 3BHBB 3CCHA 4NRXA 4F9LA 3RX8A 3MOQA 4YPGB 3BSZH 32C2A 1MLCA 4Q6IC 4FQCH 4CMHC 1DBAH 2BMKB 4H1LB 2UUDH 1NFDB 4DW2H 4YHOL 5FV2A 4YBQD 1WZ1L 1AGBB 1GGUA 2P5EA 4KROD 4DTGL 1PLGL 3PIQB 4JRYE 3TCLB 3DXAB 5F8QC 2BHZA 2BHUA 3LMJH 5T3XD 5JW4N 4MXVF 2FJHB 3QUZC 1Q38A 1AXTL 4FMKA 4ZODA 2OXHA 2B20A 2E6PA 4OB5L 1NL0L 4IRZL 2P24A 4WWKD 4YHLL 1KCRH 1H8NA 4LHUD 1RZGA 4HLZH 1BVLA 2IMNA 5MERA 3MRBB 4HIXL 2M2DA 1HHHA 2F74B 3HPLA 5DD1H 4GRWH 1Y0LB 4XVSL 1WEJH 4NQEE 2OBGA 3MGOA 3QQ4B 2Y7QB 4JFYA 5D70L 2QSVA 5EU6A 4K3GA 4X6CB 1NGWB 4C56E 1YEGH 4R0LC 4CJ1A 2OCFD 2XTJC 4HXAL 1ADQA 1RFDH 3U1SH 1YNTA 3QCUH 5BVJA 3M1BA 3ZE2E 3EJZC 4ODUB 3QDGA 4NHCL 5HYJA 1QRNE 3LV3B 3W11D 2VZ1A 4P5KB 4PJIF 1F13A 2GSGB 4I3RL 4M6OH 3T0AA 1V3MA 2YN3A 2CDFA 4U1NB 1QBLH 4PYHA 5C0AB 4QOKE 3EDJA 3U2SA 3MXVH 3KWWA 4KHTL 4AY0A 2DQFA 4NN5C 4RGND 5HI4D 3VXOB 3D39D 4ZXBB 1N59A 4PREB 4F58H 5HYEA 5J4MA 5D2LF 3VXSD 5DMJB 1JPGB 5FA3A 4AEFA 2I5YL 5CHNA 3QDJD 5GXBB 5DUMH 2CKBA 3S35H 1TQCC 2JJVA 4GSDH 4EDXB 1UYWL 4K94H 4K7FA 5EU7E 2APTA 3W2DH 3CLFL 2O5ZH 1JNHA 3HCVB 4NNYA 4MHHG 3TIDB 5EUKB 3UAJD 1RIUL 3MXWH 3O9WB 4UTAH 1FAIL 2J8HA 5L9DL 4QHNB 1FC2D 1U8LA 4L9DA 1CD1A 1CLOL 5DJCA 1KB5L 3NIFE 4IRSC 1V7NL 4XXCC 2YOCA 3VXUD 1AJ7L 3TO4A 4Z18A 1RZIB 4RFOL 4JPIB 4NYLA 3R8QA 4I9WE 2UYLA 1DQDL 4HJGB 3DROA 5CEZD 4KRMB 3TJHD 4G7YL 3LKSA 2MPAH 5EU3B 5D2NB 2VWEE 2A1WH 2IANB 4UTBL 3IDNB 1KTDA 3QQ9C 1EHLL 4ODSL 4KDTC 2PW1A 2YWYA 1JGUL 4L4TD 4GBXD 5MHSE 1Q94B 2DDQL 1IVLA 3GKZA 3QWQB 2PCPA 4U1SB 3Q0HA 3UX9B 2AEPL 1HSBA 2WLYA 3LN5B 5IMOB 3DURA 1MF2H 1UWGH 5HY9A 1J87A 1R24B 1UT9A 4WU7B 3FN9A 1XMWA 1MCJA 1T1XB 4PY8I 4FQXC 1HN1A 3TO2A 1W2KT 4U1IB 3W9DB 2Z9TA 3WJJA 4JN2B 3GMQB 1CGTA 3BKYH 4XPHL 4XC1H 2OJEA 4MCZB 3CLEH 3P0YH 4PRDA 1E4XH 1PEWA 4EUPA 4RMWA 3QIBC 4NQXB 3V2AR 1ZHLB 3LKRB 1YPZF 2PYEA 1RUQL 3OJMB 3HR5B 1L7TL 4JFHE 5GSVA 1CYGA 4PV9B 2OR9H 1YY8B 3P4MB 3GSRB 4LVOB 1WGOA 1NCWL 2AJZA 5B4MC 5AG8A 3O81A 4UDTB 2AK4D 1DL7L 4HC1A 4ODHH 1HDMB 4X5XB 1U8IA 3D69B 3IRPX 3I84A 2JCCF 2ERJB 3NABL 2FIRT 5CINH 2W0KA 1DQTA 2R2HB 2P42B 3VFWB 2FYYB 5D1XA 1QSVA 2C7UA 3C5JB 2R69H 4KI5F 5CEYB 1DFBH 2F53E 3WKNA 1T5XB 5E7FA 5B8CB 1T0PB 3L7EA 3DIFA 2FL5A 3NTCL 4V1DA 4MD4A 4H5SB 1JHTB 3LB6C 4TNWF 1R3HA 3HUJF 5FUOL 3PQYD 2YUVA 1BLNA 1AGCA 2NQCA 4P49A 1G7IB 1XCTA 1WZ1H 2H2PC 4MNGE 4WHTA 4DTGH 1PLGH 4M7LL 3STLA 4L8DB 4ZO7A 3GIZL 3VA6A 2R23B 3NZ8A 5D7IF 2OZ4A 1JTPA 1KENH 4KJPD 4RFNC 1AXTH 5F70A 4OB5H 1NL0H 1QVOA 4IRZH 2G5BB 3AM8C 1YC7A 1T2JA 5F6IB 3C8KB 4P5TC 1GYAA 1CGXA 3CFEA 1QPPA 5ID1A 1FGVL 1AP2A 2ZPKL 5HHMD 1RAMA 4WNQB 4TTGA 1HYSC 3WDJA 4XVSH 2HLAA 5EBGA 2R4SH 5KVFL 5D70H 3MJ7B 1X5FA 2JJTC 5JNYA 2HG5B 3E6FA 3MRLA 2EZ0C 4LNRB 4HXAH 4X4MA 4L4VE 5FYKE 1CD8A 1I3UA 4NHCH 5IFHL 3QULB 2YUZA 2HJKB 4NFCA 1BOGA 3UTSB 3Q48A 4W81A 2YA0A 2HMIC 4OV5A 4I3RH 4G3YL 5GZOD 4M62L 4OZFA 3PV6A 5BW7C 4H88L 4RX4D 4ESKA 4GW5A 2ZNWA 5EO0B 3SDCC 4JQVA 5I8OH 5J06A 4JQXC 5D7JC 1NC2D 2AJSH 1I4FA 1R5WB 1RIVH 1MI5D 1QZ1A 1YDPB 5D8JL 1DEEB 4QEGA 2I5YH 3UEZA 3HS0B 1BQLL 1S3KL 4MQXD 4OUUA 4ONFL 4DGYL 1UYWH 2GT9B 3SBWC 2X9WA 4OAWB 3CLFH 4I77L 4XWOD 4AEHL 4DKFL 3TNMA 4H8WL 2FH6A 2VSCA 4MXWL 4PJBB 1UA6L 1NGQL 1RIUH 1ZK9A 4KJYB 2Z0BA 4ZO9A 3MRNA 5HDBE 3WO4B 4M6AA 2VJXA 1YEFL 1CLOH 3TA3A 3MOAL 1KB5H 1V7NH 5LAXB 4LCWB 4PRID 1AJ7H 3SDXA 4RFOH 1NGXB 1P5VA 4XCNB 3ZKQD 1NJ9B 3VRLE 4GG6A 4CVZB 3CDCA 4PJCE 5IF0B 4BZ2L 2OXGA 1DQDH 4G6JH 2VLKB 3NPSC 1LP9F 1RJZA 1UB5B 5F7DA 4G7YH 1T1ZA 4S1DC 4Y4KB 3O2DH 3C6SA 4R3SB 1YEDB 4U0RC 4O51B 4UTBH 5D7KD 1T0NA 4ODSH 2CK2A 3QZWG 4FXGB 4J2XA 4TVSa 3BX7C 5F3BB 1QR1B 4NC1E 4XNXL 1JGUH 3F58H 2DDQH 4MX7A 1BREA 5IB5B 1R6VA 3FFCD 2AEPH 1BQSA 4Z8FL 3EYFA 5FYJD 1IEAB 5FF6B 4G8FB 4KJQD 1T21A 3RI5F 5B22A 5K9OA 3G6JE 4WHCA 5JDSB 1T1WB 3FB8B 2BSSB 3H7BB 4XPHH 4EOWL 4PYGA 5HGHA 5FYKL 1IGFL 2FHBA 2OX5A 3MV8A 5DZLA 4NNPL 3ZE0F 1WICA 3IFPA 3QIUB 2GJ6B 3IDUA 1V3JA 2X7LA 3BQUD 1RUQH 5D71L 4CUCA 1L7TH 4YAQA 4G9FD 2NY5C 2A0LD 3HMXL 4G8EA 2VZVA 2IAMD 2M1KA 1MY7A 3PJSA 4PLNC 1NCWH 1A47A 4YLQT 1XGUA 4CW1B 1DL7H 3FQNA 4PJ5D 4OI7A 2RBLA 3AVEA 3QUXC 3MRPB 1FZJB 3GZKA 3NABH 3VI4E 3OKDB 1VKXA 1I1FB 3HMWL 5DHVA 3WUWA 3SDAD 1UZ6F 2BNQD 5L7XL 1U8MA 4ZXBC 3WBDA 4YPJA 1KGCE 1RIHL 3SKMA 3PHQB 3BEWA 4E41B 2BVUA 3NTCH 2NXYB 4NQDD 2IADA 3QR2A 2VDNL 2FGZA 3GB7B 1EFXD 3C08L 1I7TA 5KSBB 3LQMA 3UTTB 5FUOH 3O9WC 5LGJA 4LBEB 3FQUA 5CGTA 4X98B 1VACB 1K4DB 3PGCB 1RJLB 5SV3A 4FZ8L 4XH2A 2G75B 1TZGL 4M7LH 1EO5A 3T0VA 3OPZL 3OX8B 2GYSA 4Y1AA 3GIZH 4XBPB 3BRDA 4M61A 1NFKA 2E9WA 3FO9A 1U2CA 4U6TA 5CJXA 1S7UA 2B1HL 4K3EL 3ZYOA 5GS0L 4HUXB 2J88L 4GRWF 4LF3A 1M7DB 3BRFA 2EC8A 3DRQB 5D2NC 2DWEB 5DQ9A 1ETZB 1FGVH 2ZPKH 1KPVB 3TH3T 2NY7L 4QHLA 5D2LA 1I8IB 2H41A 4YFEA 2HT3D 1IC4H 1UJTA 2ADJB 5KVFH 2W0PA 5DRZA 5IW3A 5EDXA 4QXUL 4HUVB 4LDOB 5BRZD 3OJDA 4JFDD 3LPGA 2EDYA 4Y19B 2BNRD 1FL5B 2Q8AL 5I1IL 4JRXA 1JTTA 7CGTA 5I1DB 3EYVB 5DJYA 2DM3A 4G3YH 2AXGA 4LVEA 2YD2A 4M62H 3HZMB 4H88H 1RULL 4BFIB 2P5EB 3ULVC 1HNGA 1P84J 2ATPB 3PWNA 1AO7D 1PYWA 5CS7A 3FO0L 2CK0L 1IJ9A 5D8JH 4OV6F 4PJDF 1BQLH 1OGAD 1KB9J 1S3KH 1N0LA 5FA4B 5TQ2H 4DGYH 5FECA 4ZOEA 3Q3GA 2NY4B 3C60C 3EOTL 5D6DC 4FN0A 4DKFH 2EKSB 3ARBA 5M7QA 3MACH 1L6ZA 3BJLA 4H8WH 4U3HA 1CE6B 4LVOC 5JZ7D 3LD8B 5DF0A 1NGQH 1RPQA 1HHHB 1KIPB 4X6FB 2E9IA 3S37L 5L2KD 5BS0B 2A83A 1J05A 1A7PL 5DMGD 3D3VA 3DUHA 3X12B 2DAVA 3EZ8A 4LEXL 4B5EA 1YEFH 3MRRA 1OTTD 3MOAH 2ERJC 4MHHI 3N1FC 2ZSWA 1YNTB 5C09B 5BVJB 1OLZA 4HIJA 5C08A 3GMMB 4OZGE 4A6YL 4BZ2H 1D9KC 5HYJB 1T4KA 3C09B 4BK4A 1U6AL 3SQOH 3RL2A 2GK2A 2YPKB 2ITCB 4TNVF 5J0BA 2CDFB 5ACMA 5H94A 5IBUG 4APQB 3U4AA 3RVUD 5IM7B 3FTGA 3KWWB 5FGCE 5SX4I 4XNXH 4R90L 4QF1A 3DVNA 4KPHL 5FA3B 1KCVL 1M1SA 1CFBA 3VH8A 4PV8B 1WAAA 4Z8FH 5CWSB 4WI4A 3L9RA 4I4WB 4X80L 1REIA 4NQUA 3SY0A 2W9DL 4RWYL 3IDGA 4JLRA 4JO3L 2VDQH 4ZDHA 3V4VL 1FFNA 3D0LB 2ZCLL 5DRXA 1LVEA 1RVFH 4G7VL 1P7HL 4POUB 5F6IC 4J6RL 4B7IA 1A7RL 2Q76A 4PP2A 2VSDA 4D8PA 5DMIL 3G08A 4AT6A 5ITBL 5FYKH 1IGFH 3MFFB 1EGJL 2EYSB 5IB3B 4NNPH 3VJ6B 1AR1D 3BGAA 1U3HB 4XRCA 3FAWA 5D71H 3VMNA 5FXCH 3HE7D 3CVHL 3KHOA 1CDJA 3HMXH 2GSIA 5E7BA 1MVUB 1KJ2L 5BJTB 1U0QA 4DEPB 3HUJA 1HXMA 1I9RL 2QADD 1GSMA 2J8UF 5EOQL 1N7ML 4M00A 5D1ZA 6FABL 3TBSB 4G5ZL 3GMOA 1BPVA 1FYTA 5D7IA 5L7XH 4LVNB 2ADIA 1NBYB 5ISZB 1RIHH 3GJEB 3IXAA 3P40A 3TO2B 4GG8B 3O41A 1GXEA 5C8JB 5DK0A 1VFBB 3GGWA 2VDNH 1TZIB 4TTDC 3B9KD 2OJEB 1UADC 4KH2A 3FRUB 3L3OB 4Y5YA 3ZYJA 4L3CB 5I66A 4P2QE 3SCMB 4YGVA 4ODXA 2PYEB 1P4LA 5C0EA 4FZ8H 2V9TA 3WO4C 3QFJB 2IH1B 4MNQD 1TZGH 3STBA 1P6AB 2C1PA 2KDGA 2YPVL 3D25B 4OSUH 1F02I 4QRPA 4QHUA 2LAGB 1S7QB 2B1HH 3CX2A 4I2XE 1IGIL 1UJ3A 4K3EH 3ILQD 4KMTL 1G6RL 5GS0H 2J88H 4OLXL 5DJ0B 1U8IB 4Y4KC 2XXMB 5JXAL 4CMMB 1M05A 1TJHL 1S7WA 5IP4A 1A64A 4PRHD 3QWOA 2DWDA 4LSQH 5FFLA 1FZKA 4XPGL 2NY7H 4LPYA 1YN6A 4EI5D 5HPMA 1T66C 3M8OL 5D5ME 3MRQA 4PG2A 4M8QB 3G9AB 5FO8A 2AGJL 3IFOA 4G80A 4XHQA 4QGTA 4V1DB 3QWRA 1L0QA 5I1IH 2MMXA 4WV1C 5EPMB 2QHLA 3U0TB 1GC1L 1R3HB 3RUGE 5DUBA 1AGCB 3D85D 4NO0B 3IAPA 4MSWB 1RULH 4X6EB 1CGVA 3ZTJG 1TQBB 3NPZB 1U91A 3FO0H 1W8NA 2CK0H 1TITA 3DTXA 1L0XA 1LWRA 1CCZA 1GOGA 1PQZA 1KPRA 4POZD 5KSVA 4JFFA 4MWFA 3EOTH 3V5DB 5KSAA 3CFEB 4OF6A 3S37H 5IBUB 1A7PH 5DO2D 3MUGA 3O4LB 5AYUL 1N3NA 2EEBA 3ZKMC 3E6FB 1I8KB 4LEXH 3DECA 3S4SA 1RZ8B 3VCLA 1YEEL 3P73B 5JIPA