3WFBL

Reduced cytochrome c-dependent nitric oxide reductase (cnor) from pseudomonas aeruginosa in complex with antibody fragment
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPPYLAASPGETITINCRASKSIRKYLAWYQEKPGKTNKLLIYSGSTLQFGIPSRFSGSGSGTEFTLTISSLEPEDFAMYYCQQHNEYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/oxidoreductase
molecule keywords antibody fab fragment light chain
publication title Structures of reduced and ligand-bound nitric oxide reductase provide insights into functional differences in respiratory enzymes
pubmed doi rcsb
total genus 52
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2013-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfbL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfbL01
1KACB 2D9QB 1ITCA 3H9YA 1YYMH 3SKJH 2NY6D 1S7RA 3T08A 3ILPB 5C0ND 2I24N 2Y23A 4YZFF 4LHUA 2IQ9L 3L3DA 4WEBL 2H9GA 3PE9A 1LDPL 3P30L 3TZVA 3DUHA 3CDFA 2DQCL 5LVEA 3G6AA 3AY4C 3EDKA 3PWNB 1GIGL 3LS4H 5FKAB 1PYWA 3EFDL 2FHBA 2DJUA 2IBZX 5F71A 3LSOB 2XY1A 3WUWB 1S7VA 1JE6A 5A2LH 2VDQH 2NTSP 1EEUA 5ICXB 3L3IA 2VN4A 1MCOL 2ENYA 3QG6A 5LKNA 2CLRA 2GCYA 3SGDI 2ZCHL 3DTXA 3QIBB 1QBBA 3WFBH 3P77A 2IADA 2W0KA 3LRSB 4LHQB 1X5ZA 4KGLA 1U6AL 4MA1B 1I8LA 3QUZC 1FNEB 5EN2B 3Q6FA 5C8JB 4ELMB 4XPHL 2W91A 1I8KA 4PJ7F 5D8JL 5I1KL 4U6YB 1LO2H 5GS1A 5EO9B 1DUZB 2CIIA 4F33A 2PUQT 3DUSA 2FH8A 2R1YB 3I6GB 2EE9A 5IOPB 3WXVH 1BVKB 1INEL 4DK3A 4OTXH 4Z95H 4M5YH 3SJVB 3ARED 4MHHI 1A3LL 1BVZA 3HNTL 4PJXA 4Z7UA 4PREB 3UDWA 3CPLA 4E41D 4DGIL 4X7SH 4NN7B 1NFDF 2IWGA 1JI1A 3OHXA 4G7VL 3VFTB 3CVHA 1N6QL 1I8LC 4WHTB 5CJQL 1MCKA 1DQDH 4MDJB 4YBLC 5E7BA 4TOYH 4M7LL 5KN5B 4I1NB 4Y16D 1G7IB 2VYRE 3L1OL 3L9RA 1DL7H 3KR3L 4JZOA 5IMLA 3VCLB 5F88A 4JFZL 4L8DA 1R24B 5JOEA 5DLMH 1SBBA 3WN5C 1R3LA 1XR9A 3U83A 5T33H 3S7GA 3R06B 2OTPA 4PGZA 4XP1H 5DD6B 4H88H 1DQJA 5I74C 1GHFL 4CJ0A 3U30C 1N2RA 2AJSH 1GC1C 3U1SH 1UADC 1C5CH 4HUNB 2ARJB 4L29B 4EI5D 3MSPA 1UXSA 3V6ZA 3FAXA 2J3SA 3MLZH 1SJHB 3PNWB 5IB4A 1K4CB 4O58H 5FB8B 3V7AE 4G9DB 5IMKB 3GSNA 5CHNB 3W9EB 1X5YA 3QJFA 4CNIA 3GBML 3VWJD 3DETD 2NR6D 4I0PA 1OP3H 5ISZA 2BNUB 2EIZB 1K8IA 4TUJB 1C5DA 4N9GA 3O6KL 4H0IA 3MRCB 2WBJA 1J88A 4MCZA 1UB5A 3O4LA 4XP4H 1A3QA 4ZUTB 5FYLH 4WGWB 2DLEA 3GJFB 5HHMB 3E6FA 4LSPH 3DX9A 1FYTA 1M71A 4WW2B 3MA9L 4MB3A 4F9LA 3N0PB 3LH2L 5JPMA 4BYHA 4R4ND 3TH2T 3PGCB 1UA6L 1QLEH 4Z7UE 4PJXE 4POYA 3MJ8B 3ALXA 5J1TC 5EOCH 1OW0A 1LE9B 4H26A 3JXAA 5C0AB 4QRRA 1SYSA 2VLRA 1VADA 4B0MM 5KBNC 4M1DL 4HBQA 3WFEH 5MI0C 3X13A 3RWHA 4BQ6A 1Q9LA 3ZZ1A 3JV0A 4I18B 4RIRA 2ED7A 5C0CB 3PWVB 5J11C 5HXMA 1XIWA 1OAUH 1V8HA 3QT2A 1A64A 4N8VG 3ZDZE 5D7JC 1T5WB 2F53D 2OJEA 3NACH 2VLJD 2GTWA 5CIPH 2DDQH 1RMFL 1MLCB 3BIAX 2CDGA 3P0YL 2XIDA 4LU5H 5I66B 4F7PA 4CN1A 3PDOB 3UTSB 4KJWD 4OUUA 3S98A 2FJGA 4MGXA 3MLPA 1R3JA 1PG7H 2NY4D 2RB8A 4JAMB 2J8UA 1S5HA 5L2KB 3WFZA 4ZO6A 2R4SH 4MNGA 4ACPA 4BFGA 3S96B 4NWTL 1FQ9C 5C92A 1F4HA 3AU1A 1F2QA 4YDVB 5HI3C 2FGWL 2JLLA 3PGFL 3ZDYF 1JK8B 3EDJA 2V2TB 2NY7L 2WBWB 3WL9A 1AGFA 3T1FA 1E4KC 2OI9B 1W72L 1JN6A 5JXAL 3GSQA 1U93A 3D0LA 1RAMA 1EAPB 2R9HD 4JZNB 4K3HA 5C6TH 3OGCA 4PJCB 5ISZE 3O3AA 3SDXB 4XC1L 2CRYA 2IAND 3BJ91 4KK6D 4PG9A 2LVEA 3BOVA 5F9WC 2X44D 3SDDD 1YPZA 2H26A 1N64H 3KPQA 3LKPB 3FL7A 3KPSD 4PS4L 5J1SC 3O4LE 1IGMH 1IGFH 2DAVA 1AY1H 2HJFB 3BDXA 3C8HA 2QQLL 1ZWIB 3STLB 5CZXD 3TA3A 4PGJA 3HZMA 2Y06H 2I9TA 1YNTA 2YXFA 3QEGL 4S10A 4UT6H 1JHKL 1FYTE 1RZJL 4DUVA 5MEOA 1OTUC 5KVEH 2COQA 2D3VA 2VLKE 1MIEL 2F54A 5ANME 4FXLA 5INCB 4OB5H 5F7EL 2LU7A 4DN4H 4QY8B 4FS0A 3MRQA 1HYSC 1T1YB 2B4CH 2EO9A 2XN9D 4OF6A 4JKPH 3MGTB 2C1PB 1U8LA 1EK3A 3HMXH 3MOQA 3EDFA 4QRRE 2VLRE 4JRWA 4KZDL 4P5TB 4G6AC 4KPHL 3TA3C 1GGCL 3QPXH 4DFHA 3WKNA 5AZ2L 1LD9B 2FBJH 3CFKB 4NZUL 2EICA 3GI9H 3V6BR 2Q7YA 3EZJB 3FB7B 4HD9A 1CLZH 4TNWK 3STZA 2Y07L 2E9BA 1JGLL 1KF9B 1E28A 4G42A 3QIUB 4D9QE 4LLDA 2QADC 3MO1A 1HHIB 2Z35B 2XRAL 3F8UB 4L4VB 2EH7H 3VD9A 3VG9C 4PUBL 2E5EA 3LN4B 3GHBH 4NUJB 3LRHA 4C4KO 4R26L 1AGCB 4KROB 2J8UE 1WZKA 1LP9A 2GQHA 4K23L 1BAFH 4LKXB 4MNGE 4HKXB 1YMMD 3FZUC 2ZP0T 2ZUSA 2Z9TA 3V6FB 1VFMA 1HHKB 5H2BA 2OP4L 3FO9B 3QH3B 1H9VA 3G08B 3CFEB 4UDUA 5EC2A 4U31A 3C6SA 3KDMA 3OR6A 1BEYL 4PRNB 2NY6B 2PYEA 4XX1E 2HN7A 3S37X 4W4OA 5DHVH 2VH5H 5L0QB 3IJSB 2ID5A 5DJ6B 3RY5A 1G9ML 4M8QB 2HMID 2F58L 1YPZE 1JV5B 1P7QA 3X3FH 4Y89A 1PSKH 4EUPG 2JIXA 2ZCLL 4R0LC 5C0IB 3WD5L 3SE3C 2P8MA 2W9DH 1SEQL 3DSFL 2F54E 1NLBH 3VXPB 4OF7A 4RNRB 1FFNA 5J4MA 3BO8A 1A3RL 4ETQB 2H32H 1U41A 4NQEA 5CJ5A 3C5SB 4DKEL 4HUWA 3GBNH 3PJSB 4FQHA 1GAFH 1I7RA 4U2ZA 3RI5K 4W6YB 4DGVL 2CIKB 4P9ML 1P4BH 5CIPB 2WUBL 5KVGH 3IGAA 3RNQA 4C83A 3GK8H 3RZCA 2A74B 5A2IH 5F7HA 2YUVA 3QRGL 1OCWL 5EPMB 3AVEA 4JFQA 1RK1A 5HVHC 2B2XH 1KCRL 1KB9K 2GSGB 4L3CA 5CBEB 5CZVH 3RKDC 1MLBA 4MQ7B 5I1HH 5EOCJ 1HYRC 2MHAB 3MNZA 3HS0B 5BXFA 1AFVH 4NM8L 4M5ZL 1R5WA 3HI1A 3KYAA 3SDCB 2OL3L 3NPSB 2GAZA 1HXYB 3QXDA 5DD0H 3BUTA 3EJYC 3KYOA 3T77B 5K59E 2HKFL 4NRZB 4XPGL 2DS4A 4H1LH 3MMEB 1FGVH 1U58B 1LP9E 1VKXB 2VXUL 4Z7QE 5I75B 1A9EB 4FQJH 4HFUH 2VNCA 3U9PL 3BIKA 4IMKA 1J7VR 5FYKH 4PY8I 4QT5A 1S7WA 1PQZA 1SJXA 1UC6A 2Z91B 1JPFB 5EBGA 5ICZA 3DARA 2O5XH 4OBSA 1BLNB 1EMTL 2PYFA 2OR9H 2PYEE 4KY1L 4WWKB 2IQAB 3JWOL 4YDKL 5BOPA 1ZA3B 3VDAA 1PVHA 1F6LL 1KCUH 4HWBH 4P3WA 3VMPA 4J8RA 3WCYA 3ARBD 1KG0A 2OS7A 4OUOA 3U2SA 5ETUA 4MMZC 4UTAL 4PGDB 3ARDD 1ZLUK 3MLRH 1DJSA 4PV9A 1TTGA 4C56A 5JTWA 4L3ED 4F58L 3U6RA 4JCLA 5C0RH 5DA0B 1MJJA 4JFXB 3A67H 3IFNL 4UAOC 5CGYD 2DQDL 2MFNA 4QHUB 3HZYB 1WAAA 4HZLA 5EFIA 4X9HA 2PF6A 4JFPA 4J6RH 5DVLA 3P4MB 4YBHA 4YQXL 3QWQB 4I3SH 1Q38A 2L7UA 3NCCB 1YNLH 3BWAA 3CGTA 1RPQA 2Z31B 2HFTA 1B0GB 2CD0A 1HIMH 12E8L 4H0HB 2RAMA 3U0PA 1I3GL 5DQDL 3T65B 5I1AB 3DMMD 2Y1VA 4LSSH 4P2RA 3PL6A 4JFYA 1H5BB 1LEIA 4U3XA 1FVEB 3BPLC 2AXGA 1IAOB 4XPAL 4YE4L 5BVJA 3QEHB 3S5LB 4I48B 1CFTB 3TYFA 2ATKB 1CR9L 5HY9A 3V5HA 1QYGH 1MHEA 1T1XB 2JTDA 3K1DA 3H42H 1EHNA 3LZFH 1U3HB 5BW7A 3DPBA 1IGJB 1H3VA 4HV8B 3DSNA 1X7QB 4OZFH 2DQIL 3C9NB 5T3ZL 4OD2B 5KSAA 3EHBD 4JM2F 5ADPH 4YXHH 3ULVE 4R7DA 4Z7OE 4P5MA 2NY4B 3HRPA 4UB0L 5DO2D 5ERWA 4XPBL 4TNWF 4AY0A 5TE7H 4L3AA 4OKVA 4NDMA 2FATH 1IFHL 1OWWA 2E9WA 4PRHE 2VZTA 1ORQA 4C56E 4WUKL 4HT1L 2HVKB 4OCLC 3RWCA 4YX2H 3NMEA 1S7XA 2X40A 5JOPD 4JPWH 3DVNB 3TT3H 3CCHA 5CEZH 5IHUL 5BRZD 1WAAE 2FJFB 3UBXG 2GSIB 5IFHL 3GIVB 1K3IA 5D9SB 1CT8B 3OF6D 4GKSB 2IPTL 2JK5B 2YXMA 1MF2L 2FEDD 2OZ4A 3SDDB 3RNKB 2MCPH 3SKOB 1QPPA 1ONQA 3KPSB 1VENA 4PJAF 5GISL 2AJZB 4Z7NF 2AJ3B 3L7EB 1GGYA 2J1KA 2BSRB 5KW9L 1AGEB 3KXFB 4FQLL 4AH2B 2EDFA 4XPFL 3QQ3A 1I85C 3AROA 1N0XH 2VE6A 4M61B 4OZGE 1INQA 3BUYB 3PP3K 4LGSB 4P2RE 2BNRA 4TSBL 1ORSA 5E2VH 4FFYH 3QUXA 2BOCA 4BZYA 2WIIB 5JIHA 4O00A 2VZSA 2XN9B 2ATPB 4ZTPH 1EPFA 2XWTA 5TJWK 1RK0B 4YGAB 4D94A 2P8LA 1T0NA 3HPLB 2CQVA 4P4RA 2WSKA 3CLEH 4NO5B 4HK3N 5FO7A 4D9LL 1T5XA 3RI5F 3U7AA 3O2VL 3FO2B 4MAUH 4KTYA 3RVTC 1IGIH 5F96L 3SE9L 3WMSA 2GUOA 1RI8A 1OAXL 4RFNB 2VO5A 4RAVB 4XVSH 5T3XE 2FSEA 3HC3L 3WS6A 5C70A 1OGAD 1HZHH 1YEJL 3DV6B 5E4IA 3SBWA 5FKPA 1F42A 1T89C 5HVWA 2E7CA 4FMFA 4A2MA 4HHAB 1AQDA 2FCBA 4PJIF 2QBWA 2AXFA 5SWSB 1RSFA 1C7TA 4HS3B 2EO1A 3BKMH 3G6DL 3ULUH 3NZHH 5T1LD 4YDLC 3D48R 3VXNB 2OR8A 3TM6A 2Z4QA 4AIXA 1YEGH 3T0EB 3AM8A 3GJEA 4KXZH 1F58H 2HH0L 2IGFL 1L7TL 4U1IA 1T2JA 3VU2A 3SBWC 1MQ8A 5CBAB 2AEPH 5DJ8A 5FO8B 3DI2B 1JYWA 2MTPA 3GSUA 4FQPA 3RGVA 1JFQL 3H7BA 2F5AL 4M00A 1AGDA 4DKAA 2BJML 1TZHA 4IRSA 3CZJA 3L5WA 2LFGA 2ED9A 1A6AA 2KZWA 4XWGH 1TZGH 3WDJA 1J10A 3SGJC 4LLAA 1O7SA 1U8QB 1GPOL 4CVXB 2HVJB 2R0LH 4JFOA 3TO4A 4M7KH 4S1RH 1I8IA 4R8WH 2UZIH 1HEZB 3JWDC 1B0RB 4YDIL 3QDJA 4Z77B 4OFDA 4OAWA 5IVNA 4Y4KD 5EO1B 3RGVC 3V2AR 3BRGC 3MRNB 1DUYA 5KVFH 1FJ1B 2FO4A 2P5EA 1QR4A 5JIPA 3QULA 3VGHA 1NH6A 3BGFC 4YNYB 3TNMB 1H3PL 1YEDA 5GIRB 3ZMRA 1NUNB 1MREH 5EA0H 1T1ZA 4KQ3L 4XTRC 3ECBB 2VZOA 4FFVD 1N7ML 5DRNB 4MXWH 4FTVA 1A6WL 2ARJQ 4Z7VA 1KJ2L 2NY1D 3KPRD 2FO1A 3G5YA 4O4YH 3RWDA 5LCVL 1NGXA 2R4RH 4HIXL 1MCNA 3OKNB 4WI3A 3RPIA 2ZUYA 3EYOA 4MJIB 3S4SA 4M6AA 4PJ9B 1UVQB 2X4UA 4ZDHA 3UJTH 3ZSSA 4L8BB 1SEBB 1NDMA 2NXZD 3NVQA 3WIIH 1NANH 1I1AD 4UIMB 3INUL 2V7NA 2QV2A 4HIEB 5HYJA 5JW4M 3SY0A 1NL0L 1ZLUH 4JANB 3RL1A 2MNUA 4XNMB 5GS0H 1VFBB 5F97E 4PPTA 5GGSY 2XPGB 1NCBH 1IE5A 1DLHB 2LE9A 1CXIA 1CFQA 4NPYB 3CXHK 2HAZA 2PXYA 3QIWD 4GLRH 4HJGB 5ID0A 3JVGA 2VIRA 2HFFA 4LCUA 3G5ZA 2MQ3A 3OAZK 1QSFA 4R4FL 3MUGB 1EIBA 4ZUWB 3MLXL 1UM4H 1EO8L 1D9KA 4OT1H 4RMWA 1W72A 2A6JA 3QDJE 5HGDB 1ES0B 1OAQH 5ALBL 4ZFFB 2Q6WB 4M6NL 1QA9A 2PO6C 3O9WC 4C55A 5IBLD 4R3SA 1V3LA 5EZJB 3JV6B 1CG9A 3QQNA 4FQIH 3JTSB 1FIEA 4XBGB 5T1DH 2P5EE 4DN3L 4UV7H 4XBPB 3EJZC 2D4FA 3DMMB 1S7QA 3TBVB 5IMOB 1JGEB 4HDIB 5GRVL 1Z3GL 1MCRA 5E4EB 5DJ2A 3TIDA 1FVDA 4WUUA 3TVMD 3VXOA 1EFXD 2YD9A 1XF3A 2YN5A 1TQBC 1DBBL 5JORB 3ZYJA 4FTVE 3D85A 2N7BA 43CAB 3ZSTA 1RVFL 1TQCC 1AD9B 2HWZL 1Q0XL 2DLGA 4TRPH 4OV5A 1YZZA 4ODVH 4KJYB 1T6WA 3FB5B 1OHQA 2W9EH 1DBJL 2XKNA 4WHYG 3UZQA 3OJDB 5EBMA 2VITA 4PJFB 1ZTXH 3D25A 1OF2B 5HHVL 1V3JA 3B2UC 3WIFA 2WINA 3O0RH 2MWCA 2Z8RA 2ZUQC 1FNLA 4R97B 5EU7C 5C0BB 3VFWB 3RTQA 1RZJC 3KYNA 4XNYH 5DRZA 5IK3A 5IHZB 3D2UD 5I8KH 2VXQL 4QGYA 1NC4A 5KS9F 3VXUD 1A2YA 3UTTB 3VXQB 4BSVB 1G9NL 1VACB 3EYQD 1MPAH 3KWWA 4C54A 5D6DC 4YPJA 4Y5YA 5KSVA 2OQJB 4MD4A 3M1BB 3EOTH 1WTLA 4X8XA 1U8KA 1YECH 5CEXB 3R8BB 3QAZB 3MRJB 2DLFH 4JDTH 1UM5H 4KUZH 4MXVF 2BY2A 4PRDB 4LHJB 1MAMH 4P4KD 3BJLA 3CFCL 5A43C 3TFKD 4QXWA 2BOBA 4PGBB 4OLXL 4L4TA 2CXGA 1N59A 3MOBL 1MUJB 2HTKC 4OI8A 3OAYK 4PB0L 5IWLC 3OV6A 1M7IA 4J1UB 1MJUL 3CFJB 3MGOB 3BQUC 3IU4L 4M93B 3TO2B 4YHKL 1FCGA 1GGBH 1VPOH 2VDNH 5FHAH 5AAMA 3TIEA 5J3HD 1A7PL 3BKYH 3EOBB 4ENEC 3OPZH 2XZZA 3NOIA 5I1CH 3ZTJG 2A77L 5B38B 4NKDA 3STBA 3CD4A 3VGEA 2NMSA 2XTJD 2XTLA 3GGWB 5EU7E 1MFBL 2OJZH 4JFFD 5HHOD 4WUUE 1ZT7A 3UEZA 1KB9J 4NNXA 4P46B 2CK0H 1RULH 3MV8D 2XICA 5FYJD 1CLYH 2B39A 2HYMA 2VQUA 2YRZA 5D1QC 4JZJB 1T03H 4CN4A 3VW3H 4ZS7H 3MCG1 3O45B 5EG6C 1RZKH 1G9MC 2BY1A 3VD5A 3U4EA 4QXTB 4XP6L 2VZUA 4N0CD 1IT9L 2AV7B 2DQGL 4Q58C 3IS1X 3QG7H 1LO3H 1BZQK 3BZFA 1IEHA 3OAUL 4JGJA 5IVXF 4K9EH 2HLFD 3LMJH 4EQ2A 3TBYA 1DN0A 1MWAH 1HH9A 1UXWA 3RVVD 1LE5B 1KLUB 5GS2H 3MA7A 3MV7B 4JFDA 2H2SD 5FHBL 5MEPA 4XVUD 3CH1B 1NCWH 1PG7W 1FGNL 1YEEH 5GGRB 2OL3A 3U4AA 3X17A 5JO5A 2D0HA 4WV1B 3MPCA 5K9OA 5LWYL 2BHZA 2C7UA 3VGBA 1T0MB 1OGTA 1YEHH 3BD4A 3TV3L 4M62L 5EOQH 3C09C 4OI7A 4Y5VB 1E4XL 3BSZL 3QPQC 4XPTL 1PLGL 5I6XB 2B0SH 1LEGA 4IIQA 4LSTH 3ARUA 2CRMA 1FL5B 2Y4SA 2HFGH 2ARWA 4IRZL 5BMFH 1UQSB 3M8OL 2ADJA 2ITCB 3H6JA 4RGOH 5F7FA 1MCJA 4GG6B 4HS6A 3FT3B 1UCBH 1YN6A 4I3RH 1J1XH 1R0AH 2DTML 1NKOA 5DVMA 5ELIA 3MR9A 5C6PB 1ERNA 1JHTB 4WRLA 2YKLL 4ISVA 4E0RB 5BVPH 4PRIB 1LK3H 1WEJL 2HJLB 3BPOC 2BSSA 3RIFK 2DYPB 1PX3A 4NKIH 3Q5OA 3C5ZA 4Q9BA 3OR7A 4X98A 5JW5B 1AQKL 4POZD 5FOBB 1SYVA 2VERN 5E1HB 2VDOH 3IVKB 4OQTL 4M02A 5FYLD 5JPNB 5D70H 4OIIH 5DZLA 3FQTA 4KK9D 4APQA 4MNHB 5KSBF 5BV7H 3ARFD 5EB9A 4LSQH 5CSZB 3JWOC 1KFAH 4N0YL 3MQIA 5ESAB 4GMTL 1WBXA 3V8CA 2YR3A 3B9KB 3RFZC 4RWYL 2X09A 4G8IA 4WU5A 1HOCB 3P4NB 1KUMA 4NQDD 5IG7B 2X9WA 4K2UH 4LRIC 1ED3B 3FTGA 4PBXA 4ZMAT 4M7JH 5I18H 2HG5A 1OQXA 1UGNA 3MRLB 4XB8A 4GUPA 5GRUH 1IM9A 3NIFE 5KANI 1U8IA 4EDXB 5J1AB 4LIQE 4RMQA 4WFEE 3C60B 3K2UH 4JFDE 1HE7A 1I7ZA 5KSUA 5I1DA 1U36A 3QWOA 3BW9B 4LVNC 4O2EA 3KPRB 3BEVB 2GY7B 3D69B 2YPVL 4AL8L 4V1DD 1WC7B 1BQHG 1KTLB 2CLZA 5CCKH 3DBXA 3KHOA 2IBGA 5D72L 3CK0H 3QXWA 3I02A 1I4FA 3QHZL 2ZPKL 2E6JA 5E8DL 3S34L 2NZ9D 4LPCA 4EN3A 9CGTA 1MI5D 3CDCA 3C6LC 3BP5A 1I1AB 4YHLH 5BO1H 4PY7A 4POUB 2Q86B 2DQEL 1FC1A 3O81A 2A9NH 4JFEE 4JGMA 5E24E 4D0CB 4NN5C 4JY5L 5B22A 1DQTA 2ITDB 4Y2DD 4U1LA 2V2WB 4Z9KB 5JHDD 3GMPB 1A6UL 4MD5A 3PHQB 4JRYB 1Q9KA 5E1AB 2EYSB 3TBSA 5D7LA 3WUWG 4AIZA 3JV5A 2A1WH 4I2XA 5I16B 5EZIH 5K9JL 5IHBA 1R3KA 1J05B 4N9OB 1JWUB 4WU7B 5DMGC 1FE8H 3P9MB 1DQQB 4G8EA 1CIUA 3WFCL 1OSZB 2UY6A 2Z93A 4WNQA 2CDFA 3PWJA 1ZA6A 5IV2B 3UC0L 2FGZA 1OD7A 4XAKE 4AEHH 2IH3B 2E7LA 1VFOA 2BSTA 3OGOE 2C3HA 3BHBB 1K2DB 3IFOA 1HQ4B 3IDYC 3BYTA 2ED8A 5EUKA 3WE6B 2N1KA 4FFZH 2D4DA 2EXYD 4EIZC 2IMMA 4EEEA 1I9JH 1KJVA 4EDWL 1NBVH 4UNVA 1YQVL 3QDGB 4LCIL 3AB0C 1FO0B 3V0VB 4YAQA 4G8FB 3R1GH 1MAKA 1KNOA 3V9FA 4CBPA 1KJ3L 1T2QL 4YO0A 3DHMA 3EO0A 4XCYB 3W9DA 3PIQA 8CGTA 3ARTA 3QHFL 1MEXL 2R0KL 5F8RC 4OLWH 1KB5H 2XV6B 4O5LH 2X5PA 4XCEA 1ND0A 5FUOH 2GJ6A 5KZCB 4PJGB 4ODTL 1AIFA 4TTDC 5C07B 4OCXH 2P46B 2C1OA 4LPTA 2VXTH 1FFOA 5F7WC 3L3KB 2B7DT 5FUCC 4U1MB 4NBZB 4JRXD 1NGYB 5MENB 1FAKT 3GMMA 3HE6C 3T0BA 4JJHA 1O5DT 2Y7QA 1HILA 3ZDZF 4FZ8L 3U7WH 3NCJH 4Q6IC 4F2MA 1RUML 5J12B 4OLUH 3VE0B 1NC2A 4KKCC 3EYVA 3VH8G 3QUYB 3C8DA 4LSVL 1AI1H 5MERB 1S9WB 3V7MA 4LOUC 5MP6L 4PP2A 5D7LE 4QRQB 1HHJA 5DWUL 3RAJL 1QTYT 4I2XE 4X9BA 3CDGB 3T4AA 5JHLL 2A83A 5J9PB 3VFUA 3NIGF 4I3GA 4RMSA 3DX7A 2APFA 2IF7A 5FK9B 4RQQA 1OARH 3OAYH 4PLNC 4ZS6C 1AO7A 3PUCA 1T21B 5F6HI 2VXVL 2GJJA 3FMGH 5K93A 5F72S 4A6YL 3LQMA 1OSPL 3LIZL 2ESVB 3L6FB 1WCBB 2XWJA 2VMFA 3TBTB 4OF3A 3PABB 4DWHA 4TVPE 1JZ7A 4QNPF 1GZQB 3OXSB 5HHXL 2R56L 1BZ7B 3ILPA 5DJ0B 2BDNL 4X6BB 1I1YA 2IH1A 4BZ2L 4XI5D 4FABH 5JQHC 1J8HB 15C8L 4GBXC 3CVHH 3PWNA 5FKAA 5DR5H 1TPXB 3RIFF 4QXUL 4XCCL 2XTJB 1DQLL 3LSOA 4P0DA 1EHLL 1NFIB 4WTXA 2D7PA 4ZD3H 4BM7A 2Z8SA 3HHRB 1HYSD 3OKYA 1X6NA 4GMSH 4JO1H 2GJ6E 3K74B 4PJ8B 5C7XH 3ZKNC 2DM7A 4GXVH 4DTGL 4P23C 3QCTH 4OIBA 2HT3D 3WSQH 3LRSA 2B5IB 4G6AD 3GIZL 1EERB 3OXRB 3B9EA 5EN2A 3O6FC 4ELMA 1IC4L 2P7TA 3I9GH 2ICES 1FH5H 4U6YA 5EO9A 4PGCB 1DUZA 1FNFA 1JHLL 4P2QA 5GGQL 2HTLD 3WNOA 4DCQB 2R1YA 1LVEA 3I6GA 2P4AB 5IOPA 4G7YL 5F1OB 1T2XA 5FYKD 2DI9A 2X4OA 4LCYB 3T0AA 4JO2H 3SJVA 4QWWD 4F9PC 4MYWB 5DD3H 4LVOB 1JGDB 4PREA 3GSNH 4OLZL 4AMKL 4NZRL 1E4JA 1CFSB 3RDTD 1NEZB 5CEYB 2J8UF 3TBWB 4Q0XL 3FZUD 3VFTA 3K3QA 3MBEB 4WHTA 1SJEB 5DI8B 3GRWA 5IQ7L 4MDJA 1P7KA 3K4AA 1HXMB 3BH9B 1AO7E 3CXHJ 5T1KD 4HC1L 1G7IA 2A73B 4QHLB 3DECA 4IBLT 2EE3A 1XH3A 1T80A 1E6OH 2AK4D 3VCLA 1KCKA 1VGEH 2X7LB 3U36B 1UKTA 5FAAA 1A4KA 4OCRL 4NCC1 3LOWA 3JZ7A 1YPZF 3R06A 3MRKB 4OF5A 1OOAA 1R3IH 4BKLA 5DD6A 3EAKA 3C5JA 2XQYG 1G1YA 1RZFH 1PY9A 3Q1SH 4DK6A 1IZKA 2ARJA 1Y6NR 4L29A 1P7HL 3KG5A 4KJQD 4WTWA 3QA3A 4K7PH 3WNPA 5D1XC 4IEFB 3UTQB 2ZCKL 4Y4FD 1S7RB 1G84A 3F7RA 4S0SD 2V17H 3OQ3B 1FNAA 4PJEB 3HZVA 4OCMC 3PNWA 5FB8A 1RZIA 4G9DA 5IMKA 3Q2CA 1HQRA 5CMAB 5GGRY 5CHNA 3W9EA 1IJ9A 3QUZB 1DFBL 1TIUA 3HCVB 3QUML 5CJOL 2UVFA 2CKBL 5C08D 4N68A 3G6AB 3SE8L 4GRLC 2EIZA 4TUJA 3ZTNH 2AJVL 3FHAA 3X3GH 3MRCA 3VD4A 4ELME 3IS0X 4M03A 4FNLH 3QWRD 2H1PH 5EU3B 2VISB 4ZUTA 5JQ6H 3KPTA 4P2QE 5A2JH 3L3IB 4JFHE 4GW5B 2NW3A 1BX2A 2GCYB 4WW2A 1XMWA 3D0VB 4HPOL 3VGDA 2EXWD 4CMHC 4K3JH 1L9MA 3SKMB 3PGCA 3SJVE 4V1DB 5FYKU 1I8KB 4YBLB 3QFJA 3MJ8A 1K3ZA 1TENA 3BVNB 1CGXA 4DZ8B 4FMKA 2CIIB 1BQLL 4WVRA 3P40A 1K4DB 4F33B 2KUTA 2V5YA 1Q94B 2PW1A 2WMPA 2WQRA 5C0AA 2P47B 2MMXA 2F5BL 3SPVA 1Q1JL 3V4PH 4G9FB 4I18A 5DHYB 2DI7A 3PWVA 1A5FH 2FD6L 4RMRA 3S97C 5SWQB 3WN5B 3UROR 1T5WA 1FORL 4KKAC 2F8VA 4NWUH 1MLCA 3LKSA 4FG6C 5SX5K 5I66A 5I74B 5DZNA 5CD3B 5DD5H 3PDOA 3UTSA 1QRND 1KTRL 2D0FA 5GRWA 3FQUA 1N3NB 4JAMA 2EDDA 3L9RB 2A38A 4K94C 4EBQH 1WUNT 4JZOB 1BFVH 5DK0A 4KJPC 4KV5E 2KL6A 3S96A 1RUAH 4BZ1L 2QSCL 4YDVA 4K3DL 1M05A 2V2TA 1FRGL 1XR9B 2K3TA 2HRPH 1F90L 4ZAKC 4QRPD 3W2DH 2DKUA 1EAPA 3K7UA 4JZNA 4LARL 4PJCA 2G60H 3O8XD 1BM3H 3SDXA 4P5KA 1YEIH 1QBLL 4LLUB 5IW1B 4NO2B 1P4IH 2CJUL 1P5UA 1FLRL 1C8PA 5DEGB 4JM2D 3QFDB 3PWPD 3LKPA 2FB4L 2HJFA 1ZWIA 4KRLB 5DMYA 1X5XA 3GSNB 1UH2A 1F6FB 1RJCA 3RU8L 2WM0A 1CDYA 3O6LL 4KKLC 5ISZB 3MLSH 1K8IB 4MWFB 3PXJA 3ARXA 3IXAB 1IKNC 5DK3A 1QP1A 3B9AA 5H37H 5HHNA 4D3CH 4F57L 4F7TB 4HWZB 2QQNH 5C1MB 4QY8A 1UB5B 2WV3A 5MI0B 3FJTA 1LQSR 3QFJE 2L7JA 1T1YA 2X1WL 1AXTL 1FIGH 3E6FB 5J11B 3MGTA 3CDYA 2C1PA 1FYTB 5MEQB 1PJ9A 5D7JB 1CN4A 2KZ1B 2VLKB 3HMWL 3AAZA 5E6ID 5ANMB 2LU3A 3ULUD 2XKSA 2JJVA 4P5TA 1BBDL 4MQSB 4LSUL 4RRPG 4F7EA 1LD9A 3MODL 3CFKA 3VFOB 5AG8A 3ARGC 3ULVF 1XGTB 4GG8A 3FB7A 4PJ5D 1CE1L 4BUHA 3QI9C 4ZPTB 4LQ1A 4IJ3C 4BELD 2CLVB 1YC8A 1VADB 5GSRB 3UTSE 2P24B 4KMTH 1HHIA 2Z35A 3NH7L 3WNMA 4PGEB 1Q9LB 1P84K 4L4VA 3MLWL 3BN3B 3LN4A 3SGDH 2XA3A 4NUJA 5C09A 1JF1B 1RIUL 4MVBD 4Y4HC 5D93C 1AGCA 1QEWB 2VSCA 3KLHC 3QZWB 4LKXA 3QXUA 4J4PA 2X4NB 1ZEAH 4Q2ZB 3V6FA 4XB7A 3FO9A 4L4JA 3QH3A 4F7PB 4R90H 3CSYB 3G08A 1OAKL 1R3JB 1WAAF 3N1FC 2Y72A 4JN1H 1KEML 1JTOA 5HGAB 1D3CA 2RBLA 4PRNA 5F9WB 4YDJA 1YEKH 4LVHC 4AEFA 3B4NA 1KPRB 5EIIB 3ARSA 3SDXE 3IJSA 5DJ6A 1AD0B 3DXAB 4G8GD 1ZHLB 1JV5A 5DQJA 5GSVB 3VFGH 1KGCE 4P3CH 4X6FB 3S5LG 3HZKB 3OGCB 5TH2B 5LXGH 5C0IA 2VWEC 4XNUH 3ZT7A 5K9KB 2VL5B 2DL2A 3O3AB 4F3FB 2AJYL 1CDCA 4X5XB 4PJDB 4PJHE 3VXPA 4RNRA 5KAQF 4ONHB 2X1XR 3KPQB 3IAGC 4ETQA 1AGBA 3ULVH 4XVTH 3HNVL 3C5SA 3PJSA 4M6ML 4ZFOB 5JUEH 4Q9QL 3IKCB 1CL7I 1XCQB 3FRPA 3TA3B 3BWUC 4NZTH 1YNTB 3D39D 2ICWJ 5GGSA 5MEOB 3QDMD 5SX4I 1WBYB 4PIRF 3SO3C 2P45B 5I71C 4BJLA 2A74A 4HXAL 2QADB 1QR1B 5EPMA 1I1RA 2GSGA 2CRIA 2MOVA 5CBEA 2JB5L 4JR9L 4MQ7A 1SY6L 4UOW0 3VG9B 1KENH 3AREA 2JF1A 2MHAA 5E70A 3H9SD 4BK4A 1U8LB 5D71L 3ZE0E 5L8LB 4JPVH 4J3SA 3MV01 1IC7L 1HXYA 1H15B 4AEIL 3FKUS 3O2WH 4KI5E 2E3VA 4L4VE 5ITBH 1A7NL 4FQXD 4XBEH 4NRZA 5C09E 4P2OD 3T2QA 2EECA 3MMEA 5GS0D 1T3FB 1U58A 1VKXA 2Q7YB 1A9EA 4CW1A 4ZPVA 2APXA 4Y16A 2X4TA 4WI4A 1JPTL 2GIYA 1E28B 4G42B 1CGSL 1M1SA 2VWEE 5I15L 2C26A 5TF1L 1ZVHA 4NP4L 2Z91A 1JPFA 5J8OA 4JVPA 1U92A 4EVNB 1Y0LB 1F3JB 2O26U 1BLNA 1DVFD 4WWKA 4P59H 1LP9B 1ZA3A 2EDQA 2JJSA 4WO4D 2ZNXA 2D03H 1U8HB 5H2BB 4H1LG 4HJJL 3SQOH 4H8WL 5JZ7D 4UDUB 1B88A 5EC2B 1QO3A 3GM0A 4KRNA 3KDMB 1Z9SA 3NCYP 2I60L 3UJIH 1A47A 4EI5A 3BRFA 3K8MA 4Z5RB 4MZ2A 1PX4A 4ZTOL 5FM5M 1CFBA 1CF8H 5F89A 5T3XH 3W0WD 4QHUA 3V4UH 1A1OB 3HZYA 3BKCL 3VWJA 1BQUA 2YBRA 1G6RL 1P7QB 3KPOB 3KNBB 4EI6B 3P4MA 4NQUA 4MLSA 1AE6H 3AUVA 1LILA 4QTHB 4H0GA 1UACH 1NSNL 1IAIL 4CMMB 5HVHB 4FZEL 4KI1A 5HGBB 5CKAA 4FQ1H 3O3BA 2EDBA 4EI5C 3SCMC 4GQ9H 2L4OA 2VDRL 4X6EB 1QD0A 3T65A 5I1AA 1SHMA 5EOTA 4NJ9H 4HUWB 5B8CA 1BREA 4KQ4H 5L6YL 1FVEA 5A2KH 3QISA 1IAOA 3RUGB 3DUUB 3G04B 5E08L 5KG9B 3DETC 2NR6C 3WLBB 5GGVL 1DZBA 1JPSL 3KAAA 3QEHA 3REVA 4R2GC 2W65B 5FUZH 4NM4H 4I48A 4MMXC 3VWKC 2ATKA 5J6HB 2DRUA 5JR1L 4JFQB 2OZ4H 4L3CB 4PB9L 1MCIA 1W0VB 3PHOB 5SX5H 4P9HL 4OLYH 5B4MC 4L1DA 5DTFB 1IGJA 2F53A 2NX5B 4HV8A 1V7ML 2GAZB 1X7QA 4B41A 5JXED 3C9NA 2OK0L 4OD2A 1GIGH 4PRPB 1EBPA 3EFDH 4R4NC 3S37H 5DJXA 3WKML 1S3KL 3WEXB 25C8H 4C4KT 1F00I 1QLRB 4OJFL 1W0WB 1KELH 1NAMB 3S3SA 1JUFB 4QT5B 1S5IL 1S7WB 4TUOA 4YIQB 3SOBH 5E99L 1MRFH 2ZCHH 5ICZB 5JOFB 3V4VL 1U6AH 2HVKA 2PYFB 2DBJA 1HKLL 7FABH 4XPHH 4J3WA 4A6YA 4J8RB 1MCFA 3DVNA 3RL2A 5ETUB 5HBBA 3KJ6L 4KJWC 2BRQA 3O9WD 1X4XA 5BZDB 2GSIA 1IGCL 5D7SH 5E03A 2R15A 3GIVA 3G6JE 3BGAA 1INEH 5D9SA 3MCLH 5E6ZA 4WJ5B 4GKSA 4PRHB 4PV9B 3SQBA 4E9LA 3SDDA 3RNKA 1FO0L 2BVPB 3EJZD 3SKOA 1A3LH 3HNTH 1F5WA 3KPSA 2R39A 3GI8H 1MJJB 2AJZA 3DHJA 2AJ3A 3F58H 3P11L 2BSRA 1MCEA 3BPLB 3KXFA 5TE4L 4AH2A 4AIOA 5CJQH 3UO1L 1BD2D 3IDIB 1D5ZB 3VXRD 4O02H 4Z7VF 1CZ8H 2N56A 2R9HC 3NIDE 2NLJB 2WIIA 3SHSA 3WXWH 4KDTA 5GS2D 1PKQB 2XN9A 2Y25A 4AK1A 2VQTA 4X6DF 2ATPA 5EBWA 3AXLB 1P9MC 4MSWB 4KK6C 1RK0A 4JFZH 1CFVL 3HC0A 2Q76A 3U0PB 4ZXBC 4OZGB 3HPLA 5JW3L 3PL6B 1LEIB 4NO5A 5F93C 4G6FD 5CZXC 1VHPA 3D3VD 4U0QB 3TT1H 5BVJB 2F53E 4RAVA 3T1WA 4PJAB 4ORGA 2XXMB 4PJ5B 4L8SC 2EDXA 1ZAGA 3L7FA 1YYML 3DV6A 4ODSL 3V5HB 5DDHB 3MRBB 2R8SH 1YEFH 4LKCA 1GYAA 5CJ8A 1MCPH 5SWSA 1FVCB 1F6AB 3KJ4C 3VXMD 3O2DL 4P57B 4L8CB 3S8WA 1YYLL 4HS3A 4BH8B 1UYWH 3SEPA 1YMMA 5EZOL 3IKKA 5KSAB 3HAEB 3VJ6A 1S9VB 3JV4B 4F8QA 3DROA 4HCRA 5ERWB 1AC6A 1MVUB 1X5LA 1LWRA 1KEGH 1WITA 4IRJC 1NCNA 4N1HB 4S0TD 5LGKA 1NJ9B 1NMBH 3BEWA 3ZKQD 5CBAA 4JB9L 5FO8A 2IANE 4JQIH 3LKQA 3WFBL 1ORQB 1IQWH 4M9PA 4ENED 1UA6H 1BIIB 1MOEA 3AFLA 3RWCB 3KPSE 1OT2A 1S7XB 1KPUB 5AAWA 1QFWL 3KXFE 4PJIB 4QEGA 4NQTA 2BVYA 2V9TA 5D7IF 4LFHG 4B7IA 3BESR 3MBXH 4D9RD 4M1DH 3WXVL 5I1EH 4CVXA 4Q9RL 2HVJA 4OTXL 5FYJL 4Z95L 1DBAH 1N26A 4M5YL 1BGXL 4OFIA 5D1QD 1WWBX 5DJDB 1ONQB 1HEZA 5D1ZD 5BOZG 3QBTB 2XN9E 3LEYH 3BPCB 4LCWD 4X7SL 5E00B 4CDGC 3QUMA 1RMFH 4Z77A 1L6ZA 3P0YH 2VE6B 4RGND 5EO1A 3MJ9A 3MRNA 1PEWA 1IAII 1ORSB 5CJXC 4U1SB 1OLLA 4TOYL 4YNYA 3TNMA 1JF6A 2A6KA 4NNYB 1DL7L 5GIRA 4PTTB 1ZSDA 2QSVA 3ECBA 5T5FH 2GT9B 1T0NB 2AKRB 3PGFH 1H3TA 3OSKA 1ZGLM 3I3EA 1G7MB 4RCAA 1T5XB 3E3QE 4YDLB 1DP0A 1QKZL 1W72H 3VXTB 3SE4A 5T33L 2GUOB 3BP6B 5SWSE 4XP1L 2FSEB 3O41A 3SGKC 1YMME 3U1SL 4GRMB 4QHKJ 4PJ9A 4X8JA 1G6VK 1U2CA 4CUCA 3LEXB 3SDAC 1X4YA 1I7UB 3FFDA 3BDYL 4S1QL 1SEBA 1KBGH 2GKIA 4JPKL 4X80H 3MLZL 4UIMA 2R2BB 2OSLA 2AXFB 4HKZB 5EIVA 4L9LC 3SKNA 4UIKL 4O2FB 1JHKH 4FP8L 2OMNA 3BZDA 1WISA 3QB7C 4JANA 5FM4A 3ARBA 4QHMB 3OB0K 1I9IL 4RBPK 4CL7A 1VFBA 5DJAB 1G9EA 1WWAX 3IDXH 1K9TA 2XPGA 2Z4QB 3ARDA 4H5SB 1OPGL 1W2KT 3DX8B 4XP4L 4L3EA 2UZXB 4N90E 5FYLL 3P2TA 2CDEB 3F6IA 1CGWA 1T6VN 3BZ4A 1FFQA 4MJ6A 4KAQH 5E8NB 2KPNA 3ELAT 4XWOC 1TVDA 3MUGA 4ZUWA 1CQYA 2UWEA 1MRDL 3NA9H 3RGVB 5IB1B 4HKBA 1BFOB 1QLEL 3H7BB 1CDUA 1TZHB 3BAEL 1ES0A 3L5WB 3VD3A 1WFOA 1G7HB 5EOCL 1JGLH 3LS5L 3MFFA 1LEKB 4U6XB 4OD3H 1NUGA 3JV6A 4ODHL 1F3DH 3WFEL 4JFOB 4MJ4A 3JTSA 4XBGA 3KPLA 5DRXB 4PUBH 4XBPA 3DMMA 2NXYB 4R26H 5IMOA 1OAUL 1JGEA 3PP4H 4HDIA 4K55A 4OAWB 1Q0YH 1DE4A 1UWEH 3HUJF 4LU5L 3KLSA 1EXUB 4X9GA 1DUYB 5ACZA 5JORA 2FO4B 1T7VA 1BEYH 4M6OH 4OM1H 43CAA 1JWSB 4U49A 3QDAA 5ESVB 1JPGB 3C6LD 1P84J 4HW6A 5D96C 3J7HA 3Q3GA 1HSAB 4KJYA 4KRMB 3FB5A 4XNQB 1QZ1A 2R4SL 4BK5A 2AS5M 5D5MF 3MRRA 5EORL 3OJDA 1EJ6A 1F02I 2DTSA 2F58H 3QCVH 5DK2A 3G5YB 1WWWX 3B5TA 4N0UE 5GRZA 5IGXH 3RWDB 5IHZA 3EOAA 3OWEA 1VESA 5C6TL 3ARWA 1GC1L 5C2BH 2PW2B 4X83A 1CDIA 2BNQD 3DSFH 4KVNL 3VXQA 3EYOB 1CTOA 2OM5A 5ABDE 1VACA 2R69L 2X4UB 4ZDHB 1MY5A 2OQJA 3HR5B 1N64L 4DKEH 3HB3D 3M1BA 1IGML 1CTNA 1IGFL 5CEXA 4L3EE 3MRJA 4DGVH 4P9MH 5I2IB 3IDUA 4UT6L 2HKHL 4PRDA 1KT2B 4XXCC 3IFLH 4X7FC 1FZJB 5BRZA 2PO6B 3A6CH 2A6IA 2UWEE 3O9WB 4PGBA 4NN6C 1DBMH 1W0YT 3QRGH 4HUVB 5FM5O 1OCWH 2FHCA 2XG5A 2ZJSL 4ZFZA 4LIQH 1MUJA 4MDIB 1CFQB 4HUMB 3KHQA 3CFJA 4JKPL 1P1ZB 2OL3H 3HMXL 2YC1B 2Z8WC 4XMKH 32C2B 5DVKA 4PY8J 3EOBA 2HKFH 1BD2B 3V6OC 1K5NB 1MCHA 1QFWI 4GAYB 4R96A 4XPGH 5F1KC 2KQNA 1TQBB 3SDYH 4WGVB 5B38A 1W72B 2EYRB 2FBJL 3EBAA 1PZ5A 2VXUH 3GFUA 3GI9L 3GGWA 5IW6A 1CLZL 4ZO7A 1TQCB 3U9PH 1UB6B 2C5DC 3NTCH 2KQMA 1WV7T 4P46A 4KMQA 5E2UL 2V9RA 2EH7L 4JZJA 3HE6D 1J0KA 4RWHA 4YDKH 3IRPX 3LPFA 4QXTA 2ZUQB 3O6MH 4I0PD 2DMCA 5DURD 1FVDB 2AV7A 4WUUB 1XF3B 4WEUD 1A7QL 2YZ1A 2ZZUT 1U8OB 4UTAH 5ESQA 1ZLSL 3H0TA 1OGAA 2WBJD 5H94B 1E27B 3U7YH 3O4LD 5J6GA 4LOUD 1LE5A 1KLUA 2K7QA 4KTDL 3V95A 4ONFH 4OV5B 3CH1A 3VA2C 4F37K 5E8EB 5GGRA 2DQDH 2DQHH 4KKNA 2VH5L 3BH8B 2HJKB 2J2ZA 1T0MA 5C3TA 3WIFB 3S9DB 2WINB 4YLQT 3X3FL 3RVWD 3LQAC 1JNLL 4JQVC 4K07A 4NJAH 2V5MA 4QRUB 1FL5A 1NC4B 5JOPE 1A2YB 2PN5A 1ADQH 4QRRD 5I9QB 1T1WA 2ITCA 1KTKE 3BQUB 4QYOA 3O3EB 5BRZE 1NLBL 1OM3H 1I3GH 4GG6A 4Y5YB 4MD4B 4JM4L 2DQUH 2IMNA 3C08L 3AS2A 1JHTA 4M3KB 1DLFH 3GJFK 2AQ2A 4E0RA 2B1HL 3MREB 3ZTJH 4HWEH 2HJLA 1P4BL 3O3DB 5GRVK 2FL5A 1NPUA 1IKFH 2BOBB 3U82B 2MKWA 5C3LD 4RFEA 3GK8L 5FOBA 3QXTA 1CR9H 3HKFA 3IVKA 4YK4C 4Z7WB 5JPNA 2B2XL 2PTTB 3T3MF 5CZVL 3P4LA 1KIUA 5D1QB 5I1HL 1U8PA 3Q48A 2BX5A 4P23D 4MNHA 1AFVL 3E8UH 1IAMA 1UEMA 2DQIH 4N8PA 1F3DJ 4L5FL 3CC5A 5DD0L 5CSZA 4HGKC 5ESAA 1CE6B 3B9KA 1FZKA 1JRHI 3KYKH 5SWZB 1KPVB 1HOCA 5EU6B 1L6XA 1FGVL 1T83C 3MZGB 1BBJB 2IPUK 2YPLB 3RWGB 3P4NA 1BECA 4HIJB 4FQJL 2QQKL 1IEAA 4HFUL 1ZT7B 1FCCA 5FEBA 1ED3A 5L8JB 2A6DA 5FYKL 5T5NG 1RIHL 1BVLA 4NNXB 1WICA 2FX8H 1OGAE 2QL1A 3MRLA 2AK1H 4YXKL 4R4BA 3T3PF 1FBIL 1YUHB 3C60A 4QO1A 2O5XL 2OR9L 4YFEA 3S35L 3BW9A 5TQ2H 1UT9A 1B0WA 3KPRA 3BEVA 3C09B 1W8NA 2DQFB 1KCUL 1XGYH 1WCQA 4HWBL 4Y4KC 4BFIA 1HK6A 4HJ0C 5IHUH 4TVPH 2F54D 4PJBB 3MRPB 4DOHE 5HYSG 1RFDH 3TBYB 1OAZH 2IPTH 1MF2H 1UXWB 2RQ8A 4WFGD 5B39B 3MLRL 1V3KA 4OSUL 5HYEA 1GJIA 3MA7B 2XY2A 1JMZA 5GISH 1I1AA 5C0RL 5D7KD 3OB0H 4RBPH 4FQLH 2Q86A 4P48A 5JO5B 5CAYB 4D0CA 3VI3E 4TQEL 5K9OB 2Q8AH 3OJVC 3BPOB 5ICYB 4J6RL 2V2WA 4JRYA 2AJXH 5E1AA 2EYSA 4UBDD 1A0QH 1B4JH 4I3SL 5I16A 4ZFGL 2XZAH 3VRJB 3EGSA 3QIWA 3I50L 4JFEB 1J05A 5D1XD 4BQCA 1JWUA 1D6VH 1HIML 3P9MA 4MQXD 1DQQA 1HHHA 1OSZA 1YN6B 2NXZC 3L3JB 5D2LE 4XRCA 3GNMH 3S3PA 1A14L 3EOYG 4LSSL 2J4WH 4D9LH 2AGJH 5DMJB 3WFDH 4NN7C 1J87A 1TETH 3SE9H 1U42A 2IH3A 4R7NB 3BHBA 5DUPL 1K2DA 2BSSB 1A7OL 3HC3H 2FECL 4I5BB 4HS8L 4TSAH 3WE6A 3OR7B 1J5OL 1TTFA 3BPNC 4K8RH 2XQBH 4ELMF 2UYLA 2YWYA 2PYED 4U1GB 3QDGA 1FO0A 5DUMH 3V0VA 1AHWA 2V9QA 3QIWC 3MV9B 3FQTB 3WHE1 1I75A 2XFXA 2BY3A 2DQJH 3H42L 3LZFL 4XCYA 1M4KA 1UZ6E 3G6DH 2GW5A 3TVMA 3W5NA 3H3PL 2X4PA 5ILTH 3VRLE 4HQQH 1WBXB 4F15C 1M6OB 5ADPL 4YXHL 1AJ7L 4NZJA 1AP2B 2A2QT 4LCCC 3CSGA 2FR4B 4PJGA 4I8DA 3KPRE 5C07A 1G7LB 5TE7L 5IBLC 2HH0H 1EJOL 1QG3A 2IGFH 3FTGB 3L3KA 3VFMA 4MNQB 2HT2D 5AYQA 1RUQL 5E8OB 4U1MA 2FATL 1NGYA 2CR3A 3CX2A 3U0TA 5MENA 1IM9B 1AHWC 2JJTC 4NQED 3FFCD 4NN5B 2EIEA 4M1GL 4NBYB 3IYLW 1S7UA 2W60A 3OX8B 4KKAD 4KRPD 4YX2L 4FG6D 1TXKA 4GRWF 3VE0A 1NCUA 3D2UA 2P49B 3QUYA 1MCCA 3RZCD 2BNQB 2GFBB 4LBEB 2EKSA 1KJMB 3RA7H 5E8PB 4QRQA 2MCPL 4HGWB 3CMGA 4UZGA 4YDIH 2VJXA 4LHUG 1DTUA 3CDGA 4AZ8A 5J9PA 3O2DA 3Q6GH 3LDBC 1NAKL 2BY0A 3DYOA 5EH1A 1N0XL 3Q0HA 4LK4A 3IDYB 4P4KA 1JZ2A 5HGHB 1T21A 3HRZB 3FT4B 5IFAH 4MD5B 5E2WH 5AWNH 3S88H 3TBSB 4NCDA 3UYRH 3UPCA 3L6FA 3OKLB 5E2VL 3OKEA 5GRJH 4FFYL 3ROOA 1KV3A 4Q97A 3V7AG 3AB0B 4TYUA 4YHIB 5HD8D 3BRDA 3WNNA 2D7TH 3AMLA 1R3KB 3EYQC 2D7NA 4ZTPL 3OXSA 5JW4N 2I9LB 1P6AB 1BZ7A 4G8EB 5DJ0A 1MNUH 3GMOB 4EJ1C 4OM0H 3LQZA 4YUEH 4X6BA 3ULVD 1N7MH 1A6WH 2CDFB 2O5YH 3CLEL 3PQYB 1J8HA 3QDGE 4TTGA 3WIHH 3TNNA 4MAUL 4MJ5A 2APBA 1YMHA 3GRWH 1IMHC 3SO5A 3VMOA 1XT5A 5CFHA 4P4KC 2EDHA 4XVSL 5JW4R 1GGIH 1NFIA 2WIMA 1MCWW 3TJHC 3ZT6A 3MJ7B 1QBMH 4QCIB 4ONGH 1FLTX 4YAQB 5BS0D 4PJ8A 4PJGE 4PFEA 5C07E 1C08B 3T0VA 3ALPA 3JUYA 1LO0H 2BHUA 4YO0B 4M4PA 1NL0H 3PIQB 3OZ9L 4JDVB 4Q6IB 5B3JE 3ULUL 3OXRA 5J3HC 1IGTA 5MENE 1M7DB 2E7BA 1RUKH 2OI9C 4JLRB 4PGCA 1QHOA 2GJ6B 4RA0C 3NCMA 4DCQA 2MKLC 1BQSA 1HI6B 1AIFB 3QI9D 1HHGA 2XYCA 1R6VA 1F58L 2OLDA 3CLFL 5DF0A 1V7NH 2EDNA 3MNWB 4LCYA 4U33A 2AEPL 2VLLB 4R4FH 4KHTL 3W39B 4JKKA 4Y4HD 1MCBA 3RBSA 3MLXH 4LGPB 3KLHD 1SVZA 1CFSA 1EO8H 1NEZA 3TBWA 1D5IH 3GBLA 4N0CC 3MBEA 1SJEA 4WWID 5ALBH 5L7XH 4M6NH 4F8TA 1O7VA 5F9JB 3S36X 2J5LC 1TZGL 3I75A 2X4QB 3BH9A 2HLFC 1EAJA 1IM3A 2VXSH 3QEUA 4NQXA 5DD1H 4M7KL 2A73A 4QHLA 4PP2B 3GMQB 3QO0B 3GM8A 4R8WL 3EDDA 4XVUC 4PJCF 3F7QA 4C57C 1Z3GH 5T3XD 3U36A 3LKNB 3SDXF 2VB5A 4GBXB 3HPJB 2WW8A 3AY4A 3TCLB 3VI4F 4X7CC 1DBBH 3WDIA 5KVFL 2XACC 1UM6H 2P42B 1J0HA 2XWJB 1NFDA 4UV4H 2XTJE 4X4YB 3UTQA 1MREL 5EA0L 4P23B 2WLZA 4PJEA 1I1YB 5CMAA 2IH1B 5FYJE 3QUZA 3O6FB 2CO7B 1MHCA 3HCVA 5SV3A 2FECI 4O4YL 2IG2L 1MIML 5I30H 1RZ7L 2VXQH 2YD8A 2LV4A 2N7AA 4GAGH 3S35X 1G9NH 4Y5XC 2FLBT 4POZC 2J8HA 3PHSA 1TNNA 5EU3A 2VISA 2LVCA 3UJTL 5F3HB 2O5ZL 4YZFE 1G7QB 3FQXB 5HI4C 4GW5A 3WIIL 2F15A 4KK9C 3T0DA 3D0VA 4M43H 1F3RB 3NN8B 2JB6A 3ALWA 4H20L 3ARFC 1FNGA 2LU4A 3ARVA 3SKMA 5D6CA 4X5LA 4KI5F 4V1DA 4QXGH 2BNRD 2P7TB 4OLXH 1TDQA 3BVNA 4DZ8A 4OCSH 4UMGA 5GS0L 1HSBB 1WBZB 3QUXD 1K4DA 4P2QB 3B8SA 1MCQA 1Q94A 4NO0B 1NCBL 5I0DA 3ZLQC 1QSED 4HK0A 4JHZA 3MRFB 1MI5A 3T0WA 4JJ5A 4G9FA 5DHYA 2X4OB 3FQNB 3EO1A 1UH3A 4Z0XB 5SWQA 3WN5A 4YGVB 4KTEL 1KJ2B 5FDYA 2A77H 1UM4L 5CP3H 4Y2DA 4JKWA 4OT1L 5CD3A 4XX1G 1P7KB 5GHWH 5J56B 1URLA 2V2XB 4MA7H 1UCTA 3X11B 1N3NA 2DWDB 2ZUTA 2NZ9C 4X7EC 4FQIL 1G1CA 4BA8A 4UV7L 1XH3B 3JWDL 2KKQA 5F44A 1NFDE 5FYLE 3WFHB 4CADB 3DYMA 1A4KB 2VDLL 1IT9H 2DQGH 4GRLB 2WWMD 4PJEE 1S9XB 5IBUG 4Y2DC 4ZOBA 1WWCA 2RR3A 3B3IB 4BKLB 4YC2C 3C5JB 1ZHKA 4TRPL 1UEYA 4LLUA 5IW1A 1XGRA 4NO2A 1EO5A 3SCMD 2A0LD 3BKJL 3QA3B 3NFNA 4ODVL 3ZKMD 4NQDE 5DEGA 3QFDA 2W9EL 4XP5H 3HZVB 4CMHB 5LWYH 4N8VB 1RZIB 1HQRB 1CK0H 3TV3H 3A6BH 4M62H 5LAXA 3GMLB 4RAUB 3BSZH 3O0RL 4XPTH 3MXVH 4IRSD 4XNYL 4MWFA 1XCTB 2H8PA 2YK1L 4IRZH 4R2GD 1NLDH 5F7LB 5I8KL 1VEMA 3M8OH 3IXAA 1RY7B 4F7TA 1Q9WB 2EXYC 4HWZA 3VWKD 3BE1L 4V1DE 4W6XB 2BXYA 1MPAL 1T7YA 2B4CC 4LEXH 3FAWA 5B4MD 4J3UA 2NW3B 5MEQA 1BX2B 1YECL 5D7JA 2YKLH 3C87A 1MI5E 5TPWH 2DLFL 2VLKA 3ZE1F 1UM5L 4LQFH 5ANMA 4G9FE 4KUZL 3EJJX 1CXEA 2AXHA 2YD3A 3QFJB 5FECB 3VFOA 2P5ED 3QQ4A 1XGTA 3RWJB 1KIPB 4I4WB 5H37G 4HFWB 2PW1B 2J6EL 4ZPTA 4MA8H 3GO1H 5AG9A 5GXBB 2WK2A 3FOMA 2CLVA 5GSRA 1DN2A 2P24A 3SPVB 4PGEA 3CVIL 1OB1B 3VFVB 1GGBL 4JHAL 4YHPB 1VPOL 3UP1A 1JF1A 2VDNL 1DQMH 4FTVD 1QEWA 1FL3B 2SEBB 4N0YH 3VGGA 2AEQL 3BKYL 1CD0A 3OPZL 1E4KA 2LTQC 3PGDB 3QZWA 2Q87A 2X4NA 5I1CL 4Q2ZA 4ZAKB 3LKSB 3D9AL 4RWYH 3DOSA 1CD9B 2PKDA 3N85H 4NQCB 3CSYA 5LQBH 2OJZL 5I1IH 3ZL4L 3L5XL 5F9OH 3FQUB 3ZHKA 5HGAA 4LDEB 1RULL 2Q8BH 3J8F7 2YD2A 2RFXB 1CLYL 5DK0B 3IDNB 4QRSB 3VGAC 1KPRA 5EIIA 5HYJD 2M1KA 1U3HC 5DJZB 4ZS7L 3VW3L 5IQ9B 2CUMA 3IDJA 1AD0A 1RZKL 3DXAA 2W92A 1M05B 2X89D 4AL8H 1ZV5A 1ZHLA 4KFZC 5HDLA 3UAJC 5GSVA 2EDOA 3QG7L 1LO3L 3FQRB 4X6FA 2G2RB 2ZPKH 1KN4H 4JDZB 1OLZA 4K9EL 3LMJL 1NGQH 3HZKA 5TH2A 4HZAA 3S34H 4MJ2A 1EA9C 2O61B 1MWAL 5K9KA 2VL5A 1FL6B 3NIDF 1TJIH 4P5KB 1IAKB 4F3FA 2PXYD 1SM3H 1F11B 5BS0B 4X5XA 4PJDA 2AEWA 2OX5A 3GSOA 3GZKA 4ZXBD 4ONHA 1PEZA 1QSFD 4MHHG 4YFLF 3ZDYE 4JY5H 4U1HB 4ZFOA 3IKCA 1XCQA 4XI5C 3TPUB 4HWUA 3LKOA 1YEHL 3DWTA 1D9KD 4KVCH 4AG4L 1AXIB 1CGTA 3ARGB 5EOQL 4F80A 4JO4H 1WBYA 4LSTL 1IVLA 4UT7H 1YY9D 4PJHB 1E4WL 1S7TB 4FQ2L 5HHNB 4IJ3B 5BMFL 4OZHF 4G6KH 3UTZB 3VRIB 1QR1A 4RGOL 4Z76B 3MOAH 1NANI 3WFCH 2JCCB 3EYFA 2VDPL 1UCBL 4I3RL 1Z2KA 1J1XL 1R0AL 2FRGP 1FZMB 1NBQA 1P5VA 2HT3C 1H15A 3AAZB 2I07B 1LK3L 2ZWLT 4EUPB 1JP5A 4NKIL 5CUSL 4F7EB 1NGZA 1Y18A 1T3FA 3D85D 3WJLC 4GG8B 3P0VH 2HTLC 4NT6B 4EDWH 1H8NA 4IRJD 4UUJB 4KHXH 3G9AB 5IJKC 4LVHB 4YBQD 3NPZB 2AK4A 1KJ3H 4MB5A 1I3RA 5E94B 2PR4H 4O51B 4QWWC 3GEWB 4EVNA 1Y0LA 1F3JA 5C09B 2OTWA 3QHFH 1MEXH 1N0LA 2R0KH 3ZO0A 3PG2A 4LSQL 3RDTC 1KFAL 2CUIA 3RTQD 3ILQD 1V5JA 4PG2C 5BJTB 4U2YA 1U8HA 3B43A 4R0LA 3DXAE 3LD8C 3SE3A 4X4ZA 5IB5B 3RJQB 4N8CL 4Z5RA 4M7JL 2ZG2A 5HDBF 1J1OH 4YDJB 4ZUUB 1TJHH 3DGGB 5MHSE 3FONB 1KIRB 3GMNA 3NAAL 3K2UL 1VERA 4OQ1A 1A1OA 4PJDE 1FZOA 4FXGB 5GGTH 5C08A 2FYYB 5DQJB 3ZDXF 3KPOA 3KNBA 1XZ0A 3SO3B 4EI6A 4LSVH 4QTHA 3I6LD 5CCKL 5I71B 5KAQG 4L4TD 1NCAL 3CK0L 1C1EH 2BFVH 3T0EC 5MP6H 3QWRA 4CMMA 3RAJH 5HGBA 5F6HJ 5DQ9B 4KJQC 4ZG1A 4LPVA 4YHLL 5BO1L 4Y4FC 4X6EA 3I2CH 3RIAK 1AGBB 2Y6SD 4LPWA 5K9QI 3RUGA 3DUUA 3G04A 1J8KA 4A6YH 5KG9A 2DM4A 1OSPH 3WLBA 5C0FA 2NNAB 5INDB 5GGSB 1UFUA 4WI6A 3B5GA 5I76B 2A1WL 2W65A 5J6HA 3SDAD 5HHXH 2R56H 3FO0H 2NPLX 1W0VA 3PHOA 3PWUB 4NNPH 3BIBX 3AREB 4TVSa 4MLIA 2NYYC 1D5BA 3JTTB 1MCDA 3QNYB 2NY0D 3MJGX 5DTFA 4DKFH 4E41B 2NX5A 1B9ZA 15C8H 3GKWL 1SJVA 2EXWC 3UYPA 1YNKH 2AK4E 4PRPA 4QXUH 4XCCH 1QRNA 3WEXA 3R0NA 2V7HB 1NCCL 4UDTA 4CW1B 4ZPVB 1QLRA 3RVXD 5IM7A 4PD4K 1I9JL 2X4TB 1W0WA 4Y16B 4JFDD 1NAMA 4PBVC 1JUFA 4M9OA 1YC7A 4ERSH 3R1GL 4YIQA 2AV1B 2W38A 3ME0A 3M07A 4NKQB 4XWOD 5JOFA 5F9AC 1U92B 2W0LA 1ULVA 4N0FA 1CICD 4M7LT 4D2NA 1IC4H 2UVEA 1HKFA 4TSCH 5DA4A 1KB5L 3PF2A 1EEYB 5GGQH 1JHLH 4O5LL 5JNYA 2EDJA 2X70B 4YJZL 4OZ4B 3ZE2E 4GOSA 3KLAB 1ZKAA 3ARYA 5C08E 3O8XA 5BZDA 4UQ3B 4OCXL 1QO3B 3HG1D 3TC9A 4EI5B 2HT4D 4WJ5A 4PRHA 1U8MA 4AJ0A 4JN2B 2BVPA 2BZDA 4NZRH 2QKIA 5F89B 2IBZY 4RA3A 1LDSA 3VWJB 4UINH 3U7WL 3NCJL 1ZHNA 2YBRB 1BOYA 2MSPA 4WW1A 3G6JB 3IDIA 3C5ZD 4PP1D 1D5ZA 2HRLA 3NABH 1AI1L 4HCRH 1VFUA 3RUGE 2QHRH 2NLJA 4XCNA 3O8XC 3CX5K 1P4LB 1PKQA 3JBG7 3AXLA 4MSWA 3O3BB 4XAKD 1I9RL 1J12A 2G75A 4APQD 3RVUD 2EDTA 4JM2C 4OZGA 4I0CC 4OCRH 5EOTB 4LPYA 3AMKA 3VFRB 2UUDK 4X6CF 4LSRH 1AKJD 5B8CB 4OLVH 3ZKXC 1OARL 1T22B 5KOVC 3FMGL 5JIIA 2O93L 1C16B 1S9YB 2NX5E 4PJAA 3V79C 2DLTA 4PJ5A 1HH6B 4GAJH 2AABH 3REVB 5HTSA 4PRPE 2AJUH 4NO3B 5E9DD 4QKXB 1A7RH 2AAVA 2ZCKH 5DDHA 3MRBA 1QRNE 2UZYB 4JHWH 3E1F1 5FGSA 3R4DA 1FVCA 1F6AA 2F53B 4P57A 3HFMH 4L8CA 4U05A 1EVUA 1CL7H 2VLJB 4BH8A 1FHGA 4XHJD 5ENWA 3CVHL 5E6IC 3ULUC 3MJ9H 5TE6H 3HAEA 5DR5L 5DJXB 1S9VA 3JV4A 1A1NB 4PLJC 5FFLA 4FOMA 4G5ZH 1MVUA 4J3XA 2VC2H 4ZD3L 2X9YA 4EN3D 5F7MC 1J0YA 2DKSA 4JO1L 1NJ9A 2DIBA 4TUOB 5E56A 4CU8A 5C7XL 5IROC 2FX9L 3VDBA 4GXVL 4YEFA 1EUUA 3QCTL 4NC0B 1I85A 3WSQL 4G8GA 4MVBC 1BIIA 1XGPB 1B3JA 4A6YB 1KPUA 1FH5L 5IF0B 1BQLH 4ZOCA 4PJIA 3RL2B 2F74B 4NBXB 2YUWA 3D1MC 4OFKA 3AC0A 1KIQB 2YWZA 3ULUF 2IANB 2C3GA 1Q1JH 4M8VA 4J3VA 1BWMA 2FD6H 4ZXBB 3K4DA 5DJDA 4JO2L 1JZ8A 5I8EB 5DD3L 2DM2A 4G6ML 3F6LA 3QAZC 1PKQE 2VR5A 1FORH 2YPKB 3BPCA 5E00A 2E27H 4DVRH 3D39A 3HNSH 2AERT 1B90A 4TVPD 4L8SB 2Y5TB 1X5KA 1DDHB 3EYSH 1RZ8A 4PJFF 3OKMA 4U1SA 1AXSA 1KN2H 3S4SG 4DEPC 3QHTC 4NNYA 1IARB 1T89A 4PJAE 1R3HB 4PTTA 4Z7NE 4PJ5E 5E2JA 5EBWB 4HGMA 3G5XA 3UPRA 1E6OL 2DBLH 3HC0B 1VGKA 2Q76B 4ESKA 3KJ4B 1VGEL 2GT9A 3RIAF 2AKRA 3V5DB 4XNXL 4Y8AA 1G7MA 4YHZH 3QYCA 5IP4A 3QRFM 1RUPH 3VXTA 4Y19D 1R3IL 3BP6A 4YHYC 2GITB 1YA5A 5FV2A 4ORGB 3EFFB 5F7DB 4Y1AD 1RZFL 3CZFB 2AEIT 1QBLH 1CFNA 2HLAB 3MLYH 3Q1SL 3QNXB 4GRMA 2CJUH 4TPRH 3L7FB 3LEXA 2VR9A 1I7UA 3EDEA 3T09A 4TULH 4LKCB 2C9AA 2FB4H 2J88H 4OD1L 2R2BA 4HKZA 4NCC2 4WFHD 3VGFA 2EC8A 3ROLA 4O2FA 1WLHA 1XR8B 2NY3D 1KCLA 3D18B 1OT1A 2Q7NA 2G9HA 1YMMB 1NC2D 5L88H 4QHMA 4FQXC 3VJ6B 3UZEA 4S1SH 4P2OC 1MH5B 4G8GE 5DJAA 5GS0C 2X1PA 3SGJA 1Q9OB 4K8RD 3DROB 4H5SA 4HLJA 3DRQB 3UMTA 3DX8A 8FABB 4FNLL 2H1PL 5JQ6L 3MXWH 1AXTH 4PJIE 3FB6B 2CDEA 5LGHH 5ACMA 2D31A 3BEWB 3CU7A 1F4YL 5E8NA 3W0WA 1KCSL 3HMWH 4WV1C 5HYIA 3LKQB 3IRZA 4HAFA 4K3JL 1DVFC 5IB1A 4K3EH 3N06B 1BFOA 3MODH 4HIHB 4JKLA 2B1AH 4Y5VC 3L5IA 4WO4C 1RZGA 4U0RC 3UJJH 1G7HA 1MAJA 3D39E 5D4QA 5JZ7C 1LEKA 4HH9B 4U6XA 3GDBA 3QDME 1QFOA 3IB4A 3K80A 4RGMC 3NH7H 2JJUA 5DRXA 3KS0H 3V4PL 4X5WB 5I8CA 2BXZA 1A5FL 1YQ2A 1CLCA 3MRHB 1RU9L 2DN7A 4AQ1B 4A2LA 3QUMB 2EH8H 2CKBB 2DLHA 2YZ8A 2OYPA 2VDMH 1MFNA 1R5VB 1PY4A 4HJ0D 4W81A 1EXUA 1QNZH 5DD5L 2EC9U 1HCFX 3MC0A 1JGVH 4BQ9A 1NUDA 1JWSA 5ESVA 3MJ6A 2DICA 3FRUB 5FA3B 1JPGA 2A6KB 3HR6A 5C2UB 1BFVL 1HSAA 4WHDA 4XNQA 4M1CC 2NY5H 1ZSDB 4L9LB 1RUAL 2XNAA 3QIBD 4UNUA 4WCYH 2CUHA 5I17B 4JG1L 5AUMA 4GG6F 4OBRA 4Q74A 1T7ZA 3W2DL 1EZVY 4JFHD 3MCKB 4DGYH 1IRAY 3O41B 3OB8A 2J6EA 2PW2A 2X42A 2AJYH 4X7TB 1YEIL 4X8JB 3K4ZA 3K1KC 4GSDL 3HUJB 3U0WH 1P4IL 3ULSB 3FFDB 5C0GB 3SJVD 5IT2H 3HR5A 3HNVH 4IDJL 4ZNEA 5A16B 1KOAA 2OSLB 3SKNB 4N0UB 1UG9A 1WT5C 4NSKB 1F8TH 5I2IA 5JXEC 1BWWA 1KT2A 3B83A 1D5MB 4NQSB 4LASL 4HXBL 3W0WE 3ARBB 4C58B 3MLSL 1FZJA 2PO6A 3O9WA 2X41A 5D5MB 5J06A 1RHHB 4HUVA 3RBGA 2QQNL 3ARDB 4MDIA 1B4RA 3WO4C 4XGZA 4L3EB 5CILL 1FIGL 3BZ4B 1P1ZA 2P8PB 2YC1A 4MJ6B 4X99A 1IC7H 32C2A 1NMCC 5GZND 1DR9A 2K1MA 1UZ6F 2UWEB 1BD2A 2XA8H 4U6VH 5HPMA 1K5NA 4GAYA 4HKBB 1YJDH 3VRLF 1JIBA 1PAMA 2EYRA 4BQ8A 4Z78B 2ZKHH 3WDHA 1FN4A 3BT2L 3ZYOA 1MWAA 1JPTH 4I9WD 3MFFB 1UB6A 1CGSH 2UUDH 4FXKB 4OLEA 1ZS8B 1BJ1H 5D96B 5TF1H 4MX7B 4KMTL 4OZIF 1OL0A 3KPLB 5E5MB 2I26N 4GKNB 1C12B 4DAGH 2ZOKB 1Z6JT 4FFWD 3AS1A 3RX5A 1RZKC 3GSWB 3PWLB 1OTSC 4FQQA 1DE4B 3D87B 1MFEH 4XCFL 3BD3A 4HJJH 5DMIH 4H8WH 3VFSB 2LABA 4IOFC 2DJ4A 1U8OA 1UWGH 5ACZB 3N9GH 5H94A 3EZ8A 1E27A 2MPAH 3LHPL 3DVIA 4K9EC 3U9UB 1HINL 3T4YA 4WTZA 4JN1L 4GKZB 1MFAH 1IGYA 5D6DA 3REWA 5HHMD 4K94L 5KOMC 2CGRH 3ETBF 3RWEB 5JDJA 3Q3GB 1YEKL 5E8EA 3T2OA 4H25B 3WBDA 3BH8A 3MRRB 5L8KB 3BKCH 2HJKA 1AR2A 2WLYA 2VUYA 5LG1A 4LMQI 4ZNEE 1QRKA 3HE7C 4ZODA 5DK2B 4NN6B 1ZK9A 3EOAB 4QRUA 3R0MA 5HHQB 1IAIH 4FZEH 2E6QA 5C0AD 5IWLA 4XNUL 5F1IA 3CFBB 4HLZH 5FV1L 1EBAA 5DS8B 3BQUA 2KDGA 3O3EA 3BP4A 5C0CD 5A2FA 1K8DB 5L6YH 3ULVL 4XVTL 3SGEI 5HVGB 4KZEH 4KH2A 3F7PC 4NZTL 4ALAL 1IC5L 5J12C 3MREA 3LKRA 1JPSH 4JY4A 1Z0MA 3O3DA 5I1GH 4MAYC 5BRZB 3NBNA 2A6IB 4F7MB 3TJHD 1BD2E 3V0WH 5I1JH 5IB2B 4ZFZB 3GSRB 2BERA 1JZ4A 4Z7WA 2ICWI 3VXRE 3B5HA 2PTTA 1P2CA 4ODWB 4P9HH 5L2KD 5KVDH 5D2NC 5D1QA 3NFSH 2YD7A 2DQTH 5EWIH 1DEDA 4JPVL 1ZT4B 4MXVE 4YHMH 1RV6X 5BV7C 3W5MA 3NGBC 1F4AA 3KS0J 1HDMA 5B3JF 5ITBL 3WKMH 3Q5YA 2ADFH 4R96B 1CXHA 1P53A 1NQBA 4XBEL 1CE6A 1S3KH 5TF0A 2XWBB 3K8KA 4HAGA 2EC9T 1PZ5B 1KPVA 5SWZA 1MRCH 5EU6A 1HNFA 2HFEB 1BBJA 3RWGA 2YPLA 5IW6B 1MFCL 2MQCA 4HIJA 5IJVB 3RY4A 2FZ3B 1S5IH 5IVOA 3E0GA 3CSPA 2CH8A 2WAHA 4LAQH 2M2DA 5E99H 4WDIB 1JMXA 5A1AA 1IBGH 4URTB 3V4VH 5D1ZC 3TN0C 1YUHA 2K9UA 2I27N 1B6UA 4P59L 5T5NF 2UV3A 3BN9D 2DQFA 4Y19B 4RGNC 4PJBA 3KJ6H 2D03L 2E7HA 3MRPA 1BF8A 5KSBA 1IGCH 4Y1AB 3SQOL 5ESQB 3ET9F 3H0TB 1OGAB 3BGMB 5EUOB 4PD4J 4HEME 3UJIL 5J6GB 5B39A 3V5KB 3HN3A 1FO0H 4RX4A 5KTEH 1KULA 4N0RA 4AM0B 3W11C 1KTDB 5TE4H 2PCPB 5T3XL 1FAIH 3VD7A 3P73B 4U1KB 5C71A 3V4UL 4DOHB 2B5IC 4P5TD 5IBTL 1ZVYA 5ICYA 5T1LB 4M48H 1I1FB 3UX9B 1LK2B 1MFDH 1AE6L 2W9LA 4LGRB 1NKRA 4OCNC 1Y6KR 2BVQA 3I3DA 3P9WB 3WLWD 1UACL 4YK4B 1CU4H 1MELA 3QIUD 4PRBA 4V2CB 3WS3A 1T1WB 2R0ZL 3VRJA 4QYOB 3QEQD 3FQWB 4JFEA 1MSPA 1A4JB 4FQ1L 3TJEL 4HEPG 4KI5D 4L4VD 4GQ9L 4EKXA 2IAMC 2APWA 3L3JA 5GZOD 5JW3H 2ICCA 4CGTA 2QQQA 3B9VA 4NGHH 5HVFB 4KROD 2X4SB 4Z7WE 4KQ4L 3CXDH 1F4XH 4J4PD 1L0XA 4HUUB 1GSMA 2NY2C 4JY6B 1BQHB 1T04A 4R7NA 3VDCA 1JYVA 4LCWE 4I5BA 2FL5B 4XP9H 4TN9A 4RFOL 3MLVL 4LRIA 4RGNE 5FUZL 4NM4L 4RFEB 3CX5J 4ODSH 1MCWM 4LLWB 1UJ3C 5D2LB 2GK0B 2OZ4L 5HI4D 5SWZE 1LO4H 5EU6E 2APVA 2YPLE 1U8PB 3MV9A 1RIVH 4OLYL 2CXKA 3O2DH 1YYLH 4JPIB 1BJ1J 2LAGB 4NHCH 5EZOH 3CC5B 3OG6B 4GKOA 4NHUA 4Y4KB 1G6RB 3C2AH 1SVCP 2OBGA 4LDOB 6FABL 3S37L 1M6OA 1M7XA 1FZKB 1AP2A 25C8L 2IFFL 2FR4A 3OJMB 5DGQA 4M7ZB 1G7LA 2QTEA 1IEAB 1JWMB 4JVUA 1KELL 4MA3B 2A6DB 3C6LA 4PJBE 3LEVH 4MNQA 1BVLB 2ORBH 5E8OA 1OAYH 3G5VB 5KSBE 3SOBL 1TNMA 4JB9H 1MRFL 3AS3A 3LN5A 5F70A 4R4BB 3OX8A 3TZVC 1ZVSA 3DRTB 1U95B 7FABL 2NY1B 4UU9B 1EHAA 4KC3B 1QFWH 4BFIB 1MJ7H 3LPGA 5DZOA 5F3BB 3C2SA 2BNQA 2GFBA 4LBEA 4Q9RH 5D7SL 1D6EA 1VCAA 3MCLL 5FYJH 1KJMA 4P99A 5E8PA 1BGXH 2WWKO 3MZTA 2NXZB 4ONOA 4HGWA 3GI8L 4O9HL 3SDCD 2Y36H 1JTTA 3F58L 1CLOH 4XH2A 5C0JB 1CI5A 5GRYA 4EOWH 4ZYKB 2R1WB 3DURA 1NMAH 5DFVD 1IZJA 5HGHA 3HRZA 2ENSA 1C5BH 3FT4A 4PJEF 1EHXA 2WNGA 5GS1C 3BPNB 3B2VH 3OKLA 4O02L 1B2WL 1CZ8L 1CXFA 3TH4T 4RZCB 1JL8A 2XZCL 1SBSH 3WXWL 4YHIA 3ISWA 3EYUH 3THMH 4G6JH 2C3VA 2XZQH 3EGSB 3QIWB 3FB8A 4FQCL 4GRWB 3N1GC 2I9LA 3GMOA 4LLMB 1HHHB 2X05A 1A9BA 4XRCB 3HB3C 3UDWC 4WWKD 3PQYA 1QKZH 1T20B 3HC4L 4F15B 1ZE3C 4P49A 5J13C 3LB6D 3MV9E 4I77L 5GRXG 1ACZA 2FNBA 1ACYL 4LCCB 3TT1L 3VH8B 3GKZA 3FN0H 1U91B 2DF3A 1FFPB 4YWGH 2R2EB 3MJ7A 3BDYH 4QCIA 4S1QH 2UYLB 1A6TB 5FF6B 4JPKH 2R8SL 1YEFL 5EDXA 1AHWB 2G5BB 3HE6A 1MCPL 1C08A 2XFXB 1WTGT 4UIKH 5FA4B 4FP8H 4MNQE 2FIKB 4JDVA 4Q6IA 2PNDA 3Q5TA 1A6VL 2R2CA 1UYWL 3TVMB 1EFXB 1Y6MR 1I9IH 1M7DA 1AC0A 2X4PB 3QJHB 3TYGH 4JLRA 4Z7UF 4PJXF 4ODXB 1MQKL 1OPGH 4D0DB 1HI6A 2OTUB 2Z31D 1LO5A 1KEGL 1VEOA 2RCSH 3VFMB 3KYMB 3WJJA 3HLAB 1YDPA 1NMBL 3BD5A 1I1CA 4HPYL 2BNQE 3MNWA 4KUCF 3U0TB 5E6YA 2VLLA 5CINH 5AZEL 1T4KB 3V52H 3LDBB 3W39A 4JQIL 2DWEB 2ZSWB 1MRDH 1IQWL 1S7UB 2W60B 5I0ZA 5J0BA 4I0PC 4NRYB 5CD5D 3BAEH 1ODAA 3O3UN 3D2UB 2EYTB 3LS5H 3E2HC 1JRHH 1FPTH 3RWIB 5F9JA 2JELH 5T3ZE 3VXUB 4MXQD 1QPXA 2WBJC 2WUCH 2X4QA 3IAQA 3MBXL 4ODHH 2NTFA 5I1EL 2EKSB 5C9JB 1CVSC 4OGAD 3GMQA 2C3WA 3MRMA 1DBAL 3QO0A 3WJJC 3MYJA 1U3HD 4NYLB 5DJYA 1BOGA 3OTTA 4IOIB 4X0KB 3LKNA 4F9LC 3LEYL 4XMPH 4GBXA 3HPJA 4YPGB 3TCLA 2ZNWA 1E4XI 3UAJD 4J3TA 4P4KB 3RVWC 3CU1A 3PQYE 1X9QA 4YHNB 1E6JH 1DBKL 1X5IA 1OW0C 3F7VB 3OKEB 4JE4B 3ROOB 4UILH 5JIKA 2DD8H 4OFVA 2ZSVA 2BP3A 3U4BL 3IJHB 3BMVA 4X4YA 2ICWA 4P23A 2R0WH 2ZUUA 3NIGE 5EORH 5T5FL 4PRAA 3LQZB 4MQTB 5KANG 1XIWC 4HF5L 5FO9B 4NUGH 5FUCE 4XT1C 2AXJA 1CWVA 3WO3B 3LCYA 5J7CC 3O6FA 5CGTA 3T2NH 4RISH 3TNNB 4MJ5B 1YMHB 4Q6YA 1JZ3A 2V5TA 1GOHA 4UTBH 1GC1H 5DC9B 3L3OA 4U4BA 4JFFB 4KVNH 5HHOB 4K7FA 5IEKB 5TFSH 1OWRM 4QNPE 2R69H 3P4OB 1BFTA 3MV8B 5F3HA 1G7QA 1BJMA 3FQXA 3O11B 4NOBA 4F9PA 1KBGL 4X80L 2EE6A 1T66D 3KXFD 2WANA 3BX7C 3NN8A 2IPUG 4QHKI 2HKHH 2AI0H 5HYQB 2QSQA 2H6PB 4J23A 4NZDA 1F4WL 1IGTB 2H41A 4GH7B 1N4XL 2BVTA 5IFJA 1TMCB 4KMLB 2J5LB 4PLKD 1HSBA 1WBZA 2ZJSH 1H8SA 3IDXL 5T1MB 4NO0A 1NBYB 4LMQE 1MCSA 1HHGB 1ZGLB 1IEBB 1RURH 3MRFA 4U1NA 2D9CA 3MRGA 1KCVL 3U46B 1TJGL 3OMZA 3FQNA 5DC0A 4KAQL 5LBSH 4Z0XA 5JDSA 1TVBB 4YGVA 1KJ2A 3NA9L 3P0GB 5C0DA 3FOLB 5AEAA 2BSED 1K6QH 3GHEH 2V2XA 3I75B 4WFFD 1JNNH 5E2UH 5DXWA 3X11A 4OD3L 5ACLA 2W59A 2DWDA 3QEQB 1IM3B 3QEUB 4LEOB 4NQXB 4QGTA 4U3HA 5D1XA 1EZVX 1RHFA 1JNJA 1XGUB 4PJ7B 1MJ8H 4GXUM 3D6GA 3B8YA 4GAFB 5BQ7B 3FO1B 5SWSD 1S78C 3WFHA 3PP4L 4CADA 4OGYL 2AP2A 4OFYA 2C3XA 4GRLA 1NBZB 4PJDF 1Q72H 1Q0YL 1UWEL 1S9XA 2VTFA 1A7QH 2ZOLB 1ZLSH 3B3IA 4Y5XB 4UBDC 4M6OL 3T0ED 4OM1L 4KTDH 1GGUA 3TP4A 3RRQA 1NFDB 4IS6A 1ZANH 3EW3B 4MQXC 5TQ0H 1UZ8B 4N8VA 3ARFB 3TGXA 4IM8A 4YHOH 4WY7L 1FG2B 1DSFH 1MHCB 3GMLA 3QCVL 1JNLH 2VABB 4RAUA 3OL2A 4U7KA 4N90D 5CSGA 5IGXL 1PGRB 1XCTA 4FHBD 4CVUA 4NQDB 5E5UB 5C2BL 1Q9WA 4Q7DA 4XNZC 5FCUL 4JM4H 3GUTA 4W4OC 3C08H 2NYYD 2H2PD 3FFCA 4WFGE 5B3NA 3S36H 4Y2OA 2Y5EA 4LRNH 1PDKA 4CN6A 1WZLA 5JLZA 4IDLA 2B1HH 3RZWA 2JB6B 5D7KE 1FNGB 4HWNA 1J1PL 5D6CB