3WFBL

Reduced cytochrome c-dependent nitric oxide reductase (cnor) from pseudomonas aeruginosa in complex with antibody fragment
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DIQMTQSPPYLAASPGETITINCRASKSIRKYLAWYQEKPGKTNKLLIYSGSTLQFGIPSRFSGSGSGTEFTLTISSLEPEDFAMYYCQQHNEYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody fab fragment light chain
publication title Structures of reduced and ligand-bound nitric oxide reductase provide insights into functional differences in respiratory enzymes
pubmed doi rcsb
molecule tags Immune system/oxidoreductase
total genus 52
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2013-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfbL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wfbL01
3OXRA 3IDJB 4XP1L 5EBLB 3V5HA 1RJYB 1H3VA 5CLWA 5CIPB 4ZD3L 2PYFB 1T03L 3DXAD 4NBZB 4HIJA 4L4VB 4P46B 5KTEL 3INUH 4TUKH 3FFCB 5C0AD 1U3ZA 2FJHA 4JG1L 4UQ2B 3ULVH 1IGIH 1QACA 6FABL 4M6NH 3U7YL 2E6PA 4HJGA 2FIKA 2HYMA 4Z7WA 3RRQA 2XG5A 2BFVH 4XB8A 4LVOC 5DMIL 3FQTA 5IMLA 4MNGB 4JQIL 2WNGA 3K80A 3MBXL 4KRPC 1XCTA 2D0HA 2H32A 4U6TA 5EIVA 1JK8A 2VQUA 1W8OA 1CR9L 2CLZB 5ERWA 1OTUD 3WMSA 1N64L 1I9RH 1PJ9A 2W60B 4PRDB 5I1DB 5JA9A 4JY4B 4MZ2A 3U0TB 4QOKE 5E2JA 3S3PA 1Q8MA 4U31A 1SEQH 3STLA 3CFCH 3HAEG 3ZKSD 4KJWD 4U0QB 3MJ9A 4U1LA 2DJ4A 4MNQA 3V5DB 3PHOA 1KUMA 2ED8A 4ODTL 1KTLB 1KGCD 5KSAB 3HC3L 4A2MA 3CNKA 5MHSD 1S7QB 4KTEH 1ERNA 4OLVH 4YDIL 4XBPB 4PRID 1Z9SA 4JPWH 2XT1B 4JDTH 3HLAB 3LKOA 2KZWA 4QHUB 4JGMA 4UIKL 5DZOA 2CDFA 4KPHL 2RGSA 2WANA 1AR1D 5ACZB 1PG7H 4WI7A 2ESVB 4OZHF 3UTSD 2DI8A 1WVZA 3TZVC 2RAMA 3TPKA 3A6BL 5L2KB 3PWVB 3DYOA 3QIWC 3RZCD 3B9EA 2HP4A 4NN6C 2GJ6A 3PNWA 3H9SB 4HJ0D 5F9AC 5J11C 5E9DA 4JAMB 5C6WH 4J1UB 1PX3A 3NA9H 5IWLC 2W0PA 2VLKE 4H8WC 4KY1H 5CIPA 2PYFA 4I5BA 5FYKE 4NO0A 1DBAL 3K3QA 3NFNA 4JPKL 4G80A 5EO0B 1B4RA 2E7HA 4WEUD 5C07A 1MAKA 1YMMB 1NANI 2GAZA 2Y07L 2XPGA 4X6BB 5I30L 1A6VL 3IFLL 2QV2A 4MNGA 3I2CL 3IDIB 4PJEA 1T21A 3U4BH 4G6JH 3OKNB 4MLSA 1NCDL 3VXSE 1YEGH 3TWCL 3DYMA 4OBSA 2CLZA 4RWYH 2BVQA 1P6FA 3MRDA 3MRQB 2J8UE 2W60A 1F90H 2GW5A 4JY4A 2EDFA 3U0TA 1B88A 5J6HB 2XZQL 1Q9LB 1M7IA 4MCZB 1GZPB 2XWBB 4YIQA 2R2EA 2W0FB 5JNYA 3RNQA 1DCLA 1S7SA 3ZYZA 2EEBA 3RU8L 4Z7UF 2VDPL 3HC4H 3VGBA 4KI5D 1AXSA 1VSCA 2JTDA 4KHTH 2FEDD 3QIBB 1GGIH 1S7QA 2CRYA 4GG6E 2UZIL 4XBPA 5I73C 2VLRA 1HHIA 3O2VL 4YC2B 3ULVC 4OI7A 4WHYH 1SJEB 5CINL 5I1CH 2ZUXA 1HXMA 3DUSB 5I19H 4LP5A 1GGTA 2ZSWA 4HXBL 5IB3B 2VZ1A 3VFVB 2WUCH 3G5XA 2R0LL 4WJ5B 3HS0A 5SWSB 1NC4A 1NLBL 3MGTB 1SJHB 4JFFD 3SBWC 1KELL 3OR7A 1SBSL 5ACZA 2WBWB 5F96L 5H94A 5E8DL 5B38A 4OSUH 1LEKB 1MI5A 1M1SA 5JMOC 4HPYH 3QUZB 3NIDE 3ARGD 1P1ZB 3MFFA 3T0EC 1FNAA 1RZIB 3PWVA 4LVHB 1QG3A 2FHBA 1BJ1J 4M62H 2RBLA 5BV7B 3LKSB 5BQ7A 2Q7YB 3H9SA 5F1NB 4JAMA 4UTAL 5J6GA 1GYAA 3KVQA 4KRLB 5IFJB 4F9PC 3CSGA 4G9FE 3UJJL 4NJ9L 1T7WA 2ZKHL 1QSFD 1CXIA 4ONHB 3VD4A 1BM3L 1SBBA 4IRJB 4JQVC 4JFDE 3K8MA 4JN2B 4YGAB 1L6ZA 4XI5D 1LK2A 5C0BB 1Z9OA 1QRND 1QFWL 1T1ZB 3BYTA 2LTQC 3S9DB 5GHWH 3IDIA 4MJIB 2AJSH 1LVEA 1SYVB 1II4E 4DZBA 1JGVL 1I3UA 3JUZA 1N5AA 3T1FB 3OKLB 2ZUQC 1UFUA 5I8CA 4NO5B 1FNSH 5H35A 5ADOH 2NY0B 4LLVB 4GMTH 4TVSa 1E4XL 2P7TB 2XZAH 4Y2DC 2BERA 1FNEB 2Z93B 4BZ1L 3OHXA 3RPIB 1QBAA 5DGRA 3U6RB 1Q9LA 1EA9C 3HNVL 3L7EA 4I3SH 2XFXB 4NQSB 3UX9B 5MP6L 5JHDA 3DGCR 3IT8D 4YHOL 2IANE 2ZCHL 5HHPB 4HAGA 4F7EA 1NAML 5FKPA 1V05A 2FATL 2VDQH 3L7FB 4HWZA 4OZGB 3T3PF 2JCCF 4KQ4H 3DECA 4KJPD 4PRAB 1NEZB 1KLGB 4NKQB 2APTA 5ACLA 2EYTB 2YPLE 4M9PA 3SDCA 4FQQB 3TCXA 5IB3A 2Q7NA 2BOCB 1IGYB 2R2BB 5IUSA 5C08D 4P46D 4R7NA 3TT1H 3FFCD 5GRYA 1SJHA 4JKPH 4HSQA 4KUCF 4MDIA 1JNLL 1HH9A 4JE4B 5C2BL 4KI1A 2NY5H 3BAEL 1XIWD 3C8KA 4U1GC 3QUZA 4N0YH 1WV7T 2V7NB 3M1BA 3MOBL 3UBXG 3LKSA 3THML 3W5NA 5F1NA 1RMFH 4RGMB 3U0PB 1SY6A 1GCFA 1M7XA 5A2JH 3EIFA 3MBEC 2Q3AA 5ESQA 3HA0A 5C6TH 4H5SB 1WBYA 4NN7C 3OGCB 1QSEA 3IFPB 4XAKE 2VDRL 1ZE3C 5C0BA 1T83C 1TIUA 4HWBL 4D0DA 2W9DH 4KDVA 3B2UD 5KSAD 1SYVA 4NJAL 2PR4H 4L8BB 1PYWA 4AK1A 3OKLA 3BKYH 5E2WH 1VERA 1JYVA 3QXWA 5DEZA 1EZVX 5FM5M 4N5UA 3ALPA 1UXSB 2H2SC 3SKMB 5E8NB 1M6OB 2DAVA 2HFFA 1XGRB 2BDNL 3PP3K 2ZUWA 2MMXA 4GMSL 2XFXA 2PYEA 1T6VN 1CE1H 3UDWC 1KEML 5BMFH 4GRWE 2VITB 5C0JB 1IKFH 5F8RC 3WNKA 1TQBB 4O4YH 3SDXB 2BVOB 3SDYH 3LS4H 5A16B 3HG1B 5E5MB 3RDTA 3L7FA 4UV4L 1RZ7L 5IT2L 2B7DT 4OZGA 35C8L 4XCCL 3W39A 4PRAA 3WN5C 1NEZA 2ZNXA 4HUUB 3RVTD 1EIBA 3TN0C 1J0HA 1MCCA 1QQDA 4MA8L 4ZO8A 4TNVF 1YNTB 3JTTA 2BHUA 4ZPTB 3VRIA 2ZSVB 1FSKB 1N59B 3OKEB 4HW6A 2W65B 1C08A 3WJJC 1LP9B 2OL3H 1FL3B 5TF1L 4G7YH 1PAMA 3BZFA 3MJ7B 3TVMC 1BWWA 3GJFB 5C70A 4K23H 1QFPA 1PDKA 2V7NA 1T0MA 3WIHA 1OSPH 4KROC 3LKPA 3BP5A 2A9ML 4P23C 3EBAA 4PLKC 1JZ7A 1MFBH 3SDDB 1WIOA 1FAKT 1YEIL 4FQJH 1IEHA 5JMRA 2YN5A 2UZYB 2R29L 3S35L 3UP1A 3P9LA 4RGOH 3J7HA 4H5SA 5FK9B 3MRMA 4LHUG 1S3KL 3ULSA 4NWUL 4Z8FH 2P8LB 1Q0YL 5TE7H 1VPOH 2EH8H 4G7VL 4LCWD 3QIBD 1FORL 3O6LL 4PRHB 3EDEA 5A2LH 4UUJB 3WUWG 5DQDL 2D2OA 2FL5B 1G7IA 4WFED 3QISA 4PG2C 5DFVC 2NY5C 2UWEB 4WFFE 5E4IA 1M6OA 3SE3A 5SWSD 3VXTA 5I18L 4DKDC 1U41A 2NR6D 4Z9KB 3Q3GB 5EIQA 2XA3A 4FXLA 4MAUL 5C0JA 4PJ9D 4HFWB 4OJFH 5BXFB 3SDXA 2BVOA 2HVJA 2IGFL 3I50H 5E5MA 2VXSH 5SV4A 2AQ3A 4KK8D 4I0PB 1UH3A 4KQ3L 4JKLA 3VFMB 3P9MB 1RZJH 3EYSH 2W0KA 3V5KA 1QSZA 1V7NL 4IRJD 4YHIB 5KVEH 3OJ2C 4ZPTA 2ZSVA 1EHLL 3QJFB 4RIRB 4O58H 2KZ1B 4WTXA 3WXVL 4HH9B 1U3HB 5H8DA 1NCBH 4I18A 5KVFH 1WT5A 3MUY1 5KS9A 3GJFA 4L3CB 4MJID 4GRLB 1DBMH 4Y1AA 3BUYB 5BRZB 4AIZB 4MD5A 4U1NA 3BWAA 4FXKB 2Z31C 3TO4A 3GSQB 1QPXA 3CLEH 4PREA 1RZKC 2NY0D 4G8IA 4OCLC 3ZYJA 4C55A 2WP3T 1MRFL 4JRWA 3O2DL 4HUNB 1P84K 5DZLA 5FK9A 1ACYL 3RWDA 2P8LA 4U6VH 3C08H 3MRBB 3MLVH 5CP7B 4DKFL 1F97A 2FH8A 3MREB 5C9JB 5DK0A 3OJDB 5HHVH 2XTJB 1CLZL 4K3JL 1W0YT 5EU7C 4H0HB 4FQ2L 1R3LB 4KI5F 2EDNA 1MAMH 1ZHNA 4PRBB 1P4LB 3VWKC 1DDHB 3O6KL 5JW5A 5KJRH 4U1HB 4LFHG 5FGCE 3EYFB 4TSCL 2UWEA 12E8H 5FGBC 4WVRA 3KLHC 4I0CC 5IB4B 4X7TA 1OP5K 3IETB 4R0LC 3A0OA 1A1MB 4ODSL 1U8HA 2P8PA 5IMKA 1D6EB 4DKEH 1J88A 4HG4K 1I9IH 1SMOA 1U8LA 3VMOA 4DKAA 3QG6B 4Z7NE 1I8IB 4UDTA 4U49A 2E9WA 2YD6A 4XTRD 4HS8L 3VFMA 1AE6H 1S5HA 4JHWH 1TPXB 1H3WM 5D1ZA 5FYKH 2ILLA 3D0LB 3VXRA 3RTQA 5C3TA 1CXEA 4X6DF 1T5XB 2LE9A 1G6RL 2X4PB 3QJFA 3LB6D 1RZFL 4P2RD 4M6NL 4LSTH 5LQBL 5D1QC 3P0VH 1U3HA 3EFDH 1A21A 1MFCH 4HKZB 1RU9H 3FTGB 5EO9A 2YEZB 1MNUH 3BQUB 1S9WB 5IKCB 3O11B 1MJ8H 5BRZA 3GHEH 3B83A 3MJ8A 3D85B 2JK5B 3H9YA 2XN9E 5SWZB 4Y88A 5TPWH 3VU2A 4OZHA 3GSWB 3C60D 4IHOA 3MGOB 5D5MB 1WFUA 2Y6SC 1LO0H 3FO2A 3JVGC 3DRQB 4XBEH 4GKSA 1G7LA 5I15L 5GRXG 4OGZA 3GMNB 4OLXL 2EDYA 4ZNCD 3EFFB 1SEQL 5SX4I 4I4WA 2XQBH 1WSST 3GI9L 2Z92A 1FAIH 2CKBH 4YDKL 3QULB 4QRRB 1RZJC 3VE0A 4X0KA 5HI4D 1GHFH 4M93B 1UQSB 3DGGA 3HG1D 4WW2B 4BH8B 3MSPA 5HYSG 5IFAH 2BMKA 3SDAB 4J8RA 1R3LA 3OKDA 2OJZH 1CICA 1XF5B 1P4LA 2X4UB 5D7IE 4U1HA 1EXUA 5D8JH 3EYFA 2R8SH 1ZLVK 3MLXH 1R3HB 5JDSA 5GGSY 5IB4A 3GNMH 5JOEA 2GFBA 4XP4L 3BGFB 3FFDB 3IETA 1CTOA 3M07A 2DN7A 5C0NC 2Y36H 5E8EA 2PNDA 1D6EA 3QDGE 3QEGL 4P5KB 1TMCB 4H20H 1YN7B 2JIXA 3QHTC 1Z5LA 5CZVL 3IAPA 5JORA 1WBZB 1BD2B 1YY8B 3F65A 2VDKL 3V7AE 4LF3B 4NCC1 5F6IB 1KENL 3UTZB 1YPZB 4N0RA 2HJLB 3SDDD 3VGAC 4FQLL 2R4RH 2QADC 4OKDA 1XZ0B 4LSQH 3WKNA 3BRGC 4KY1L 5TDNB 4HLZH 3A6OA 4QHLB 5B39A 2B0SL 5C0GA 3OF6D 2Y7QB 1T04B 1IAIM 5DMGC 5GRZA 1U8NB 3QUXB 4JFQB 1G7PA 2YEZA 2BX5A 3O11A 2OLDA 2HKFL 4PRHD 4OZIA 2NY7L 4RA3A 3HAEH 1LEIB 4HUWB 1YEKL 2P42B 1MCWM 3MRCB 1T89A 1R3KA 3GSWA 4L9LC 3RQ3A 5J3HD 2WM0A 2YD5A 2WBJB 1DSFH 2OR7A 4FABL 1EGJH 2A77H 4A6YB 5F9JA 4DK6A 4EUPA 4F2MB 3GMNA 4OQTH 4YEFA 3EFFA 4UT6H 3TYGH 2B1AL 1KIPA 4WI4A 3HE7A 1BZ9B 3L3KB 1ULVA 3QA3A 5EU4B 3VXMA 1PG7W 2DWEB 4I0PD 4YNYB 3SDAA 4PJHF 3Q5OA 2O5XH 5ESAB 1XF5A 4J2XA 2IADA 1UCTA 1Z0MA 2BRRL 5D7KD 2DS4A 4GAJH 3V6FB 2Q86A 2A1WL 2WUCL 3IKCB 1HWGB 1E6JL 5I9QB 1S5IH 5GS0D 4OIAA 1ZVHA 2ERJB 2VABA 1A4JB 5L0QB 1BBDH 3UYPA 3H9HB 1AKJB 4M7JH 1ZVYA 4LLWA 4PRPD 5T3ZH 1E4JA 4GRLD 2HFEA 5F7NC 3JV6B 3OJMB 2COQA 1V7MH 2YMXL 4PJGF 3CXDL 5LGKA 1AO7E 2A6DA 4ISVB 4URTB 3VCLB 5B21A 1LGVA 3ABZA 3UTZA 4U6YA 5C1MB 2HJLA 1FRGH 3RJDA 4U33A 3BN3B 4JM2A 1VFBA 1XZ0A 1G0YR 3BHBA 4XPAH 5IJKA 4UU9A 1UJ3C 5M94B 5HYJD 5CHNA 3QT2A 2N7BA 4J3SA 4QHLA 3C5SB 1H3PL 4Y4HD 2JCCA 4HZLB 1CQKA 4NFBA 5MEOA 2FO4A 4L3EB 5GHWL 4O51A 5HDBE 2FYYB 5J8OA 1LEIA 4P5TB 4ZAKA 1MHCB 4IMKC 4Z5RB 5ADOL 3H7LA 4ELMF 1AHWB 5DLMH 4D9RD 5K9QI 1I4FA 3LKRB 1OSZB 2C26A 4PJBF 1WZMA 4XVUD 4X9GA 4AMKL 5HVWA 3FT2B 2WBJA 4XNMB 3DSNA 1W0VB 1B90A 4JRXB 1RHHB 1OAXH 4E5XA 1F4HA 2FGWL 2NNAA 1U8QB 1EDQA 3TT3L 4QKXB 4M7KL 4M4PA 4RQQB 3W0WA 2P5EB 4IRSA 4OD3H 4GRWH 4EOWL 1H5BC 4P2QB 1QFUL 3BEVB 2GK2A 2Y23A 3BISA 4PJDE 1JPFB 5I8OH 3QDMB 2VDQL 3G6JB 5E1HB 3T77B 3LVEA 3CMOL 1IAKB 3LD8C 1CDHA 3CD4A 4KKLC 4M5YH 5DRNB 3SPVB 3WO4B 3MLUL 4M1CC 3UPRB 4HAFA 4YZFF 3DBXB 1O5DT 4W4OA 1OB1B 2CUIA 3HUJF 2XYCA 2YK1H 4XNXH 1QR1B 1QYGL 1WLHA 2X4OB 3FB7B 4PJCF 5F97E 1CG9B 4JKPL 3WEXA 4NHCH 5F89A 3OB0H 1CQYA 2ZCKL 5I1HL 1N2RB 3BQUD 2OR8A 3QJHB 1ZOXA 1HYRC 1NAMA 1GGBL 4BQ8A 2FGZA 3D85D 1F2XK 4ISVA 5JIIA 5SWZD 4S11A 5C0CE 4BQ6A 1AGFA 1W72H 4NQDA 4Y4FC 3SKUD 1TZHB 2BC4B 4YXHL 3T8XB 4HC1H 1I85C 4PJ7F 4DN4H 1GGCH 1U3JA 3O3BB 5C6TL 5DD1L 4JG0H 4K7PY 2VDOL 2EZ0C 2VSCA 1BJMA 4QRRD 4L3EA 4F3FB 2I26N 4ZUSA 2VISA 4MQ7A 2OXHA 1UKQA 1B6UA 3ESVF 4PTTB 1X5LA 3TYFB 2BSSB 2I9LB 2PO6B 2IPTH 4DCQA 4P5TA 1VGEL 1TTGA 1QLFA 4Z5RA 3EO0B 3H3PH 2H3NB 4DUXA 1UC6A 3VXQA 1QVOB 4PV8A 2CK0H 1BAFL 4YAQA 1I1YB 3KJ6H 4M48H 1T2XA 1W0VA 4GSDL 2CJUH 1IGCL 3DJ9A 4KJQC 1PKQA 1CE1L 2YZ1A 4EI5A 1C7TA 4Y19B 2P47B 3F7VB 4P2QA 4XBGA 4HWBA 3U7WH 3BEVA 1D5ZB 1CFQA 3SDYL 5L2JB 1BD2D 3LS4L 1M71A 4IOFD 4NM4H 3W11C 4NQEE 1K3IA 5CD3B 4R3SA 1IAKA 5I1LB 3QUYA 1KC5L 2WWMD 5DUML 3BP6A 1G7MB 4RFOH 1XMWA 2VZTA 3RX5A 4KRPB 4K3DH 4ZG1A 5FGSA 2E5EA 4TTDC 2HJFB 5EUOE 4HS3B 4PG9B 1WQVT 4LLQB 5E2VH 5HJ3A 2X4SA 3ARZA 3QUXD 2DQDH 1TVBA 4L8CA 5AYQA 3TFKC 3EOYG 1FFRA 1EMTH 4ZUTB 4YBLC 4GBXC 1RVFL 1KNOA 2VE6B 5CJ8A 3RGVC 1Z3GH 1TENA 3SCMD 4BKLB 4GW1A 2DQUH 1K8DA 2FEEL 1ODAA 4OCXL 1I3RB 4HWEL 4NP4L 4M7LT 5JXEA 5DA0B 2FD6H 3EJYC 3O3BA 4RGOL 2R1XB 3VXNB 2VIRA 2PTUA 1MWAB 4PR5B 5EZJA 5TDPB 4Z8FL 3MRRB 4IIQC 1N6QL 3TC9A 4MJ2A 2VXUH 4R4FL 4PLJD 2ZOLB 4P3CH 2EO9A 3BKMH 4OIBA 4XMLH 1FZOA 4YFLI 3EUUA 1FNGA 3S97C 1I7ZB 4RZCA 5K33A 1E4KC 4JDVA 4XVJL 4BJLA 2X7LB 4V1DB 1MFEL 4MXVE 2CSPA 4CMMA 1KG0B 2IAMA 4JO1L 4RGNE 3EO0A 3FQRA 1NBVH 5HHOE 2A9NH 1P4IH 1BJ8A 1TJIL 4MD0A 3TZVB 3VDAA 3GM0A 3QIWB 4GS7C 3PG2A 4L1DA 2WZPD 4QHKJ 4NN6B 5J11B 4JO4H 2V6HA 5D7JC 5GSVB 5EG6C 1FG2A 5BW7A 1AKJD 1HHJB 3IJYA 3M45A 2YBRB 5GIRA 2NX5B 3GSNL 3QEQA 2DQTL 2HJKA 4YLQT 5L7XL 4O5LH 2D3VA 3DHMA 3MV8A 1RZGB 4K94C 3SO3C 4QHNB 4X6CB 4FTVE 3QXTA 7CGTA 3MRJB 2GTWB 3DVGB 2HMIC 4UV7H 3IFOB 5IVOA 4F7PA 4K8RH 1F2QA 2V5RA 4NT6B 3ZSTA 4CADA 1JFQH 1BQHG 1DQDL 5FHAH 1JTOA 1ZTXH 3O6FA 2MNUA 4HFUH 3BKCH 3IU3A 1I1AA 2K7PA 3QAZC 3R8BB 2FCBA 3I85A 5KVFL 2OP4H 5FECA 2XY1A 4N1CA 5HVGB 4JN1H 2APXA 3P3YA 3WNNA 5D72L 4H88H 1T0NA 3K81A 4Z7WE 4C58B 1T2QL 3U9UB 1D5IH 5EZLA 4JFFA 5E6ZA 4MYWB 2NXZD 4QGYA 2ZG2A 4QHKI 3R06A 4FQHB 4P4KA 1F6LL 3AXLB 2XY2A 1DQQA 3FRPA 5JIKA 2X4TA 5I73B 3VXNA 4K7PL 1GOHA 1RUPH 2ZCLH 4HEME 2ED7A 4LSVH 2P5ED 1IGFL 3WXWL 1CLOH 3QDJE 5DGQA 5MEPA 3O4LE 1C16A 1KYOK 1J1PH 5IVXE 3SGJC 3QDMD 5EOCL 3V4VL 2BVEA 1I7ZA 3JWOH 4HD9A 3VFPA 4XNYH 2IG2H 3MNWB 1KG0A 4JZJB 4NQCD 4CJ0A 3L3DB 1UXWB 3MYZA 1BFVH 3T0EB 3O2DA 4DN3H 4YUEH 1DEDA 1QRNA 5IBLD 5DEGA 3QHFH 5T3XD 5F7DB 4XHQA 3KG5A 5GSVA 1K4CB 5FDWA 3DO7A 4EXKA 1WCBB 4P57B 4ZQKB 2EDDA 5A3IC 2YPVL 4HIHA 4X6CA 1RJLA 4KMLB 4JCLA 3HZYB 3MRJA 4QRTB 4CAGA 2MCPL 4PJIF 5F9WC 2LTQB 4NQXB 2FX8L 1UA6L 1HHKB 3LOWA 1MH5B 2ZUQB 4K3EH 3MV9D 1Q9KA 4ZNEE 3DLQR 3WS3A 1UACL 4MJ6A 4PJAA 5I1EH 1EBPA 2O5YH 4Y2DB 4OCYL 2XQYK 2I07B 3FN3A 2HRLA 1QPPA 2MPAH 5D7LA 4M7LL 4QCIB 1IE5A 2CO6B 3C5ZA 3VXPB 1SM3L 2NZ9C 4ODXB 3QIUA 2PO6D 4HQQL 3QQNA 1QBLH 4KK5D 4QYOA 3RZWA 4KK6C 3WYRA 1M4KA 1YEDB 2GSGA 43CAA 3L9RB 3PHSA 3ZMRA 4QRSB 3AXLA 3P4MB 1OGTA 4G8FA 3KJ4C 1G6RA 4TQEH 3S37X 4NM8L 4RNRB 4HHAB 5DJ6B 1LK3H 3FOLB 5INDA 1CZ8H 3UTTE 5DJ0B 4KMTL 4RAVB 2DBJA 1F4XH 4OLZL 4K8RC 4XWGL 3VMPA 3LHPH 5IFAL 3WFCH 1TCMA 3OKYA 4PJ5B 5HDLA 3VWJC 1N8ZA 2YC1B 3GI8H 3MNWA 2AV7A 4JZJA 4NWTL 5D1XD 2F74A 5IV2A 2AJZA 3I02B 3QZWA 4U1GB 1AGCA 2NY3C 4C4KT 4KRPD 2R8SL 4DWHA 3ARVA 3CZFB 2VLRE 4BUHA 1HXYA 4U1KB 3LRSA 2BNRB 2CIKA 4KUZL 5IEKB 4MB3A 4HMEA 4F9PA 1PKOA 1YEHH 5EU6E 3S37L 3M17B 3DETC 3ZT6A 3ISWA 3MBEB 1F3RB 3MV7D 4E41B 2J1KA 4NN7B 2ICWI 3C8DA 3QFDA 5IB2A 3NFSH 2X6MA 4XX1G 5K59F 1FNFA 3LN5A 1UB5A 2V7HB 5HYQB 4FQ1H 2D0FA 3B5GA 2H9GA 5D5MF 3S8WA 5EU3B 1A3QA 5B3JE 1JHTA 4I13B 4OT1L 2Q8BH 2P5WE 4D9LH 3KLSA 5AEAA 4TRPH 3TNMB 3U46A 3VH8A 3JV5A 2VR5A 1KEGH 1IGTA 3IJHB 1FVDB 3SY0A 1VGKA 1DBBH 3S96B 3G5YB 4Y89A 1MHEB 1VDGA 3VFNB 3LKNB 4LKXA 4V1DD 3WJLA 2AK1H 4RMQA 1QNZH 3VFWB 1YEDA 3TZVD 4S2SA 3BSZL 5HHQA 3C6SA 3DOSA 3QIWD 3PABB 4JY5H 2XNAA 4M1DL 4ELKB 1DQML 1EGJL 4JPVH 1NBZA 4M8QA 3FMGL 3FQNA 3KPQB 4RNRA 1YEEL 2NTFA 3MCG1 4HHAA 4RISL 5DJ6A 3TYGL 3WN5B 3FOLA 5HI5C 4XP5H 1S9XB 3PWNB 3OBAA 5HSFA 4LLUA 5DJ0A 2NX5D 3TN0B 3V2AR 5CEZD 3KPSE 2EKSA 3QRGL 4DW2L 4LCIH 3BDYH 5JHDE 3EO1B 4MJ5A 3EDKA 2YR3A 5F3HA 3MODL 1OAYL 3L1OL 3TVMB 3EOAB 3L3IA 5C0EA 2X40A 4KROB 2PW1B 1KPRB 1DE4B 3GJEB 4U2ZA 4EDXA 1S5IL 4WO4C 1JPTL 3S5LG 1T66D 4FZ8H 3QXDB 5FO8A 3WFDL 2ENYA 4EIGB 4N0FB 4YHKH 1INQB 3RWHB 3F6IA 4Y16C 5IOPB 4S0SD 4E41A 5CSZB 1V7ML 3RY6C 3CDYA 2RFXA 2EIEA 4YWGL 3V9FA 5FUOH 1FCGA 5IK3B 1IGMH 4NKMB 4Y4KC 4YBHA 4LHUD 4ZO9A 1I7TB 2BSED 2HT2C 3FAWA 2F15A 2JB6B 1ZEAH 1MHPH 2EDRA 2HFGH 1VB9A 3EDJA 4PJ8D 4ZUUB 3MLPA 1PBYA 3V4UH 1X5HA 3CSYB 3I6GA 4PYHA 2FLBT 3RP1A 5ITBL 1JWMB 4S1SL 1IC7L 1QBBA 4GKZA 4POYA 3PGDB 1HZHL 3MCLH 5DUPL 1KN4L 3IJHA 3K2UL 1X9QA 5IB1A 1FVDA 4G6ML 1HQ4A 3VFNA 4O2EA 3HZMB 1RIUH 1X7QA 1U36A 4PJCA 4M9OA 1ZANL 1QD0A 5DD3H 5D2NA 2FHFA 5EZIH 4S1QH 3VXUA 1FGVH 3OL2A 4ORGB 5AAMA 1MJJA 2Y5EA 2VAAA 1UM6L 4ELKA 5JIPA 1UG9A 1UYWH 3O8XA 3ARBA 1ORSB 1H3GA 4Z0XB 1HH6B 3H6JA 2I9TB 5DTFB 5TQ2H 4APQA 2VLJE 4PFEA 3UO1L 1S7XB 4BELD 1WTLA 3OXSB 2V2TA 2AV1B 3MV11 3PDDA 4PJ7A 4Z7VE 4HKXA 1JPGB 4YDLC 2PYEE 2ZUSA 1TQCC 3PV6B 3PWUB 2ZWLT 3QFJB 4JVPA 2DQCH 1HYSD 3TO2B 3RKPA 5IG7B 3TVMA 5MENA 2HRPL 1K4DA 3B5HA 5GGRB 5EOTB 5SWQA 2F54E 1FL5B 2VWEE 4XNXL 4S1DC 2Z31B 4LSSL 4PJXF 3DHJA 4N90E 5I2IA 1CDGA 3CPLA 3ARDA 3QYCA 4MHHG 4Y2DD 3CDGA 1LO5A 3JZ7A 4OF0A 3RWHA 1R5WB 1R24A 1XH3A 1MREL 1B3JA 5A2KH 5IF0A 3RWEB 1KJ2H 3F58H 3JTSA 1XF2B 1KCRL 4NKDA 1LE5B 3G6AA 3PL6A 5E6YA 2KQMA 1NMCC 4ODBD 1NGQH 2NLJB 1AD0B 3ZT5A 4DTGH 1W72L 4PP1C 5JLZB 1I8KA 3MLWH 2OK0H 1I7TA 1FYTE 4DN4L 1A2YA 5GGSA 3VRLE 1GPOL 5CBAA 2VXVL 4JG0L 2W59A 3VWKB 1JP5A 2OL3B 2Q6WA 5HDQH 4AL8H 4N1HB 5F7MC 3QNZA 4XGZB 4G43A 4B7LA 4H26B 2FSEB 1T80A 4PJ5D 3HZMA 2QQKL 3D3VB 4R0LB 4LFHD 2J5LC 1XCQB 2A83B 4N8PA 4P2RA 1H8SA 1EJ6A 4F7TA 4FQIL 1GIGH 2BNRD 3HNTH 2NY2B 4AENB 4HULB 1NFDB 1HH6A 4ZSOE 2LABA 4JRYB 4BSVB 5EDXA 1TVHB 5ID1A 2M2DA 3DMMA 1BZQK 2HLAA 3GK8H 3MBED 4XP9L 2EDQA 1ORQA 4CW1B 1LEGA 1I9JH 1UZ6E 3WHXB 3MXVL 3PWUA 5D1QB 3EKCA 3MLRL 1GVIA 3O9WA 4CNIA 4ZTOH 4F8QA 2V2XA 1AGEB 2HVKB 3QEHA 5DUBB 5EOTA 1A47A 1R5VB 2CMRL 3OG4B 2Z31A 3T4AB 3CK0H 1LDPH 1IVLA 2P43B 1QRKA 4HLJA 5IQ9B 4UT9L 2H2SD 2OBGA 4DK3A 2BXZA 5I1AB 4P48A 3VD3A 1R5WA 4EBQH 1F6FB 1EMTL 1LO2L 4Q9BA 1JHLH 4TVPL 5JZ7C 4DGYH 1NGXB 3RWEA 5IMOB 5IB5A 2ZUUA 2FR4B 3SJVB 2ZOKA 3QI9C 2DQUL 1AD9B 4Y1AE 3UAJC 2MQCA 4RBPK 2H32H 2WINA 5JLZA 3NN8A 5FO7B 4EN3C 2UYLA 3UJTL 4AIOA 1MCBA 2XWTA 2VDLL 1A6AB 4OLWL 4JFPB 4XCFH 2VXUL 4E9LA 2GSIB 3TN0D 5IFHL 4MA3A 5FM8A 1QEWA 4RFEA 3FQWB 2ATKA 4XMLL 1ZVSA 2YZ8A 3MJ9H 3VI3F 5E5RB 3ZSSA 3IB4A 1LMKA 4I8DA 1U8OA 2A83A 4HWNA 2VR9A 5TH2B 3STZA 1SJXA 2IF7A 3ARPA 4ZFFB 1YJDL 1PY4A 3D39E 4H25B 4KROD 4BFBD 5M95B 4QHMB 1CGXA 4P23D 3I3BA 3TESA 2DICA 4PLKD 4LKCA 5FCUH 3RY4A 1DBKL 4Q0XL 1NFDA 3VGAB 3EYOA 4NRXB 1ITBB 1CD1A 4QY8B 2OTWA 2QADB 1DBJH 2J88L 3EZJB 1C5CH 4I48A 2ZG3A 3V8OA 2ICWB 3U4EA 4O2CA 4P4RA 5MERA 2AXGB 5IIEB 1NL0L 1QA9B 3F12A 2AGJL 2QL1A 4UV7L 2AJ3B 5AZ2H 1NBQA 2HVKA 5EB9A 1F11B 1HHHB 1AGBB 4OGAC 2VXTH 1R5VA 1H15A 4ENEC 5FHAL 4JO2L 1ONQA 2F53A 4ZPVA 4CBPA 4Z76B 3G04A 1ZTXL 2HH0H 4X6FB 4HFUL 3BKCL 4LASH 1YNKL 5IQ9A 4L9LB 5DFVD 4R26H 2X9YA 1NBYB 4HGKC 1LO3L 3GSNA 3OAYK 4U6XA 3CVIL 4F9LA 2QBWA 4JN1L 4H1LA 1NGXA 2EYRB 3LIZH 3BFOA 5CWSB 3HNSH 4ZOEA 5DJZB 3B5TA 1D5IL 5KN5A 3O3DB 3H0TA 4YE4L 2GJJA 1PGRB 2DQFA 2VLKB 1HQRA 1HOCB 3EOBA 1AY1L 4CL7A 1WK0A 4LNRA 3X13B 3SKOA 4OZHE 2GTZA 4LK4A 4OCRH 1UM5L 1RUPL 4ETQB 5IHBA 5I76A 3T4YA 3P11L 1MCHA 4O2FB 4ZDHA 4N0CC 4J4PA 3QFJD 2LQRA 3GIVA 3KPRE 4Q9QH 4LARH 5T1LD 3JWOL 4PY7A 43C9B 5TH2A 2C7UB 3M8OL 1BFVL 3SE8L 2GIYA 4QOKA 3JWDL 2OQJA 1MIMH 5IBUG 4PGCA 2W38A 1WJ3A 1CXKA 1BGXH 1F13A 1IEAB 1I1FA 2ORBH 1KCSH 3FRUB 2CKBB 5HTSA 3V95A 1UJ3B 2E6QA 2ICWA 1A6PA 3WKML 1RJZB 2OTUB 1MRCL 5IIEA 4GOSA 1CBVL 3ARTA 1GAFH 5LJYH 2AJ3A 3LMJH 1S9YA 4YHYC 5ELIA 4YHML 2I5YH 3RX7A 1NCCL 2X44D 3MNZB 2G9HB 4K3EL 4KJYB 1B4JH 3V52H 1YMHA 3B8YA 3CU1A 5HGBA 4Z7UE 5HGHB 4RAUA 2QSCL 3F5WB 2CIIB 3BP4B 3KLHD 3C8HA 3D5OF 4L8SB 1L6XA 4WW1B 3D3VD 1K2DB 4NUGH 4QXGH 1MCOH 2EICA 1OWRM 5EPMB 4ZODA 5D2LA 4KGJA 4G9FB 1H5BB 3KWWB 3RL1B 2C3VB 3VFUB 4FQPA 3F7QA 4NZRH 3S4SA 2ADJB 4N0UA 1O7VA 4JFDB 3LD8B 4HDIB 3X3GL 4XXDB 1LD9B 3GIZL 4JRYD 4CU7A 5JUEL 3Q5TA 3NMEA 2R23B 2XA8H 1F4XL 4LLMA 1S8DA 5BJTA 3VXSA 1MCFA 5ETUB 5DQ9B 3O41B 5ICZA 5D1QD 3HPJB 1OL0A 3GBNH 1RIHH 1A7NL 2J8UA 5GGQL 1CGWA 5L6YH 1ZAGA 5DT1H 1TNNA 5HHMD 1KPUA 3D69A 1J8HA 1X4XA 4L4TE 4HBCL 3ZO0A 1NDMB 5FHBL 3GMQA 4U1MB 4U1SB 3TBSB 1IEAA 5CLTA 3Q48A 4Y4FB 4OFYD 1YEHL 4FG6D 4U7SA 2IANB 3LEVH 2Y6SD 4MD4B 3PDOA 4BM7A 3L5IA 1W0WB 4QRUB 4GG6A 3SJVD 1IMHC 3HRZA 5KVGH 2UZXB 3D18A 4ZFGH 1A6TB 3SKJH 3WNMA 1OAQL 2YPLB 4OTXL 5CGTA 1ZT7B 3KAAA 5DEFA 3QQ4B 4ZFOL 1OQXA 4FQ1L 3MUHL 2AXFA 2Q20A 4HV8A 5IHZB 2EC8A 2J4WL 4G8EB 2G9HA 5LWYL 4ONGL 4JFEA 3GB7B 2Q8BL 1NDGB 2E27H 4N8CL 1LO4H 1NMAH 3L3OB 2QR0A 4U7KA 5IROA 4EIZC 4GAGH 3KXFA 1DBBL 5DRZB 3PP4L 3T3PE 2JCCE 4L8SA 4LMQE 1A6WL 4OLYL 3FHAA 1K2DA 3HI6H 3D25A 5C0ND 4X98A 1A1OA 3RL1A 3CFBA 2Y1VA 3LQZB 3KPOB 1BEYH 4YQXH 3RUGF 3B9AA 4JFDA 1P5VA 4I3RH 4HDIA 1WEJH 2BVPA 2NW2A 2P8MB 3BE1H 4OZFG 2QADD 1I8LA 4XP5L 3CH1A 3SCMA 1AC6A 2R23A 3FN0H 4PGEB 2VL5A 3W0WE 5ETUA 5TQ0L 3BDYL 3HAEA 5DMGD 2ATPA 1A1NA 3NBNA 5AZEH 3TBWA 5ALCH 1FPTL 4GBXB 4NC1E 3K0WA 3IKKA 1VEMA 3RGVB 1NDMA 1EGJA 2YUWA 3WFEH 5F3BA 1P7KA 2D9QB 5T1KB 4GRWB 2IANA 2V9TA 3IAGC 3GUTB 3L3HA 4JDZA 3LAFA 3ZKQD 3NFPA 4AH2A 3VFOB 4HGWA 4Z95H 4JFOA 4NZTL 4J23A 1D7FA 4LQFH 2ICEB 2G5BB 2DM3A 4IIQB 3I75B 3ARWA 5D71H 4QWWC 4LCUB 5EOQH 3WIHH 4LSPH 3BD5A 1HN1A 1JPSH 4AEFA 4YHZH 1KJMA 2DD8L 3QQ4A 3CFDA 4MJ4A 5FYKD 3TA3A 4PS4L 3KPLB 2NY6D 2EIDA 4CN4A 2N7AA 3IDXH 4W68A 4NQDE 3BPOC 1CD9B 3STBA 2H26B 1IL1B 1NDGA 3P4LA 5T5FH 2UV3A 1EO8H 8FABB 1J87A 2G2RA 4XVTL 2MHAB 2Y72A 3FT4A 3MCLL 3WE6B 2W91A 3V8CA 3IU4H 4GS7B 1DFBH 1OGAD 4LAQL 1E28A 5DRZA 3PJSB 1OTTC 1D6VH 4HZAA 1JHKL 4M03A 4PJXA 3RPKA 3D48R 3SDCC 5JQHC 3ROLB 5EZIL 2LU7A 2D7MA 4S1QL 4NUJB 4UT7L 1WC7B 4FFYL 3DXAE 3IDNA 3SO3B 3OKMB 5C0AE 3QWOA 3X11A 3L6FA 5D6DA 3TBTB 2XKUA 4DGVH 3L5WA 3QUZC 5GRWA 1FFPB 5BOPA 3V0WL 1OM3L 1Q0XH 4NO3A 1KV3A 4AQOA 1TETH 1NCWH 1UWEH 1MCQA 4UOW1 1B2WL 5EC1A 1IC5L 4G6KH 1PKQE 2CPCA 3K2MC 4JLRA 1QKZH 1MVUA 2VZ3A 3QAZB 4F57H 2Q3ZA 3RVWC 4NSKB 1BECA 5GISH 3VI4F 5CJXA 2H6PB 5CKGA 4HKBA 3MC0A 5T1DH 3NAAH 2YD1A 4KKBC 1DUYB 3MYJB 4OCWL 2DYPB 2J2ZA 1NGWA 2IH1A 4GW5B 1UKSA 1MLCB 4AT6B 5T1KA 2ITDA 3FCTA 2O93L 1AQDA 4RDQG 4HIIB 3U48A 5E8OB 1DEEA 1NGYB 1SMAA 2VZOA 1IAOB 1KGCE 1R3JB 5DJXA 5MHSE 1OP3H 4LSUL 1U58B 3ZDYF 1FDLL 1IT9H 5DHVH 2ICEA 4D8PA 3S36X 1BP3B 2G60L 4IIQA 4U1JB 4G9FD 2IPUK 1DQLH 3S3JA 4P3WA 4PLNC 1A6ZB 5CGYC 1F8TL 4WHDA 5IJVA 4Y5XA 4XXCA 1X44A 5T33L 4KKLD 4M1CD 2H26A 4JFHE 2RHEA 1GJIA 2ID5A 4NHUA 4LEXL 3UTSE 2W1NA 1XR8A 2MHAA 1BFSA 3MXWH 2GJZA 3WE6A 4FZEH 4M61B 3RDTC 2AAVA 2VWEC 1INDH 3O3UN 3EOTL 2QKIB 4KVCH 4GUPB 5I74C 1NFKA 3VDBA 1D5MA 3BI9X 3MV9A 3ROLA 1VHPA 2IBBA 4GG8B 5I1GL 2M8XA 1W72A 3L95A 1WC7A 2EDTA 3NCBB 4NRZB 3OKMA 5FO9A 3HNTL 4JPIB 3F6LA 2BSRA 4Y4FD 5JPNA 4LBEB 3VD7A 5F9WB 1AXIB 1ACZA 1JWSB 3T04D 1A7PL 2QQNH 3MJGX 1CVSC 1FE8L 1NAKH 4JKWA 4RGMC 2EZ0D 2VLLB 1ZWIB 3IFNH 1L9NA 3QEQE 2W9EL 4Q6IC 4DGIL 5FGCB 1P4BH 3LKQB 2Z9TA 2H1PH 1KXVC 3BO8B 4WHTB 2DLHA 4OB5H 4GXUM 3MUJA 1UGNA 3CFJB 3B9VA 1FN4B 3CK0L 2GK0A 1MLCA 4W4NA 5T3ZD 4XPGH 5D1XA 5K9OA 3KDMA 4EBQL 4Q6YA 3LS5L 2YKLH 3GSOA 3TBVA 2AABH 3KJ4B 5F1OB 1JN6A 1RAMA 3AM8A 4KJQD 4DVBB 1AQKH 3QQ3B 5K9KA 3L5XL 3HMXL 3D87B 4MA1B 2X4QA 4U1JA 3W9EA 3SE3C 4MAYA 1A3RH 1CE6A 1BQLH 4JVUA 3HE6A 3W11D 4JFFE 4XP1H 3VWJB 1DUZB 3GMMA 3EYVB 5B8CA 1C12B 1DLHB 2X1XR 2E7BA 2NY3B 4LDLB 4AYFA 4LRNL 5KTEH 5IR1A 1OT2A 4X99A 4JG1H 5AYUH 6FABH 4M61A 4TTDD 3U7YH 1U93B 3MNVA 1NCAL 3QWRD 3DIFB 5DMIH 1EEYA 1UB6B 4UOJA 2XN9B 3UXFA 1FFQA 5F6HJ 5E8PA 3MBXH 4DAGL 3TFKD 2ARJA 1ITCA 2DBLL 4GJTB 3BGMB 4JFXB 5H2BB 3C5JA 4WU7A 1S7VB 4X6DE 3L3GA 4GBXD 3ILQC 1CR9H 2BJML 3RGVD 3VD5A 3HI5L 1E27A 3MRKA 1N64H 2H2PC 1XGPB 4I18C 3RA7H 2CLRA 2IFGA 1QRNE 3RI5K 1MHHB 1JWSA 5GSRB 3VFTB 4F33A 1W2KT 3TO4C 1ZSDA 1H8OA 5F9OL 4IS6B 1G84A 3X14B 4EI6B 1S9VA 1ZWIA 4ODTH 4RRPG 2X4NB 5D7IB 4Z77A 5DC9B 5IW6B 1A4KA 4LNVA 4YDIH 3V0VA 5JW4Q 1HKFA 3P77B 5IEHB 2ZJSL 5EIIB 1VKXB 3T2NL 3U36A 3PWLB 4F58L 2OCFD 3MUZ1 4UIKH 3DX6A 4OFKA 2I60L 3QDGB 4KPHH 3SQOL 5I0DA 2HKHL 1F6AA 2BVTA 1KULA 4DOHE 1HKLL 5D7JD 3BJLA 3HZVA 4PJAE 5F6HI 5CD5C 3KPNB 3ARED 4G42B 3UTOA 4AY0A 4OUUB 1G7HB 3A6BH 2EE3A 3ETBF 1YEJL 4AZ8A 2NPLX 3NPSC 2BVUA 5H37G 3CFEA 4NBXB 5C08E 3FB6B 1IAIH 1T5WB 2LAAA 5D6CB 1PZ5B 3G5ZB 4G8GA 2IFFL 1CL7L 1GRWA 1DLHA 1DBAH 1BLNB 4HPOL 1EFXA 4JPKH 1F00I 1EX0A 1KLUB 2A2QT 3TGXA 4IDJL 4WO4B 2Y07H 1UB6A 3HZKA 5ESVB 2XN9A 5DS8B 3REVB 1A6VH 1JZ4A 3I2CH 5D1ZC 4PJ8A 3ZE1F 4DZ8A 3RTQC 4WFFD 3D2UA 2GY5A 1NCDH 4Y16B 1S7VA 4NQUA 4KZDL 2PW2A 2GEEA 4LQ1A 3TWCH 2AJXL 4XH2A 4WY7L 2X4RB 4PBWD 4RX4D 3R1GH 3OX8B 5EUKB 2FBJL 5I17A 5ALBH 2DYPD 5FYLD 3WUWA 5DYOA 4QF1A 1IEBA 4Y4KB 1U6AH 4TNWK 2XZQH 5GJSL 5EO1A 5IM7A 3RNKB 2WWKT 1CD0A 3PGCB 1XGYL 1JZ3A 4EI6A 3LQAL 1GAFL 1CTNA 2VDPH 4KGLA 5ID0B 5LBSL 2Z0BA 1IM3B 1XF3A 1F4AA 2FJFA 2X4NA 5D7IA 5IW6A 4GKNB 1HINL 3KPPA 4XZUB 3S3SA 3AS3A 4P3DB 2UZIH 3BH9B 3QCUL 1Q9WA 3RWCA 5CINH 1N6UA 1YY9C 1VKXA 5EORH 3VW3L 1PW3A 3V52L 5HHNB 4HXBH 2D7NA 4HS6B 4X4XB 1MUJB 3L3JA 2R0LH 2K1MA 1NLBH 4HX1B 5J89A 2XTJC 1KELH 1SBSH 1R5IB 3BIKB 4PJHE 2YN3A 1CICC 5F96H 1AO7B 1KT2A 5I16B 1ZLSL 2IH3A 3P4OA 4G42A 2V9RA 1MCOL 3P73B 3IDUA 4OUUA 3VFGL 2HT3C 4HKJB 3MA9L 3OB8A 5A3ID 2C3WA 3U30C 4RWHA 4UTAH 1TQCB 4FP8L 2AEQL 4EXPX 4U1IB 3UJJH 5D93C 3TIDB 4NJ9H 4ESKA 4KTYA 5E24E 4JVWA 3BESR 2XWJA 1M05A 3BGAA 4PJGE 1JI2A 2XA8L 4RFNC 1YYML 2V17L 3WNPA 1NGZB 4YPGB 4N8VB 1S78C 32C2A 4OF6A 4D0BB 1HCFX 3REVA 1FV1B 3MRIB 4KDTA 1BVLB 4P2OA 3ROOB 3LEXB 4BK5A 3VGFA 2YSSB 5BVJB 3T09A 1KB5H 1JGVH 1S7UB 4I2XA 1VEOA 3GSXA 3RY6A 1HI6B 5D9SA 2NZ9D 4R96B 3OX8A 5IW1B 4LLDA 2EDEA 3ZZ1A 1E4XH 3QSKB 3TCLA 4KK6D 1NMCB 1H3XA 3RHWK 3GMPA 4BZ1H 5ADPL 3BZ4B 3MLZL 3LEVL 3QXAA 5DA4A 3HNVH 4PJDB 4KZEH 4LSRL 4LCWE 4W70A 5EU5B 3UJIL 1G9NL 5CJQL 5GZNC 3S88H 3RUGA 5MP6H 4ODWB 3B9DA 1T89C 4XMKL 4YHOH 4LOUD 2ZCHH 4ELME 1YC8A 4WDIA 1NAMH 2A6KB 3WFHA 5KVGL 1FH5L 1EEZB 4PJBE 4MA7L 1IM3A 4ZFGL 2FATH 4WFEE 1BVKB 4GKNA 5DSCA 4O9HL 5FIEA 1T1XB 3IF1B 2XRAL 5SWSE 2H8PA 1PVHA 4IMLB 1DN0B 2DKUA 3VWJD 2J5LB 3HE7C 4D9QE 1MUJA 3PF2A 2C4FT 2NY3D 5F7UA 4RMVA 4HX1A 3PQYD 3K46A 4IJ3C 4M93C 4LPWA 3SDAC 5GS1C 1JNLH 1A9BA 5C2BH 3BAEH 3V79C 3QUML 2RQ8A 5FB8B 3BN9C 5C0CB 4YZFE 3RVUC 1TZIA 4XMPL 5EBMA 5ISZA 3AU1A 5JR1L 3GKZA 3IGAB 3ILPA 3HUJE 3DV6A 3WLBA 2R9HC 2VUYA 5HD8C 1JGDA 4ZFOA 2Z8SA 4PJCE 3SGEI 4YDJB 2D4DA 1BEYL 3THMH 1FFNB 5D2NE 5GRVK 1H9VA 2CXGA 2HN7A 4I3RL 3F7PC 1ZLUH 4OZ4B 2HTLD 4MJIE 2BK8A 4HIXL 4Y8AA 2KPNA 2VDRH 1LE9A 3OGOE 3BMVA 2N4IA 4ALAL 4D0BA 4HWBH 4WI6A 3MRIA 4JM2C 2APFA 2X9WA 3FQXA 3LEXA 5IJKC 4ODUB 5E1AB 5BVJA 5GGTH 4NJAH 4PJ7E 2EEDA 1VADB 2FX7L 3CAFA 3KLDA 3TJHC 1FZJB 4FQXA 2EH7L 5HYSA 4MGXA 1NPUA 4K9EL 1NJ9B 3P4NB 5MENE 1EEUA 3QI9B 5DMKA 3WFEL 3QPQC 4C83A 1J05B 4NPYB 2BDNH 5ITFB 1FNHA 1BFOB 5FKAB 4MS8C 4PJDA 4EN3B 2X1QA 3NVQA 3CVHB 4NQEB 4ZAKC 5IW3A 1KEMH 3CXHJ 5GS3A 4UILH 5HI5D 4XCEB 4I77L 5DK3A 4FQCL 5EOQL 4MB4A 5TE6L 3WDJA 3E6FB 2WBJC 5E94B 1BVKA 1AXTL 3C9NA 1ZHLB 4UV4H 5IT2H 1T1XA 5E7FA 1VFAB 3U2SB 1ZGLB 4ZUVA 1CXLA 2PCPB 35C8H 4XCCH 3C2AH 1KPVA 4NBYB 3UPCA 4IRSC 4M6ML 1G7JA 1CFNB 1KTRL 3RWFB 4C56B 3GMRA 5J56B 2LVEA 3IU4L 1IZKA 1DFBL 4NC1C 1CFTB 1NSNL 5J1AB 5TF1H 1KJ2B 1NFIA 2BRQA 2X09A 4HF5L 4X80L 5FB8A 3TPUB 3AMLA 4W4OC 1U8KB 3BVNA 3H7BA 2A9MH 3SEPA 1P7QD 5DJAB 3MLYL 4EVNA 1FFNA 5DQJB 1YEIH 3IVKB 4P2RE 3CC5B 3DURB 5CSBA 5EBWA 3QG7L 4DGVL 5JOFA 2R29H 4Y4KD 3UROR 3S35H 1T7VA 5K9JL 2XICA 2HT2D 2R1WA 4KMQA 4NWUH 1NCWL 2FHCA 4YO0A 1Q0YH 1QKZL 4RGNB 1FO0B 5HHOB 3KHOA 4P2YA 3DWTA 5GZOD 4HUVA 1FORH 3DVNA 4G9DA 3O6LH 3HFML 4G3YH 1J12A 1RURL 5DQDH 1MCPL 1MOEA 1OCWL 2LAGB 1NJ9A 5DRXB 2C1PB 4X5XA 3FO1A 2V2WA 4DJMA 3NCEB 1F3JB 3OWEA 1BFOA 4U3XA 4EN3A 4PTUB 3HG1E 5CEYB 1AO7D 2FJGA 3B3IA 4F7CA 4NQEA 4FTVB 1IT9L 3TNNB 4MAUH 5C9KA 3NCFB 3CDFA 4J3VA 2IGFH 1REIA 3O81A 2JB5L 3FO9A 1OF2B 3NCCB 5T1MB 3TIEA 4NGHL 4GXVL 2ZG1A 4KQ3H 4MNHA 3T1WA 3MRGB 3OXRB 5EUOA 3U79A 4EI5C 5J1TC 3O3EA 1CFNA 3OAZH 3C09C 4BSJA 1V7NH 4HIJB 4TUOB 4JJ5A 4TSBL 3RWFA 3B8SA 1EHLH 2FJHB 4S1DD 1HSBA 2J6EH 1CFTA 2FIKB 3WXVH 2Q76A 3QUYC 4Z7WB 2YWYA 1EO5A 5E5UB 3OQ3B 1KJ2A 3FQTB 4KVCL 3QCVL 2VL4A 3HC0A 1A5FH 1RULL 1OY3B 4O02L 5DHYA 1F02I 5DJDB 3O0RH 1UWGL 1XCTB 4KRMB 5DJYA 2H32B 1QZ1A 1JK8B 3LEYL 5BZWA 4P9HH 3MV01 5ERWB 2Y25A 3O3AA 4KKCD 3CC5A 3O2DH 4PP1D 4P59L 2OZ4L 4YHYB 1T1YB 1ACYH 3LZFH 3SKNA 1RSFA 3C6LA 1RIVL 4GO6B 4PRHE 3STLB 4DKFH 2K7QA 3GSUA 4MNQB 1U2CA 3PHOB 5HHOA 5JXEC 3MGAA 1KIUA 2WQ8A 1N26A 3RBGA 4HK0B 4WI5A 3RBSA 4OM0L 1PQZA 4D3CH 3LKOB 5KVMC 4TSCH 2C1PA 4ZOBA 3DRTA 2CDFB 3IS1X 4MX7A 2VC2H 3AB0C 5C09D 2F53E 3SQBA 1F3JA 4WWKA 3U1SL 5CEYA 1T3FA 3DROB 5F1KC 4ODSH 5INCA 2IAMC 1A3LL 2DQJL 1XF4A 1AQKL 3CX2A 5FYJL 1S7TA 5D7KE 1UT9A 4JFYB 1MFAL 4XRCA 2EEAA 4L4JA 3PNWB 3IJSA 4HS8H 3MRGA 4HJJL 4NNPL 5ICYA 2XG4A 5BW7C 4YXKL 2DLFL 5DDHA 2VDMH 4G5ZH 2C9AA 4I5BB 2NW3A 4NO0B 4PRPE 4TUOA 1G6RH 4U2YA 4UQ3B 5ABDE 1RZFH 3HR6A 3FO0L 5AYUL 3NFNB 4PJFF 4G80B 2NZIA 5LQBH 1JNNH 5C07B 2GAZB 2XPGB 1N6VA 3ARFD 2HLFC 4PJIE 2C5DC 3NOIA 4PJEB 3HMXA 1T21B 3E8UH 4JR9L 5DJDA 3U0WL 5BS0D 1Z9LA 1OTSC 2VYRE 3O6FC 5JZ7D 5HYJE 1I1AC 4XC3L 2FEDC 4FXGA 1FZMB 2BVQB 3MRDB 1DLFL 3RA7L 3NTCL 5JPMA 5KAQF 1FNLA 3QDJA 1OOAA 5E7BA 4M1GL 1FIEA 1T1YA 5I15H 1M7IB 3O4LA 4OLXH 5IVXA 5KG9B 1FJ1A 4YIQB 2R2EB 3GI9H 5JNYB 3RNQB 5CEXB 4YDKH 1S7SB 2JJTA 1AXSB 1QOKA 1KCVL 4IEFB 4P4KC 3LPFA 1K5NA 3O6MH 5KSUA 3B9KA 2VLRB 1HHIB 4R90H 1IM9A 1IKNA 4HK0A 1HXMB 1N3NA 2ZSWB 3MR9A 5KSBA 3G5XB 2P24B 1Q1JL 3HS0B 1NC4B 3JXAA 4C56D 3ET9F 1Y18A 3OR7B 4XP4H 5H94B 2DQHL 5B38B 3DROA 4MVBC 3T2PA 1MI5B 1OP9A 3QEGH 3MFFB 2R2CA 5CZVH 5FA4A 4NKIL 4XI5C 4JFYA 2Z8VC 3QXUA 1LQSR 2VDKH 1TJHL 1KENH 3BP7A 5BQ7B 2PETA 2EC9U 3WO3B 5J6GB 1IAIL 4WEBL 4FQLH 4B7IA 3H3BC 5D2LE 5I6XC 4ZNEA 1P2CA 1ZHKA 2P5WB 5L9DL 3RWIB 1EERB 4CDGC 1PEZA 4N0UE 4OGAD 4XPFL 4UQ3A 4ENED 2B0SH 1JF5A 1XGQB 4QXTB 3IDMA 1LK2B 2ICCA 1AP2B 2EXWD 3O45A 5K59E 4PRNA 2KL6A 5E0QA 2HKFH 5ENWA 4DZBB 4HH8A 2NY7H 1N5AB 5D5ME 4ZMAT 5E4EC 4MLIA 5JHLH 1YEKH 5I8CB 5H35B 3NCYP 1FZMA 3R1GL 5ALBL 4OF3A 1OGAA 4LGRB 2W9LA 1UVQA 3UTTA 3OHXB 4WV1A 1U6AL 4QRRE 4FABH 1JIBA 1J8HE 3C5ZC 4NRYA 3L7EB 3KPSB 2OS7A 4N5ED 3KNBB 5KG9A 5F70A 3QIUC 2B1AH 5C7XL 4OI8A 4FTVD 5CEXA 3BPOB 5JHDB 4UNVA 4X7EC 4F7EB 4ERSL 4TUJA 3FB8B 3CXHK 5FKPB 1OQOA 1WF5A 3RI5F 4HWZB 4N0CD 2AKRA 2BRRH 3UTQB 3MLSH 3QEUA 5EORL 2ZNWA 3SDCB 1YA5A 1EZVY 2A1WH 4X4YB 5JXAL 5EU6A 1E6JH 2P24A 4G6AD 4R7NB 4QNPF 4I0KA 2PTVA 3OR6A 1BQHA 4MDIB 5BV7H 1HH9B 5DR5L 3CFKB 4JFEE 3ZE0F 4JZJC 4YHNA 4GQPH 1MJ7L 2GQHA 3C8KB 1QBML 4KU1A 3OKKB 3DI2B 4OF5A 4YR6A 1JRHH 3KXFE 3M1BB 3QH3A 1MCWW 2YMXH 2F5BH 2VB5A 3CXDH 4HT1H 3A67L 1BIIA 3EHBC 3H2WA 1B0WA 1YYLL 2D03L 3DARA 3S98A 5DXWA 5F7HA 2P5WA 1U0QA 3QP3A 1IILE 3RWIA 4LIQL 3V6OA 1XAUA 3I3DA 5ESQB 3CZJA 5FA3A 1WBYB 4UIMA 1H3PH 1QSEB 1XGQA 4QXTA 4PBXA 4TSAL 5ANME 1JZ6A 1AP2A 2DLGA 1KFAL 2DWDA 4MNQD 5CJBA 4D0DB 5JQ6L 3H42L 5DD0L 4E42B 4JY6A 1KB5L 3ZHKA 1WWCA 1JTPA 5L8KB 1PYWB 5F1IA 2ED9A 3DX9A 5KZCB 1FVCA 2P46B 4ZYKB 1IAII 5JOPD 5L8JB 2VLJB 4AMKH 2VH5L 4I9WE 2HFFB 1CGYA 2APVA 4MQTB 2ZPKL 2FGWH 4KZEL 3KPSA 3KNBA 3MROB 1O7SA 3TT3H 3S88L 4U3CA 2PYEB 4M7KH 3WJLC 4EOWH 2UY6A 5JO5A 1QFUH 4OFVA 5LGJA 4DFIA 2PF6A 1SVZA 1FVEB 4LVNC 3FB8A 1F58L 3E6HA 3QO1B 2ADIA 3RDTB 2GJ6D 4TNWF 4P9MH 1T20A 2F54B 3CMOH 5E9DD 5I0ZA 3MLUH 3W39B 1KCUL 3E3QC 3UTQA 5I74B 3OZ9H 3IDGA 1QQDB 4X4YA 4NO0D 4L4VD 2ADGA 4YJZL 1QYGH 3JTTB 4QRPA 3VRIB 1JZ2A 3ULUD 1L7IL 1KJVB 1C08B 3CFKA 5C07D 3BZFB 2ZCKH 5DZNA 5I1HH 4NO2B 3OKKA 1T0MB 3ZYIA 3MRHA 1GGBH 1DVFB 3LKPB 4XWOD 3DPBA 3BP5B 3B4NA 1FYTB 4EEEA 2GY7B 4TOYL 3G08B 4PJXE 3Q6FA 2WLZA 4Y0GA 3QNXA 4ETYA 1X6LA 4J6RL 4YXHH 1CGSL 4Q6IB 3RAJL 3P9LB 4YHLH 1EJOL 2I27N 5DD1H 3MRMB 5DVOA 3ULSB 2VDOH 2P45B 4NNXB 2PXYA 2DF3A 5GGUA 4EQ2A 1BQSA 2DTML 4DQOL 4E42A 2NR6C 3RVVC 4R4BA 2NCMA 5GGTL 3B43A 2C3XA 2VLRD 2WLYA 2V5MA 1VGEH 3SGDH 3IRZA 4N9GB 4JM4L 4KK8C 4ZYKA 1G7IB 5GRVL 1CGVA 2EYSA 3GJFK 3QWRA 2P5EE 2VLJA 4BA8A 3VXTB 1NC4D 1BAFH 3U9PL 1X5XA 4GSDH 1IGCH 4K3GA 4XCNA 1J1OL 1MY7A 3QDME 3MROA 4JREC 4Z7VA 4CVXB 2ESVD 3OPZL 5AUMA 1MI5D 1RUML 5D2NC 4ZTPL 1JV5A 4BQCA 4UILL 1Q94A 4NQCE 2CDEA 4GKOA 2HVJB 1FVEA 5L2KD 3RHWF 1QFWI 2AEIT 3QO1A 1S9KC 1QLRA 5I8EA 3B6SA 3H9SD 5E6IA 2F54A 3O8XC 3ARBC 4QT5A 5LGHH 1RHFA 1KC5H 3CUPA 4CU6A 5DUMH 5T3XE 1CF8H 3C2AL 4APQC 3LH2L 5KSVB 1JF1A 3V5KB 4LCYA 5C86A 1A9EA 3IYLW 1RUQL 4X4ME 5FV2A 1E4XI 3PP3H 4AG4L 1KJVA 2FWOB 1KB9J 4Z78A 2Y5TA 2Z91B 4K71C 5TGBA 4FFWC 1YMMD 3WFBH 4I18B 1CD8A 2DLIA 4NO2A 5KS9B 3TJEL 1J1XH 4Y1AB 4XPTL 5ICXB 1RVFH 2PKDA 4MD5B 4U1NB 1DVFA 4X9FA 4F37K 5A2IH 1DANU 3BWAB 5EC2A 1FYTA 3TO4B 4PREB 3G08A 1IGJA 4G8IB 3MV9E 1B0GB 3ARDC 4QWWD 1RQ5A 4OCXH 1MCJA 5AWNL 2E8YA 4HWEH 4Q6IA 4NP4H 2HWZL 2EDWA 1RY7B 5IVZA 1ZGLP 5CP3H 2VZUA 4BFIA 5E08H 3RWDB 1KOAA 2FECL 1QO3A 1N6QH 4NNXA 3PL6C 4R4FH 5JHDD 2KDGA 2BNQA 1K9TA 5DK0B 1B0RA 2YA1A 3FL7A 5BZDB 4XVJH 1MFEH 1ZHNB 4G3YL 3IS0X 1OTTD 4JO1H 2VAJA 4MXQC 4N9GA 4J7RA 5JW5B 7FABH 2DI9A 1MCRA 2WBKA 1TJIH 3SDCD 4ZSOA 3QHZL 2K9UA 2VLMD 4KXZH 4ZXBA 3NPSB 1HIML 5DJ8A 3HTLX 1Y0LA 4X7TB 1JGLL 4CVXA 4X9HA 2IPKB 5I66A 5DMYA 3VXOA 3S5LA 1U8HB 2P8PB 3I9GL 5IMKB 3GSNH 5F7WC 2DQTH 3QUZD 3DX7A 5L7XH 1U8LB 2XV6B 4H1LH 1MF2L 5F93C 1EAPA 4TYUA 4F15C 2IQAA 3AUVA 4UDTB 5C71A 5EBGA 1Q9OA 2ITCA 4S1RL 1OPGL 1P53A 1S5HB 5KSVA 1VACA 3RVWD 5D1ZB 3DMMC 2X89A 5EWIL 1DQDH 3VXRB 3RTQB 3W82A 3BZEA 2B5IB 3P0GB 3CSBA 2FWOA 4OF8A 1QSED 3MV7E 4KKBD 2AXJA 2Z91A 2J6EL 5AAWA 3A6CL 3O9WC 4WFHD 1HHGA 4R7DA 5C0BD 4Z0BL 5EO9B 1A14L 1D5XA 5DHVA 1C5BL 3WHE1 1A5FL 5ICXA 3O0RL 1P9MA 5D72H 2BSTB 3MJ8B 1T2QH 4TVPE 5KZCD 5HPMA 5LXGL 4P9HL 3DTXA 4OZHB 1T2JA 1H0DB 5DRWA 1XGTA 1B0GA 3HR5A 1OWWA 1WICA 4IHOB 2GT9A 5K9QG 3P30H 1U92A 3FO2B 4IRZL 1I3VA 4GW4A 2AJUH 1G7LB 2DTSA 4GKSB 5CGYD 1EHNA 3LZFL 4K7PH 2IQ9L 4HUXA 5KANI 1R0AL 2PYED 4I4WB 1IGFH 5K93A 2Z92B 3WXWH 3KPRB 3QRFM 3N0PB 4HEPG 3VE0B 4X0KB 1OW0A 2QTEA 5HVHC 15C8L 4OGXH 3DGGB 5BZDA 5EOCH 4L5FL 3V4VH 2O61A 2BMKB 4HK3J 4J8RB 3OKDB 4M43L 1CICB 4NQVA 4IOIA 1L9MA 3D39A 1MQKH 1U8MB 4JZOA 1A7OL 4PJFA 3EYUL 4D3CL 1IQWL 4U4BA 1LNUA 4PB9L 4IBLT 1EXUB 4R9HA 5SX5H 3ZHLA 5BO1L 5ILTL 2NX5E 2XQYG 5JDSB 2VC2L 4X9IA 4L8DA 3U30B 5CEZE 2EC9T 2GFBB 4U3HA 2IPKA 5D93B 1UEYA 5E8EB 5SV3A 2JIXB 1Z5LB 5FF6A 5JORB 2YPVH 3EO9H 4RFNB 1IRAY 4U6HA 4OV5A 5AG9A 2NY2C 4UOW0 3ULUL 2DJSA 4WIQA 1MFDL 4KKNA 1EK3A 2RCSL 5DD6A 3HMWH 4DUVA 2MCPH 5DVMA 1A7BA 1ZT4A 4MQXC 2VDML 2FX8H 2K3TA 1LILA 1UA6H 2JJWA 4WHYG 4G5ZL 4Z7UB 4WTZG 2MKWA 2DL2A 5B39B 2QQLH 4CUCA 5JW4M 1UACH 4G8GE 5C0GB 1OP5H 1JNNL 3GO1L 3UC0L 1G6VK 4OCYH 3RKDC 1G7PB 2ICES 3E8UL 4M7LH 4OZIB 1W8NA 1SM3H 2BSTA 2LU4A 4HQQH 3QWQB 3PQYA 2Y06L 4YXLL 1R3KB 1H0DA 3NGBC 3NZ8A 4HWUA 1MCKA 5AD0A 4RDQF 4F9LC 2EDJA 1DR9A 1A7RL 2G75A 2EXYD 1GGYA 3E2HC 5F9JB 4EUPB 4NM8H 1KCLA 2IALA 1WAAF 1KIPB 5IGXH 1B9ZA 3HE7B 4KMTH 3HI1A 3KPRA 1IC1A 3QA3B 5EH1A 1R3IL 4OLZH 3VXMB 2DIAA 1Y6KR 5A2FA 4IJ3B 4LGSB 4XWGH 4WHCA 1Q72L 2QHLA 4KK9D 5GS1B 1HNGA 3KS0H 3O6ML 4X9BA 1U8MA 2IADB 4Z7QE 4R90L 4NWTH 3RWJA 1RZ8A 1ZT1A 2Q86B 4LLAA 4CVZB 3ILQD 2AXHA 1KLFA 2VABB 4J4PC 4KUZH 3ULUF 2H2PD 5I1JL 3S37H 4LLWB 1NLDL 2NQCA 2R4SL 2FH6A 3BZDA 4OM1L 2HFEB 2UY7A 4Y1AD 4YH6A 3ES6A 2EDBA 3PWJA 3MMEA 4PJEF 3KPMA 2A6DB 1T0PB 3TO4D 1EBAA 3MUGB 4U6YB 3N1PC 3QCTL 4CGTA 2EO1A 5ECJE 4TULL 3HCVA 4JM2B 2OSLA 3MO1B 1VFBB 3BHBB 3HB3C 4UU9B 3KLAA 4Z7UA 1QR4A 4X8JA 5C92A 5CHNB 4Q9CA 4OT1H 1SYSA 2VJXA 2JCCB 2ZUTA 2VDNL 5MEOB 2FO4B 1J5OL 1CK0L 1CT8A 2OI9C 2OR9L 4O51B 2KQNA 3N1QC 2W0LA 3C2SA 1HILA 5DVKA 3CH8A 4ZO6A 2R0ZL 5HHXH 5JHLL 3G9VA 3MOAL 4ZAKB 5CD5D 5CCKL 1I7RA 3BSZH 2AJYL 1I4FB 2ZUYA 4I2XE 4H0IA 1AIFB 4RCAA 4M1DH 1OVZA 5GRUL 1DQMH 4POZC 4UZGA 5E00A 3UYRL 2F5AL 1DL7H 4E5XB 1YECL 3FMGH 2NNAB 5CBEB 1YEEH 4RISH 2W92A 3W0WB 4IRSB 5A43C 3QQ9D 4TTGA 1VEPA 4CU8A 3QRGH 3TBYB 2AK4A 4DW2H 3RUGE 1KB5B 1WBXA 3LSOA 5GS1A 4LSDA 3WLWD 5DC4B 1AR2A 4PYGA 2XTLA 3BIBX 3MODH 1OAYH 4L4TA 3L1OH 3CDCA 4XCYA 1ADQL 2UVEA 3MLSL 4KAQL 3SOBL 5D1ZD 4AEIL 1K8IA 1ND0A 3VXRD 3RTQD 1JTTA 3V6ZA 4CVZA 1J86A 1MSPA 1JPTH 3WEXB 4WUKL 5BV7L 4C54A 4Y5VA 1ZLWK 1U3HD 3WFDH 5F89B 3WL9B 3RL2A 1KB9K 1OARL 5BRZD 1JRHL 1NAMB 2F5BL 3B2VL 3S7GA 1HWHB 1JYNA 4YWGH 4HT1L 5KOVC 2YA0A 3MUGA 3ME0A 1AGFB 1D9KA 4NQDB 5ISZE 4NYLA 3MO1A 1SHMA 3JV4A 1AC0A 4MXWL 1BFTA 1FP5A 5J06A 1Y6NR 5J9PA 2APWA 4FFVC 4CRPA 3ARXA 4QEGA 1YY9D 4Y7MA 5ITBH 5I1IL 4S1SH 1IC7H 3WV0A 1HZHH 5DUPH 1G7QA 1KN4H 4ZUSB 3K2UH 2VISB 1BZ7B 2FX9L 3JBG7 4G6MH 4MQ7B 2XTJD 4NIKB 3NACL 5HYFA 1DN2A 1OD7A 3ZLQC 1CICD 1U2HA 1F3DH 1ZANH 3BJ91 4DCQB 4MWFA 4ZUWA 1QLFB 4IOFC 3NCMA 1G1CA 3VXQB 2DQIL 1MRDL 1YNLH 5DVLA 1X5FA 4U0RC 5IROC 4PV8B 5GQBA 2HT3D 4FHBD 1AIFA 4YAQB 2HAZA 3UTPD 1UM6H 1NKRA 3F7YA 4L8SC 1CIDA 5CBEA 1A6UH 3P9WB 1PKQB 3BH8A 2I24N 2YD7A 1CGTA 3UO1H 4EI5B 4ZOAA 4Q58C 4XBGB 3C09B 2JIXD 3FONB 4P0DA 2IMNA 1CFQB 4GRMA 5C0DA 3TBYA 1M71B 1VFMA 1KB5A 1BX2A 4R8WH 5I1KL 4R3SB 4P9ML 1S78D 1FC1A 3QUYB 1E4WL 3BP6B 2VO5A 4K3HA 1I8LC 3OZ9L 2HRPH 3SCMC 5KW9H 4W81A 4RMRA 3BD4A 1HSAA 2EIBA 1DANT 1QFOA 3WIIH 4LSSH 3MCKA 4NQTA 1M7DA 5HJ3B 2AS5M 2X4SB 3K8KA 3WL9A 1TVBB 4L8CB 4JB9L 4W6YB 1BVZA 1MREH 3MA7A 5GGVL 3VI4E 8CGTA 5BOZG 1KNOB 4X5WB 5F21B 1KCRH 5GZND 5CFHA 2P4AB 1JYWA 1U8PA 5T5NG 4GW1B 3BXNA 2UUDK 5C09A 1K8DB 4KTDL 3PUCA 1NC2A 5FCSH 1SEBA 1YQVL 1F4YH 3FAXA 4NKOA 4WUUA 3W9DA 3D1MC 2CUMA 3U82B 4YHLL 1GPOH 1DJSA 1PZUB 2VIRB 2VXVH 4Y5YA 3ZDYE 5EZJB 5FUZH 1I7UB 3RZCB 3MRPB 3HE7D 3PWPA 3GHBL 1O0VA 5F88A 3BRDA 3RWGA 3KYMA 4JQXA 3VXMD 1BZ7A 1FZOB 1FNGB 3AB0B 3TA3C 4F7MB 3SDAD 4RZCB 4JDVB 3G5VB 2QQKH 3DXAA 4CMMB 2IAMB 5C0AA 1KCKA 4OZGF 3FQRB 3BN9D 1KXQE 3RVUD 4MD0B 2P44B 3S6CA 1A64A 4S0TD 1XR9A 2R9HD 5HD8D 4FQIH 4FNLH 3RIAK 1INEL 1FG2B 5F7EL 3IJYB 1JL8A 1L0XA 1XGUA 5GIRB 4ZS6C 2E3VA 3QEQB 2HJKB 4XP9H 3FONA 4ONFL 3MV8B 2CKNA 3OAZK 3MLTA 5GGTA 3BIAX 4LGPB 4K7FA 3MXVH 4ZFZA 1QHOA 4FFZH 1BF8A 2AERT 3MLRH 5LGHL 5D6DC 2X41A 1CF8L 1TCRA 4JM2D 4F7PB 3ZTNL 4JANB 2E7LA 4CADB 4JZNB 3SE9L 1RK0B 1YUHA 4DFHA 2CMRH 3O6FB 3TJHD 1V3JA 3IU3B 1J0IA 1I1AB 1S7WA 25C8L 3LPWA 4UT9H 1U42A 3WFBL 4PRIA 5FECB 1J1XL 5CJXC 1LO2H 3J8F7 4TVPH 1GC1L 1DTUA 4MS8D 4X5WA 1T0NB 5EU7E 4KUCD 2A74B 5SX4H 5EZLB 4ZAKD 4JFFB 2D7OA 1AI1L 1U95A 1U3YA 2EDOA 5GJTL 5L88H 3R06B 4BSWA 2WBJD 4P4KB 3UJTH 4KV5E 3UTSA 3WS6A 1DQQB 1JWUB 4GQ9L 4U05A 2X4TB 3RY5A 5E08L 2VDLH 4OLWH 5J13C 1DQTA 5IBLC 4LCCA 1I7UA 3W0WD 4IRSD 3MRPA 3RZCA 5IFHH 5MEPB 2E7CA 1C16B 5E99L 4F7MA 4Y5XC 2OXGA 4XXCC 2X9XA 3SDXF 3NIFF 1GOGA 3G5VA 4MCYB 5DD5L 5AG8A 3VFPB 5DMJB 2IWGA 1FYHB 3F62A 1UM4L 5D70L 2V9QA 3BT2L 7FABL 4NNYA 1YJDH 1QRNB 2BOBA 5DEGB 4L1HA 2QHRL 1HE7A 1DBKH 4Q0XH 2EKJA 1G9ML 2EDXA 4EDWH 5FDWB 5I6XB 3DO7B 2J88H 1LP9F 2CRIA 3DYPA 4YDVA 1MQ8A 5KS9F 3P0YL 1IQDA 1ZA6B 2B2XL 4HIHB 1FG9C 1NL0H 1RJLB 4YX2L 5HHME 2AGJH 1X6NA 3IXTA 4GXUN 5GS0L 4XNQB 4PGBA 4NQDD 4NOBA 5DJCB 3SGDI 4PIRF 4JANA 4JZNA 5GXBB 1RK0A 4JO2H 5E4EB 1VFUA 3T0WA 1Q9KB 2D4FA 1YNKH 1ZV5A 4PUBL 3WS3B 4MJ6B 1IC4H 4PJAB 3SGKA 4KHXH 4L3ED 3SJVE 5JW4R 2VKWA 1LO3H 3CVIH 5D7LB 3MZTA 3C5ZB 3PDGA 4JO3H 4R2GC 5C08B 3QIUB 2A74A 4ODHH 4P5TD 1BBJA 1CFVL 1NMBL 3MQIA 4ODVL 4YE4H 1CS6A 4QYOB 4M4RA 1GZQA 4GAYB 2GSGB 43CAB 4BK4A 1RV6X 1AY1H 3P30L 2NTSP 5D1XC 1IBGL 1U8IA 1XIWB 4HXAL 1OGTB 2UWEF 6CGTA 4JRXD 1JWUA 2AJUL 2FIRT 4G8FB 3ARGA 1YQ2A 1G6RB 2BY0A 4M00A 4F37F 3CJJA 3AM8C 1UM5H 3N9GL 4HLZG 5DI8A 4EI5D 5INDB 2J6EA 3T0VA 3P11H 1JGUL 4P2QD 2SEBA 1KTDB 2H45A 4MAYC 2MQ3A 4OGXL 3HE6C 4FMFA 3TLRA 2CGRL 4EKXA 4X6DA 1QSFA 1I9EA 5J0BA 4MCYA 1U91B 1MQKL 3QUYD 1N8ZB 4ZS7L 3FT3B 3T0BA 1TTUA 2AV7B 3EDDA 1UZ8A 2F74B 5B8CC 1HDMA 1QLEL 2AJZB 2MWCA 3QZWB 5IV2B 1WITA 1AGCB 5FOBA 2BY1A 3LY6A 3X12A 3GSRB 3M8OH 2HA1A 4LPXA 3SE8H 3JWDH 2OYPA 2FEEI 3QNYB 1HXYB 2R0WL 1HEZA 4YGVB 3LRSB 2CIKB 1KTKE 1TZGL 4R4NC 1QSVA 4XPHL 1HNFA 1UENA 5KSBE 3VG0L 4W6XB 1QTYT 3ZE1E 5DJ2A 4ONOA 3KYOA 4L3AA 4WGWB 3WKMH 1ZA6A 3EO9L 1MRCH 1CLCA 4Z7OF 1CBVH 3QFDB 4R97C 4XP6L 2BCKB 5I8KL 5IB2B 1WAAA 4WCYH 4XNQA 4Q2ZB 1RUAL 3HMWL 4M6AA 4WWID 3LN5B 5DJCA 1UB5B 4JFHD 4YHMH 1FGNH 3ESUF 5JXED 2H9GB 4OD1L 5B22A 1NCCH 2F19L 1Z2KA 4KXZI 3I6KA 2QQLL 1JHTB 2Z4QA 4PJHB 1IZJA 4OAWA 2IBZX 4UTBL 2GI7A 5DWUH 3U46B 3VRJA 5LKNA 2QSCH 3VH8B 1PLGL 2NYYC 3NH7L 2Q1EA 1IGTB 3IDJA 3SY0B 1VGKB 2MFNA 5EBLA 4WFGE 1RJYA 1YJDC 4EZMA 2AQ1A 2DL9A 2A0LD 4LKXB 2HT4D 4OLUL 5F7YC 5C08A 4P46A 4L4VA 3FHQA 2IAMD 3FFCA 4UQ2A 2ICWJ 1X5JA 4GAYA 4S2SB 4WI2A 5HHQB 2BHZA 3C6SB 4PY8J 5EOCJ 4LVNB 2D31B 1XIWA 4QO1A 2XNAB 5CJOL 4PJGB 3FZUC 3AS1A 1NBZB 1RFDL 4M8QB 3X3GH 3FQNB 2XIDA 1OGAE 2NTFB 3GIZH 4BQ9A 5JUEH 1FBIH 5IGXL 4LLUB 4MA1C 2DDQH 4Y19D 3QEQD 4JGUA 1T66C 1JNHB 1KTDA 1P84J 3K8LA 3MV8D 2EKSB 4PRDA 5I1DA 3OMZA 2IC2A 5D96B 4K2UL 3G6DL 4MJ5B 1U91A 3FT3A 5F3HB 3SE4A 2HLFD 1A7NH 5GGQH 1BF2A 3GSRA 3L3IB 5C0EB 1CGUA 2DIBA 1WZ1L 5F71A 3V5DA 3QNYA 3W2DL 1OTSD 3O6FD 4HBCH 4YGVA 4EDXB 5FHBH 1KTLA 5KSAA 4LCWB 1I1AD 3HPLB 5FO8B 3ZL4H 1RUKL 5DK2B 4PJ8C 3JUYA 4ELMB 2DI7A 4OIIH 4RAHA 4PJBB 2X1OA 3HLAA 4QHUA 2B39A 2OMBA 2CH8A 2RFXB 4X7SL 1OAZL 4OZIF 1GGUA 1YDPB 2BCKA 4PY8I 4HG4J 4Q2ZA 1OAQH 4OTXH 2ESVA 1CI5A 5F7FA 4P4KD 4UI2A 1CXHA 2J4WH 4PJ9B 2WP3O 5LWYH 4ONGH 4PJHA 5L2KA 3I6GB 4OLEA 3JWOC 4N8CH 3V6OE 3NABH 4GKZB 2JKXA 4J1UA 1JNJA 5IB1B 5CJ5A 1HQ4B 2WIMA 3HUJB 3PP4H 5D7SH 1A6WH 3JWDC 4O2EB 4OLYH 1X7QB 3KGRA 4WW2F 4PJCB 4JREB 4MVBD 3D0VB 4A6YL 5HHXL 5D2NB 3VXUB 5EO0A 1HYSC 1YMMA 3KS0J 2D31A 4X6BA 1MJJB 2DMBA 2VAAB 2AEWA 4PJGA 1BMGA 1I75A 1PD6A 3O8XB 3ARBB 1KBGL 1DL7L 5BVPL 3OKNA 4X7DC 4APQB 3DI3B 2R2HB 4RSVA 1L0YA 2EE6A 1JNHA 3PGFL 3ZDZF 2V2TB 3MRQA 4PJ7B 4HKXB 3JV0A 1FQ9C 4LU5H 5TQ0H 4UDUB 5J6HA 4K71B 5JIHA 1J0YA 4MCZA 2DM7A 1GZPA 1YPZF 5MENB 2XWBA 1K4DB 2W0FA 4RRPA 4JM2F 1FPTH 3U7AA 5SWQB 4UB0L 4WU5B 4LCWA 3HPLA 1MJUL 4OFPA 3QIBA 2BY3A 5I71C 2XZZA 3TH3T 4KDTC 4XPBL 5I2IB 2BNUB 3CPLB 4P2OC 3ARDB 4LP4A 3CDGB 4GAFB 1LO5B 5DK2A 1SJEA 4QRPE 1RPQA 4ELMA 3GMOB 1R24B 1XH3B 3DUSA 3V7MA 4PJBA 5D7LD 3S34H 3C5ZD 4NC0B 2ENSA 5IF0B 3JTSB 3VFVA 4NZTH 3QIUD 4WJ5A 4KC3B 2RR3A 5SWSA 4NKDB 3MGTA 4HMDA 3G6AB 3PL6B 1YDPA 2FNBA 3FJTA 2DD8H 1I8KB 1ADQA 3CCHB 1FFOB 3I6LE 1LEKA 3AY4A 3N50A 4PS4H 1A2YB 3BKJH 5T3ZE 4PJ9A 5GGSB 1P1ZA 3ULVD 5CBAB 4KKAC 1RZIA 3NZHH 1CIUA 2Q7YA 1J0KA 4XVTH 2Q6WB 5IFJA 2W07A 4LAQH 3QNZB 3HUJA 5LCVL 4G43B 4ONHA 1CLYL 1JHKH 3O4OC 1N4XL 1JF6A 4YPJA 1KN2L 4IRJA 3D0VA 5D4QA 4JN2A 3CFIC 1FIGL 4P2RB 4DVRL 4UT7H 3QPXL 3T0ED 1YNLL 3Q1SL 4FFYH 1EHXA 2KBGA 4F7TB 1T1ZA 4FMKA 2B4CL 3EHBD 4F15B 4MJIA 4GH7B 2D7TH 2OJEB 2E6JA 1A6UL 3T1FA 5ID1B 5KVDL 3DMMB 2R2HA 3V0WH 4NO5A 5FEBA 2HLAB 1OM3H 3BRFA 2IPUG 4LLVA 3C60B 1B2WH 2XKNB 1IC5H 1ORQB 2P7TA 1LEGB 4R8WL 1FNEA 2Z93A 3RPIA 4UDUA 4LRIC 5T3XL 3U6RA 3ZTJG 3O9WB 4CNIB 1RZKH 2V2XB 5E2UL 4NQSA 3QEHB 3SN6N 2YRLA 5KW9L 1IFHL 4BFEA 1D3CA 2A73B 5HHPA 2AJVL 4WU5A 3WIIL 4OCWH 2WIIB 2BNUA 1Z9MA 4XX1E 5KAQG 4J3WA 1L0QA 1IARB 3S35X 1KLGA 3GMOA 2EYTA 1XT5A 4FQQA 4FQXC 2BOCA 4LSUH 1IGYA 2R2BA 1FDLH 1ZS8B 2FBOJ 4M6OH 5IB5B 2G60H 2ZOKB 1EV2E 3KR3L 5HI3C 2WINB 5FXCH 5HVHB 3CCHA 1FFOA 3NN8B 1F8TH 3WSQH 1C5DB 1F3DJ 1F4YL 2UYLB 4NZDA 5E70A 5C2UB 5T33H 2XWTB 3K4ZA 1ZK9A 5FUZL 4WRLA 1U8JB 4LEXH 4OGYL 4MA3B 1QEWB 4B53A 4RFEB 3U0PA 2ATKB 5TE4L 5DVNA 1ZVSB 4XVSH 3EOTH 9CGTA 2F8OA 3IRPX 1I8MB 2BNQE 3G6JF 4HGMA 1U8OB 3OGCA 5I1GH 1YEFH 2VXQL 3IFPA 3S36H 3STZB 1EEQA 2ADFL 2NY1C 2X10A 4WGVB 4NZUH 5FAAA 2E9IA