4ODTH

Fab structure of lipid a-specific antibody s1-15 in complex with lipid a carbohydrate backbone
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
226
Chain Sequence
EVQLVESGGGLVQPKGSLKLSCAASGFTFNTYAMNWVRQAPGKGLEWVARIRSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVRHRGAPLYYGNGAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTSGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S1-15 Fab (IgG2b) heavy chain
total genus 39
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odtH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odtH01
3TBTA 3SE3A 3O4LA 1MFDL 4JRXB 2BJML 1XT5A 1WZKA 2IAMA 4HKZB 3EDEA 3RWEA 2M26A 4R3SB 4JFDA 8FABA 4XMLH 5DUPL 4XVTL 4QOKA 3GMOB 4ISVA 3HFML 3PHQB 4RAVA 2AJSL 4OCRH 4CVXB 1XF2B 3DXAB 2AJSH 4XCFL 3GEWB 4RWYH 5EOQL 5LKNA 5EO9A 5BRZD 1J1XH 5CCKH 4I5BB 2J4WH 3S37L 3I3DA 4S1RL 2YPKA 5INCA 3NCCB 4X7TB 5EU6B 3EKCA 3ECBA 4FG6D 1QLEH 1IGJA 2DMBA 2OL3B 2PO6C 2PTUA 1TQBC 4RISL 1Z5LB 3QO0B 1UZ8B 5F7FA 1QNZH 1T4KA 1C1EH 3LEYH 4IBLT 1XCTB 2Z31D 3U0TA 3ZMRA 3ARBA 2W0KA 5JIKA 1ZT7A 4K3JL 4PJ7B 4CVUA 2BFVL 1OGAE 3TZVA 2E6JA 1BJ1J 1J9CT 4LEXL 4F2MB 5IW1A 4L3AA 4L3CA 3K4AA 4YUEH 4LSRL 3RFZC 4YFEA 1FVEA 3SE9L 4E41A 4TULH 1YN7A 2FATL 4RA0C 1J5OL 4Z7WA 1GGIH 1WQVT 2BVQA 2OJEA 3JTTB 5DJCA 4ZUUB 1QSFB 2YD7A 1FC2D 5LGJB 1KLGA 4OSUH 2YPKB 5INCB 4YBQC 1MIEH 3IKCB 1T2JA 4HKBA 1H0DB 1IC7H 1D6EA 2CMRL 1DVFA 2QSCL 4QRQB 1VFMA 4JZJB 1IGIH 3WNPA 4NJAL 2V5MA 3DYPA 2YEZA 5C1MB 3O4OC 1HNFA 2WQ8A 5KS9B 4Y88A 1QPXA 3TIDB 2BY0A 3FT3A 3IRZA 4GAJH 5DUBA 5HGHB 2Z0BA 2IWGA 6CGTA 1E0OB 5IR1A 3GIVA 1KCRH 4WUUD 1QYGH 1ONQA 2R69L 3TFKD 4PR5A 4PV9A 4G5ZH 3R06A 3WO3B 1F8TL 5MERA 4M6OH 4UDTA 4IRJA 4JVUA 4WTZG 1IZJA 1IC4L 1MCPL 1ZHBB 5SX4I 1T2XA 3QDAA 1R3IH 4ZXBD 3V8OA 5JDSB 5CAYB 3P4MA 1NBZA 3IJYB 5BZWA 3FT4A 5C0BD 3AREB 1N0XL 4OCYL 3D39D 2R9HC 3HPLA 4U3HA 5TE4L 4MSWB 1QFOA 4LSSH 3N50A 3HLAB 5E5UB 4PTTA 1MCBA 4O51B 4CW1A 1H3XA 4Z8FL 4OLYL 3WE6A 3CSPA 3LMJL 5FM8A 5JW5B 5SV4A 5J6GB 5B8CC 1A7PL 1ED3B 1VFAA 5DD5H 5D1ZC 2R1XA 3MXWH 2Z35A 2E7CA 1IAOB 2VN4A 5HHNB 4G5ZL 1ZVSA 3WFCL 4HV8B 2Z31C 3NTCL 3ZKND 3RX7A 1ZHBA 3QEHB 4XBPB 4WI6A 4PJXB 1MY5A 1AXIB 2LVEA 1T89C 4N0UA 3KPSA 3LV3A 1V5JA 5C0NC 4XNYL 1U91B 3BP4B 3MUY1 4RX4D 3GJFK 3L5XH 4ZFFB 4G8EA 4ZOAA 3QDJE 1V7ML 5CUSH 5GRUL 4P5MB 3GBML 4PJ9B 3LRHA 4AEIL 3FQTB 3U4EA 1I7TB 3CVIH 5A43C 3IDYB 3R1GH 4X7DC 3IFLL 1E4WH 3QIBC 2XKNB 5BOZG 4S0SD 1MQ8A 1BEYH 1Y0LA 3MLTA 4JAMA 3ZO0A 1UEYA 5C9JB 2QQKH 3FQUB 5ITFA 4GXUN 4I0PD 3KYKL 3REVB 1GXEA 4PJXA 1ZANL 2UWEF 3IDJB 4NZUL 4JDZA 4XPHH 1H9VA 1NGYB 5BS0A 4U1MB 5J1TC 2GHWB 2J88H 4MMXC 4JGUA 1J11A 2G60H 4LRNH 1K9TA 3CMGA 5EG6C 1F5WA 5EIQA 3UTPE 1CD1A 4MD4B 4FQQA 1N7ML 5CZKA 1HZHL 4TVPL 2YD5A 1SJEB 4RISH 4APQB 1HZHH 4HFUL 1JWUA 4LLQA 3RL2A 3T0AA 1DL7H 2VLKE 4N9OB 1AH1A 1K6QL 1T1YA 5I1CL 1U8IA 4L3EB 4R96B 4KQ4L 2X9XA 5GS1C 1HXYA 4ODVH 1U3JA 1T2QL 4U7KA 5IB4A 1BD2A 3ZDXE 4IRSA 4WHYG 1P7KB 3MODL 5C09B 3IJSA 1YY8B 3A6CL 3S4SB 4YDVB 2YN3A 1R3KA 2O5YH 3TH2T 4RGNC 1GHFL 1MFBH 3ZHDA 15C8H 3A0OA 5DEFA 1YPZE 3G5ZA 1J05A 1WIPA 4G6AC 4G8IA 4JQVA 4WO4C 3LHPH 4RMVA 1I8IB 1Q1JH 4JB9L 1AHWB 5F93C 3U7AA 4POYA 2FIRT 3PF2A 5GSRB 1E4XH 4ZAKB 2A77L 3EGSA 3S7GA 3O4LE 3RWCA 1MLCA 4OZFA 1JFQH 2AQ3A 3BPNB 2JLLA 2BDNL 2GFBA 4TSCH 2K1MA 4FQPA 1T3FB 5IVZB 1INEH 4JFPB 5ERWA 1QFPA 1LE9B 1RHHA 3C60C 3QJFB 3PWNB 5FYLH 3K1DA 1B4RA 3HNSH 2IALB 2OK0L 5KZCD 1SJXA 1Z0NA 2HJKB 1S7UA 1UT9A 3O6FD 3JV4A 4PGBB 3VA6A 2HTLD 3UTTE 3D18A 3GSUB 4G8IB 2LU7A 3LCYA 1NFDB 2IBZX 2VNCA 5HGAB 5DWUL 3O9WA 3W9EA 1HQ4B 3T09A 1MHHA 2IPTL 4O9HH 3GMNA 1F90L 1B3JA 1XMWA 4F37F 4AQOA 3ZE1F 3ZYIA 4IMLB 4N0RA 4PJHF 4BSJA 4RMWA 4F7CB 3RWJB 3MLSH 3OB0K 1RZIB 4PY7A 2IALA 1FL3A 1KCRL 3AM8A 3C5ZA 5EWIL 3K7UA 5LWYH 4OI7A 4Q74A 2ITCB 3MA7B 3MV8B 5E99L 3MLUL 2WIIB 1IEBB 1P7KA 5H8DA 5IM7A 3QI9C 2LTQC 4X7CC 5GISL 1QO3B 4YDVA 5JIIA 1R3KB 3U0PA 3RNKB 1YEFL 3UTZA 3WEXA 4R7NB 4IIQB 3NH7L 5T5NF 1J1PH 5JPMB 3CFEA 1Q38A 5H37G 5LGHL 5C6TL 3N1PC 4UTBH 3Q3GB 3HNSL 2R2HA 1MRFH 4XZUB 4JZNB 1JHLL 5DJZB 4YZFE 2O93L 2GTZA 1R5IB 4AL8H 3MACH 3E6FA 4P3WA 4O5LL 3RWGB 3MJ7B 5D72L 5EORL 3QCUH 5E2TH 2I9TA 2Y5TB 3DBXB 1RZ8A 1U8OB 3SKOA 2GK0B 1H5BA 2BNUA 2UZXB 1H8SA 5DGQA 2GTWA 4K3JH 3F6LA 2EECA 4OZIA 5HJ3A 5FUZL 1I1CA 1ORSB 2AABH 1YNTA 1QSEB 2Y6SD 2VAJA 4AY0A 3ULVF 5IG7A 2XWBA 2P5WE 3GO1L 5C86A 3I9GH 3WKNA 3BPCA 3EFFB 3MCLH 4MCYA 5GJTL 3EOAB 4RAUB 5D7LB 4UNVA 1JPTH 1BFVH 2ORBL 2HT4D 3SCMA 3EJZC 4D9RD 4G8GA 4EQ3A 4UBDC 3LS4L 4XB7A 1YEJH 4PJDE 5B22A 3H0TA 4LCYB 3PV6B 3IVKA 3IU4H 4PJ9D 2IBZY 4IDJL 2C1OA 3RY5A 1A6AA 2IAMD 1N7MH 1BFOA 4MJID 1EGJA 3ZKNC 4Y4FC 5FYJE 4RAVB 5M94B 1CN4A 4M5ZH 5GRVL 4ZFOA 1ZV5A 2QADB 3LOWA 5EBMA 4JFHE 3WJLA 3CFEB 3NCJL 3X11A 5LAXB 2PO6D 4OCWH 1A4KB 4A2LA 3X14A 2R0KL 1G84A 5IVXE 2UZIH 4OZHB 4ZFGL 5IT2H 4UILH 4YEFA 1LD9B 1VGKB 1OGAA 3F12A 3RWEB 2VR9A 2ZZUT 3RKPA 4AM0B 4UV7L 1G9EA 3OR7A 5ESVA 2YD9A 3VFRB 4XXCA 3VE0B 2FWOA 3UJTL 3VRIA 1MFCH 2QL1A 2JIXA 4OFDA 4EI6A 4PRIE 2NX5B 4MCZB 3S8WA 5HSFA 5GRJH 3FO0L 2E7BA 5IQ9A 4L9LC 43C9A 1AC0A 1WBZB 2IBBA 2CKNA 2G60L 1B0GB 4LKCA 4Y19A 3RWHA 5IW3A 3DGGA 1UKSA 1Y18A 2JTDA 1I3RA 3MRNA 1DVFD 1DLFH 5EO9B 2VXTL 5ETUB 3LRGA 5A2IH 1CBVL 3V6ZB 4K8RC 4XVSL 2FGWL 3QDMB 4Y16D 5D96B 1PYWA 1TVBA 3L9RB 3LN5B 1XR9B 5IBLD 3QEGH 3KPTA 1CLYL 1FL6A 2AAVA 4UV4L 5I8CA 3U4AA 1CE6B 4TPRL 1T7WA 2Q86B 5HDBF 2PXYA 7FABL 1JN6B 3BQUD 4P46C 4QHNB 1VGEL 5D1QC 4NQCD 4UDTB 1Z0MA 4QRSB 1YNKL 5EU5B 3QWRA 4HXBH 1VDGA 1MEXH 5ISZD 2Q20A 1V3LA 2ZUYA 3V6ZA 4F7PB 3QUZD 1K8DA 1P7HL 4P59L 5FUCC 3G5XB 2VZVA 2ED8A 5SWZD 3RTQD 5IFJB 3TYFA 1FL6B 4JKMA 2D2OA 2XQYK 3SDCD 3QUYA 2FHBA 3HHRB 1UXSB 2XTJB 3OJDA 5D7SL 2H32H 2DM7A 4O2EB 1LO4H 3OGCB 4YHML 2PKDA 3TBVB 5DA4A 2X70A 4WHCA 3OR7B 2FEDC 4I2XA 3PGDA 3ETBF 1I7RA 4Q6IC 3VRJA 1T66C 3STLA 2GQHA 3BP4A 2OMBA 3QFJB 2NCMA 4QF1B 5KSBE 1D5MA 3GJEB 5I75C 1JPTL 4EI5C 1H3WM 1YNLL 1NLBH 2JJUA 1U3ZA 1TZHB 1I1AB 4OCXL 5C0RL 4PLJC 3EO0B 2VKWA 1B6DA 1HH9B 5EC2B 3HMXA 3ESVF 2BOCA 2CO6B 5E9DE 4PBWD 5TF1H 4JJ5A 5F89B 5LCVH 3RPKA 2GSIB 5CJOL 4Y2OA 4PG2C 1NANI 4WW1A 3O3DA 1CXLA 2XWTA 1V05A 3EYFB 2WP3O 4HWBA 2L4OA 3MROA 1A2YB 2V2WA 2OTWA 4E0RA 1JWSA 2R1YA 1JGUH 4PJAA 4P2QB 4HKJB 4I4WB 4R90L 3GSVB 2ERJC 2ESVE 5CJQL 1WEJL 4R2GC 3D0VA 1IBGH 1MF2H 4WU7A 4NKDA 3QFJE 1JPST 1JV5A 4EDWL 4JLRB 4KXZI 4HUNB 4G9FA 5LGHH 2AJVL 4PP2B 3PGFL 4P5MA 1MLBB 5HI4D 1QFWH 3UROR 4UNTA 3SDDD 1FJ1A 4NQDB 2JJWA 3NZ8A 3MBEA 5DJDA 1GH7A 2ICEA 3S4SG 1CZ8H 2IPKB 3FQUA 4X9IA 4A2MA 4PRDA 5C08E 3PL6B 3IF1A 2DKSA 1UGNA 3TPUA 3EYSL 2KQMA 3WO4C 1EO7A 2FX7H 3V5KB 4M9OA 1OARH 3P4NB 3NFNB 3QFJA 4FFZH 4PJDF 5FF6A 4JDTH 3HG1B 3N9GH 5CMAA 4EBQL 1J8HE 5GSRA 1JGVL 3QUMA 3GMLA 2PF6A 3MFFB 3IAPA 1P9MC 5DSCA 5JXAL 3VCLA 5EZOH 5T1LA 2YK1L 5HHOD 2PXYC 4WFHE 5D5MB 3HE7C 3LS5L 3NA9H 1NFIA 4YAQB 1NBVH 2EEDA 3V0VA 3ZE2E 4DEPC 2A2QT 4A6YL 3GBMH 4AEIH 1P4LA 2V7NA 3AU1A 4CVWA 4M4RA 4U6VL 4K94H 1DBML 1HKLL 4W4OA 2P5WA 4X6DA 4MZ3A 4U49A 1DUYB 1CXFA 1BD2B 2DJSA 2H8PB 5IOPB 1VERA 3GSUA 1ZGLP 3O3EB 1N26A 1UWGL 3MACL 1NAMA 4IRJB 4OAWA 4WJ5A 4JFYB 4XXCC 3KHOA 3MV9B 1AI1H 2R8SL 2CLRB 2BSTA 5DEZA 1TQCC 4QHKI 2ADFH 1L9MA 2W9EH 1A14H 1DN0A 1W72L 2JK5A 2RIKA 4KKAD 4LVHB 4L3CB 2FGZA 4UILL 2X9YA 4MXQD 3D18B 4X6DB 2NY1D 5C0AA 5F9AC 5IB1B 5FO8B 3X12A 3OBAA 3G04B 3QI9A 4UQ2A 5DJCB 3D3VD 1XGQA 1T3FA 5IVZA 5IM7B 1MHHB 5HTSA 4Y4KD 2FJHA 4P5TC 1JTPA 1IZKA 5HYSG 1U36A 4WVRA 2YPLA 1ZHLA 2ZUVA 2OXGA 3WHXA 4TOYL 4AMKL 4I3SH 2ATPA 5HY9A 1SYSB 5F7UA 4JZJA 1DEEB 3OKNA 2FO4B 2V5TA 1KULA 3R8BB 4NCC1 5LG1A 2VLKB 1OB1A 3OXSA 3ZKXB 5CP3A 1R3HB 5K9OB 1G7MB 3ZT6A 2KUTA 3HI1A 3MV01 3SDYL 4XBGB 4ELKA 4APQD 4G6KL 3BN3B 4ZMAT 2XNAB 1SY6L 5J89A 3O2WH 5AYUH 3DRTB 4WTWA 4D3CL 5DQ9B 1B2WL 1P4LB 2V7NB 3MRIB 1UJ3C 4ELMA 4JQIL 1B6UA 1AD0A 3MMEA 3GHEH 4LCWB 4JG0H 3ILQC 1EO5A 5SWZE 4YPGA 4XRCB 1DUYA 2Y06H 3RVTD 1HIML 1W0WB 5L7XH 4RFOH 3FB7B 1KN2H 4H25A 1CTNA 1T0NB 2HJFA 3R8QA 2AV1A 1EV2E 4G6FB 4KQ3H 4PJ7E 4U31A 3HCVA 4WV1B 3BDYH 4RAUA 1WBXA 3RTQC 2NY7H 4XWOD 3VFPB 2ICWI 4WO4A 3QUML 3CFBB 1GL4B 2XZCL 4AL8L 5IHZA 1M7DB 1ORSA 4L3EA 5EU7C 2FR4B 1PSKH 4LPWA 2XPGA 3WFBH 1N6UA 4MS8C 5ICZA 2YD4A 3UX9B 3V0AC 2FX9H 2NY1B 5M7QA 1OAUL 2BERA 3ROOB 3NFPA 3MJ7A 5J12B 5J1AB 4PRHE 1DANT 5EC1A 5DHVB 2XWJA 1E6OL 2R0KH 1KB5B 5GGRA 3NIGF 4OT1H 4LSSL 4XC1H 2LAGB 3SO3C 3SBWA 4PP1C 4JM2B 3OWEA 5C07A 1MCSA 4KK8C 3V7AE 2D7OA 3O6KH 2X05A 4L1DA 5J0BA 2ZCLH 2YHGA 3QRGL 4E5XA 4KI5E 3PUCA 3W0WA 4YHOL 4EDXB 3RIFF 3JV6A 1HDMB 1W72A 1Q9KA 3A6OA 3IDXL 4JPWL 5JW4R 1KBGL 3QIWB 2O61A 3OPZH 1GC1H 1U8JB 4CAGA 1IM3B 1FFOA 1FL5A 3F65A 3WJJA 1HH6A 5HGDA 1UXWA 2CRYA 3BUYA 3QUXC 4LCCA 1F97A 2JCCE 1T04B 4H20L 5ENWA 2RGSA 2L7UA 1LO3L 5FO7B 1YYLL 2BP3A 3LDBB 2OK0H 2AV1B 2ZG2A 3WCYA 3O41A 4GT7A 3QCTL 4XPTL 3PGCA 1SMAA 2HG5B 1A1NA 5L8KB 3UTSA 3QP3A 4YWGH 3TO4A 1OPGH 1KBGH 1ZHNA 3QQ4B 2PYFA 1G7LA 3BISA 2ITDA 1QEWB 1EFXA 5DRWA 2PW1A 3O4LB 2X4NA 2P8LA 1QVOB 4CJ0A 4NKIL 1YEKH 5IV2A 1TETH 4IRJC 2FBJH 3BKJH 4V2CB 3VWKA 4PRPA 4G3YL 2NY1C 3IFPA 3MLXH 4MCZA 1H3PH 2KZWA 4H26A 4OIIH 2I24N 2XQBH 3N9GL 2W92A 5ERWB 4JDTL 4UQ3A 4XPBH 1R24B 5IVNA 4N0YL 1RZ7L 1FFNB 4YHKL 1CFBA 4LHQB 4U6TA 3MXVH 4WGWB 4X9HA 1JNNH 3FTGA 2CLZA 4Y4HC 1I9JH 1SBSH 3KAAA 2WBJD 4KK9C 5DLML 4FQXB 2NZIA 3QNZB 3QFDA 1HK6A 4JFFD 4JVWA 2CGRL 5C0DA 3ULUH 4NQEB 1U3HA 4GLRI 4CJ1A 4HWZB 3MJ9H 3PG2A 2BZDA 4MA3B 1KPUB 5T3XD 1G7IB 2IAMB 5IMMA 1T4KB 3BWUC 3LQAH 1RV6X 4DAGL 2RB8A 2AJUH 1HH9A 1U42A 5BXFA 3MRPA 5HYJD 3P0GB 1KFAH 3B2VH 2W9DH 4WW1B 2EDHA 2HG5A 3GMPA 4YXHH 4BSWA 2FX9L 4D3CH 2W65B 4PJIF 1FRGH 1IL1B 5I74C 2ESVA 3CK0H 5F7DA 4X99A 3T04D 1X6NA 1MWAH 4LPCA 1JRHL 4HKJA 1FLTX 1FZMB 1HYSC 1XGUB 2CSPA 4P5TB 4N8VA 3AC0A 4EOWH 1U2CA 2WK2A 4MJIB 5LCVL 1OGTB 1WWAX 2QKIA 3I50H 4OD1H 3VWKC 1PDKA 4PGDB 1AGBB 1S9WA 4GKSB 3P9WB 4P2RB 1A9BB 3ILPB 4AMKH 4I9WD 3HNVL 1WTLA 2EIBA 4Z7NF 4XHJD 1CLOH 1MLBA 1QHPA 3BD3A 1J8HD 4XVTH 1ORQB 2VC2H 2OQJB 1CDYA 4OZGF 1GZPA 1TJIL 1SY6H 5GGUB 1ZK9A 3NH7H 3WFHB 3MRQA 5BJTA 1MNUH 1WFTA 2B1AL 4PS4L 1DLHB 4QRRE 1Q72H 1DDHB 5DS8B 3TPKA 1KJ3L 4IRZH 3GSVA 2A6DB 3BKCH 4JO2H 3EAKA 4HH8A 1MVFA 3C9NB 5JZ7D 2O26U 1AR1C 3C09C 4FFYH 4D8PA 2FNBA 3G5VB 5CD3A 4MXWL 3FT4B 2A9NH 1RMFL 2OQJA 3S97C 2BMKB 1MRDL 4PUBH 2IAMC 4ESKA 2AQ2A 4DQOH 1NSNH 4OD2B 4P48A 4OFVA 1CQYA 3MRQB 3UTTD 1BQLH 4BJLA 5KVEL 4LIQE 4LSQL 3CFIC 1XF5A 4J3UA 5D7JC 4Z0XA 4YGVA 4HH9B 4X9FA 5JXAH 2IPKA 5J12C 2F5BL 2Z93B 3BZ4B 3CZFB 3BPNC 4B50A 4N1CA 3TPUB 5CUSL 5D1QB 3ZL4L 2EICA 2NXZB 3VXRA 3TESA 1T83C 2DQIH 3Q0HA 4ZNEE 3U82B 4ZODA 5HHMB 5DJ8A 4J12A 4HK0A 5IFJA 3RWDB 1I7TA 5HPOA 3HPJA 1JGEB 5F3HB 2BVOA 1IRAY 1NUGA 2APVA 5IB4B 4YWGL 4A6YH 4R8WL 1S7VB 2ZCLL 3QIBA 5FM5O 5T5NG 5D5MF 3VXPB 2VAAA 5ALCH 4JM2F 3BZ4A 3WLBA 1BHGA 2ATPB 1A22B 1I3RB 3MRNB 4LCCC 3KWWB 2J7LA 5I15H 4UZGA 1T7ZA 1CL7H 4JRWA 1FO0B 3UZEA 2I5YL 4H20H 3BP5A 1NAMB 4P5KB 4KMLB 2WQRA 1NAMH 5C0AB 2VDKH 4XNZC 5KSBF 2OP4L 1NBQA 4MNQE 3VXNB 5IT2L 3CPLA 3PJSA 2NXZD 2HN7B 4TNWF 4JPVH 3HPJB 1IKFL 3BYYA 4AEEA 4CVZB 2ADJB 4K23L 2HJLA 1T1YB 3WL9B 1A47A 1VFBB 3CU1A 4BYHA 5D1XB 4QGTA 5CJOH 2D7NA 1IARB 3MCG1 5IB1A 1I8IA 4MB3A 5SWQB 3KYMB 1VEPA 4BK4A 3U9UB 3WV0A 3C08L 4OZIE 5DMGD 3D1MC 3T65A 4FQLH 4HPYL 3C87A 3PQYB 4HMDA 1RUML 4HPOL 4F58H 2NPLX 3WLWD 4GS7B 4NZUH 3DI3B 3GMQA 4Y2DA 1Z5LA 4LNVA 5HHQB 3IDYC 4MDIB 3TN0A 1K4DB 5EN2A 3GJFB 3PDGA 2GITB 3QZWA 1BM3H 4PJBB 1BIIB 4JQIH 1YMMD 4FOMA 5IQ7H 3I2CH 2XA3A 1CGVA 4ZPVA 3IFOA 3MUJA 3SDAD 4HJGA 3HE6A 2CPCA 1TQCB 5D1XA 2XRAL 4DCQB 4X4XA 4QXUH 4JEGB 4K71B 1U2HA 3E1F1 2DKMA 1YUHA 2ZKHL 4H1LG 5LGJA 1RU9L 2BNQE 1LE9A 3HR6A 3FN0L 4UT9H 5EA0L 1KYOJ 4KDWA 4YHNB 2J8UE 3QQ3B 3REWA 2WWMC 1EJ6A 3C2AH 4LPUA 4U6XB 3HI5L 3BXNB 3GKWH 1EVUA 4MD5A 4F15B 1PG7L 4KTDH 4O2CA 3V4UL 3VXUE 1AKJA 4EUPA 1GVIA 3MRDB 4PJ8C 3AS1A 1SQ2N 3JVGA 2AXFB 4LOUC 3EYUH 1TVHB 4LLUA 4OCWL 4X6CE 5DMJB 4UIKH 4NQDE 2K7QA 1LE5A 2OSLA 1C5BH 3QNYB 3O2DA 1HSBA 3H42H 3P30L 3VG9B 1F6LL 1JRHI 4EXPX 2XPGB 3SY0A 4AIZA 4WWKB 4LLAA 1QQDB 2ITCA 4Z7UA 4BUHA 3G9VA 4K8RD 4HUXB 4CMHB 1BD2D 4QTHB 3QPQD 4RSVA 3HLAA 1KEML 4ORGB 4Y4KB 3NOIA 5ACZB 1MIMH 3WS3B 5JHDB 2EYTB 3O6ML 1YY9C 2EDNA 1LVEA 3WEXB 1EGJH 4IMKA 4PJFF 4NDMA 2NY4D 2PYEA 3HZKA 2AXJA 2B7DT 4NJAH 2BK8A 1A6WL 4QRRD 1UWEL 2YSSB 1S7RB 4LVOB 1CDCA 3TJHD 3VXMA 4OZIB 3GSXB 4GSDH 3DV4B 5ESQA 5DJZA 2IFGA 1L4IA 4M62H 1NDMA 1HDMA 1W72B 1U91A 1UB5A 1X5KA 4NHCL 5CJ8A 4WHTB 3BPCB 2W1NA 2E7MA 3L3KB 3BIAX 1YUHB 3EUUA 1AO7A 2IANE 2G2RA 4EBQH 4RZCA 2PNDA 3VI4F 5B39B 3SE9H 4ZFOB 3S3JA 5FGCE 4M43H 4JN1H 4PJFB 4LVHC 5JXED 2E9JA 4BKLA 2XN9E 5IJVA 3L3HB 1QEWA 2VLKA 2HFGL 2X4PA 4KMQA 1LO0H 4JFZL 3VFOB 3FRPG 2CXKA 1DBKL 2XG5A 5FA3A 1CICC 5F9JB 1WITA 3AXLA 3IU4L 4X8XA 1W0YT 2JCCF 1HI6A 3D0LA 2GY7B 2VLRA 1FP5A 4JGJA 4WW2C 3RU8H 2D7TL 4PBXA 2VE6B 2WV3A 1PKQA 2HKFH 2VLJA 2X1QA 4OV5A 2MJWA 1RZKH 5FHAL 4JFEE 2DMCA 2XN9B 3T0WA 3C8HA 3U83A 2D0FA 3W2DL 4PJ8A 3RL1A 5HVFB 2I5YH 4HEPG 4MA8L 1G7IA 5JO5A 3FO9B 1DVFB 2WINA 1PSKL 3NCJH 5A2LH 2G9HB 3L3IB 4R26H 3GIZL 1UCTA 3VFTB 1J0ZA 5HHME 1DUZA 1G7HA 4KHXL 1J0IA 4H26B 1I75A 2E3VA 2D31A 3VGEA 3GMPB 4ZD3L 4HJJH 3TCLA 4PV9B 2A1WH 3GSXA 3VXQB 1ZHLB 5GS1A 5FV2A 2ESVD 1XGRA 3WO4B 4FA8A 4F33B 4M1DH 4JFQB 4S10A 3CMOL 3TP4A 3BX7C 3OKNB 5JTWA 4JKPH 3BO8A 3NCEB 2Y06L 3KJ4C 4EN3A 4OB5H 1KV3A 3DXAD 3MC0A 5EU4B 4OZFH 2H32A 3ZDYE 4C56B 3N0PB 2H6PA 1R3HA 4LSVH 4FN0A 2P43B 3ZSSA 5A16A 2GJ6E 4RMSA 1OM3L 3PWLA 1KPRA 3LEXA 4TNVK 2XNAA 5CZVH 4ZUWA 1RHHB 3DSFL 1ZEAH 5C0BE 4JRYA 4NT6B 4OTXH 1EDQA 3EW3B 5E95B 3V5DA 1BP3B 3QH3B 4MQXD 5LWYL 1CD9B 4FXKA 5DRNA 1I3GH 1MVUA 5CEYA 5CKAA 5AAWA 4I3SL 2W07A 4GLRH 3F7YA 3CIQA 3LN5A 1JI1A 1T1WA 3MV7E 2VLRB 1EX0A 2VQ1A 4YHLH 2NXYB 1QSFD 4PRBB 1FFOB 3L5WA 1HXMB 4M4PA 5A40E 1I1AD 1FGVH 2XT1B 4YJZL 2LFGA 3S5LB 5D7KD 2IPTH 4HGWB 4ONFL 3A6CH 4ODHH 4O2FA 1DTUA 1F4XH 1Z9SA 5CJ5A 1C12B 5DK0B 4C56D 1QLRA 4RAHA 3LD8B 3EO0A 4JQXC 3DYMA 4QOKB 1G7QA 4LVNB 4HIJB 3HAEA 4U1HB 4U4BA 4LQFL 4WEBL 3STZA 2BNQD 4OKVB 1DE4A 4PGDA 2CXGA 2XZZA 4JQXA 4KUZH 1Q94B 5JHLL 4XPFL 4M6AA 3HE6C 3JV0A 4XAWH 3PNWB 4EI5B 1LP9F 1HCVA 5D2LA 4OQTH 1YN7B 3QEGL 1CFTB 3SQOL 3SDCC 1BGXL 4QY8A 1D5MB 4NQVB 1K85A 4K3EH 2J8UF 2X4SA 1FZJB 3C5SA 4PJ5D 4UB0H 5DEGA 4FQQB 3T77A 2C3WA 1U58A 3HAEG 2PR4L 4Y4FB 1MAMH 1NGXA 3PQYE 5BJTB 4NKDB 5DJ6A 4KRNA 1SM3H 1GRWA 3PWJA 3STZB 5FFLA 3CFDB 4D2NA 3LY6A 3U7YL 2QQNH 4CMMB 4ODSL 3PXJA 4LBEB 3SGDI 4HS6B 3DPBA 2QSCH 5IR1B 2CMRH 1GJIA 1UJTA 3HKFA 2C9AA 1UM5H 3V5DB 4APQC 3NZ8B 3MGAA 5SWSD 1INEL 5BVJA 4LFHD 2R4RL 5C0AE 4XVSH 1J87A 5I71B 2YD3A 2OTWB 3QUXB 5FGRA 4LP4A 3VXUA 2FX8L 5T5FH 2A77H 3M8OH 5KSAC 2VZSA 1ZKAA 2UYLB 1VEOA 3RY6A 4KU1A 4UT6L 4F7MB 1JPFA 4P5TD 2HFTA 5C2BL 4OF6A 5JDSA 2NYYD 1RUPH 1ZS8A 3ARDB 4FP8L 4OLYH 4QYOB 4JO2L 4KVCL 1KIPA 1KTKE 1JNNL 3F5WB 4FZ8H 1VADA 2AEPH 2AJXL 3TV3H 3OHXB 3G08A 2DD8L 2IGFL 1ZOXA 4DW2L 1MRCH 1JGLH 4S1SL 3IFPB 4XNUH 4KTDL 3HNVH 2ADGA 2NY5C 2YZ8A 3MYJA 5IEKA 4I8DA 2LTQB 4ZUTA 3WLWC 3UDWA 4UT6H 1WT5A 3BPOB 3TN0C 4K07A 3N85L 3P77B 1TCRA 2F54D 5I66A 3G6DL 4G9DB 4LAQL 5HVWA 2GITA 3QZWB 1EJOL 4ZAKC 4F9PC 5IEHA 3BJ91 4FFWD 4LLYA 1YZZA 5K93A 3SDAB 4JFHD 3ES6B 1FRGL 2F19H 2MTPA 4JHWH 1NLBL 3BIBX 1C7SA 3QA3A 1FAIL 4U6YA 1Q0XH 5FO8A 4NJ9L 4ODSH 5A2JH 1HCFX 5L0QB 4YAQA 3HE7A 3MYJB 5FOBA 1UA6H 5EB9A 3X13A 4LPVA 2HLFC 3NACH 2CLRA 4FZEL 4MNQA 1Q8MA 1F00I 1BVZA 3GJFA 2VSDA 1UADC 3IJYA 3QG7L 4HZAA 4YXLH 2P5WB 4P9ML 3WIHL 1R6VA 4G9DA 1S7TB 4MMZC 3QDMA 3SDYH 5IOPA 5DD1H 1F3JA 1P4BL 3GBLA 5JW4N 3ZSTA 3V4VL 1OD7A 3X12B 3RIAF 5J11C 2JJSA 1XIWB 2Q86A 2J2ZA 5IF0A 3PV7A 4GAFB 1PVHA 5HDOA 4CKVX 4JRXA 2GTWB 1JK8B 2X7LA 4OCXH 3ULUL 3JTSA 4QRTB 2V7HB 4PJXF 1D5BA 1YNKH 4OD2A 3VGAC 2B5IB 2R0ZL 3C60A 5TDOA 3CC5A 4YGVB 5FB8A 4Z7VB 2WBJC 3RBSA 3FQRA 4KAQH 3BKJL 3SDXB 4ZSOB 4YLQT 2HRLA 2E7LA 2IAND 4M3JA 1FPTH 2NXYD 1ZMYA 1IE5A 4PJ9C 3KLHD 3NIFE 2DIBA 1A7RL 3CFBA 4DTGL 1X5YA 3MLUH 3IYLW 4M93C 1IKNA 3TIEB 1MCDA 3RX8A 2VDLL 4EKXA 4XH2A 3KVQA 4L8BA 3ZTJH 4OBSA 2AXFA 4HZLA 3GSNL 1G6RA 1F4AA 4D9RE 5KVMC 4RRPG 3QJHB 1F6AA 1U8PB 2CDEB 4NN6B 5HVGB 4IHOA 3DGCR 1AO7B 4DOHB 4ODTL 1MFCL 2D4FA 4F9LC 4LF3B 4JM2D 3AM8C 3C5ZC 5CZXD 5GGRY 2IF7A 1PY4A 1NBVL 2P5WD 3FCTA 2SEBB 4M03A 1CDIA 1OF2B 3GB7B 4NNPL 3TWCL 4N90D 2HTLC 4HUXA 4HXAL 4XVUC 5A3IC 4NO0D 5EZIH 3FB7A 5FUCE 5M95B 3EHBD 1LEGA 3CX2A 3JWOL 4GBXA 5D70L 4YHZL 3MCKB 1XCQB 2ZPKH 3DVIA 4PFEA 4FQLL 4P2QA 4E41D 5HPMA 4JPWH 4G43B 5EC1B 4GBXC 1JK8A 2X7LB 3W39B 2NX5E 3VDCA 3NCBB 1CE1L 3OX8A 1U9KA 3BUTA 1IGML 4LRIC 4TTGA 1MI5E 4GG6F 1RIUL 3F58L 5EO1A 5I1GH 2H26A 2D0GA 1SVZA 4Z7QF 5IMLA 4P9HL 4ZO8A 1AP2A 1T7YA 3BKCL 3GMRB 3C60B 2JB6B 4Y5XB 2ILLA 1JNHB 4X7SH 5HGBB 3U9UA 4NO2B 3ZKSD 4K9EL 4PS4H 3TT1L 1I9RH 4KRPD 4WI3A 1P7QA 1S5IL 5DZNA 1RK0B 1Q0YH 3FMGH 5D2LF 4H8WC 5HHQA 1LK3L 1KNOB 3OR6B 5T3XH 1QR4A 1AHWC 4NQXB 3U30C 2ZCKL 4BQBA 2FRGP 2BY1A 5C09D 1N6QH 2CK2A 4GMSH 2YKLH 2E27L 3BW9A 3RWFB 3U46B 1A7QH 4ETYA 4JZNA 4WFFE 1ES0A 1RVFL 3ARQA 3OKKB 4PIRF 1DBKH 4RNRA 5ALCL 5E1AA 1NFKA 5ILTL 3QUMH 1T7XA 3IS0X 5J56B 1UZ6F 5IB5A 2HTKC 5DQDH 1R0AH 5D71L 3OZ9L 1A7OL 4OFYD 3ABZA 1TPXB 2D4DA 3TA3C 2JCCB 1S9XA 3IXTA 3I6GB 4OTXL 3I6LE 2E7HA 4DOHE 1A3RH 2OL3A 1O7VA 1QSFE 5BO1H 1CXKA 4IOFC 4CVZA 2Q3ZA 4YH6A 3IAGC 4KGJA 4L29A 5JW3H 4DVBB 4L8CA 2Q8BL 1H15A 1FE8L 3QHFL 3T8XA 1FFNA 1OAXL 1UQSB 3P0YH 3K8MA 3OF6D 4YK4C 1D9KB 4FQ2L 4KKBC 2G75A 4QRPD 3MRGB 4E42A 4QO1A 2ARJB 3QXUA 1A1MB 2R23A 3HMXL 3MNZB 1UB6A 2AJUL 1I1FA 2MHAA 1I1AA 1MH5A 1UWEH 2EDBA 5F1IB 4JR9L 4ONHB 5ADPL 3THML 2UVEA 3GMRA 4C56A 2WUCL 4OI8A 3PWVA 1LD9A 1IC4H 1MCPH 1VGKA 3F12B 4NPYA 4PJXE 2X1XR 1TVDA 4H88L 1LQSR 3T0ED 4ZQKB 2C1PB 4LLMB 4OIAA 3FOLB 3P0VL 4U1LA 1I8KB 1IFHH 4MD0B 2HKHH 1FG2A 4PLJD 4JFXA 4TVPE 5ANMA 1UZ6E 1FZJA 3C5SB 2X5PA 4M6MH 1MVUB 5CEYB 3RWHB 4PJEB 5DUMH 1LGVA 2X09A 3T2QA 1U8QA 2E8ZA 4RGOH 3W82A 3VXOA 2DLFH 5BRZB 2I07B 5IIEB 1CLOL 5EU6D 5DR5L 1S9XB 2EXWD 3IXTB 4HS3B 4I48B 1IJ9A 4NM8L 1AGBA 4GKSA 5SWZB 3S5LA 4GXUM 1NQBA 3GSNA 2EDJA 3RKDD 4MNGA 1HHIB 5D8JH 2J8UA 4KZDL 2QQQA 1JGUL 1J12A 3LN9A 5FDWB 1KLFA 5DQ9A 4MB5A 2VJXA 3H0TB 4LCYA 2IEPA 1T1ZB 2R2EA 5F6IC 1EJOH 2EDRA 1YEDA 2GUOA 5EZJA 5TGBB 2Q7NA 1OSZB 3IF1B 1XH3A 4C83B 3PWJB 4XP5L 2HMID 3QUYC 4NN5B 5HGAA 4ODXA 1K3IA 2PW2A 2NMSA 5C0RH 4Q9QH 4ZFFA 2ZCHL 1A0QL 2Z4QB 3LB6C 2BNRD 4HUWA 1NC2D 3MX0A 1IM9A 1FZKA 1S7XB 5C08D 1XGUA 3SGDH 4LPXA 1PKQE 2VLJE 4WI8A 3QAZB 1BPVA 4X8JB 4CBPA 5FYJH 1NMCC 3KLHC 1ND0B 3OSKA 4O2EA 2AJXH 3KPOA 4LCWE 3GSWA 3VWKD 3KLDA 4PY7B 4RFNB 1N8ZB 3W0WE 1PY9A 1WFUA 4PLKC 4Q2ZA 5TDPB 2C3GA 1PAMA 1KXTB 4Q7DA 1RIUH 3FOLA 4U1LB 1KGCE 3UO1H 1CR9H 3QR2A 4KHXH 3BEWA 4NQCE 3KS0H 5D7JA 3RNKA 5CFHA 1Y6KR 1B0RA 4GQ9L 3JWDC 2DDQL 4KJPD 5HHVL 1Q9WB 4LASH 5E5MB 3ARFA 5D7IE 2H41A 4PJIE 3F7VA 4E41E 2WBJA 4J3XA 3WD5H 4NQTA 3AROA 5GRVK 4HFWA 4U1KA 3B5GA 4FFVD 3MA9L 2HFFB 1D9KC 3TWCH 3MGTB 1NC2B 1Y6NR 1E28B 2AQ1A 4O58H 2W60B 1M71A 2FHCA 2YZ1A 5TQ0H 5T3ZH 4ELME 5MEPB 4X6CB 2FJHB 1A6VH 1ZA3A 3ULVD 4HG4K 4FQIL 3DUSB 4P2CG 1Q9WA 4ZXBC 4R8WH 3X3GL 3FQWB 2QV2A 3F7YB 5IUSA 4JN1L 2WBJB 3A67L 3OXSB 1A7RH 3E8UH 3FHQA 5AEAA 1GOFA 4C54A 4JANA 2A73B 1LILA 4ETQB 1SJVA 1D5XA 3ECBB 5C08B 4WNQB 3CJJA 1UWXH 4O02L 3LEVH 4PJAE 1VFAB 1J18A 1ND0A 4U1HA 5MI0C 2JB5L 4HHAA 3A6BL 3NGBC 1N8ZA 4YHIB 4U2ZA 3KXFE 1A6WH 3JTSB 5A1AA 4Q9CA 1P9MA 3S36H 3SKNA 2P8MB 2VL5B 5EZLA 3H3KA 4TQEH 2VISA 1FNSH 1J7VR 2R56L 4OF0A 3G5YB 1S7TA 1ZAGA 2X4OB 4NFCA 5I1EH 4BELD 4HLZH 4RIRB 5I0DA 1BJ8A 3IDIA 5LXGL 2OJEB 5MP6H 1FGVL 4PUBL 5EOCJ 1BX2A 4I1NB 4JZOB 4M1GL 3VXNA 5FGSA 4XP1H 1DBBL 3GIVB 2W59A 4XNQA 3NGBB 5C70A 2Y5EA 2X4TB 4P59H 3BWAA 5D7KE 1I3UA 4HFWB 3MV7B 5CEZL 1K3ZA 2MQCA 2NW3A 5ADPH 1XIWD 3K2UL 3NZHH 5HVHC 5JXEC 3WFDL 2EIZA 4ZS6D 4PJGE 3REVA 1RZJL 2R0ZH 4JJHA 3DI2B 3ZE0F 3CSGA 2F53E 3NFPB 5C0DB 4OSUL 2GCYB 3O3EA 4KJWD 4EI6B 4R97B 3NN8B 2ORBH 4KV5F 6FABH 1UC6A 1GGIL 1EAJA 1A4JB 4ONFH 4XMKL 3QB7C 3CVHB 3BKYH 4WIQA 4GFTB 3BRGC 4KJQD 3VFGL 1ADQH 1LEKB 1QBML 4U7MA 2R4SL 4GKNA 4TTDC 2GTZB 2EDYA 4JPKL 1N4XL 4CUCA 4YZFF 5HI5C 2OMNA 4KK6C 2GW5A 5I1KL 4QHUA 1F13A 3OAZK 3GMQB 2NY0D 4UOJA 3MLZL 3QCUL 5E2TL 4QCIA 2O5ZH 4DKFL 2ZWLT 2F54B 1ROWA 2DWEB 3MBEB 5D8JL 2F5BH 5FYKL 2R2BA 1XR8B 4WI2A 2Z35B 1IEAA 35C8L 2K3TA 4KVNL 4PV8A 3VXSA 1JP5A 3IFOB 4Z9KB 1X5ZA 3PL6A 5I1JH 2CRIA 1R3JB 4U1NA 1LEIA 4CVXA 1NGZB 2BVYA 3MODH 3WDIA 3EOBB 3IS1X 4KKCD 5D1XC 5HHMD 3P9MB 4HLZG 1WVZA 3HI1B 4EVNB 3B43A 5J6HB 2P8PA 3FFDB 3RHWF 3G6JA 3QEQD 3NCYS 4U2YA 4YK4B 2OSLB 3QDHA 4YDIL 4PJCF 5F7KC 4KJYA 1NFDE 3RIFK 5BVJB 5C9JA 4OFKA 4OQ1A 3LN4B 5B4MD 4LLWB 1MREH 3VXSB 4NN7B 4NO3A 4NUJA 5CJBA 4KGLA 2J4WL 3S37H 3RKDC 1OSPH 4RMUA 3T1FB 5JUEL 4WI9A 1MSPA 3MLVL 4P2YA 3QA3B 1QFUH 1OAQL 3VI4E 2R0LH 2Z8SA 3MGOA 5JZ7C 3MRIA 5T3XL 4S0TD 1BQHG 3BH8B 4F8TA 5I19L 3MNVB 4X5XB 4HUUB 1XZ0B 3BVNA 4K7FB 1ZGLA 2YSSA 2PN5A 3VGDA 3UP1A 4KC3B 5FCUL 3TCXA 5ID0A 1W0WA 3R1GL 5IHZB 2OM5A 2C4FU 4MLIA 4U0QB 1KPVB 4PJGF 2YWZA 3MUHL 3VW3L 4OJFL 3WN5B 2GI7A 3EO1A 5DUBB 2R1YB 4ZDHA 2P5EB 3RGVA 3RWIA 2KDGA 3MV11 5JR1H 1P6AB 5ESAA 3LKQB 3MRGA 2BOBB 5JR1L 5JNYA 3UJJH 3ZTJG 4GG6A 4HIHA 3MGOB 4YFLF 12E8L 3HZMB 4X4YA 4KK8D 3P77A 5DC9B 3QNXA 5F70A 3FAXA 1J0YA 3EFDL 3RUGE 4Q9BA 1OAKH 3PWNA 4ELMF 5DJ2A 2X4PB 3MRPB 3GI8L 3KPLB 4YC2B 1KPVA 1D9KA 4P3CH 1CGWA 3ES6A 2HKHL 3HNTL 4XBGA 3JWOC 3QEQB 1II4E 2EDKA 3B83A 3RJQB 1JI2A 1U41A 2HLAA 4M48H 5TDNB 4XHJC 1MRDH 3I85A 4Q9RL 1NLDL 1DQDH 3QG6B 3VFOA 3GKWL 1NBYB 4XMPH 4K9EC 2BCKB 1UKTA 2WUCH 1KCSH 2C26A 2CD0A 2FEDD 3TBYB 4WRLA 4U3CA 1F6AB 1U8PA 2CDEA 5KSVA 4HT1H 3MFGB 2R1WA 4RGMC 5BW7C 3CLFL 5E5RB 5I8KH 1OHQA 1AGFA 4X7TA 1E6OH 4K3GA 5EU6A 5MENA 1HH6B 5HGDB 1MHPL 1NGQL 4H8WL 3SKMA 1PX4A 1F2XK 4LDEB 5D6DA 5L2JB 1TCMA 1L7TL 4P4KD 1G7LB 3D39B 5KOVC 4GG8A 3ROLB 2FJGB 3BFOA 3NMEA 4PJ7A 5GHWH 1T1XB 2DI7A 2A83A 4RMQA 3VJ6B 2V2XA 4CU7A 5I1DB 1BFOB 3RWIB 1HN1A 1T03L 3ARDC 2IH1B 5HPMB 4G43A 1FE8H 2F19L 5C07E 4OGYH 1X44A 4XXDA 2EC9T 2NR6D 4LSUL 5AWNL 4MNGB 3WSQH 3HS0A 3MZGB 4PRIA 4QOKD 5FDWA 2EZ0C 5CEZD 3SKOB 3NVQA 5F7NC 1P4IL 5MENE 4OZHA 2NY7L 1QSEE 5BRZA 1YEHH 4R26L 3VFUB 5TGBA 1QG3A 3FRPA 1LK2B 2O5XL 3T0BA 3IETB 3SKJL 1LNUA 3QULB 5I1DA 4HWBH 2IC2A 1OWWA 4EI5A 1T03H 2VDKL 4OIBA 4NQEA 4QXWA 5D7LA 3RBGA 4I4WA 3WNNA 3LKOA 4NC2B 1H5BB 2BNUB 5D7JD 1VCAA 1HHHA 2HVKA 4H1LA 4JFEB 5FYLD 1DL7L 2ZCKH 2BRRL 3GB7A 3DARA 3KPOB 4HGKC 1JUFA 3N1FC 1LO5A 3VXRE 5HHOB 2X9WA 4RCAA 3VFUA 2H45A 2BXZA 2YD6A 3EJYD 1I4FA 1OGAD 3VH8G 1G7PB 3KPMA 5E2VL 4CW1B 3SGKA 3SPVA 3UYRH 1J8KA 4P49A 5E8EA 4XPHL 1C16A 1HSBB 1QFWM 1G7QB 3L3GA 3QPXL 3BKMH 4ZOEA 3NPSC 2J6EA 5CJXC 4YHKH 2HH0H 2HWZL 3TVMB 1JVKA 3D2UA 5C0CB 5IBUB 2IANB 4NRXA 1Q94A 4L4JA 4RDQF 3KPSE 4UI2A 4WV1C 5JW4M 5F44A 1UVQB 7FABH 1REIA 5FECB 4Y1AD 5D4QA 5EPMA 1XF4A 5CWSB 2HJFB 5I1JL 5I73C 2BRQA 4P3CL 4KVNH 5KVFH 3L3JB 4L4TA 4UINL 1NC4B 1V7NH 4OLVH 3BAEL 3F62A 3T4YB 3QUYB 4GUPB 3B5TA 3I6LD 5DD0L 3HZVA 1T89A 4K94L 3UJJL 1N4XH 1MY7A 2AJZB 2PTVA 1AXTL 1AGDA 1DQML 2P24B 3PIQB 5DGRA 3VFGH 5DR5H 2GAZB 4NOBA 5EU7E 4G80A 1YEEL 1R5WA 4OGXL 3D39E 5MHSD 1H3TA 2H8PA 2B5IC 1UCBH 5CBEA 5AZ2H 2IQ9H 2DL9A 2VLLA 4OLWL 4WNQA 5EUOB 1P1ZB 1KPUA 4OAWB 4Z77A 3O2WL 2YA2A 4YQXH 5JOEA 3LKRA 2E9WA 3X3FH 3PWUB 4H8WH 1DSFL 1CFSA 1D6VH 1QZ1A 2Q87A 4G6FD 4OD3H 3HA0A 2EYRA 2BNRB 1LO2L 3DRQA 5IEHB 2P24A 4HX1B 2YPVH 3M07A 4OI9A 1EIBA 5JIPA 5EFIB 4N0CC 3V4PL 1XF5B 1CGUA 2L7JA 5HXMA 1L6XA 4ZUSB 3RNQA 1CT8A 4HBCL 1JZ8A 3SE8L 1CTOA 2PUQT 5EU5A 1AIFA 5I1EL 2CR6A 4MA1C 2XZAH 4PD4K 2AKRA 2V5RA 4XPFH 5E6IC 4NQSB 5HHOE 4Z95L 1ITCA 1PQZA 3WHE0 5I76B 4OGZA 3DURB 2VITA 3QDME 3CK0L 5DJXB 3ZT7A 3V7AG 1S9KC 1NC4A 3WNLA 4RGND 5D93C 4HX1A 2GCYA 5GGSA 1WCQA 4U6YB 3MUGA 1T21A 4YDKH 5HVHB 1EUTA 3PHOB 1A4JA 3HUJA 1IBGL 2R2CA 3GO1H 4KTYA 2AK4B 5GGQL 2P8LB 4JY4B 1J5OH 3B2UD 5DFWH 2RCSL 5IHLB 1N59B 1ZT4A 5TF1L 2R29H 5I6XB 4PJCE 1ACZA 2P47B 2ZG1A 1I1RA 5FF6B 1X5HA 3VH8A 2F15A 5DO2C 4BFIB 1FCCA 2FO1A 3CDYA 1C1EL 3LEYL 3O11B 3VMOA 4NZRH 5DZOA 5JOPD 5CLWA 3HMWL 2MQ0A 4JRYB 2HT2D 3SHSA 5IVXB 2ZSWB 1NL0H 5T1DL 4FMKA 1BD2E 4N8CH 3VXUD 1GZQB 3DROB 4KUZL 3V6FB 4GRWB 3WXVH 2NY5H 1J1OL 5BS0E 3QIUA 1NGZA 5JOFA 4KHTH 1CWVA 3ZKXC 2YD8A 1L0QA 2PW2B 4OIIL 2OL3L 2X4RB 4P4KC 4X6FB 2BSSB 3P0VH 3O4LD 3EOTL 4WI4A 1T80A 3T0XA 2V17H 3TT3L 1ED3A 1YEGH 4NKOA 1YECH 4BA8A 1FNAA 4HIJA 4CMHC 1XF1A 1MEXL 3B4NA 1BQSA 1DN0B 4FQHA 2ZUSA 2EH7L 4AT6B 3GMMB 1GZQA 3THMH 1U8NA 2BY2A 2HAZA 4B5EA 5MP6L 2VOTA 1TJGH 5I1LA 5ICXB 1IL1A 1CL7I 1NGWA 5I15L 1CVRA 1XGQB 5HHXL 2XQYG 4OUUA 5MEQA 2X4RA 1RZKL 1UH2A 5DDHA 2EDOA 4DK6A 1B90A 4LF3A 4MA7L 5E24E 4KZEL 2YBRA 2ZCHH 4J1UA 4PP1D 4JHAL 1Q9LB 2XKNA 3TEUA 4D0BB 2UV3A 1G6VK 1V7MH 3HPLB 2Y23A 1MHCB 2EIEA 1RFDL 1FQ9C 1MJJA 1E28A 3T08A 3W5NA 2AJ3B 4QHLB 1XGYH 1FNGA 4PG2A 5DSCB 1NCBH 3R0MA 4B7IA 4HJJL 5BV7L 1S5HA 4HDIB 4U1IB 2I9LA 3OAYH 3GSQA 4XVUD 3LHPL 5FYJU 3UJTH 5A3ID 3LPGA 3CVHH 1SY6A 1GAFL 4Y7MA 1FYTE 1UFUA 2HP4A 4MQ7B 4M93B 4WEBH 5JORB 1QVOA 5DJ2B 4ZYKB 1T7VA 4KAQL 4PJGB 2DOCA 4MX7B 2JB6A 3HZYB 4X5WB 5EUKB 5JHLH 3AB0C 2Y36L 1VKXB 5E9DB 3DO7B 4B0MM 2MNUA 5E6YA 3VWKB 4WUUA 3TA3B 1T83A 5EU6E 3LKSB 4U1SB 2R0WL 2EDLA 2NY4C 3EJJX 5JUEH 3HZMA 3MV9A 4GKOA 3ARDA 3DXAE 4UU9B 3D25A 5SV3A 1HHJA 2PTTA 3NFSL 5ISZB 1F8TH 4PJBF 3UMTA 4FQHB 4AT6A 1ES0B 3SGKC 2X4UB 1JYWA 3D39A 3MJ8B 5EULV 3S88L 3K4DA 4IDJH 3GUTA 4Z7UE 4JVPA 3DNKA 2VLME 5DD1L 1OLLA 4X0KA 2F74B 5JLZA 4JR9H 4QNPF 4RZCB 4WCYL 1OM3H 5C6WH 4F3FA 1OAZL 1SJEA 5F3BB 4BZ1H 5IQ7L 1WBZA 1CXHA 3EYUL 4L9LB 3AGVA 2X4QB 3GGWA 5I66B 5T1DH 4JM4H 4WO4D 3OKYA 1MJJB 2E5EA 3LQZB 1WT5C 1QP1A 5IJKC 4U7SA 4EVNA 5J6HA 1RZGA 1EEYA 1CFQA 1Q9KB 3SKUD 4ODTH 4L8SB 4LLUB 5FYJD 4Z7QE 3ARXA 4QY8B 4UOW0 2RCSH 1BJMA 1TTGA 4NO0A 3VXPA 5DEGB 3UBXI 3OKLB 4RGNE 2K7PA 5F9OL 4NNYA 4OZGA 4GRLC 5DD6A 5T3ZL 1EEQA 2I25N 3WDHA 3AXLB 2ATKA 3L3IA 5DMKA 3V5KA 3MXWL 1A6TB 2AK4D 2X42A 4Q58C 4KK6D 3ARRA 2JJSC 3BMVA 3T1WA 2D03H 1C5BL 4YGAB 4PRIB 4CADB 2ICES 5T1LB 4OZFG 4Y19D 2NY2D 5J9PA 2XICA 4K3DH 2LU3A 1BQHB 4L4VD 3DV4A 5LVEA 4OV6F 1CXEA 3L3GB 1LO0L 2NY6D 2QR0B 3E6HA 1O0VA 3OKLA 2CDGA 1MPAL 3WNOA 5HYIA 2V2TA 4WHTA 3O2VH 3VXOB 1TPXC 3WYRA 4ZS6C 4OZHE 3S88H 3VRJB 1E6JL 5DRXB 4XGZA 5BV7H 1NCUA 2ZG3A 5IK3B 1UACL 4KH2A 1QO3A 4J8RB 2E7LC 1WWCA 1F90H 4ZS7H 3SDXA 1TTFA 5FUOH 4R7NA 4W6WB 3QWRD 1NLDH 3O45B 4OZ4B 1HKLH 2HVJB 3F8UB 1W8OA 1T1ZA 1KCLA 2R2EB 2WW8A 1AD9A 1IC5L 3SCMC 1MQKH 1CL7L 3F7PC 1QACA 3HMXH 4MXVE 8CGTA 3S36X 3SDCA 1AFVH 2O61B 3KPRD 1P53A 1HXMA 1MCNA 2OR9L 1QBLL 4K2UH 5E2WL 4DN4L 3QQ3A 2FEEI 2KPNA 2WBWB 1YEDB 1LDPL 4AG4L 1A1OA 3VRLF 4Y2DD 4X8JA 5D9SA 5I2IA 1GIGL 3MLWH 1LHZA 2ED9A 3S96A 3UCRA 2CRMA 4N9GA 4P2RD 3MRDA 2WMPA 3EOTH 5DJ8B 2EYRB 1T20A 2KQNA 3TVMC 3WIFA 3DBXA 4M7KL 4HMEA 5D1XD 5JW5A 1KIUA 4PRPB 3QDJB 5DURD 2GT9B 4XNUL 2F9BT 3DRTA 5IFAL 1EVTC 4QRUB 1F2QA 3RVVD 3CUPB 2PW1B 1NEZB 3BZDA 4D0DB 4DUWA 2EE9A 3WLBB 2WAHA 3KPLA 1HEZA 1AIFB 2VDNH 1JE6A 4K71C 3MLSL 4NSKA 5E8NA 5ESVB 3GNMH 1I9RL 2IQAA 3HCVB 4WV1A 2ZKHH 5DJYB 3QUMB 4XPGL 1YECL 4XT1C 1EZVX 3F7VB 2A6KB 3SGEI 5L2KD 2AGJH 3ARSA 5BZDB 4QRUA 5IKCA 1YPZF 3ZHLA 5I30H 2R15A 4GS7C 4X9GA 2CLZB 1CDBA 2Y25A 1J10A 1F4WH 4PB0H 4P9MH 1ULVA 4J6RL 3ZE1E 2P44B 1SYVA 3MLPA 1RURH 2UYLA 1NMBH 4C55A 2VC2L 1O5DT 1PEWA 5JIHA 2W9DL 1NL0L 4PLNC 4YNYA 5I16B 5L2JA 4K94C 4AZ8A 5D1QD 2VLMD 3GBNH 3BGAA 4Z95H 4Z5RA 3WFEL 3L5IA 3UBXA 1SM3L 2HT3D 2GEEA 1VADB 4ZUVB 4ZFOL 3K2UH 1U8IB 4ZTPH 2UWEA 4EOWL 5TH2B 2G75B 1IM9D 5C08A 2Y72A 4V1DE 5E00A 5FKPA 3M1BA 3PP3K 3HG1D 4PB9L 4XXDB 5KW9L 1P5UA 1WUNT 4M1CC 5IQ9B 4RFEA 4JM2C 1OTUC 1OQXA 5CILH 4CU6A 3LH2L 3FB6B 2O5YL 4NWUL 5LQBL 1JPSL 1FZMA 4PJ9A 4TUOB 5T33H 1S7QA 4H0IA 1IQWH 3RVVC 1JNLL 4MDJB 1FPTL 4HC1L 3ARBB 5FECA 1L9NA 1A14L 5E4IA 3K74B 4PG9B 1GAFH 5HHPB 5C2UB 1M7XA 5HDBE 4J3SA 5IV2B 2BX5A 3QEUA 2KBGA 4F8QA 2EH8L 1DQLL 2W91A 1CGSH 5DS8A 1TZIB 1X5AA 5E00B 1TVHA 5FKPB 4H0HB 2BVOB 5C2BH 1EHAA 4H1LB 4NCC2 4QCIB 4V1DA 4WFGE 2DQHL 1MFAL 1VACA 3E8UL 1GZPB 3M8OL 4M5YH 3VFNB 4AIZB 2DQIL 1U8QB 3FQNA 1IQDA 2J6EL 4NGHH 5E0QA 4LLDB 3FO2B 4JRYE 3B9EA 2XN9D 4GW4B 3MROB 1KEGL 4HUKB 2C4FT 4Y1AE 1FHGA 3GJEA 3S36L 1K5NA 5HI3D 5HHXH 4NKOB 2NY2C 5D5ME 1T5WA 3OXRA 1TFHA 5F1KC 3UBXB 3C6LD 2AJYH 5KOMC 1RJYB 5D1ZB 1GGTA 1BOYA 5EIVA 2FBJL 1F3DJ 5DRNB 5KVEH 1KN4H 5B8CB 4Z7UF 4OUOA 5TH2A 3BPLC 3WD5L 3VFNA 4LVOC 2N7AA 3KGRA 2VXTH 2MWCA 1G9NL 3VG0L 3DTXB 3QIUC 4KPHH 3KYNB 1FFRA 2FD6L 3BQUA 5EC2A 4XWOC 1K5NB 1QBLH 1S9VB 4K2UL 5JMRA 3LSOB 2FL5B 5C0FA 1D5BB 1ACYL 1SVCP 3ARDD 4OCLC 3NCFB 1HHJB 2DLIA 2PTTB 1F3RB 4XZUA 5ISZA 1QRNE 4LLWA 4KKLC 1MOEA 4XX1E 4S1RH 1YEJL 5D2NC 4MJ6A 1JPGB 2Z91B 2GAZA 4N5ED 3OAYK 4XCFH 4GW5A 4WUUB 5DD3L 3TA3A 4C59B 4DGIL 3RZCC 2D7TH 2HWZH 1N0LA 4BM7A 5D1ZD 1A1MA 2R23B 3U48A 4J23A 4AEFA 2Y7QB 1H3VA 5C3TA 3P4MB 4LCWD 4GO6B 5L8LB 4J3TA 2Y07H 4KRMB 3T3MF 5IP4A 5E8PB 2LU4A 5C0ND 1T04A 5FYKE 2HJLB 2HFGH 3VMNA 1ZTXH 2FYYA 2VXSH 4F7CA 3PGFH 1AJ7H 5F88A 1MI5B 5CKGA 1GIGH 3MLWL 1KJ2B 1CFVH 2UY6A 1RJCA 3WS6A 1A3QA 1LDPH 4HF5L 2NY4B 1T5WB 3EJYC 2MKLC 3KYMA 2D31B 3WXWL 1FZOA 3AB0B 2GJ6B 4LKXA 2I60L 5TPWL 4PJ5A 3D69B 5KS9E 1U3HC 4NHCH 4NJ9H 5H35B 5JPMA 3O2DL 2AJYL 3D85B 4S1QL 4L4VE 4QXGH 5MEOB 2BCKA 1ZXQA 2WP3T 1WZLA 1I8LA 3DUUB 1F4WL 5HGBA 4ZPVB 1NCTA 3I9GL 1A6TA 3H3PL 3LKQA 2OBGA 4OF7A 5T1KA 4XI5D 3IXAB 4YIQB 4JDVA 3GSOA 3GK8H 1MCOH 4IRSD 1MIML 3V0VB 4H5SA 4ZG1A 1AGCB 1JWUB 2PR4H 3PP4L 5GGVL 3B9KA 3BH9B 3T4AB 1MFAH 4CN6A 4RDQG 2DN7A 1INDH 3BZEA 1JPGA 1QSEA 4ONGL 3UJIH 4AJ0A 4PJ5E 4KKLD 1J05B 3V2AR 3KDMA 2W0FB 2NY0B 3QO1B 1EHXA 3SDDA 3FFCA 1YC8A 5DRXA 3MBED 1JZ7A 4JZOA 5DWUH 1TZGL 5D7IA 5IK3A 3S35H 3S4SA 4QNPE 3CXDH 5TJWK 2W9EL 3TO4C 3DVFA 4NP4L 2KZ1B 3O45A 4Y19B 3AAZA 1MHCA 3L1OH 4KK9D 4R96A 1DLFL 1FNEB 1S3KL 2BHYA 3K1KC 1MUJB 4M6OL 5DHXB 3ARGB 1AKJB 4EUPB 4WWKA 4Y4HD 5JQ6H 1E27B 2RBLA 1FNLA 3CLEH 5SWSE 4TSAH 1ITBB 2NZ9D 3F7RA 1V7NL 3LZFH 4OLVL 3WKMH 2NY3D 1V3JA 4XPTH 2ESVB 2A74B 5F7DB 2CK0L 2GJ6D 1SYSA 5D6DC 3W9DB 5CEZE 1A7BA 3LKOB 2WIMA 3CH8A 1QKZL 3KPPA 1NGXB 1G7JB 1MWAA 1G6RL 3DUUA 15C8L 1OGTA 4GKNB 1I8MB 4WW2B 4KXZH 1P2CB 4WFGD 4Q6IB 2QBWA 1BQLL 4JDVB 1Q0XL 1S9WB 1LP9B 4P2RA 4S2SA 1ZSDA 1RIHH 4F80A 1E27A 3K3QA 4FQXD 4MAYB 4Y16C 1AI1L 4JFPA 1CCZA 4K7PX 2DWEA 4LSPH 4LSTH 4P46A 2VDOH 5GS3A 1FG2B 5KVGL 5HYJA 1ZVYA 4L4TE 3B9KB 2QADD 5FHBH 1YMHA 1K6QH 3OGCA 3G6DH 2HJKA 4IEFB 2DQTL 3EBAA 3HR5A 5L2KE 3SN6N 1G1CA 2DQUH 5JQ6L 1T0NA 3K8LA 1FSKC 4ZD3H 3C6LB 2Z9TA 3P9LA 5GGSY 3SDDB 4OLUH 3T2NH 3U36A 5GSVA 3QI9D 1BECA 3QDMD 4JPVL 2OYPA 1N5YL 1T22A 1XF3A 3QQ9D 3CAFA 1KB5A 1MRCL 3QDJA 5GGRB 2FH6A 3HI6H 4ZUWB 1IQWL 1R3LA 1IILE 4PJBA 1UXWB 1Q9OA 4NWUH 4JRXD 3ARWA 4POZC 5FHAH 4PRHA 1EEYB 2E6PA 4MAYD 2VL5A 5EZLB 1N5AB 3RDTA 3O81A 5C0JB 2G9HA 1CDUA 2AV7A 4NSKB 3DXAA 3RWGA 3UPRB 2NYYC 3ARGC 2OTPA 3NA4A 3FAWA 5HI3C 3G9AB 1RHFA 3ZYZA 3V6OC 43CAB 3DSFH 1XZ0A 3H7BB 4DUVA 2IANA 4WFEE 3VG9C 5EIIA 1MCJA 1YYMH 3TBSB 5FO7A 4KQ3L 3VFTA 2VKXA 1FFPA 1MRFL 4ZUVA 1CICA 1BAFH 1N2RA 1HIMH 2NY0C 1JHTA 1IGTB 5L7XL 2JE8A 3LKPB 3Q1SH 1A7PH 4HUWB 3NA9L 2I60H 5TPWH 2YS4A 3KHQA 5F6IB 3VXSE 5F7MC 3CX5K 1QPPA 1XGPA 4JO3H 5FAAA 2JELL 3NABH 4ZUUA 1QSFA 1A3LH 3C5JA 2H2SD 1CU4H 2IG2L 4D94A 2G5BA 1CIDA 4XC3L 4HBCH 4QT5A 2CRZA 3Q6FA 1DBJL 3PIQA 1J8HB 2HFEA 3P9LB 4ACPA 1K2DA 4OM1L 4LDLB 4WW2F 3MRRA 3AMLA 2KL6A 2V9QA 1QBAA 3CDGA 3LZFL 1G9ML 5D7LD 3QT2A 3GSNH 5D7JB 2J12B 1MFEH 4I0PA 3GIZH 1QYGL 3VFRA 3UTSB 5KN5A 3LIZH 3OG6B 1HSAB 4XNMA 2CKBA 1I7ZA 5KSBA 2GYSA 3QO0A 4KJPC 4X6CA 5DYOB 5C0IB 2MCPL 2N7BA 4OD3L 2NLJB 1WZ1L 1BMGA 2DIAA 1DQJA 2VL4A 1EEZA 4KDVA 2HFFA 3CXDL 1KTRL 2VMFA 3H9SD 3QG7H 4HUVB 1YEIH 3UTTB 1YEIL 5J7CC 3MLXL 3O2DH 5B3NA 1FO0L 5IBLC 4ODUB 5H37H 2CIKB 4OGXH 5GIRA 1W0VB 3L95A 5TQ2L 3QCVH 5LJYH 4BQ8A 3V4UH 3BIKB 4PRAA 3WE6B 1S7XA 4R90H 4LSDA 4YXKL 3I3BA 1QLRB 5EN2B 3ROLA 5T3ZE 3C6LC 1KIPB 3SQBA 3E3QE 4HS8H 4LPTA 3T8XB 4JY4A 1ZTXL 2VXSL 4U3XA 4GAJL 4HV8A 2JK5B 2AI0H 4HXBL 5GZOC 3KYOB 5L88H 4GKZA 3MRMA 1ONQB 1MCQA 4JFFB 1CF8H 3ET9F 5JOPE 5FKAB 1HYRC 1S8DB 4OM0L 3GMLB 1QSVA 1T2QH 2Q8BH 5DTFA 3U4EB 4MJ4A 3GSRA 4P5TA 2P46B 3L3DB 3TM6A 2YUXA 3DETC 4WUUE 4ERSL 5CZXC 4G7VL 1TTUA 1BZ9A 2QQLH 4N8PA 3ALPA 3QYCA 5K9OA 1IGYA 2V6HA 4GQ9H 2AXHA 4I13B 4CMMA 3WJLC 4BFEA 4OGAC 1MPAH 4EIZC 3QIWC 3UTQA 2ZSWA 4D9LH 2FJFA 1OCWL 5ANMB 1QNZL 2VYRE 3L3OA 2VXQL 4NZTL 3TBVA 2CUMA 4UUJB 1MCCA 4TRPH 5JOFB 4LCWA 5EU4A 5IMLB 4QRQA 2PETA 5C0EA 1QRKA 3ILPA 4KK5D 2OTUA 2XWTB 3PE9A 5HGGS 5DVLA 4IIQC 1J88A 5ACZA 4P57A 5EBGA 3C5ZD 3KLAB 4MHHG 4FXGA 5TFSH 3LPFA 3JWDL 4RGMB 3G04A 3QI9B 4UQ2B 5AZ2L 3T2OA 3U7YH 2CH8A 1S5HB 5F7EH 5TF0A 5E7FA 3FL7A 3IKKA 4D9LL 4NRZA 3DX9B 3MRFB 4HCRH 3VFVB 5IBUG 3RPIB 3MO1B 3MLZH 5D93B 1UH4A 5I0ZA 3G5YA 4WDIA 1G9NH 3FB8B 1SEBA 4LLVA 5K33A 3C9NA 2QADC 1ETZA 4K3EL 4XCEB 3L3JA 5DDHB 2V9TA 2Y7QA 3UYOD 1RFDH 4ZUTB 1KCUL 2RQ8A 4LHUG 1SEQH 3LMJH 3PDOB 4FXGB 2FIKB 1I1YA 4BKLB 1U3YA 4OM0H 4NWTH 3QUKA 5DUML 1AGEB 4GAGL 4M6ML 3SOBH 4GSDL 4YDLC 3C08H 1YQVL 4MS8D 4QHMA 1X9QA 3ZTNL 5FA3B 3ARZA 4IM8A 1RQ5A 3C2SA 3OKMB 3G6JB 1NFDF 4LVEA 3QPXH 2MQ3A 4JY5H 4JG1H 1YDPA 1WICA 3BP5B 4IHOB 1I9IL 3DIFA 4X0KB 3GDBA 3MNZA 3FFCD 4Z77B 1UM4H 3P4OB 3ILQD 3TGXA 5JA9A 2EH7H 5H35A 5E5MA 3ALWA 3L1OL 4ONHA 4YE4H 3KR3L 2UY7A 1BLNB 4XP1L 2F53A 3HC4H 1K4CA 1DBJH 4OFIA 1VKXA 3QQNA 1LDSA 4K8RH 4WWKD 4Y4HA 1XCQA 4QOKE 1IKNC 3T0VA 3MLYL 3LS4H 2XY1A 2VUOA 5FB8B 3SE3C 2IMMA 4I18A 4PRDB 2XWJB 3IU3A 3OB0H 1T0PB 2DQFA 1RURL 3CVHL 1INDL 4NZDA 3KPNB 4JM2A 4B7LA 3ARFD 4W68A 2BNRE 3RZCA 1BLNA 1YEHL 3EYVB 2VLJD 3QDGB 1WBYB 3N1GC 3V4VH 1I85C 3RI5F 4FQXC 4M8VA 3UPAA 3CSYA 1G7PA 4OM1H 1VESA 3JV6B 4G6ML 4PJ8D 3VXTA 3PWPB 4GBXD 3CGTA 3D3VA 4XCYA 3PDDA 5C7XL 2J1KA 4JAMB 2JIXD 3VXRD 3WIHA 1PLGH 4J3OC 3GBNL 4XNXL 5DA0B 4UTAL 1X5LA 5SX4H 4EJ1C 1YMHB 2UZYB 4ZTOL 2SEBA 1YPZA 5I19H 4ODWB 3GRWA 3LAFA 2UZIL 5GHWL 3VD3A 2Z92A 3RTQB 2BJMH 2OZ4A 1G0DA 3TJEH 1HINL 3FN3A 3HI6L 3UTZB 4IRJD 2DYPD 1J1PL 3EOAA 3MREA 1AGFB 5IFAH 4Y19E 3QIBD 2EKSB 4U1JA 4YDJB 4MVBC 1XEDA 1ZWIA 2DTSA 3CMOH 1IM9B 1FZKB 3REWB 4M7KH 1EEUA 2F53B 5C8JA 2VZ1A 4PRPE 2ATKB 5DMKB 4PJEE 1UJ3B 2D7QA 2CIIA 3L7EB 4PYHA 4LK4A 4OKVA 1A6ZB 1EFXB 5DRWB 4KI5D 3CX5J 4M7ZB 4X4XB 2ICWB 1N64H 4LQ1A 1ZHKA 1TITA 1KJMB 1EO8H 3MCKA 4OFPA 3RDTD 2AK1L 4KWUA 1U92A 4H25B 1FZOB 4TNWK 4I18B 2DQCL 3WS3A 3NIGE 4M48L 2YPLB 2BRRH 3TJEL 2VLLB 3WHXB 1BQHA 5FOBB 5CLTA 1CYGA 4OFYA 1QLFB 3KPSD 4MD5B 1LK3H 3SY0B 2HKFL 4XRCA 3ULUE 1DR9A 1FVDA 1QD0A 4JREB 3TBSA 3OJVC 1RZIA 5LGKA 3GSOB 1FFPB 1A9BA 4U0RB 2W60A 1NAKL 3MV7D 4LBEA 1FIGH 1R3LB 2DLEA 4PJFE 1IGMH 3TH3T 2DBLL 3TNNB 5FHBL 5I6XC 2F5AL 2ZUTA 1JRHH 5C0CD 3QG6A 3O3AA 3MBXH 3K46A 1S3KH 2B2XL 1N5AA 3RDTB 4DN4H 2NNAB 4LAJH 1OTTC 2B0SH 5EO0B 3RVXD 3CC5B 1NDGA 1N3NA 5AAMA 3H9ZA 5FM4A 3W0WD 5H94A 4KK5C 3WIFB 3M17A 3EDFA 4AK1A 5TE4H 2B1HH 2DS4A 1U8MB 5DQJA 1S9YA 4JHBA 2D7PA 2BVEA 1UB6B 1U95B 4TSBL 5I17B 1RMFH 3TYGH 5I8EA 4KUCD 1AKJD 4X6EA 5FOJA 1AR2A 1X6LA 3Q6GH 4HKXB 4S1DD 2WINB 3MV8D 4ZS7L 4HQQL 1OW0C 1NANH 5F9WC 2Y1VA 2WBKA 3CDGB 4HFUH 4HUVA 5CWSA 1DQLH 5E8NB 3IB4A 4RBPH 5CGYD 3FOMA 4X7EC 4JG1L 1N3NB 2VE6A 4NM4L 9CGTA 7CGTA 5I1HH 1BZ7B 3SDXF 3L3HA 3D25B 2Z93A 1TENA 3U4BH 1TJHH 3TBTB 3MLYH 2XTJD 1VEMA 2ZOLB 4EDWH 3P0YL 3ARVA 4R0LB 1OL0A 2J8HA 3FFCE 3TNMB 3W0WB 4EDXA 5IMOB 4IS6B 4O4YL 3SGJC 2P5EA 3RGVB 5K59E 3Q1SL 3CFCL 1YEKL 3AY4A 3L6FB 4CL7A 1CD8A 3CZJA 5JLZB 3KYOA 4DKEH 1PG7H 4P3DB 4F37K 3ULVH 2IBGA 3QFJD 4LDOB 1KPRB 1RUKH 3VXMD 1P1ZA 2B20A 3GM8A 4NNXA 3QWOB 5ENWB 2AJZA 1R24A 4UIMB 3GK8L 3IDMA 3KXFB 1V8HA 4XNYH 4P4RB 3ARGA 3QH3A 4ODUA 5JPNA 1KC5H 3O9WD 2Y07L 4Y5YB 1AO7D 5HDQL 2ERJB 4UMGA 4G8FA 1MWAL 3PGCB 3L95B 5AUMA 1U8NB 3AVEA 3VFWB 1EAPB 3QXDA 3MRMB 4GKZB 4HG4J 2AXGB 2OZ4L 3O3UN 2A74A 4W6YB 1UXSA 5DZLA 4JFFA 1GOHA 2APBA 4Z5RB 2R2BB 2EE3A 2NX5A 4HGWA 2J5LB 5KJRH 4PV8B 5I30L 4X7SL 1S7SA 32C2A 5E8OA 5J3HC 4KVCH 5L9DH 3T0DA 3AUVA 1P6FA 4RMRA 4JKWA 3KXFA 1I1AC 3NPSB 5E2VH 2AERT 1BWMA 4LLDA 2OLDA 4FQIH 1S8DA 5D2LB 4O51A 3V8CA 3X14B 2XV6B 4O2FB 3QSKB 4PGCA 5CIPB 3JBG7 4Y2DB 4YDIH 2N1KA 3BGFC 1KCSL 4JJ5B 4WY7L 2OJZH 3BESR 3D5OF 1IKFH 4OZHF 2H1PL 2NQCA 4TUKH 5C3LD 1RZ7H 3CH1A 2X6MA 2OI9C 1N2RB 2VDNL 3QISA 1TXKA 3X3FL 4E0RB 4Z7OF 1FGNL 4X5WA 4N0UB 1J0KA 4FZ8L 2I26N 2JB5H 2F8XC 1L6ZA 2YD1A 1JL8A 5F71A 4X99B 1PEZA 4NQCB 4NQVA 5CP3H 4DZ8A 3U7WH 1G6RH 4QXTB 4HJ0C 5E70A 2HLFD 1J8HA 1NSNL 2HFEB 1AXTH 1IAKB 4JFDE 4JO4H 3I75B 3BXNA 3V5HB 4W81A 4G7YL 2X70B 5D72H 5EORH 4L9DA 1E4JA 3WN5A 2GJJA 2GSGB 2R4SH 4HIEA 3ARPA 1EK3A 3GI9H 1AFVL 4X6FA 5I8OH 3O0RH 2E6QA 4JANB 5I18H 5ESAB 4WEMB 2H3NA 4BK5A 3BQUB 4IRZL 5E2WH 4RFNC 3U30B 1ZVHA 1A1OB 3S35X 5B4MC 3ISWA 5K59F 1LO3H 4UDUB 4MJIA 2EKJA 3IGAB 4ISVB 3FQWA 4MA7H 4PRID 5EO1B 1FVCB 4HHAB 3B3IA 3AS2A 3SJVA 4XP5H 5F7LB 1Z3GL 1BIIA 4R4NC 3BSZL 3HG1A 3E3QC 4HK3J 2IH3A 3DURA 4F7PA 4P99A 5FUOL 4KDTA 4LMQI 3O6MH 1KJVA 3OMZA 1MCEA 3OPZL 5F88B 4HIEB 5CILL 3INUH 4XP6H 3LSOA 5D5MA 4PREA 4HH9A 4KJWC 3QRGH 4QYOA 5F1SA 5IEKB 3RWFA 3U46A 5E2JA 4M1GH 4W4NA 1IEHA 2ZSVA 2C4XA 4IOIA 5E8PA 2P8MA 4JY5L 4P2QD 1DJSA 3RZCD 4F57L 5AG8A 1FAKT 1FYTB 2HRPH 2B1AH 2D03L 1A6UL 4NFBA 4QHLA 1M6OB 5HI5D 5IW6A 3EGSB 4YQXL 4M9PA 3RWDA 4MNGE 4OF5A 4TUJB 3GSRB 2MCPH 3CZFA 4JQVC 4XB8A 4ALAH 1MIEL 1VPOH 3HZVB 5B38B 3MCLL 2VRAA 4HKZA 5TE6L 2XTJC 2YOCA 3C2AL 4OB5L 5ADOL 4DVBA 2VO5A 1F3DH 5T3ZD 1DQMH 4GRLD 3VJ6A 1JZ4A 4HIXH 1PKOA 1NAKH 4G7YH 2VWEE 4HK0B 3DO7A 5C09A 2ZOKA 2H3NB 1R0AL 4XC3H 4YIQA 3KS0J 3D0VB 4JPKH 3WNMA 1ZEAL 1WSST 3TC9A 1UEMA 2VZ3A 1ZWIB 3ZZ1A 4WO4B 1X4YA 1RZFH 4NRYB 2R9HD 1LEKA 3O6FC 1OAQH 2VWEC 1KELH 1UJ3A 4PTTB 3QUZA 4FFZL 1X3DA 4ENEC 3TVMD 3RTQA 5FO9B 1A6UH 1LNUB 3QULA 4PY8I 2XOTA 1S5IH 3S3SA 3TT1H 4NQDD 1A02N 3CPLB 3PJSB 2EKSA 4U1JB 4YDJA 4OKDA 5ANME 4X6BB 1JIBA 3V9FA 1ZVSB 1OP9A 4XWGL 3NCMA 4X7FC 1CFNA 4KROC 5J1SC 3L3DA 1FORH 1ZLVK 5D2NB 1RY7B 1MJ8H 2VN7A 4K55A 1CE1H 1U0QA 2CGRH 2W0FA 4XTRD 1MUJA 4LARL 2X1PA 5ITBH 4NUJB 1C08B 1L0XA 2J88L 4LSPL 4LSTL 5A16B 5D7IB 2ENSA 5C71A 5DVOA 4N1EA 4BFBD 1U92B 3KNBB 2Q6WB 4KV5E 3SEPA 3MUGB 3QIWD 1HILB 2HLAB 4P2OB 1K4DA 5IMKA 5KVFL 3HB3C 1Q0YL 3FMGL 4RQQA 1E4WL 2XQBL 3A6BH 2FHFA 1CF8L 2AP2A 1BFSA 2B0SL 5GJTH 3SDAC 1OF2A 3UC0H 2ZNWA 4RIRA 2DQUL 1A5FL 2CKBL 2XA8L 3E6FB 4DGVH 4KKBD 1DUZB 1NUNB 3HE7D 3TN0B 1FIGL 4R0LC 5E8DH 4M7ZC 2BOBA 2V5YA 1RK1B 2P49B 3QUXD 1F11B 4OJFH 4OZGB 3VD4A 4G9FD 2ED7A 1NCDL 3VXQA 3X3GH 2C7UB 4OLEA 4TVPD 1B9ZA 1U95A 3DX8B 4HJGB 2HMIC 1A6VL 2YA0A 4DWHA 4OQTL 4GBXB 5EDXA 5DK3A 1MAKA 5GSVB 1BOGB 4F7TB 2M2DA 2OI9B 3UC0L 1A9EB 4U6HA 5F9WB 5EBLA 2VIRA 4OCYH 4Z7WF 4PLKD 1KCKA 1RK0A 1B0RB 5FIEA 1KIQA 4PJAF 4GAYA 3BGFB 4YR6A 1I1YB 4U6XA 1I7UB 3G5ZB 1KB5L 3WKML 4K9EH 2HVJA 1RK1A 2QLVB 3TJHC 1HOCB 1JPSH 2MPAH 5EIIB 2DYPB 4FTVB 1UM6H 4R4ND 1A8JH 2XZCH 3IDXH 3STBA 1MLCB 4YHOH 4LARH 5ITBL 4YBHA 5EOCL 2YRPA 4AQ1B 4M6NH 1HILA 3MSPA 2P5ED 3H3BC 2VTFA 5MEQB 3QQ4A 1NH6A 4MD4A 3H9YA 2IFFL 5EUOE 4M7JH 3X11B 4KDTC 3WIHH 4HC1A 3VXMB 2GJZB 1KXQE 3ULUC 1KELL 2JELH 3NABL 5KZCB 3VDBA 4PRHB 3HB3D 4R4FH 5J57B 5C07B 3VWJD 1RZFL 1RJZB 3S96B 4KHTL 5GZND 1BEYL 2EYTA 1HWGB 5CJQH 2OZ4H 3ARGD 3B5HA 1OAXH 3SKJH 1HHGA 2B2XH 1L7TH 1YA5A 1ZGLM 1A4KA 3VGGA 2W65A 4P2QE 1U8JA 4UAOB 4AENB 4OV5B 1V3KA 1KT2A 3HS0B 4NQED 1VACB 1C5DA 2A9ML 5IESL 2OXHA 4PJEF 1U58B 1U6AL 4NO3B 5ADOH 2EEBA 3IDMB 1KJMA 4I3RH 4P9HC 2P1YA 2V2TB 3RJDA 4DK3A 4FQXA 3WFCH 3P3YA 5E6ID 4PTUB 2IPUK 5CGMA 1YJDL 3VMPA 4Y5VB 1TQBB 2RFXB 4I0PB 2YPLD 4YC2C 2EZ0D 4HWZA 1CG9A 1XGTB 4GXVL 5DFVC 5I9QB 1PZUB 1BM3L 2Q7YA 5IFHL 4LL9A 1JHKH 1BVKA 4P23C 4H5SB 3OAZH 4QT5B 2MOVA 3VI3E 3OKDA 4KROD 1KUMA 4O00A 4WTZA 4D0CA 2FSEB 5KBNC 3HC0A 3MLVH 3BP7B 3DX7A 4Y5VC 1QRNB 4ZXBA 1WZ1H 5I1CH 2CJUH 3WUWG 4LGPB 5GISH 1WLHA 4MGXA 3MYZA 2ENYA 5IHUH 4BH7B 4N5EC 1FL5B 1NCBL 3BIKA 4QF1A 2QHRL 4LEOA 4PGCB 1YQ2A 3LQMA 5CSZB 5KANG 3V7MA 2Y6SC 1OW0A 1KLGB 5GPRA 4PRHD 1CLZH 2MCG1 4DGYL 4ERSH 1TZHA 3OJDB 2VLRE 5KG9B 4OLZL 1GGUA 3N1MC 3RHWK 3TYGL 1BVKB 3TBWA 1NCWL 2B4CL 3DV6B 4Z76B 4XPBL 1ZLUH 1A6ZA 3BPOC 2VERN 3AMKA 4JKLA 5F89A 4JHAH 3ZKQD 3BDXA 1NUDA 2C1PA 3V5HA 1XH3B 4DZBB 1ZLVH 5K9JL 3DRQB 3NBNA 3VGHA 3RA7L 3EIFA 3PWLB 4PGZA 4ZTOH 5SWZA 3QXAB 5DVKA 3KLSA 1KB9K 3TYFB 3BGMA 4TTDD 2ADFL 5FYKH 2EDWA 4FG6C 4XCNA 4DZ8B 1CGTA 3EFDH 1QRND 5IROC 3UYPA 2DTMH 3K0WA 5F9DC 5K9KB 3IFNH 5CHNB 2UWEB 1GGCH 3MJ6A 5DD0H 3TBYA 5KSVB 1FVCA 3NCYP 1BJ1H 4PPTA 2BVPB 4I2XE 1ADQL 2RFXA 1IAIM 1ZLWK 3U7WL 3FT3B 1HHIA 2AJ3A 2W0LA 4OQTA 4Q0XL 5BS0D 5DXWA 3SDAA 1Q1JL 4JB9H 4K7PY 4UIKL 3S5LG 4N68A 3RVUC 4XVJL 5CCKL 5FYKD 4E9LA 4NQUA 3DETD 1PGRB 1HHKB 2QHLA 4PREB 3TNMA 3QIBB 4BQ6A 5CINL 1IAIH 3X13B 1OD9A 4DKDC 4FTVE 5CHNA 3MR9B 1MAJA 2OJZL 4U1KB 2RJMA 4NZTH 3VD5A 4XI5C 3BHBB 3UJIL 5KW9H 1H8OA 1KG0B 1DBAH 4WDIB 3E2HB 4M7LH 3IRPX 3IDNA 3FN0H 5EA0H 1N5YH 4HLJA 4MA3A 3QWQB