4ODTH

Fab structure of lipid a-specific antibody s1-15 in complex with lipid a carbohydrate backbone
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
226
Chain Sequence
EVQLVESGGGLVQPKGSLKLSCAASGFTFNTYAMNWVRQAPGKGLEWVARIRSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVRHRGAPLYYGNGAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTSGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S1-15 Fab (IgG2b) heavy chain
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odtH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odtH01
2HRPH 3K80A 3MROA 5DRXA 1KCLA 5EU6E 4MXWH 1BHGA 5EU6A 3S98A 4CNIB 1U8HA 2CH8A 3VFPB 5D8JH 3T0WA 5J3HD 1P7KB 2DTMH 1YEKL 1JGVH 1ZKAA 2V9TA 3OKLB 1LILA 5F9JA 2XG5A 3U0TB 2VR5A 4DWHA 4MJ6A 1F58H 2VITA 5B8CA 1DE4A 1M7DA 1I7UB 1RUML 3ZKXB 4GRLD 3TNMB 2NY2B 4HKXB 3GRWL 2CQVA 3C5SB 5IEKA 2GJZA 4JZNB 4LDOB 5DJ2A 1T66D 4O51B 1A1NA 3NFSL 2DIJA 2AEPH 4D9LL 4S1SL 1ZLVH 1H0DB 2G60H 3V5KB 1A6VH 5D1ZC 4PPTA 3BIKA 3D3VD 4NUJB 3BE1L 4GAJH 1QSEE 1QSEA 3IFLL 3RAJL 1RUQH 1YNTA 1MI5D 4YXKL 4EI6A 1CR9L 1ZT4B 1MCEA 3CFBA 4JPIA 2W65B 2GTZB 2AI0H 3QHZH 3QEUB 2YUVA 3EFDL 4MXQD 1UKTA 1DUYA 1MIEL 3DXAB 1S9XB 2NW2B 5E6YA 2BSSB 5K59E 3HPJB 3T1FA 3WL9B 5CLWA 2ITCA 4KPHL 1LNUB 2R2EA 4MQ7B 3I84A 1MJ7H 3PHOA 3ULVE 4JDTH 3R8BB 1CGWA 4X6DB 4MNQD 3PGFH 4LEXL 3UYRH 1ACZA 2XQBH 1BFOB 4LHUB 4YEFA 3IDIA 4HPOL 4HZAA 1CE6A 2DAVA 1JPGB 3WFHA 1FL6A 5CIPH 3SKMB 3ISWA 3UYOD 4L9LC 4M5YH 4NN6B 1SVCP 3IFPB 3VXUA 5DURB 4NRYA 3TVMD 2FIRT 3VFWB 3TCXA 3EO1A 1W0WB 4Y5YC 1KJVB 3L3JB 2ENYA 2OL3H 1AGFA 4XI5C 5DEGB 5DMIL 2BRRL 4I0CC 2YXMA 5F97E 1XIWA 1AR1D 5CEZH 1MREH 2HRPL 3EAKA 1I3RA 4JZJB 1VADB 1DLFL 3U9UB 2NX5E 5EU4A 2UYLA 2NX5A 1MVUA 1L9MA 4JN2B 5DSCA 1NGXA 3JTTA 1TTGA 1EEYA 5B4MD 2R0ZH 1A02N 2SEBA 2VDMH 2HKHH 4LGRB 5IKCB 4AM0B 4HJGA 2HT3C 3KG5A 4WIQA 5HHQA 1U8PA 2XWBB 2CDGB 3FT2A 1I7RB 2QHRH 3UTZA 1V05A 4ALAL 4WI6A 3JV6A 3KLSA 3IDMB 5LQBH 3VXRE 1IGJA 3RTQA 3VXRA 4B5EA 5IROC 1DQLH 4F2MB 2AEPL 4JY6B 4XC3H 5GRXG 3VXOA 2H41A 2VMFA 5DHVH 4U4BA 3UC0L 1HXMB 3MBEB 4OGYL 1CLCA 4UIMA 5IHZB 3SDXF 1V3MA 4QXGH 1CFNB 1J12A 1HH9A 3EHBD 4X6BB 4K94L 5JLZB 1Q8MA 4KUCD 3UPAA 3HI6L 2NXYB 2YBRB 2ATPA 4WENB 4KV5F 5JO5A 2PR4L 3QDJB 1EJ6A 4U6VH 2Z9TA 2D3VA 3MRPB 5FYLE 2QSCH 1U3YA 5I1JL 3BDXA 4Y19B 2CLVA 1D6EA 2R2BB 2FX7L 3SGKA 4LQFL 4AT6B 2PYFB 3RVVC 3VFTA 2UZIH 4JANB 4KJQD 1MI5B 1GC1H 1G7PA 3IDNA 5DD5H 4HJ0D 4OF8A 3W9DA 4CVZB 4U1MA 3PGFL 3GGWA 1ACYH 4PRPA 4YEEA 1YY8B 4FQ2H 2PTTB 1JI2A 1TCMA 4YAQA 4CMHC 5HGAB 5HHOD 3DX7A 3P0GB 1QLRA 4XVUC 4X5WA 4WJ5B 5ECJE 5IB4A 2I07A 3OF6A 3VFUB 2ZCKH 4IRJD 4M5YL 4OKVA 5E2UH 5EOTA 5DD3H 4K7PL 5C6PB 5I1CL 5EULV 2W1NA 4CW1A 2AV7A 5HTSA 3FCTB 3TO2B 4IOFC 4DQOL 4EEEA 4YLQT 5HHME 2DWEA 4Z76A 1N3NA 2GK0A 5KOVC 1G7QB 4L3EB 1HYSD 2LQRA 1MREL 4M8VA 3O6ML 1EO7A 4XX1E 5H37G 1ITBB 4U1KB 1JPFA 5FB8A 4PP1D 4GKSB 1GZPA 3BKYL 4FP8L 3WO4C 1I9JL 1IILE 2X4RB 3TZVA 1YC7A 2DLFH 3AC0A 5JHLL 3NOIA 3U2SB 1TJGL 5CBEA 2C5DC 2XPGB 1EJOH 2A77H 2Y06H 2IH1B 1YMHB 2QHRL 5SX5H 4XNZB 5IW1A 4M1CD 1JZ7A 1KPVB 1BLNB 5LQBL 4XXDA 1H3VA 3MJ7A 5DQ9B 2YHGA 1DQLL 1BD2B 4GXVH 4EN3B 1EH9A 4XX1G 3HZKA 3STZA 1MLCB 3H9HA 5DYOA 1QFPA 4C56A 3QUXC 1KTLB 4MNGB 3ZYOA 1CLOL 4GRMB 5GGTH 4N8PA 3X13B 3TWCL 3PP3K 4LOUD 3RGVC 1LK2B 3P4MB 1NCNA 1GAFH 4DCQA 3WUWB 1S7WA 4K7FB 1JUFB 4GG6E 5ESAB 4RIRA 3VD4A 1MCCA 3DRTB 3RBGA 2EDJA 2YKLH 3K81A 1VHPA 5JW3H 2YEZA 1I9RH 3D85B 1U6AH 3H3KA 4LSUH 1A14H 4WFGE 3ZDYF 4A6YA 1FV1B 4Y88A 1DVFD 3RWFB 5FOBA 4P23C 1P9MC 5FKAA 3BOVA 4Y2DD 5F9OH 1Q9LB 5AUMB 1SBBA 1ACYL 1NFDE 1DQTA 4K8RD 2RQ8A 1NFDA 1B90A 2D7TH 3PQYD 1GL4B 4F33B 3WNPA 4GKOA 5ADPH 4E41B 1HEZA 5E2UL 2HN7B 4XMKL 1D5ZB 5GGRB 4DKFL 4N68A 3VWJC 2IH3B 1VFMA 4Q2ZA 1KB9K 3O2VH 1F3DJ 4CJ1A 2VLRD 3S34L 2F54E 2D7NA 5EPMA 3FONA 1CFTB 2F54A 1HSBA 1PGRB 4W81A 1H5BA 4NSKB 4OF5A 4P5TC 5HHOB 1OWWA 5EC2B 3IB4A 4GW5B 1ZT7B 3HG1D 3BRGC 4IRJB 1WIPA 4YHLH 5EORL 3P0VH 1TJIL 2YZ1A 3KYNA 4LF3B 1T2XA 4BH8A 5K9QG 3GI8L 3L5IA 4NFCA 5JXAL 4PJ8D 1P7HL 2A9NH 4NRZB 5IVXF 5ABDE 1S7VB 5EZOH 2KPNA 3J7HA 2DLFL 1G6RL 3KPSD 5DJCA 2FCBA 2CKBH 2P5ED 2VDNH 2VL4A 5D1XD 2CUIA 2LAGB 1EJOL 1B0GB 4Y4KD 3L3OA 1X5ZA 3FKUS 4MZ2A 3FZUC 4UT7L 3U7YH 1ZHLB 3EJZC 4XP4L 4APQB 2CDFB 2E6PA 2I9LA 3LSOB 5HI3D 3CFJB 3QRFM 1J7VR 3IFOA 3MRIA 4I9WD 1KNOB 3VG0L 5GGUA 4U1LB 3WJJA 1A6WH 5FAAA 3IAPA 3ARED 2G9HA 5JMOC 1Y0LA 5CMAB 3O9WD 3QIUD 2A6KB 5HGBB 3NMEA 4GRWH 1NJ9A 1GAFL 1FGVL 3HMXA 2EICA 5H94B 5F7LB 1NGPL 3V52L 3V4PL 1D3CA 5FO9B 3GI9L 1AO7B 3STLB 1ITCA 3WN5C 4PJ7E 4GAYB 3WS6A 2XRAH 5A40E 4PJ7A 1JPTL 5JW3L 1YJDL 1I9RL 4GMTL 5DJ0A 2X4SA 3TYFA 4QWWC 3D69A 3DV4B 4XPFL 3BWAA 3IJHB 1WT5A 2DM7A 3FT3B 3BESR 4GG8B 3DWTA 5GJTH 3C6LC 2HLAA 4G42B 2VDOL 2VXVH 5F9OL 3RUGB 4WW1A 4PY7A 5B38B 1RZJH 5CZVH 1T6WA 4AZ8A 4JQIH 2C3HA 4P3CH 2VXTH 1CDCA 1M7IA 4MXVE 1R0AL 4W6XB 3O4LD 3BPCA 2YR3A 4TPRL 3DX8A 4M5ZH 3IJYB 3QG6B 5F89B 3IDJA 2X10A 2IQ9H 4Y2DB 5LGKA 4PJGB 1S8DB 2HVJB 4NC0B 4EUPA 5L6YH 4WRLA 5IJVA 4JVWA 3OXRA 3G5YA 5EO0A 1FBIH 4LIQL 2ZG2A 4X6FA 3P9WB 2E27H 5GS0D 3WIIL 2DQTH 5FUCC 2GTWA 4YHLL 4F9LC 5KS9B 5C0CE 2BDNH 5C0CA 1I3GL 5DGRA 1JRHI 5DRZB 2P5WB 4QXUL 5IB2B 2PXYD 4G9DB 4UZGA 5GISH 2A9NL 3ES6B 4Y16C 5J56B 43C9B 4LRIA 4FN0A 2D31B 4OQTH 4XCNB 5FYJE 1ZLSH 3UAJD 5J89A 4DEPC 5B39B 1CFBA 2VDNL 4NWTH 1KXQE 4K7PX 4NC2B 1DDHA 3DRQB 1UWGH 5DTFB 1RIHL 4P4KD 4LLUA 1YEFH 5E2JA 3GMNB 5JOEA 4U6XB 4KK6C 4S11A 3KPRE 3VFOB 4YHYC 1XF2B 3KPRA 4R0LB 4G43A 4WUUB 1K2DB 1GC1C 2H9GA 4FQ1H 2DQJL 3KPSB 4LAQL 4N5UA 5J8OA 3HS0A 4KQ4H 4XCFH 5HVWA 4XZUA 2B0SL 3CVHA 4G6FB 1PSKH 5C0GB 4UT9L 3ALWA 3B9EA 1I4FB 2UWEA 1U92A 2ESVD 3DO7A 4IHOA 3HC3H 5H37H 3U6RB 3EDDA 1MCOL 1AHWB 1A9EB 5D96B 4LAJH 4J8RB 1OCWH 4KKLC 1Q94A 1Q9KB 4YZFE 2WUBH 3MLXH 1BVLA 2AGJH 4PGEB 3HNTH 2A6IB 5KG9A 4R7DB 1S7XA 1TDQA 1SY6H 2Z0BA 1L9NA 3TA3C 3K1DA 2WV3A 1G7MB 1R5VB 4U1IA 2MSPA 5GGVY 3SOBL 2KZ1B 3BW9B 3O0RH 4UTAL 4I4WB 1RZJL 1YEGH 3MRCB 4RQQB 4PG9A 4YHNB 1OD7A 1FL3A 4Q97A 4JQIL 1XGQA 1RJYA 4NC1C 2EZ0C 4TTDD 4S1RL 2XN9D 5FDYA 4RAVB 5CILH 1NEUA 1EFQA 3GSNB 1N5AB 3FN9A 4PYHA 7CGTA 1DUZA 2GUOA 5EU5A 1LO2H 3WE6A 5HDOA 1SEBA 5ID1A 1RAMA 5F96H 4L8BB 5I17B 1OSZB 4QT5A 1X6LA 5L88L 2BDNL 4OD1H 3UJTH 1QUNA 5A43C 1EAJA 2AP2A 4IIQC 2FEEI 1CICA 1ND0B 1ZV5A 4HS8H 3BZEB 2DQCL 1YEDA 2QSVA 4JQVC 1I8IA 3N0PB 4OQTL 1MIML 5J13C 3OL2A 3ETBF 4TUOB 4O2EB 1UWEH 1C5BH 3P9MA 4G6JH 4NWTL 3MRDB 3SJVB 3QAZB 4LSRH 5CJOL 3LH2H 2ADGA 5FO8A 4NQDD 3VI4E 1UWGL 3KPTA 3BUYB 3CVIL 3OJMB 3FQWB 3CZFA 1I7TB 5HHVL 1YEFL 3I75B 1YEIH 2PXYB 4OFYA 3LN5A 5HHPA 2DQDH 3M1BB 4HUXA 4OCYL 3P4OB 2IQAB 3GKWH 5D7IB 5ICXA 2OSLB 3O11A 1P4IL 4ZPTA 5IMOB 2VR4A 1AGCA 3Q6FB 1HXYB 3SQOH 3RZCD 3E3QC 2YZ8A 2HVKA 2AXFA 3PXHA 4OM0H 4P4KB 2VXQH 5C9KA 4HIJA 5E5MA 4N0CD 5KSBE 2WP3O 3N50A 4JFXB 3SDCC 5J1AB 1G7IB 4DUWA 3PIQB 5ERWB 2ZSWA 1PX4A 1NCCL 2V2WB 5IB1B 2VDKL 3DVGB 3T2NH 3K4AA 5K9OA 2WUBL 2X5PA 3MLXL 1RPQA 5DK3A 3U0WL 4M48L 3HNTL 5F6IB 1ZSDA 4KU1A 4CVWA 2VDLH 2N56A 5F6HI 5I1GH 3DECA 4PGCB 4X4YB 1SY6L 3NFPA 2VABB 5C09E 3UTQA 1OTTD 5C09A 2H1PL 3LEXA 3ZKSD 3QIWA 4MMZC 4RWYL 3EYQD 3C8KB 3MGTB 1FAKT 3AAZA 3CMOH 5E00A 1ZTXL 4RISH 4G8FB 5DO2D 1VEMA 3RVTD 1BZ9A 2W91A 4NUGH 4NKDB 4GS7C 4UNVA 2QQKH 5C0IA 3U7WL 3AS0A 3CJJA 1JYWA 1PKOA 2V9RA 2R29L 4ODUB 3N1QC 3LZFH 4BZYA 1A4KA 2YMXH 3L3HB 3O81A 4H0HB 3HTLX 3UJIH 3TN0B 4PJEE 1FFRA 4PJEA 5DUBB 5I1AA 1MQ8A 4JLRB 1QSZA 5E2VH 2WINB 4LBEB 4XC1L 4V1DD 1OAZL 5EFIB 5EC1A 3CDGA 1ADQA 1HINL 2XN9B 3CCHA 2NY0D 4RFEA 1GGBL 2ZJSL 3WD5H 4KWUA 2Z93B 2FIKA 3OHXB 4XWGL 2FZ3B 4AIZB 5EO1A 3RI5K 2N7AA 4LLAA 1KIRB 3FQTA 1JV5B 1UWEL 3DVNB 3TH3T 2FJGA 3SDAD 1S9YB 3LH2L 4U2YA 1EEUA 2H32H 5DZOA 3QJHB 5E2WL 4EKXA 4H0IA 3Q2CA 2JE8A 1F3JA 3QFDA 2FHBA 2EEBA 5IIEB 2DQDL 3QUYD 3TO4D 2JB5H 1DR9A 3GIVA 2BVOA 5C0BE 3GKWL 4RA3A 3RVXC 4D3CH 5C0BA 2VTFA 4I3GA 3GUTB 1FYTE 4GUPB 4UOW1 1FYTA 3SQOL 2APFA 3QXTA 4I0PA 2P8LB 4OM0L 1KJ3H 1HDMA 2VXQL 1TVDA 3MJ9H 4F7CA 4TUKH 1ERNA 5BO1L 3W81A 2V2TB 1AR2A 1I1AA 4K8RH 5GGSY 4IMKA 5I66A 1RJCA 4PUBH 4HF5H 4O5LH 1OQOA 3PGCB 2EKJA 2OJEB 3D6GA 3RZCB 4UU9A 4ETQA 3ZSTA 3KS0J 4HIHB 3GMRB 1KTRL 1BF2A 2VDLL 4JDVB 3EZJB 3VD5A 3PGDB 1VDGA 5D7JD 3IU3A 4GRLC 3F7YB 3ZE2F 4POYA 1FLRL 3LMJH 3MOAH 4R97B 3P0YL 1KEGL 2FO4B 1F5WA 1LE5A 4CAGA 4RISL 1G1CA 2VLKA 2EIDA 2W9DH 3HE7A 5EUOE 1P4LB 5D2LF 5EUOA 1F11B 5IQ9B 1HE7A 3MRGA 5DXWA 1I3UA 4NUGL 1VSCA 3BISA 3GK8L 1Q38A 4R96B 3IJSA 3LZFL 2NY4D 4CADA 5C0FA 2DM4A 2YMXL 4LVHC 5LAXB 3KNBA 5DJ6A 1S5HA 3N9GH 1ZHKB 5EOQH 5FECA 1PLGL 5GRWA 2WWKO 4EXPX 4YDVA 2O26U 4PREB 2VE6A 4JG1H 4Y5XB 3WNMA 4GLRH 1P2CB 3O3UN 4J1UA 4MXQC 2NNAA 3TBYA 5L9DH 1FZJA 4MA1C 5GRYA 4YBLB 4GFTB 1KIQB 1A6ZB 3C6LB 3GMPB 3NFNA 4IRSB 3V5DA 5E8DH 1VPOL 3MODH 2ZUVA 4CVXB 2HT2D 3QWOA 1T89C 4PGZA 5T5NG 3W5MA 3MRLB 4XP9L 2HG5A 4EI5D 1G9NH 3PWLA 3RIAF 2NY0B 2P8MA 3ROLA 2Y6SC 1NAMB 3ZO0A 4K9EH 4G9FD 3TVMC 3ARFD 4KRNA 4MHHG 4QRRE 5H2BB 4GQ9L 4QRRA 1IC7L 3FOLB 3QUMA 5EIQA 3ZYZA 3MR9B 1WFNA 4GBXD 2B1HH 4KJPD 1J0KA 3AY4C 3O3AB 4TSCH 1Q9WA 5E08H 4Z7VF 3S36L 5I2IA 1RJLB 3U48A 1OWRM 1KJ3L 1AR1C 3LS4H 1KENL 5DJXB 3MJ9L 4FQJH 5GZND 3O45A 5DJ8B 4TUKL 3TZVC 3T0XA 5BVJA 4K8RL 1MY5A 4P57A 1J5OL 2QHLA 4EVNB 2Z31B 5IG7B 3RL1A 3VH8A 5JOPD 5TQ0L 4OZIA 2FR4A 3QO1B 2AXHA 5LGHH 5IFJB 5D7LD 5DT1H 4Y16B 3BZDA 4WTZG 4KGLA 5T5FL 4GRWF 4WV1B 1EEQA 1OP5K 4Q0XL 2EDYA 4H1LA 5IM7B 2RJMA 2B20A 2V6HA 3Q48A 2Q8AH 4V2CB 3MOAL 3L3IB 4NRXA 3F5WB 2X89A 1IM3B 3UROR 3FO0H 2UZXB 5CHNB 3T77A 3MV8B 2G2RA 5GS0H 1H3PH 4NN7B 5E4EB 3JWOH 1WAAE 2GAZA 2W9DL 1I7ZB 1WAAA 3ARDD 5C9JA 1A7NL 4P2OC 4RAUA 4Z0XB 5I8CA 5MENB 1U3ZA 2Q3AA 5F70A 5D7JB 1RUKH 3K4ZA 3HE6A 3DMMC 2VIRB 2BNRD 3EGSA 1NDMA 5TE4H 1QSFE 3EHBC 5GGQL 1QSFA 2HFEB 3EO0B 3RX8A 5L2JA 4FZ8H 2YA2A 2FGZA 4LLQB 1D9KB 3D25A 5L0QC 3AB0B 3HZYB 4JG0H 2J7LA 3N9GL 5EOQL 3NIGE 4HEPG 4UILH 4XPBH 5EUKB 2PTUA 4KVCH 2IWGA 5D7SH 1DBBL 2AJ3A 5HBBA 2DMCA 2A74A 1F8TH 3QZWA 5C0EB 3N1PC 3X11A 1EEZB 4NO3A 3B5HA 4LPYA 5KOMC 2IPKA 3VG9B 4PJAF 2W0LA 1CS6A 2XA3A 3QNYA 2ICWJ 3MREB 3MODL 5HD8D 5HYEA 4WI7A 1VGKA 3N85H 2FBJH 1YA5A 5I1DB 3SKOB 1YNLH 2ZOLA 4NP4H 3QXVA 4Y7MA 1JTPA 4N0RA 1NQBA 4K9EL 5EWIL 3BVNB 2Z35A 3GIZH 1BFSA 1QRNE 2I9TB 5J12C 1Z9SA 1QRNA 2O61B 5JOFA 3QZWG 2LV4A 1SBSL 3ULVD 1LQSR 1OT2A 4TSCL 4WUKL 4OLYH 4EOWH 5E08L 1T1XB 3V7MA 1DQQB 2JJSA 4EI5B 1LE9A 1NCDH 2X4TA 3LS4L 1JNLL 2OMNA 3ZYIA 4HWEH 3VXUD 1YPZE 1CT8B 4X6EA 5KZCB 4HG4K 2IPUG 1UKSA 4R4FH 4PP1C 3NAAH 3G9VA 1TQCC 4MA3A 1SQ2N 1IQWH 3RNQA 1VFUA 1T21B 4LHJB 5IHUH 5LGHL 5BV7B 1UB6B 4I5BB 5CSZA 3MNZA 3M07A 5I19L 1YNKH 5BZDA 1AIFA 3OGCB 2YD6A 4UTBH 4URTB 1CE1L 3GJFA 4KUZH 4YPJA 3MRJA 4M1CC 2V5RA 2EH8H 1A2YB 1QG3A 1CBVH 3PNWB 4X4ZA 3RNKA 3E6HA 1MCWW 1TITA 5GS0L 4UNTA 4PJXE 4S1DC 3JWOL 3JV4B 4J6RH 1UT9A 1VACA 5ACLA 5D7LB 3F12B 3P4LA 1H3XA 4FQHB 2VOTA 4JR9H 1LGVA 1QFHA 3BKMH 4XNXH 2IAMC 3R0NA 1DFBL 3HUJB 2JCCB 4JFDD 3AU1A 5TE4L 5D7KD 3MROB 5DRXB 1DL7H 5EU6B 4FZ8L 4V2BA 3IFNL 1U8HB 5AZ2L 1R3IH 1EERB 2I5YL 3VXRD 4PD4J 4HC1L 4UILL 2J6EL 4MQXC 4XPBL 4OJFL 4KJWC 2R1XA 3QCVH 4P2RD 5F9JB 5F7WC 4OLUH 3SKNA 4MJ6B 2VITB 2P7TA 5B8CB 1DVFC 1DE4B 1M7DB 3VXQA 1F8TL 4P2QE 3SO3B 4P2QA 1IGTA 1RY7B 5IEKB 2GJZB 3LDBC 1DTUA 5DJ2B 3ZTJG 4NFDA 1BBJA 3MRNB 1A1NB 1W0VA 5AYQA 3KLHC 3D0VA 3S5LG 5TJWK 3SBWA 4QTIH 1OP5H 1JMZA 1EBPA 3HRZA 3N85L 4JM4H 5ALBH 4PTTA 1WZMA 1KFAH 3BIKB 4YDLB 3MC0A 1UEYA 3VXNA 1QSEB 4HWBL 4UOJA 4XPHL 3RIFF 1NMCC 2VZ3A 3A6CH 1YNTB 4XVTH 2XA8L 3H7LA 1CGUA 1HSAA 2NY3D 3GJEA 1FFPA 1KB5A 4Y5VC 5D5ME 5D5MA 1M7XA 4EI6B 2DS4A 1HKLH 1WWBX 3CFBB 3D48R 2IPUK 4PRPD 4JPIB 3BPLB 3P30L 3BKCL 4L4JA 4PJBE 1U8QA 4KUCF 4DKEH 4PJBA 2A38A 2E6JA 1MNUL 4JHZA 2H2PC 2KL6A 4OF7A 1DUYB 2RCSH 3ARBD 3T1FB 5HI5D 2ITCB 2R2EB 1MHEA 3PHOB 1RURL 4HFUL 4LMQI 4PJ8C 5HDQL 4OZFA 1FNEA 4NBYB 5ALCH 3L6FA 3U46A 5D72L 4YHKH 3CFCH 1P53A 3BMWA 3IDIB 3ARXA 4NGHL 5GS2D 1CE6B 2J88H 3WFHB 5D1XC 1FL6B 1GHFL 1E28A 1HWHB 4Y4KC 5KVFH 1I8LC 2ADIA 3VXUB 4KUZL 4MS8D 1JL8A 2OR7A 4NRYB 2VLME 2EH8L 1J1PL 4F3FA 2NZ9C 2R56H 5IK3A 3EO1B 3RPIA 3SHSA 5ISZE 5E6IA 5ISZA 3S36X 5HI3C 1AGFB 5IMKA 2MNUA 2RHEA 2RGSA 3ZHLA 1X5FA 4JPVL 3S9DB 2DJSA 4OD3H 2DL9A 4XNXL 5EOCJ 1XIWB 2BXZA 3AREC 1NLDH 3MLTA 4X4XA 2EYSB 3T09A 3O9WC 4YDKL 5B3JF 3QIUC 1I3RB 4DVBA 2QKIA 4U1HA 3D9AH 4LU5H 2A0LD 1G9NC 5EU4B 1A7RL 2UYLB 3DX9A 4P2CG 2NX5B 1MVUB 1IZJA 5DSCB 1NGXB 3JTTB 3WJLA 1EEYB 1NC4D 4ZXBC 2SEBB 3WO3B 1KJ2A 4HJGB 3MFGB 5HHQB 3D0LB 2ZUQB 3DURA 1U8PB 3SGEH 1YEHL 3GSRA 4C56D 4JFZH 3FT2B 5I30H 1RK0A 1MAKA 3UTZB 3GNMH 2EXYD 3CNKA 3JV6B 3MCG1 4LSPH 4HUMB 1IGJB 4KQ3L 3RTQB 3VXRB 3VXOB 4P2RB 1IFHL 4JM4L 1CZ8H 4X9GA 4Y4HD 1KFAL 3P9LA 4UIMB 4AH2A 4ZOEA 1M1SA 3X3FH 1HH9B 3IYLW 4NN5B 2BOBB 4XVTL 4OD2A 2ATPB 3MUHL 3FHQA 4O4YH 2YD2A 5JO5B 4J3VA 4OLXL 5T1LD 2CLVB 1D6EB 1KT2A 15C8H 3JWOC 1FNAA 2GIYA 1OM3H 5SWZD 4JHBA 3VFTB 1ED3A 2YUZA 2RCSL 2K7PA 2NY3B 4H88L 4Z7NE 4NO5A 1G7PB 3IDNB 1ETZA 3GSOA 5TPWH 4LNVA 3W9DB 4M7JH 4U1MB 3GGWB 4PRPB 1HQRA 2CLRA 3LPWA 3UAJC 2BY0A 2YRZA 4YAQB 4HJJH 3CFCL 1WBXA 3OMZA 2ED9A 2WP3T 2FH6A 3MLUH 4ZD3H 2J88L 3DX7B 2XG4A 1QLRB 1BZ7A 2Y5TA 4UDUA 4X5WB 3IXTA 4TULL 5IB4B 2I07B 3V0VA 4PRHE 2R9HC 4Y8AA 4OKVB 1TETL 3GSVA 4PRHA 2MOVA 5EOTB 4M00A 3LPGA 2BERA 4CW1B 3TCLA 4P9HL 4K3DH 4OCNC 2AV7B 1UA6H 4NZJA 1PG7L 2AQ1A 5F71A 2IGFH 3RY6A 3T1WA 4Z7UE 4AL8L 4Z7UA 2DWEB 4Z76B 1N3NB 2GK0B 2Y5EA 5HHMB 1NAML 3CFDA 4AEEA 1NLDL 2HFGH 2I25N 4ZS7L 1INDH 1UM5H 2AEWA 4RGND 4TQEH 4G80A 4QYOA 3C60A 1JPFB 2AABH 5FB8B 1GZPB 3K8KA 4ETYA 1IKFH 4QO1A 3ULUD 3TZVB 2UVFA 2ZG1A 3JZ7A 3DNKA 2V9QA 2DI7A 5DD0H 5CBEB 2L7JA 4JFZL 4M61A 1QR4A 2WK2A 3OKEA 4U3CA 5E99L 3WCYA 4MAUL 5M94B 2DBLL 2OS7A 3TP4A 4JFFD 1VFAA 3GNML 3O2WH 5IW1B 3MTRA 4YPGA 4XXDB 4LSPL 3MJ7B 3FRUA 2UY6A 1XGUA 2JK5A 3P11H 4XP1H 4FQXC 1T83A 1CXEA 3HZKB 3STZB 3H9HB 1WFTA 5DYOB 3LD8B 4C56B 4GW1B 3FQRA 4AMKH 1LK3H 5FA4A 3HC4L 4WCYH 1I85A 4TTDC 4LCUA 3X14A 3V79C 4PJHF 4DCQB 1S7WB 4O2CA 1XGPA 3MRQA 1A5FL 1N6QH 4RIRB 3TT3H 2CR3A 4PJFE 2ZUWA 15C8L 2YEZB 3LV3A 1F02I 3QG7H 4PJFA 3F58H 5EIIA 5L0QB 5C08E 2APVA 4GXUM 5C08A 4A6YB 1OM3L 3ORJA 1T3FA 4TSAL 5FOBB 2DQHH 3BQUA 3E1F1 5FKAB 4D9RE 3T3PF 1CCZA 3PDDA 3B2VH 5TPWL 3ZTJH 1OARH 4HUKB 1ZGLA 4PS4L 1NFDB 1OPGH 3WXVH 1H15A 3NIFE 2D7MA 4UINL 1SVZA 4Q6IA 1A7OL 3GHBH 2EIEA 1HEZB 2IG2H 4WHCA 2V5MA 5C0CD 4YX2H 4Q2ZB 3BDYH 3WFZA 5EPMB 3FONB 2F54B 1RHHA 1HSBB 5F9WB 1H5BB 4NQTA 4WW2C 5I73B 1MHCA 2VL5A 3QI9A 1AH1A 4KKBD 1FNSL 3C5JA 2EDOA 1JN6A 5F1SA 5T33H 3KYNB 4N0CC 5I1EL 4OCWH 3GBNL 4I18A 4Y4FA 4BH8B 3DLQR 2CK2A 3FMGH 3QDGD 1PG7W 1HQ4A 1FCGA 3VXMD 3MRFA 3T3ME 4YDIH 3KPRD 3WNOA 5BOZG 5DUPL 2CSPA 1V7NH 4Q9BA 3MXVH 3NABH 5DJCB 5CEYA 1VEOA 2QEJA 1TZGL 3EO9H 3OX8A 2BCKA 5AWNH 4RGNB 3L3OB 3VFGH 3OJ2C 4MDJA 4YHZL 1V3KA 1OSPL 1RZ7L 1OTTC 1Y6KR 3GZKA 1S7QA 3HE7C 4N1CA 4XTRD 3EYQC 3P11L 4XP1L 5BV7L 4M1GL 3IFOB 3MRIB 5GGUB 1WUNT 2CPCA 2R15A 1ZWIA 2G9HB 5CINL 1Y0LB 3BZ4A 1QYGH 2DQIL 4X7DC 1I9EA 4LASH 1B4JH 5E8OA 4AG4H 5J6HA 4YFEA 1NGWA 3BEWA 4AQ1B 1RIUL 4U0QB 4TN9A 2X4NB 4ZTPH 4JHWL 5EZIL 2A6DA 3AFLA 4DN3H 4EJ1C 4OB5H 3TT3L 5L7XL 4PJ7B 3AS1A 1MFCL 5D93C 4NT6A 3F58L 3P2TA 1KCKA 5DJ0B 2DD8H 2X4SB 5D71L 3TYFB 3D69B 4JRXE 5EG6C 3BWAB 3VGFA 4IMLA 4JRXA 4HMDA 5DJDA 1BM3L 3JVGC 4P3DA 2HLAB 5KSUA 4HXBL 3E2HC 4KRPB 3NH7H 4WW1B 4L1DA 4PY7B 3FQXA 4NQCD 5HYFA 1OAQH 5I8EA 3V6OE 2F9BT 1OPGL 3V6OA 3QWRD 3WXVL 4M9PA 2ZUSA 3IKCB 4JFHD 5TH2A 3W5NA 1M7IB 1QLEH 3KYAA 5K33A 4N8VA 3BPCB 3SDAC 3HC0A 2L7UA 3DX8B 4KKCC 4WNQA 3IDJB 2IG2L 1BVKA 3CUPB 3MXWL 4GQPH 4KMQA 2R1YA 1GH7A 1Q1JH 2XTJE 4EUPB 1N4XL 3QUYC 3BDYL 5IJVB 3TO4C 1IGCL 2X1WL 1MJUL 3OXRB 4X6CF 3G5YB 5EO0B 1EXUA 4X6FB 3ZE1E 4W6YB 1SJXA 2GTWB 2HA1A 3EYUH 5CJXC 4J4PD 3SN6N 5C0CB 3E8UL 3L3GA 5FCSH 4OCWL 4Z78A 4N8VG 2Y25A 5GRJL 4E9LA 1GOHA 2BX5A 3VW3L 4R4ND 2MCPH 1MCKA 1Z0NA 5KVEH 1AXSA 4H25A 4WEUD 4YDIL 1IM9D 1PZ5A 5I0DA 3RDTA 4BFIA 5F1IA 5JR1H 5HVGB 1DDHB 1WEJH 3S37H 1FZKA 4LLUB 5F7HA 4IOIA 4NZRL 1PG7X 1MFAL 5FYKE 3ULVL 2O5YL 2ZWLT 3MYJA 5DHYA 3KPRB 4G43B 4W4OA 1J1OH 3IS0X 3HS0B 4ONGL 3HE6C 4XZUB 3CVHB 1DZBA 3ARGD 5E6ZA 1CXFA 5MP6L 4WW2F 4LVNC 2UWEB 1U92B 3DO7B 5AYUH 4JM2D 4IHOB 5FOJA 4FG6C 4AG4L 1HNGA 1KF9B 1MFBL 5JQ6H 2Q8BL 4JN1H 1FSKC 1F90L 4ZTPL 3MLVL 4NKMA 5GQBA 5GS2H 4DN3L 3MNWA 1Q94B 3UTTE 5JA8B 2JJVA 3UTTA 4KI1A 1BVLB 3SGJC 1BQSA 4RZCA 4W6WB 2DD8L 3QCTH 5IBTH 5KG9B 3VDBA 1S7XB 3PV6A 3DYOA 4XCCL 3PP4L 1SYVA 3VFNA 2IADA 4YBQD 1GPOH 1ZANH 4OUUA 3LQMA 2I26N 2LTQB 5JHDD 4U1IB 3WLWD 5DA4A 5AG8A 2DB8A 4NOFA 1V7MH 4F8QA 1OAQL 2VQUA 1PDKA 4PG9B 4RAHA 1FL3B 1TTUA 1XGQB 1RJYB 4NWUL 3H9ZA 3HAEH 5HVHC 4ZO9A 4ZFGH 5HYIA 4OLZH 5EZJA 1FL5A 2HKFL 1OVZA 2ZPKH 3ZDXF 2VUOA 4OLEA 1NCAH 3ARFC 4G3YH 2GUOB 5EU5B 3WE6B 4GBXC 4M43L 5T5NF 1SEBB 4HCRA 4KJPC 5CBAA 1BPVA 4MHHI 5ID1B 4YBHA 4WFED 1FN4A 2FYYA 3U4BH 4QT5B 2EO1A 4RMTA 4BELD 3S96A 5K93A 5FA3A 3O6FA 4ZFFA 1KN4H 2AQ2A 2GJ6E 5GZNC 2XACC 1BQHA 2GJ6A 3C5ZA 3I6KA 1CICB 2ZUTA 2XNAA 5H35A 2E8ZA 5LXGH 1YEDB 1S7SA 5KVEL 5E2TH 1I8IB 2BVQA 4KHTH 5FYLL 2ICWA 2LU3A 1U3HA 3P9MB 4J12A 4AYFA 2F19H 2VAJA 3QPXL 5IFHL 2ADGB 2CGRH 4P0DA 3HHRB 5FO8B 1TNMA 3S37L 5KSAA 2OP4H 3CZFB 2FJHA 1U95A 5HHPB 3LN5B 5DQDH 4R2GD 1DANT 1R24A 4HUXB 5F72S 3ZT7A 1CL7H 1I1AD 2X4QA 2AJXL 3HZVA 1O7VA 3QEHA 3O11B 4P46A 1YQ2A 4ZPTB 1BEYH 5ICXB 4EQ3A 4F7TA 4YJZL 1L0XA 1AGCB 1Z5LA 3SE3A 1OAYH 1MHHA 3MRBA 2DYPD 2HVKB 1U8IA 2AXFB 4D9QE 1WWCA 3C9NA 4NBZB 4HIJB 5E5MB 3HNVL 5AYUL 1XT5A 4IDJL 2R1WA 5JQ6L 2ZSWB 4JN1L 4W70A 5C07E 4BM7A 5BCAA 3FFCD 5C07A 4HMEA 4OCRH 4XB8A 3OKYA 4QRUA 5K9OB 2AVGA 2VLKD 1AC6A 1ZSDB 3FO1A 3W11C 2OZ4H 1P4BL 1GPOL 2CKNA 3NFPB 3QJFA 5J6GA 3UTQB 1W0YT 3FRPA 5IGXH 5C09B 3LEXB 5JUEH 4XNQA 1KC5L 5T3XE 12E8L 1UH3A 3QIWB 4B7IA 2WBJD 4WEMB 3AAZB 4ZTOH 5E00B 4TNWK 2R23A 4JO3L 2GJJA 4U1SA 4G5ZL 4LSVL 4XAWH 5GGRY 1BZ9B 4ZAKD 2YUWA 4Y1AE 4ZFGL 1J8KA 4Y1AA 5C0IB 1DBAL 4AEHH 1WFOA 4ENED 3LRGA 3ZL4L 1A4KB 1AQDA 4H5SA 4YE4H 3D18A 1OP3K 5DEZA 1CIDA 2FB4H 4G3YL 4H26A 3LQAH 4PJEB 5I1AB 3U36A 3BEVA 3LQZA 2EIBA 4F9PA 1ZAGA 5K9JL 2N7BA 3VGDA 1MHPH 3W0WA 3ZE0F 5EC1B 3CDGB 4CBPA 4J2XA 1IE5A 5ICZA 1TQBB 3ECBA 1KN4L 3CCHB 4RFEB 2X4UA 4M93B 4LPTA 5DLML 2FIKB 2O5XL 5LXGL 2R69H 3ABZA 3B9KA 2B5IB 4LRNH 1EHLH 5CP7A 1JWUA 5EO1B 1IL1A 3DX6A 4KTDH 3ILQD 3FQTB 5CLTA 5TE6H 4X5LA 2D03L 3UBXG 1SHMA 2FJGB 1NANI 4AEFA 2H3NA 1CTOA 2OP4L 4I1NB 1F3JB 2XYCA 1DQJA 3QFDB 4O02L 2W9LA 1HKFA 3WUZA 1ZVHA 1RULL 1SMOA 2F5AH 4YUEH 3GIVB 2BVOB 3P73A 4L5FH 4QKXB 3PWPD 5KW9L 5CD3A 5C0BB 1BEYL 1QA9A 1P84J 5D1QA 1FYTB 4G8GE 5LVEA 2R0LH 4KRLB 4G8GA 1ZS8A 2NY5L 5GSRA 1K9TA 4FFZL 4WWKC 2QADD 4PJCF 5D6CA 4I0PB 3H3PL 1HDMB 3TBSA 4PJDE 4F7CB 4HULB 3QUZC 4IRZH 4PJDA 5JW4Q 1I1AB 5I66B 3HI5L 3PE9A 3BD5A 3PWUA 3VD3A 3UMTA 1FC1A 1L6ZA 4UU9B 5I15H 4ETQB 2VQ1A 3RX7A 4LL9A 3WIHH 3IU3B 1RHFA 5IGXL 5EBWA 4OLVH 3HI1A 5JUEL 3ALXA 5DMYA 1GGTA 1LE5B 2NY1C 5CEXA 2VZ1A 4J3WA 4ZTOL 3WXWH 1KGCE 2VLKB 3HE7B 4C54A 5EUOB 1WLHA 1T5WA 3MRGB 2BJMH 1FGNH 4X7FC 1NDGA 3BYTA 2GW5A 1KEMH 3CDCA 4PJ5E 3IU4H 3B3IA 4PJ5A 5AAMA 2X7LA 4OZHF 5MI0B 1FDLH 1OL0A 5D2NE 3IJSB 5D2NA 3ULUL 4CADB 5C0FB 4L8SA 4HIEA 4YE4L 4YK4C 3HR5A 5DFVC 4K55A 3KNBB 2J8HA 3GHEH 3LQAL 5DJ6B 1S5HB 5LJYH 5FECB 2P48B 4B50A 4YDVB 4XAKD 2VE6B 3D87B 1RJZA 1Z3GH 4J1UB 1NL0L 2NNAB 4XMPL 3NTCH 2YK1H 5D9SA 3QDAA 4I3RL 4YQXH 4ZPVA 3TBYB 4D2NA 1FZJB 4FFWC 2R69L 4Q9RH 4ODWA 4LRNL 2JLLA 3NFNB 1QRND 1VESA 1C5DA 3V5DB 4KTDL 1T0MA 4RGOH 1QEWA 3QUKA 4PG2C 3S3SA 1ZK9A 3QWOB 4YFLI 3CMGA 1HNFA 2HG5B 1CDJA 2O5ZL 2JJWA 3PWLB 2P8MB 2OQJA 3ROLB 3RU8H 5C86A 4YFLF 2ZCLL 1ZLUH 5DRWA 3Q0HA 4MA8H 4QRRB 1I8KA 1NMAH 4YUEL 5A3IC 3IRZA 3QUMB 4JO4H 4QHUA 3JXAA 4F37K 5DRNA 5GS1A 4YIQA 4PJ9A 3ARPA 8CGTA 4NOBA 1Q9WB 2R0LL 1MCBA 4F8TA 2E6QA 5CJ8A 3SKUD 5I2IB 3F65A 4KK5C 1AY1H 1OP3H 1FIGL 1UGNA 1ZA6A 1DLHA 3O45B 1D5XA 3L5WA 1A0QL 4YXHH 1U8MA 5BVJB 3O2DA 3LKQA 4P57B 1BQUA 2A0LC 4HFWA 1NSNH 3RL1B 3VH8B 1EGJA 4OZIB 5BRZD 1BOGA 5C2BH 2FR4B 4KTEH 4HT1H 2B4CH 5I15L 1IGFH 3EYFA 2X05A 5GZOD 4RFNB 4H1LB 4MAYD 4H8WH 2EXYC 1X5GA 4G7YH 3U30B 3OR7A 3QNZA 5E8EA 4NRXB 1KCUH 3GMOA 4RMQA 3T77B 4OI8A 2G2RB 4WI2A 1DQDH 2GAZB 4CVUA 1LHZA 4LSQH 5C9JB 2PO6A 3TJHD 1JGDA 3AROA 1WIOA 2BJML 4RAUB 1E0OB 4Y4HC 4OF6A 1CG9A 5I8CB 4O58H 4KC3B 3HE6B 3BHBA 1UZ8A 3EGSB 1NDMB 4TOYL 1FDLL 1MAMH 1QSFB 4HKJA 4OM1L 3SDXE 5L2JB 3SDXA 4M7LH 5HI4C 3D25B 1OW0A 4HPYL 1XCTA 2D0HA 4U7MA 4KHXH 1EBAA 2VZUA 1TVHA 2QQNL 1J05A 1YYMH 4U6HA 4XPTH 4KV5E 1FNLA 1EVTC 1Z3GL 3SGDH 2AJ3B 4JKKA 2A74B 3NTCL 3NBNA 3QZWB 5F7DA 3X11B 4Z7OF 4NO3B 2AK4E 2IPKB 3BH9A 2AK4A 4QRPE 4J7RA 4QRPA 3QNYB 2J1KA 4BFBD 5KVDH 1E27A 1VGKB 3P4NA 2ZOLB 5HGHA 4NHCH 2X44D 1IAKA 1MVFA 5DWUH 4BZ2H 1SMAA 3CLFH 3RU8L 4ESKA 1YYLH 5JPMA 4I0KA 4XVSH 2VLJE 2VLJA 4MA8L 1MH5A 4LGSB 1I1YA 4XH2A 1QRNB 5JOFB 3P40A 3CX5J 5D1ZA 5DJZA 3H42H 1IGYA 1QVOB 4J3OC 5DC9B 4LPCA 1LE9B 1AY1L 5E1AA 2X4TB 3MOBH 2BVEA 4YXHL 3G5XA 4X6EB 3V8CA 3MMEA 4K07A 5F9DC 1R3HB 4HIXH 1NSNL 1MCRA 4U05A 3RHWF 4MA3B 4K3HA 3RNQB 4WTXA 1G84A 4KTEL 4YGAB 4HT1L 3B2UD 2VAAA 3LQAC 2OLDA 1IGFL 5HHXL 5CSZB 3MNZB 1Q0XH 4DJMA 5BZDB 1AIFB 5AG9A 3MJGX 3GJFB 3MRJB 1YN6A 5FUOL 4NQSA 3NZHH 2CUHA 3RNKB 3E6HB 1DQDL 1VACB 2AJUH 2N4IA 4LSQL 4EXKA 5BJTA 4UMGA 4OBRA 4L9LA 1QD0A 4NO0D 1SJHA 1HCVA 1HZHL 3AU1B 3DETD 1YMMD 1BJMA 5DUML 1MAML 5JXED 3TPKA 2V17H 4DTGL 4Y5YA 1IAOA 4M7LL 4D0BA 2ERJC 3H7BA 4JFEE 3JTSA 4JFEA 1J1XH 4TVPH 4UAOB 3D2UA 2R1XB 4PRIE 2WQRA 4BQBA 3C2AH 4PRIA 3SKNB 3MUZ1 2P7TB 3LIZL 1JGLH 3VXQB 3GO1H 5J9PA 4NFBA 4OIBA 2F5BH 3CZJA 2WWMC 4OLWH 3ZDYE 4P2QB 1VCAA 1T2QH 1IGTB 3PABA 5FYJU 1QP1A 3IGAA 4A2LA 4OCLC 3VFSA 3TEUA 4GSDH 5T1KA 1BBJB 1W0VB 2XWTA 3D0VB 4JHAL 1F6AA 3V6FA 3HRZB 1FO0H 3CSPA 3VGHA 4PTTB 3V7AE 4KK8D 1QRKA 2V7NA 2XKSA 3VXNB 4HS3A 1KB9J 4YGVA 2XQYG 5IROA 1NMBL 4NHUA 3GJEB 1HSAB 1FFPB 1KB5B 4MD4A 5CP3H 5BOPA 4ZFOA 5D5MB 2Y1VA 1FVDA 1K8IA 5EZLA 1W72A 2EC9U 2JKXA 1RMFL 1JCKA 4NJAH 3H42L 3MV9E 1U8QB 3L9RA 3MV9A 4PJBB 5GRVK 3CU1A 3NA9H 2UZYB 3RA7L 2AKRA 5T3ZD 1FC2D 4G6AD 2AV1A 1A9BA 3HKFA 2W92A 2PCPA 3QWQB 3BFOA 2IBBA 3OG4B 1MHEB 2R4RL 4OZFB 1FNEB 4OCXH 5T1MA 1BFVH 2ZSVA 3KVQA 3L6FB 3U46B 1CU4L 1FPTH 4WGWB 5M7QA 1CFQA 1ADQL 5IVXE 3VMPA 5IVXA 2MJWA 1Q0XL 1E28B 4YFDB 1I1FA 1INEL 4KAQL 1S78C 2ADIB 5FIEA 3TGXA 5KVMC 3KXFD 1J8HE 4NQEE 4POZD 1J8HA 4F3FB 3Q5TA 4NQEA 2V7HA 5IK3B 5IESH 3C60D 4RX4D 3RPIB 5CD5D 4L8CA 1HHKA 4DN4L 3G5ZA 5E6IB 5ISZB 4DZ8A 3MUGA 2AJUL 5IMKB 5C70A 3F7RA 4K3EH 4HKZA 3AGVA 1MRFL 1OT1A 4P59L 1JF5A 2B1AL 4R90H 5GGVL 4AQOA 1QKZH 1MUJA 4ZG1A 1S7TA 4X4XB 3BJLA 4DVBB 1FCCA 2QKIB 3FO2A 4U1HB 4U3XA 3RZWA 1ZOXA 2Z8WC 5C6TL 3GRWA 4MYWB 2BY2A 1HN1A 1UCBL 3NCEB 3LRHA 1K6QH 5FDWA 1KJ2B 5SWSD 2EDDA 3C2AL 3DURB 3T0ED 3QFJD 3GSRB 1UM4H 2DMKA 1UACH 1JGLL 1RK0B 3ULUF 3SE4C 3GO1L 2FHFA 4UV4H 4ZUSA 2PETA 4LARH 1IBGH 2HH0H 1AKJA 3MJ8A 5I71B 1YN7A 1NC2A 2XQYK 1K4CA 1EIBA 1JGEA 2WLZA 4MA7L 3GBLA 5INCA 5F8RC 3MLSL 3P9LB 4AH2B 1BQLL 1J87A 5C08D 2B4CC 3BQUD 2DQEL 1INQA 1E4WL 2EKSA 4OD2B 5DZLA 4H8WC 2NY7L 4LLWA 2NY6D 1IAIH 3MLWH 3QUXA 5J11B 2EH7L 2C1OA 4NJAL 4AEIL 1KCSH 1KT2B 1EHXA 1FG2A 1F13A 4HGWA 1KG0A 3RGVA 5K9KA 3DTXB 2EXWD 1KLFA 4J4PC 4XVJL 1ED3B 1CLYH 2CXKA 3BP7A 4NO5B 5TE7H 1ETZB 4K2UH 3GSOB 4R4NC 5DZNA 1S7RA 1BFVL 4OI9A 2YS4A 1HQRB 2CLRB 1NGQH 1JGUH 3QI9D 1WBXB 1FNHA 5C0DA 2DQFA 4UDUB 2DM3A 2Y5TB 1QFWL 4P23A 3IXTB 3O8XD 3B9AA 1P9MA 3KYKL 4K3GA 3V0VB 3GSVB 4PRHB 4P46C 5IEHA 3T2QA 3WFEH 3T8XA 3DSNA 4Y4FD 3TCLB 3OAUH 2VQTA 2RR3A 2VZSA 4JPKH 1H9VA 4MVBD 1P6AB 1UWXK 2MMXA 1F2QA 3GM8A 5I1HH 5D6DC 5CZKA 1B6DA 4K3EL 3QEQE 3WHE1 5HYJE 3QEQA 5HYJA 3MCLH 3CFDB 1T03H 4M7LT 1QKZL 4LK4A 3VWJA 2NZIA 2CRMA 3BIBX 3SE9H 3OPZL 5HDBF 4G80B 4QYOB 5AZEH 4QOKE 3C60B 3QUML 5J4MA 3F62A 4A2MA 4QOKA 4R3SA 2NYYD 4P5TA 1WSST 1AFVH 3RRQA 1K6QL 1X4XA 4TSBH 4YHMH 1NBVH 3O3BA 1U42A 4M61B 3SCMC 3OKEB 1XF3A 2QQQA 5I0ZA 3U1SH 3IAGC 1CDIA 1VFAB 2Q7YA 4YBQC 5DMGC 1MY7A 2AK1L 3GDBA 4LARL 5HY9A 2Q6WA 4YPGB 4DGIH 4WI9A 4JO1H 3NIDF 4HEME 1IBGL 3DYMA 3FRUB 4UIKH 4NZTH 4FQPA 1XGUB 2IBGA 2JK5B 3KYOA 1DBJH 2BNQE 2UWEF 4OKDA 4LKXA 5CFHA 5DJYA 5JNYA 3FQRB 5FA4B 1CGXA 1JFQH 4ONFH 2Y07H 4LCUB 3L95A 5E03A 4BK5A 3X14B 4M1DL 1Z6JT 4O2CB 1XGPB 3STBA 5A2JH 3MRQB 3I9GL 3LKOA 5CCKH 1IAIL 3MLWL 4WHYH 5DVMA 3WDJA 1MAJA 5FKPA 3THML 1TCRA 3LV3B 4PJFB 4QRSA 5EIIB 5C08B 3MBXH 1CVSC 3FAXA 1D6VH 1T3FB 5JIKA 4CDGC 3BQUB 4TNWF 1FHGA 5CIPA 1CLYL 2PKDA 1LO0H 1UADC 1HHIA 4D94A 4K2UL 4FTVD 3WN5A 2OCFD 1MEXH 1ZGLB 1T2JA 2FX9H 1NGQL 1VGEL 1XGYH 2DLTA 1H15B 3CDYA 2OL3A 1G9MH 1RZIA 1EAPA 1WBZA 3O4OC 4Q6IB 4MB5A 5CEZE 1Z9OA 3MLZH 1DSFH 2OXHA 4R2GC 3OAUL 3AM8A 4NIKB 3WFBH 2VDPH 3T08A 1RHHB 35C8H 1NBZA 5JIPA 5I1HL 2UUDK 1MHCB 2VL5B 3QI9B 4WFHD 1Q72L 3EOBA 1Y18A 4ELKA 1E4XH 4LCCC 3PL6D 3TV3L 3O8XB 4J3UA 3C5JB 5JW5A 4BSVA 1JNHA 1BGXH 1JN6B 1ZXQA 2R39A 2W9EH 2B8OT 1U9KA 4RDQG 3SE9L 4I18B 4Y4FB 5AZEL 4X8JA 5ANME 2X70A 3CSGA 5ANMA 4YHOH 4YXLL 5HYSA 2OI9C 3FOMB 4U31A 1HQ4B 1AXTL 2E7LC 3MRFB 2LE9A 2J5LB 2F74B 5FUCE 1IJ9A 3BSZH 4NM4L 3VWKC 4TSBL 2LVEA 5CEYB 3H3BC 4F9LA 4ZODA 5DHVA 4C57C 2CLZA 3OAYH 1GGCH 3DSFH 3OX8B 3IDYB 2BCKB 3T65A 5E9DE 1BBDH 3MFFA 5C0RH 5E9DA 4Z7WA 2Y72A 1JWMA 4MDJB 5GJSL 2G75A 4L4TD 5GRUH 1KN2H 5BZWA 1S7QB 2Y7QA 3TFKD 3L3DA 3MSPA 3LEYH 1ZLVK 3QXWA 2XKUA 3ZKMD 1DBJL 1O5DT 3G6JF 1EK3A 1F3RB 5DA0B 5EN2A 5HYSG 5FGCE 4ZAKC 3CXDL 4UB0H 1ZWIB 5BS0E 5EBGA 1K3IA 3BZ4B 5BS0A 3HMWH 2YA0A 4G8EA 1UWXH 4OGXH 5D70H 5E8OB 2YXFA 1T0NA 1NGWB 3BEWB 4BKLA 1P1ZA 1FIEA 2A6DB 5A1AA 1NUDA 4JM2F 5I74C 4NYLA 4JZOA 4NT6B 3VGGA 2V5TA 3G08A 3BPNC 1D6VL 4IMLB 4JRXB 5DJDB 3VRJA 4LVEA 3B6SA 4P3DB 5IBLD 1LO0L 3BKJL 5KSUB 3L5XL 5FO7A 4U6YA 4ZYKA 4LLVA 4R8WL 3FQXB 4JQXC 2FEDC 2J8UF 4X83A 5I8EB 3ILQC 5H8DA 3VXSE 5TH2B 1PAMA 3VXSA 2E9IA 1G9ML 4N8VB 3QXAA 3HC0B 3NFSH 3TA3A 4WNQB 4D9LH 1BVKB 4PJ9C 1DSFL 4ZDHA 2R1YB 1GOFA 3TH4T 1WICA 4I48A 1XR8A 2XTJB 3QIBA 4ZS6D 2O93L 1FQ9C 4NC1E 1EXUB 3RAJH 3EYSL 2F15A 4POUB 1KUMA 5DQJA 1U58A 2WAHA 4YXKH 3CH1A 2QADC 2OR8A 4M7KL 3L3GB 2YPVH 5KSAD 1KB5L 1WWAX 4F15C 3QYCA 4LHUD 4RRPA 1LEIA 4NQVA 4YDJA 2IALA 3EFDH 5HSFA 1AXSB 4X4ME 4H25B 1MIEH 2HFFA 4UBDD 4X4MA 2ZNWA 1PZ5B 3V6BR 3RDTB 3WS3A 1X7QA 4BFIB 4XMLL 5F1IB 3DPBA 4F37F 1GGCL 5IOPA 1KXTB 4U0RB 4IIQA 5GGTA 2XZCL 2EO9A 4IOIB 5GRUL 1KN2L 1EV2E 4HPOH 4JQVA 1U8NA 4QY8A 3H9SE 3ZE2E 3MYJB 3LEYL 3H9SA 1FRGL 5DHYB 4L4VE 4L4VA 2Q3ZA 2DIBA 2ICEA 5CZXD 4Y8DC 5DFTA 3WIFA 1AGBA 5D2LE 1F42A 1FFQA 4RMWA 5D2LA 1RUPL 3HMWL 3LHPH 5DMIH 1LO3H 2BRRH 1WZLA 2VZVA 2EDKA 5ID0A 3MGOA 3NCMA 5T3XD 4NKMB 1GJIA 5DDHA 5LGJA 3E3QE 3MNWB 5EO9A 1T1YA 4XWOC 1DLFH 3UTTB 4LP5A 4FMKA 1S7UA 4RZCB 2VNCA 3DBXA 4ODXA 1DANU 3U79A 1S5IH 5FGRA 2DICA 4HWZA 3PV6B 4F57H 1SYVB 3VFNB 2QBWA 3SDCA 1MWAH 4Y1AD 2IADB 5JA9A 4OUUB 2OR9L 3PWVA 2CO7B 1NLBL 3MBED 4NM8H 1KJ2L 2YD4A 3VMOA 4ALAH 2ILLA 3BPOB 5I1LA 3LRSA 2RFXA 2VKWA 4GJTB 2NXYD 5DI8A 2OM5A 4JKPH 3SQBA 3QQ9D 3W0WD 3QDJD 5EZJB 1FL5B 5E56A 4PJIB 4LFHD 4B7LA 3UC0H 4Y19D 4OGYH 2E7BA 3WNNA 3B9KD 1T4KA 4XBEL 1FLTX 2A73A 5CBAB 1CFVL 2GTZA 3TYGH 3VE0B 4K94H 1XCQA 3HI6H 3S35L 1FN4B 2FYYB 3OZ9H 2CKBA 2PR4H 3S96B 5FA3B 3O6FB 4ZFFB 5I1JH 2YPVL 4Z7VE 1BQHB 2GJ6B 4Z7VA 3C5ZB 2YPLE 3I6KB 5A16A 2XNAB 2FX7H 5H35B 2YPLA 4LQFH 1S7SB 2VZOA 2BVQB 2JJTC 2UY7A 2ICWB 1U3HB 3QPQD 5HYQA 3BN3B 3CK0L 5D1QD 4NNPH 2Y4SA 5SX5K 4Z0BL 1A3QA 3UJJH 2A1WL 5HXMA 3IF1A 4RMVA 1CN4A 5KSAB 5F9AC 2FJHB 4MAYC 1U95B 2X40A 1KLGA 1CXLA 4GRWE 3SPVA 1R24B 5IBUG 1ZGLM 5I75C 1RU9H 3HZVB 3NPSB 3QEHB 4P46B 4F7TB 4L3ED 2VN4A 2HWZL 1Z5LB 4K7PH 5I1CH 5T3ZL 2VSDA 5DF0A 3QXDA 1F6FB 1MHHB 3MRBB 4PB9H 1U8IB 3QO0A 1IKNC 3O6LH 3C9NB 3R06A 3L5HA 3LHPL 4KROD 4DQOH 4OZIF 1MPAL 1LO3L 1IC5H 1G9MC 1HIML 2R1WB 2ZKHL 4LCYA 2GT9A 4JN2A 4P5KA 5C07B 4I8DA 5I18L 3I6LE 1H8OA 1S9WA 1AE6L 3O6MH 4QRUB 4E42A 2FLBT 1DCLA 1QBLL 4E5XA 1TVBA 3M17A 4CN1A 1S5IL 2XZQH 4OZ4A 4FP8H 3BKYH 1I9JH 3FO1B 4F7PA 2V2XA 4OF3A 4F57L 5L8LB 2JF1A 1MWAL 1BD2D 2XXMB 5J6GB 2W0FA 3L7FA 3QJFB 2W0PA 4EN3D 5JHLH 3M45A 1RZFL 3RKDC 4XNQB 3O3EA 1TJGH 5IB3A 3R0MA 4NM8L 4ELMB 2IMMA 4MDIA 2VUYA 3EJYD 1MCPL 3PWJA 2ZUUA 4JJ5A 3LKSA 2R23B 4PJAE 4U1SB 3SDDD 4PJAA 1JF1A 4GRLA 4Y1AB 4JKPL 1EZVX 2EIZA 2W60A 3F6LA 3VRLF 1NBQA 4OGAD 2APWA 1UH2A 5JLZA 3HLAA 4HUWA 1N5YH 1AQDB 1CLOH 3D85D 3D18B 4H5SB 4IM8A 5TF1L 4H26B 3TWCH 4AJ0A 2PTVA 4ZOBA 1DN0A 3U36B 3BEVB 3TYGL 1FH5H 3C09C 3D3VE 3LQZB 3MOQA 4P4RA 3D3VA 4G7VH 2IMNA 1EVUA 3OZ9L 2CIIA 1PYWA 3W0WB 2HLFD 3RIAK 5ICZB 3ECBB 2Q76A 4HG4J 2X4UB 1E4KC 1TLKA 1YC8A 2W0KA 3B9KB 4JREB 4MD5A 5CP7B 1JWUB 4E41D 1IL1B 4NQXA 3QB7C 3DX6B 3TT1L 1DBKH 4NNPL 1UJ3C 3B2UC 1QLFA 3ARTA 4M7ZC 1K5NA 3UJJL 4NNXA 2H3NB 1DQJB 3WFDL 3KHOA 2YPKA 5ACMA 4MNQE 4MNQA 1Z2KA 4FQIL 4NZUL 3P73B 2CJUH 4JFOA 1RU9L 4ORGA 1NCWL 5CD3B 5C0AE 4WI5A 1QA9B 5C0AA 5D1QB 4XMKH 2BZDA 1T89A 5DVLA 4R4BA 1FORL 4DKFH 1KPRA 4PB0H 4G8GB 1ZS8B 5GSRB 3S34H 5D6CB 4PB9L 3O6LL 3TVMA 4I77L 2WLYA 3TBSB 2DLGA 4PJDB 1IC5L 5JXEC 1SY6A 2VDRH 3CX5K 4BSWA 3OB0H 5DVKA 3AY4A 4D0DA 3QP3A 3PWUB 5BQ7A 2H26A 5EORH 1QR1A 1TJIH 1GOGA 4HBCH 1YECL 5GSVB 32C2A 4HMCA 3GI8H 2PO6D 2VXUL 4DGYL 5JXAH 2VQ1B 2XZQL 4RBPK 2VH5L 3DHJA 4APQD 4KROB 1KTKE 1G6RH 5EBWB 3HI1B 3BYYA 2OBGA 1T7YA 4HSQA 2LFGA 5CEXB 5F44A 3OTTA 4UT7H 1U8LA 4PGJA 3WBDA 2HT4D 4XP4H 1T5WB 3JUYA 4OTXH 2V5SA 1NDGB 3WNLA 3B3IB 4PJ5B 1MFEL 2X7LB 2I27N 2EYRA 1AO7D 3VG0H 5D2NB 1N5YL 5EU7C 4L8SB 4HIEB 3HR5B 4HLJA 1A1MA 5TF0A 3VFVA 4KH2A 4S0TD 3PHQA 4P2OA 3SDDB 4XBPA 1FH5L 5C7XL 1FGVH 4G7VL 3VA6A 3DMMA 1NGPH 3V52H 1L4IA 3V4PH 1RJZB 2VERN 4B41A 4GG6A 3LAFA 3GI9H 4MGXA 1OTUD 5GHWL 4G6AC 5D9SB 1JPTH 4N1HB 1YJDH 4ZPVB 4GMTH 4KJYA 3U82B 3EFFA 4XPFH 2OXGA 3DGGA 4ODWB 5I9QC 2R8SL 2ARJA 1C5DB 1K3ZA 3K2MC 3WUWG 1T0MB 1DBKL 1QEWB 4PLJC 2VDOH 2DLIA 3QUKB 3VGAB 2EDNA 4N90D 2NTSP 4LMQE 2OQJB 2YD5A 4GT7A 4POZC 1HILB 5DRWB 4YH6A 1R0AH 1I8KB 4JFYB 2CJUL 4HK0A 2IEPA 4Q9CA 4QHUB 4TPRH 5GS1B 5DRNB 3S35X 4YIQB 4PJ9B 5IVZA 5HHOE 3F7QA 5HHOA 3BGFC 1LP9F 4ERSL 3ZKQD 4PB0L 4WEBL 2P5WD 3EJJX 2NXZC 4BFEA 5IT2L 3QEGL 1ZA6B 5GRZA 1DLHB 4LIQH 1D5XB 3L5WB 2VDRL 1U8MB 4IJ3C 3WIIH 3ZTNL 3LKQB 1E6OH 4HFWB 4OV6F 5B3JE 3EYOB 5TDOA 5C6WH 1RIVL 4UUJA 3C8HA 4HBCL 1I3GH 1BOGB 2D2OA 4QXUH 3PUCA 2F8XC 3T04D 3EYFB 3T0EC 3MRMA 2YC1A 2FO1A 4U7SA 1ZHBA 3NGBB 4WUUD 4K94C 4OUOA 3OR7B 5CGYC 3QNZB 3EW3B 3C08L 1F4YH 5E8EB 3REWA 3GMOB 3AVEA 4UOW0 4G6FD 4MWFB 1OHQA 1RIHH 1WZKA 1JPSL 4JFED 2PO6B 1JGDB 1X4ZA 3D1MC 3K8MA 4XRCA 4OTXL 3D2UD 1CG9B 4PRID 3DI3B 1VKXA 2ATKA 3BHBB 1UZ8B 2X4OA 2DQJH 4LAQH 2WM0A 4YO0A 4OGZA 2X1PA 4HKJB 2B0SH 2MKLC 3KPQA 4QRQA 4WHTA 3SDXB 1IEAA 4Q9QL 1MFDL 3K4DA 5KVGH 4UT9H 1XCTB 5EIVA 2NY6C 5T1KD 2ZOKA 3KPPA 2HT3D 3TM6A 3U7AA 1TVHB 1J05B 1MCOH 2EDRA 2IAMA 4U6HB 4P48A 3CFKB 2EXWC 3CIQA 3RPKA 4BZ1L 2H32A 5F7DB 3RIFK 4HQQL 1IARB 2AK4B 3UTPE 2Q1EA 4QRPB 4RBPH 3VXPA 1E27B 1UB5A 1DVFA 3SOBH 3P4NB 5HGHB 3KR3H 4UTAH 2GY5A 2WSKA 1IAKB 5EBLA 3QQ4A 3AM8C 2DBJA 3OAZK 4DW2L 5JPMB 5FM5M 3MJ9A 1A1OA 2P8PA 4YHPA 2VLJB 4UI2A 1MH5B 4XH2B 1I1YB 1U8OA 4U1GC 4S1RH 3ARUA 4HIIA 2J4WL 3PQYE 3PQYA 4JB9H 5D1ZB 4HUVA 5DJZB 1IGYB 1MLBA 5ACZA 5B38G 1BAFL 2EDWA 5M95B 5E1AB 4J3XA 3K1KC 1JZ6A 4RA0C 2B2XL 2VLRE 4Y5VA 3G5XB 3RWCA 2VLRA 4P3WA 3UPCA 4HUUA 3MMEB 1E6OL 3AMKA 5F3HA 1J8HD 4NQED 3SJVD 4LNRA 2NYYC 2YRLA 4C83A 4RGMC 5L88H 1F97A 2V5YA 3HG1E 3V4UL 1I1CA 2VLLA 3HG1A 2VAAB 2QSQA 4FNLH 2XTLA 2DQCH 3QH3A 1JHTA 1MIMH 1WZ1H 3Q6GL 2EE2A 1YN6B 4PJ8A 3VFRA 4NQSB 1F4YL 2BVYA 3KWWA 5CJOH 5KAQF 3BAEH 2D7OA 2DQUH 3CVIH 4IOFD 4KK9D 2P5EE 5HHVH 5TGBA 4M4RA 3OKDA 2P5EA 5BJTB 1KELH 5D1XA 5BVPH 1MJ8H 4Y4KA 4L9LB 1I8LA 4FXKB 2BVUA 4OCYH 5B39G 1SJHB 1P4IH 3EOAA 1YEJL 4CN6A 3L1OL 3K46A 1CDHA 3I3BA 3WFCH 4Y5YB 1IAOB 1A6TB 1JI1A 4D0BB 3H7BB 4FFVD 3ILPA 5KVGL 3EDFA 1MCDA 3N1GC 4PJHE 3JTSB 4JFEB 1OAUL 4PJHA 1NC2D 4WO4C 3D2UB 4PTUA 2WIIA 2IFGA 4OZGF 4PRIB 3AREA 1NCCH 3O9WA 3QIUA 2VDKH 3OKKA 3OKNA 4X98A 4ONHA 5MEOA 5J9PB 4QHMA 1G7MA 3U0WH 4M48H 1GVIA 3PABB 1XGTA 4S1QH 3IGAB 2NTFA 3LVEA 3VFSB 4ZXBA 3FHAA 5T1KB 1F4WL 2XWTB 2XY2A 3MA9L 4RQQA 3T3PE 4CL7A 1F6AB 1O7SA 2H1PH 3V6FB 1A3RL 2OJZH 4PLOB 4AY0A 3BXNA 5E5UB 1UXSA 5FYKU 3KR3L 4RWYH 3RGVD 3TN0D 3QIBC 2V7NB 2CMRL 1ZTXH 4S0SD 4HS3B 1OAKH 5J1TC 5T3XL 4YGVB 1BWMA 4KGJA 4JCLA 4NHUB 4MD4B 4ZFOB 3U7WH 1B0RB 5E8NA 1QPXA 1FVDB 2F8VA 3KJ4C 2H8PA 1K8IB 1W72B 2R29H 4FS0A 4JB9L 4BQ6A 3O4LE 5I1IL 3HCVA 3A6BL 3O4LA 4UNUA 3L9RB 3MV9B 4PLKD 1T7ZA 3PL6C 3ZSSA 2XWJA 3A67H 2ZP0T 3DHMA 2AKRB 1JP5A 4ZUUA 2AV1B 1A9BB 3MCKA 2PCPB 3ZHKA 1C12A 3U0PA 5BMFH 5LWYL 4XC1H 3MRHA 1OAZH 2AW2A 2ZCHH 4OBSA 5T1MB 1FYHB 1HINH 1IGML 6FABL 1FFOA 2ZSVB 1GGBH 2ZJSH 1CFQB 4FNLL 3PV7A 4XWGH 5IJKC 4RDQF 5IVXB 2C9AA 3RWIA 1I1FB 1WZ1L 2FSEA 3ET9F 2BSED 3VWJD 4TVSa 1J8HB 4NQEB 3TFKC 2V7HB 4L8CB 2GK2A 3P4OA 5E2WH 3IETA 3BAEL 1HHKB 3G5ZB 1QBAA 2DQUL 1YJDC 4CMHB 4FMFA 4DZ8B 3ZKMC 3MUGB 1C1EL 1KELL 3MUY1 5BVPL 4HKZB 1MJ8L 3OAZH 1I8MA 1MUJB 1S7TB 4LLMA 1X3DA 3FO2B 3WFCL 1CD9B 3BP5A 3DUUA 1G7HA 3HR6A 1A7QH 5FDWB 3ZKXC 1SEQL 5IFAL 5BO1H 5KSBA 2NY2C 5B22A 1GZQB 4HD9A 2ESVE 4HX1A 2ESVA 5KSVA 4PGCA 3FZUD 1KACB 3G5VA 4ZUSB 3UDWC 3WO4B 4S1QL 1WBYA 4LSTH 3G9AB 5CAYB 2MHAA 2Z92A 1AKJB 1KBGL 3MJ8B 3LEVH 5ENWA 1YN7B 1NC2B 1RZGA 1K4CB 1JGEB 1FLRH 4ZOAA 1WITA 2OJZL 4OIIL 3P0YH 1KEGH 3RX5A 2WMPA 3QDME 1T20A 5INCB 4DUXA 4Q74A 5I8OH 2E7MA 2R2CA 3QDMA 3ARSA 4MB3A 1OAKL 1E6JL 1INQB 4N0FA 2ARWA 1HI6A 1OTSC 2EKSB 2IBZY 4FQXA 3AXLA 3QBTB 4LLWB 4X5XA 3GKZA 2AERT 3QUXB 3IKKA 3GK8H 5TQ2H 2C1OB 1NCTA 5EOCL 4FQQA 3OV6A 1WIUA 1FG2B 4HGWB 4X6CE 1KG0B 2Y9RT 3RGVB 3U4AA 3TJEH 1WCQA 5K9KB 4X6CA 3A67L 2XN9E 3BO8A 4FQCH 1PLGH 3C6LD 4FXGA 4IRSD 4YWGH 3BP7B 3KDMA 5ESVA 4IDLA 5BMFL 2IFFL 1X5KA 2BMKA 2ZCHL 4LQ1A 4X80L 1S7RB 5FHAH 2D4FA 2K7QA 1MRCL 4UBDC 2G5BA 2EYTA 4NN6C 4FABL 5C0DB 5JZ7D 2C4FU 2DQFB 1GGIL 5MEQA 4L3AA 4P23B 2I60L 3N06B 1VPOH 5IEHB 5IIEA 1ZVSA 2FJFA 3BZFA 3T8XB 4P5MB 3Q5YA 3E6FA 3OKOA 4XP9H 1NKOA 3CSYA 4KMTL 4LLDA 2ED8A 5DMKA 4NQDE 4H0GA 4JZJC 4NQDA 3QEQB 5CZXC 2PW1A 5HYJB 4GQ9H 1IC7H 2Z31D 4AIOA 3OXSA 4NNYA 3VWJB 1CVRA 2DRUA 5E9DD 4XNYL 1RZJC 4QOKB 3S36H 4Y16D 4WW2A 3O3DA 4R3SB 5KANG 1NKRA 4P5TB 4ODHL 1KENH 4CJ0A 3P77A 1A7QL 1WQVT 5HHNA 1R5WA 5SWQA 1PW3A 4XT1C 4PRBA 1J5OH 3WV0A 3O3BB 1EPFA 3P3YA 1XF3B 3JWDL 3MV8D 5TQ0H 5J3HC 1ZHNA 3O2DL 4NZDA 2Q7YB 4QF1A 1LEKA 5HY9B 2Q6WB 5BS0D 1QHOA 1U8JA 4KK6D 4LSTL 1D5BA 1EGJL 5T5FH 4U49A 1CGVA 3LEVL 1A47A 3MBEC 4Q0XH 5MEND 4ZFZA 4MJ4A 3KYOB 4BH7A 1BJ1J 3UPRA 2C4XA 4LKXB 5DJYB 5JNYB 4HS6A 4N5ED 4ZUTA 5I8OL 1D9KD 3MZTA 1T66C 2NXYC 2A83A 5I6XC 3MGAA 4PY8J 3L95B 1XAUA 1A7NH 5CJQH 2NCMA 2MPAH 4JVUA 3ZDXE 5I16A 4LGPB 5IW6A 4AENA 5TQ2L 5DK0A 5GGQH 1CGSH 5FKPB 1JVKA 1TCRB 4QRSB 2G5RA 3TJEL 2VKXA 5IWLC 2AJVL 4FQCL 2Q87A 1KPUA 3TA3D 5FUZH 3WHXA 1MJJA 5CIPB 4YWGL 1QNZH 3WSQL 4EDXA 1N0XH 1HHIB 4OT1L 2RAMA 1KIQA 1NGYA 4M6ML 3WN5B 1DBBH 3VCLA 4ODSL 5FHAL 1PD6A 4HAFA 5DD6A 3QPQC 4V1DE 2OL3B 4V1DA 1XZ0A 4PJIF 3JVGA 1RZIB 1EAPB 1WBZB 2EZ0D 4NBXB 1ONQA 4PRDA 1EMTL 5C8JA 4KI5D 1EZVY 1WFUA 1DEDA 1MSPA 2XI9A 1NUNB 3U9PH 4P9ML 5FXCH 3FOLA 2FWOA 1W8OA 4LHQB 4HZLA 1NBZB 1C8PA 1JHLL 4MD0A 3EOBB 3DV6A 1Y18B 5EWIH 3SDAA 4ELKB 5CSGA 5INDA 5KZCD 4Y0GA 5JW5B 3PWNA 1BF8A 3WDIA 4BSVB 1J11A 1JNHB 4WTZA 1SBSH 5GRVL 5F7EL 3V0WL 3QUYA 4WUKH 5E5RB 3TO4A 3VD9A 2Y23A 2XFXA 4X8JB 4EDWH 2X70B 4KVNL 5ANMB 3JV5A 4F58L 5HYSB 2DLEA 3I02A 2FD6H 2D7QA 1JWSA 1JNLH 4X6DF 3H9SD 3GSNH 4TRPH 4XNZC 4ZO8A 5CJXA 1FFNA 2QTEA 4WV1A 5DHVB 4EZMA 2CLZB 4PBXA 4B53A 3T65B 3MFFB 5E9DB 4Z7WB 4RMRA 5B4MC 1JWMB 1MCNA 2G75B 4EN3C 2PUQT 2Y7QB 3L3DB 4QHLA 5I19H 3HZMA 2P43B 5HJ3A 2H6PA 4DEPB 2ITDA 1WCBA 4GKZA 1CE1H 5EN2B 3ZZ1A 1CLZL 4DKAA 1QACA 4MJ5A 5EU6D 2BXYA 5BS0B 4PV8A 4G8EB 1HHGA 5CJQL 1AP2A 1KLUA 3B5TA 4RNRA 4YHYB 1A6UL 3KGRA 1T0NB 2MPAL 5LKNA 1DFBH 4BKLB 1P1ZB 1C7TA 4NYLB 3RY4A 1CGSL 4JFPA 4JJHA 4ORZC 4JZOB 4I13B 4UQ3A 1IMHC 1MCFA 1TIUA 3IFNH 1T5XA 3FQNA 5AZ2H 3G08B 2I5YH 3VRJB 4ELMF 1GCFA 3B6SB 4HC1H 5FUZL 5ETUA 2J6EH 9CGTA 2VN7A 1QNZL 1HHHA 1N0XL 4OJFH 4FHBD 3V5HA 5FO7B 4OSUH 4U6YB 3ZE0E 5C92A 4ZYKB 3NN8A 4TTGA 1H3TA 4LLVB 1JBJA 1JNNH 1U8KA 1SJEA 5KN5A 3SGJA 2DJUA 3K8LA 4KJQC 1PQZA 1QSED 4DAGH 1OB1A 4ODTH 3VXSB 4HJ0C 1LDPL 3QXAB 4Z95H 3TA3B 5E8PA 3MLRH 2CK0L 1H3WM 4ZDHB 3TIDA 4U1JA 4I48B 3U9PL 1XR8B 4UV7L 5CJBA 3G6AA 2X09A 4IRJC 3C8DA 4HWBH 5I8KH 2KKQA 4GMSL 4XPHH 2Z91A 4DGVH 3S4SA 5BW7C 2XA8H 4BSJA 5DQJB 1U58B 4KZDL 3CH1B 1RZ8A 4G9FE 1U3JA 4G9FA 3ARFA 3P30H 3BKCH 2A6JA 4PJCE 4ZFOL 4EDWL 3Q1SL 1LEIB 4PJCA 5LCVH 4NQVB 4YDJB 1W72L 2FD6L 4GBXA 2IALB 1MNUH 3RWGA 1HYSC 2HFFB 4N0YL 1CF8L 1KOAA 1ULVA 3GSNL 4TRPL 3WS3B 1YPZA 1X7QB 1RURH 4HFUH 5HDQH 3QNXA 1IC4L 4FZEH 3SKJL 5IOPB 4APQC 3S4SG 4IIQB 5D72H 2P4AB 4NGHH 1U8NB 1IT9L 4QY8B 3SEPA 5JOPE 1R3JA 5FM8A 3RVXD 5J13B 1GHFH 3H9SB 3FQUA 5ICYA 1XIWD 2DJ4A 5JMRA 4L4VB 2LU4A 2ICEB 1J1PH 2HT4C 4XP5H 1UM6H 1WK0A 3BP6A 1NPUA 4G6KL 3HUJE 2BC4A 3WIFB 1AGBB 2NX5D 1RD6A 2HAZA 4PJXA 5D2LB 1Q9OA 3RJDA 2L0DA 1T22A 4XP6L 4JPVH 4XBGA 2XZZA 1OF2A 3GMLA 1EHNA 3JSSA 5IP4A 4OZHE 5ID0B 2DDQH 3MGOB 4OZHA 3ZDZF 1WTLA 3ARDA 4LOUC 5DDHB 5LGJB 5EO9B 4YDKH 1T1YB 3ME0A 3S5LA 1X5XA 1XGRA 4WFFE 1S7UB 3DBXB 4ODXB 1A7RH 2BNRE 4HWZB 2BNRA 3RTQD 2VWEC 5E0QA 3SDCB 1PEZA 1CK0L 1OTUC 3ZMRA 2E7HA 5SV3A 4OSUL 2ZG3A 1EHAA 1YEHH 3PWVB 5FHBH 1JNNL 3MRNA 4O00A 5T1DH 1CDUA 4NKQB 4NCC2 3K3QA 4DAGL 2KBGA 4MJ2A 2X1QA 3QRGH 5I1LB 4ODTL 4Y2DC 2QLVB 2IPTL 3LRSB 1L7IH 2XICA 4KQ3H 2RFXB 3BD4A 5DI8B 4Z95L 3V0AC 1UZ6F 3MLRL 4K8RC 4OAWA 1IFHH 5FYLD 1T7XA 5F7FA 1T4KB 5I8KL 2A73B 4DGVL 3NCJL 1TENA 4GS7B 4QNPF 1XCQB 1I9IL 4M8QA 2YOCA 4OFIA 2CKBB 2DQGL 5IBUB 2BHYA 4OLXH 4QTHA 4Z7VB 5LCVL 2DI9A 2WBKA 3INUL 5A16B 1F4XH 2YPLB 4TNVF 2NPLX 5F1KC 2K9UA 1N8ZA 4DUVA 3OF6D 4RFOL 2EECA 5HYQB 4H88H 5C0AD 5FK9A 1NCBH 5F3BA 3QHFH 4FZEL 1QHPA 3IF1B 3VXUE 2Y6SD 5K9QI 1OAXH 4R0LC 1J9CT 1KLGB 3SPVB 4GRWB 4L9DA 3KPMA 1DP0A 4J3TA 1UYWL 5HHMD 4TULH 1RQ5A 1NUFA 1JZ5A 1TETH 2C3VA 1JRHL 1MQKL 4XP5L 1UM6L 4Q6YA 3QXDB 1N6UA 4P9HH 3WKNA 1AHWC 3BP4A 2EE3A 5D96C 3QO0B 5A2LH 1PG7H 3R06B 2EYSA 2X4PA 3MNVA 4HH9A 4MXWL 3TZVD 4AL8H 1BP3B 3IVKA 1VEPA 3MLPA 4LCYB 2GT9B 2X9YA 1NAMH 2DDQL 4P5KB 5D8JL 3T4AA 4C55A 4PP2A 3FT4A 1S9WB 4ZS7H 2DTML 4E42B 1JGVL 3S6CA 4WWKA 1H8NA 1TVBB 3D0LA 2CUMA 4JFDE 4E5XB 3M17B 1F58L 4ISVA 4JFDA 4OZ4B 5D7KE 4F7PB 3CU7A 2V2XB 3QUZA 4K9EC 1U41A 2W0FB 3L7FB 1CTNA 1G0YR 2APXA 3QA3A 3O3EB 2X6MA 3GSQA 3Q3GA 5FHBL 3HNSH 5IB3B 5E99H 5T1DL 4MAUH 4HV8A 1UENA 2DBLH 3LN9A 4Z7OE 4MDIB 4P2RE 1UQSA 4XB7A 3PWJB 4P2RA 4JJ5B 4Q58C 2G60L 3LKSB 4P2OD 1A6VL 4Z8FH 3QRGL 4PJAB 3NACH 4QHNA 1L7IL 4XXCC 1JF1B 1FVCA 4GRLB 4GAJL 1VFOA 3DMMD 2EIZB 2A2QT 2W60B 1RUQL 2BOBA 2QL1A 3HLAB 4HUWB 2X1XR 5DVOA 5I6XB 2M8XA 5KTEH 4WFGD 3HC4H 1DN0B 2AI0L 1TTFA 3QHZL 4P4RB 1T04A 3D3VB 3S8WA 1BIIA 2CIIB 1PYWB 2GSGA 1A5FH 4NQUA 2Q76B 3O41A 4LVHB 3W39A 5GS0C 4QCIA 2CXGA 1JF6A 4IEFB 1MJ7L 4JDTL 1F4XL 1YZZA 3RUGF 3C2SA 1R6VA 4MD5B 4GW4A 4PRPE 2BRQA 4TSAH 3QAZC 2XY1A 4L29A 4NQXB 3UYRL 2XQBL 2DKUA 1U91A 1QLFB 2PXYC 1NCBL 4HGKC 4CMMA 1K5NB 3K7UA 3QHFL 3TBTA 4NNXB 4PS4H 3ARBA 3SE8H 2F54D 4MA1B 2HJFA 1OAXL 3NA4A 2EE9A 5LG1A 2YPKB 4YC2C 4PJGF 4UINH 4MNQB 2VYRE 1HOCA 3PF2A 1A7OH 4JFOB 4ORGB 1P7QA 2XIDA 2OL3L 3RFZC 4PG2A 4KK9C 5C0AB 4P4KC 4R4BB 2ZUXA 3OBAA 1KPRB 2FEEL 5CEZL 5DS8A 5KS9F 3TVMB 2OTUA 4Z7QF 2PYEE 4F7EA 4BSWB 2PYEA 1U93A 5F6IC 1FNSH 4FFVC 4D0DB 5BQ7B 2H26B 1QR1B 2R0ZL 1CDYA 2VDML 2HKHL 3EDEA 5I1EH 2F53E 3GBNH 2C7UA 1M6OA 32C2B 3MRKA 2F53A 1AGDA 3KPLA 2EEAA 4CU6A 3HAEA 3VRIA 4MNHA 4JGUA 1H3UA 5DUPH 2AAVA 2GHWB 3RVUD 3UZEA 3HNSL 2HYMA 1TZGH 2NW3A 4S1DD 1NC4A 4XC3L 1X5JA 1PKQE 1U8LB 5FV2A 3ZHDA 4YHZH 1PKQA 1OSPH 1RZ7H 4Z5RA 1GGUA 3NPZB 4C4KO 3FFDA 4C56E 4Z8FL 4GLRI 4GW1A 3NACL 2IAMD 4QXGL 3TN0C 5BV7H 3PJSA 4PGBA 3VI3F 2EYRB 4M1GH 5JW4N 3IS1X 3DIFA 2WQ8A 5JIHA 3HAEG 2P49B 3VD7A 1A1MB 5KTEL 3VFVB 2EC8A 3PHQB 4U6VL 5CINH 4MQXD 3UTPD 1J0ZA 2QSCL 4P2OB 2DQIH 4XBPB 4Y4HA 4KJWD 1J10A 1UKQA 2JELH 5ESQA 1V8HA 3DMMB 4KRPD 1RIUH 4PLKC 1CQYA 1C7SA 4LKCA 4GG6B 2UZIL 4JHWH 5EZIH 3ULSA 1BMGA 5L7XH 3HFMH 5DFWH 1GC1L 1MFCH 3S3PA 1JK8A 5DD5L 4KJYB 5D71H 3HPLA 3EFFB 2DTSA 3DGGB 3KLHD 3PDGA 1BM3H 2ARJB 1ZGLP 4FQ2L 5T1LA 4HXBH 2ICES 5SWZE 5IMMA 5SWZA 1NBYA 4GAGH 4ZO7A 4OFVA 2ZCKL 1G6VK 3SE8L 1F2XK 5DD3L 3I6GA 1HHJA 3DARA 2RIKA 5IF0A 3S97C 3KYMA 4HK0B 5DEFA 3BDBA 3RHWK 3IDGA 5IVZB 3L7EA 2P1YA 3MXWH 2BSTA 1N4XH 3QR2A 4LSDA 2ARJQ 4XPGH 1IGCH 2H2PD 4PRNA 1MJUH 3L3KA 2OZ4A 4TYUA 2GSIA 1QSVA 5J12B 5FYJD 3RZCC 3MV7E 4R6UA 4OFPA 3MV7A 1U36A 3UYPA 5TDOB 4UUJB 4X7TA 3E8UH 3BMVA 4DFIA 4F80A 4EBQH 5GRJH 2HTKD 4X8XA 3VW3H 5LBSH 2Y06L 2A77L 2KUTA 4R97C 3ESVF 4RGNE 3MRMB 2YC1B 1ZHBB 4PBVC 5DK2A 2NZ9D 4YHIA 5EDXA 1W2KT 1TQCB 3REWB 3RWHA 3ULUE 3KLAA 1CDBA 2VZTA 5D7IF 1H8SA 4GXVL 4NZRH 5HPOA 1MFAH 3ULVH 5EB9A 3TNNA 2WWKT