4ODTH

Fab structure of lipid a-specific antibody s1-15 in complex with lipid a carbohydrate backbone
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
226
Chain Sequence
EVQLVESGGGLVQPKGSLKLSCAASGFTFNTYAMNWVRQAPGKGLEWVARIRSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVRHRGAPLYYGNGAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTSGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S1-15 Fab (IgG2b) heavy chain
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
total genus 39
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odtH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odtH01
1E6JL 4ODWB 1KYOK 2PTTA 4JRYB 1MCDA 4KVCH 3SBWA 4U1JA 5TE4H 4YHML 4BQCA 1FPTL 4B7LA 3QUXD 1VACA 1YEEH 3K8KA 4LSQL 4EXKA 1RIVL 2NW3A 4M8QA 4QRSA 3WFEL 2FD6L 4AIZB 2F53A 5FYKH 1FNGB 4HWBA 5CZXD 3GGWA 3T65A 4YHOL 4HQQL 5FUOL 2I60L 1CGSL 5GGTH 2N56A 2O26U 2R8SH 2VDMH 2X70A 1SY6H 3IAQA 4WJ5B 1BGXL 2FIRT 2AJYL 5JW4Q 4MJ6B 4QO1A 2NY0B 4N1CA 1WEJL 4WO4A 5JXEA 2UV3A 4NZUH 3TA3C 5KG9A 4OCYL 4O02L 4HS8H 1WF5A 1T22A 4MXVE 1D5ZB 4QTIH 2C1OA 1A6WH 1K4DA 4NJ9H 2EDLA 1S5IH 4OBRA 1LQSR 2PYEA 2RIKA 4TSBH 3FT3B 5HYFA 1YNKL 5EU6D 4K94H 5D7JB 4LSDA 1V7NL 5IM7B 4HW6A 1NFDE 2BDNL 5BZWA 2E7MA 1XF4A 2DQEH 1YUHB 2AXGA 3CXDH 5D70L 5F44A 3ZKMD 3PABB 4PRID 1BEYL 2F8VA 3OHXB 4CVXA 1KACB 2ZWLT 5IEKA 4Z5RA 2OR9L 4RAVB 5LGJB 7FABH 1UB6A 1SEQL 4NO5B 1MRDH 3UPCA 4N0FA 4OUOA 2B20A 2DQHL 5GRZA 4MHHG 4PJ8D 2OSLA 4UTBH 4FQQB 2WBJB 4J4PA 3LKNA 3IFPB 1F3JB 3KYKL 2CO7B 2VDLL 1D5BB 5SWSD 5JHDE 1EZVY 2HFEB 1UJTA 3NZHH 5LBSH 2ZPKL 1NC4D 3ARGD 1E4XL 1PQZB 3U2SA 1F4WH 5D7IA 5KSBE 1RUPH 1S7VA 5JOEA 3TV3L 3UTSE 3ARWA 2BNQA 1OAQH 2FJFA 4BFBD 4QXTB 4JHWL 3U46B 5GS1A 1YPZB 2E8YA 3GNMH 4LEOB 2XXCB 5KVDL 5FEBA 4PJFB 4WI6A 2BHYA 4R2GB 3B6SA 3VGAB 2VXTH 5ANME 4LSTL 1AHWB 1CFVH 3LY6A 5LQBL 5E6IA 2H32A 3C2AH 2PW1B 3CLEL 4OFKA 3SO3C 3TO4A 3OKLB 3T2QA 3C9NB 3IJHA 4M1CD 1T04B 4PRDB 4U6TA 5C07B 1DANT 2XTJD 4IRSD 4QKXB 4E0RA 1UT9A 4XT1C 4NNPH 1BHGA 2Z92B 2VWEC 5A40E 1G7MB 2FL5B 3PV7A 5GPRA 2F8OA 3BP7B 5GS0H 1D7FA 1JVKA 2BNRD 3MLVH 1PFCA 3KYMB 1KEML 5DJ2B 4RBPK 1P6FA 4LP5A 4ONFL 5F1NA 4NQEB 4JR9H 5IQ7L 4ONHA 1CIDA 3GSVA 5CBEA 3T77A 1J9CT 2WZPD 1UWXH 3HUJB 4YXHH 2HG5B 3UTTD 5TDPB 2F5AL 4RMQA 2D03L 4HCRA 5E1AA 1DL7L 3VI3E 4WEBL 1YDPB 4X6FA 1H3UA 1CFSA 4UV7L 3DVFA 1CU4L 2NYYC 2DMCA 2OS7A 5IGXL 2X6MA 2YA1A 1N59B 1HYRC 2OBGA 1AI1L 1CE6B 1G7LB 3TBYA 5TF1L 3D3VB 4TTGA 1MFEH 1CXKA 2P4AB 2P5ED 3FHAA 4F15B 4PBWD 3MV9B 3T3PE 3INUL 3JWOC 1SM3L 2VLLB 5IV2B 4PGZA 4XPHL 2A6JB 2CGRL 4HUVA 1KPRA 2DMKA 3C5JA 4HF5L 2KL6A 3GMQA 5KOVC 2XZAL 5GGUA 3PDGA 5KS9A 2HFFA 2V9QA 5FO8A 5GRJH 1LGVA 5F6HJ 4DOHE 2NXYB 1VPOH 4XNZB 4ZFZA 2NX5E 1M7IA 1U8IA 3VXSB 1UKQA 4XPAL 3V79C 4GS7B 2XN9E 5IK3B 1YEFH 1MVUA 1NCAH 5IVXE 3ABZA 1SHMA 2XG4A 3ZSSA 3V8CA 4K9EC 4LGPB 2ZUUA 3R1GH 2EE2A 2P47B 4KMTL 3ZKQD 3FOMB 4LBEB 1QFWL 5K9JL 1KLGA 1AGFB 3ZO0A 1FQ9C 4HFUL 4NFDA 3VI4E 1D9KA 1I3UA 2GTZA 4R26L 1S9YB 3VDBA 5HD8C 2OQJB 5ISZB 3SJVD 1NGWB 3CFBB 2G60L 4JQIH 1A9BA 5DUBA 1R0AH 2AJUH 1UWEL 4QRUB 3NBNA 3DV4B 5IIEB 3UPRB 3CU1A 4KI5C 4Y5VA 3GJFH 4OLXL 4LLAA 2FNBA 3AREC 3QEUB 1NLDL 1S9WA 2B2XL 5E8NB 3KLAA 2JJWA 3QCUL 5GHWH 4YFLF 4U7MA 4DCQA 5I76A 4PY8J 3P11L 3WL9A 5I1LA 4R7DB 2UVEA 3HC0A 1BP3B 4QXGL 4M1DH 43CAA 3CFDA 3SO3B 4X7TA 4JPKH 4M4RA 1XGYH 2WQRA 4EN3C 3ZT5A 5KSAC 2WINA 3A6OA 4TUOA 3TH4T 1UKSA 3QQ4B 4OZFH 1CXHA 4WV1C 5EOCJ 2VH5L 3O8XB 4NQCA 3QUZD 3O2WL 3UC0L 5CCKL 3RX8A 1KJ2L 1MCEA 3N1PC 4U1KA 5BW7C 1EFXA 1E6JH 1P1ZA 1SEBA 2RCSH 1XR9B 4Y4HA 2GT9A 4YHMH 3AS3A 4HLJA 1FPTH 2CRMA 2E7CA 2FO1A 4HT1L 3VXRB 2NPLX 3REWB 5DJDB 2IG2H 4DVBA 1NMAL 1RIVH 3WFEH 1A0QH 2K7PA 2FD6H 3O4LD 4YZFF 3O6KL 4R3SA 3X12A 4YHOH 3C60D 4HQQH 5DGRA 1F3RB 2I60H 5FUOH 3RTQD 3STLB 1CGSH 3VGGA 4F7CB 2YEZA 5F7YC 5EUOB 1RHHB 2O5XL 3GJFB 1BGXH 4LSSL 2R29L 3S3SA 1DZBA 1PZ5B 2EDNA 4POZD 1ZGLA 4GRWE 2AJYH 2X05A 4IEFB 4UILL 4YO0B 3NN8B 1KG0B 3VD5A 3FB5B 3ROOB 3W11C 3ARDC 3RI5F 5EU5B 2R1XA 5FM8A 2UWEE 4OCYH 3G6AB 2B39A 1GJIA 1MHEB 3SDXF 3PIQB 4P9HL 1BZ9A 5HY9B 5EPMB 4GBXD 3I75B 5I66A 1M05A 1CL7H 4OZFB 1UM5L 3BIBX 4Z76B 4JFYB 1MI5A 4OKVA 1RZKL 1DUYB 1YNKH 3IJYB 1UA6L 4DN3L 3EYFA 2EZ0D 1NJ9B 2AJVL 3MA9L 4G5ZL 4DAGH 4FQIH 1SJXA 4Y16D 4KHTL 1QLRA 3BRDA 1UZ6E 4IJ3C 4KDWA 4XMKH 3LQZA 2ENSA 4KJPC 3Q48A 1E27B 3I3EA 2OR9H 4MB5A 3QIWA 4XNXL 4PV9B 4NPYA 4CADB 1SEQH 1CD8A 2AJSL 1S8DB 5I19L 5EU3A 2LU3A 2J8UE 3BUYA 1JN6B 2DQHH 2NZIA 1QQDA 1UZ8A 2O5ZL 2WBKA 3ESUF 2VB5A 1CGUA 4JZJC 5IEHA 4U1IB 1QOKA 4QT5A 4NO3A 3KYKH 4PRHE 2VDLH 1IC7L 4LCWE 4NYLB 3BH9B 4PJXE 5HPMA 2ZPKH 1B0GA 5JHDA 3I6LD 4HSQA 1PX4A 3VWJD 4OZFG 5D7IF 1NANH 3ZE0F 3AREB 1F02I 1QBMH 3MRDA 3TV3H 4HK0B 3L95B 5JQ6H 4KZEL 1NFIA 3UTSA 4JRXE 4E42B 3SDDC 5BV7L 5FKPA 1LE5B 4LCUB 1I7RA 5H2BB 3LRHA 4LSTH 2E7HA 4YDIL 1UQSB 2HN7B 3D18A 3AM8C 5ANMA 4LVNC 4BH7A 5LQBH 2Z8WC 4JM4H 1DDHA 3MRBB 4POUB 5CINL 1IL1B 1I85A 4F7PA 1SMAA 5D5MA 4HEME 2YPLB 3T0EE 3STBA 5DQ9B 2LU7A 2L0DA 4I1NB 1PSKL 2AEPL 4KRPC 2CLRA 3C5ZA 1ZLSL 1OAXL 1JHTA 4HULB 5C6TH 1FCCA 1IM9D 1ZA3B 2DBLL 2EC9U 2AGJL 2HMID 4HH9A 1YMME 3TBWB 3LKQB 1NDGB 1BD2B 3ORJA 3PP3H 1KEMH 1PD6A 4ONFH 2JCCE 3KPNA 1FYTB 1MAJA 4U6XA 5IQ7H 1UJ3A 1MAML 3GZKA 1Q9OB 1J8HD 4I48B 3DYMA 2HT2D 4KQ3L 2F5AH 2LE9A 2D03H 2V7NB 3F58L 3U36B 4U1LB 1G9ML 5EO0B 3RA7H 1ZS8A 1X5FA 3MV7E 4A2MA 1T0MA 3PP4H 2GY7B 3P0VL 4WEBH 4CVZA 3NCFB 3B9DA 1CU4H 4LFHG 3BMWA 4Y4FD 3VRLE 1RZ8B 3EDKA 1RI8A 3ZZ1A 5IGXH 3T4AA 3ZKNC 4EBQL 1AI1H 2OMNA 1P7HL 1ZA6A 3PL6D 4HPYH 3IJSB 4G8GE 3GKZA 1XF3B 2QHRL 2VDNL 2R69H 1VADA 3RZCA 1JGEA 5HI3D 4XXDB 5FGSA 2MTPA 3INUH 1SM3H 3DGCR 4EVNA 1DE4A 4XPHH 2IQAB 2CGRH 1H9VA 4AEIL 5EBMB 4ZYKA 2O61B 5KW9H 1CDYA 4KK6C 3SKJL 1IAOA 4HF5H 3HPLB 3P4MA 2M1KA 1ZHKB 2EDFA 3FHQA 2AJZA 1K2DA 3GI8L 4Y89A 5MERB 1MCFA 5C9KA 5I1DB 5CHNB 3IDIA 4QRPA 2NX5A 3MRMB 2NZ9C 2V2WB 4NNXA 1ADQL 2CK2A 4IJ3B 5IMOA 4XPAH 1WFNA 2VLKB 3V5HA 4Y5XA 4ERSH 2AI0L 4MWFB 2AABL 4XRCA 2XN9A 4YHPB 4OCSL 3HE6D 1G1YA 3PV6A 5IVXA 1FYHB 1TVHB 1MLCA 4HDIB 5FK9B 5DVNA 3GI9H 4Q97A 3SE4C 1GHFL 4LPYA 4Y19B 5EO1B 4A2LA 4X6DB 3LS4L 4JZJB 2HKFH 4Z7OE 3OAUL 4XI5C 1LD9B 2YD6A 3R8QA 4HFUH 4MX7A 4JQXC 4R26H 2IBGA 3PWPB 3SE9L 5F8RC 3M17B 4PG2A 2G60H 2X10A 1LEKA 1UWEH 3ARFA 4X6CA 4AYFA 5DJYA 3NIGE 5F9JA 2A9NL 5KAQF 3QAZB 4PRAB 2CLVB 2B2XH 4C59B 1DQJA 5I8OL 4RAUA 1OTTC 3QCUH 1QKZL 1VFAA 4KI5E 1H15B 4K3DL 4P2QA 3GSQB 5T1MA 1CGYA 3P11H 4MQ7B 5D1XD 1FP5A 1I3VA 4K3EL 1I3GL 1TQCC 5T5NF 4ELKB 4GXVL 5ALCH 1I1AD 2CDFB 3L3OA 5F7EL 3EW3B 1RZKC 1T7WA 4NC1C 4XBGB 1ORQA 4P59H 3MRHB 1HEZA 3E6HB 1CLYL 4KRPB 3V4PL 2DB8A 3WFBH 1VEOA 3HR5A 2VH5H 4QHNA 3QDJE 4NO2B 2WAHA 3O2WH 5CCKH 5DQDH 1R3KA 4LLVA 3TZVD 4Y4KC 3SKOA 1KENL 3O0RL 3FO9A 2QHLA 2P43B 4X98B 5C3TA 1BIIA 1CK0L 2Z31D 4HT1H 2Q76B 4FQPA 4JZOB 3ULUD 1S7TB 3K1KC 2P44B 3QIBC 1NMAH 3IDUA 4KUCF 2DJSA 3O41B 3O6KH 4HUXB 4TNWF 4OGAD 4R4NC 3L5JA 4KY1L 5DFWH 1S7QA 3RGVD 3MACH 4ODUA 2O5XH 4LSSH 2R29H 1CS6A 2YUVA 4G6FD 1CGVA 2ADIB 2UUDK 3O2DA 2DDQL 4UILH 5BV7C 1D5MA 4CL7A 4FXKA 3N0PB 4XB7A 1JHKL 3RNKA 1OPGH 5MHSD 4R0LC 3BDYH 4NCC2 5J6GB 2UWEA 3SPVB 3AFLA 4P9HH 3W9EB 4BSJA 2VISB 3TA3A 3AMLA 5J13B 1ES0B 1JTPA 3W9DA 1UM5H 1BAFL 4S10A 2CUHA 1UWGL 1OP9A 1D6VL 2DAVA 2NTSP 4AL8H 3L3IB 3QNZB 1CFBA 1RZKH 5D7SL 8FABA 3QXAA 3MA9H 2AJVH 3EHBD 4G5ZH 3HN3A 3STZB 4M8VA 5JTWA 1G1CA 1KPUA 4S2SA 1Z5LB 4KHTH 4WFEE 4I8DA 3R06A 4EIZC 5DHYA 2PO6A 5L2KD 3B3IB 4O2FA 1PKOA 1ZHNB 5EO9A 3WNMA 2VLJD 4OIBA 1NGXB 1R3IH 2LTQC 2X4UB 1KF9B 1V7ML 4XNXH 4J3UA 4LSUL 5ICYA 1H3VA 2AJSH 4L8DA 2VXUL 5I19H 5D1QC 3QFJE 4EOWL 1KCLA 1A7NH 3EFDL 1I8LC 4OUUB 1G9MC 5JW5A 2J8UA 4EJ1C 4ZS7L 1B6UA 4GQPH 4NT6B 4EXPX 1QNZL 2VDOL 4IM8A 3UZEA 2FJGB 1IC7H 2B1AL 2AXFA 4I18C 3MJ6A 4RMSA 3ZE2F 4LCWA 4PJXA 1OVZA 1OLZA 1J1PL 1XGUB 5E94B 3I6KB 1UM6L 1QSED 2QADD 5JIPA 1QO3B 5DJ8A 5HVWA 3ZT6A 5FA4B 3IDNB 3QHTC 5EZOH 5D96C 2C7UA 3FQXB 4KZEH 1JGVH 4JRXA 3TGXA 1IGCL 1CG9B 4BKLA 2GCYB 1TQCB 5IESL 2GFBB 3SQOL 4K23L 4PJIE 1UENA 1G7QB 3L3KB 1HNFA 1EXUA 3GDBA 1UH4A 4IOIB 5IBTH 5ITBL 2DQDL 5D5MF 3T2PA 3VXUE 1OF2B 4RRPA 4ORZC 3T0EA 1AR1D 1F2QA 1PSKH 2PNDA 2RJMA 3QUXC 1OAXH 4Y4KB 3BEWA 3VE0B 1WAAE 2DBLH 2AGJH 4PJ7B 4K2UH 4RDQG 3WJLA 4K8RL 1P5VA 1YMMA 4LPTA 5CZXC 3RIFK 1RZFL 4O9HL 4X5LA 5EBWA 1HYSD 4QXUL 3QIBB 2E9BA 3H9SD 1I7ZA 2RR3A 4IBLT 4OKDA 1FJ1A 3D69B 1JNHB 2JCCA 2YD8A 1A4KA 5IOPA 2VXSL 2XYCA 3W82A 3O4OB 4YDJA 3C09C 3F58H 3LQMA 1A6UL 4MA7H 4ODSH 2C3HA 5D7LB 3S3JA 3BH8B 5TDOB 4XP1L 5B38B 1WBYA 1F2XK 4ZNEE 4WWID 3FCTB 3Q1SL 4EBQH 1CGWA 3GSNA 4R4FL 1YMHB 4U31A 2OL3A 4R0LB 4G8GA 2QHRH 4NO0A 1R24A 5HHQB 2FB4L 4OZGE 5DMJB 5GIRB 3N1MC 4HG4J 3H3PL 4LHQB 1RHFA 3KLDA 3V0AC 2MJWA 2FO4B 2QR0A 1D5IH 4MQTB 3X3GL 3D0VA 4AEIH 2CXGA 1SJEA 1UC6A 2R39A 5FV1L 2J1KA 4KKBD 2Z91B 3WFDL 3ZKMC 3VXMB 3DETD 1B6DA 3BKML 5IUSA 3S5LB 4K71B 4OFYD 5J57B 4DKAA 2D7TH 1EO7A 3SGDH 3GM0A 4F7EB 2B1HL 3V7AE 1ADQH 3KHOA 2Q7YB 2EIDA 5CZVL 2AI0H 1Z0NA 1U3JA 2LFGA 4M48L 3TT3L 4MLIA 3QQ3B 4PJ8C 5B38G 1EMTL 4RX4D 4EI5D 5IVXF 2BX5A 5EU4A 1M6OA 1MFAL 1P9MC 4JPWH 2EH7L 3IAGC 3VRJA 1GHFH 1Z9LA 5ACZB 4OFVA 4RMVA 3ARGC 3LKSB 5BS0B 5E9DB 4M6AA 1ZT1B 3U4BL 3QO1B 1FL5B 1AD9B 3ARBA 3QJHA 3BQUB 3MYJB 3VGBA 3VI4F 3SE9H 3DGGB 3EJYD 4MNQD 1IJ9A 4ZUVB 3IU3A 5F89A 2CIKA 1B0RA 3S5LG 3HAEA 3MBED 4X6CF 3F62A 2H3NA 3K74B 3SE3C 1FG9C 3Q6GL 1DQDL 2X4SA 4Q6YA 3SKMA 1QKZH 2GSIA 3C6SB 3IKCB 4K3DH 3MODL 1RVFL 1AJ7L 5AWNL 4M1CC 5C0CB 1LO0L 4IRSC 2XTJC 4K3EH 1UEYA 5FYLD 1N2RB 3NFPB 3PHOB 4U3CA 3BIKB 4GXVH 1DSFL 1KEGL 1JUFB 4ONGL 3V6BR 5F7EH 5C0EA 1KT2B 5E2TL 2C9AA 5IFAL 4ZODA 3V4PH 1CLYH 4ELME 2AQ2A 3UBXI 4JPIB 4ZUWB 1I1CA 4NC1E 1X6LA 4RGOL 3NCYS 4GOSA 3DO7A 5KSAA 1X7QB 3QDJA 4K7PH 4Z77A 1CGTA 1W0VA 1UCTA 3MRPA 2XPGA 3BAEL 3O0RH 4WV1A 3BP5B 4U0RB 3NFSL 1FFNB 2BRRL 5HYJB 5BMFL 1JZ5A 4URTB 4ZUUA 1QSFB 1CT8B 1CK0H 5F3BA 1WISA 2FWOA 4NWUH 3C5SB 2DL9A 4PJ5D 1LILA 1YNLH 5GRUL 1JK8B 3G5ZA 3NMEA 4KY1H 4M7ZC 4U3HA 3CDYA 3DTXA 4GKNA 4LVOC 3WEXB 2HRPL 3MV8D 4PG9B 5LXGL 3SGKC 4R7NA 2DDQH 3EOAB 2VZTA 4GRWF 3BZFA 5CWSA 4LCYA 3OAYH 5JIHA 3WSQH 1XIWA 3I50L 3LIZL 4JLRA 2BVTA 3H7LA 4HK3J 4R90H 2BY0A 5E6YA 1HWHB 2G75A 4Q9CA 3KWWA 1F3DJ 4MCYA 3GRWA 4PRIB 3I3BA 4HIHB 1BAFH 3M1BB 1AP2A 1D6VH 2D7MA 2BSRA 5CJ8A 1DUZB 3QZWG 3WS6A 1TLKA 4AH2A 3TCXA 4NRYA 5TE7L 3QG7L 3PE9A 4PLKD 2NXZB 1S78D 1UXSA 5TDNB 5KVMC 4HUKB 4PGEA 4FNLL 4ZXBB 5LCVH 1P69B 5IMKA 3P9LB 5H35A 5IMLB 1MUJB 1V7MH 4LSUH 3MRCB 2XQYK 2FYYB 5FDWA 3CPLA 4EOWH 3RPIA 3U7YH 5DHVA 3GK8L 1YY8A 3EFDH 3QFJA 4DGIL 3BDBA 2ATKB 3IU4L 4NQDD 2JE8A 1WIUA 5JXAL 4ZS7H 1KFAH 2VDOH 5HGHB 4LLDA 4HZAA 3DX6A 2VAAB 1F4YH 1NC2D 2B1AH 1DP0A 4XTRC 1IM3A 1AGBB 5DJAB 5E24E 2ICWA 3LEYH 4XMLL 5KVFL 1G7JA 4RA3A 3QH3B 4LVHC 1X5HA 1AQDA 2YOCA 3FT4A 5E7FA 5FOBA 4ETQA 3TBSA 1IGCH 4K07A 5I9QB 4GO6B 4IRSB 2YN3A 4DN4L 2NY7L 5IESH 3SQOH 4K23H 4JO3L 4BK5A 3SDDA 4PJIA 4C56E 1OD7A 3ZHDA 3TIEB 5ERWB 3QUZC 3TYFA 4JCMA 3X17A 3HG1D 1F42A 5T1LA 4P9ML 5ITBH 3IXAA 2DQDH 4PJ9A 5EZJB 5F8QC 4NQVB 3MJ7B 4G80A 4LGSB 1PY4A 1F11B 3QDGD 2OYPA 3UBXA 1ROWA 2A6DA 3QXTA 2R2BA 1DLFL 1S5HB 4RQQA 4W4OC 3CX5K 1HHIA 1WAAA 4S1DC 4UDTA 4K8RH 1J5OL 4O9HH 4TUJA 4MQXD 5T3XD 4QXUH 3C60C 5LAXA 3RTQC 2GJZA 5CGTA 3OZ9H 4WI8A 4KHXH 5DDHA 1JV5A 5K9KB 2JCCF 2DQFA 2VXSH 2VZUA 3QCTL 2Q6WA 5DMIL 4POZC 4JM2B 3I3DA 4R96B 4EI6B 5F7MC 2PXYD 3OKEB 4JFQA 3RWJA 4WFGD 3Q5YA 1AO7D 4XP1H 5DMKB 2PCPA 1GRWA 4WNQA 1MCOL 1RK1A 1VCAA 1C08B 4QHLB 4H88L 3RAJH 3RRQA 2O5YL 3KG5A 3Q1SH 3SOBL 1Q94A 5IT2L 3F6IA 4XPGL 3BPOC 2CLZB 3UTZB 3Q3GB 3JWNC 5IJKA 3LV3A 3H7BA 4PR5A 3H3PH 4X8JA 2EZ0C 3F7VA 4LHUD 1GPOL 3NFNB 3B9KD 4PP2B 3D9AH 5F7HA 4UT6H 5EU6E 4FQCL 1BLNA 3L3HB 4TRPL 2J5LB 3QBTB 1DQTA 1FAIL 1OWWA 3BKMH 4XVJL 4AEFA 4DZ8B 4ODTL 3WO3B 1J0ZA 4LNRA 4P57B 2P5WA 3MXVH 2W60A 3MGOB 3K80A 4YHIA 3S4SB 4GRLD 4L3EB 4KAQL 2B1HH 3VXQA 1QRND 3D2UB 4PTUB 4JEGB 5CZVH 1N6VA 2EO9A 3AS1A 3ULUL 4JJ5B 4M48H 3H9HA 3TT3H 3QIUD 4G7VL 5DI8B 1EMTH 3GSOB 4MA8L 4XVUD 1U3HD 1WC7B 3SJVB 1MFAH 4YHYB 1PKQB 2R2EA 2X4QB 3VWKD 3DRTB 5EOQL 5CD3B 2EH7H 3DV6B 2B5IC 5D9SB 3MR9A 4M3JA 3VGDA 3WHXB 3U9PH 1TVDA 4XVTL 5DK2B 1MJJB 4CJ1A 3VWJC 2HVJB 2QJDA 3U4BH 4JFXA 4Z7OF 1UH3A 4HWEL 5SWSE 3GUTB 4X9BA 4XNYL 4HWNA 2AK4E 3GB7A 4ZO6A 5B39B 4N5UA 3MRNB 1FH5H 4LDLB 5FHBL 4NBXB 3FMGL 1D6EB 3CVHH 4P5TB 4YIQB 2G2RB 3RWDB 5DT1L 1NGZB 3PWUB 3BGFC 1HQRA 1NMCC 4HAFA 1I3RB 3TLRA 2XQYG 3Q6GH 5J89A 1DQDH 1IAIM 1KJVA 5TGBA 1JI1A 2R23A 1RVFH 1AJ7H 1LP9E 4GRMB 5AWNH 1QR1A 2W9DH 3V6ZB 3TPUB 2F53D 4O5LL 3ES6B 1LO0H 3D48R 5TQ0L 1ULVA 5GGSB 1CFNB 5ACMA 4NKQB 4L5FL 4PGDB 5EC1B 5TE6H 1NGYB 1KEGH 3FN0L 1QHOA 4ONGH 3CFEB 2XTJE 4R4BA 4ZAKC 5I16A 5DD6B 2HMIC 1C12A 25C8L 5IFAH 3V4UL 5DSCA 1NDMA 3NIFF 4RGOH 2BNRE 5SX4H 4WO4D 1G6RA 3C2SA 5ADOL 4DEPC 2OZ4H 3EO9H 2HT2C 3C60B 3NFSH 3RTQB 2VQ1B 3KGRA 4B41A 1U8PB 3RNQA 5GRVK 5IWLA 1HSBB 2OTUB 1A6VL 3UTTE 3AY4A 1RUMH 5I71C 3AMKA 3MLRL 4Y4FC 2ZSVB 1HKLL 3FQNA 1JPFA 1JPGA 4WDIA 4P5KB 3O3BA 3QPXL 5F1OB 3WN5A 4Q0XH 1J11A 4WTWA 3PL6C 3CVHB 2HVKB 1BFOB 2Y6SD 2R1WA 1WZLA 3TVMD 5HI3C 4RFEB 4XNQB 3WKMH 5LXGH 3GMOA 2UYLB 2P5EE 3BPOB 4WWKD 4B0MM 5FFLA 3MJ9A 2APWA 2V2XA 2CKBA 3VFMA 1OP5K 3I50H 1VFBB 3LIZH 5MEQA 1LO2L 4BSVB 3FONA 2AEIT 3OX8B 2VSCA 3ALWA 4J4PD 3N9GH 2F74B 1EHAA 3E6FA 2VKWA 1L9NA 4MGXA 3ME0A 1NAKL 2XNAA 4G6JL 4HWZB 3IETA 3HE6C 3VRIA 3F6LA 3CDGB 4EEEA 4HKZA 2DTML 5TE7H 4WHCA 1MNUL 3QG7H 4OLWH 4TPRL 2BNQD 2AJXL 4PJHE 3U4EA 5EC2B 1BBJA 5K9QI 3S8WA 2DRUA 4NM4L 4HFWA 2P48B 3UYRL 3L5XL 4DQOL 2N7AA 5BVPL 4HXAL 4LCCA 4AY0A 3IDGB 1ZLVK 1RZGA 3RWEB 2DBJA 3VWJB 2YPKA 1CDBA 3MO1B 5E6ID 1M7DB 4HLZH 3X13B 1KB5A 1AXSA 3GK8H 3TO4D 5F88A 4PJGB 4DGIH 1IEHA 4X4MA 3IU4H 4GAJH 3LEXB 1BJ1H 1BQLH 3UJIL 2VN4A 2CIIA 5JXAH 1RPQA 5KZCB 4V1DE 3OPZL 2EIZA 4UIMB 3RVVD 3MMEA 5HHOA 3OR6A 3VFWA 2QQNL 2EO1A 2VLRB 5D1XC 4OZIF 3MGTB 4PJAE 3T8XA 4X4YA 4I18A 3PWVB 2MKWA 2R0KH 4ODXA 5CSBA 1FGVL 4O58L 1A6TA 4Q6IC 3DX9A 5CBAA 3LH2L 2H1PL 3MLYH 3HI1A 4XP6H 5HSFA 1IGIH 2C26A 4XH2A 5C09B 5I6XC 1A7RL 3D39D 1AGCA 4JO3H 3VFPA 4YHNB 5HGDB 4PJIF 5IB5A 1IM9B 1ZWIA 4D2NA 4ZAKB 4C56A 3O3EA 3QWOA 4AK1A 1U92B 2Y25A 3FRPG 1HINL 4XPBL 4P9MH 3TZVC 2NY1D 5DO2D 4NN5B 4UQ3B 4N90E 5E2VH 4M5ZL 4QGYA 3MZGB 5AUMA 2R1YA 3ZKXC 5L8JB 5JLZB 2Z31C 1FZMB 2VNCA 3ULUC 2D9CA 3QUMA 3MJ8A 3T1FB 5K9OB 1T1ZA 1DLFH 5DEFA 3HI5H 1WAAF 4NGHL 4OGAC 5CJXC 1FN4A 2FECI 5J1AA 3SGEH 5C9JB 5I71B 3RGVC 3O4LE 2NY2D 4LDOB 2V2TA 1FIEA 1WLHA 3VW3L 1DBKL 3PGDA 1MELA 3QCTH 5DR5L 5DMIH 1SJHA 4XHJD 5IHUL 4WGVB 1BVKA 3GMNB 1EX0A 1CN4A 3O9WB 5E8PB 4HJJH 3RVWD 5B4MD 1RJYB 4MD0A 1HI6B 1GZQB 5J9PB 4MJIB 1W72H 4QTHA 4OIIL 1QYGL 3CFKB 4JDVB 3VXOA 1INEH 1OAZL 2YD1A 2X4RA 4LKXB 4P3DA 5C0BA 3TBVB 1NCDL 3ARYA 2EE3A 4H88H 5F1IB 4L8CB 2O5YH 4C83B 3I6GA 3SOBH 1P4LB 3K3QA 3LN5A 4QHMB 3MLWL 2ZUQB 4I2XB 4GW1B 4I5BB 1U8MA 3N1QC 1IFHL 5C71A 2IFFL 3BWAA 5I75B 3GSWA 2NY4D 1RUQL 2DM3A 3EHBC 4I77L 3UTQA 2EDTA 4ZSOB 1GPOH 3PGFL 4HLZG 1XGPA 1OGAB 4FQCH 4TRPH 2XA3A 3C87A 3QSKB 1E28A 4OQTL 4P4RB 1CVSC 3BT2L 4XVJH 2DOCA 1Q0YH 2FDBP 3WE6A 1MJ7L 3QUKA 2ARWA 3TCLB 2BC4A 1ONQB 3ARTA 4KAQH 1O0VA 2CH8A 2MMXA 5F7LB 1GZPA 1A21A 1M71B 2VXVL 2V7HB 1UVQB 1E4JA 1QVOA 4N68A 2XWTA 4QLRA 4OCWL 3B9VA 3OSKA 4MA8H 3F7RA 3QWQB 1XGTB 3C08L 5EOQH 1EEZB 3R8BB 5DWUL 4NDMA 3UEZA 1BQUA 4CDGC 3IXTA 5EZLB 4GLRI 4LPCA 4RNRA 1S7SB 1CFQB 3ROLA 4RFNC 4E9LA 1W72B 1A3RL 2QADC 3KPMA 3C8KA 3BP4A 4HWEH 4I3RH 1OY3B 4PV8B 4QRTB 5DS8A 2B7DT 4LLYA 4IIQC 1JZ6A 2Z93A 4DFHA 2FATL 2AK4A 4KGJA 3LS5H 3X14A 4NQCD 4JFEB 3FMGH 4P3WA 1AR2A 3HCVB 4WY7L 1CLOL 3G5VB 1JGDB 1LNUB 5D1XB 2CO6B 1EFXD 4XZUB 3IFNH 2CSPA 2YC1A 5DT1H 1Z3GL 3O6LL 1XCQB 3WLBB 4Q6IB 4ORGB 1F6AB 3IRZA 3MROB 4AIZA 1A7QL 3REVB 5I6XB 2H26B 3K4AA 4I13B 3IYLW 1CR9L 1LP9A 5TQ0H 3IDJA 4Q58C 4OZ4B 1AR1C 1W0WB 1RK0A 4C4KO 4ZFOA 2PTVA 3KLHD 2ORBL 3FN0H 3IF1B 1T20A 1H8SA 2GAZB 12E8L 4MJ6A 3FB7A 3V4UH 1JNLL 2Z31B 3S3PA 2W92A 3SN6N 3UDWC 4N0UE 3FT2B 2BNRA 5ID0B 1P7QB 4N1EA 2YWYA 4JFFD 2GJ6E 5ADOH 3WS3B 3RGVB 5CUSL 4GG6E 4PGJA 1J8HE 2NY3B 4RAHA 1A6VH 4OZHE 1VDGA 3LOWA 5MI0C 4Z7QE 4JDTL 1RAMA 3MLRH 3QG6B 4HIIB 4J8RB 5D7JA 2DL2A 3QNXA 4G6FB 5AD0B 5EOTA 1HKLH 4HX1B 1MI5D 4LEXL 3QPXH 3WFHB 5C0JB 1N64L 5IW1B 3EDEA 4N0CD 2P49B 1MHCB 3PABA 3PXHA 5DLMH 1T2JA 5CP3H 4NQSA 3BVNA 3BXNB 2OTPA 4OLUL 3HFML 4DZBB 4RAVA 4LK4A 5TQ2L 4NO5A 3HPJB 4Q9RH 3BD5A 2AEWA 2GITB 3OXRB 4HWUA 3QIWD 2OJZH 5GGVL 1BIHA 4KKBC 5GGTA 1ZGLP 3SGKA 3DETC 4GW4A 4U6HA 3TIDA 5MP6L 2WBJA 1LO2H 1WCQA 5EUKA 5B21A 1HH9B 3RPKA 1YECH 1ZANL 3B43A 1BBDL 1JE6A 1QFWM 5ITFA 4M43H 1HHJA 1V5JA 4FTVB 4ZFFB 4J3OC 5L2JB 1NAKH 4YFDB 4FP8L 5E8OB 4G6JH 5JHDD 5IR1B 5J7CC 5E03A 4MNGE 4QNPE 4EI5C 3ZHLA 4M5YL 2GUOA 3V5DB 4TPRH 3S37H 1YPZA 3UTSD 4X7SL 2D9QB 4KH2A 4PJHA 2JK5B 4PJCB 4NM4H 1O5DT 1OAKL 2DD8H 3NAAH 1I4FA 4XCNB 2ZOKB 3UYRH 3L5XH 4DQOH 1MPAH 5SWQB 1VEPA 2PW1A 4HXAH 5I73C 2CDEB 3MA7B 4NKDB 3HC3L 2PW2B 5MEPB 3FQRB 4DK6A 1SVCP 2JJSC 3EYOB 3QNYA 4PRDA 4E5XB 4PB0L 1I9EA 5HGBB 3UJIH 3WIIL 3MBEC 4AEHL 2QSQA 4LSRL 1H5BB 1G7MA 2FL5A 3OPZH 4OTXH 2CR6A 4MAUH 4V1DA 3ZYIA 3B2UC 4F37K 1WWAX 3DWTA 5FCUL 4IMKC 3OJMB 3MCLH 6CGTA 3GSUA 5E6ZA 5DURD 4CBPA 3DVGB 1I7TA 1FGVH 2FH8A 4WVRA 2HG5A 5CS7A 5DHXB 3EOYG 3A6BL 3LH2H 1TZGL 1PW3A 5LGHH 5JUEH 1A7RH 2YPVH 4OGXL 1MJ8L 4S11A 5CD5D 5I15H 1S7XB 4PGCB 5F7DB 5HGGS 1N59A 3QDMD 2W65B 4EDWL 1CE6A 1G7LA 1TCRA 4M5ZH 1T5XA 3H9SB 1A7PL 1TTGA 5T1KB 5DRWB 1VSCA 4Q9QL 1UB5B 1Y18B 2ICCA 2FEDD 2QQKL 1L0QA 3CJJA 3VMOA 1EBPA 4PS4H 5DD1L 3RZCD 2VLLA 3CUPB 3UROR 3HLAA 2CJUH 2ARJB 5DYOB 4ACPA 3OJVC 4NGHH 2DTSA 2R0WL 4LSVL 1FFQA 3ULUE 1CGXA 1HZHL 3IVKB 3QO0B 5MI0B 3WJJC 5GSRB 3QEHB 4GJTB 3LKOA 1S9VB 1CXEA 1FVCA 3O4LA 5LVEA 3VW3H 1DBKH 5CJBA 4KTYA 5I1KH 1XGQB 1IAMA 5DR5H 5IHUH 2NY6D 3C8HA 3ZHKA 3IDMB 1FNFA 3SGJA 5HDQL 4QRPD 2IBZY 2NX5D 4OIIH 1I8KA 1QYGH 1U8NB 3G08B 1OAZH 1RY7B 4YHZH 1NMBL 2IFGA 2MHAB 4M61B 4LDEB 3U0PB 2XN9D 2CDGA 4X99A 2Y7QB 3IS0X 5MHSE 5CIPA 4R9HA 4C4KT 1LWRA 4HWBL 1MLBB 3MLWH 3I2CL 3V52L 4WUKL 2IFFH 5FUCC 2K3TA 4HPOL 4M6OL 4GBXA 2ERJB 1RUQH 5GZOD 2VAJA 2OQJA 4I77H 1A1MA 3LD8C 3OB0H 4PLKC 3KPRB 1FVEB 3PGFH 1S78C 1VKXB 2ID5A 4EKXA 5E2UL 4OI9A 4GMSL 1FBIL 3DV4A 3BT2H 5IIEA 4Y2DB 1E4WH 1IMHC 3ARFD 4ALAL 3QEUA 4Y16A 3O45B 2AQ1A 2XTLA 5L2KE 3T4YA 1CL7I 1R3LB 4RZCA 1MOEA 4HMCA 4NNYA 1U95A 2VLJE 3BW9A 1MCPL 4DJMA 3U79A 4P2QD 5B8CC 2E7LA 2MOVA 2VABB 4OCWH 5I73B 4EQ3A 5KVEL 4Y0GA 4JN1H 4XBEH 2EEAA 2G9HB 4DUWA 4P5MA 5DWUH 3MCG1 2NLJA 4JZNA 4TULL 2VC2L 2DLFL 3MBEB 3QQ4A 1PYWB 1A3RH 1GGYA 3O8XA 5I1GH 4D8PB 3N06B 2XZQL 1F4XL 3S9DB 2L7JA 4K7FA 4LLUB 4PLNC 2VQUA 2FATH 1QSEE 3EO1A 1K6QL 2ZUTA 2A6IB 1WWWX 1XZ0A 1LEIA 2ITCA 3KLSA 5M7QA 4ODVH 1L0XA 3REWA 3JV6B 1Q9KA 1A7QH 2JB5H 4NN7C 3KPSE 1GOGA 1P7KA 1NANI 2P24A 2WNGA 4PP1D 3VFVB 5CEZL 1CR9H 3WLWD 1IGML 4Z7WE 1LP9F 5ESAA 2Y5TB 4XP5L 1ZLUK 1H0DB 1C5CL 4YUEL 4JVPA 1OGTA 2ORBH 5DVKA 3TJEL 3VFTB 12E8H 4UTAL 4LP4A 1A2YB 1JNLH 3MLUH 4GKSB 3FB5A 5KOMC 3BI9X 4MQXC 1BZQK 1DQLL 5ESVA 1OAYL 2KZ1B 1URLA 4JFPA 1DEEB 4PJ5B 3EAKA 1ZAGA 4MD5A 1I1YA 4L8BB 1WSST 2GJ6A 3ZE1E 4X5WB 2Q8BL 4OCMC 1BX2B 1YC8A 4KRNA 5CUSH 2XFXB 2IANE 5F7NC 2PXYC 3S36X 5I1AA 4GG6A 4NM8L 1J8HA 3NA9L 1Y6NR 1BVZA 3MV8B 4JDTH 4OZHA 4JKPL 1HCFX 4L8SC 1MQ8A 1TENA 2C4XA 1XR8A 4PRNB 4LEXH 3AXLB 3MRGA 3RUGE 2RB8A 4B50A 4N9GB 1N64H 3ALPA 4MA3A 2E5EA 3WIFA 3LSOB 3BEVA 4Y4FA 2P42B 3RWIA 2CMRL 1FC1A 1QZ1A 2Q7NA 4MLSA 4OLUH 1E27A 4M93B 1CQKA 1RJLA 2PO6D 3HFMH 4PV9A 5TQ2H 3BZ4B 1KC5L 4KTDL 3BKJH 5E4IA 3MOAH 3B9KC 4HCRL 1YYML 5GGVH 1JN6A 3MJGX 1EEYA 3FOLB 4W4NA 5MP6H 5IB4B 1RIHL 5AYUL 1KELL 2BSSB 4KPHL 4PREA 4U1IA 5DD5L 3WO4B 4JPVL 4RMTA 1ZANH 1BFVL 2MKLC 2BVPB 3D0LB 1ACYH 1KLFA 4WUUB 5IJVB 3WYRA 5FKAB 3TEUA 1Z9SA 1EO8L 3LDBC 2PN5A 5F7WC 5B3JE 3BE1L 4FP8H 3MX0A 4AENA 4YX2H 1T7ZA 4LCWD 1CTOA 2QLVB 4HK0A 1NEZB 4XVUC 1U3HC 4M5YH 4F9LC 1JPSL 4X6BB 5HYSB 1YPZF 1ORSB 4X7SH 5DZNA 2H9GB 4NQDB 1HN1A 4PJFF 4PJHF 5IW3A 3MXWL 1U3YA 4BM7A 1NEUA 4PB9L 4KJWD 4APQB 1MIEL 4NQXA 3UAJC 5J1SC 4IMLB 5BXFA 3RL2B 2XKSA 2YKLL 3HC3H 4QOKD 2OJEB 5EDXA 2YD3A 1OQXA 3QFDA 3GMLA 3BUTA 4ZUTB 4EIGB 5DEGA 2I07A 3WIIH 3SBWC 4LSRH 3HMXA 1FZOB 1GSMA 1KPVB 4MNQE 3T0ED 1ZA3A 3EGSB 5HYQB 1IQDB 4X9IA 3TBWA 3R0MA 5FCUH 3THML 4E41E 3CXHJ 1FNHA 5CEXB 1LHZA 1JYXA 1UYWH 2E9JA 3DXAA 3VFUB 3UPAA 1NBZB 1Q9OA 2IH3A 2ZSWA 5F3HA 4J12A 2P8PB 4MSWB 2AK1H 2AV7B 3U1SH 3BMVA 3RY6C 5T33H 4PRPB 3A6BH 5FYLE 3U36A 5HYSG 4LQ1A 1TZGH 3P77B 4KKLD 2BOBB 1KOAA 4OGXH 1I1AA 4GUPA 1MJ8H 2HTLD 3OXSA 3E2HC 4FHBD 2YK1H 4JN2B 4LSPL 4WO4C 4H25A 4TVPH 3RJDA 1J87A 1RZIA 4EDWH 1SYVB 3SKUD 3S88L 1MVFA 4XX1E 4QCIB 2DYPA 3ZKSD 1A7PH 4Q9QH 3H6JA 1CZ8L 3FFDA 3TZVA 5C1MB 1YEDA 3FZUD 4M3KB 2G5BB 2J7LA 5DZOA 4NO0D 5DD1H 1LMKA 3RI5K 5I1JL 1BF8A 2E6JA 5J4MA 5DEZA 1WTLA 3QI9B 1M4KA 5EBMA 2R0WH 3JVGA 4HUUA 1HZHH 1ZT4A 3FQWB 3I9GL 5INDA 2NCMA 3TESA 2UZIL 4WFFE 4PJ5E 5FXCH 3WUWB 3TNNB 4UOW1 2Y6SC 3PQYD 2VE6A 1BVLB 1EA9C 3NPSB 5FYJL 4Z8FL 1WQVT 1A6ZA 1X5KA 2QV2A 4P2RB 1FZJB 3MRMA 5F96L 3DO3A 1GIGH 4YH6A 1KN2L 5SV3A 3MRJB 5HDQH 4U2ZA 2VL4A 2I25N 4YHPA 4XBPB 3BGAA 2YN5A 1T6WA 3MV01 1TVHA 3CH1B 4LHUB 2MWCA 3EO0A 4HDIA 3B9KB 4NKIH 4PUBL 2EICA 5HJ3B 3E8UH 2ICES 5CEYB 4J4PC 4Y19A 5I1IL 4RIRA 4HC1A 2BERA 2J12B 3I2CH 1ZT7A 3V52H 4WUKH 1OHQA 3HTLX 3KPLA 5DD0L 1VFOA 4I0PB 4ZOEA 3CMGA 1AQKL 1QRNB 3L7EB 5FUCE 4F2MB 3ARBD 1T0NA 32C2B 4GMSH 1U36A 1T2QL 1FBIH 2YD4A 5GS1C 4M4PA 2ZJSH 1U3HB 1KCUL 4XC1L 2IEPA 1MCLA 2CLVA 3NGBC 2DS4A 3JV0A 3EKCA 2FHBA 5L2KA 3DX8B 1KJMB 5E6IC 5DF0A 1BQHB 3TO4C 3GMPB 4KK9D 2VLJA 15C8L 2ADGA 2CUMA 5HYIA 3ILPA 1K4CA 4ELKA 3K2UL 5KVEH 3NCJL 4LHUG 1KIRB 2NTFB 3MLXL 4AT6B 2DWDA 5GGRB 4Z7VB 4MAYA 4G43B 1XGRB 3RVVC 1ZTXL 1TQBB 4CN1A 4Z7UB 1GL4B 2ZCHL 3E6HA 3QRGL 2PTTB 4HHAA 2VC2H 2DLFH 4U1JB 1KTKE 3SY0B 2X4TA 1YJDC 4AEEA 4U7SA 1F4XH 1VACB 4DFIA 4OM0L 1FE8L 1RULL 1FRGL 2NW3B 4M8QB 4QRSB 4U2YA 3BRFA 1QSEA 1K6QH 4PFEA 2F53B 2DM2A 5IFJA 4OAWA 1RURL 1N8ZA 3T65B 2VZVA 2R4RL 1MIML 5DJ0A 1S7TA 2I5YL 4AG4L 3S36L 2X70B 4ZTPL 3HS0B 5E08L 1FNLA 3ECBA 3DARA 3SE8L 3KPPB 4K7PY 3KPSA 2NY1C 5DO2C 5FOJA 4UBDD 5CEZH 3E2HB 1BQHG 1IGMH 3ILQC 4UIKL 1U91B 2WWKO 5JA9A 3HG1E 4Z7WA 1C5CH 3WFZA 4YUEH 4MB3A 4H0IA 5KG9B 5DMGD 1CI5A 3DHMA 1T22B 4UTAH 2HT4D 3QDGE 4P4KB 4G8IA 4U1GB 2C1OB 1K4DB 2LVEA 2NY2C 1INQB 2PYEB 1R3JA 3MUZ1 5J6GA 5ICXB 2A1WL 3QJFA 2X1QA 1CVRA 5T3XE 1P53A 3V4VL 1XIWD 4XHJC 4OIAA 2H32H 3WXWH 1A5FL 3HZYA 5BZWB 4ZO8A 3VGHA 4XMPH 3RVWC 5IP4A 5B4MC 3QXVA 2IANA 2X4NA 4GG6F 2C3VA 3B5HA 3NA9H 4P49A 1NBVL 3QNZA 4OZHF 5HHNA 4QRRD 3V5KA 3MYZA 5IEKB 1BZ7A 5IBUB 1J12A 1E4KA 1AO7E 3QEQE 5FM4A 2Y36L 1TJIH 3RUGA 4H0HB 3FO1B 3B3IA 2WK2A 1MSPA 4RGNB 5DZLA 5BO1H 2NY4C 2OSLB 2HT3D 4WFED 1XCTA 4M62L 1KC5H 1MFBH 4KTDH 3LKNB 5J12B 4FA8A 4Z6AT 4TQEL 4NRZA 3MRQA 3LQAL 4Y5YA 4HCRH 1LO5A 1YYMH 4MCZB 4DTGL 3VCLA 5J0BA 5D7IB 1RIHH 5AYUH 1ACZA 4KPHH 1NCWL 5DD5H 1S7VB 4JPVH 2P8LB 3C6LB 1BFVH 1H8OA 2FJGA 2BNQB 2DKSA 4N8VB 2FJFB 2H2PD 4Y5VC 4M03A 4JREC 5GS1B 1XGUA 5E94A 3I6KA 1T1WB 4PRBA 5IKCB 1VENA 3BE1H 4YEFA 1QO3A 2X41A 1VFMA 3NGBB 3B6SB 2BJML 5IBUG 4QNPF 1JPSH 2H32B 5DRZA 5EORL 3TO4B 5FDYA 1O7VA 3NCEB 1CG9A 2EKSB 4XCFL 2F54E 1XFPA 3IJHB 4EI5A 4ZDHA 1TPXC 1X4YA 4PB9H 5BRZD 1QUNA 3L3KA 4E0RB 1MIEH 4H8WL 1C1EL 5J11C 1F5WA 2YKLH 4I3SH 4S1QH 1IGTA 5D4QA 5FAAA 4WEUD 1B4JL 1TETH 5KANI 1MWAA 4Y1AD 5T1LD 2VQTA 1AC0A 4PJ9D 1FNSH 5F1NB 3RVTD 5JOPE 5MEOA 3VE0A 2Q20A 2JJSA 3GSVB 5CBEB 3T77B 2GIYA 1G7PA 3THMH 4JO1L 5CGMA 4MDIA 4XHQA 2A2QT 4E41A 1E0OB 5IHZA 1JHLL 4D3CL 4X6FB 1JZ2A 5DK0B 3GIZH 3LRGA 3TBTB 3KLHC 4YZFE 2D2OA 4IMKA 2NY1B 1CDUA 3ULVH 3BKCH 4LAQL 3ZMRA 3TBYB 2XKUA 1EERB 4UT7H 4TNWK 2WM0A 3SCMA 3ARQA 3P9MA 1KCVH 2G5RA 5H94B 5TH2B 4LSPH 2Y5EA 3KXFE 3V95A 3GBML 5D2NE 2E9IA 5CILL 3S88H 1FNAA 1J88A 4LASL 1WITA 3W0WB 1YMHA 4L4VB 4HUVB 3CK0L 3C5JB 1CFTA 1OTUD 1K5NA 5HHQA 1CZ8H 2GSGA 3GMQB 2ZG2A 3SDXE 5GIRA 5GGUB 3TFKD 5KS9B 5J1TC 4IS6B 2HFFB 5FO8B 5TJWK 5I1JH 2BVOA 1FIGL 5FGCB 4ZFZB 1LO3L 4UU9B 3FO2A 3B83A 1U8IB 3I9GH 1IGYB 2UZIH 3GJEA 3L5HA 2ZCLL 4N0CC 4HJ0D 2FGWL 1DVFA 1HIML 5FYJH 2W0FB 4NQTA 3UTPE 1MVUB 5EA0L 1DBBL 2V5SA 5L6YL 3LPFA 5L7XL 5F96H 4QHKI 2P5WD 4YGAB 1KN2H 2CXKA 3TM6A 3P4NA 3QIWC 1HHHB 2NNAA 4HUWB 2DF3A 1KLGB 2GJJA 1J0KA 1Q9LB 5EWIL 4JFDD 4YE4L 1D9KB 3A6CH 2GTZB 2WWKT 4G6KL 4PUBH 1GYAA 2PUQT 4IRJA 5I1IH 3IS1X 1A9BB 4X6DF 5DUBB 4U6VH 1G7IB 2OR8A 3O6MH 5DD0H 2X9XA 2VZOA 1I8IA 1AD9A 3MYJA 1AQKH 1F6FB 1KTLB 3DGGA 3LCYA 1S9WB 2OXHA 4QRQA 3O2DL 5C7XL 3KLAB 3HZVB 4DCQB 5I76B 1T2QH 4P2OA 3WL9B 5I1LB 3HC0B 4A6YH 1RUKH 3K4ZA 3D25A 4U1MB 1DBAL 4XC1H 5LWYH 5MENB 43CAB 3CFDB 4X7TB 3GIVA 2DQUH 4M1GL 4HV8B 1OD9A 3IKCA 4QF1A 2YD9A 2WINB 5KTEL 5E7BA 1U2CA 4TUOB 15C8H 1I85C 4NZJA 3PHOA 1K8DB 3BIKA 1NKRA 1JUFA 3MLXH 2H8PA 1AIFA 2X7LA 1KT2A 4JGJA 3ELAT 1ZTXH 1ADQA 1WWCA 1U41A 5CKAA 3HZKB 3DUSB 2ZCHH 1SEBB 3QRGH 4Y4HB 4ZUWA 2GT9B 4ZS6D 3K8LA 2M26A 3T0DA 1U8JA 5KAQG 3P73B 4FQXB 4OM0H 1FE8H 4DVBB 1F4HA 4KZDL 3FQTA 1BFSA 2HJKB 3G6JE 4RWYL 4WCYL 2XY2A 1HH6A 4O4YL 2UZXB 4R3SB 4P46D 1RURH 4NUJA 1IAIL 3QDHA 1CT8A 3X12B 3LQAC 1MIMH 2YEZB 5T5NG 3S36H 3OKDA 4AG4H 4YNYA 4ZTPH 5CD5C 5E08H 5BZDA 3FB6B 3L3GB 4BFEA 3D39E 4H1LG 3SE8H 1ZGLB 1FO0A 4Z0BH 5HHMD 2DQCL 2J4WH 4JG0L 4UIKH 3MUGA 4Q7DA 3EFFA 4Z7WF 4GG8A 3CLFH 2FEDC 5IVOA 2GK2A 1GC1L 3RZCC 1JP5A 4ZPTA 1Q0XL 1BZ9B 2DQJH 4BQ8A 5ECJE 4U49A 3LVEA 5I66B 3D85B 1AFVL 3EYUH 1HXMA 1U8QA 1M05B 4S1RL 2W1NA 1L7IL 4OKVB 2JKXA 5JNYB 3EYFB 2NY6C 4H8WC 4YEEA 1NFDB 3HMWL 3VG9C 1BFTA 2F5BL 4HIHA 1HDMA 1QLRB 1RD6A 3LKPB 1GGBH 3DMMB 3QUYD 1L4IA 5IB1B 4Y5XC 4GAGL 1QHPA 3LQZB 4XCEA 2PXYA 3TNMA 4KMLB 5E4EB 2Y36H 4NPYB 1AO7A 2IBBA 3QEQA 4HIJB 3RUGF 3BFOA 5EU3B 3HC4L 4L8SA 2Y07H 5JW4M 5JO5B 3BUYB 1UZ8B 1CF8L 2HLFD 4LNVA 2OCFD 4YXLL 3N1GC 5IEHB 4WHDA 5GZOC 2X4PA 2AS5M 4QT5B 5F6IB 1OOAA 3TC9A 4NO3B 4TQEH 5HVGB 1SQ2N 3LQAH 3WXVL 4X0KA 4BSWA 2BHUA 5HPMB 1FFPB 5E5MB 1B0GB 5JHDB 3OMZA 4PG2C 3MCKB 4JGUA 4F9PA 3ARFC 1I1RA 3U0WL 5KSBB 4HG4K 3SDCD 3QP3A 1NFIB 3UTSB 1G7HB 2WWMD 4YDVA 5DJAA 3BPCB 1I9JL 3GSNL 1IC1A 2I9TA 1JZ4A 2I26N 2OL3L 4GRLA 5HHOD 2MCPL 1I7RB 2QBWA 4UDUA 1A7BA 2C4FT 1MJUH 2BJMH 2C4FU 3P0GB 3WV0A 5IB3A 3D18B 1MRFH 4J3WA 4TTDD 5ANMB 3WIHA 4BH7B 5EORH 5ICZA 1DDHB 4PJBE 3NZ8B 3QIUA 2KQNA 4F7PB 1FFRA 1NCBL 2F54A 1CICB 4F9LA 3VDAA 2X44D 9CGTA 5FGRA 3VWKA 4FFWD 5SX5H 3PNWB 2CLRB 3C5ZB 5ERWA 4HIXL 1JZ3A 1JHTB 1R5IA 4H8WH 2AXJA 2KH2B 1OW0A 5HHPB 2Z8SA 3K46A 2PYFB 5E2WL 1B4JH 4NQVA 1SBSL 3KAAA 3MJ7A 4GW5A 5DJZA 4OD1L 5DURB 2OTWA 3H0TA 4UNTA 4NQCE 4MA1B 1KN4L 4FABH 5C6PB 3KPNB 4U6XB 4F37F 5J3HD 1UJ3B 3MRKA 4KC3B 3X11B 4PJ7F 4JVUA 4JO1H 5E00A 4MJ5A 4PP1C 4FFYL 5F1SA 3WLWC 3EIFA 1JHLH 1ZS8B 4LVEA 1T0MB 4D3CH 4JJHA 4XGZA 4KJYA 1EHNA 5K9KA 1DQQB 3O3AA 2Y06H 4K9EL 1IGJA 4YR6A 2APTA 3N1FC 4LAQH 4R96A 1WCBA 1G9NL 1KTDA 3T4AB 3GSRA 2RGSA 2WANA 4X4XA 1T3FA 2ED7A 2GQHA 1QFPA 5DMKA 3RY6A 1EDQA 1VADB 3RZCB 1JGEB 3PWJA 1C08A 5SWZE 5C0DA 2W9LA 3GBMH 1DE4B 5CILH 5C0BD 3KXFA 4LASH 2JIXD 2F8XC 5D2NA 4ZYKB 3CK0H 4JFFE 1IAOB 3Q3GA 4LLMB 2DLEA 2AQ3A 3NA4A 3OR7A 3P4MB 4PY7A 3SDXA 2UVFA 4UNUA 4XNUL 1CLCA 2XT1B 2AJZB 1K2DB 4FRWA 4OF8A 1FIGH 4DOHB 1FV1A 1LO3H 4UUJA 2YD2A 2NX5B 1N4XH 2IPTH 4PP2A 5FUZL 4NNXB 3S98A 1NUFA 5SX4I 5IMOB 3OKOA 4JVWA 2ZCLH 3B8YA 1GGCL 4P3CL 2A74A 4Y5XB 1MI5E 1EUTA 4P57A 4XRCB 5EA0H 3OBAA 2XN9B 35C8H 1NQBA 4D9RD 3S4SA 2R2HA 2PO6C 3PV6B 4KJQD 5IVXB 5T3ZD 4WENB 5L7XH 1MLCB 4PTUA 3D2UA 3W2DL 4BFGA 1TZIA 3TVMA 4L9LA 4NZTL 4J3TA 4JJ5A 1JFQL 1FL3A 4BZ2H 1X5YA 3GHBL 4KROD 1XF1A 4YAQA 5EWIH 4WWKA 4YBQD 2ZUWA 4YE4H 1BF2A 1PKQA 1ND0B 2X4QA 5C08E 4G6KH 1EK3A 1BREA 1EBAA 1GXEA 1U8OA 1MJJA 1VHPA 1N7ML 1YNTA 1LEKB 2V6HA 2V5TA 5EIQA 2YMXL 3P40A 5B39A 5TF0A 4AM0A 5JHLL 4F80A 3ZE2E 5B3NA 1IARB 1YYLH 3SDAB 5HHVH 4RAUB 5KSUB 1GC1C 1FL6B 3O2DH 5C7XH 1VFAB 3HHRB 4GRWH 2AK4D 4WFHD 4JHBA 2MSPA 1NAMA 4LOUD 4JRYD 4NC0B 3DYOA 1FDLL 1I3RA 2AV1A 2H2SD 1ZOXA 1DBAH 4OD3L 4KJWC 4ZOCA 1KUMA 1JGUL 3RDTB 4FFZH 5I17B 3L3OB 1HNGA 3TPUA 3ES6A 5C3LD 3HR5B 4PGDA 5EC1A 4M7LL 4NBYB 4QHNB 1N6UA 3T0EC 3AROA 5JZ7D 2DLGA 4JY4B 5D5ME 4LLVB 3S7GA 5C0GA 3SKOB 1BMGA 3QCVH 3CZFA 1A1OA 3FO9B 1DANU 2NY0D 3WJLC 3EDJA 1BIIB 5BVJB 1KGCD 3FO0L 4PIRF 1ITCA 2XICA 1MCSA 4IDJL 4X5XB 4OCXL 4RWYH 2JLLA 3G6JA 4O4YH 2A77H 1QG3A 2A38A 1IAIH 1U8PA 2OTUA 1S7QB 2HTLC 2W07A 4ODUB 5A16A 1V3KA 2J6EH 1LE9A 3MV11 2D4FA 1F3DH 5GJTH 5C0ND 3D39A 3LN4B 5DK3A 5D7JD 1C5DA 3IT8D 3CVHA 4GRWB 4ZD3L 4JG0H 1F58L 2WQ8A 3QDME 4QHKJ 3RNKB 3FZUC 2E3VA 2UWEB 1GC1H 3K8MA 4OJFL 2LVCA 2IJ0C 1AGEB 4EUPA 3TA3B 3S6CA 4YK4C 5FYKD 1C5BH 1NUGA 5AZEL 5EU7C 4S1RH 2DI7A 4JKLA 2APBA 4BSVA 1VGEL 4NKOA 1R6VA 4MS8D 5F21B 3OX8A 2WBJD 3QXAB 1X4XA 4KK5D 1K8IB 4JDZA 2F74A 4M9OA 3PDDA 2F5BH 5DA0B 1KPUB 1YN6B 2ESVE 5DRXB 5GXBB 3R06B 4U1HA 5GSVA 5JDSA 5DHYB 2PO6B 5ID1B 4F58L 1D5XA 1RIUL 3CDGA 1EFQA 4QRPE 2OZ4A 1A64A 3SGEI 1XEDA 3G6DL 2OK0L 5ICYB 4DK3A 3JZ7A 2XQBL 4RBPH 4L8DB 1IZKA 3HC4H 1I9RL 2VR5A 1YEGL 1EJ6A 3QR2A 1AY1H 3BYTA 2J8UB 1CF8H 1HQ4A 5JW5B 1AE6L 1KV3A 2A6KB 4R2GD 4YXLH 2ZUXA 3VFSA 2FSEA 3GBLA 2BY3A 2IPUK 3RWEA 2F9BT 2BMKA 4FQHA 3WXVH 2AXFB 3ARBC 4PRHB 4LCWB 4PJXB 1G9NC 4CVWA 5DJ8B 5C07D 3U0WH 5F9AC 3QPQD 4I0CC 3PF2A 5HI4D 4JRXB 3FFCE 3U30C 4V1DD 4HS6A 3EOTL 2YWZA 4RMWA 3GSNH 1I9JH 4MMXC 4X6CE 3VU2A 4KK9C 4TUKH 3FRUA 2MCPH 2X4OB 2OI9C 1T66D 2CR3A 1KIQA 5BQ7A 3PWVA 4UOW0 1G0DA 2MCG1 4P2QE 1EXUB 2FIKA 4PD4J 1MHHB 3QT2A 4PJBA 5EG6C 1YA5A 3T0EB 3JWOH 3CNKA 1KIPA 4HIXH 3RWGA 1JRHL 5ESQA 4H1LA 4YHKL 3OJ2C 3BEWB 5E2WH 3DUHA 1WICA 1RMFL 4U1SA 1YMMB 4X80L 4OD1H 5JLZA 3JSSA 1FZMA 1KN4H 2FHCA 4N90D 3T1FA 3BN9D 1I7ZB 2EYSA 5D1ZA 2JCCB 1AKJB 4FXGB 1A4KB 5IOPB 4LAJH 1DN2A 4YDJB 2Q8AL 2NW2B 2VZ1A 3ET9F 4UBDC 5DMYA 4FQ1L 1W8OA 1TTUA 2WUCL 2ZG3A 3MV7B 1EGJA 3OGCA 4LSQH 4K9EH 3BHBA 2A0LD 4KDVA 5DMGC 1JCKA 1NBYB 1QPPA 1WBYB 3GMNA 2NXYD 4JM2F 5FYKU 1RJYA 1EHLL 3UXFA 5GS0D 1GZQA 2J2ZA 3GSNB 4MJIA 4DWHA 4RRPG 3GBNL 4G8GB 3F5WB 1BJMA 3HAEH 4LKXA 3QHZL 5SWZA 1XIWC 5JW4N 4U1NA 3D0VB 1SJEB 1WEJH 4I2XA 4LKCA 4XPTL 1KLUB 1MEXL 2PF6A 1KJ3L 4JFFA 2ICEA 3KPQA 4O02H 4HXBL 3ZSTA 2HKHL 2R4SL 5DRNB 2FR4A 1CBVL 2CUIA 3WD5L 3H9ZA 4JRWA 3WS6C 5FUZH 5ISZD 4NRXA 1GGCH 4P4RA 4P3CH 3DECA 3OAZK 3T3MF 2HT3C 1T7XA 1G6RL 1V7NH 5ETUA 2BDNH 5EU4B 4MD4B 1M6OB 3VRJB 4LIQL 5D70H 2X2YA 4NZTH 1JFQH 1LDSA 3G9AB 3GHBH 1BEYH 4HBQA 4MNHB 1TJHL 3DIFA 5KSVA 3ARBB 3QJHB 5C08A 3GMMA 1B88A 2H2PC 5EZLA 1CFQA 3VFNB 2XI9A 5E8EA 3PUCA 4HKBB 1N7MH 1W72A 2X40A 2A9ML 1MCKA 3IU3B 5F89B 3GKWL 2AJ3B 2CIKB 1B0RB 1R5VB 4PV8A 3HAEB 2H3NB 3O8XD 5DC9B 5FB8A 2COQA 1A8JH 5JHLH 1EAPA 4JFEA 4L3AA 3HCVA 2X4SB 1L6ZA 4JHAL 1LNUA 3OKMB 2GSIB 1CXFA 4XXCA 1E4XH 2SEBA 4CMHC 2VXQL 3G04B 2P7TA 4LCIL 2GI7A 5SV4A 1FDLH 3MJ9L 5E99L 4K3HA 4OD3H 4JY5L 2IMNA 5K59F 3VXRD 1JGUH 3HNTL 4NCDA 4JHWH 2H26A 5C0EB 3G5XA 3U83A 5FF6A 5KVDH 4KKAD 4PJ9C 4TNVK 4QOKE 1PLGL 2VR9A 4EN3B 2NYYD 3RVTC 5KSAB 3DO7B 3F8UB 3QDJB 5DJ6A 3CLEH 2EDEA 4Z77B 4XNMA 3MRPB 2XPGB 4YBLC 4GKZB 4WV1B 3ISWA 1OWRM 2KKQA 4ZUUB 1R5WB 3RWHA 5HYEA 3HAEG 1P7QA 3L3DA 2JJTA 2FWOB 2F58L 3W39B 2X9WA 5EN2B 4C58B 2D7OA 1S7UB 3G6JF 4HJGB 2KBGA 2CPCA 4YC2C 1CDHA 1KB5L 2GJ6D 3G5ZB 1F8TL 5DHVH 4U3XA 4JG1L 2QKIB 5EIIA 4HS3A 3AU1A 2Z35A 1C16B 4GKNB 5I8EA 3WHE1 2YA0A 4GSDL 4HX1A 1YEIL 4JY6B 2HYMA 3WFHA 4PBVC 4R7NB 3JTTA 3DROA 3O6FA 1DL7H 1F58H 1AGDA 3QDMA 3CC5A 4UV7H 4CMMA 1J05B 1XIWB 3OF6A 3TFKC 4DZBA 1FNEA 2H45A 5L0QC 4OJFH 5IJKC 1FG2B 4HKJA 3QWRD 3V6FA 4P23A 2K1MA 2GITA 3ARDB 4LLQA 3TO2A 5TF1H 2G75B 4D0DA 1DTUA 4MCYB 4HJ0C 4D9QE 5INCA 1VGEH 1AP2B 4P2YA 3EOBA 1IQWL 4AH2B 3PQYE 5EU7E 4NRYB 1J0JA 4FTVA 3K4DA 5I1HL 4PGEB 5E8OA 2ESVA 2W9EL 3PDOA 2XZAH 5IR1A 4KDTA 4WHYG 4F58H 1RIUH 1QLFA 5H35B 5LJYH 1ETZA 3JTSA 3AAZB 1ERNA 3QUML 3V5DA 1TZHA 2XQBH 5FDWB 4JHZA 1PDKA 3CPLB 4PJDE 4Y7MA 3RPIB 1WFTA 5DHVB 3QFJB 1YEGH 4XCNA 2ZOKA 1AE6H 2YR3A 2MQCA 5SWQA 1CXIA 3NIDE 4LLDB 1BOYA 3DX6B 2LQRA 1S3KL 2CDEA 2PW2A 3LRSA 2PKDA 2ZCKL 3UO1L 1PJ9A 2DIBA 3MLSL 1IM3B 1ZHLB 4KMTH 1RV6X 1QFWH 2ICWB 5K9JH 3BKYL 2YPLD 3RWCB 1RZJL 1I1FB 1A14L 2AERT 5IF0A 4J2XA 5EBGA 3FT4B 3M8OL 4ETQB 3CFJA 3TBSB 4CMHB 3VGFA 3DRQA 1JF1A 5JIKA 3FFCA 3EOTH 4HGWA 1O7SA 1BD2D 1YEKL 1EO5A 2R15A 4G8FA 3SDDB 4PJIB 4OLXH 3DVGA 4WI7A 4ZOAA 4ONOA 1BJ1J 1NLDH 5KVGL 3DXAD 2EXYD 3TYFB 1QEWA 3WCYA 1TMCB 4CW1B 3IXAB 4PJBF 1YQVL 5FCSH 1ZVSA 4G80B 4ZS6C 4C54A 4QXGH 4LVNB 3VXUB 4WHTA 1S7XA 5D6CA 1JRHH 5F7DA 2A6DB 2R2BB 4RQQB 1JI2A 4NFCA 5JIIA 1ODAA 1ZHBB 4WW1A 4UDTB 1RMFH 1PG7X 4XCCL 5DRWA 3NIFE 4GXUM 4X80H 4TUJB 1UB5A 1CQYA 1X4ZA 4MVBD 5LAXB 4ZFGL 2GJZB 2BVQB 2DYPD 3KJ4C 4JO2L 5DDHB 1TJGL 3UC0H 1LO4L 5IG7A 2P46B 5IWLC 4OB5L 1KJ2H 4OGZA 2DQFB 1U8HA 1LEGA 2Q6WB 1IILE 3AY4C 4H5SA 4YC2B 5C0IA 3QO0A 4LPWA 4XB8A 5GSRA 4J7RA 2VN7A 4JFQB 3WN5C 3RWJB 2HFGL 3HNVL 2VZSA 2PCPB 4WNQB 3S35X 1RK1B 4YDKL 1INDL 3MOBL 2YXFA 3IDMA 1FHGA 1OCWL 1KIUA 1EHLH 1Q94B 4JCLA 5F7UA 2VLKD 2Z0BA 1DFBL 2VSDA 4M61A 3UBXG 3LV3B 3H7BB 4PR5B 4F57L 4N0RA 3U0PA 3QHZH 4X8JB 4OZGB 3VFRB 1JYWA 1IKNC 5C92A 3CGTA 5ILTL 4RWHA 3F7VB 1MH5A 3D1MC 1MLBA 5F93C 4Y19D 4XPTH 1BLNB 1KJ3H 4GAFB 2AP2A 3QUYC 2PR4L 2IH1A 5CP7A 2HKHH 4LNRB 1KNOB 2IADB 1CBVH 2W60B 5ALBL 1IT9L 4ZFOL 1KULA 2ITDA 3QULA 1FVEA 4OM1L 3OG6B 4PGBA 1A6PA 3PWPD 5CSZB 4QRRE 4OV6F 3ALXA 3TYGL 1AD0B 4KFZC 4UAOC 3H9HB 2HLFC 5I2IB 1UA6H 4DN3H 3O45A 1KJ2B 5DVMA 4NZDA 1R3LA 4MMZC 1R3HA 4F7TB 3CZJA 3EDFA 3G9VA 4AMKL 3MR9B 4LCCC 5JR1L 2VABA 3S97C 4JFXB 2FECL 3RBGA 1TJHH 4KXZH 1TVBA 4K3JL 4R97C 3SDCC 3GB7B 2XG5A 2XWBA 1IAKA 1U3ZA 5JORA 4MAYD 3GSXA 3H9YA 2A9MH 2O5ZH 2W0LA 1CE1L 1I75A 2E6PA 5HVFB 4L4JA 1HCVA 1EJOL 1YEEL 1HQRB 2UUDH 3KNBA 4TTDC 3U0TB 2GW5A 2OR7A 4PJEE 3VXTA 3I02B 4ZO7A 5TGBB 3V7AG 1KCRL 2VXQH 4LCIH 1CDGA 4OZIE 4B7IA 4K3GA 3MJ9H 5E99H 5GGTL 4XWGL 3ZTJG 4FFWC 4JY5H 3B4NA 5L8LB 4D0CA 3HNTH 4JFOA 3KDMA 4WGWB 5BV7H 5M94B 5BRZE 3VFVA 3VFGL 4HEPG 4XCYA 5DSCB 3NCMA 1VESA 3KPSD 3HA0A 4ELMB 1NDMB 1PLGH 4YDIH 1MCJA 4HS8L 3BGMA 4QOKA 2VMFA 2DN7A 4NSKB 4Y1AE 3N50A 5CINH 5BCAA 1A6WL 4X6EB 4NJ9L 3HB3D 3KJ4B 1NLBL 4FN0A 1DEEA 2AEPH 2BXZA 1KXVC 5HDLA 1ZLSH 1A6AA 1HSAB 1YEHL 4TSBL 2JF1A 4K94L 3FQNB 1JPFB 3ARXA 2FRGP 4KQ4L 4WDIB 2DQEL 3S96A 3WN5B 2BY1A 4FMKA 1F8TH 1S7RA 4JG1H 3PGCA 4PPTA 4LRIA 1HHKB 1MAMH 2IAND 1MCQA 5E8DL 1RZJC 3KS0J 3AXLA 3GMOB 1JPTL 4KQ3H 4N9GA 7FABL 5DQJA 1QTYT 1G9MH 1MRDL 1Q72L 3CFIC 1S9XA 5KJRL 3P0VH 3MUHL 2V2XB 2W91A 3VFMB 4GAYA 1JWSA 3V6OA 2V9TA 5MEQB 1Y6MR 4Z7NF 1U58A 5EFIA 3FONB 5GJSL 5BV7B 1A9EA 1TNNA 4CJ0A 2N4IA 3NZHL 3E6FB 3VMNA 2VDNH 1F4WL 3WNNA 2C5DC 4KRMB 2FX9L 2BSSA 2FH6A 1T89A 3DI2B 3IETB 1T21A 1IQWH 3K7UA 4KJQC 4HKZB 3PQYA 4WUUA 5IJVA 5FKAA 3SKJH 4MDJA 4UAOB 5I1HH 3U4EB 1H3XA 1XF5A 2W9EH 4EQ2A 2P5WE 3MNWA 1BBJB 4RSVA 4KROC 5FECA 3GI8H 4YBQC 5JDJA 1ZGLM 4WI9A 3HE7A 3QUMH 1CFVL 1U8LA 5BJTA 3C2AL 2Q87A 4JFDE 1OP3K 1RZGB 2H9GA 2IPKA 1AXSB 3ZTNL 2AABH 4PJDA 4NUGL 5AAMA 2LTQB 4OCSH 1IGFL 4APQA 4O2CA 1N26A 4CN6A 4NNPL 4ETYA 1N3NA 5D1QB 1FZKA 3RL2A 1S3KH 5GS0L 2ZCKH 3UO1H 3MQIA 3MMEB 1B9ZA 2LAAA 3LS4H 3X3FL 4ZUTA 3VFWB 3BKYH 3OAUH 4LOUC 1J86A 3RHWF 1PG7L 4EDXA 1II4E 1DN0B 4ZPVA 1A14H 1FZOA 2H2SC 3T8XB 4X4YB 4I18B 5C0FA 3RWFA 3ULSB 3M8OH 1A6TB 3DX9B 3WNPA 3VD4A 3HI1B 4D9LL 5IHLB 4XH2B 3OV6A 5D96B 1AGCB 4E41D 3VFPB 1RU9L 1NBZA 2A9NH 5IB5B 3VFUA 1ZWIB 5C2BL 4NHUB 4C56B 5I8OH 3QWOB 4PRPA 4X9FA 4Z0XB 4O51A 3S35L 2MFNA 3P77A 3ZDXF 4NC2B 3BPNC 3HZMA 1CD1A 3O11A 1YQVH 3Q5OA 1MFEL 2HFTA 2ED8A 1RSFA 3RJQB 2NY0C 4OV5B 1I3GH 4JN2A 5JPNA 4BQ9A 3PHSA 1LK2A 1BWMA 2XKNA 3SCMD 3QUMB 3ARVA 1T1ZB 5DEFB 3QUXB 3LKRB 1FN4B 3P3YA 5J1AB 3L7FB 3MRRA 2V2TB 5HDBF 1C8PA 5GRJL 3V0VA 1K9TA 1TJGH 4OB5H 3BPLC 4LIQE 1VEMA 1SJHB 1KENH 5C0NC 5D7JC 3AS2A 1BVKB 4HKXA 1DBJL 2K9UA 3PWLB 3WUWA 4JFHD 4KV5E 5D8JL 3GMRB 4MD0B 1BVLA 1TIUA 1YEFL 4QTHB 3VXOB 2HFGH 1NCAL 3HNVH 5HHME 1RZ7L 1IKFL 2OLDA 3QZWB 4WFFD 1DVFD 1PX3A 2X4RB 3C09B 3IFLL 3MOBH 4P3DB 4NBZB 1OCWH 3I6GB 3H3KA 1I8MA 3LN5B 1VGKB 3BZDA 1U6AL 4XBPA 1U8MB 4LLWA 4DKFL 1J0HA 3BWAB 3GSWB 3ULVE 4P99A 4MS8C 2IBZX 4HUMB 5HJ3A 4W81A 3MNZA 2WBJC 4KK5C 5ILTH 3UTQB 3QXWA 5DGQA 3J7HA 4S0SD 2AJUL 3FKUS 4IRJD 4G9DB 1JHKH 1E28B 5EU6B 2PR4H 4I0PA 3LPWA 3QUKB 5ALBH 1IT9H 2BC4B 1B3JA 5DFVD 3VXNA 3BQUD 5GHWL 2DIJA 1U93A 1GZPB 4QRRA 3RY5A 3AVEA 1UWGH 5FGBA 4M1DL 5D7SH 2XWTB 2LU4A 1HILB 4P2OD 4R2GC 2EDWA 3VGAC 2BY2A 4AQ1B 3DX8A 4K94C 5GRVL 4AMKH 5DVOA 4NDMB 3P30L 1IEBA 4PJ8B 4TYUA 3ROLB 5JR1H 4G3YL 3KPMB 3C8KB 1KIRA 3BP4B 4ZQKA 5GGRA 5DS8B 4Z7VA 3BN3B 5SWSB 4K3JH 2WP3O 4LLYB 3QPQC 3IFOA 1NC4B 2VXUH 3ARGB 4Z7UA 2AK4B 4L4TE 5HI4C 5I8KL 2UY7A 4X4ME 3SY0A 1CE1H 2D7NA 2YC1B 2VIRA 4Z78A 5C6WH 1EJOH 1T66C 2X89A 3RGHA 1QNZH 3KHQA 2IG2L 3WDIA 3MRFB 4GXUN 1A0QL 3O3DA 5HHOE 4YPGA 3RVXD 4LL9A 3VD9A 4PJEA 3TPKA 1J1PH 1KCRH 1UM6H 3MUJA 1LP9B 4OZIA 5HYJD 1Z0MA 3IDJB 4XWGH 1QSFD 2VUOA 3LHPL 3HS0A 3S34L 1RK0B 1W0YT 5K9QG 4ZFOB 3BPNB 4RFOL 1T20B 2D31B 4UQ2A 2YSSA 3KPPA 4I9WD 5DJXA 2XTJB 3FB7B 3VFGH 1IEAA 5BRZA 3MC0A 2EYRB 1U91A 4YGVA 4CAGA 3MOQA 2EDBA 5GISL 1F45A 1QBAA 3BN9C 2BNRB 4F15C 2Z9TA 2NY5L 3SEPA 4Y1AA 1MCNA 4P4KA 1KCSL 1QPXA 1J7VR 2A83B 1NLBH 1INQA 1CL7L 2FLRT 5ICXA 3BPLB 1CTNA 1UACL 1YEHH 43C9B 1AC6A 3UTTB 2ATPA 2A0LC 3QNXB 2KZWA 5EOTB 2NXYC 4XNZC 4KQ4H 1Z6JT 4DAGL 3CXHK 4FQIL 3BOVA 1RZFH 3D5OF 3IGAB 5GS0C 4TSAL 1NCTA 5JPMB 4NQUA 3VH8A 5C0AE 4XMKL 4GS7C 4GLRH 3SGJC 4NQSB 3BVNB 4I4WB 3ZYZA 5E8DH 3HMXL 2YUWA 1JPTH 3PWNA 4M7ZB 3TF7C 1WBXA 1A6UH 2P5EB 1Q72H 4NOBA 4LVOB 1JJUA 2NXZD 1RQ5A 3FO1A 5KJRH 4BELD 3EDDA 4G42A 3QEQD 4M6ML 5C0BE 4GW4B 4U6HB 4ISVA 4ZXBD 3TIDB 5A2KH 5EUKB 3U6RA 3TJHD 2YBRB 5GJSH 4GBXC 3IB4A 1X5GA 3W5MA 5ITFB 1UWXK 4R4FH 4MCZA 3R0NA 1HHJB 2C3XA 4H20L 4HAGA 3MTRA 2FX9H 2FB4H 5LKNA 5IMMA 2P8LA 3C6LA 2BCKA 1QBML 5IROA 4DGYL 2HH0L 2JJUA 1PVHA 4HIEB 4OCRL 5JQ6L 4N8VA 4OCNC 2ZUSA 4G9FA 3X3GH 5IVNA 2GUOB 3O2VL 1T1WA 5IKCA 4Y16C 4D9RE 1JMZA 4R8WL 3WFDH 5T3ZE 4PJHB 3MZTA 2EDQA 1HWGB 1I4FB 2ZNXA 1NPUA 1T1YB 1MY5A 1N5AA 4N8PA 4ZUSB 4JM4L 2E7LC 1X5AA 2EKSA 4JFDA 3CSPA 3QNYB 3ZTNH 4NUGH 4PJDF 5FM5M 1IGFH 3FB8A 1GH7A 2F54D 3BZEA 5C6TL 5JOFB 2ZOLA 2EDJA 3O8XC 5D2LE 3NIDF 4V1DB 1EVTC 1J10A 3X3FH 4WIQA 4H0GA 4F3FB 2XXMB 1I9IL 2ZUYA 1PG7H 2AKRA 1GGIL 2KQMA 5DJCA 2EXWD 3LAFA 3GSUB 3L5WA 3DURB 4PJAB 4WFHE 3MFGB 2L7UA 2VITA 4JRYE 1I7TB 1FAKT 1XF2B 1MCIA 1G9EA 5JOPD 3LB6D 4HC1L 5CIPH 4D9LH 3RA7L 4KKAC 4LVHB 2WIMA 4X7EC 2DM7A 3PP4L 4B5EA 4WW2A 5DK0A 1ZXQA 4NKMB 1RU9H 3TBTA 2GKIA 3SKNA 5C2BH 1V05A 3MFFA 3CU7A 4M7JL 3FQUA 3S35H 5J6HA 3MODH 5HI5D 4UNVA 1WIOA 4JM2D 4MYWB 4HPYL 1TCRB 1T5XB 3UCRA 5H37H 2R69L 3QUZB 5H94A 5TH2A 1PBYA 1DSFH 1DEDA 3ZYOA 3EZ8A 1QACA 4X4ZA 4WI4A 5E2TH 4BQBA 3GJFK 4MXQD 1U9KA 3HLAB 1WFUA 3W0WA 4L4VA 1KGCE 5KW9L 4CN4A 4YWGL 2WP3T 4HMEA 5C86A 5F9DC 3KXFD 2ARJQ 2IALA 3LKOB 4JQVA 1XH3A 4IS6A 1F97A 5F7FA 1FVCB 3O4LB 3RL1B 3T09A 5A2LH 3EYQD 4X7FC 4P46A 1T6VN 3BAEH 4UU9A 1MQKL 1IGYA 2BRRH 4D0BA 1DBJH 5BMFH 1JMXA 2YUXA 3VMPA 5D8JH 5C70A 4BJLA 4JKWA 4ERSL 1TXKA 1N6QL 2IAMA 2W0FA 2X1OA 2V5MA 1I8KB 3NTCL 3PJSA 1RZ7H 1IKFH 3IFLH 1GOFA 2E6QA 4DVRL 5GRUH 2CDGB 3IRPX 3UTPD 3GI9L 4X99B 4L3ED 3V9FA 1HHHA 2I9LB 5CIPB 4HGMA 3D2UD 4HUWA 4PYGA 4K8RD 1U6AH 2HKFL 2HJFB 4DKFH 5IB2B 1Q9LA 4F8TA 1NUNB 4GBXB 2HRPH 2DIAA 5FYKE 5DD3L 1KB9K 2N7BA 1PEZA 1X6NA 1A1MB 1JNJA 4ZG1A 1G7IA 3U82B 1IKNA 2EDKA 2GTWA 1KTLA 4Y16B 4XTRD 1YY9D 3UP1A 3T4YB 2NY5C 3HZVA 3QUYA 4RZCB 4NNYB 1U95B 3SHSA 3BW9B 1BOGA 4PBXA 2LABA 4P5TD 4U1MA 5MENA 2P1YA 1T0PB 5ALCL 4HV8A 3PXJA 1YPZE 4XP4L 2WBWB 5FO7A 1GAFL 2BNUB 5KN5A 4P5MB 3P4OB 4P59L 4PJFE 3WHE0 4FNLH 1MCCA 3P30H 2IWGA 2NLJB 4JZNB 2QSTA 3WFBL 4F7MB 1K8DA 4G3YH 1EEUA 3ZDZF 1A4JA 1UEMA 2B5IB 4Z7VF 4K7FB 5DQDL 3F12A 4BFIA 1MRCL 3HZKA 1ZSDA 4J1UA 3DUSA 4Z7UF 3EO1B 5I8KH 5C07E 1ED3A 4L4TA 1XZ0B 3OKYA 1LEIB 2ITCB 5H37G 4OSUL 4O2EA 1U2HA 3SDCA 5I8CB 3P73A 4FQXA 2Z4QB 1QSZA 2HJKA 3H8NA 3HRZA 1Q9KB 2EXYC 1YQ2A 1T5WA 4S1DD 1P7KB 1NUDA 4PJEF 1OP5H 3TN0A 3BGFB 1NMCB 2P24B 4NQEE 2VDKL 4XMLH 1GGTA 5KVFH 2GHWB 5ESAB 3MACL 1CD0A 1A1NA 3P4LA 3LHPH 4WI3A 3S34H 3FB6A 3HUJE 3L3GA 3PHQA 1OGTB 1I1AC 4RFOH 4HZLA 3Q6FA 3CCHB 3T2OA 4JAMB 4TNVF 4WU7A 2NY7H 4DN4H 1QP1A 4HH8A 3ARSA 4A6YA 3JV4A 4MVBC 5ESVB 5GISH 4K7PX 4XAWL 1OPGL 1SVZA 6FABL 4JFPB 5IQ9B 4OLZL 3BDYL 1P2CA 4N0UB 4U7KA 3CAFA 4G8EA 2NY5H 4MD5B 3U48A 1T4KA 1I1YB 3D3VE 3CD4A 1KCSH 1U42A 2GJ6B 3L9RB 3D85A 4MHHI 4CNIB 1OB1A 2CRYA 3MV9E 4N1HB 4LF3A 4Q2ZB 3JVGC 5I1AB 4GG6B 1WIPA 3U9UB 1J8HB 1TDQA 1UACH 4AL8L 4DEPB 5JNYA 4OZHB 1S7WB 1ZLVH 1Y0LA 3FJTA 2MNUA 3NCCB 1XR8B 1NFDA 1J5OH 1T83A 3MRGB 4CUCA 1T1XB 3F7YB 4MA3B 1FGNL 3WIFB 4TSAH 1MWAL 2BOCB 3LKPA 2V9RA 3RKDD 3BEVB 3DMMA 3VFOA 4Y4FB 5IB1A 3RWIB 4KUZL 5C0AA 2EC8A 1QBLL 1U8KB 3HMXH 4Y2OA 3L6FA 1RJLB 1R3IL 3VXSE 3PL6B 5C8JA 7CGTA 4HIJA 3MRLB 1B4RA 5JO5A 3ETBF 1A7NL 5K33A 1EEYB 1A3QA 3PP3K 5FA3A 4M6MH 1MCOH 2GK0B