4ODTH

Fab structure of lipid a-specific antibody s1-15 in complex with lipid a carbohydrate backbone
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
226
Chain Sequence
b'EVQLVESGGGLVQPKGSLKLSCAASGFTFNTYAMNWVRQAPGKGLEWVARIRSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVRHRGAPLYYGNGAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTSGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S1-15 Fab (IgG2b) heavy chain
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odtH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odtH01
1T1ZB 1E6JH 5LGKA 3ZDYE 1IGFL 4Z7OE 3P73A 2EE3A 2IG2H 2XACC 3F8UB 1DE4A 3BO8B 3IFLH 4X5WA 3BEWA 1UB6A 4WW2B 1QHPA 3H9SD 2OK0H 2MHAA 3K4DA 5EBLA 2X4RB 4AM0A 2CJUH 1NCNA 2ZKHL 1QYGL 1MQKH 5L2JB 3IETA 1YMMB 3EFDH 5JOFA 3ARDB 2J5LC 2ZNXA 3NZHH 3V4PL 4LARH 4P2OD 1RULH 1A5FH 3PV7A 1HIML 3TN0A 5LVEA 1MCBA 1KCUL 2Z31D 5DURB 2AK1L 3OG6B 3RU8H 5TE7H 2NXZB 4P0DA 4S1DD 1JZ4A 1HI6B 4A6YL 4WO4D 3QYCA 4G9FA 2R2CA 4M3KB 2P49B 1MFEH 2XWJB 5AUMA 2ZZUT 5I9QB 4L8CB 2VL5B 4K7FA 3MACH 3VWJC 5TE6H 2FLBT 3CFEA 5HHOB 4LPXA 1TVHB 1I9JH 4X6EA 3G6AB 3KPRB 3RKPA 3BISA 5IVZB 1IEAA 1Z3GL 5BCAA 4GW5B 1NCCH 4LCUB 1P69B 3TZVC 4PJAF 2D7OA 5GJTL 1DEEA 4RMQA 4W81A 1NLDH 3ZE2E 4JFFA 2XKNA 3ARGD 2DL2A 4LIQL 5AYUL 2VLME 5IROA 5C0GB 2IH3A 4M1DH 1KEGL 3MRQB 3CK0L 2Y23A 3OPZL 3P4MA 2VLKA 5FUZL 4HS8H 4YDVB 3OGOE 4D3CH 2NY3C 1P53A 4XWOD 1RZKL 1W72A 3RDTB 1FYTE 3MJ9H 4M4PA 5C0BB 1BOGA 1T4KB 4P23C 5JW5A 3INUH 4AL8L 2J1KA 3LN9A 3FCTB 1FIGH 3CSPA 1V8HA 3VXMD 3CSYA 1PAMA 4GKSB 4M03A 1AIFB 1N5AA 4QO1A 4GRMB 4R8WH 5ENWA 5C6TL 4PJ8A 4KK6C 3LN5A 5JOEA 4Z78B 2GCYB 4P2YA 4WEUD 3FOLA 1CDBA 4FQ2H 1RIHL 1QSZA 3O4LE 4AIZA 1ZE3C 3HUJA 5CHNA 2QQKH 3BDBA 4JEGB 3L3DA 1IT9L 3EAKA 4PRBA 4P3WA 4GXUM 2ZOLB 2EE2A 4WFHE 4XBEL 4YHZL 1S7VA 4GKNB 5GRYA 5AEAA 3WO3B 5DVNA 4XXDA 5KOMC 4NWUH 5IW1A 3U0WH 3RVUD 3H42L 5GS1B 5ISZA 1IGIH 4U7SA 3HLAB 2DQUH 1NUGA 3I6LE 4NNYA 1CD0A 4GLRH 3AY4C 5LGJA 4GUPB 1AGEB 2HH0H 1VFBB 2LU3A 1II4E 1HHJB 3PIQB 3MNWB 4HGWA 5FGCE 5FYKH 1CDIA 5KSBA 4GW4B 3LIZL 1JWUB 5EA0H 2XIDA 3IDJB 1D9KD 1XEDA 4JJHA 4PJHB 5H37G 1RZGB 3VGDA 4ETQA 2CO7B 4GW1A 4OCYL 1VDGA 3CD4A 3TC9A 1E4XI 1T2JA 2P8LA 3NPSC 5EU4B 2BVOA 3S9DB 4C58B 5FXCH 4NQEA 1W72L 1OAYH 4QCIA 2R1WB 4GMSL 5I16A 1DSFL 3BJ91 1AJ7H 1CXEA 3X13B 1NANI 1NGQH 4JQIL 3RPIA 1FGNL 3VFTA 1BF8A 4KKCC 1CLOL 5D7SL 3TT1L 3W0WD 3MLRL 3PWPA 5JOPE 2K1MA 5KVDL 1U6AL 4PJXF 4OLUH 2NMSA 1HH6B 5EG6C 1TZGL 4UQ2A 2C4XA 1IL1B 2FSEA 3HNTL 2W0FB 4HPYH 1Q0YH 4Z77A 3I6GB 4PRPE 1YEKL 4JHWH 3BUTA 4M7ZC 4LSVH 1QOKA 4KJYB 4FTVD 3TVMA 3F7QA 3VH8A 5CGYC 1NMCC 3QHFH 5I8CB 1ETZA 4WUUD 4ALAH 4ZUVA 3KJ4C 3C60D 1CT8A 3WIHL 3L3HA 1AHWA 3MCLH 4LGRB 4XVSH 3V8CA 1NUDA 1OAUH 1Q38A 1NSNL 5DJAB 1NC2D 1CDJA 1B0RB 1IMHC 2ZSVB 4HKJA 4MXQD 5DFWH 5E08H 5MP6H 4KZEH 5IJKA 3KS0H 4HGKC 5E99H 2HFGL 4KMTL 4X7TA 5BV7C 5M95B 4DKDC 1JPTL 2YKLL 4G8EA 5KSVB 4XBGB 4YIQA 2A9NH 5E5MA 1QBLL 5FO7A 2WBJD 1UG9A 1XGTA 3EFFA 3KLHD 4X7SH 4IDLA 4D0DB 3HA0A 4ZTOH 1KJVA 1H3GA 1KENL 2F5AL 4I13B 4M62H 5DEFB 1JTPA 3SO5A 4MVBD 1G7QA 2GQHA 3MC0A 5I1KH 1GRWA 2F58L 1C5DB 4WI8A 3HC3L 3WE6A 3D85B 4FZEH 1UWGL 2P4AB 1UCBH 3QA3A 4KKBC 1DQML 1MHCA 4IMKA 3AUVA 1T6WA 1TZIB 1YEEL 4FZ8L 5ANMA 1AO7D 4K23L 1JGEB 4OZIF 4Z18A 3DI2B 3UTZA 25C8L 4S11A 4HUVA 4MA1C 3MBXH 2F9BT 4NZDA 5DUMH 3KS0J 4XMLL 1QBBA 3RGVA 1E4WL 4X80L 2A74B 1S7QB 3ZDXE 1C5BL 2XNAA 4ZDHA 3I6KA 2FB4H 1LP9A 1H3PH 4NZUL 1IKFH 1TVDA 3GSXB 2I07B 3IJSA 1KB5H 3TV3L 4ELME 1ZGLM 1HQRA 3LEVL 4GRWB 1WCBA 1YPZA 3DIFB 1M1SA 4JPKH 3TNNB 3H3PH 5EH1A 4JFDE 4PGCA 4JKWA 3EGSA 5IIEA 5BO1H 1CFBA 3VWJD 3O3DB 4I4WB 5E6IA 1CR9H 5KJRH 1KJ3H 2AJ3B 4K7PX 3KXFB 5FGRA 5GGVY 2MOVA 3NGBC 5CIPB 5I74B 1R5WA 3O45A 2WIMA 3FRUB 1KCRH 3BRGC 4EDWL 1U2HA 3I3DA 1H3XA 2NXYC 4XNXL 3WXWL 2PTTA 4OZHE 3WFDL 1JWSA 2RR3A 1GGIL 4RAUA 4KROB 4PB9H 1JNLH 3GHBL 1K9TA 5CEZL 2NY3D 5CMAA 2E7MA 3N1PC 1AD0A 1A3QA 4XMKL 5IFAH 1WSST 3QI9D 1OGAD 1QSEE 2OTWB 3PGCB 2V2WA 3QNXA 4P23D 4U6HB 5DJYA 5CBEA 4GBXC 4WW2F 3JUYA 2ARJA 3VJ6B 5F1OB 5BQ7A 4NQDB 1E4KC 1ND0A 5L7XH 4BJLA 1A6ZA 3JZ7A 3S7GA 1J1XH 1H0DB 5B39B 1BFOA 3OJDB 4KK6D 1KC5L 1MRCH 1WIUA 2D7QA 2UZXB 3V2AR 3QUKA 2PO6C 5A3IC 3PJSB 5K93A 1AGDB 5IHUH 3S3JA 3EYUH 1Q9WB 3S96B 5TDNA 3OKNA 2FX9L 5TE4H 2WQ8A 5ACLA 5K9KA 2W65B 1TJGH 1G9NC 2CGRH 4G6ML 4Y5VC 3RTQC 4R90L 3EYFB 2VABB 4NKOB 3RWJB 2BNQE 2YUVA 3NCJH 2ZJSH 3MJ6A 4OQTH 4EUPH 5MERA 1AE6L 4JY5H 4RAVB 4MAYA 4YAQB 3VMPA 5EIIA 5HHQA 4CU6A 3QAZC 3AU1A 1BQHA 2V2XB 1ES0B 5IMLB 1N0XH 2APXA 2NYYC 5E9DA 3JVGC 3MOQA 4TSCL 4BSWB 5FFLA 1WFUA 2E7LA 1Q94B 3V8OA 5F7HA 4L3CB 3KPNA 3VW3L 4JREC 4P57A 4Q6IB 3ARZA 2WQRA 1QHOA 1A0QH 4BUGA 3UZEA 1VKXB 1TJHH 4XVJL 1F2QA 5KSAC 1NCDL 5HD8C 2VISA 1WICA 4FOMA 5T1KB 4XRCA 1BQLL 4Y1AB 3CJJA 1SBBA 1ZT7A 2LU7A 5D2LA 3TBTA 2VO5A 4I77L 4X8XA 5EU7E 4LHUB 3SDXA 5D72L 1CICC 3ULUL 1HDMA 3QDGE 2Z9TA 3L3IB 4X98A 3FAWA 5DD5H 2ATKA 2J8UB 5FGBA 2CK0L 4KKCD 4NUJB 4CDHA 3K7UA 2HFEA 3PHSA 3SO3B 5KVGL 4XNMB 4LCIH 3QJHA 2SEBA 1CXIA 4KQ4L 1BIIA 2FBJH 3CDGB 4JKPL 3I02A 3H9HA 3IKCA 3G6JB 2DQDL 1YNLL 3QFDA 3QDMB 5CGYD 3QCUL 5DVLA 2P5WE 3K74B 1OM3L 3QJFB 5DC9B 4NQCB 2AJSH 3HI6L 2MQCA 2FLRT 1X5YA 3E2HC 3M1BB 3LSOB 5EU3B 2Y06L 4PD4J 1IC1A 1G84A 2R2EA 3VCLB 4NT6A 4ZSOE 2OJZL 1GHFH 2VLMD 5I8EB 3U1SH 3MA7A 2XZQL 5IFJA 4Y5XA 2ZUQB 2VYRE 1I1AA 1DFBH 3VFMA 4JO1L 1QNZL 5DJ8B 1U91B 4K3EL 4IBLT 4UDUA 1T1WB 3DGGB 5ETUA 1FYTD 3GSRB 3LQMA 5IG7A 3V95A 2VZOA 2EDBA 4ZTPH 2VDPH 3WJLC 2V2TB 2ZUUA 4OKVB 1FLTX 4GG6A 1BFVL 3O8XB 1HHHB 4YHLL 3D2UB 4YDJB 1F6AA 2PXYA 5GZOD 3F58H 1A4JA 4JQXC 3RWEB 2EO9A 2YC1A 3QQ4B 2P46B 3ULVE 1BBDL 4IS6B 1UB5A 3C5SB 2Z93B 4W6YB 1I9RH 3TFKC 4PG2C 4OCXL 3JV0A 3MMEA 3N0PB 4XCFL 5CJ8A 3O4LD 3RL2B 2HVKA 3X11A 2DQIH 1U3ZA 5J1AB 3WNNA 1S3KH 1KCVL 1FYHB 5FB8B 1DQQA 3V79C 1LK2A 1MAJA 4J3XA 3F62A 4WFHD 4PGZA 4WI6A 1XAUA 4CU8A 1IGCL 1NAKL 4OCLC 2VLJA 3UROR 1H5BA 3EOAA 2YN5A 4HH9B 1MCLA 4OBRA 4LLYB 4HWZA 3KHOA 5F89A 2UYLA 2Y5EA 3HE7B 5HHPA 3OAYK 4OUUA 5FIEA 3I6LD 5HJ3B 3VRJA 4F7MA 2H8PA 1SM3H 2IAMC 3VFOA 4LVHC 5IKCB 4PJGE 1JHKL 2VXUH 3BE1L 3MYJB 1ZS8B 1JE6A 5FM4A 1R3HB 1EK3A 1LE5A 1NC4B 3KYMB 1JZ2A 2W92A 2NY0C 1VPOH 2OR7A 3F5WA 4X7DC 5C0AE 1CD8A 4DKAA 4R2GC 2DYPA 3HPLB 5D7LE 1J0HA 4FFVC 1MJUH 3ZTNL 1FNGA 1WZ1H 3ARFC 5DHXB 2NXYD 3QO0B 3UYOD 4WWKB 4OIIL 5CJQL 3M07A 1N8ZA 5JXAL 2X4OB 1HOCA 3TIEB 3CVHH 4DKEH 3QIBC 3SKJH 4TOYH 3PP4H 5IBLC 4RA3A 3CFCL 4BZ1L 2PYEB 5JOPD 3X3FH 4ONGH 1N6VA 1GC1C 5IVOA 4EI5C 4H26B 2M1KA 4YHPA 3RKDC 1MHEA 1CE1L 4X4XA 5DJ0A 5K9OB 4PRPD 4GBXD 2EKSB 4O02L 2GJZB 4U1MB 3MV8B 4ZO8A 3RUGA 2XQBL 1TENA 2EECA 2Y5TB 2KQNA 4JRWA 1RU9L 3SGKA 5I71B 4PJBA 3T0AA 4OZFG 1UC6A 5T1LD 2PO6D 4DVRH 5A3ID 1A7RL 4YXHH 5EIQA 5C2BH 1YECH 2XWBA 1T5WA 1VACA 4OB5H 3V0WH 3DO7A 3T77B 3WXVL 4GRWF 5LAXA 5IB1B 1UJ3B 5GS2D 3KYNA 1FO0B 3V7AG 1A1MB 5IBTL 3RTQD 4RSVA 3ARBB 35C8H 1FL5B 4NKDB 1YQVH 1JPSL 4DGYL 4MA7L 3FT3B 1SMOA 4X6DF 1FFNB 1YUHB 3UXFA 3DSNA 4QLRA 4Y2DC 5I73B 3HN3A 3BIKB 1Z9OA 5HGGS 3SKOB 1P84K 2YUWA 1WT5A 4MXWL 5I2IA 3AS1A 4NDMB 2CUMA 1MH5B 5HYFA 2XPGA 2I5YL 2H9GA 1C16A 5EO1B 3RQ3A 5HI3C 5MENB 1CGWA 2CSPA 1GAFL 3FZUC 1FQ9C 1AXIB 3ULVC 4G8FA 2VTFA 2FJGA 5I66A 3VWKC 3BMVA 4Z7UA 3WNPA 4P4KA 2HJLA 3FO0H 2E5EA 2R15A 5KSAD 3BX7C 5HYJE 4O2EB 1CVRA 3DX7B 5E94B 1DANT 5HD8D 4X4ME 3FMGL 3OAUH 5C0FA 4UTBH 5IMKB 4LLAA 3VE0A 2VDNH 3T4AB 1BLNA 5CUSL 3R0MA 4HJGA 5HVFB 1EEZB 4G6AC 3H9SA 2R4SL 4Z9KB 4GS7B 5IFHL 3O3EA 4MQXD 4EBQH 4QRPB 5E0QA 2ZCKH 4U1SB 4POZD 3NBNA 1DLHB 3LPFA 1CK0H 2I27N 2YPKA 4OM1H 3OKYA 5IB4B 4R96A 5HHNB 4WRLA 4P2OA 1RZ8B 1HKLH 1PD6A 4JFDD 2Z31A 3RP1A 2DQCH 4RWHA 5KVEL 1N5YL 4G7YH 3T2NH 1F11A 1LD9B 2H2PC 4HPOL 4P99A 4CVXA 3VFSB 3R1GL 4U3XA 1R3JB 5D9SB 5IEKA 5L9DH 1FV1A 4MNQB 3RVXC 4JJ5A 1FBIH 3ZT7A 4WHYH 4X0KA 2DWEB 1S7RB 3GSOB 4G5ZH 3RWFB 5J9PB 1I8IB 4ZAKB 5BOPA 4RGNE 1GGCL 4X6DE 4DZ8A 4XB7A 4UTAL 3BPOC 2D3VA 2RFXA 1FAIL 5HI5C 3DV4B 1JN6B 3ARGA 5DTFB 3X12A 3U9PH 2FL5A 5GGVH 3PGDB 4IHOA 2XZAH 4Y8AA 3MROA 1QSED 4NGHH 1ERNA 3C9NB 4NQVB 1WEJH 2V7HA 2X7LA 1T83A 4L8BA 5CSGA 1EJOH 4EZMA 1U8MB 3IF1B 1UWXH 3K2UH 1XFPA 3HFML 5L88L 4UT6L 1MI5E 3IFOB 1IEBB 4JDTH 3MUZ1 1Z5LA 1E28A 4NQUA 4QXTA 1HXYA 4HT1H 5EU6B 3VXMA 5KS9A 4APQC 3IFPB 4LNVA 5E4EB 1YEIL 4TTDD 4YHYC 4ODVH 4XNYL 1CIDA 3GMMA 2HT4C 3WFCH 4RIRB 3DO3A 1UXWB 2D7PA 5CJOL 2APBA 1MREL 1V7ML 5BRZE 4OAWB 3OG4B 4P9HL 4H5SA 4X4YA 2D7MA 4R9HA 5C70A 4XCEB 2BNQD 3G6JF 1DBAL 1RUPH 1ZWIA 2C7UB 1LGVA 1FE8H 1JZ6A 4DOHB 4UB0H 4TNWK 3U46A 4L9LA 3WBDA 5ECJE 3BUYA 4NJAH 4XPBL 3MLTA 2VDLL 5ERWB 2BZDA 4Y2OA 1IGJA 2IAMD 1CGUA 2BRRL 4AT6B 3ILQD 4X6BB 3EDEA 1IM9B 2XWTB 4OD3H 3PV6B 3DRTA 1B9ZA 2EIEA 2Q7NA 4YK4C 3MBEB 1T3FA 3UMTA 4YBLC 3WLBB 3TYGL 2ZOKB 3GMNA 4NN7B 4RQQA 1JPST 2ZCHH 4POYA 1EH9A 5ICYB 1SJEB 3G08A 4QF1B 4QRTB 4M5ZH 1DUYA 4LAQL 4YHIB 5D2NA 4MDJA 4N8VA 5KAQG 3B8YA 3TT3L 1RURL 5GSVA 2EDHA 4FFVD 3ARFD 1OY3B 1D9KA 2P47B 3FFCB 3VGHA 3DTXB 3I50H 2QSQA 2Z35A 3TPKA 3QDGD 4KMLB 1CDHA 4DVBB 3SKMA 4MA8L 4X9BA 1Q0XH 4JGMA 3FQTA 4XI5C 2DKSA 3QIBD 5IBLD 2B4CC 4M1CC 4L3EE 3O9WC 3H0TB 5GZND 4EI5D 5FKPB 3S4SA 3U30B 1FP5A 2Q8AL 4GH7B 4IOFC 1MJ8H 5D5MA 4OGYH 4HFUH 4U3HA 5E8EB 3W0WA 3KYKH 4UIKL 2Q6WB 3ARDD 4HZLB 2VE6B 1ZLVK 1NDMA 3GSNB 3B5HA 4U2ZA 2J6EA 2P5WD 2X4QB 4U6YA 5ALBH 2H2SC 3MRDA 5EUKB 3BYYA 4FTVA 4JQVC 3L9RB 5IF0A 2CKBH 5DDHA 4MQ7A 3IXAB 2B5IC 3VFRA 4WUUA 4YFEA 2AXFB 3KPMB 3E8UH 2NW2B 4U6VH 2QSVA 3C5JA 3LQZB 3C60A 5F1SA 4U1KA 3QFJB 4MX7A 1I8MA 1JPGA 3DMMC 1NC2A 4XWGH 4ORGB 3BKYL 4RGNC 1MIEL 3JBG7 4RX4D 4PRAB 4E41E 2JB6A 2X1WL 4NHUA 4NQCE 1EHXA 4GLRI 3TNMA 3ES6A 4K8RC 1XGRA 2FO4A 3IVKA 3KR3L 2NLJB 1KUMA 1EXUB 5JIKA 2WBJA 5C07E 4KDTA 2Q86B 1U3HB 3AAZA 2VR9A 3SOBL 4QTHA 5HI3D 2CXKA 1J11A 4EN3B 3JV4B 1TCRB 2C3HA 4BZYA 1JGDB 3X14A 5EWIL 4JG0L 3VWKD 4ZNCD 3AM8C 4ZOAA 2NY1B 4HUXA 3GIZH 3K1DA 3SCMB 3OXSA 1PLGH 1XGPB 3RNKA 1AO7A 2OR8A 2FX7H 5DD1H 5GGTL 2GT9A 2C3GA 3H9ZA 4MJ5B 4D9LH 1CXLA 5A1AA 2LAAA 3D5OF 1FL3B 3TO2A 3K4ZA 4PJDB 4G6AD 2JE8A 1TLKA 1KN2H 2DI9A 4RMWA 5K33A 2NY5C 1Q9OA 4AENB 2VXSH 5DJZB 5C0RH 1YN7B 3NAAH 1X5FA 2J6EL 4PRIA 3PDOA 4JANB 3C2AH 2P45B 5JQHC 4TRPL 5ADPL 4GG8B 1UEYA 3O6ML 3IXTB 5EN2B 2FZ3A 3LKNA 2EIBA 3U4AA 4M8QB 4WV1C 3RBGA 1OARL 4QRQB 1QLFB 3MRKA 5IT2H 1MUJB 1SJXA 2R2HA 1FHGA 2DLGA 2OTUA 1AY1H 4HIHA 4AEIH 3JXAA 3LEXB 1XCQB 4YWGH 1SMAA 4PJCA 5D1XC 5C0AD 4N0FA 5F6HJ 3RVXD 3VWJA 3QEQE 1ZSDA 4UBDC 1RZ7H 5D7LD 4QYOA 5SWSB 1D6VL 2CIKA 3GSUA 2G75B 3DJ9A 5I17A 5IM7B 4OZGE 1DBBH 1JJUA 3IDNB 4LSQH 1T80A 2J3SA 3TZVA 1T21A 4UILH 4LCWE 5L6YL 1TTFA 1T04B 3L3JB 4DK6A 5I1EL 4X83A 2NNAB 5GGSY 5HI5D 3P4OB 4HIJA 4F15B 4YHML 2ORBH 3GK8L 3MGTA 2CUHA 3HNVH 3NN8A 1VFOA 3WIFB 4NM8H 2MKWA 4J1UA 4Z0BH 5K59F 4OLXH 4RGMC 1VADA 1Y0LA 5C7XL 4IEFB 1MCPL 3HS0A 1OGAA 4OI9A 1N7ML 4LLMB 4OCSL 4P23A 4FMFA 4LF3B 3SQBA 1P6AB 1RVFL 1HHGA 4NFDA 5CD3A 3GHEL 1LNUB 1K85A 1KFAH 4APQD 5DJ6B 5AZ2H 3TH4T 1FZMB 2YD3A 1Z0NA 3JWOC 2NX5E 3P9LB 4L9DA 4NKMB 1ZGLP 1S7TA 4JHAL 1F8TL 3REVA 4LLDB 2FD6H 4JZNA 1EERB 3EOYG 4P46C 4QXGH 2PW2B 3MCKB 5FA4B 5J57B 1KN4H 5A2KH 3WKMH 1FAKT 4LSSL 1I7ZB 3ARPA 3GMOB 3QIWB 2VQTA 2X9YA 2FYYA 3BAEH 4WHTB 2ZSWB 4RNRB 4PRDB 1NGXA 3A0OA 5EZOH 4MSWA 3UDWC 4R97B 4UIMB 3IGAA 4LLUA 4B53A 1CD9B 3O3UN 4NUGL 43CAB 1DN2A 5H35A 4JZOB 1B6DA 5ACZA 1NGWA 4WEMB 3P4NA 5I30L 4P2RE 3AY4A 4F57H 4I2XB 1FVEB 1CDGA 2P1YA 4M6MH 3GDBA 5TDOB 5HYJD 3EO0B 1FORH 1KTDB 4G6KL 4Q74A 4AH2A 1FNHA 1S5HA 5EZLB 3D85D 1LEGA 2XN9B 1TDQA 3BZ4B 2ADFH 3B2VL 4XVTH 4KK9C 2ZUWA 4M43H 2CDEA 4JFYA 1UA6H 3KNBB 1QLRA 3HNSL 3RAJH 2E6PA 3QDJB 2R69L 2DRUA 5CP3A 2VAJA 5I1LA 4XI5D 2FWOB 3PGFL 5C0NC 4Q6YA 1EZVX 4LSRH 2VDRL 3L6FB 3HZMB 5EO0B 3H7BA 5MHSE 5DJDB 2B1AH 4M1CD 2AGJH 5EOQL 4IOFD 5I1HL 1KTRL 1G6RH 2AEIT 5FYLE 1C1EL 4MD5A 4LPYA 1J7VR 4XNUH 2CIIA 4QT5B 4U0QB 3I84A 4M7LL 2JJUA 2BY1A 4QRPE 1FFOA 3Q3GB 1C08B 1WTLA 3W81A 1PFCA 2H2SD 3HE7C 3V5KB 3F65A 1B2WH 5DK2A 3OJ2C 3RWIA 1HSAA 4J3SA 3RIAK 1BZ9B 4MA3B 5J6GA 2XV6B 5DJ2B 2OL3H 3DMMD 4N0UA 2DD8L 4FQIL 1P7KB 4AJ0A 4B7IA 4M5YL 5KN5A 4X6CB 4RGND 5HDOA 5B3JF 1BVLB 2ZP0T 2H32A 1PYWA 3MPCA 3RZWA 3PNWB 1KNOB 3SE4C 4WDIB 3DXAE 4K2UL 3BMWA 4QXWA 2BOBB 3V5HA 2AJUL 2AABH 3BD3A 4NKIH 1BF2A 1T1XA 4H8WH 3GMQA 4TYUA 1I1YA 3BW9B 1MJ7L 5IV2B 1VFAA 1G9EA 4OCRL 2XG5A 3MUY1 1FYTA 1MI5D 1XIWB 3I85A 4LLQA 3VFWA 1FZOA 5M94B 3EYOB 1FL6A 1LO2L 1I1FA 2A73A 3P0VL 1WAAE 1T22A 4FQQB 2Y6SD 4TUKH 1ZLUH 2JK5B 1AKJD 2QR0B 2JB5L 3D25B 1F45A 5GIRA 5BRZD 3STZB 1CD1B 3GO1H 3O4LA 3N9GH 3IDIB 5CJ5A 4EUPB 1X7QB 1MEXL 2P7TA 3HI5H 5B8CC 1T0PB 4XBPA 1A7QH 4KUZH 1MF2L 1KJ2B 1S7WA 3TCXA 5E6YA 4ZUTA 3C6SB 4LVOB 2BVPB 1XGUA 2PF6A 1QFUL 3NFSL 2CDFA 2DWDA 5F6IC 2D03L 3ARSA 5J7CC 2OZ4A 4TQEL 2R56H 2PCPB 5GGRB 5I1CL 3VGBA 4I0PB 4R7DB 3BXNB 1Q72L 1HWHB 3FKUS 3LN4A 2CPCA 2NPLX 1B0GA 3LV3A 4P5TB 4LU5H 1DUZA 2A77H 5D1ZB 4LRIC 1S78C 3UBXG 4UBDD 5MEOA 3QB7C 3LH2H 4KAQL 5BV7L 4JB9L 1GOGA 3SJVE 4GAYA 1IGFH 1DN0A 4LDLB 3S37L 1HXMB 3SDCB 3RNQA 4HBCH 2W1NA 1AXTL 1UGNA 1GCFA 1QR1A 3CX5K 2ZKHH 3KYOB 5T1KD 4CNIB 1IQDB 3EDFA 1KLGA 4QTIL 4OIAA 3QRFM 3GGWB 3T3MF 3JTTB 4M3JA 3LRSA 2H3NA 2OS7A 3LKPA 3V4PH 2HLAB 3X3GL 5EZJB 3V6FA 43C9A 2YPLE 1HIMH 4QRUB 4Z5RB 4PRPA 5E1AB 4GBXA 1I9EA 4PJDF 1BVZA 3HCVB 2A83A 5DRXB 1INDL 3LS4H 4Z7VB 3MFGB 1E4KA 4CUCA 4ODUA 2Z8WC 1KPRB 4A6YH 1F4YL 5LG1A 2BDNH 1X4XA 3NIFE 2E7BA 2WNGA 3RY4A 4U6TA 1H15A 4MS8C 5C0IA 2GSGA 3IDGA 4KV5F 3VXUB 3VG9B 1SBSL 5T1LA 1MRFL 2PO6A 4P46D 3L5HA 5A16A 4U1GB 3VXTB 4E41D 3U4BL 5ALCL 3MLXL 4M7LT 4JGJA 4NQCD 4JFHE 2W60B 1SEBA 3RWGA 5HVGB 5F3BB 4ZQKB 4C57C 2C5DC 2OZ4L 4K9EC 4LIQH 4KFZC 4Y5VA 1ZA3B 3RTQA 4BUHA 1YQ2A 5JORB 1KYOK 3VGGA 2WIIB 5C07D 3CK0H 1RJLB 1IC4L 1JGVL 4UQ3A 5B21A 2CLVB 2XY2A 1INQB 3PWNB 2QHRL 1T2QL 4FQ1L 3TJHC 1ZVSB 3JVGA 1RIUH 1TPXB 2R4RL 4Z76B 3QHZL 3FT2B 4POUB 1F90H 1ZVYA 3OHXA 3LHPL 2BY3A 4XPGL 3DRQA 4V1DE 4WU5A 4BQ6A 1QEWA 5C6TH 5F7WC 5KSAA 1EAPB 2OJEA 3ZTJG 4KZDH 1EFXB 4KK9D 1IGYB 1Y18A 5E8OA 3Q5OA 3MRRB 1X5XA 3KPQA 3T3ME 5IBUG 5C0ND 3BZEB 2H6PA 1S7SA 5HYSG 5J12B 3QIUB 4YXLH 1FFRA 5GGQL 4JFZL 4XBEH 4HF5H 4N90E 4M6OL 5J3HC 5DYOA 5I8KL 1E27B 4ELMA 1UADC 4JFEE 5E8DL 4JFOB 1I3GL 1V05A 3H42H 1L7TL 2O5XL 3MRFB 4JFDA 2GITA 2OSLB 3HE7D 4ZMAT 5F9JA 3FB6A 3QEHA 4KV5E 4XP1L 2AQ3A 3O2WL 1JNHB 4M9OA 1EIBA 3VRLF 1CGTA 5FA3B 5DK0A 1QKZH 2AK4B 5ESVA 5FYKE 5K9QI 1NFIA 1JWMB 5DI8A 4X8JA 4HQQL 1AQDA 2DTML 3LIZH 4LCWD 3WS3A 4PP2B 3T1FB 2AJVL 1KPVB 4LOUC 4M8VA 1FVCB 1R5IA 3HZKA 4QOKA 3JWDH 4OZHA 4OLVL 4S2SB 1S8DB 1T0MA 4OCYH 4NRXA 1JTTA 1EX0A 4XC1L 2E7CA 1ZHBA 3WNMA 1FH5L 4HHAA 5GRXG 1BAFH 2VZ3A 2BX5A 4HIEB 4KPHL 1BJ1H 1BWMA 1QSEA 6FABL 4L8SC 1ZLSH 1SYSA 4E5XB 1FGNH 2K7PA 5H94B 1CLOH 3TT1H 3WJLA 3S8WA 3MLRH 3D6GA 5KVDH 4U0RB 1U6AH 4KTEH 5CZXC 3ZYIA 4M9PA 4WIQA 2P5EE 3GB7A 2NX5D 3VI4E 1R3LB 1W0VA 1BGXL 2D9QB 3QNYB 4JQXA 4OJFL 1T5XB 1BBJA 2ENSA 3HPJB 1DZBA 4L8DA 5IW6B 4S1RL 1A6AB 2YS4A 4PG2A 4WFGE 5DJXB 5FECB 2IADA 1XCTA 3WIHH 3MFFA 4CGTA 3BGMA 5FOJA 4PUBH 4H1LH 5T5FH 1RZFL 4QHUB 2I26N 3G9VA 5FYJD 2ESVE 4KHTL 1JHLL 4PRNB 5INCA 4J6RH 2BNQA 5L8JB 5AZEL 3NH7H 4F33B 3MNZA 1CFTB 2HFFA 1F4XH 2HTLC 1OD7A 3NABL 1U8QB 4ZFOB 3I9GL 2YRLA 4BK4A 3UZVB 4S1SL 1J0KA 3ARBD 1RMFL 1EJ6A 2IANB 2IAMA 1L4IA 4X6CF 4P2RD 5CILH 1LO3L 1EO5A 1RZJH 3DNKA 2XRAL 4HLZG 4XMPH 3W39A 4CW1B 4LBEA 2F58H 4PTUB 4NYLA 5DEGB 3VH8G 4JDZA 1KBGL 1S78D 4Q9QL 4NN6C 1NAMA 1QA9B 1YEEH 5TH2B 4RFNB 4K23H 1WCQA 3VFVB 5DRWA 3QULB 3EW3B 5GISL 2ICWA 1WC7B 3ARFA 3FQWB 3MRNA 1NL0L 4BH8A 2IBZY 2X4NB 4XMLH 5MHSD 4KRPB 1E4WH 3DSFL 1DANU 3QDGA 4LCYA 1F3RB 4ZPVB 4WI3A 2XN9E 4NQXA 1C5BH 4NO2B 3QIBA 4PV9A 2A6DB 1CXHA 4WI2A 5FYLD 1CL7H 4GSDL 4EI5A 1CFSB 1T03H 3GMPB 3EDDA 4QRPD 2A9MH 3TV3H 3SE9L 4MQTB 5DUPL 1YDPA 3HC0A 3H9YA 3LVEA 3MOAL 3NACL 3LEVH 2FNBA 3RA7L 4JM2C 1D5ZA 4RMTA 4N8CH 1MCIA 2P5WA 4JFPB 1G7PB 5SWZE 2HJFA 4LSDA 4MS8D 4RDQG 1E0OB 4WI9A 2HRLA 3BKMH 4HWBH 1LE9B 3QXWA 2V7NA 4ZSOA 3MV7A 1WISA 4HUMB 2HTKD 3DXAD 5T1MA 3HTLX 1MPAL 4OTXL 4RX4A 3FN0H 1GPOL 2Z92A 1JNJA 3WFDH 2QQLL 3U0TA 4GW5A 1R0AH 1KT2A 2C26A 1OF2A 3CGTA 1RJCA 1RUKL 1ZAGA 3L95B 3VGAB 1DJSA 2XXCB 3OXRA 1IZKA 5E6ZA 1F4HA 2O5YL 3MXWL 1YYLL 4GJTB 4JLRA 1NAML 5EBWB 2X4SA 4PJIE 2OYPA 2F19L 4XPAL 2OM5A 1URLA 4PG9A 3QG6A 3FO9B 2UZIH 1I7TA 1LVEA 1EEYA 3VWKA 2J8OA 3Q1SL 4HH8A 1CFQB 4YE4H 1T4KA 1LDPL 1P2CB 5JO5B 4YUEH 1PZ5A 1ZHNA 1OSPL 5DO2D 1YEJL 3MYZA 4HKBA 1CLYL 3UTSE 3DV6B 1AGFB 4TUJB 2AXGA 2V5RA 2VDOH 4MJ6A 3U7YL 4ZYKB 3MZGB 3O2DL 3FTGB 5I15H 1QBML 1N59B 5IJVB 1KXVC 5DFVC 4XZUB 1P9MC 4F7PA 1GC1L 5DJCB 1CIUA 1Q9LA 4Z7VF 4Z78A 1JK8A 5D7KE 4R90H 3U83A 4RGOL 5DMGC 5E00A 1IGTA 2I9LB 4ZD3L 5EBMA 1HEZA 3C8KA 2ZOLA 1IFHL 4XCNA 3LCYA 5JDJA 2HKHL 4NBZB 4PJGA 3QUMA 3KWWA 3U82B 5DZLA 4HK3J 4HKZB 5EC2A 3WIIL 5AG8A 2VLLA 4Z8FH 1EHAA 1WJ3A 2DIBA 3VW3H 1NCUA 4J8RB 4KH2A 1EHNA 3PABB 3SJVD 5C0AA 1W0YT 5EUOE 1C12B 2YD6A 4XVJH 5DRNA 3P9MA 5D7LA 4GUPA 3CFJB 12E8L 4LOUD 4ZXBC 1NCDH 1NGYA 4FXKB 3BP7B 1TIUA 5D7IE 1DBKL 1BQLH 2P8PA 5ACMA 1JWUA 5DR5L 4I77H 5KSUB 3C5ZC 3GNML 5IMMA 2MCPL 3ULUH 5E2WL 4JDVB 4IOIA 3QDAA 3P30H 4Z7NE 1TETL 1NFDB 2YPLD 3CFKB 5C9JB 5FO8B 2K3TA 1BQHG 3LD8B 1ONQB 3ULVL 1U8JB 4L1DA 5TPWL 1ZLWH 5CZXD 5KVGH 5CD5C 4G3YL 2DLFL 2I60L 1T2XA 1CN4A 4KQ4H 5JR1L 4JKPH 2ATPB 5JIHA 1K8IB 3QZWG 3OX8B 3C6LB 1YNLH 2P8MB 4FQJH 4GQ9H 1D5BB 5EC1B 4D8PB 4APQA 3KPSB 3CFBA 1G9MH 1HH6A 1MHHA 4LDOB 5EZIH 5FUOH 1OM3H 1F4WL 3VFUA 5J13B 2EIZA 3TBSA 4FQHA 2EH8L 5HGHA 3HI6H 1ZT4B 4JFHD 1RJZB 3IDUA 2K9UA 2Y06H 2WMPA 4Z7VE 4Y4HC 3ALXA 1EO8H 3E3QE 3L3KB 4I5BB 5F8QC 5DJAA 4C56E 3TP4A 1U8PA 1NUNB 3TPUB 1ZVHA 2HTLD 3QUML 2Z8VC 4XNQB 3IJHA 4Z0XB 1JNNL 4K3EH 1G0DA 2IALA 4Y16C 1MFCL 1KULA 1QACA 2YEZB 1U3YA 4RZCB 1TVBA 4XBGA 5ID0B 4X7CC 1U8IA 1HK6A 2JLLA 2R0KL 5E24E 1D5MB 1I75A 5KBNC 2YPVL 3W5NA 3O3AB 5IR1A 4UV4L 4WGWB 3RZCB 4YHLH 3BPCA 1U3HD 4V1DD 4Y5YC 5L8KB 5DD6A 5HYJA 1ZEAH 2R1YB 1CGSH 3KJ6H 4EN3D 3O6FB 4X4MA 4PGBB 4QRRE 3IU3A 2BHYA 4K07A 4K3DH 4P5KA 4OV5A 1MIML 4UNVA 3TYFB 2NY1D 1J8KA 4M6NL 3VXSB 3ZYJA 3D0VA 4P4RB 4Z7QF 3ISWA 1KJ2L 3HC4H 5L2KB 4N90D 1IGCH 1NAKH 1RK0B 5CSZA 3NFPB 3ROLB 4JFED 2OMBA 5DC0A 3CMOL 5MEPB 1NCWH 2P24B 1CLZL 3O9WA 4F3FA 2MMXA 4UINL 3W5MA 3NIGE 1S7QA 3BH8B 4DUXA 1A7NL 4ZFGL 2IPUK 3K3QA 1NUFA 2OX5A 3SDAB 2AI0L 4ZFZB 3FB7A 4OCNC 5CZVL 1ZHKB 2X4TA 4JM2D 5I76B 1A6WH 3P0YL 1N64H 2R29L 1LDSA 1BZ7B 5FYKD 4LQ1A 1S9YA 4JQVA 3LRGA 5C0JB 2DQHH 4JY4A 4L4TB 1JTOA 2QQNL 2Y4SA 1PKOA 4FS0A 4DFIA 5KVFH 3TA3B 2ZCLL 3DMMA 2R23B 1P5VA 3O3DA 4I18C 4X6DA 3ZTNH 3GSQB 3Q6GL 3F12B 4HXAL 2AK4E 2PNDA 2VLRE 4OIIH 4WFFE 4S1QH 2RGSA 4WU7B 5JXAH 1R24B 1UWEH 1GVIA 3MGAA 1RFDL 1HCFX 3BWAB 3CFCH 4JRXB 1P4LB 4GXVL 3W82A 3DETC 5EB9A 1HINH 4DZBA 5J11B 5FM5O 1MI5A 2P5ED 4JRYE 3GJEB 3OJMB 5CWSA 5FKAB 1J1OH 4JN1H 3RX8A 3HMXA 2GTZB 2G60L 3ZE0F 4WFGD 3AM8A 4G6JH 3G5YB 1JZ3A 4ODTL 1UM6L 7FABH 2C4FT 4PGEB 1B4JL 4P5MA 1AKJA 2R0LH 4P2QE 3U0PB 3MV11 3IAQA 4F7TA 4Z7QE 4LKCA 3MOBL 5BRZA 3DGCR 3SE3C 4NRZB 1FG2B 3E3QC 2B4CL 5B39A 2CDGA 2ESVD 4LASH 1EPFA 4DUWA 1MWAB 4GOSA 4NM4H 5JW3L 4TPRL 1LO4H 4R4FL 4OFIA 4PS4L 4HBQA 3T8XB 3AROA 2DM2A 1OP5K 5FDYA 3NA9L 5DMGD 4V2BA 4JFQB 4NJ9L 2OCFD 5ITBL 1F3DJ 1JPSH 4NN5B 4EI6A 3B43A 1C5CL 2CQVA 4DGVL 2XYCA 3GSWA 5IQ9B 3FQRA 4P9MH 4MXWH 1X3DA 1XGYH 3RWJA 2XZCL 4HK0A 2YSSB 1MLCA 1DQDH 1YEFL 4RFEB 1MCJA 4CMHB 1AD9A 3LB6C 1GAFH 4ETYA 3DUSA 4CBPA 4DN4L 4BSWA 4OFKA 1OAQL 4BQCA 3BD5A 1ACZA 3B83A 5GRJL 1NJ9A 4ZXBD 3V4UL 1DQJA 5GPRA 3FMGH 4NOFA 1C7TA 1JV5B 3MRIA 4P2CG 3C08H 1G7LB 3WSQH 3RL1B 4K8RL 4TNVK 3V5DB 2FIKB 5CUSH 5C0EB 2XN9D 3C5ZD 4LNRA 3ETBF 3VXQB 4HW6A 1IAII 4L3EA 3VFGL 1QSFE 5F1NA 5C0CE 1U8LA 1RJYB 3DURA 3VFNA 4P3CH 1DVFB 4H0IA 1S9XA 1A7OL 2XTJB 4NIKB 1BREA 3G5XA 4CDGC 3OR7B 3ZE0E 3L3IA 3MA9L 1DQLL 4I3SH 4E42B 5F7YC 4OZFA 2AV7B 1MHPH 1J8HE 1FNFA 5SWZD 3W9EB 5KVEH 1UENA 2OQJB 4FFYL 1QPPA 5DQJA 1NEZB 3PL6C 3FQNA 3HRPA 3R1GH 4U31A 4BQ8A 1JL8A 4HCRA 3HR5A 2APWA 1LEKA 4AZ8A 4Y4HD 2NY5L 4P46A 2D9CA 4E41A 4O58L 4OF7A 4NQCA 4JR9H 5DRZA 4P59L 1GGCH 4UTAH 3T0EE 4QHKJ 3TIDB 5D7JB 2QTEA 3NCBB 3OGCA 5C07A 2JCCB 4OLZL 1A3RL 3AREB 3UDWA 4NNPL 4DWHA 4Y16D 1BJ8A 3HAEH 3D39E 3O6KH 1ORSB 3O0RH 2R2BA 1DR9A 1K4DB 3UJIH 1G0YR 5DXWA 3IU4H 5L88H 3DHMA 3MUGB 3QXDA 4L3AA 1OP3K 3KLAB 2G9HB 2VITA 3WO4B 5K9JH 5JPMB 3PQYB 1AXSA 3UTSD 1FNAA 4ZUWB 4UV7H 5DSCB 1MAMH 1S9WB 2DBLL 2AJYL 4XNYH 3UJJH 1NFDF 4FFZL 3WEXA 3FQXB 5KAQF 1L6XA 4U3CA 1W0WB 4U1LA 3GJFA 4F7CA 1P84J 5CJOH 1MREH 1V7MH 2AEPH 3CH8A 4UT9H 1WZMA 1MSPA 3GJFK 4OD1H 1YEHL 3CCHA 5FF6A 5ICZA 5D7KD 1CFNB 1QVOA 4KY1H 4XCYB 4HIXL 4NO3B 2NY6B 3VRIB 1IRAY 3QEUB 4P3DB 3P11H 4ZFOL 4R3SA 5ILTL 2NY2C 2FJFB 3JWOL 1OTUC 4PV8A 4HK3N 5D8JH 1NBZB 4HCRL 3CXHK 3QQ9C 3P40A 3ZT5A 4K3JH 3HE7A 5EU5B 1MY7A 4FQLH 4JPVH 4RBPH 5IHZB 5AWNL 2XT1B 3QEQA 3QQNA 4YC2C 5D70L 1ADQH 1T20A 4NPYB 4TN9A 5EOCH 3EO1B 4OZGA 2DS4A 4HMDA 1HQ4B 4XNZB 2J4WH 1NCAL 2CLZB 1INEH 3V0VA 5AD0A 4LCWA 2AS5M 1RURH 2L7JA 3MLWL 3BN9D 4EOWL 1QFHA 4LSPL 1BFTA 1F00I 5I6XC 5JLZB 3UTTB 5KG9A 4PJ9C 4XX1G 3SE4A 5HSFA 3IDMB 1HHIA 3OKLA 3LKSA 4MA8H 3SDDB 3UPRB 3UBXB 5INDB 3RFZC 2EEDA 1EHLL 1I1CA 5D71L 2A1WL 3NCYS 5IVXB 5JPNB 2VIRA 3DETD 1BVKA 4XH2B 3EHBC 2CUIA 2VH5L 2B39A 5F7MC 3CLEL 4GMTH 1ACYL 4JO3L 5F88B 4GRWH 2YWZA 5CINL 5JIPA 4PLNC 2R0ZH 2GAZA 5B38G 2NX5A 1NFDE 2AXJA 3B9KC 4G9DA 2NTSP 4MYWB 1XMWA 2GJZA 4N8VG 2BSRA 4XAKE 4YJZL 1XGQA 5CIPH 5BS0B 3K2MC 3S5LA 4N0CC 1QO3A 4Y4FB 4C56D 5KZCB 3HG1E 5B8CA 3T0EC 2IPKA 3D0LA 3W2DL 4Q0XL 2DQGH 2C1PB 3MJ8B 3MRGB 1XF4B 5A40E 3HI1B 3LZFH 3ABZA 4HS3A 4ODBD 3S4SG 3P73B 3KR3H 1EBAA 4GRLC 1DE4B 4X5WB 3BEWB 1UB6B 2YUXA 2EO1A 2MHAB 5DA4A 1ZHLA 4NKDA 4JO4L 1OQOA 1WVZA 4P2RA 4AM0B 4C83A 1FDLL 4EQ3A 3IETB 3LB6D 5BXFA 1JCKA 5DHVA 4C4KO 4NDMA 5JOFB 3BFOA 4LRIA 2GY5A 4U6XA 1FN4A 4O4YH 3TN0B 1SY6H 2IPTL 3FOMB 5GGTH 3BIBX 2KL6A 3BPNB 4K94H 4XP9L 3FB8A 4NQSA 4XPHH 4G9FB 2GJJA 5GJSL 5E2TL 2RCSH 5C08E 5AUMB 1ZLVH 2DIAA 5I19H 1JMXA 4K7FB 3T4AA 2LFGA 1G7MB 3CFEB 3SDYL 1K6QL 4U1JA 3GI9L 4X6EB 5DD0L 2JTDA 3P3YA 1XF5A 1IEAB 4Y88A 2OR9L 1D6EA 2O5ZL 3SBWC 4TRPH 5MI0C 2BSTA 1DEEB 2VR5A 3O6MH 4LSUL 1D3CA 1DLHA 1JRHH 1MQ8A 4P49A 2DKMA 4JFFB 2XKNB 5IBUB 1K5NA 3D18B 4N5UA 5HHNA 2IH3B 3WN5C 1RHFA 2YK1L 2WW8A 3AFLA 3K0WA 2P44B 3PL6D 1P4IL 1RZ8A 1A14L 3CPLA 3MLZH 5EO9B 3P4MB 2VLKB 3TWCL 3UYRL 3FO2A 4R26L 2XKUA 5JW4R 1W72B 5H8DA 1BOGB 3MV9A 5JW5B 1A1NA 2AK4D 1A9BA 4IRSC 3NPZB 4PJ5E 4WFFD 3EOBA 3DXAA 2FCBA 1V3KA 3CSYB 4L4TE 5IK3A 4FQXC 1MCDA 4YHMH 4XPTH 1N5AB 1UH4A 5ENWB 2RB8A 4PJ8B 4ERSH 3LN5B 1YY9C 1FNSH 4JRYD 5KANI 4QHNA 5C7XH 2E6QA 2FH8A 1MCPH 1WIOA 4AIZB 4KI1A 1OLZA 3HUJB 1WAAA 5CHNB 4YQXH 3EJJX 2UWEF 4PRBB 5IEHA 2EDEA 1PX3A 3NCYP 1KLUA 3FN9A 1RVFH 2R9HD 1S7VB 3GHEH 1JF1A 1U8MA 4P2QD 4ZS7H 1CTNA 1VENA 4AEHH 4XXDB 4HDIA 4GQPH 5JZ7C 1F8TH 2HG5A 1OPGH 4NP4H 4O5LL 3RIFK 1CL7I 3IFNL 2FHBA 1KGCE 3QPQC 1RQ5A 1M7IA 2CKNA 1GOFA 2VERN 5FYLL 3GIVA 5LGJB 1HHKA 1MCNA 4ZO6A 4N1EA 2PW1A 5I18H 5C2UB 1WITA 4HGWB 4G8GE 3SGDH 4CMMA 5TQ0H 5CFHA 5KSBB 3TCLA 2R8SL 1WK0A 3O81A 2BVTA 1YYML 3B5TA 1UKTA 2NY2D 2O61B 1CZ8L 8FABA 4R4BA 1OTUD 4ETQB 3QQ9D 4NUGH 4GW1B 1TNMA 3HE6C 4OLYL 1KIQA 2P8LB 2BVOB 3OAZK 2QKIA 3BQUC 3PG2A 5HVWA 4NQEB 1W8NA 2IAND 4QCIB 5I16B 5LBSL 2NY4B 5HVHB 1EA9C 3RPIB 3VFTB 3SJVA 4G6KH 2BP3A 3Q48A 2JCCF 1BZQK 4NSKB 4K9EL 1A7BA 1MCRA 1U95A 3W11C 3D9AH 1ZANL 4UQ2B 4JPIA 5CCKH 2ADJA 3LKQA 4OCWL 2FSEB 4OT1L 4ONHA 4Z77B 2Y25A 4PJ9D 4KQ3L 4LPCA 4YX2L 5ICXA 3TVMB 4J2XA 1VERA 1QSFD 3VH8B 5C0CD 5JTWA 3BPLC 4H88L 2VXVH 1ETZB 4ZUVB 4UAOC 3DTXA 1CT8B 1H3VA 1PDKA 2H26A 3L3HB 2A0LD 1AHWB 4F8QA 4L8SA 2UWEE 2YPLA 4AMKL 2V9TA 4XAWL 1JYVA 3CSBA 4UMGA 1J8HD 5D93B 1C1EH 5GGUB 1J86A 3H0TA 4X7TB 2EYRA 1IAOA 3O3BB 3A67L 4G8EB 2EE9A 3B9KD 1HH9A 4YIQB 2DN7A 4WHDA 5E5MB 3E6HA 2AP2A 4YO0B 4FQCL 5FO7B 3DVFA 1XGTB 3C09C 15C8L 4HUUA 3EFFB 4I1NB 3VXOA 4L5FL 3L3GA 4KGJA 1R5VA 1MJJA 4Y4KC 1KJVB 2DD8H 4MJIB 1G7QB 2PR4L 3IAGC 2RAMA 3T0ED 3SE8L 3KPPA 3ZHKA 3EO9H 3MX0A 3LQZA 3WE6B 3QA3B 3RWHA 3VD9A 3ZKQD 1EO7A 4K2UH 5ANMB 3S36H 2ARJQ 3D39D 5D1QC 4RWYL 4GRLD 3AMKA 3UTZB 4WO4C 3UP1A 4HUVB 3MJ9A 2Q8BL 2ZWLT 1E6JL 4H0GA 3ULSA 3RGVB 2JIXA 2IG2L 4PRHE 3HZYA 3GBLA 2V9QA 4KXZH 4D0CA 1YEDA 4ZDHB 3I6KB 2F53E 1L9NA 2OK0L 3MZTA 1RD6A 1LP9B 2Q86A 4UOJA 4V1DA 2CJUL 2C3XA 3IJSB 1MQKL 3V6OE 5IVXF 2RHEA 2ED8A 4YLQT 1HQRB 5HGDA 4U4BA 1WCBB 1YPZB 3NZHL 4PBVC 3U7WL 5FYJH 4LARL 1RULL 1MEXH 1A5FL 4K3GA 1HYRC 3T65A 4PGCB 3EGSB 3QQ3A 3MRPA 4HLJA 5IIEB 1MF2H 4FA8A 1FO0H 5TE7L 3RHWF 1IQWH 5E6IB 1AH1A 4JFEA 1JF5A 3QISA 1BP3B 1R5WB 3NFSH 3UYPA 3LS5H 5DT1H 5TQ2H 4K7PL 3O45B 4MNGE 2D03H 5TE6L 1FIEA 1WFNA 4TQEH 1UFUA 5IWLC 4WW1A 1I3UA 1I9JL 3MRJA 2PTTB 3DVNB 4JM2A 1NCCL 4FHBD 4RAUB 1DQTA 5T3XL 1RZIA 2DMCA 5HGBA 5CMAB 4R0LC 1AD0B 4JFXA 3T3PF 3JTSA 2A6IA 4KAQH 1GZQA 4HIIB 2V2WB 3QNXB 3CXDH 4JB9H 4UU9A 5DJYB 5CBEB 3OKEA 4HS8L 1DBMH 4D94A 4D3CL 2ARJB 3DVGA 4JN2A 5BQ7B 4RMSA 1ND0B 3QH3A 3PXHA 1AXTH 4FQXD 4UUJA 3MJ9L 4EIZC 3GI8H 1A6ZB 4ODWA 3QNZA 3KLDA 1WWCA 4NCC2 4D2NA 4JG1H 4YZFF 1YY9D 4QTIH 3ZL4H 2BFVL 4O9HH 3BJLA 3FO1A 4GAFB 1J0IA 1XF3A 2DTSA 5TDNB 3OKNB 2P5EA 5K9KB 1N2RA 1KACB 5EBGA 1U8OB 2X70A 4FQ2L 5IVXE 4PLKC 2OP4H 2FIRT 3CLFH 2FO1A 2LQRA 2IMMA 2QQKL 4QRSA 4XAKD 3V0AC 5MERB 1QSVA 5HDBF 5JZ7D 4MAYB 5EIIB 3TH3T 5HHQB 2NCMA 1P6FA 3ECBA 4IMLA 3AU1B 1BQHB 1M71A 5I75C 3C6LD 3VD3A 3T2QA 1WIPA 4CRPA 3HG1D 5KW9H 5E9DB 1NGPL 4YDKL 3U4BH 4WGVB 2VDKL 3LMJL 4PJFE 5ALCH 3ZDZF 1YN6B 4NWUL 3WHXA 2ESVA 4ZOBA 1P9MA 3D48R 4X9HA 3KPNB 1IGIL 1VA9A 3BT2L 4P57B 4LIQE 2DQUL 4H8WC 4DGIH 1UVQA 5JW4N 3ARXA 1PKQE 2HH0L 4KVCH 2ADIA 1G7HA 2EICA 1CYGA 2VISB 3ARRA 1GSMA 2JJVA 3SY0A 2QHRH 4XRCB 3SQOL 5D7JC 5FYKL 1T2QH 1FZKB 3HE6D 1ZT7B 5D2LB 3TBTB 4TVPL 3BQUD 5F72S 1HDMB 3T3PE 1I7UA 2VKXA 4X98B 5JHDE 3V6OC 4NZTH 3LHPH 4MXQC 1QQDA 3S35X 3VG0H 1BEYH 3ZKXC 2I24N 2HFEB 3O4OC 1NGQL 2HT2D 4ZXBA 3QJHB 2SEBB 1BECA 1BIIB 1KTDA 2ERJB 1P7QD 4YZFE 5C08D 3I02B 2VDQH 3H9HB 3IKCB 4QNPE 3QFDB 4MLSA 4G42A 2XN9A 5FHAL 4HMEA 3C5ZA 2LE9A 5F9DC 5CBAB 1KB5A 4JFZH 5T3ZD 4MVBC 4LSVL 4U49A 5HI4D 1O7VA 3I3BA 1I3RB 4GAGH 4LVNC 5C9KA 3QHFL 4G9FE 3L6FA 2R2EB 3MXVH 4NT6B 4PJEE 4YPGB 5DJDA 3MCLL 5IOPA 3MA7B 1BM3L 5IFJB 1OAUL 4OBSA 4Y5XB 1I1AB 2APVA 4HJJL 3VFMB 5SWZA 1AGBA 5E08L 3O2WH 4KKLC 1QRNE 2OTPA 5TDPB 5SX5H 3CX5J 5E99L 1M6OA 1YEGL 5C0DA 2DQEH 4UDUB 5ETUB 5E5RB 5KSBF 5E1HB 5IG7B 2LVCA 1IVLA 4Y4KD 3DUHA 4LSTH 2A9NL 4PJ5D 2FEEI 2NTFB 4HQQH 2DTMH 4GG6B 4Y4HA 1IC7H 3WV0A 2DLEA 4L4TD 5J8OA 1X6LA 3DROB 1F6AB 2PXYB 4X7SL 1A4JB 4OLVH 3SKNB 5TF1L 3TA3D 2YC1B 4U1IA 3QG7H 4XC1H 5IQ7L 1M4KA 2HWZH 5I1KL 4DKFL 3MMEB 1HKFA 5D1QD 3S36X 4I48A 3BVNA 5CEXA 4FZEL 2HVKB 2BNUA 4ZPTA 3X11B 6FABH 2E27H 4Y16A 5JMOC 2KUTA 1DQQB 3ZHLA 2M8XA 3GBMH 2BOBA 1LK2B 4PJIA 3TJEL 2OI9B 2VLJB 3EOAB 2X5PA 4M93C 3GSNH 4Q9CA 4U1HA 3T2OA 4HWZB 2R1XA 4Y5YA 1VHPA 4OJFH 1F2XK 2UYLB 3NCMA 4X9IA 4R7NA 3UTSA 1KYOJ 3PWVA 5HHPB 4OUUB 2FB4L 1KGCD 3VRJB 1DDHA 2H8PB 4F7MB 1FCCA 2EDYA 2EEAA 2YOCA 3VFOB 5GXBB 3WDJA 5HYSA 1IKFL 3G5ZB 3EOTH 1KB5L 2C4FU 4BFIA 2LABA 3CDFA 3THML 4PY8I 4G8GD 3OV6A 3R8BB 1LE5B 5DS8A 3QI9C 4JPKL 1BD2E 4MNHA 4OQTA 4WI4A 5AZEH 3H3PL 4WUKL 3F5WB 4IRJC 1I7RA 1RK1B 5BO1L 1T1YA 3MODL 2DYPB 3I9GH 4RMRA 2MCG1 5KJRL 5DWUH 5HHME 4JAMA 4CVZA 3UTPE 5E2VH 3JUZA 4J4PC 3VXRE 1MFBL 1LO3H 1IKNC 5KSBE 1N8ZB 2X1XR 2E3VA 1UZ8A 2ED9A 2DDQH 2GJ6E 1HOCB 2AEQH 3UC0H 3VI3F 2VAAA 5GGRA 5EUOA 4RDQF 4URTB 4TUOA 5EOTB 4KJQC 1F3JA 4Q9BA 5F8RC 1CU4L 4YHPB 1MHEB 5DJ0B 4X4XB 2YBRA 5D7IA 4PB9L 3KHQA 5LGHL 4I18A 2BNRE 2HLFD 4KHXH 5GISH 3RVTC 5IFAL 2BY0A 4J3WA 3RUGB 2WWKT 1NL0H 3EZ8A 2YA2A 5B4MD 3QO1A 3P9WB 5DGQA 32C2A 1Y6KR 3VXPA 1LP9F 1EAJA 3D3VE 4PJBB 1LO0L 1FPTH 4OM0L 5L7XL 1KEMH 4WVRA 2XWBB 1VACB 3DO7B 3KDMA 3GRWH 1MRCL 1YPZF 2QADB 4NQTA 5LAXB 2QLVB 4PJAE 3PWJA 1DVFD 3KYNB 4PLKD 2XTJD 4TULH 3NZ8A 1LHZA 4L4VE 3WFZA 1PG7W 5TE4L 1QUNA 5L0QC 4Z5RA 4IJ3B 2HJKA 1A02N 2XZZA 5I2IB 3JWDC 2YZ1A 2DM4A 3NCJL 2ZJSL 4OQTL 5EIVA 2Y36H 3SE3A 3B9DA 2H9GB 4JY5L 1C16B 5C09E 1TJIH 1KOAA 1IC5H 1KB9K 3HAEB 4C56A 4AK1A 1CS6A 3HMWH 5F71A 1OB1A 3UX9B 4G8FB 2FJGB 1GPOH 5I66B 3VXTA 1M05A 3P2TA 4Z7UB 2IQAA 2EDRA 4P4KB 3SGEI 2QQLH 2HJLB 2N7AA 5GSRB 2EDFA 3L5XL 5JW4Q 4MJIE 3FQUA 1LQSR 5C0FB 3AB0C 2FJHA 3VE0B 5D7JD 3ULUF 1BLNB 4PRHD 4LFHD 2DMBA 4HJGB 3MXWH 1YYLH 3VI3E 3H9SB 5H37H 5DZOA 2F53D 2X89D 1SVCP 3PWNA 1KIUA 4YDLC 3CZFA 3O3EB 3MNVA 4NHCH 5D96C 2EDNA 3QUXC 4KVNL 3TESA 1IBGH 4QRRA 2B1HH 3Q1SH 4R96B 3DYPA 1LDPH 3IRZA 4P2OB 3BDXA 1A6UL 1OSPH 1HWGB 5F9WC 3B6SA 5DD5L 5HGAA 2Z31B 1SJVA 4BSJA 3MJGX 4NZRL 4N0RA 2VN4A 3O2DH 4Q7DA 2EEBA 1QBMH 1YNTA 1F11B 3LDBC 4CVXB 1BOYA 4LCIL 3H8NA 3V52L 3H2WA 5IEKB 2FGWH 4LCCC 1FV1B 2FBJL 3E1F1 4JJ5B 2FECL 1RUMH 4IIQC 3HR6A 2F8XC 4X0KB 1VGEH 1EV2E 1TQCB 3C8DA 5GZOC 5C71A 2GEEA 3F7PC 4IDJH 2NY6D 1RZJC 3HZVA 1IFHH 2MPAH 2HKHH 2Y07H 4DZ8B 2RFXB 4HC1H 1JFQL 2Q3ZA 3DLQR 2D2OA 3ARGB 4BA8A 2A38A 1LWRA 1K4CA 2FL5B 4RA0C 4KKLD 1UJTA 3PL6A 4IHOB 1OTTC 5T1DL 3U1SL 4BKLA 3MROB 3P0GB 1DFBL 2V7HB 2WP3O 5F9OH 4OI7A 3PHOA 1RHHA 1S7UA 4LQFL 1XZ0B 4PJ7F 4KTDH 4PJXE 2VZVA 1Z5LB 2VKWA 1E28B 2VLRA 1RPQA 4QXTB 4R6UA 1HXYB 3CVHA 3VXMB 5KS9B 5F7EL 5HY9B 5DR5H 4ZUSA 3GSVA 3ILPB 3V7MA 3STBA 3ULUE 4M02A 2MCPH 3GMMB 3F58L 2KQMA 5E2WH 1TETH 2GUOB 1L0YA 1H3TA 2WP3T 4JRYA 5IB5B 3S88L 3QUYC 2RBLA 1A7PL 1T7ZA 5TPWH 4G8IA 3B9AA 2LTQC 1SYVA 3CVIL 4H5SB 1WBXA 4D0BA 4X4YB 2YA0A 4DN3H 2DLFH 2F74A 2I60H 3O6LH 2VZSA 5JR1H 1FGVL 1ZWIB 1PQZA 1RIVL 4KC3B 3U46B 1JUFA 4P2QA 4L9LB 3BUYB 1K2DA 1P5UA 3MLTB 1IGJB 1QFPA 2ED7A 1T5XA 3IKKA 3J8F7 5FDWA 3DRTB 3P77A 4KTYA 1FSKC 1T3FB 1A9EA 4PP1C 2CO6B 2YWYA 3GMNB 4RQQB 3S34L 1JRHI 1GIGH 2BK8A 3NTCL 3GMLA 2G2RA 3G08B 3Q6FA 3REWB 1VGKA 2VXUL 4IRJD 5KZCD 1DUYB 5D2NB 4MDJB 4N8VB 4TSAH 1WBZA 2Z4QA 4OZIE 5BVPL 5GSVB 1YNKH 3L1OH 4EDXA 4NO0D 4JZJC 4LEXH 1D9KB 1MFCH 1VPOL 4FMKA 4J4PD 4GG6F 2Z35B 3V6BR 1N26A 1WZLA 2R0KH 5JHDD 2FHCA 1ZT1B 3FQTB 1F5WA 1WZ1L 5ABDE 5DMIL 3CUPA 1GJIA 4XP6L 3RI5K 4KJQD 4PJ7E 3S4SB 3QWOA 2J2ZA 3TO4C 4XCCL 4AIXA 3MRHA 5D5MB 3CVHL 1X4ZA 4DKEL 3W0WB 4XP5H 3SKJL 1ZMYA 5HPMA 1MIMH 4ONGL 3RVTD 1NDMB 3ZKMC 4M6NH 1TQBC 1CG9A 1KCKA 4U6YB 1U92A 1UYWH 3R06A 4PJ9A 3MRDB 4FTVB 3RWCA 4HX1A 1KJ2H 3QULA 4PTTA 1QSFA 5C0CA 5DDHB 4HV8A 4WUUB 4G9FD 4CJ0A 3C60B 4YHNA 2X4NA 2IJ0C 4U1KB 1I8MB 1MVFA 1JPGB 4UINH 3MRBA 3QZWA 1VEPA 2BHZA 1A7NH 2MQ0A 3DX9A 4OSUH 4DEPC 4DVRL 2EDKA 1J8HA 4WTZG 3IJYA 2A6DA 2AI0H 3WFEL 5C2BL 2JB6B 5CEYA 5CZVH 4NHUB 5DVOA 1QRND 2G5RA 4OB5L 3TNMB 3ES6B 4RFOL 2R29H 4I8DA 5JIIA 3B9KA 1XGRB 2FO4B 3IVKB 2DQTH 5B3NA 5J6HA 3SGDI 1S7XA 2WBJB 35C8L 4LHJB 1YQVL 1G7PA 4EQ2A 3AAZB 2L7UA 4MQXC 4K71B 5ESAA 3RY6C 4QTHB 2MWCA 4POZC 3KAAA 1JGUH 4F37K 5F7DA 1I9IH 3T0EA 2DI8A 3X14B 1ITBB 3ULUC 3Q6GH 4HUXB 2IPUG 5HDQH 3OXSB 1S9VA 3ARWA 1GGYA 1YMME 3RNKB 4GG6E 1AO7B 1L7IL 1CGXA 3N06B 2GT9B 3D39A 4GRLA 1XH3B 2BHUA 1EMTH 1LO5A 3TO2B 4F58L 1YJDH 5D6CA 3FO0L 3JV6A 3QSKB 5A2IH 1WQVT 1OOAA 1UWXK 3TH2T 3BHBA 1T6VN 2VDNL 1WWWX 1UACL 1Q9OB 2B2XH 3QUXD 1G9MC 1J05A 5A2LH 5MEQA 5EBWA 1PW3A 3ZO0A 1F02I 2J5LB 1PSKH 4PJBF 1UM6H 3SEPA 4PRIB 3PDOB 3NCFB 3QUZC 3IDYC 5HHOE 2FH6A 4OD2A 4UNTA 2LAGB 2FZ3B 1CK0L 3KPRE 3LKNB 4OM1L 1AFVL 2IH1A 2BCKA 2R2HB 3IS0X 1BD2D 1HKLL 1D5IL 5JW3H 4TPRH 4YR6A 4RCAA 4PJCB 2WUBL 4N0FB 2P48B 3VWJB 4M6AA 4ZYKA 4PJHF 2AKRA 1ZSDB 3NA9H 1AI1H 4YXKH 4NJ9H 3CFDA 2VR4A 2CIKB 1FNLA 3GSUB 5HHMD 5ITBH 5I17B 1A64A 1TNNA 3UTPD 1PZUB 1C5CH 3L5WA 3VXRD 5I1JH 5CP7A 5E5UB 1KJMA 3TZVB 3SBWA 4XXCC 1T21B 1FBIL 2ZG2A 5CGTA 2DQJH 2GJ6D 4TTDC 3VGEA 1ZTXL 4G5ZL 3EDKA 5C0BE 1YEFH 4DAGH 1KSRA 1KPUB 3MGTB 5HYQA 3WN5A 1OTTD 2EYTA 2PETA 3I75A 3NN8B 3H6JA 4PB0H 4J1UB 2D7TH 1VADB 1Y0LB 2NY3B 4KWUA 3S97C 2X05A 2BNRD 4ESKA 3HS0B 1OGAB 5GRJH 3OR6A 2XZAL 5J1TC 1A3LL 1KELH 4JKKA 4NGHL 4J8RA 4P23B 5B39G 3PABA 3IT8D 1S9KC 2HKFL 2VZTA 4IRSA 4K8RH 1HHGB 1EJOL 5CD3B 2EYSA 4Q2ZA 3D3VD 3K2UL 3BDYL 3MJ7A 4FQXA 4G43A 2D4DA 4KXZI 3O2VL 1S7TB 2B0SH 2YMXL 2Z91A 3ILQC 3K8LA 4PYHA 1VEOA 3AS0A 3BSZH 4C55A 1A4KA 1NGZB 3TVMD 3MRCA 1BHGA 2IMNA 2ZG3A 3QUYD 4MHHI 4ODVL 5C1MB 3QCTH 3WFCL 4HUWA 4L4VD 1U93A 1A47A 1NFDA 2FYYB 4C54A 2CKBA 4I3GA 1ROWA 2GYSA 1B90A 5EU7C 3BP4A 4MSWB 3IGAB 4LLUB 1RUPL 1K8IA 5C09D 1PEWA 3OX8A 3C6LA 4NFBA 5H35B 4CVUA 4UB0L 5ACZB 1NGWB 2NY5H 3HG1A 4WW2C 4I9WE 1J0JA 1MFAH 4NJAL 4PP1D 3P4NB 4PJHE 4KJPD 4A2MA 3RY5A 2Q76B 5GZNC 3WL9A 4YEEA 4UT7H 2FRGP 3QXAA 5FGSA 4OD3L 1RJZA 4DK3A 1WTGT 4MJID 2O93L 1AP2A 2GK0A 5BZWA 5CEZD 1K8DB 4AH2B 3ARDC 4Q97A 1S5HB 1NMBL 1HE7A 1LEGB 3ESUF 3OSKA 1A3RH 2ZCHL 1O7SA 5M7QA 4NCDA 2J88L 5I8OL 4W6XB 4JFYB 1HNFA 4AY0A 1QLRB 1U9KA 4M7KL 2NXZC 2D31B 2KPNA 3HE6A 1PG7H 3NPSB 4HULB 5I1LB 3BQUA 4PY7B 2QQQA 5HDLA 3H7BB 5KS9F 3BH9A 5I9QC 4RZCA 4DW2H 1NDGA 5LWYL 5D4QA 4BFEA 4H0HB 3EDJA 5DC4B 3CX2A 3TGXA 3TO4D 3LQAL 2AJYH 4MD5B 2IQ9L 1J9CT 4FFZH 5CKGA 3B9EA 2CIIB 4X99A 3ZKMD 1FFOB 3GBNL 1MJ8L 5C08A 1P7QA 4HFUL 4K7PY 4M7ZB 4TNWF 5DK2B 4ZO7A 4NRYA 1NMCB 1HSAB 3RWIB 5A2JH 2HVJA 4OFYD 3KJ4B 5ALBL 1I3VA 3PWLA 1J87A 5J6GB 4OZFH 2GI7A 4N0UB 3FHAA 3DX6B 3UJTH 5KN5B 2CKBL 3RDTC 4CN4A 4BSVB 2H32B 1P7HL 3QRGH 1PYWB 3JWOH 4HD9A 4HZAA 4U6VL 5GHWH 2LV4A 5CS7A 5DMKA 5EFIA 5BV7B 1OHQA 5DMJB 1TXKA 5DA0B 4XWGL 3V5HB 2GY7B 4HJ0C 1T1XB 1I1YB 1G7IB 5D70H 1VFAB 1FYTB 1MLBA 5F93C 4YPJA 1BZ7A 4LLQB 1FZOB 2VQ1A 1NCAH 4Y4KA 5E2UL 3VFWB 1N4XH 4PJ5A 1FL6B 2A73B 1FVDA 4EOWH 4L4TA 1T22B 3F7RA 3OZ9H 3ULUD 1PY9A 1HSBA 2OXHA 1OP3H 2Q8BH 3MRMA 1X4YA 3WLWC 4AQ1B 4KK8D 4Y8DC 3VXNA 1Q9KA 3D69A 4LAJH 1N6QH 5GIRB 1RI8A 1EHLH 3TEUA 5D1QA 3MGOA 3RWDA 4WO4A 3O4LB 5GS1C 5D5MF 4JVWA 4MA1B 3GIZL 2AJZA 3A6CH 1UQSA 5EPMB 2P7TB 3G04A 1H8OA 1DBJL 1U8KB 1ACYH 4XBPB 4GRWE 4JO3H 1S7WB 4HSQA 3MREA 5JA9A 4ZUTB 3ZHDA 3RJDA 4NO5A 1XGUB 1KN2L 4NZJA 5AAMA 4CADA 3UO1H 2CDFB 3QUZD 1ITCA 2DWDB 3FONA 3KXFE 1P1ZA 4LPUA 3NAAL 1V7NH 3C2AL 4HWEH 2EDDA 3LN4B 4GFTB 1ZV5A 2X4UB 4KJWC 1B0GB 3LV3B 4G8GA 5FGCB 1J0ZA 3W2DH 1DUZB 3WFBH 5MEOB 5IT2L 3VA2C 1AY1L 3VGFA 4AEIL 1FC2D 3NGBB 4YWGL 4N1HB 4GAYB 3MLUH 2V17H 1DN0B 5JNYA 1DL7H 4WI7A 1F13A 3T8XA 4QXUH 5LJYH 2PYFB 3OKDA 3RNQB 5IWLA 3PUCA 2W91A 2NXYB 2NW3A 3BZFA 2J8UF 3GKZA 1QR1B 1MCOH 1DBBL 3OKMB 6CGTA 4LSQL 4L4JA 4NQDE 4F7EA 3NFNA 1KLGB 3QPXH 3LRSB 2H3NB 4N5EC 4R0LA 5LKNA 3HNVL 4G6FD 4CJ1A 3V6FB 43C9B 3EIFA 4OGXH 1FRGL 3S5LG 2EH7L 4NM8L 4Z0BL 4PRPB 5E8NA 4GBXB 4LGSB 4XP9H 2ILLA 2A83B 1A8JH 4ODUB 3CXHJ 4PGDB 1LEIA 1J5OL 3TM6A 2DQFA 5GJSH 5EORL 5E2TH 2Z0BA 1A2YA 1H15B 2X44D 3MLYH 5C0IB 2GSGB 3IDGB 3OF6D 3OJVC 2UWEA 1ZA6A 3SDYH 5T1LB 1G6RA 2PO6B 4Q9RL 4JY6A 1K6QH 5AZ2L 2C1OA 3I2CH 5B38A 4O2FA 1KV3A 2OR9H 1CDUA 1V3MA 2O5ZH 3MCG1 3Q5TA 4QHLA 1SEBB 3RWGB 5T5NG 1D5XA 4QXGL 2BOCA 4Y5VB 3RTQB 4NC1E 1I85C 2XA8H 1JVKA 2V5MA 2YK1H 4PJCF 1FFPA 1P4IH 3F7VA 5A43C 1MCHA 4UQ3B 4G80A 3TWCH 2Q1EA 3BAEL 2OL3A 5F9AC 3QAZB 1NBQA 1MCFA 3I3EA 1G7JA 4ELKA 5JHLH 2W59A 4QY8B 4WHCA 3EYSL 4Y1AE 1P4BH 4DQOH 4JREB 3OHXB 1YMMD 5C3LD 5J4MA 2CH8A 3DRQB 3U2SA 3UTOA 4WU5B 2Y7QA 1QEWB 4XTRC 3J7HA 3KPLB 5KSAB 2OJEB 4M6ML 3PHQA 2J8UE 5DURD 1FORL 4MDIA 4XGZA 2ITCA 5D7JA 1F6FB 2NXZD 4PRHA 3BKJH 5A2FA 3KPQB 1A6TA 2F53A 2X89A 1CICB 2ADFL 1PG7X 2H6PB 3JV5A 4M43L 3TF7C 3G6JE 1X5JA 3U36A 3RAJL 4YGVA 3QDME 1JHTA 1R6VA 3V6OA 2WLYA 4M61A 5DYOB 5HHOD 3W9DA 4ELMB 2L4OA 2W9EL 1ZLUK 1QFWL 3KPRD 3KLAA 5I74C 1CWVA 3H3BC 1X5LA 4O5LH 5JPMA 3IFNH 3H3KA 2RIKA 4JFDB 4OF8A 2GITB 1G6RL 4YFLF 2X6MA 3FB6B 5F9JB 3QEHB 1LK3H 1NBVH 1MFDL 3LKRA 4LLVA 4XNUL 1KCSH 1OT2A 1OCWL 2IFFH 4KROC 5ESVB 1E6OH 1L6ZA 2X1OA 1NFIB 3E2HB 1G0XA 1B2WL 5DI8B 4X8JB 1AQDB 4MNGA 3WS3B 3RDTD 2QL1A 1R5IB 2E7HA 3HZKB 2XICA 4QOKB 5LQBL 5C0BD 4QGYA 2Y6SC 3HHRB 4OZHB 1T0MB 2OL3L 2VJXA 4FXGA 4NRXB 1SEQL 2DYPD 1ZHBB 2VZ1A 4HHAB 2QEJA 4HJ0D 2FJFA 4BH7A 5LBSH 3ZDYF 4Z7OF 1QSEB 1SYSB 2APFA 2VB5A 3QR2A 4K94C 2AABL 3GKWH 3M17A 5BJTA 5IHZA 4H8WL 1Y6MR 2A6JA 5KTEH 1ZANH 3E6FA 3GB7B 4OCWH 5J1SC 1W0VB 1SQ2N 5T3ZH 3WLWD 1BBJB 1EGJH 1F58H 4L8DB 5FYKU 3AC0A 1XR9B 3U6RA 1N3NA 3FN3A 5C8JA 1IAIL 4WJ5B 3QXTA 2IADB 1XCTB 2EDXA 3MFFB 2FATH 3F6IA 5JW4M 4TUKL 4WTWA 1ZKAA 3BGMB 3LY6A 4XAWH 3LKOA 1KIRA 5BVJA 4GAJH 3RIAF 5IVXA 4A6YA 3GO1L 4NC1C 5INCB 3UCRA 4AQOA 2BNQB 2AV1A 4Q6IC 2QADD 3A67H 3MNZB 4ONFH 2HFFB 3TBWA 5F88A 1J1PL 4NWTL 4HS6A 15C8H 4I9WD 2UUDH 1NMAH 3IDXL 4WY7H 4YHKL 2IAMB 4PJFA 4LVHB 4JVPA 5JQ6L 3ZE2F 4MWFA 5DQ9A 1AR1C 1CFVH 3WD5L 4KJWD 3W39B 4OLEA 2HN7A 3KVQA 4OZ4A 4NYLB 1KTLA 1QFWM 4JDZB 3QI9A 4ISVA 4G7VH 1NAMB 1PKQA 1BFSA 2NY0B 2HRPL 3BD4A 4IRJA 2PYEE 4LPTA 5DRWB 1I4FA 4RWYH 4R2GB 3SO3C 2ICWB 3MRGA 3ARFB 3MRNB 4NO0A 2UVFA 1RUAL 4JO2L 4BH8B 1T0NA 4J4PA 3QDGB 1IKNA 4LCYB 5JHDA 3C87A 3MV8E 5JUEL 1BPVA 4NQXB 3ARYA 1UH2A 4FG6C 3QIBB 4HBCL 1OSZA 3FB5A 4PV9B 1I1RA 1L9MA 4N5ED 3VFPA 1M7DB 4EI5B 4ORZC 2G5BA 4WEBH 4C59B 5FCUH 2JELH 5DHYA 4Z6AT 5E8PA 2QSCL 1YDPB 3HC0B 1NH6A 2VXTL 1CDCA 5FYJE 4I0CC 2KZWA 3U7WH 3SPVA 1D5ZB 3R8QA 1YC8A 2CLRB 2ZUQC 1GZPB 2P5WB 3QXVA 1JYXA 1MWAH 3FOMA 4UNUA 4FQPA 2HJFB 4XHJC 2YXFA 3LS4L 5HYEA 3OKOA 1OVZA 4QWWC 2BDNL 2V7NB 1UM5H 4ZSOB 4PJEA 1YMHB 2MJWA 3MV7B 1AQKH 2FX8H 4K7PH 3E0GA 4PGJA 4Y19B 5T1MB 1G7MA 2C3VA 3LOWA 3O8XC 1IAIM 4KI5F 2Z92B 2JF1A 1QRNA 3U0TB 4M7JL 5MENE 3L5JA 4N0UE 1KT2B 5DVKA 1OF2B 5T3XH 4Y2DB 3RVVC 1FZJA 3ZE1F 5K59E 2FR4A 3OXRB 3D18A 3MUHL 3R0NA 5LXGL 1N6UA 1YY8A 4JLRB 2WZPD 2X4SB 3T0WA 5EO9A 1FNEA 1U8HA 2DF3A 5SWQA 3MR9A 1Z9LA 2AQ1A 2VL4A 1ZGLA 4MCZA 4PG9B 3QG6B 4EXPX 1WWAX 1I7TB 1EEYB 3T4YA 3VWKB 1RIUL 3IRPX 3BKCL 4GKOA 3RPKA 4XTRD 2ITDA 1PZ5B 1ZHNB 4HKBB 1F90L 3FFDA 2AXGB 1XR8A 5GGSA 2BFVH 2R0WL 4MJ6B 3C2SA 1R3KA 5CJXC 5LCVH 4F7PB 4XP4H 3M8OL 3WCYA 4KZDL 1Q9LB 3WUWA 1JK8B 5F1IA 3QT2A 3PDDA 4AG4L 5BZDA 3QUXA 1PEZA 1UXSA 1KIPA 4W70A 5E00B 4F80A 3KXFD 1IGTB 4PR5B 2I9TA 3L3OA 4WCYL 5EBMB 3WIHA 4MNQE 1HEZB 5HHXH 3C8KB 5GRUL 3GM0A 4YXLL 4HF5L 4XCNB 4PJGB 4H1LA 4H20L 3QUMB 2ZUXA 3KWWB 5E95B 1U58A 5J89A 3O11A 2DMKA 1NGPH 4YDKH 2C9AA 2VDKH 3LMJH 4CL7A 4WWKC 5EC2B 2NY7L 2VLLB 3F7YA 4K55A 1BD2A 5FV2A 4LGPB 2BC4A 3BT2H 4KROD 4LCCA 5ESQA 3WNKA 5IVNA 5C0AB 4M1GH 4LDEB 3BYTA 1TTUA 4UDTA 1U3JA 3AXLA 4IIQA 5DRNB 3P9MB 1IJ9A 5D7LB 5FEBA 4QHMA 4KI5E 4WFEE 1NGYB 5HHVH 1QKZL 3VXRA 3SQOH 2P8PB 4MJ2A 4NQDD 3LEYL 3WFHA 3BPOB 2GJ6A 5AAWA 4TVPH 4I3RH 3ZE1E 2O61A 5I1IH 5JDSA 3JWDL 2BMKA 1MRDH 5IMMB 1JGLH 2COQA 4XC3L 3N1FC 2M2DA 5FOBA 4O2CA 4IOIB 5EU6E 3U4EA 1U8NA 5I71C 5F96L 2EDWA 2N1KA 1HN1A 4YNYA 4N9OB 1BAFL 5GS0H 2XQYG 2BNRA 2Q7YA 1ZLSL 3ZDXF 1UJ3C 3MLSH 5C3TA 3VU2A 3OB0K 3WYRA 4NSKA 4APQB 3D3VA 4KTEL 4YFDB 3ARBC 5FHAH 3CFBB 1MHHB 1CF8H 4YHYB 3VFUB 2EIZB 3TBSB 4FQHB 5HGHB 1TZHA 4ELMF 5I73C 4DOHE 3S98A 4HG4K 3QUYA 4PJAA 1V3LA 4QKXB 5B3JE 1F42A 4LLWA 4MD0A 4L4VA 1BM3H 1Z0MA 1U8PB 4HJJH 2VZUA 4Q58C 4PUBL 2YD5A 4LKXA 5T5FL 3NMEA 3QP3A 5FV1L 5ID1A 1CE6A 3IJHB 5GGUA 1SJHA 3KPOA 1YEGH 1J12A 4H25A 4HWBA 4J6RL 1CQKA 2IALB 3V6ZA 4MZ3A 3NH7L 3O3BA 1QYGH 1TVBB 3ROOA 1F4XL 4Y1AD 5C09A 3GUTA 1U8IB 2WLZA 1AR1D 1FJ1B 4YO0A 3NCCB 5FO9B 4YK4B 1FG9C 3EYQC 4N9GA 4OZHF 5IR1B 4LHUD 3B3IB 3FFCE 4YBLB 4MAUL 3BPCB 4GS7C 2WSKA 1NLBL 1A21A 1LMKA 5CILL 5TF1H 5DD6B 5KOVC 5HYJB 1RZJL 1KCUH 2BVQA 4MJIA 5IQ7H 2AK1H 4XMPL 4N8PA 4DKFH 3AMLA 3WNLA 5FHBL 3IU3B 4BZ2L 4P5KB 4OV5B 1M7XA 2ADGA 2CXGA 4JZJA 3WUZA 2BERA 5H2BA 3UPCA 1IARB 3D0VB 4L29A 3TJEH 3UTQA 1QD0A 3QDMD 4FG6D 3CDYA 5CSZB 3TBVA 1AGCA 3MLVL 3TBYA 1Z3GH 3ZKSD 3ZLQC 3B5GA 4F3FB 3BEVB 3O9WB 4ODSL 5GJTH 2HTKC 3TO4A 3STLA 4LMQE 2DICA 5AYUH 5TGBA 3FB7B 3QFJE 2X4TB 1CL7L 4X7EC 3G5VA 1KEGH 4PRID 4GKZA 1ED3B 4ZAKC 1T03L 5E56A 3OPZH 3ZZ1A 5FUZH 2A9ML 3THMH 1S9YB 4XHJD 5E4IA 3ET9F 1WBYB 4BELD 1RZKH 4X5XA 2WBWB 2B5IB 4JY4B 4N8CL 2CR6A 4OFYA 2ICEA 4HUNB 4KI5C 4WUKH 3BP6B 1QBAA 4QWWD 4AL8H 5IMOA 3HRZA 3DMMB 3MODH 4RGNB 4X6DB 3O8XD 5ITFA 3D2UD 2YN3A 2X41A 3BKML 4HWBL 1MFBH 5DO2C 1L0XA 1T66C 2NQCA 3TZVD 4NNXA 5E4EC 3VDCA 3RVVD 4O51A 4QOKE 3FN0L 1RIHH 3BP5A 3DVNA 2X42A 4DZBB 1IT9H 1R0AL 1MI5B 4LL9A 1CU4H 4PJXA 3RY6A 1OAZL 4YHZH 5CWSB 5DD3L 3O41B 5LGHH 4PJDE 4LPWA 1B3JA 4HIIA 4DCQB 3ARUA 4EUPG 3K80A 1JPFA 2FEDC 4P5MB 4CN6A 1AKJB 2Y1VA 1AC6A 1LO0H 1MCQA 4F7TB 4LKCB 2X4PA 3OMZA 2UZIL 5BRZB 4OM0H 4LRNL 1XF2B 1FC1A 4U1NA 4YE4L 3ZTJH 4ODXA 1NPUA 4YUEL 2CDGB 4FNLL 4OF3A 2VDML 3MBEC 4MXVF 1ZLWK 1G9NL 2VDOL 4NN7C 1MVUA 4MD4A 1NC4D 3GMRA 5ADOL 5I15L 4CKVX 4EVNB 4EI6B 3L7EA 4B7LA 5E7FA 4HKXA 2A6KA 3QUZA 1U8OA 3GSWB 1RAMA 3FQRB 5SWSE 1I8KA 2B7DT 1W72H 4HK0B 2J7LA 1MLCB 1Z9SA 4WV1B 4GMSH 1DSFH 4WWKD 4JQIH 3PF2A 2WV3A 1AD9B 1EEUA 2P42B 5D7SH 5D1XB 3DUSB 1AR2A 2V5SA 2PYED 3CH1B 1YN6A 4OZIA 1TZGH 2H45A 1U36A 2MKLC 3N1MC 3U30C 4Z8FL 3HNTH 1NJ9B 3L5XH 1DQJB 4EXKA 3DBXA 1YEKH 3MRIB 2D7NA 1EZVY 4LEOA 4XXCA 5IB2B 3DUUA 3MV8D 1NBYA 3PWUB 4LNRB 3ULVF 1NSNH 4L3EB 4PJ7A 2GTWA 5F1NB 1FZKA 1U8LB 4KVNH 4RGMB 3DURB 3VFNB 3L7FA