4ODTH

Fab structure of lipid a-specific antibody s1-15 in complex with lipid a carbohydrate backbone
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
226
Chain Sequence
EVQLVESGGGLVQPKGSLKLSCAASGFTFNTYAMNWVRQAPGKGLEWVARIRSKSNNYATYYADSVKDRFTISRDDSQSMLYLQMNNLKTEDTAMYYCVRHRGAPLYYGNGAWFAYWGQGTLVTVSAAKTTPPSVYPLAPGCGDTTGSSVTSGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
molecule tags Immune system
molecule keywords S1-15 Fab (IgG2b) heavy chain
total genus 39
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odtH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odtH01
4NO5A 1RIHH 3FQTA 2PYEA 3TO4C 2XY1A 3KYNA 1NCWL 1FVCB 4PJXB 4UV7L 1CL7L 1Q72L 2YN5A 5D7KE 5DMKB 4RA0C 4NM4H 4UQ3A 5EN2A 1G9NH 1FVDA 3TWCL 2EIEA 3BE1L 4NN6B 4D9RD 4E0RB 1H8SA 1MI5E 3PIQA 2VISB 3I50L 2IPUG 5DK0B 5GPRA 4PJ7A 5J89A 3S36X 3CX2A 4E42A 1GIGL 5KTEH 4KKAC 1K6QL 1KUMA 2EXWD 4IRSC 1PVHA 4KTDH 4OJFH 3V0VB 1BPVA 3HPLA 1QHOA 3JTTB 2EYTB 5EBMA 2XFXB 1T03H 1T1WB 5J0BA 3DUSA 3S7GA 4EXPX 4EZMA 3W11C 1QSFD 1IM9B 4N9OB 3VMPA 1SY6A 2H8PB 3D1MC 4XCCH 5C0AA 4HH9B 1MIML 5IBTH 3KPSA 3EFFB 2CJUL 1MHPH 4OZHB 1JGDA 4XCYB 5HD8C 1FL5A 3RA7H 4AIZA 4OCWH 3GI8L 2EYRB 4HCRA 1R3IL 3MXVH 5I6XC 1N8ZB 4MAUH 4WEMB 1KEMH 2ITCB 2YD2A 3VXSB 5EIVA 1CQKA 1FFOB 3B2UC 4UIMA 2VXVL 3I9GL 2A9NH 3QQ9C 4S2SB 4MXVF 2YRLA 4HIJA 4L3CB 1X5KA 3LN4B 3FQUB 4DTGH 5T5NF 5JIIA 4L1HA 4G43A 1YC7A 1J18A 4J1UA 2WUCL 5E99L 2PYFB 1FNGA 2ICES 5IUSA 2FO4A 4HBCH 2VDRH 4F7CB 5E2UH 4RBPH 5H37G 3ILQD 4NUJB 3C6LD 4C56A 3RFZC 4JO3H 3KLHD 4XVSH 2E27L 1QRNE 1IGJA 2MQ0A 4JFFA 2P1YA 3B9AA 4ZFOL 4R4NC 4OD2A 3WFZA 5IHLB 2EIZB 4J4PC 3UAJD 3MLSH 4UV4H 4B7LA 3CFDB 3T4YA 5KSBB 5IMKB 2NY0B 3WBDA 1KTLA 4I0PC 4IRSB 2IBZY 1QFWH 4NQXB 3AAZB 4JANA 4D0BA 5IMLA 3C6LC 3B6SA 3UTQA 4N1CA 2F8XC 1U8PA 3DNKA 5BVJA 1XCTA 2IGFL 1NFIB 2YUXA 1F5WA 1RY7B 1B0GA 1AH1A 4QRQB 1NCCL 4N0CC 5CJXA 4XBGA 5TE4H 3HKFA 3V4UL 1I4FB 4P2RB 4Y7MA 2ZCLL 3ARGD 5TQ2L 4MXWL 1V3MA 5AYUH 2JIXA 4TQEL 4TVSa 3VH8A 1CFVL 1ULVA 1S7RB 4U49A 4GW1A 1MIEH 1NBZA 4WTWA 3RJQB 1I1CA 5F72S 5HYSA 4LRIC 3CXDH 4QKXB 1S7VB 5KVDL 5GS2D 3QG7H 3O9WD 4JCMA 1FNSH 3VXRE 4P2YA 2AK4A 3U36B 4D3CL 3QDHA 3AS0A 1Q94B 4L8DB 3W82A 4OTXH 4QNPE 2PNDA 5IVXE 3HPJB 3U7AA 4YC2C 5JOPE 1FYTE 4K8RD 1UH3A 3STLB 2R1WA 1MHHA 4P49A 5T1MA 3ECBB 3DO3A 5I66A 5ESQB 1CI5A 3DVIA 4I3SH 1J0ZA 1Q9KB 3NCMA 4X5XB 1R24A 4EQ3A 3BPNC 1BHGA 2LU7A 3ULUC 2Z93B 3IETA 3WO4B 2YZ1A 2AXFA 1NAKH 4ORGA 3QDMB 3UBXB 3O81A 3WJJC 5IVZB 4LSVL 2EH8H 2VE6B 4ALAL 4HFWB 2VKXA 4HWEL 2R1XB 3IRZA 4IRJC 4QHKJ 1J5OL 3BZ4B 3RUGE 1IARB 2BXZA 3FOLA 3P9MA 4YHKL 3DVGA 1A5FL 3JV6A 3TO4A 4M6MH 4APQD 4LDEB 1QO3A 3PXJA 2QLVB 2XTJB 1I8MA 2W9DH 3BZFA 4WI9A 3UJIL 5D1ZD 5DHYA 3ULSA 3BEWA 4MXQD 2C4XA 1J86A 3F62A 1NGZB 4YX2L 1KCUH 1TFHA 2BK8A 3GMNB 4PJ8C 3JV5A 4PJBE 5ICYA 3KXFE 3FCTA 3KYAA 4QNPF 1DN0A 3E8UH 1CFSB 1GAFL 2WIMA 1EXUA 1OT1A 3BWUC 3IFOB 1F6FB 4YR6A 4H8WH 5JXED 4HKJB 3WNLA 1J05A 1CK0L 3MRRA 4DZ8B 1ES0B 4NQCA 1YNKL 1FNEA 1OTTD 3DX7A 1MHEA 5ICZA 1ZEAL 4TSCL 3A6OA 1P4IH 2WV3A 2HFGL 1QFOA 2Y36L 1QYGL 1HXMA 4OLUL 2GKIA 2QBWA 5GRVL 1NMCB 1T2QH 2B8OT 4H20H 4ZS6D 4JRXE 1CE1L 4M5YL 3HG1D 1A4JB 3OKMB 1YYLL 3PWPA 4PRNA 3GSWA 3I3BA 5FOBA 4MAYD 3X14A 3ZDYE 3MCLH 2ERJC 4PUBL 2AJUL 2BY0A 3Q6FB 5D1ZC 1D9KD 4GRMB 4OCMC 2VDQL 3NN8B 3MFGB 4MVBC 4H26A 4WFEE 5F7NC 4MA8H 3AM8A 3V6FA 1LGVA 1OAQH 3QXVA 2VZTA 1E4WL 1GGUA 2C26A 3U30B 3ZKXB 5CHNA 4HH8A 1LEKA 3CIQA 2X09A 3WS3B 3VRIB 3EBAA 4PJGF 3GB7B 1KOAA 3QUXD 4V1DD 1GOGA 3UCRA 5I1HL 3B9DA 1SYVA 1K85A 4HAGA 1LO0L 3AU1A 1J88A 1A7RL 1MWAH 1UVQA 4XCEB 5F71A 3EJZC 4C59B 1TJIH 4CADA 3VXUE 1GC1H 3AMKA 3L3KB 4WCYL 4ZS6C 4XAKE 3RA7L 2Z35A 1SM3L 1N26A 3O2WL 5EU6B 4MS8C 2B5IB 1SEQL 2B4CH 4EDWL 1UQSA 1HXYA 2VXQL 3FB8B 1BZQK 4GKSA 1RAMA 3IF1B 1BFVH 2ICEB 2EIBA 2G5BB 3BPLB 1TTGA 1N2RA 5C0RH 3S96B 1QLEL 5IK3A 4APQB 1NFDA 2JJWA 5C7XL 3I6GB 2AVGA 5FKAA 5E2UL 1K4CA 3RP1A 3V7MA 5DJAB 2VLLB 4LCIH 4Z7VE 2WWKO 1F4YH 3RVTD 1PY4A 4LPVA 2XI9A 2HTKD 4R2GC 4X6BA 5EO0B 4PPTA 4IS6B 2O93L 1Z2KA 4IOFD 5T3XH 4UILH 2A9NL 2LE9A 4P5KB 1LP9F 5BO1L 4Y4HA 3RQ3A 3WIFA 1QSZA 5JXAH 1HYSC 5ACZB 4Y16D 4BELD 2H2PD 1BQHG 4RMWA 4RDQF 4P57B 1J8HB 3RY5A 3WFHB 3QULA 1Q72H 3CZFA 3IDYB 3GMOB 4L9LC 3SO3B 5BRZE 1MHPL 1YN7B 3BZEA 4C4KO 2HFTA 1VGEH 3JWOH 3V6OE 2OL3B 1CLYH 1IGMH 1XGRA 1MFNA 5GRZA 2J8UB 3QIBB 2FJHA 2P42B 3R8QA 1A3QA 5L6YL 4OGYL 3LEYL 4X0KB 3T0EA 3HG1B 2J8UF 1WZ1L 4PIRF 2E7CA 2NPLX 3VDAA 3A6CH 4DAGL 4M00A 4I1NB 3F7YB 2NTSP 2DM3A 1J11A 2GHWB 4KHTH 5TDNB 4PB9H 5HPOA 3QPQC 2UZIH 3KPSE 4P3DA 4WDIA 3T8XA 2MCPL 5C09B 5DZOA 4C56B 1MNUL 3LKNA 2V5MA 4WFGD 1I9EA 4RGNE 2PTTB 3VWKD 1C1EL 4HIXH 1QSVA 4RA3A 1PSKH 2V9QA 2ARJQ 2VAAB 1JPFB 2CD0A 3NH7H 2HJFA 1LK2A 4A2MA 3N1GC 5TFSH 1CGSH 5GGQL 2AJVL 1AY1L 3MUY1 4YDIL 4TPRH 2IJ0C 5CJXC 3FZUC 4X6CA 1CL7H 4KQ4L 1TETH 4UUJB 1PLGH 5CJQH 1TZHA 2JKXA 1MRCL 1I7RA 4NJ9H 3SCMD 1JPST 4XB7A 4P4KD 3TZVC 2N7AA 2H45A 1IGFH 3ARGC 5EZJB 3D0LB 1TNNA 2R0KL 1Z9SA 1D7FA 1S5HB 2AJXH 1AY1H 2DLGA 3LZFH 3T04D 1DQJB 5JOFB 3VFRA 3BKCL 1RU9L 3C6SB 5E03A 4KMTH 3FN3A 1AGCA 2DTML 3MRKB 4OZGE 1WBZB 4R7DB 1N4XL 1KN4H 3A0OA 3FFCA 1ZHBA 4QF1B 4GH7B 5DJXB 4GBXA 1MAMH 3TC9A 43C9B 3PWLB 1S8DA 3E6HB 4OLZL 1WBYB 4I77H 5DUPL 5FYLD 3SDYL 4WV1B 4DKDC 1VA9A 4R2GB 1JNLH 3F7RA 3A6CL 3HMWH 1WZ1H 1QLEH 1QOKA 3CVHL 4HX1B 2MKLC 3BN9D 4PRAA 3MLWL 3V5HA 1MCPH 5I9QB 3W9EA 5IFAL 3FN9A 2DJSA 1N7MH 1KEGH 2H1PL 1UWXH 4M48H 4JO4L 3MREA 2R0ZH 2E6QA 1ZHNB 4B53A 4WW2A 2VAJA 4ZUUB 3R1GL 1GSMA 3VFWA 5I8EA 3HE6B 1QBAA 4R4BB 5J1TC 3MBEC 3TCLA 4Y5VC 4KROC 2I27N 4HUWA 5B22A 4CL7A 1KCVL 4WUKL 4WI8A 3MBXH 3BKJH 3SJVB 1F2QA 4ORZC 5IJVB 1XR8B 4QLRA 4JZOA 1W0VB 4CRPA 1CGXA 1ZLWH 3GM8A 3QJFA 3PL6B 4I3GA 1PZ5B 3REVA 3C2SA 3CLEH 4KTYA 2PO6A 3VWKB 3M17A 4E5XB 3NZ8B 1TTFA 2VDOH 5T1LD 3VXTA 1IE5A 3JV6B 4PJ5B 2XV6B 3NACL 5F1KC 2A6JB 4KKAD 2CK0L 4WHTB 4I4WA 3EYUL 4NM8H 1I8MB 2GITA 2AJUH 1FGVL 1X5IA 1A3RH 3BZFB 5FK9B 2CDGA 3KLDA 4TTGA 1MCFA 5MEPA 4GBXC 2IH3A 5EZLA 2A1WL 1YNLL 3BEWB 5C1MB 5ETUA 3CH1B 3OPZH 4AH2B 4TUJB 5IOPB 1SEQH 2A2QT 4LIQE 1CDGA 5F7MC 4YHLL 4YE4H 4RAVB 3V52L 4HK0B 1Q9WB 2XN9D 3EDKA 4OZIF 5H94B 1DLHA 5JQ6L 5LWYH 4ODWB 2B20A 2X9XA 4HPOL 2Q6WB 5FDWA 5CD5C 1T04B 2ZCKH 3FFCE 3KPPA 2GYSA 4D8PB 1QLFB 2YPLE 2P4AB 5IFJB 1V7NL 4Y1AE 4UAOC 5DWUH 3H9SE 3TNNB 2R29H 3OR6A 2OMBA 3DX6A 5EFIB 4OT1H 4LRNL 3ES6A 2VERN 5EOQL 5D72L 3ULVD 2Z8WC 2F8OA 3IVKB 3OKMA 3VW3L 2V2WB 3GI9L 2YEZB 4MWFA 1N6UA 4QHMB 1CCZA 2R2HB 5J6HA 5LGJA 3WHE1 3VG9B 2IMNA 3AROA 4WJ5A 2QSTA 4FQCH 4WWKC 3GMQB 4G9FE 4EI6A 1AO7B 2FHFA 2BERA 3GUTB 3FFDB 2PXYD 2AABH 1ND0B 2IAND 2SEBB 3BXNA 2XPGB 3MNVB 1C5CH 1IQDB 1FZKA 4O58H 2DWEA 1DUZB 4G42A 1DQLH 1PG7X 4IOIB 3HE6D 5DD5H 4DOHB 4LNRB 4X6EB 1VFAB 1I7TB 4BKLA 4L3ED 4Q6IB 3EGSA 3EDDA 4P9ML 5FCUL 3U9UB 5GS0C 3JVGA 1HHIB 5GSRA 4MNGA 5ILTH 4I0PB 4R4FH 2D7NA 5L88H 4JZJA 3EYSL 2XIDA 3C5ZC 5GRYA 4APQC 2FO1A 2FD6H 1Z5LB 2Y6SC 4XP4L 3D2UA 3FHQA 3UC0H 4U0QB 4TNWK 1HXYB 1QZ1A 5DJCA 4JFXB 2ICEA 3OKLB 4WUUE 3OXRB 4XMKL 3S96A 3G6JE 1LEGA 4NKQB 4HPYH 4BSVB 3BD3A 3HZYB 2D31B 3S5LA 5HYSG 1WTLA 1BFSA 4KROB 1IGTB 4NC1C 2ITDB 1QSEA 2H26B 1F3DJ 3GSNA 4M61B 4FQXB 4MNQA 4YBLC 1J7VR 4ZUVA 5JW4N 5TH2B 1CD8A 2Z31D 4MDIA 3B5GA 3N0PB 5GRUH 5GS2H 1JYNA 4RRPA 3GI9H 2APWA 3F7QA 4YIQB 4HJ0C 4JFDE 2XN9B 4NJAL 3LV3A 3QI9A 4JAMB 3TA3A 4I3SL 2KH2B 3PWVB 2Z0BA 3GIZL 5EUKA 2IGFH 3DSFL 2FBJH 5AZ2L 3BIKA 4POUB 1NANI 3PF2A 4PRIB 4GQ9L 5GJSL 1NFDE 4X4ZA 2DDQH 2KQNA 5KSAC 4L5FH 5CFHA 2FJHB 1UKSA 3IDNB 4F9LA 4PJ9C 2HT4C 1BREA 4X0KA 2VLJB 1DCLA 3U4BL 3PUCA 2X4TB 3RKDC 2DWDB 5FXCH 4R0LB 3V5KA 4LBEA 3Q1SL 4QHNB 3WD5H 4D0CA 2W65B 1CF8L 1RZGB 3L5XH 2GY7B 2OQJA 4L4VB 3D48R 4EN3A 3BDYL 4ZDHA 2LFGA 4GW5A 4LPTA 4LSRH 4GSDH 4LCWA 4TQEH 2EKSA 3UO1L 5CBAA 1XF3A 2ZJSH 1LO3L 4QYOA 2V7NA 1KTDA 2V2TB 1JUFB 2E8YA 3M45A 5DUMH 1BGXL 5C07A 5EOCH 5D7IA 4K3JH 4XT1C 3QDMD 3VXQA 5DI8A 3NGBC 1T83A 2EE3A 4F37F 1S9VB 4O2FB 1IEHA 4FQIH 4P0DA 5GRWA 3DHMA 4Z5RB 1OAXL 5C9JB 5B21A 4XCFH 5I30L 4QXGH 4NNYB 4QHLA 4NFCA 1V3KA 3DRQA 1AGEA 3KYNB 4GRLD 3BO8B 1NJ9A 3L1OL 4IRZH 4PV9B 3D0LA 3S37X 3GMLA 2ZCHH 1DL7L 4UQ3B 4JRXA 3SDAB 1Y6KR 2R0LH 3NFSL 4PGCA 5HHPA 1J0KA 5K9KA 4JY4A 4TOYH 1FFQA 5DJ2B 4I48A 2B1HL 4BA8A 2R0WH 2EEAA 4JFDA 3TNMA 2CRMA 4Q58C 3GJEB 4UB0L 3UJTL 1S8DB 5K33A 2Q86A 3TESA 2LU4A 3ARFA 4HMDA 5IB5A 3S5LG 2JIXD 4X8JB 5L2KB 1OAYL 1HHHA 3MZGB 1DBJL 4PJAB 1M6OB 4UTBH 4Y8AA 2NYYD 4TTDC 4ZXBD 3ARGB 2M8XA 4N9GA 3X3GL 1NEUA 3X13B 1RZFL 3Q5OA 1HYSD 2BMKB 1T1WA 1A7PH 1J0HA 2FGWL 2BVOA 1TQCC 4ZO6A 4DFIA 4YXKH 3V2AR 1P4BH 2GJJA 5C0AB 1G6VK 5F89A 5C0GB 3H0TB 4XBEH 3HI6H 3GMRB 4AEEA 4DCQB 1LDSA 1JNNH 1MCNA 4IMKA 4M3KB 2GTZA 4Q9RH 1AO7E 4G80B 4HDIB 4R4BA 2FL5B 1H9VA 4JO1L 4BQCA 2Y25A 3AC0A 4O9HL 1MRCH 4JRYB 5FIEA 1OF2A 4QOKA 3HC3H 2I5YH 2DM4A 4HK3N 2PXYC 3JUYA 3CXHK 4GLRH 4KK9C 1UC6A 1EO5A 2UV3A 4CW1A 4BZ2L 1PD6A 3G6AA 1U8LB 1HHGA 3QNZB 1F2XK 4RWYH 2PYFA 1ZA6A 1XFPA 4U05A 3VXNA 4PFEA 3KPRE 3OKYA 1AR1D 1DJSA 1FNHA 4FZ8H 4HKBA 3FQXA 4XWOD 1JE6A 3QR2A 1J0JA 4PJ5A 5D1QD 1FYTA 2GITB 4U1MB 4PLJC 4LHQB 1F58H 1XGQB 1FORH 4NO2A 3T09A 2YA0A 3MRNA 4X7FC 1A9BB 4ZSOE 1BECA 4WGWB 4F8QA 5F3BB 3L5JA 3LRSA 1WIOA 1JWUA 3H3PL 2OR7A 3PQYA 4A6YL 3G6DL 3WHXB 5J6GB 5ANMB 5F1IA 3OKEB 4AG4H 2G75B 3GO1H 1AKJD 1NGXB 4CVWA 2V17L 3EYFB 3AAZA 4JANB 4D0BB 4JJ5B 1PLGL 3H9SA 4N8VA 1X7QA 4WIQA 2YPLA 3GJFA 3I6KA 5KVFH 2CKBB 3E6FB 2IPTH 5HVGB 1WF5A 4JR9H 1MVUB 5FEBA 1HHKB 1CFNA 2NX5D 5IVXF 1LK3H 3MXWH 4FQQA 25C8L 2DI9A 2QV2A 4XGZA 2IANE 4QXWA 2GJZA 4NQVA 4HIIA 5CEZL 5DJZB 2YSSB 2JIXB 5L2KD 1FIEA 3G04B 2FECI 3QZWB 5J6HB 4MJIE 3F8UB 4GW1B 2BVQB 4MA3B 1JPSH 1G9EA 1MQ8A 5KN5A 4K9EC 1YY9D 2VXSH 3MTRA 4EDXA 2DD8H 4Z76A 1R3HB 1RZKH 1SJHA 1A6WH 1I7UB 3TVMD 5C0BE 4OM0L 5E4EB 5DA4A 1DSFL 4KHXH 4Z7VF 3CFIC 4PRPA 2CIIB 2JF1A 3DMMA 3LKOA 4KC3B 4LNRA 4X6EA 2EDHA 4Q9QL 1I7TA 4YHYC 5GXBB 3KAAA 4P46C 3G5XB 2Y06L 2X4QB 4CU6A 1AXSA 2XTJC 2J8OA 1L6ZA 2VDLL 1PG7L 1E6OH 3HR5B 3MV8E 2VL5A 2YD7A 1I1FB 1FDLH 4PV8A 2BRRL 3EO9H 1W0WB 5GGVL 2D4FA 3VXPB 3OXRA 4KRNA 4XVTL 5I1DA 2J1KA 3X17A 5EOCL 3WUWB 3O4OC 2MTPA 4HXAL 5F96L 3C8HA 4IIQA 4XP6H 4MDJB 2WP3T 2HLAA 1FCCA 3SCMB 3BMWA 3UO1H 4PRHD 3DPBA 4MQXD 3GRWA 3P11L 2GK0A 2W60B 1HSAA 1LEIB 3T77A 1FLRH 5T33H 4CVXB 1Z0MA 3LV3B 2DYPB 3FRPA 3U4EB 1A7QH 5DRNB 2HFGH 5D2NC 3OR7A 1N5YL 4ODXB 5IHUH 3OX8B 3D3VE 4F9LC 3L1OH 4EUPG 4HWBH 4U7SA 3RGVC 3QH3B 2AJZB 2A6DA 3D85D 1QD0A 3GK8H 4H8WL 2NY3B 3LIZH 1J05B 2HWZH 1FL6B 43CAB 4RFNB 1B6UA 2NXZD 2YUWA 2RFXB 3VGAC 2DL2A 3CVIL 3VE0A 2JELH 4LGSB 5D2NE 5KZCB 2JK5A 3QYCA 5DUML 4NN7B 4DZBA 3ZKXC 3EOAB 1U0QA 3MUHL 4JHAL 5CP7A 3TIEA 4O2EB 3LS5L 4QRRE 3MBEB 5CBAB 4DGVL 5KS9F 4F9PA 5DZLA 3WS6C 1IQWL 2VJXA 1U6AL 3KNBA 5B4MD 1T6VN 4QO1A 4A2LA 2BNUB 1PYWA 3MJ7B 4G8GB 1LEKB 2X1PA 3PWUA 5C08A 1MJUL 4X4YB 3KDMB 3U4BH 4RWHA 4GRWB 2BJML 4K07A 3BH8A 1NAMH 4UDTB 3QXAA 2FIKB 4U1NA 1E4KA 3MA9H 5LQBH 2J2ZA 3WLBB 3NIFE 5DHVB 5SWQA 2EZ0C 4BH8A 3E2HB 3VFGH 4EI5A 2FBJL 1A9EB 4U6XA 3RX7A 3QWQB 2WMPA 1SJXA 1FCGA 4FQJH 5EU5B 5CGYD 4YX2H 3QDJD 3ZE0F 3LPWA 2VL4A 3FB6B 1M7IB 1UQSB 5JIPA 1Q9LA 4I3RH 4MJIB 1EAPB 2DQJH 2ZOLA 1ZHLB 1BBDH 3RWHB 4YXHH 1JWSB 2N7BA 5ELIA 1UM4H 2HT4D 2F5AH 4NKDA 5FO9A 3P30L 4DGYH 3RI5K 3QPQD 2HKFH 2B2XL 1JYWA 2HH0L 2EIDA 5K93A 1UJ3C 3CFJA 5C8JA 3QHZL 5FYKL 5B8CB 3CXHJ 5HY9B 4AT6B 4PJDA 1WWAX 4YDLB 2Q8BL 3UMTA 3L3GA 1NDGB 4LSSH 5TE4L 3UTZB 4U31A 2R29L 1ZVSB 1QSFA 5T3ZD 2YHGA 3SDXB 2FL5A 1EFXB 4WW2F 3GMOA 2XTLA 2P8PA 1HNFA 3MRLA 5MHSE 4H1LH 1ZVYA 5DSCA 2ZG1A 3BZEB 1UEMA 5I2IB 4F15C 1P1ZB 3QRGH 4OIIH 2BDNL 2FEDD 5C08D 3QO1A 3RZCB 4U1JB 4Z0BL 5DFVC 2A73B 2CSPA 5H2BA 1T20B 4L8SC 1RFDL 4JZNA 1U3YA 1XIWA 1YNTA 1H3WM 1W2KT 4DGIH 4NQDB 2A77L 3FO0H 3HUJF 4XXDA 3IS1X 3VXNB 5F7UA 4JCLA 2X2YA 4YNYB 2A1WH 5IROC 3MRGA 5D1XB 1LE5A 5F7YC 4F80A 3QHFH 1DBML 4K7FA 5LVEA 1HE7A 2DBLL 2ZP0T 2R15A 1D6EA 4PRIE 2BNQA 3GHEH 3W5NA 2JB5H 4HUKB 5KAQG 2XA8L 5T3ZL 5HI5C 4QOKD 1A9BA 4CVUA 4CJ1A 2P8LA 1OW0C 3MODL 1NCCH 3QXTA 1NDMA 1G6RB 3QCUL 1DVFA 3SGDI 4PR5A 2NYYC 2E5EA 3BISA 2A83A 3RWEB 4HFUL 4GRWH 4R3SA 2PYEB 4IBLT 4G6FD 5LCVL 5L8LB 2NY4B 2KUTA 1FVCA 1MJ8H 3SE3C 5DMKA 4L3EB 1RZIB 2KKQA 1GRWA 1KC5H 2DICA 3WKMH 3G6JB 5JOFA 1J0YA 2LAGB 4Z6AT 4FQQB 3IB4A 2XWBB 1INEH 4XGZB 4PJBA 1AGCB 5I17A 1D5BA 4M93B 4UT6L 1BZ7B 3PIQB 3FN0H 3KYKH 5C0BD 5CIPA 1ZHBB 5DJXA 2XQYK 1AJ7L 3WFEH 3CZJA 4CN6A 3MV8A 1BEYH 4MA3A 2GJ6B 4QRUB 3UZQA 1G7LB 4ZFFB 5HJ3B 5ICXB 3QDAA 2XRAH 1P4LB 4TSBL 1KCLA 2VLMD 3PDGA 1I7UA 1AD9A 4U1HA 5FF6A 1F8TH 3JTTA 4HEME 2WANA 5DD1H 3O4LA 5K9OB 4IMKC 4JPKH 2FR4B 1OP5K 4BSJA 2GSIA 2VITA 5DEFA 1F6AA 2X4OB 1N3NB 4TUOB 3IDIB 1I75A 3VFWB 5H35B 5FUOH 4OFPA 3PHQA 4G9FB 3VXRD 3I3DA 5L0QC 1CG9A 4NFDA 4UDUA 4RSVA 3O9WC 4MJ5A 5HD8D 4MB4A 4Q9CA 1MREL 4OZ4A 4KQ4H 4RGOL 4XP1L 4JB9H 3FQRB 4KHXL 3TBYB 4XPAL 5JR1H 4BQ6A 3REVB 4J1UB 1IZKA 1P53A 1F3JB 4ZFGL 3KPMB 1YYML 2BVPB 4NP4L 2ZSVB 1AXTL 3BGFC 3M17B 4E5XA 3C9NA 3RNKA 1T5WB 1QR1B 1U8HA 1RK0B 3LSOB 3RWFA 1M7DA 5IW1B 5E9DE 1JZ2A 4OGAC 3U9PL 2J5LC 1CLOH 2VLKE 4PLNC 1LDPH 4RAUA 1T5XA 3ZT5A 5IBUG 5JZ7C 5KSVB 1P7HL 2W60A 3SE3A 2V2XA 5JNYB 4O02H 1VFMA 5MEPB 2BCKA 2Y72A 4BFIA 5A2FA 3IRPX 3SGKC 1JRHL 1PEWA 1HH9A 3CSYB 4LIQH 5BV7C 4UAOB 1LD9A 3ULUD 4NM4L 3FT3A 5BZDA 2Z8SA 4PBWD 1KIQB 5HGAB 4PY7B 1KTLB 3CFEB 4YHNA 3C8KA 5FYJH 5H94A 4LLMB 3MLUL 1IGML 4NQXA 4LSSL 2V17H 4LRIA 5IG7A 2UZYB 3VCLB 3MLVH 3KPRA 3IU4H 1HILB 1U8PB 1JGUH 1G1CA 5INDB 3TNNA 3SY0B 1D9KC 1BIIB 4LSQL 4FMFA 1MCOL 3QJHA 4E41B 4FQLH 4M43L 2JJSC 5IHZB 4FFWC 3NCEB 2ATKB 2YC1B 4NCC1 1S7WA 4RFOL 4YLQT 5ADPL 2UWEA 3HUJA 2AK1L 4KV5F 3H7BA 4LVOC 5I8OL 1UJ3B 4BH7B 1CLOL 1EJOH 3LN5A 4JFFE 4HWUA 1QRNA 2ZUYA 3QIBC 5D7SL 1M71A 3DETC 3RVVC 1FZOB 3MRIB 4ISVB 1HDMB 4LCWD 5BS0E 4I2XA 2XPGA 3MNVA 4OZHE 5SV4A 1FZKB 2NY5C 1TIUA 5CWSA 3PWUB 3KJ6L 3ZTNL 3THML 4W68A 1FFNB 3K7UA 4JB9L 4XMPH 4UDTA 2GTWA 1Q0XH 1YEDB 4MX7B 4DVRH 4WFGE 3SGJC 4UZGA 3LDBC 5MEOA 4WUUA 5DMIL 4TSAH 3RZCC 3REWB 5TF1L 1G7IA 1XF4B 1HINH 4LLYA 1P5VA 4DK6A 3Q5YA 5D70H 4JQVA 1TJIL 4CKVX 5C0IA 1H5BC 4NQCD 4GUPB 4K94L 3LQZB 1X5AA 2ZOLB 2W0LA 4OCNC 4UINL 4FG6C 2AJSL 2AXGA 1A6UH 3U1SH 1SQ2N 4QRPB 3MYZA 5E8NA 4FTVA 1UB5A 3MNZA 2X7LB 5HHNA 2R4RH 5L2JA 1LVEA 4LLUA 2FJFA 2VQ1A 2D31A 2AQ1A 4RAHA 4LCIL 1EV2E 5D2LF 4FQXA 4MNQB 4OD1H 4ZUVB 5JA8B 3VD9A 1T89A 4ONFH 5JO5A 4WO4B 3L7FA 4XAWH 4KVCH 4K3GA 2A38A 1JNHA 2EKJA 1ORSB 5IV2A 3SGJA 2R8SL 4HD9A 5EBGA 4AL8L 4KZDH 2CO6B 1KNOB 1XF5B 3MRPB 5LBSH 2IAMA 3PP3H 5EC2A 4BFGA 2AKRA 5D7LB 4ZXBA 4Y0GA 3RZCD 2R39A 2VTFA 4FNLH 4JAMA 4IHOB 4U1SA 2MFNA 3FCTB 1GZQA 2P7TA 4J6RH 5BVPL 5IB3B 1I9RL 5BVPH 1A6VH 1CICC 4EOWH 1TJHH 1RZJC 3OBAA 4MB3A 1OPGH 2IG2H 3A67H 3JWDL 2VNCA 5DURB 2VYRE 5SWSE 4JG1L 1IC4H 3O6LH 2P5EA 2ICWA 5JOEA 5SX5K 5T33L 3HRZA 5LBSL 3D0VA 5TF0A 2ILLA 4G8GD 1AQDA 3O9WA 1WCBB 3VD5A 3F7PC 5D1ZB 4PP2A 4WFHE 2DWDA 5F7DB 1JI1A 2APTA 1QBBA 1XIWB 4M8QB 3B8SA 5F9DC 4N0RA 4XXDB 3IFPA 1HH6B 1KCSL 3DI3B 3NTCH 4MD0B 3TCXA 1OL0A 4NDMB 3DRTB 3MGAA 5DC9B 1K8IA 2PKDA 1JF5A 1WFTA 1OAQL 5F7FA 3HHRB 3O3BB 4NOFA 1ZLUH 4WUUD 3CDCA 3EYVB 1A7BA 2YR3A 4TUKL 1BFTA 5D5ME 4K23H 3LKRB 5E2TL 4MQ7A 5FYKD 1XF3B 2R4SL 3MV9D 3C60C 5F3HB 3GNML 4YHMH 3S3JA 1FZMB 2BHZA 4UTAL 3C5JA 5MEQB 3MA7A 4F7TB 3FT2B 3VRIA 3JTSB 4NCDA 3GB7A 3NFNA 2HTLC 5HHXH 3OKDB 4U6VH 2CGRL 4R97B 4HJGB 1UT9A 3ZYZA 1HK6A 3HAEA 1NAMA 5I18H 5DRWA 5IW3A 3DRQB 4XPHH 2W92A 3D9AH 5LKNA 4X5LA 5K9QG 1CU4H 4XCNB 3CVHA 4MLSA 1RJCA 4LKXB 4ONOA 1CDCA 2VDNH 1MJJA 1G1YA 1ZGLA 5E6IA 1WWBX 2NXYD 3WNPA 4XP5H 5IFHH 1RJLB 4OLYL 1E4KC 1YEHL 1RVFL 1OT2A 3P2TA 4JREC 4AJ0A 1GJIA 1P7QA 3BKML 3WL9B 2W9DL 4AEIL 5ENWB 2EO9A 1NC2B 3QEQE 5J8OA 4G5ZH 2DM7A 4LVEA 4YUEL 1J1XL 1OSZA 1X5GA 3VFUB 4S1QH 2BFVH 2GIYA 4X8JA 4L9LA 1BOGA 2HTKC 1SVZA 1ZS8A 1I1RA 4R2GD 1JFQL 3RGVD 4HPYL 3TV3L 1WAAA 3DROB 3W9DB 1HQRA 5BS0A 2FGZA 2Z8VC 4YXHL 4BYHA 4NQDD 1F90H 2ZNWA 5KSUA 1B2WL 5TQ0L 4P5KA 3MMEA 3CNKA 5F89B 5C0GA 4KI5C 4LLQA 3U6RB 1YC8A 4DCQA 5IB2A 1I8KB 5FUCE 4DW2H 5DT1H 4JVPA 4G9FA 3RVWC 2FCBA 4OKVB 5D5MA 3I6LD 4X7TA 4UIKH 4GRLB 3UDWA 3M1BB 2FHBA 3L9RB 1A7OH 1QBLL 4QOKB 4L29B 4RGNB 1FORL 2BVEA 2FX9L 3AREB 2J8UA 3QIBA 5DR5L 2NXYC 3KG5A 3VA2C 4JM2F 4KMQA 2A9ML 2F53E 4MLIA 5T1LB 1T1XB 4H0GA 1FNSL 4ODTL 5GGRA 4ELMA 3KPMA 2D7TL 1NGPL 3L6FB 3NIFF 3OQ3B 1NANH 4YHOH 3LSOA 3FQXB 3RWFB 2ENYA 4LK4A 4QRRD 1ADQH 4NKOA 4XVSL 4OF8A 1IMHC 4PJBF 4TYUA 2IPKB 2PTTA 2V2XB 3H3BC 3R4DA 4FXGB 5FB8A 1DR9A 5CUSH 3SGDH 5DRZA 3QQ3B 3VXSD 1XGQA 3ZKMD 4X6DF 4XNMB 4F3FB 3EFDH 1TVBB 2VLKA 1LD9B 3U46A 2V9TA 2PUQT 2BNRD 3KHQA 4LL9A 3VFVA 2DQEL 3FO2B 4Y5YA 1P84J 5E5MB 2L4OA 1ZHKB 1CLCA 1DQML 5C6PB 1WGOA 3RNQA 1C5DA 3GJFB 1TVHB 1IT9L 4EBQL 4URTB 1M1SA 1EEZB 5INDA 4YDVA 2XOTA 3QJHB 3TF7C 3G5ZA 3G6JF 3ZE1E 1E28A 3AY4A 3OPZL 3PV6B 1WFNA 1ZANH 1CXIA 4O4YH 4FRWA 2AGJH 2EDYA 5DJZA 1UENA 1QP1A 1L7TH 4M62L 4PJIF 1A21A 2X5PA 1E27B 4M7JH 5SWZA 4N8CH 2VSCA 1FJ1B 4KDTA 1S3KH 3MO1B 5D1QB 1EHLL 3SEPA 4JREB 3TYFB 4LPCA 1JF6A 5CZKA 1D6VH 1UADC 4MNQE 5HI3C 4PTTA 1IM3B 3UEZA 1U95A 3FO9A 3U7YH 4Z7VA 3L3DA 4DQOH 5KBNC 3Q2CA 4P2CG 5TDOB 1RZ8A 3LVEA 4PYGA 5GGVH 2H8PA 1EAJA 4PGBA 1JGDB 1IFHH 1NCBL 4XPBL 3HE6A 5D7JC 1K4DA 3ILPB 3REWA 1PEZA 3UTOA 5DLML 5I1IH 2VL5B 4PY8J 1PG7W 5JORB 3VXSA 1GYAA 2EH7L 2CLZA 1FFOA 3KHOA 3KWWA 2H1PH 3WO3B 4AMKH 4CMMA 2B5IC 1W0VA 2XICA 2ZPKH 4L3CA 3VXUA 5F6IB 1Q1JH 5E8NB 4GT7A 2OTWA 4M1CC 4L8SA 4Z7QF 3ZHDA 4FXKA 1IVLA 3L3JA 3VH8G 3LH2L 1TZIB 2WINB 5EPMA 4OZFB 3SCMA 1YEEH 5GSVB 1KPUB 4L3AA 4MJID 3Q6GH 2DLEA 3UP1A 1VEMA 3VFMA 1JHLH 5FK9A 1DFBL 7FABH 4XTRC 4Z78A 1VHPA 5KOMC 1R3LA 1A2YB 2R1YB 5GGSY 2E3VA 1E4XI 4LMQI 2BNQE 1I8IB 2P48B 4F7PA 1DQMH 4M7ZB 3CDGB 2VLRB 3DSFH 3OX8A 5AZ2H 5K9QI 4RMSA 5CAYB 3DGGB 5GGUA 2NNAA 3K74B 4KXZI 2BP3A 1CXFA 1EGJH 2GY5A 2WLZA 4F57L 1GGIH 2QJDA 4ODWA 1EFQA 4I9WD 4F9PC 3SDAC 3BWAA 4Y1AA 1UH2A 1T04A 3KPPB 1EVTC 4ZQKA 2PYED 4Y4FD 2HRPH 1NFIA 2XTJD 5E6ZA 4WU7A 3WLWD 3EJYC 4PJIE 3TV3H 3VE0B 3RUGB 3U48A 3W39A 5LXGH 1KPRB 4JFYA 4RNRA 3BQUA 3P77A 3HFMH 1U8OA 2Q8AL 4HUUB 3SKJL 2BFVL 2O5ZL 3C60B 1OAUH 1QSFE 4KJYB 2HT3D 3WXVH 3V6OA 3ZDZF 3TIEB 2NY2C 1R6VA 4F37K 4JM4H 3GSRB 1PZUB 1CFQA 2MCPH 4HBQA 3IJHA 4J3TA 5DC4B 4CMHC 4XZUA 2UZIL 3IKCB 3CFCH 4NHCL 3ZLQC 5TJWK 3T3ME 4Y5XB 1G7MB 2EDXA 4HKZA 4HK3J 1ND0A 1EO8H 2W59A 3CMOL 1BX2A 4NT6B 4KKBD 5ISZA 3BW9A 4DKFH 3OL2A 3KPQA 1RJZA 4WHYG 3DLQR 1HHJA 2D7QA 4L8DA 3MRFB 3U0WH 4LCUB 5DQDL 3QUML 4C4KT 1R5VB 1S5IL 2IBZX 3ARQA 3QUKB 1DLFL 2W9EH 1PY9A 3TFKD 3WNNA 4C55A 5C0BA 3OJDB 1B2WH 5DHVA 4NQTA 1G9NC 4U6VL 5HDQH 5B39B 1CDYA 1OGAE 3MV7A 4GLRI 1CXLA 4JHWL 4ZUSA 2OSLA 1DP0A 4NZRH 5I66B 4ENED 1T2JA 1Z5LA 1Q9KA 1RQ5A 4JPIB 1R3KA 1BJ8A 3FB6A 4LVNC 3E3QE 1IKFH 2YD9A 4MA1C 3B9EA 4XTRD 4Y2DD 3IETB 4I13B 2NY0D 4YFLF 5D7JB 4JFXA 4ORGB 4FQHB 1OGAB 4FQCL 3MR9A 3RKPA 4HG4J 2VE6A 2W1NA 3FOMA 3QUZB 1QQDB 1V3LA 1EVUA 5ID0B 3HZYA 1S7UB 3CU1A 3VW3H 3VI3E 3C2AH 5DDHB 1M7XA 2GT9B 4HGKC 1ZS8B 3UTTE 3ARYA 1L4IA 4LRNH 4M1DL 3OAZH 2VDNL 5C8JB 2OTUB 4DN4L 3PL6D 3T1WA 4V2CB 1X5HA 1FAKT 1LE9A 4S1RL 1HZHL 2XWJB 1IEBB 2VH5H 2PN5A 1MEXH 2YBRA 4M7ZC 1P7KA 3I6LE 2XZZA 3GMPB 3MMEB 5GRJL 5J9PA 1YECH 4RQQB 5I18L 4FFYL 4Z7NF 1FO0H 4OZGA 5HVFB 3ARDA 5D5MF 5IB2B 4OCSH 1I8KA 5CP3A 5BZWB 5BOZG 3FQWB 5I1EH 4PLOB 3M8OH 5DJDA 5GZND 2RR3A 3QPXL 5I6XB 3PP4L 1OSPL 4PJIB 4OLVL 4FQXC 3AREA 1BM3H 1FYTD 4KDWA 5F44A 4YAQB 4X98B 2VRAA 1YQVH 1T20A 4N5EC 2CK0H 1IAII 2BRQA 4NQDA 5F1OB 3L6FA 3I3EA 4LFHD 4MXVE 2IQ9H 4YHZH 1A4JA 3PWPB 4P9HC 3X12B 1LE5B 4Z7WF 2ZJSL 2FSEB 1RZ7H 2HLFD 1SJVA 1JGLL 4XMLH 4YZFE 4X7DC 4GW5B 3SKOB 3C09B 4OFDA 4O00A 1DBAL 1QVOA 3HE7B 5FDYA 4FZEL 3QDGE 2BNQB 1KTDB 1CXHA 2DJ4A 4XNMA 4NZUH 1QBML 1RIVL 3HCVB 5KSAB 3CUPB 1YJDL 4J3VA 1TVBA 3VA6A 1T66C 3P73A 5KVMC 1TJHL 1WJ3A 1HINL 3QT2A 1MJ7H 1DEDA 1S9YB 4OIBA 1LQSR 4F33B 4XPFH 5C2UB 1INQB 2I60L 2QQKL 4KRPD 1TQBB 3STZA 2ADFL 1MWAA 3QAZB 3RNQB 4WU5A 1VFBB 2VLJE 3O8XA 2EEBA 1TVHA 5LGKA 3V5DB 3V0AC 1QPXA 4XB8A 4JQXC 3DARA 4HMEA 5JUEL 2Y07L 2APVA 1NGQH 1MLBA 1UA6H 2GAZA 1EO8L 4PGCB 5HHPB 4Y19A 3VD3A 1MI5B 1ZK9A 4LVHC 2JCCF 5I17B 2OYPA 3ARDD 4L4TB 2YD4A 3BEVB 1ZT4A 2VDKL 3CCHA 2QQLH 3TNMB 1MAML 1SY6H 2LTQB 4QTHB 3LHPH 3SDCB 2B39A 4AM0B 2Y7QB 4XC1H 5L2KA 4P4KA 3HC0A 4M5ZH 1YMMB 5F7LB 4HUVB 2N4IA 4P5MB 2DQIH 2Q76A 1YZZA 5FO8B 4ACPA 4G7VH 1SEBB 4JY5L 4R7NA 2MCG1 4KRPC 1FRGL 1ZTXL 5HYJA 2YD1A 1A02N 1XIWD 2H2PC 5EUOB 2GJ6E 1JZ4A 3SE9H 2X4RA 1ORQA 4FS0A 3KPLB 4KY1L 2FWOA 4OLXL 1H0DB 3B2UD 4G80A 3PHQB 4HDIA 4OBSA 5FM5O 2RHEA 5A2LH 3ARWA 1BVLB 2C4FT 5EBWA 1JRHH 3P4MA 2CLVB 1S7QA 3MJ9H 4G6ML 5CJBA 1KJ3L 1BQLH 3ET9F 5DJ0A 2V7HB 4Z0XB 4DOHE 1H3VA 4FXKB 2MOVA 2R23A 3QUXA 4V1DA 5C0AD 1EHNA 2NY3C 1NCDL 4GKNB 2WINA 2B4CC 5KVDH 1S9WB 1RK0A 3FFCD 1OCWH 4M6NL 5D9SA 2QHRL 4RWYL 4LPUA 3TT1L 4Y5VB 2PO6D 2DQFA 4JDZB 4OM1L 3L5IA 2NY1C 4MA7L 2VSDA 5HYJE 4Z78B 5BRZB 1MFAL 1U8QB 5GIRA 5ESAB 4KU1A 5C71A 4Y4FB 2VUOA 3OKNB 4HIEB 1NLDL 3RVWD 3RWCB 2ZUUA 3QNYA 3PP3K 3CFKA 5FYKE 1GPOL 3EOTH 4F7MB 4BZ1L 4ETQA 2OL3H 1KLUA 3NZHL 1MPAH 3D85B 3SN6N 4JFQB 5E00B 1NFKA 2MSPA 4U7KA 1GOFA 1B0RB 1AP2B 4LARL 4F7EB 4CVZA 3P0GB 4EIZC 5HDBF 4Y89A 7FABL 3SHSA 1XGUB 4C57C 4JVUA 1HHKA 1F97A 3VI4F 2RCSH 1IBGH 2H3NA 1U8OB 3WEXA 1OAYH 1YEIH 2CRZA 1IAIM 2NW3A 3MFFB 2FEEL 1XF2B 1XGPB 5EH1A 1KPVB 4R7DA 4XNYL 4MCYA 4RFNC 3G04A 1MFBL 3QZWA 4ZTOL 4WI2A 4AENA 3EYQC 2R0WL 1UZ8B 5CGYC 3OKOA 2B1HH 4MAYA 4YK4C 3I85A 2C1OB 4XP1H 2AGJL 1MREH 4KKCD 4Y5XA 1YY8A 2RCSL 4HCRH 1J8KA 3BW9B 1VACA 1IZJA 3DOSA 1KB9K 3CU7A 5CILH 2VDMH 1PKQB 1CXKA 5D2LB 1PJ9A 2UVEA 3QDGA 4OD3H 3QBTB 4Y2DB 5E8EB 3BQUD 4QY8B 5GGRY 1WZKA 3MREB 1UXSB 2VXUH 1JVKA 1OW0A 3NPSB 4Q6YA 2H32A 1QFPA 2X4QA 1JI2A 2CKNA 1O7VA 4XCFL 1FIGH 1PQZB 4RISL 3TP4A 4JPKL 2DQEH 4OCWL 4GOSA 1U91B 4I0PD 4JM2D 3QDJB 3WFBH 3O4OB 4YJZL 5IQ7H 3SO3C 4EN3C 1RUQH 1XR9A 5IQ9B 2D9QB 3KYMA 4NRYA 1S78C 3LD8B 1I8LC 4Z95H 1BEYL 1U3HA 5ESVA 5HHNB 3BFOA 3KYKL 3ZSSA 1TPXC 1NQBA 2PO6B 1IC5L 5D93B 4O4YL 4LCYA 1A6ZB 2XY2A 3SDYH 3EYOA 5KTEL 3RDTD 3QIUC 4X7CC 3VXTB 4EXKA 2C3GA 1MRDL 2EXYD 4DUVA 2P5EE 2OTUA 1JNHB 4IMLB 1A6AA 4WHTA 2DLFH 3OHXA 4TNWF 1HCVA 4Z7UA 4DUXA 1MJ8L 2OTPA 2XWJA 2WIIA 5C0JA 2OK0L 2RGSA 4G3YL 3IDMB 4K8RC 3T0XA 3MNWB 3GSUB 1OLLA 1TENA 3FQTB 4UOJA 1A7OL 1RU9H 5HPMA 4L4VD 3TLRA 4HFUH 2YK1L 1CLZL 3SQBA 4XH2B 2G9HB 4NGHL 3SKNB 1S9KC 3VMNA 1IJ9A 1TLKA 4N5ED 4NNXA 5JMOC 5EN2B 4WGVB 4WNQA 1S7XB 3BP5A 2VZ3A 4KK8C 4RIRB 1QLFA 4X98A 1UWEH 4ONGH 5IFJA 3QCTH 5ACLA 4OI7A 4M6OH 1C08A 3U2SB 4E0RA 4PP2B 3S3PA 3FRPG 3DX6B 5DS8A 5SWSB 5IEKB 2VQUA 4XNUL 3ES6B 4P9HH 1A5FH 4JPVH 4DKEL 4O51B 4KVNH 5CS7A 4MD0A 3EJJX 4XC1L 2DQHH 1HCFX 5IW6A 5HHVH 1PW3A 3CX5K 4JY6A 1C1EH 3DXAB 3MRCB 5EUOF 4FG6D 3NIGE 1OM3H 3LCYA 2EYTA 1AGDA 2BY3A 3O3EB 5EBMB 1PAMA 2AP2A 4LKCB 1AO7A 1QRKA 2OXHA 1SYSA 4MNQD 5EZOH 5CCKH 2AS5M 5D71H 3SE8L 1KG0B 5CBEB 4I3RL 4OLYH 3TIDA 1FBIL 3DV6B 2J6EH 1HKLL 3C08H 5D96B 3KPSB 1HN1A 5IF0B 4G8GA 4PLKD 4UNVA 4IDJL 4JPWH 3S88H 3G9VA 4HLZG 1PDKA 4P23B 2N56A 4FTVD 3VFGL 1INQA 5ILTL 2NW2A 3WCYA 3QQNA 5EU4A 5DRWB 3HR6A 4CGTA 3JWOL 5I16B 4OLEA 1KYOK 3U30C 3EGSB 3NCJL 5B38G 3UPCA 5GSRB 4LF3B 5CKAA 5DHVH 3GKWL 3CVHB 3K4DA 5J1AB 2NTFB 4WY7H 4U6HB 4NRZA 1DUYA 2LTQC 2H6PB 2CIKB 3EO1A 4LSUH 1Q9LB 2FO4B 1VENA 4JFEE 3HUJE 2CR6A 4H88L 3LKSA 4N0YL 3LHPL 1IC7H 1WC7A 3HB3C 3SDCA 3CFBA 2OR9L 1A7NH 5MI0C 4KK5D 3E0GA 1G7JA 3QWOB 4HGWA 2YXFA 4W4NA 5FGBC 5KG9A 3MSPA 4HUVA 5IFHL 1AQKH 3RRQA 1RURH 5SWZD 4NQSB 5FUZL 2DIJA 3AB0B 2JELL 1E6JL 3QIWA 3CFJB 1UFUA 4XPTH 3NVQA 1O0VA 3B5HA 5L9DL 1SBSH 3VMOA 4OBRA 4JRWA 3WNMA 1QFUH 1T1YA 2J12B 3HI1B 1A1OA 4PG9A 3VXOA 3GHBH 4WFHD 5EOTB 5EU6D 5GGVY 5IMOA 1T0NA 2Y23A 3IXAA 1OPGL 1YEFL 4CDGC 5EIQA 5D4QA 5IB4A 1DDHA 1UZ6F 2V9RA 3M07A 1N5YH 4OKVA 4YHLH 5FM5M 1RZKC 4GRLA 1B4JL 4LCWE 1KN2H 3FB5B 3L9RA 2IALB 3GDBA 5EC1A 4E41E 4GG6B 1NUDA 4ELKA 1I4FA 2CLVA 3GFUA 1DBBH 1ACZA 4XPTL 3I02B 2A6IB 3ZDXF 4KVCL 3EW3B 1JHKH 4XMLL 2W65A 2P24B 1FAIL 1OAKL 3DBXA 1C16A 1G0YR 1U58A 4EN3B 5IT2L 4ETYA 4F2MA 1AGFA 4HWZA 1DN2A 2BVUA 4KWUA 4NKOB 3MYJB 4ZYKA 1NL0H 5BRZA 4PTUB 2V7NB 1LO4L 5B39G 1JIBA 3GK8L 4L8CA 3QA3A 1DQDL 4Y4FA 2EYSB 2GFBB 2Y36H 1KCRH 1QLRB 4D2NA 3VXQB 5T5FH 1RUKL 2R1WB 5I1GH 2OI9C 4HQQH 2DKUA 5IJKC 4LGPB 5ESQA 2OZ4H 4AIXA 1A7QL 1JYVA 3OG4B 1MFCL 2CJUH 1AGEB 5D7KD 4LLAA 3L3OA 1CBVL 5HYQB 4PRBA 4PV9A 4CVZB 4XVJH 4KAQL 2W9LA 3VXME 3BD4A 1AKJA 1MCJA 1V8HA 1E4XH 2HRLA 2XWTB 3MCKB 2R1XA 4Q2ZB 4ODSL 3WEXB 2D2OA 1CDUA 1HEZA 1CS6A 3TZVB 3MJ9A 1IEAA 3FZUD 1XGPA 4I77L 1A7NL 4CU8A 4EKXA 2Q7YB 4MCYB 1IGYA 1JP5A 1X6LA 1EERB 2XN9E 3FT4B 1Z6JT 1QO3B 5SWZB 4ODUB 1UCTA 1P7QD 1MFDH 4YHKH 3MX0A 5FM8A 2V5RA 5EU3B 25C8H 5HGHA 2Z31B 5KAQF 2DQDH 3NCCB 3LEVL 2X42A 2WZPD 4KZEL 3C60D 3LKPB 4CDHA 2WBJA 4HC1A 4LSQH 5INCA 1KBGH 3QCTL 3OF6A 1UWEL 3UYOD 4ZFZA 5ADOL 2GSIB 1XGTB 1AFVH 4DVRL 2MPAL 4J2XA 2OI9B 4YEEA 4Y5YC 2WW8A 1DQTA 3QDME 3RPIB 2V6HA 4NQCB 4XWGL 1Z3GH 4ZUTA 3WMSA 5I73C 3S88L 3VG0H 5C0EA 4JPWL 3ILQC 2NY6B 5HVHB 1CG9B 4N8PA 5KVEH 4J3OC 4PJCB 4EIGB 2F53A 1Y18B 3UJJH 4JKWA 3KWWB 1ITCA 2EDQA 2IEPA 3TVMA 3H6JA 2JCCB 2YWZA 5F88A 3FQRA 5D6CB 3FO1A 2J5LB 3G6AB 2Q87A 4YWGH 1D5XA 2NY7L 1HHGB 4C83A 1DE4A 5T1DL 5KS9B 2ZSVA 4ZNEE 3RX5A 2IQAB 4I18A 5C6WH 1QR1A 1G7QA 1W72B 2MWCA 3QNXA 5EZIH 5F7HA 3IDJA 1CT8A 3MACH 3LEXA 2C4FU 5C0DB 1D5IH 5DVLA 3P3YA 5J12B 2HRPL 4KROD 2X6MA 5DYOA 3LEYH 1UXWB 2J6EL 3C08L 4QXTB 5BCAA 2R1YA 3L5WB 4WEBL 4BZYA 3O45A 1MCWM 1NBVH 4F7PB 5JHLL 3RU8H 3GBML 2OS7A 4YPGA 1JWUB 5EO1B 1CIUA 3FAWA 4U3XA 4L4VE 2NNAB 1T0MA 2X44D 1U36A 3GSNH 4WNQB 2GK2A 3VGEA 2Z92B 4P5TC 4ODHL 3H9SB 3TT3L 4Y1AB 2DOCA 5HI4D 5F7EH 2ZUTA 4MNHA 1S9XB 5CZVL 4MJ2A 2A0LD 3DO7A 2DLFL 5JHDE 2VDML 4WU7B 3AREC 5E2WH 4JM2C 4KJWC 1K4CB 3SDXE 4FFZH 2C3HA 2C7UB 1SVCP 5BXFB 1V7ML 4YXLH 4MAYC 3LQAC 3TN0C 5I73B 4X9FA 5C0CD 3ULUE 3TJHD 3IDXH 3NA9L 4BH7A 3OJVC 4LKCA 5FCSH 4FXLA 4AMKL 1SYSB 4TOYL 1M71B 4R8WH 1CTOA 1YMHA 1I3RA 1FV1A 3DV6A 4LLDB 4RZCA 2C3VA 4QTIH 4NNPH 3LRHA 3BJLA 1JN6B 4LQFL 2NXZB 4OIAA 3MOQA 1KGCE 1GC1L 3RWIA 4XPBH 2MQ3A 5E8OA 4LEOA 2PF6A 5E2VL 2CQVA 4HG4K 5EU4B 4ZAKB 1R5VA 3VI4E 3HA0A 2FBOJ 4ZAKC 4LF3A 4CNIA 2ENSA 2QSCH 1BBJA 3SGKA 3OWEA 2YPKA 3PNWA 3TBSA 1H3TA 4WI4A 1LNUB 5JHLH 4RGMC 3VWKC 4JFHD 5FYJD 2Z8RA 4O5LL 3MRJA 3HC4L 3UZVB 3O3DA 5D7JA 5FYLL 3IYLW 4O2CA 1T3FA 1OB1B 2OBGA 1LO2H 3QZWG 4J7RA 4NO5B 5ID0A 2VQ1B 2EEDA 4MHHG 2X05A 5D2NA 1S7UA 4HMCA 4LSPH 1X5YA 3ZKNC 5KJRL 5JHDD 5EWIH 4G6KL 4JDTL 4XNXL 1X44A 1RFDH 1DL7H 4DEPB 3I50H 2MJWA 3HZMA 2NR6C 3GJFK 5EBLB 2OJEA 5F7EL 2X4SB 2XYCA 1NEZB 5CGTA 3MLYL 4NZDA 5GJSH 3T2NH 1DEEA 5KVGL 4BQ9A 4FQ2H 4PJFF 3ABZA 4Y4HD 2CXGA 2EDDA 1MCQA 2NY4C 2VWEE 1T83C 2FZ3A 4PJ7B 4U3HA 3FQWA 2BHYA 2BOBB 3U0TA 2VZ1A 4KY1H 4H1LB 4PJFB 3BAEL 1KT2A 4FABL 1GHFH 3INUL 4KK6D 2W0PA 2MPAH 4ELKB 3HRZB 1ED3B 2DTSA 1AQDB 3O9WB 4YAQA 4CBPA 1WISA 3C5ZD 5MERA 2AV7A 5D1ZA 5EO9A 1I1YA 2P24A 4ENEC 4QHUA 4HLZH 1K8IB 2HFFA 3W11D 3ARBB 4F2MB 4JDVB 3QEHB 4BZ1H 3O3BA 4PD4J 1YDPB 4AQ1B 3RIFF 1N8ZA 3HPLB 2NY7H 4ALAH 3LKRA 1ACYH 4YFEA 3S9DB 3N1FC 5ID1A 2O61A 1BBDL 5D96C 4WEBH 4Z8FL 3ZTJG 2AEQH 1CXEA 1A3LH 2G60L 3KNBB 4K2UH 5C2BH 4S2SA 1UA6L 4XP5L 5D1XC 1PYWB 1RZJH 2D9CA 4I2XE 4OZHA 5C08B 5JUEH 3J7HA 1U8MB 2ED7A 3S34H 4X4ME 2EYRA 1P9MA 3NFNB 3BH8B 4PJ8A 4WW1A 3O8XC 3FONA 1ZSDA 3PQYD 1MWAB 2XG4A 4OUUA 4MD5B 1AFVL 1YPZF 4M7LL 5HYQA 2CLRB 2CGRH 5F1NA 3HLAA 4XCNA 4U7MA 3SJVE 1RUMH 4I5BA 2HVKB 1B6DA 1N0LA 1YA5A 4R26L 2P5WB 1BAFH 1JYXA 4OFYD 1OAZH 5T1KA 3LEVH 4Q6IC 5C0NC 3FL7A 3WLWC 4XC3L 5DK3A 1HEZB 1CR9L 4PGZA 3BT2L 1ZHLA 4YUEH 1SHMA 5I1KH 4OQTH 2JB6B 4PP1D 1NC2A 4I4WB 2Q7NA 4XMKH 2EC9U 2DQTH 3VU2A 3O2DL 5IT2H 5A2JH 4JN1L 5HGDA 3DTXA 5GJTH 2F8VA 1AHWB 3MJ8B 5J13B 4JY5H 4X6FB 3VXRA 5D1XD 5FAAA 1B0GB 5ERWA 1T7VA 1K8DB 2V5TA 1Q9WA 3K4ZA 2CMRH 4ZFZB 5FKPB 1BM3L 5I0DA 4RGNC 3EDJA 3PQYE 1Q9OB 4X9IA 5FHBH 1B4JH 4D8PA 2J7LA 3MLTB 5CZXD 3QWRD 4J6RL 5CP3H 4HWNA 4UV4L 4X6DB 1RUAH 2EDRA 4R9HA 1LO4H 3VRJA 15C8H 1ZA3B 3U36A 3QO1B 3FKUS 3DV4B 2BSTB 2R2HA 4ELMF 4M1GL 3FTGA 4DN4H 4XWOC 4Z0XA 4GXUM 2DLTA 3MLXL 3RAJH 1DE4B 1X4XA 3QUXB 1RZ7L 1JHTB 2M2DA 2F74A 1EMTL 4V1DB 4ELMB 1AQKL 4KJQC 4PGEA 5LAXA 3BP7B 1A1NA 5E2JA 5C92A 3STLA 4JFDD 3MV7E 1KXVC 3WE6B 5E99H 4LHUB 3CSBA 3KR3L 5JPMB 3B43A 1T7XA 1SMAA 1U41A 2IPKA 3VJ6B 2DJUA 5DYOB 2DS4A 4OFVA 5HHOD 4JKPH 5CJOL 4UINH 5BQ7B 2P5WE 1FH5H 1MCHA 3L5WA 2VXVH 3EO9L 2MHAA 2Y5EA 2P44B 4W4OC 5AWNL 1WT5C 4HIHA 4W81A 5CINL 4WY7L 2VIRB 3BZ4A 3MRMA 2NXYB 1WBXA 3D69B 3MRHB 5JW5A 2R69H 5BV7H 4MCZA 1AXIB 1BD2B 1KFAH 2JJTA 4M7LH 5JIKA 12E8L 1X4ZA 1RJYB 4WO4C 3KPNA 4GG6F 1X6NA 4LCCA 2E9WA 5JQHC 4F7EA 1N7ML 1KEGL 2EDKA 3ARRA 4L3EA 1QRND 1HQ4A 3PGCA 4F8TA 4KQ3H 4ERSL 1UM6H 4LP4A 4WWKA 5MHSD 1AGBA 1OTUD 3OV6A 5J3HC 3OGCB 3S5LB 3MJGX 1A3LL 1U8KB 2G60H 4K2UL 2ARJB 5JXEC 3B3IB 1KFAL 1IAKA 3D2UD 3QXUA 4HS6B 1I9IH 4MSWA 4Z9KB 3ZO0A 1ACYL 5FA4B 4LVHB 4JM4L 5DGQA 2HJKA 1IC7L 1Z0NA 5C0AE 5CEZH 1JPTH 4NRXA 5DK2B 5DHYB 3GHBL 4YO0A 5D1QA 5HHME 4DZ8A 3UZEA 3MCG1 3QIUD 4RZCB 3ULVF 3BP6A 1PKQA 5D6DA 4B5EA 1E6JH 1JF1A 4KGLA 2R0KH 3RGVA 3OJ2C 3BIKB 2VDLH 4PRIA 2FR4A 4ZG1A 5E8OB 4Y2DA 5E8EA 2YOCA 2EC8A 4PGBB 3INUH 2HJLB 4LLVA 4XPGL 4POZD 1SJEA 4LLWB 1ZT7A 5IVNA 5C07E 4JE4B 4GRMA 5DQDH 4NBXB 3VFTB 3NN8A 5C0CA 1NC4B 4A6YH 3FAXA 2B0SH 1NGYA 4V1DE 5HDBE 2D7OA 1I85C 3KJ6H 3ZTNH 6FABH 15C8L 1JBJA 5JORA 2E9IA 3DURB 4NZTH 5F93C 3MRJB 2IADB 3WIHA 4QXUL 5I15H 3QIWD 1XR9B 5IQ9A 3O41B 1FVEB 3LY6A 3GSWB 1T3FB 1P69B 3VXUB 1OB1A 5DC0A 3O2VH 5GGTL 3QFJB 3PGFH 3NCYS 4UNTA 3RY6A 2XT1B 1HOCA 4I18C 1N4XH 3VGHA 4IRJB 3L3JB 4NQUA 1KELH 4KI5F 1CDBA 2XNAB 5FO7A 3QI9C 1OVZA 1CGVA 2X1OA 4WFFE 5AZEH 1C5BL 2H9GA 4FQLL 3KYOB 3QP3A 4KRMB 3AFLA 4PJCE 4Z95L 1CVRA 1NMBL 5E5RB 2ZPKL 2VC2L 5ACMA 5KW9L 3FB8A 3IDMA 5DJ8A 1XH3A 1CFBA 3O2DH 3PJSB 2UYLB 3RTQD 1DQQA 2XZAH 3B9KD 4XAKD 3PHSA 4XCEA 3CD4A 5A40E 1NJ9B 2IF7A 1N2RB 1RMFL 4P46A 4P2QA 4WI6A 4MXQC 2FYYB 4KPHH 1W8OA 4J23A 4NGHH 1YPZE 4WV1C 4PY7A 3CDFA 5HHMD 4PJHA 4GS7B 4LLMA 2NY4D 4S10A 2FEDC 3T0WA 3UYPA 3U7WL 5K9JH 3L7EA 3K8KA 3QWRA 3IFLH 4G3YH 3MRQA 3PDOA 3WSQH 4OD3L 1A7PL 4I48B 1C08B 3U2SA 4JM2B 4M6OL 4NHUA 1N59B 1F4YL 2NLJB 2V5SA 4JGUA 4PB9L 2GCYB 4KHTL 1U8IA 4ZPVA 1NLBH 2HMIC 3VFSB 4PRHE 3QFDB 4NP4H 5FUCC 3SPVA 1YDPA 4B7IA 3H7BB 4PRHB 3MRCA 4PG2A 1MAJA 4LU5L 2DQCH 3IAQA 1A8JH 2OCFD 2WLYA 1OOAA 3LN5B 5ID1B 2O61B 1G9MH 4JHZA 4G8FB 1D9KA 3VXMB 3UAJC 2Y6SD 3WFCH 3H8NA 3HC4H 3LN9A 5C08E 3R8BB 3MOBH 5DEGA 5GS0L 3EZJB 1BX2B 4I2XB 3GMMA 1OQXA 5DJYB 1JHLL 4OGZA 2EDNA 1HHJB 5HSFA 2DQGH 2UWEF 5CJ8A 2NW2B 4ZO7A 1UB6B 2VZUA 4OUUB 3ULUL 3ZE1F 3LH2H 3QUKA 1YEDA 2OL3A 5IJKA 1XGRB 3PHOA 5I1HH 1CE6A 4OB5H 4WI3A 2QQNH 3F58L 3MV7B 3T0EB 3U0PA 1MI5D 3T0VA 3B2VH 3KPSD 1RUQL 4JPIA 2HJFB 2P5ED 4ELME 2DLHA 1N6VA 1LK2B 2XRAL 2H6PA 1YEJL 4XP9H 5JTWA 1S3KL 3O11A 3HE6C 5DJ6B 5DRXB 2X9YA 3LKSB 2F54A 1ERNA 3FOMB 2DBLH 3MRDA 5HVHC 1T22A 3SO5A 1REIA 1ADQL 3L3IB 1BFVL 1YYLH 3TJHC 5E1AA 3BP4B 3TH3T 4ZFOA 5DVKA 3DTXB 5JO5B 1AHWA 2AV1B 3LRSB 3SGEH 5JPNA 4HHAB 3AXLA 1DTUA 4XNXH 5ERWB 1K5NB 4XXCA 3WHXA 4FFVD 1RPQA 5FYLE 1IT9H 5FGSA 4EBQH 5IESH 1FHGA 3GMPA 2IAMB 5EC2B 3UJJL 3GGWB 1WBZA 2EC9T 1T0NB 1L0XA 2VISA 4GBXB 5GZNC 3PWLA 3S97C 4PJ7F 4EJ1C 4E42B 4NQED 5TE6H 5CD5D 4WV1A 1NLBL 1H3GA 5DGRA 1FVDB 2ZKHL 1DBKH 4Y4FC 2A0LC 5JMRA 5TQ0H 5AAWA 3ZE0E 2OP4H 4FOMA 5GRUL 1NPUA 4FQPA 4JQIH 2EE6A 4NSKA 5F7DA 4JG0L 4GAGH 1IM9A 1F4XH 5I74C 2B2XH 1JZ5A 1WBYA 2VWEC 1WQVT 1OCWL 4M6NH 5LAXB 3GSOB 1F6LL 4XCYA 2Q3AA 1CE1H 3QQ9D 2NX5A 1R3HA 2ZG2A 2FSEA 3SQOL 2VQTA 3HS0A 3I84A 3V5HB 4DN3L 3BH9B 5DD3H 3VJ6A 2A9MH 2Q3ZA 2ITCA 3R06A 1TXKA 5GGTA 2OJZH 2PR4L 3LKOB 4TN9A 4FHBD 3X11A 2C9AA 4HH9A 5IJVA 4PJGB 4Y5XC 5JLZA 3FQUA 4MA7H 1QLRA 5IVOA 4F7TA 4QGYA 3MLRL 4KH2A 2E6JA 4AIZB 3U4AA 2GSGB 3WN5C 9CGTA 2QEJA 3ULUF 4OLXH 4F33A 4L8BA 4LCCC 5EZIL 3HAEB 2PETA 2ED8A 3MGOA 4BSWA 5CEXB 2BNRA 3EO0A 5B38A 4HKXB 1TITA 2FHCA 5MP6L 2FLRT 5J4MA 1F90L 3WS6A 5TE7H 3UJIH 3QUYD 1G6RH 5D7LD 1HQ4B 1KBGL 3A6BL 4LKXA 4G7VL 3PL6A 4K7PX 2IH3B 1IGIL 1PBYA 4YC2B 3K81A 1T4KA 4OF6A 2ARJA 1IQWH 6FABL 2HLAB 4F7CA 1ZT4B 3CCHB 4NQEE 3WL9A 3BRGC 1TTUA 3BHBA 3P4OA 5I0ZA 3KPOB 1RMFH 3CMGA 4MXWH 5AYUL 2XKSA 3ULVE 1BZ9B 4J4PD 5EZLB 3BQUC 4YHZL 2QL1A 1WV7T 1J12A 4JFPB 4Y4KA 1NGQL 1NMBH 1II4E 1YY9C 3DROA 3W9DA 2RB8A 3MUGA 4KFZC 4GG6E 5DD6A 3QUZD 4ODXA 3TZVD 1IILE 2ESVE 2WK2A 3DVFA 4HK0A 4XVJL 2F58H 4QCIA 3JWNC 2UVFA 1OSPH 1KB5H 3QUYC 3VXUD 4N0UE 5IMLB 1BWMA 3HI5L 3NIDE 3QQ4B 4LLWA 2IG2L 1FLTX 3A67L 3EYQD 1S7RA 3RPIA 3RY6C 1LP9A 3T0BA 3UTQB 3WNOA 4DKAA 5I1LA 3L95A 4AEIH 1MJ7L 3GMQA 3OR6B 3NPZB 5EFIA 1MSPA 1BF8A 2JK5B 2SEBA 1Y18A 3BXNB 1MCDA 4XBGB 4L29A 2GQHA 1H3PL 1MEXL 1S7QB 3BSZH 3CXDL 2I07B 1DBAH 1CU4L 1Q94A 3H9HA 5LGJB 4O2EA 4JGJA 1CBVH 3NACH 1I3VA 2R23B 4IRJA 4JN2B 3VGAB 4OD1L 1FC1A 2ZCLH 4HBCL 1QA9B 4HT1L 4HT1H 4RMUA 3VGGA 2DIBA 3T0EE 1NCTA 4NYLB 3LEXB 5EOQH 4EUPH 4Y5VA 3RPKA 3CVIH 1DUZA 1W72H 5AWNH 4DTGL 5D93C 4MQTB 3LMJL 1WCQA 2Z93A 2FIKA 4U1NB 3B8YA 2AXFB 4OV5B 4KK6C 4BKLB 1DQQB 2C1PA 3U9UA 1EX0A 5BJTB 4B41A 4R90H 5EO1A 2G5RA 1A6VL 3VFVB 1I9IL 1A9EA 4U6XB 4Y5YB 5IROA 1FZJA 4F7MA 3DVNB 4XRCB 3CPLA 4J4PA 1R24B 5SWZE 5FHBL 4KK9D 4KJQD 5I75B 3TYGL 1ODAA 1YEKL 1CD1A 3HG1E 3PDOB 1S9XA 1HZHH 5HYFA 4JM2A 1BQSA 2R8SH 1FFPA 4JO3L 3JZ7A 3THMH 3BSZL 4QRTA 5CLWA 1P2CB 4K9EL 5EULV 5GJTL 2WUBH 3DXAE 4GQPH 5BXFA 2OR9H 3O2DA 1DN0B 3QG6B 1T0PB 5JDSA 3C09C 2BSED 1VCAA 4OQTL 4N0YH 2AI0L 1A6UL 3VRLF 5I1JH 2DMCA 2YPLD 3MRRB 3LMJH 2Q8AH 4LLDA 3HFML 4DK3A 4M43H 3W2DH 1MHEB 5GS0D 4TRPH 5EUKB 4HC1L 1BJ1J 1U9KA 1J1OH 1EXUB 1NCWH 1OD7A 2OMNA 3C2AL 1CZ8L 4ZAKA 2W9EL 5DSCB 5CSZB 5FFLA 3PHOB 1ES0A 3D87B 3S37H 4X4XB 5E9DA 3QO0A 4GMTH 4H26B 3U1SL 4YBQD 2YK1H 3OMZA 2R2BA 4U1GB 2VLRD 3HMWL 5GGQH 5KS9E 5FECB 3G5YB 1HKLH 3DIFA 3O6ML 4ZUWB 1T1ZA 4R96B 1GGBH 1KENL 4NWTH 1MLCB 4GRLC 4Z77A 1BAFL 5D70L 5E8DL 4CMMB 2F54B 1T21B 3TGXA 4RX4A 5TE7L 4LCWB 2OTWB 2Z4QA 1MRDH 2K1MA 3ARDC 3QEGH 4NNYA 2QADB 4JKKA 4HW6A 3V6FB 5L8JB 1Q0XL 5MENE 4RFOH 5CEZD 4WHDA 5F6IC 3EYOB 4P5TD 5F9OL 4JPVL 1BQUA 4DKEH 4NQCE 5C07B 3G9AB 1M4KA 3MLRH 4KXZH 3VRLE 3NOIA 4Z5RA 4Z7UB 4Z7WE 1RURL 2Y4SA 2WIIB 5J7CC 5C2BL 2UUDK 4R3SB 1SYVB 5DJ2A 2OJZL 3IXTB 4PBVC 1AHWC 5EU7C 2FX8L 2QQQA 3IDGB 1QSEE 2JJVA 4UT7L 3OZ9L 3P4NB 5FKAB 1C12A 3GMLB 5GGUB 2X70B 3FQNB 3S6CA 1Y6NR 4JRXB 1JZ6A 2O5ZH 4IOFC 5C6TH 5HTSA 3G6JA 1HHHB 2VXUL 5GGSB 3K4AA 5IMMB 1U8NA 1PKQE 5EB9A 1RHHA 1P4BL 1EJ6A 4M7KL 3HN3A 4XNUH 2Q1EA 3IF1A 4JFEB 4NOBA 1ED3A 5KSAD 2OK0H 5I19H 2EE9A 4JQIL 4R26H 2G5BA 4PJ9B 1JGUL 3WJLA 4D9RE 3G5VB 4NSKB 1MNUH 1LDPL 2DLIA 2FB4H 5CKGA 2ZG3A 4IJ3C 4RGND 3AS3A 5IK3B 1IGCH 4QT5A 4Y4HB 4O51A 5MI0B 1OWWA 2BC4A 4U2YA 4L4TE 5DJAA 4OF0A 3ARBA 1NMCC 4IOSD 3S35H 2GTZB 4OZFG 2BY2A 3PV7A 3VFNB 2GI7A 4YGVB 3GSRA 4X6BB 1MFBH 1F3RB 1BVKA 4UBDD 4X5WB 4FQXD 5FYLH 4U6YA 2VITB 2AEQL 5JHDB 4XP9L 3WIFB 4S0TD 4PJGA 5L7XH 5M94B 4O9HH 4TUOA 1G84A 3WUZA 5DURD 2X4PA 2CKBH 2KPNA 5TDPA 1EUUA 32C2A 4P57A 4P23A 5BW7C 1UACH 4PJ8B 1EHXA 1AE6H 4OB5L 3BUYA 3LS4L 1PFCA 1X5JA 3MGOB 1PGRB 4BSWB 1IL1B 3MV01 1A7RH 1MWAL 5IEHB 1KJ2H 4MD5A 1F3DH 1XZ0A 2QKIA 4WTZG 3MV9E 3BPOC 4JEGB 4U1GC 3ARBC 5GS3A 5J11B 2OP4L 1EEYA 1N64H 4HV8A 2A74B 4GW4A 4YQXL 3V0WH 1T4KB 4JJHA 3V0WL 5F3BA 4G6FB 1T5WA 3ETBF 5BMFL 3NBNA 4XBPA 1L7IL 3CSPA 1G9ML 4X6CB 1CICB 5CZXC 4OV6F 4S1DC 4OM1H 3BHBB 3OKEA 2KQMA 4UUJA 4NO3B 4ZTOH 3PXHA 3C87A 3UTPD 4XNYH 3H9YA 2GT9A 3T3MF 1HH9B 3CSYA 4EI5D 1MY5A 1S7TB 4OLUH 4L9DA 5CLTA 2DQGL 3U7YL 4NNPL 3ARTA 3PWNA 1K8DA 5J3HD 4PJEA 3VFRB 5ANMA 1EK3A 1IEBA 5F1IB 3IGAB 3T2QA 1MCIA 2GJZB 3EYFA 4NQVB 1FGNH 3GZKA 1T7ZA 4JJ5A 2YSSA 4HLJA 5IG7B 5TGBA 3C5SB 3RWDA 3VCLA 2O5YH 5DHXB 1NSNL 1GPOH 1ROWA 2YUZA 2CO7B 1AIFB 1V7MH 4H25B 3T0AA 1OQOA 4PJ9D 1GZPB 3TO2A 1X4YA 3P9LB 5ECJE 3V7AG 3EDFA 2FB4L 3CJJA 4HX1A 4EEEA 5KW9H 2DL9A 2ADJB 4LP5A 1F45A 3W9EB 2XFXA 5ITBL 5IBLC 3FTGB 2QSCL 4JN2A 5E56A 5F70A 5T3XD 3EOBA 3B9KA 4QRPE 2PO6C 3MROA 4YBHA 5E2VH 3LS4H 1LWRA 2I26N 3MRBA 4F58H 1SJHB 4QGTA 4JFOA 5JPMA 4YWGL 1BQLL 3IU3A 4LEXH 3SDDA 1OGAD 2HVJB 2EDEA 1VPOH 3LD8C 3QHTC 2GTWB 1FFRA 2VC2H 2KBGA 2YPVL 1F02I 3WN5B 2AXHA 1J87A 3LN4A 3RBSA 3TBWA 3TVMC 5E24E 1PZ5A 2DQCL 2CH8A 5GRXG 3V6ZB 1VGKA 3SDDC 4D0DB 5HDLA 2AW2A 3OB0K 4XPGH 3STZB 1RJYA 4X4MA 4HUWB 1ZGLM 4XHQA 4GUPA 3KPNB 3O8XB 2UWEE 3LQZA 4Q0XH 3E1F1 2GK0B 4Q9BA 4MB5A 3ZHKA 1DQLL 4LHJB 5EA0H 2AAVA 1J1PL 4Y2DC 3OSKA 3QHZH 3QJFB 1K3IA 5FYKH 5GISH 1S7SA 1DANT 3IFLL 4Q2ZA 1OP3K 2QADC 1MH5B 5ETUB 4Y19B 2OL3L 3RVVD 2Q20A 1TCRB 1MFDL 1CD0A 1L0QA 4X8XA 4RAVA 4P2OC 1SY6L 2KL6A 4ODUA 1OP5H 2EH8L 2AJZA 3SE9L 3T77B 1QEWA 1ZKAA 2BX5A 1G7PB 1MCSA 2ZSWB 3CH1A 1WIPA 4PD4K 1ZTXH 2DYPA 4ODSH 1XCTB 2H41A 4D9QE 3BP6B 1ETZB 4PGDB 4ZTPL 3HMXA 3GSXB 1NUGA 1V7NH 5D8JL 2DQDL 4CAGA 4J3WA 2CUIA 4KDTC 2VLRE 3SKMB 1HYRC 2V2WA 3QH3A 1KELL 1JPTL 1MRFL 2HJLA 5A3ID 2F54D 5CSZA 2QQKH 3ULVC 4G5ZL 1YUHB 3DX9A 3M8OL 2K9UA 3UTTA 4HS8H 4HQQL 2W0KA 5C3LD 1P9MC 3WFDL 3P0VL 3F6LA 1JTPA 5FECA 3DURA 3OGOE 1KENH 4NWTL 1HH6A 3D18A 2E8ZA 2Y1VA 5EBWB 5HHOE 3IVKA 4OCLC 4W4OA 2WNGA 1VADB 2VH5L 2DWEB 4LVNB 1NGWA 5F88B 4AEHL 4G42B 3NMEA 1A3RL 3FRUA 5FYJU 4K23L 5E2TH 1TZGL 4XAWL 3NCYP 2B1AL 4MQ7B 1T89C 3H9ZA 3HPJA 3MA9L 2E7HA 4EI6B 1MFCH 3HZVB 1YQ2A 2I60H 1S9WA 4PRDA 5SWQB 1MHHB 1AI1L 4PS4L 2H9GB 5T1MB 3O0RL 5MEQA 2AK4B 4X4YA 4RMTA 1VFUA 2QSVA 5J1SC 2BXYA 1R5WB 5SWSD 4HJGA 3T4AA 1VFAA 3MBXL 1HI6B 1K2DB 5GIRB 1KCVH 3QB7C 1A22B 1N5AA 2UYLA 3BPCB 3MV9A 4UQ2A 1HHIA 4KDVA 3IDGA 4P2QB 5ISZE 4MAUL 3V52H 3QRFM 1AI1H 3ZT6A 2X70A 2NQCA 4PG2C 3ZZ1A 2YKLL 1QHPA 3BYYA 1FPTH 2Z92A 4X6CF 2D0FA 5M95B 1MVFA 1RHHB 2D4DA 4MJIA 3MRQB 4MNHB 1L9NA 4XMPL 4JLRA 5C0FA 2Y9RT 2HKHL 4X9BA 4IRSD 1SBSL 1RIUL 1JWSA 1FGVH 4PJ9A 5IM7B 4AEHH 5DQ9A 2BHUA 3RWJB 4GAYB 1CQYA 4AT6A 4OGXH 4QT5B 4BSVA 4ONFL 3PL6C 1JV5B 5ALCH 1JGEA 1OSZB 3FOLB 1FPTL 3D39B 3GMNA 5ITFB 3UTZA 3PWVA 1KB9J 4U2ZA 3WFDH 1MCRA 1O5DT 4P46D 2R4RL 3VFNA 4YZFF 1X3DA 3IFOA 1UZ8A 3CLFL 4FNLL 3RVUD 2AJSH 1YMMD 1KB5L 4L3EE 4YR6B 4KMTL 4U6YB 3OXSB 1QBMH 4G6AC 1QPPA 3RVTC 4PJDF 4MHHI 4PY8I 2ESVD 5D8JH 5IBLD 1NGZA 2VLJA 3L3HB 1OAZL 4GO6B 2EO1A 1B3JA 1MF2H 3UXFA 3P11H 5ICYB 1JN6A 1NH6A 1W8NA 4ZSOA 2ADIA 32C2B 2AXJA 3AUVA 4TVPE 4H5SA 1R0AL 1WFUA 3EUUA 3BUYB 3MGTB 5D5MB 4L4VA 3ZTJH 4K94C 3P40A 1UH4A 3ZL4H 1MCCA 3NAAL 1T6WA 1KJMA 4PB0H 4J8RA 3PWPE 3BPLC 2BOCB 4C58B 3KXFD 3QAZC 5ICZB 1T03L 1RV6X 4IDJH 3IJSB 4QYOB 4JZNB 1EHAA 4DKFL 1LNUA 3TBVB 1I7ZA 1OLZA 5IWLC 1RZGA 5HBBA 5ISZD 5D7IB 2D0HA 2XQBL 4OZIA 3C5ZA 2KZWA 1KXTB 5FOBB 3CFCL 4NHCH 3WS3A 1JPSL 1CICA 2JCCE 4EI5C 5EA0L 4K7FB 1U3HB 2FLBT 2MKWA 4NQDE 3MRDB 3VGFA 7CGTA 4P23D 2Y06H 5ABDE 4OAWB 2COQA 1U93B 3W0WA 1B4RA 4FXGA 4MA1B 5E1AB 2HA1A 2IAMC 1OD9A 2VKWA 1U8JA 3D39E 2L7UA 3T65B 4JR9L 5JPNB 5AG9A 1MCBA 4NC0B 3RL2A 1K5NA 2JE8A 4TVPD 2ICCA 3JWDC 3UDWC 2OJEB 1N0XL 1OHQA 3ARED 3S4SA 4JY4B 4QHLB 4DUWA 3D25B 3AU1B 1KJVA 4NO0B 5FYJL 5A43C 2X40A 4CADB 3AMLA 4PREB 5AUMB 4DVBA 4Z7QE 4X83A 3JUZA 1RUPL 1YMME 1RZIA 4F58L 1G7LA 5EU6A 5IB5B 2AEIT 5F97E 5DUBA 4LIQL 1H15B 5BV7B 1KCKA 3UTSE 1P4LA 3CAFA 1WZMA 4TVPH 3ARGA 2IPTL 3AVEA 3A6BH 4NZRL 1PSKL 5KVFL 5EO9B 3Q6GL 3QEUB 3I6GA 3NCBB 3EOBB 5DXWA 3ROLB 3QUMH 5LG1A 3WFHA 4XVUD 3DXAA 4UB0H 2DQUH 3CZFB 2CRIA 4N9GB 3FN0L 4BZ2H 1R3JB 3T2NL 4KK5C 1RSFA 2HVJA 5IESL 1CLYL 1IAIL 3GM0A 3Q3GB 3WN5A 3BESR 1CICD 3ARUA 3GMRA 1U8LA 1OM3L 5BRZD 5HYEA 1K4DB 3ILPA 1F3JA 1AC6A 5CSBA 4PBXA 4D0DA 3F5WA 2EZ0D 4HGMA 1G0XA 5JXAL 3OJMB 3QDGD 4OF5A 2A6KB 5J11C 4MJ5B 1F4XL 2W0FA 4XNQB 5CJ5A 3LKNB 8FABA 2C3XA 2EXWC 4N0CD 3T3PF 2K3TA 1DVFC 3TBYA 4CW1B 1CTNA 1MY7A 3OKKB 2HVKA 4I5BB 1L7IH 1GGTA 2VAAA 2P8MB 1X5ZA 3QNZA 4HCRL 3K46A 5T1KB 1DBJH 1ITBB 4UTBL 1GHFL 4YQXH 4I0KA 4J3UA 1VKXB 4LSDA 1UM5L 5TE6L 3B2VL 4HZLB 3TO4D 5C09A 4LAQL 1I9JL 1WC7B 2O5YL 1CLZH 3CFEA 4WW2C 3C8KB 1UKTA 1FN4A 3MCLL 3NA4A 5IBUB 4U1MA 4YXLL 4UT6H 3D3VA 35C8L 3OAZK 1F4AA 1KLFA 5EZJA 1HILA 1UACL 5E70A 3WD5L 1QYGH 1KJ2B 1M05B 1QNZL 1BIIA 1ETZA 2ZCHL 4MYWB 1S5HA 3FT3B 3GSXA 4G6KH 4QTIL 2F53D 1MCKA 1I1AA 2LU3A 5AD0B 4GKZA 3C6SA 3SCMC 3WJLC 3SKMA 2BSRB 1S7WB 1EEQA 3TT3H 4QWWC 2UWEB 1ZLSH 1MPAL 1I7RB 3SDXF 3QQ4A 4GQ9H 5AG8A 3NA9H 3MLTA 4RBPK 1QACA 43C9A 4LAQH 2CKBA 3E6FA 1OP9A 4PJEF 2DKMA 1JGVH 5KN5B 5BMFH 1MVUA 4K3JL 1OTTC 1BJ1H 1IC1A 2LAAA 4NJAH 1J8HD 3QEQA 2R0LL 2XA8H 4HUUA 3VRJB 3VD7A 2LABA 1LO5A 2FX7L 3C60A 1WLHA 3HUJB 2VDQH 3DUSB 4AZ8A 4QF1A 3C6LB 2BVQA 4PJ8D 3MBED 2HLFC 1WIUA 1QKZL 1ZHNA 3HZVA 1AXSB 3BVNB 2F5AL 4MNGE 2N1KA 4UT7H 4PRAB 3KPQB 1ZAGA 4LSVH 4RMQA 4PJ5D 4PRPB 2DQJL 4QRSB 4UIMB 4WVRA 1W0WA 4XX1G 4OV5A 4C56D 2DDQL 1QBLH 3BOVA 1XR8A 5FV1L 2UZXB 3UC0L 5CD3B 2XKUA 5T3ZE 4GG8B 5A16B 2P5WD 5I8EB 4G43B 2PTVA 2I9LA 4K3DL 3K2MC 4LLUB 4UBDC 4ODVL 2QHRH 2OSLB 1FZJB 4XWGH