1FRGL

Crystal structure, sequence, and epitope mapping of a peptide complex of an anti-influenza ha peptide antibody fab 26(slash)9: fine-tuning antibody specificity
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
217
Chain Sequence
DIVMTQSPSSLTVTAGEKVTMSCKSSQSLFNSGKRKNFLTWYHQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLTITSVQAEDLAIYYCQNDYSHPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords IGG2A 26/9 FAB (LIGHT CHAIN)
publication title Crystal structure of a peptide complex of anti-influenza peptide antibody Fab 26/9. Comparison of two different antibodies bound to the same peptide antigen.
pubmed doi rcsb
source organism Mus musculus
total genus 50
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 1994-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1frgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1frgL01
2R29H 1WWCA 3M1BA 3U0PA 3R1GL 2EEDA 4X9GA 5FYKL 3T0EE 1MNUL 1HHGA 4YFDB 3K80A 4A6YA 3WO4C 3DRQB 1A6ZA 5F7DB 4YHIA 2ARJB 3D9AL 2VDPL 1P2CB 2X44D 3LIZL 5MI0B 3DTXA 2VWEC 3TNNB 2A74B 3DXAA 1OGAA 1RJLA 3ARED 1G1YA 1T0MB 1BOGB 4J3XA 1CE1L 3IRZA 5AAMA 2AJZB 1T7VA 1X5FA 1KPUA 1RUML 3DX8A 3OTTA 3RVTD 3UDWC 4G80A 1I3VA 4WI8A 2I07A 3PP4L 4NN5B 2VH5H 4JLRB 5SWZB 2DQUL 3UTSE 2JCCB 1I9EA 3ECBA 4OCMC 3FQWB 3TCLA 2Q86A 4D0DA 4PRAB 5IB1A 5IJKC 3QRFM 1AGDA 3C2AL 3SDDB 1KCUH 4NT6B 1RZ8A 3GUTB 3J8F7 3E2HB 3QIUC 3HAEG 5JPMA 4X80L 3LS5H 2W1NA 4XP5L 4EI5D 2OXGA 1I7UB 3EYQC 2DIJA 3SDCD 5FCUH 4LNVA 5HHNB 2R0KL 3ZHLA 5EFIB 3RUGF 2BY0A 3C2SA 2OLDA 5FDWA 4UV7H 3EOTH 3LKOA 3F58L 1DUYB 2FJGA 1MCOL 1BMGA 1ZLSL 4G8FB 3IB4A 1LO4H 4FQCL 3CFBB 3OV6A 4JFEA 2R2HB 3VXSB 3TZVA 3WUWA 2YS4A 4ODSL 1UM4H 4OZIB 1G7HB 3RNKA 1KG0B 3HE6B 3I84A 3RVXD 3JTTB 5LG1A 5GGQH 5GGRY 4H8WC 2D31A 1ZA6B 1ZKAA 1TIUA 4KXZI 1RIVH 3MBXH 4NNYB 3S35L 4F80A 5SWSB 2X4QA 1D6EB 3RDTB 4OCWH 4Q0XH 1IM9A 5MENE 4QO1A 2J6EL 2NQCA 3GKWH 1L0QA 2FEDC 4Y2DB 3U2SB 2KZWA 4KK9C 2BNRD 3CD4A 5IVNA 1SVZA 5BQ7B 2AABH 1FJ1B 3X3GL 2R2CA 1WCBA 4M00A 5CGYD 1YY9C 4LLYB 1NC4D 2GTZB 3U83A 4ETQA 1AFVH 4ALAH 2FX7H 4RGMB 2X09A 2CLRB 3RJQB 4YXHL 3PIQB 4GS7C 5F7LB 4FZEH 1LNUB 3QIBB 4K3DL 2OZ4H 5IM7A 2GJ6E 2WWMC 2XZAL 1R3LB 1EHLL 4S2SB 3GMQB 3UP1A 4Y19E 5KAQG 4YDIL 4ODWA 1D6VL 4XPTH 5J6HA 4A6YH 5DQ9B 1W8OA 4MA1B 3SDXB 4NYLB 4PG9A 3QDAA 3RX7A 1WFOA 5DRNB 3LN5A 3WD5L 3T3PE 3CPLB 5IG7B 1WZKA 1TJGL 2C9AA 4KK6D 3RL1B 4F37K 1FE8H 2DKSA 1GZQA 2X4TA 4OIBA 4D3CL 4LLWA 3FN9A 4H1LA 1TZIB 4YGAB 3LRGA 1TCMA 2EEBA 5DUBA 3X11A 1Z0NA 4PRPA 1KIRB 1S9XA 4X8JB 2EE2A 1HHHA 3QQ3B 2XQBL 1E27B 5FYKH 3CJJA 5KSBE 1I3GH 4FTVE 4XZUB 3D9AH 4G6AC 4W6WB 1B6DA 4LVHC 4O2FA 4CJ1A 2UWEA 5HDQL 4AIOA 3A6BL 1EBPA 1U8PB 5C0AD 3OBAA 5E8NB 3KJ6L 1D5MB 5J9PB 4KQ4L 4X7CC 2FX9L 4GLRH 3CU1A 4CKVX 1RUMH 3PP4H 3GMRB 1K2DA 5BCAA 1JNLL 1YEDA 3OSKA 4UT7H 5I2IA 2DQUH 3HNTL 2FJFB 2X7LA 1F6FB 4NNPL 1IC7L 3PWNB 3V6FB 2BFVL 2BSRB 1C16A 1T2QL 4GKZB 4YHYB 3MRHA 3L9RA 4R7NB 1MRFH 3C2AH 4X0KA 5F6HJ 4OFIA 4P3CL 3NFSH 5D7JC 5MEQB 4QT5A 5I1CL 3RZWA 2RCSH 2AJVL 1J0KA 43CAA 5IESH 4HWEH 3BP5A 2R0KH 5FOBB 3BZDA 1AP2A 4N8CH 2MKLC 2ARWA 3CH1A 5H94A 2VDNH 4WO4B 3F58H 5E6ZA 5CJOH 3QHFL 4P2OD 5CFHA 4UIMB 1VSCA 1E4XH 4JG0H 2IANB 3MV7A 4ODSH 3UC0H 5EOTA 3ARXA 5KSAA 1Q0XL 1L4IA 1BP3B 1C8PA 2W0KA 3K7UA 1D7FA 5FKPB 3IJHB 1G7QA 3DXAD 5CUSH 1OGAD 3T0EC 2A83B 3TN0B 4XGZB 1X5YA 1MI5D 3MLXL 5IMOA 4NHUB 1MCPL 5FYKD 5J06A 4OLVH 3CXHK 5BJTB 1FZOA 3MACL 1GGIH 2NX5D 3REWA 3RX5A 1JHLH 2R1WA 2Z8SA 3C6SB 5GGTA 4PJDE 5AD0B 4Q6YA 1LP9E 2G5BB 1DDHB 5E1AA 1UWEL 4H1LH 1WTLA 1QVOA 1JTPA 2ED7A 2VDQH 2XZAH 2B39A 4NHCL 2Y1VA 2AXFA 5CZKA 2D7TL 1OP3K 2JCCF 4UUJB 5HBBA 1D6VH 2O5YH 5C09D 4X6FA 4UTAH 2A9ML 2EYTA 5JORA 1FZMA 3SE4C 4NKQB 1VPOL 2OTWB 1X9QA 1ZVHA 1P4LB 1I8KB 1JFQH 1TJGH 4CADA 3MJ8B 5FV2A 5ESVA 3TZVD 5TF1L 1MJUL 2PW1A 3U48A 3QRGL 4D3CH 1I1CA 4JFDB 5EIVA 1MCSA 4KVCL 2P5WA 1AY1L 4EDXB 4UDUA 3MRCB 3EYOA 5E08L 3QXAA 3TBYA 5E2JA 3PJSA 1NCWL 1MAJA 4NKDB 5ICZA 4PJ8A 3SDAC 3WYRA 1IGCH 3B2UC 1YN6B 3U30B 2C7UB 5HDQH 1D5BB 1G0XA 1TVBA 3U9PH 3Q6FB 5AYUL 3KJ6H 1NCCH 3I6LD 1LK3H 4M8QB 3B6SA 4R97B 3CC5B 2BSED 1DP0A 4MNQD 3LB6D 1BF2A 5D7IB 2HJKB 3HNTH 2NY2D 5C0BA 3QUZB 5B38G 3CFJA 3RRQA 3FN3A 1AXSA 3FQRB 3MBEA 1KPVA 1RAMA 4LAJH 1VGKA 2DI7A 2R2EB 4J12A 2VE6A 4M7JH 4YPGB 2AJXL 2H32B 1GPOL 4H0GA 3T77B 3ZE1E 2PXYB 3QXWA 4MXWL 5DXWA 2FRGP 1W0YT 2AAVA 2BX5A 4OBSA 1QSFB 4U1HB 1UZ8A 1JMZA 3QT2A 3T8XB 3WFCL 1JGDB 1GGUA 2WUCL 1JNNH 2ITDA 1GXEA 3KYKH 3C6LA 3VFVA 3QHFH 4JQVC 4YGVA 4YHPA 1A64A 3TT1L 3QDMD 5IIEB 5E4EB 3VXMB 4I3GA 3NIDF 5D1QC 5EO9B 2VXQH 2XFXA 4MQSB 5C07A 5T1LB 4MD4A 4CU8A 1FYTE 1RZIA 1XR8B 3VU2A 2GT9A 1X5KA 1T04B 3LS4L 4BZ1L 4OD3L 4J1UA 5GGTH 3B43A 4M61A 4MMXC 5E7FA 1RZKC 3GGWB 3QA3B 4X6CF 3DGGB 4EVNA 4KK8C 4LEXL 5EH1A 4YBLC 5ICYA 1JPGB 3TBWB 3NCBB 3QXTA 2Y23A 3MLXH 1E6JL 4JFQB 4HWBA 2LABA 3BW9A 4P2RB 3S8WA 1FNLA 4PJBE 4MVBD 3RBGA 3FHQA 5DQJB 5IB5A 1BPVA 3MACH 4RAVB 2QSCH 2QQLH 4YC2C 2ZUVA 4NO0D 4OTXL 3K2MC 3ZL4L 5I71C 1F4AA 5I75C 1ETZA 5DLML 4O51B 4NHCH 2NXYC 1N0XH 5F97E 2VLRE 4FFVC 3TGXA 3LAFA 5GSRA 3EYSL 3OKMB 2X1PA 1VB9A 3EIFA 1T1XA 4LIQH 4GW4A 2HRPH 3L5WA 3NFNB 1WBZB 1DUZA 1MHCB 1JF5A 2FD6L 4PJIE 3VRLF 3MV7D 3RIAF 1NBQA 2IMNA 2EE6A 1MHHB 1JWSA 4RWYH 5KSAD 3U0WH 4KVCH 5TQ0H 5HVWA 4J4PD 4NP4L 5E08H 4MAUH 4NCDA 4PJAF 4KV5E 4FN0A 1OQOA 3PQYD 3QCTL 3W2DH 5B3NA 3MROA 4GBXC 4KHTH 2DQIL 2GUOB 3KYMA 3IRPX 3OKLA 2WIMA 3U0TA 3HI1A 4AQ1B 4PB9L 4PJHB 3BHBA 3KPQB 1QSEE 4QRQB 4K71C 1XF3A 1OTSD 1U8LB 3WS3B 4QRRA 3S88H 3UYRH 3NTCH 3DV6A 1L6ZA 1MREL 5DQDH 4KI5F 1F2XK 4RWHA 1UXWA 3PV6A 1AGCB 1WFTA 5D93B 1UA6L 5J1AB 1RULL 2AXHA 1GPOH 2ENSA 2BVQB 1FIGL 1JF1B 3L3DB 1SJEA 2CRZA 4B7IA 4NN7B 5IT2H 5L7XH 3NABL 2DQJL 1O0VA 1CXFA 2MWCA 3WS6A 5B4MD 5GS0L 1OSZA 3WFCH 1VFBB 5F1NA 5D2LB 2NXZB 3FKUS 3DWTA 4NZRH 4KJYA 1YYML 4GW5A 1U8IA 3X12A 3DUUA 4LCYA 4NKOA 4WTXA 3KPSD 3WEXA 2ADFL 3H7BA 3HE7B 1IQWL 3OXSA 4HXAL 3DUSA 3W39B 4WI9A 1VCAA 2FB4H 3MGOB 4ZXBD 5TF0A 2O93L 4FA8A 1Q9WA 3LQAC 5AEAA 3G6JA 3ULUE 1MJ7H 5C7XL 5FO8B 4R4FL 4HWBH 1EZVY 3BZ4B 4PJEE 1MRCL 3AM8C 1DN0B 3BDYH 4OUUB 2NY0D 2C3GA 4PJ8D 3B9EA 3DNKA 4OD3H 5CEYA 2J4WL 5DJAA 1LEGB 4KRLB 1OTTC 4MDIB 2CK2A 4KRMB 3OGCB 4KDVA 4TULL 4ZS6D 5H37G 1KTDB 3GJFK 1WAAE 3IJYB 4JPWL 2R15A 1QPPA 3LKQA 3QUKA 1YDPB 2VXUH 3KHQA 5DD1L 4L4TD 4XI5C 2P46B 4MAYB 1FL6A 2C1PB 3P4OB 5T1MB 4ZS7H 2NY7L 1NGXA 4GXVH 3ZL4H 2OL3L 3ROOA 3BPLB 4BUGA 4JDZB 1KOAA 1NUDA 3KYOB 1CE6A 3F6LA 3GNMH 3U4AA 4V2CB 4QOKD 5IBUG 4U2ZA 4WUKH 1T7WA 2O61A 2P8LA 3BP6A 1EH9A 4EBQH 2DI9A 4YAQB 3GJEA 2B7DT 1DLFL 4KH2A 1BZ7B 3TFKC 5C6WH 4LDLB 3NCJH 2A6DA 1LK2A 3O0RH 4MNGB 3T0WA 2OI9B 4LSUL 2OL3A 3DLQR 5FYJL 2APBA 5GSVA 1PKQB 1GOFA 2MHAB 3RI5K 3FQUB 5C07D 1EHAA 2W9EH 1BJMA 1JI1A 3C8KA 3KPOB 1XIWC 1F02I 3VWJB 1P4BH 2JK5B 2HT4C 3FB6A 5T3ZH 5TH2A 3DROB 1MF2L 2DQIH 1YQVL 3UAJD 2LTQC 3MA7A 5L2JA 3OKEB 1MLBB 2NY1D 4OSUL 4DOHB 3VFPB 1G0YR 2YBRB 5D7LE 2FHCA 4ONFL 2AJYL 3ISWA 1MCQA 1T5WB 3BE1H 4PB9H 2CDGB 2X1WL 4F7PB 4P46A 3MOAL 5EOCH 4YO0A 3WKNA 3KLHC 4W68A 3SGDH 3VGDA 4F57H 3Q6GL 2HTLD 4AMKL 2GSIA 3VXUB 2YPVL 1IMHC 4IIQB 4EDWL 1NFDA 2J8UA 4OT1H 3S96A 3NBNA 1CICA 4DUWA 3ZKMD 5KN5A 3STLB 1KC5H 4FQHA 2YXFA 3P30L 4XC1L 5LCVH 4HGKC 5ABDE 4OLUL 4ODTH 2HTKD 4S11A 1NEZA 2FCBA 3RVWC 2A6KA 4I0PC 2IPUG 4ELMA 3KHOA 2MCG1 2AKRB 1RJYB 4U1IA 3D85B 4FG6D 2DQEH 1H15B 4RIRB 4C56E 1AGEB 1MY7A 2A6JB 3PHOB 4HS8H 2BY1A 1A9BA 1IQWH 4DTGL 4G42A 4L9LC 4WFEE 3MRQA 1KCRL 4Z77B 4NCC2 3KPRB 4XPHH 3MXVL 4Y4FD 1J05B 3H42H 2XNAA 1L7IH 4NC1E 1TCRB 1OAQL 4HMDA 3GSWB 2I26N 3OG6B 5BS0E 3VXPA 4X6DB 1CDYA 5E5MA 2HKHH 2NY6D 2NY3D 3L1OH 3LKRA 4TQEL 3FOMA 2J4WH 3VMPA 1N64L 3ARGC 3PWPE 3U46A 1UYWL 4PRBA 3AFLA 1U95A 3S37X 1NUNB 1ZMYA 2CLZB 4OF0A 5KANG 2E7LC 1CIUA 4PJ9A 1P84J 3VI3F 2DTML 4GRLC 2GJJA 2GJZA 4QNPF 3T08A 4TULH 2GTWA 4UINH 4XMLH 4DKEL 2A9NH 3OL2A 4LPWA 3SKNB 3NGBC 4NJAH 3BZFB 1MPAH 4TUJA 1S9VB 4X8XA 4URTB 5JW4M 2X4RA 1ZVSA 4I3RL 3KPNB 4HHAA 4ZYKA 3RX8A 4HIEA 3MREB 3QG6B 1U93B 5FHAH 3RWGB 4U6YB 3UJJL 2BVUA 3GSRA 2NY7H 2Q6WA 3WHE1 2OL3H 3W81A 5CJQL 1QZ1A 1T89A 1HIML 5TE7L 1VDGA 4IOFC 5ITFA 3MV9D 1ZOXA 3TWCL 2XWTA 4KROC 3ULVH 4F7TB 3S3JA 4QHLA 3FFCD 1A4JB 3RWJB 1NC2A 2FHBA 3FQNA 1DLFH 3ULUL 4M6AA 3L3OB 1HKLH 4LFHD 1BEYL 5KTEL 5H2BB 4WNQB 4LSUH 4JHZA 5TPWH 2R69H 3VFUB 5JLZA 3MV8B 4OKVA 3HPLB 5HHOD 1A1NA 3QNZB 1JTOA 3O2VL 5DK3A 4ZUSA 5DMJB 5GS0D 4DWHA 2DQDH 3HRZA 5BRZE 3GJFA 4RCAA 4PJFF 1KJ3H 2CKBL 4WWKD 4Q7DA 3VCLB 2HN7A 4JY6B 4NRXA 2HVKA 3SCMA 3F12B 1KN4H 3IFLH 5HTSA 2XACC 4YFLI 4KUCF 3REVB 1JYWA 3MRMB 3Q48A 3RKPA 3VWKC 3RIAK 4XPAL 1RI8A 2J8HA 1K5NA 3QUXB 3EDJA 3TO4C 4UI2A 3DRQA 5F7DA 3ZHDA 4XRCA 1OM3L 2GY5A 3OAUH 2FECL 4D9LL 3V8OA 1IAIH 1IL1A 1ZTXH 1T83A 4GMTH 3TNNA 2BHYA 1NBVL 1BOGA 4WI6A 2GCYB 5A43C 1MWAL 2NTFB 3BEVB 4R96B 1OARH 2AJZA 1WK0A 3ILPA 4XVSL 1K3ZA 2NYYC 3UTPE 4NKIL 5I8KL 4C54A 1V7NH 3FQWA 3L3KA 2HT2C 1A3QA 4N8PA 5I1AB 2VDOL 5DJZB 2P43B 1IZJA 3QDGB 4NT6A 1YC7A 3GUTA 2XA8L 4LASL 3TO2B 3RAJH 2G5RA 1UWGL 5FM5O 1BF8A 1MQKL 4XTRD 1FNEB 1I7UA 5HJ3A 3MUJA 4JFEE 3QXVA 4XCEB 1AQKL 1UCBL 1OAQH 2VLJB 5HHNA 4PB0H 4QEGA 2HVJB 5JHDD 1EHXA 4PJCB 2VAJA 4TQEH 1A6VL 2GFBB 1S78D 4G8FA 4BQ6A 3CFBA 4Q2ZB 1D9KD 3RFZC 5F70A 5FYJD 4JRWA 1S5HB 3TH3T 3VGAC 3VXSA 4PTUA 2MPAL 2FO4A 2AJSL 3VMNA 5D1XC 2XWBB 2DTMH 3EJJX 4U3HA 3JTTA 3ZLQC 3NA4A 3AMLA 4DKEH 5MP6H 4MJ5B 4LLUB 1LO5B 3BEWB 6CGTA 2X05A 5BV7B 1SMAA 1CICD 1LO0H 3O6FD 5SWSA 4ERSL 3KYNB 1INQB 1G9NC 1SBSH 3QI9A 3GI9L 4EKXA 3ROLA 3U2SA 1T7YA 3EBAA 2ZUTA 5TE7H 3QPQC 3PWUA 3C5ZD 3CH8A 5BQ7A 4HDIB 2NY4B 4XCFH 1FJ1A 2MQ0A 3NA9H 2P5EA 3GJFH 5K9KB 1MHPH 5DMGD 3TWCH 5JZ7D 3F5WA 4MQXD 2PO6D 5FA3A 4LLYA 4OFYA 1XMWA 4Z7UA 4GS7B 4HAGA 1MAML 5C9KA 1KF9B 4LSVH 4Y7MA 2AEQL 3VW3H 4G9FD 1LNUA 3QIBA 2I9TB 1OOAA 1G6RB 2E6QA 1A9EA 4HC1A 3SEPA 1R3LA 4S2SA 1CVRA 3SY0B 1PD6A 5DYOB 5J12B 1XT5A 3QIWD 3H9ZA 2QBWA 3CLEL 1UT9A 3X17A 4GLRI 5C8JB 4WW2F 3SDXA 4ZO6A 4NYLA 4IRSD 1C12B 1KGCD 4PRPE 4NC1C 1MCRA 4YEEA 1MQ8A 3RL1A 3D0LA 1G7PB 1VENA 2PYFB 3EYFA 5I1HH 2VZ1A 1TZIA 1XGRB 4NQED 3VG0L 5GRVK 4WU7A 1X3DA 4X8JA 4FQQB 4OLZH 3FB8B 3CVIL 1EUUA 3QEQB 3KDMB 3P0GB 3HB3D 3U7WH 4LVHB 1JPSH 1R3HB 2JB6B 3MGAA 1YEGL 1A5FL 2AK1L 3BIKA 5E94B 1JPFB 1UM6H 1P6FA 3JVGA 4L3EE 5C70A 1U8PA 5JOFB 1NBVH 5HI5C 3TC9A 5J9PA 1PBYA 5ERWA 1E4XI 3QZWB 3KPLB 4ODXB 4AIXA 3CUPA 3QAZB 3AUVA 3BXNB 3UO1L 3GMRA 2YEZB 4P23D 1RUPH 4BQ8A 2OSLB 1CYGA 3AAZB 2ID5A 3PWNA 3V6FA 2WUBL 2EEAA 4R7NA 4ZUVB 3OMZA 5D5MB 2W0LA 4WUUA 4HQQL 2XA8H 4LASH 4OCLC 5GRXG 1F13A 2VZTA 2EIEA 2R4SH 4Y4KA 1FNSH 2YPLD 3RY6C 4U1LA 2OJEB 4YHNA 1MQKH 3ZSSA 4F7MA 1FZJA 3QBTB 1RZJL 3MRDB 3QO1B 1I9RH 1UCBH 5FOBA 3UTQB 3G5XB 5KG9B 1PVHA 1JGVL 1A6VH 3LPFA 4WO4A 4LSDA 4PIRF 1T4KB 4UB0L 2IQ9L 4PREA 4UIMA 1JWMB 1OW0A 2W65B 4M4RA 2I60L 2X1OA 3RQ3A 5ALCH 4HPOL 1TVHB 2JJTC 4LVNC 1HHKB 2OYPA 1LE5A 1PG7W 4LSQH 4D0CB 4BFEA 1HYSD 1VACA 2F53A 1AO7E 3IJHA 3B8SA 4K9EL 4BH8B 4ERSH 2QQNH 4JAMA 2Z31C 4WCYL 5A3ID 2A83A 3GI9H 4U6XB 4YX2L 4HD9A 4MHHG 5T1KB 3V6ZB 1NFKA 4HC1H 4F9LA 2VYRE 4G7YL 3IGAB 2YK1L 5F9JB 4GG8A 3WSQL 2E7BA 5BJTA 3C60A 3F7VB 1ZGLM 2DQTL 2LU3A 1HXMB 1V8HA 2E9WA 4RNRB 3LCYA 4QXGL 1J9CT 3BPCB 1JWUB 5K9QI 4M6NL 2NW2B 1MAMH 5LXGH 2V9RA 3HNSH 2G5BA 4S1SH 4NSKB 2FL5B 2ATPB 1XF5B 1SVCP 2B4CH 5SV3A 3EJYC 3IF1B 4HPYH 3MRPA 5IB4B 3KJ4B 2K9UA 4I3SH 1EGJL 4NPYB 4UUJA 4M6OH 2C5DC 1F3JB 3BPOB 3GIZH 2OTWA 2QADD 1P4LA 2HJFA 3D6GA 1S7UA 1FIEA 5HGAA 3MJ8A 3W9DB 5JW4Q 3TZVC 4LIQE 3IAQA 4K2UL 4TSCL 3MNVB 2CUMA 3ARFA 2H6PA 3BO8A 4JFDA 4P4KD 4Y89A 1Q9LB 5HY9A 4PJCF 4JKLA 1I1FA 4RSVA 4V1DD 2X40A 4HLZG 1YN6A 1A5FH 3BKJH 1H3PL 1D5BA 3PWJB 3QI9D 1D5IH 3H9SD 1MCEA 3QXDA 4BJLA 1N8ZB 4ZFOL 5C0BE 4JPVH 4JFPB 2GAZB 3CC5A 4DGYH 2GYSA 2P5ED 1IVLA 4NQTA 1FFNA 1QQDA 2BRRL 3SN6N 1FCCA 3ZYZA 3OKKB 5IVXB 4OFYD 4HS6B 5D7IA 2HJKA 3W5NA 1KXQE 1DVFA 3QUZA 4CL7A 2J5LC 4PLJC 4TRPL 2R2EA 2APXA 4TOYH 1JGUL 4YPGA 4ZFOA 3I6GA 1B9ZA 1CTNA 2DD8L 3T77A 4OGYL 3T0XA 5HI4D 1QSFA 3V4VH 4U1HA 3T8XA 4QHMB 1JGDA 5C08E 2ZCLL 5GGRB 3RA7H 4ZAKB 4GRWE 1T20A 3EYUL 3W9EA 1ADQL 3QEHA 1ZEAH 2VLKD 1YEIL 5BW7A 4R7DB 4N8VB 3KWWB 5ELIA 1I85A 5EBWB 2B2XL 4IJ3C 1J0HA 2NY5L 4KKLD 4QRPB 4UB0H 5C1MB 4KDTA 5D1QB 4MJIB 2D0HA 2BZDA 3TVMA 5IV2B 3MNWB 5JUEH 2QQKL 2G60H 1YEFH 2IAMD 4MA8H 1YN7A 1G9EA 3HI5L 3HRPA 2APTA 1TLKA 5DHYB 5T1LA 2EDJA 4OCNC 1XR8A 5CEZL 1T04A 4RGND 3K2UL 1R3IL 4UT9L 4HK3N 2XTJB 4WCYH 2VL5B 3QA3A 1EUTA 1JN6B 3FL7A 1R5VB 5E6ID 3FT3A 4YX2H 1JPGA 5MERB 4RFNC 3TBWA 1AR1D 2K1MA 5JW4N 5CJXC 1Z5LA 4B7LA 4OZHA 4FOMA 2HA1A 4AZ8A 1CGSL 4JFQA 4G7YH 5KVGL 3F7QA 4DK6A 4L8DB 4OLXH 3W82A 3WSQH 3PGFH 4KQ3L 5DQJA 4NM8H 4RAVA 5GGUA 1IBGH 4QHUB 4XP4H 5I71B 4WUUD 3MLSH 3MLRL 1KJVB 1U91A 1J8HB 1EZVX 2NXYB 1B88A 1ZLWH 3GIVB 4M8VA 2I9LB 1BBDH 5E5RB 1KUMA 4JVPA 2PYEA 3FRPA 1CLZH 3MMEB 5E8PB 1IEHA 3ULSA 2VSCA 2PCPB 2Q3ZA 5I30L 2ESVB 1IC4L 4NRYA 3HMXA 5F71A 5D5MF 5EUOE 3NFNA 2AJ3A 3R06B 1WBZA 1AI1L 3MR9B 1I8IA 5FM8A 3IAPA 1HCVA 4L4VD 4EIZC 1N5AB 3WLBB 5F1IB 4CN6A 1AD9B 5HHXL 3H9HB 8FABB 4Z7WF 4N68A 1WTGT 3UJTL 4LDEB 1JNHB 5EORL 4OLWH 1UACH 1I1AD 4XB8A 5E00A 4QRSA 3UBXG 4QRRE 1LDPL 1CXLA 1HWHB 1FG2B 3NZHH 1MY5A 5EOQL 4E41D 2E27H 2YA0A 5T3ZE 4LCWD 4PJHA 3QJHB 1A7QH 3KPQA 5L0QB 3HZKB 4PJ5E 4CJ0A 4P5TD 5CZVL 1T80A 2NZ9D 2KKQA 2R0LL 3C60D 5HYSA 3MRJB 1W8NA 1UH3A 5SV4A 1TZGH 5C0JB 4Q6IB 5LGHH 3DMMA 1AGCA 3ARUA 4YR6B 5J1AA 3DHJA 1F4YL 4PUBH 2BVQA 5EWIH 2DD8H 1JF1A 5I1IL 4XP6H 4JJHA 1CDBA 4HKXB 3NIFE 2DQCH 2W0FA 1FSKB 1VFBA 3O9WB 5D2LA 1YC8A 4ONHA 1O7VA 5C0ND 1EEQA 3EYUH 3PHQB 3G6JE 4N5UA 4I0KA 3SJVB 1WISA 3QWRA 5E1HB 4DZ8B 3HE7A 2B2XH 4IEFB 4CDGC 4NRZB 5I8EA 1CFSB 1P69B 3MGOA 5I76A 1U8QB 1DQTA 3ARFD 2BK8A 4K3JL 1LWRA 2QQKH 1RUQL 2R39A 5FO8A 2VDRH 2Y5TB 3BZ4A 4TUOB 2GW5A 1DN0A 1OQXA 4OUUA 4P48A 1OAKH 2CK0H 3HC0A 2VDKL 3MLVL 5CEZH 1L6XA 2XKSA 3K2UH 3V5KB 2W59A 4MDIA 4G3YL 4FQXD 1ZT4A 3OGCA 4JM4L 2OR9L 5IKCB 2QR0B 5JNYB 3DBXA 5GZND 2VO5A 5L2KA 1KCVL 3D18B 2IWGA 5CSZA 1KTDA 2HKFL 2LFGA 3IJYA 5L9DL 1YDPA 3HMXH 3MBEC 4NC0B 4HXBL 1RIUH 3A67H 3LV3B 3CXHJ 1ONQB 3JTSA 3G5YB 3MLRH 3P4OA 3P0VH 4BSJA 2DDQH 5EUKA 2CO6B 3FZUD 1YNKH 4XMPL 5T3XE 3L5JA 3DVNB 4JDZA 4YJZL 2ATKB 3HPJA 4HFUH 4J8RA 4DVRH 3SO3B 3C5JA 1CN4A 4PGDA 5EN2B 3C6LC 4NBXB 32C2B 4NWUH 2NLJA 1A21A 1BZ7A 3VFTA 4WY7L 3ULVE 2BDNH 1NCAH 5ESAB 3TVMD 1J1PL 4KJPC 2AV7B 3QDJA 5HHXH 4FQJH 1T2JA 3EOAB 2G9HA 1QBAA 4FXKA 1RFDL 4KC3B 1FNAA 2BNQE 5EORH 4D8PB 4DN4L 3KPOA 4JN2B 4APQD 2JK5A 2LTQB 2GY7B 5EOCJ 2UY6A 3C09B 1W72B 1WFUA 1LD9B 4JM2C 2H1PL 4ZTOH 3SE3C 3T3PF 1GH7A 2V5YA 1A02N 4KMLB 4KKCC 2NY1C 3GSVB 2YBRA 5TE6L 1HYRC 5LKNA 1XGUB 1T5WA 3UJIH 1L7TH 2EIZB 3FO1B 1NFDE 1JK8A 4F7PA 2J8UE 4QTIL 4KFZC 1OT2A 5T1DH 5CZVH 5I6XC 3T4AB 2HLAB 2GSGB 2HTLC 3U82B 4FQ2H 3VXUA 5CEZD 4N9GB 4XVUD 4HEME 5KSBF 5K93A 2R0WH 1YY8B 5ID1B 1K6QL 1Q0YH 1UKQA 3CXDL 4ELME 4FP8L 3WV0A 2B0SL 1OP5H 3STLA 4H0HB 4RRPA 1RV6X 3QCUH 1FH5L 1A47A 2R9HD 4LRIA 4S1QH 4Z7QF 1RQ5A 1BVKA 3QNYB 2AKRA 1RJYA 3MLYL 4XC3L 1MLCA 4Q9QH 2ED9A 4PGCA 3HC3H 1H15A 2E5EA 4RIRA 3EZ8A 1GGBL 5LWYL 4C83A 1KN2L 3V79C 4R0LB 4X7DC 5DO2C 4TVPH 4KMTH 2P1YA 1S9YB 1RUQH 3OX8A 1J05A 1INDL 4Z78A 1TCRA 4AY0A 5CSBA 5F7FA 5C92A 5GGSA 5DTFB 4QHNB 3GSWA 2X10A 4X6DA 3IVKB 4NQXB 4FQIH 2NY6C 3E3QE 4YIQB 5HHMB 3NPSB 1TDQA 2Q8BH 4HIHA 4U6VH 1BX2B 1ZANH 3MOBL 4OZFB 4G3YH 4YHMH 4KGLA 4JEGB 2CLZA 4JM4H 4TNWK 1WZ1L 4FXGB 3VFMB 4KY1L 4TSBL 5D7SL 4KRPB 3WXWL 4WW1A 1YYLL 3SKNA 3O6KL 1YMMB 1S9VA 3UTOA 1C5BH 3DMMD 3F7YB 1KJ2B 3MREA 1MCLA 1NDMB 1IGMH 5HGHB 3RWGA 3E1F1 2O5ZL 4XMPH 1QYGL 3WS6C 1VESA 1YQ2A 3QJFB 4WENB 3J7HA 3BPNB 4M7LT 4AENA 2DQGL 4M02A 3I9GL 5C0DA 3CCHB 5FECB 3QNXB 2GQHA 3QWRD 3RWJA 3X14A 3QFJE 4PJDF 4M1CD 2AGJH 1NMBL 5I0ZA 1LP9F 4JFHE 5H2BA 2P8PB 1Z9SA 3A0OA 3VFUA 1K4DB 3MV8A 3HPLA 3QNZA 4N0FA 4DGIL 5HD8C 1RFDH 2DB8A 1C5DB 3HUJA 1KIQA 5JW3H 3O2WL 2V2WB 1CF8H 1JL8A 1H3VA 3S98A 1N3NB 3HTLX 4IRZL 4R8WL 3VCLA 4PJ7B 3BRFA 1J7VR 4BK4A 4GKNA 2ZJSL 5DZOA 3VG9C 3VXOB 3F12A 5DEGA 5F7EL 2VLME 1NL0L 1YEJH 5TE6H 1NMCB 5SX4I 3REVA 5KSVA 4OJFH 4B50A 5IOPA 1S7VB 3MRMA 5L2KD 1HSBA 4HUWB 4QTIH 5EBGA 1U6AH 1QLFB 1HXYB 3QUXA 4PY8J 1KEGH 2F54A 1FDLH 1YECL 3H3PL 1MCIA 3AREB 3M45A 5MHSE 4OZ4B 5SWZE 1TETH 1XGQB 5CZXD 2JCCE 1FH5H 5EIIB 5KW9L 2GCYA 5IHZB 4P2QA 1FCGA 4K7PL 1ZAGA 2DN7A 1S7TB 3P73B 1BREA 3UPCA 5DD3H 1ACZA 4FFYL 3HC4H 3JV5A 3L6FA 1YNTA 2J88L 2H2SD 2F5BL 4Y1AA 5B8CA 2BERA 4ODBD 1MCHA 4XPBL 5DJZA 1UGNA 5IWLC 4WI2A 2VSDA 3QDJD 4LF3B 3ZE1F 4EI5B 4HIIB 4K3HA 3E6FB 3SDCB 3IJSA 2YKLL 2WLYA 3FO0L 1FNEA 3DURB 3K1DA 4JDTL 5GRYA 3ULVC 2Y07L 1EFXA 2VLJA 3WFBL 3VXSE 4OZIE 2CUIA 3L7EA 1RUKL 1QPXA 1WFNA 3MOBH 4E42A 1UH2A 1FN4A 1T22B 4PRNA 4Q2ZA 1CFQB 4MZ3A 1S5HA 3V4PL 4PJXA 4P46C 5SWSE 2VIRB 2XWBA 5D7SH 4GO6B 1UM5H 4DFHA 1EEYB 1YYLH 1EJ6A 4HUUA 4L8SB 3O6KH 4DW2L 4MJ5A 3ARBA 3BEWA 3BD4A 3OXRA 3S5LA 5KJRH 2DLIA 1FFOA 4KPHL 4UIKL 3CFCH 1INQA 1P1ZA 2BNRB 4N0CD 2DQHL 3VFSA 4XH2B 2D2OA 3KXFD 5INCB 2B1HH 2BP3A 4LPUA 1NGZB 1D3CA 4HDIA 4PYGA 3TA3A 2EYSB 2ADIB 1H0DB 4P4RB 3OPZL 5K9KA 5DHVB 3I9GH 4MGXA 4MQXC 5IR1A 4I9WD 4EIGB 4PGEB 4XNUL 3WMSA 1ZGLB 4C56B 5JMOC 1NMBH 3IFOB 3SDXE 3RWFA 2I9TA 1RZ7H 2EO1A 2MQCA 2VR9A 3WNKA 2Z8RA 5I17B 5I1DB 4AM0B 5DMKA 1KEML 2YMXL 3FO2B 4HIJB 5DYOA 5FHBL 3O2WH 5HDBE 3W0WD 2R56L 4BFBD 1NUFA 3V95A 5C8JA 3EFFB 2XZQL 4IRZH 1C12A 3LHPL 4UQ2B 1WV7T 1QLRB 4WHYG 1DLHB 1FO0L 5F7EH 3SE9L 5C2BH 4PJIF 1F6AA 3G5ZB 4PJ9C 2VXSL 3E3QC 4PLKD 2Z35B 1NLDL 1C5CH 2GHWB 4J3WA 1Q9OB 3RJDA 3MNZB 3JV4A 2FLBT 1R3HA 4GKOA 3I2CH 4KV5F 1OAZL 4XNQB 5C0AB 4QXWA 4QTHB 4UU9B 5C0GB 2FIKB 4XCCL 1JPFA 3GSOA 2BRQA 4X6BB 4IOIB 5CJ8A 1FNGB 1C08B 2Y7QB 4KZDH 3QUYD 4LAQL 5JOFA 2HT3C 5KW9H 1T89C 2V17H 1R5WB 3OF6A 4K7PH 4YXLL 4ODXA 3LEXA 1OAXL 5T33L 4G7VL 3D2UD 2YEZA 5J13C 4JRYD 3IDMB 2J88H 1PY9A 1AH1A 3OAZH 3MLUL 1ZHBB 2DM3A 2XRAL 3NACL 4MS8D 4X98B 4XPBH 4OB5H 4ZUVA 2W9DH 1WZMA 5JQ6L 3AC0A 4JREC 5GS2D 1Q94B 1BJ1H 1IAKB 1VGEH 3QQNA 5I16B 1WZLA 3VXRA 2OJEA 4PRIA 3G6DH 3QR2A 4Z7VB 2IANE 2Y07H 3DI3B 1UB6A 2Y36H 4H20L 4XP9H 4XBPA 3H8NA 5BV7H 5KG9A 1KLUB 3LKNB 3SCMC 3IETA 1YPZB 2VR5A 2QL1A 1T4KA 4KAQL 1FRGH 5C0CD 1TTUA 3BSZH 3OZ9H 3V4PH 1EK3A 3LKPB 4LVNB 4A6YB 1A6ZB 2F5AL 1AGFB 5D7KE 5EU6A 3VGEA 1LEKB 1HHKA 3SKOB 3V5DA 2RQ8A 2JF1A 4DW2H 2F54D 5JOPE 3DXAB 3RTQD 1OGAB 3KLSA 3E0GA 5MI0C 1T83C 1IGJB 4KPHH 4UIKH 2VERN 1DBAL 5A3IC 1KPUB 3VD3A 3GSXA 4P2QD 5FUOL 2UZXB 4XAKD 2X42A 5T1KA 1DQML 3UTZA 1QFUH 2JJSC 4Y16A 3KNBA 4NN5C 4OF7A 4ZSOB 3TCLB 3IGAA 1JRHL 5DK0A 1WAAF 5IB1B 5F9JA 2IFFL 3EOBA 4M48H 4Y1AD 1GL4B 3S36L 1F11A 3SQBA 3BGFC 4RNRA 3T0AA 3BPCA 3TLRA 4GUPB 5IBTH 2ZP0T 5KVMC 3VJ6B 4NUJB 5IB3A 4LARL 1CDCA 2ZOLB 4NSKA 2FEEL 2ATPA 1XF5A 4Q9BA 4JR9L 2VDLL 5C09B 2YMXH 4DN3H 5JDJA 4L8CA 5FDWB 5DFVC 5E6YA 4NPYA 1ZS8B 3NCFB 3MRGB 1I3UA 1G7JB 1WBXA 4JFDE 1F3JA 3BGMA 4CAGA 3TZVB 4ZOAA 2EO9A 3GSNL 4LLDA 4NO5B 4F3FB 5KAQF 2XG4A 3U4BL 1IAMA 1S7QA 4XMKL 4X99B 2XICA 3HE6C 1Q9LA 3U4EB 3VFGL 1INEL 2HWZH 2F58H 3CNKA 2X4SA 4W6XB 4N1HB 3ARBD 2X4QB 2R4RH 3SGEH 3P40A 5H8DA 4N0UB 1DBMH 3FMGH 4ZMAT 5J6GA 3MRNA 4OCRH 4DUXA 2Y6SD 4WJ5A 3QI9C 3MXWH 1ED3B 4U0QB 2FIRT 4LLVA 4Y2DC 5D7IE 3DVFA 4JFPA 1WCBB 2AI0L 2GAZA 3CVHL 4MNQB 2WV3A 4YXLH 3TA3D 5A1AA 1HILA 4RQQB 2NY2B 5JIHA 4G7VH 1WLHA 2JIXA 3OKKA 1GGTA 5IVXA 1IE5A 4MWFA 4HIXL 1Q9KB 1NAKL 4RGMC 1QBML 2BJML 5DJYA 1QSFE 3BWAB 2FR4A 3QIBC 2EDXA 3GMPB 1UEMA 3V5HA 4E0RB 2PF6A 4ODWB 3T0BA 4IRJD 3CVHA 4HWZB 5J6HB 3PUCA 4GKSB 4PG9B 1IGIL 3DPBA 1A4KA 3DETC 5K9OA 2ZG3A 3TJHD 4HKJA 4QHMA 1II4E 2ZNXA 4M62H 4MA1C 4J6RH 4HMEA 4ZOBA 4ZAKA 5AZEH 3T2PA 3VXME 3SQOL 2ERJB 1WWBX 5I1KL 1GZQB 3QPXH 4LLWB 4H1LB 1TNMA 3LDBC 3QDMB 3GHBH 3QG7L 4NGHL 3X11B 4QRPA 4MCZA 2B4CC 1A6AB 1HHHB 3RL2A 3IU4L 4MJIA 4UILL 2AJUL 2DL9A 4S1DC 3GB7B 5IHLB 4L3AA 4NM4L 3ZTJH 4FMFA 1BD2A 3AY4A 3MLWL 4O2FB 2UWEB 3BISA 3OKDB 1EEZB 2KZ1B 5J1TC 1X5ZA 4LQFL 4JKMA 2ZNWA 1CI5A 5TE4L 4P2RE 4WFGD 2WM0A 4JFYA 3JVGC 4R2GD 4NN6B 1AXTH 4RFNB 2VL5A 4YWGH 1DBAH 4Q97A 3SE8L 1R5VA 3CSYB 5FUOH 4I4WB 4PLNC 5I2IB 1DQMH 2DM7A 3V9FA 1KTKE 5CD5D 2ZPKH 2Y5EA 2MCPH 4JB9L 2IFFH 3L9RB 4X0KB 3TPUA 1PG7L 1A7NL 4Y5YB 3SDYL 1PSKL 2ZCKH 2PW2A 4NO0B 4YDKH 3QCVH 1DANU 4U6HB 4X5LA 2PYEE 1OWRM 4QT5B 3BQUA 1VFOA 1KJVA 1J8HA 4LARH 5E2WL 4DJMA 4JR9H 3PXJA 3GIVA 4Y4KC 1DBBH 3VXRD 5I0DA 5DURB 3IXTB 1B4RA 5I1GH 1OPGH 3MZTA 4AEFA 3CH1B 3BUYA 5I73B 4L9DA 1NBZA 5DD6A 3PL6D 5E8PA 3RPIB 3PF2A 5BMFL 3KAAA 3ES6B 3HR5A 3LH2L 3D3VD 2COQA 2ESVA 3MJ7A 4WI4A 2ZG2A 4WO4C 5E24E 5ACLA 3R06A 2PR4H 3MV7B 3MR9A 4F7CA 4LRNL 1OW0C 3DJ9A 5KSAB 3U4BH 1N5AA 3WLBA 4NQSB 5F1IA 4R26L 5IQ7H 4Z7VF 5EZIL 3O3DA 1ZLUH 2VN4A 3VFGH 2YZ8A 1G7QB 2ICWI 3PQYB 4DKFH 1JIBA 4KVNH 2HJLA 4PJHE 4JPIB 5HI3D 4N90D 1OLZA 4YHKL 3BN3B 2EXWC 3P4MA 4X9HA 4QCIA 5KVEH 4H5SA 3TN0C 1FG2A 1JZ5A 5TDNB 5E56A 4OCYH 3QZWG 4QYOA 3LEYL 3QJHA 1OB1A 3CVHH 4W4OA 4OF5A 4F9LC 1UWXK 3VXNA 1FZOB 4FZ8L 1F97A 1HNFA 1XAUA 3ZDYF 2VTFA 2R1WB 4HBCL 3MRJA 5JW4R 1DQLH 1SQ2N 4KJQC 1K9TA 4OZGB 5C0JA 4Q6IA 1J5OL 1QBMH 4EN3D 3CK0H 1LO2L 2XZCL 9CGTA 5D2LE 3S6CA 2GK0B 1LQSR 1LMKA 4OD1H 2UZIH 3MTRA 3TYGL 1IAOB 4X6FB 4HKXA 1YEHH 2JJUA 4WFHE 4MA3B 5JORB 3QULA 1DE4B 5E5UB 3RWCA 3HZYA 5CEXA 3SQOH 3WFZA 5ESVB 3PHQA 4IHOA 5I1KH 2PW1B 3SJVA 4DZ8A 1E4JA 4NGHH 4NRZA 2P5WB 1CFSA 3MSPA 5IUSA 1U8QA 3IU4H 3QXAB 3TBYB 1IKFH 2D7PA 5BVPL 4YQXH 5K9JL 4UILH 1A7OL 1J11A 2Y5TA 3BN9C 4PJ8B 4TUOA 1HZHH 1KBGL 4RMUA 5FYKU 1MFEH 3BKCL 5F9OH 4GMSL 3U30C 1GC1C 1AHWB 5GQBA 5TE4H 3V5KA 5DVOA 3STBA 3D39D 5AG9A 3SE8H 5ISZA 4U31A 1L9NA 3VA6A 3JWDL 4ZTPL 1PFCA 2A77H 2QR0A 3BI9X 3WLWC 1I9IL 5C0RH 5AAWA 1G7LA 1FFQA 4L4TB 3MBEB 1KPVB 1BM3H 4JB9H 1VGKB 1DVFC 3QUZC 1PG7H 3SDYH 4OGAC 1QFPA 4JZJA 1U3YA 3LV3A 2E8ZA 4JO3H 4D9RE 1A3LH 4O2CA 4NQDA 4NCC1 1UZ8B 3HI6L 2PXYC 1KLFA 3S34L 2ATKA 4ZD3L 2ITDB 1F90L 5IJVB 2HMIC 1T1YA 25C8L 3C6LB 3AS3A 1EO7A 2EICA 4BELD 1J0ZA 3FAXA 4YGVB 5BW7C 2BMKB 4YHPB 1T03L 3OKYA 5EN2A 3F7RA 3RGVD 1PKQE 4NWTL 2BSTA 4O00A 5FGRA 3CSBA 2DMBA 4KDTC 3D5OF 5E4EC 4X9BA 5D2NA 5ESAA 4UOW0 2AV7A 2XFXB 5C07B 4DFIA 4MD4B 1CL7L 5EZIH 1TENA 1ZWIB 5IGXH 1BD2D 4DOHE 4K23L 2VC2L 1U3JA 1NPUA 4M61B 3BP7A 4M03A 2JLLA 3SBWA 3PABB 2NY1B 5DWUL 1RUAL 1W72A 5ICYB 1LD9A 3MA9H 4YHKH 4XNZB 1S8DB 3GSVA 4HJGA 3VXUE 1XGUA 4QRUA 4AIZA 4MXQD 3FO1A 3IDGA 5GGSY 1RIHL 2ADGB 3EUUA 4JHWL 5IB5B 2W07A 1ZHKB 3S4SG 4MB3A 3JWOH 2GSGA 5M94B 2FZ3A 3V7AG 1CDUA 4N9GA 4PD4K 2EH7H 1YY8A 1ETZB 3BQUD 2HFGL 1CWVA 1OTUC 1OY3B 4P9HH 4J7RA 1NGWB 2RFXB 4IOSD 1FG9C 4K8RH 4UOW1 4XWOC 2WP3T 3TYGH 4M43H 2Q7NA 1TQCB 3N9GL 3K8KA 4MD0B 4GW4B 2B5IB 4JQXC 5FUZL 4H88H 5F1OB 4XNMB 4KU1A 5A2LH 4UBDC 1PYWA 4N8VG 3HS0B 3ARDA 4C4KT 2F74B 5FGSA 5I1EH 1GGYA 1NSNH 2C4FT 1WQVT 1MJJA 4X6DE 4Y4FB 2IPKB 4R0LA 3EYVA 2AXJA 3OQ3B 5BVPH 3K8MA 1S3KL 4EUPG 1S9YA 4PRDB 5LBSL 3MROB 2YHGA 2NY6B 5ADPH 5DTFA 4QHNA 1F58H 4AK1A 3G5VA 3BKML 1TJIL 1X4YA 3OKLB 4NQXA 4KI5D 1H3GA 2NNAB 5EZJA 1BGXH 3BHBB 1BX2A 3ZKQD 3D48R 4OZFA 3R0NA 3GBMH 1YNLL 2XXCB 1GGCL 1X5IA 4ZTPH 1AIFA 3G04A 3N85H 3VFMA 5F9WC 1GVIA 4X7SL 5KS9B 4BA8A 1BAFL 1GHFL 1Y18A 2OM5A 5M95B 5IW6B 1OGTB 3DMMC 5D93C 3F7YA 1ACYH 1BQSA 5HGHA 2DLGA 3LEVL 2PUQT 5CKGA 5GZOD 4YE4L 1NGQH 3HI6H 1JGLL 1OSZB 4ZFGL 1A7RL 4NN7C 3I02A 5F1NB 3S34H 1P7KA 1XZ0A 2SEBA 3MV9B 4JKPL 5B39A 5HDOA 1U92B 4MD5B 3K8LA 4KJYB 1B0GB 3MLZH 2XKUA 1I75A 1A6UH 3QJFA 3FTGB 2NXZC 4LCYB 3FFCB 2VQ1A 2QSTA 4XBEH 5BZWB 1BQUA 3CCHA 1PGRB 3DUSB 3MV8E 3QNXA 4U4BA 4QXTB 1W72H 3HE7C 5DZLA 2CO7B 3HUJE 4R90L 4H0IA 4WGVB 4K3GA 5HHOB 3L3HA 4LSPH 2YPKB 2Q8AH 5JR1L 2P8PA 3C5SB 1N5YH 4JRXA 3QQ9C 1BLNA 4KJWD 1O7SA 2RR3A 1ORSA 5DD0L 4AT6B 3GSUB 2APWA 5J3HD 1IT9H 4WWKB 1C5DA 2CR6A 15C8L 2VC2H 4X5XB 1LHZA 5DJAB 5CP7A 5L8JB 3U7AA 3V0AC 1QBLL 4PJ7A 3T1FB 2R8SH 5CGTA 3X13A 5CJBA 3HR6A 5A2FA 1CFVL 4K7PY 1G7IB 1SEBB 2DLFH 3CX2A 4JO2H 5B21A 4GAJH 3T4YA 1S7VA 5DUPH 3VRIA 3LKQB 4HUWA 4MQTB 4NFBA 5KVDL 2ORBL 1F2QA 3VD4A 1DFBH 1FL6B 1QLFA 3WDIA 1HXYA 5FUCE 2RGSA 4HT1H 3FQXB 2FLRT 5LGKA 4LSRL 3WBDA 1HWGB 1KIUA 4LCUA 3AREA 5IVZA 4HMCA 4NQDD 1CE6B 2ICES 4QXUL 1P7QD 1CDGA 2HH0H 3UTTA 1UWXH 5CINL 1CD1B 3N9GH 1S7TA 3E6HB 3P73A 5GISL 1EDQA 3E8UH 4XX1G 4DEPB 4F37F 3QDGE 4C59B 3VD5A 1AKJD 2FGWL 4K7FA 3LVEA 1LK2B 5ANMB 5CJ5A 1DN2A 5EU4B 3DSFH 4R3SB 2OL3B 5LQBL 4OZFH 2MSPA 2VLJE 4MB4A 1Z3GL 2OI9C 2X4OA 3RU8H 1QFWL 2O26U 4LF3A 1U3ZA 1UCTA 3C8KB 5D1ZD 3SDCA 1KFAH 3FB6B 3Q1SL 2ITCA 1EA9C 5TH2B 5DFTA 3FHAA 3MA7B 4HCRL 3V52L 1S9WB 2CJUL 3B2VL 2DYPD 2J8OA 5HHVL 3EO1A 4WGWB 4F58L 3KLAA 2CKNA 2ZUSA 2CMRH 4JANB 3NAAL 1D9KB 2ILLA 1P4IL 1TPXB 3C08L 3DX7A 4MZ2A 4RGOH 1EMTL 3BYYA 3O2DL 1U3HD 4YO0B 1CFQA 2F9BT 5D96B 2BSSA 3W11D 3B9KD 3KR3H 4P2RD 4JM2F 4TYUA 4LU5L 1SY6L 4FQ1L 2UUDH 1KB9K 1DL7H 2J8UB 1X5HA 3S96B 1CICB 5D8JH 5JXED 4L8SA 1GHFH 1WGOA 1X4XA 3ZZ1A 3UZEA 1WITA 1HHIA 3ZE2E 4B5EA 3QDHA 4JN1H 3OB8A 2A6KB 3MLPA 4BZ2H 4ZFGH 4LRIC 4DUVA 4XAWH 4U1IB 3PWLA 5INCA 1J1OH 4JKPH 2PKDA 1CFTB 1NGZA 2EYSA 1FLTX 2PO6B 1H0DA 1NC4A 4P4RA 4Y8DC 5F1KC 4HJ0C 1W0WA 1A9BB 5DHVA 3SPVB 2KUTA 2EDNA 3S7GA 5D9SB 3ARDD 4MLIA 4PGEA 1BZ9B 3TNMB 1QRND 4DGVH 5CILL 4G9FB 4HGWB 4WW2A 5KOMC 1ZGLA 2EDLA 3IFOA 2H26A 5JR1H 3FT4B 1SM3L 4JFFA 1JHTA 5I1DA 4Z76B 3QIWB 2IFGA 5DC0A 3FO2A 4HIJA 4ONGL 4JFZL 1G9MH 4XWGL 4IRSB 3FOMB 4OAWA 1T66D 3EFFA 4PS4L 4OIIH 4JFOA 4F9PA 2JB5L 3U46B 5HGDB 3MCLL 4PRBB 5F6IB 5EUOF 1U95B 3HLAB 5C71A 1QLRA 1DLHA 1HNGA 3QEQE 4NQEB 5EC1B 1ZHLA 3N1PC 1IQDB 1KTLA 1HKFA 3DRTA 4PJGB 3QB7C 4PG2A 3BP4A 4TUJB 3OWEA 4LSSL 5KVDH 2OK0H 2AEIT 2UYLB 3B9DA 4ZYKB 3CFDB 4HIEB 4CU6A 2GITB 4XNQA 5KSUA 1REIA 4UU9A 4QTHA 5C0GA 2FIKA 4X6BA 1FNGA 1RZGB 1C08A 3GO1L 1RJZB 3T2NL 2XWTB 1R5WA 5CINH 4P23B 3WHXB 4ZOEA 4QHLB 1V3MA 2BVPB 3QO0B 1TTGA 5D5ME 1BJ1J 4HFWA 2AQ2A 4I18A 3L5XH 3EDKA 4NFCA 4WRLA 4X98A 3IFPB 4R9HA 5JLZB 4N0YL 1AE6L 4OKVB 4RX4A 4ZUSB 3HAEB 3F8UB 3T04D 5K33A 3MUY1 4JRXD 3VDBA 2YPLB 1MCNA 1IAKA 1QFWH 3SGJA 2YA2A 3ZHKA 1WSST 3MYJB 1XF1A 4KUCD 3KLDA 1CU4L 1ERNA 4NRXB 3LMJL 2HVKB 3V52H 5MEOB 2Y9RT 4DQOH 1Q1JL 4I77L 4LPYA 2EZ0D 1CD8A 4F58H 3G6JF 4GQ9H 4P2OA 3LKNA 1EAPA 3MFFB 3BKYH 1YPZA 1UKTA 5FKAA 2OMBA 5FAAA 2IEPA 1VADA 1GAFH 4Z95L 4Q9RL 1K5NB 1MFCL 2CKBB 3LKPA 3RP1A 1AGFA 1QRKA 4XRCB 3OGOE 4YH6A 3QUXC 2A1WH 5DC4B 5DHVH 1LEKA 1IL1B 3SKOA 2VXVL 4K94C 4WEBL 2HFFB 4Z0XB 3WIHA 2FBOJ 5HYJA 4UDTA 3BJLA 5HVGB 5DRXB 2CIKB 2D03L 4LHUG 3LSOB 1IGJA 3O4OB 5CD3A 3ILPB 1UZ6E 4LSTH 5FUCC 3UTTD 4FQLL 1MI5A 1MCCA 1ZA3A 5BO1H 1IGFH 3ILQD 5I1LA 2MJWA 4MB5A 4ZSOA 1GZPA 1U42A 3HG1D 2X70A 3B9AA 3K3QA 3L3KB 4L1HA 2BVTA 3MRFB 3BGFB 2NX5A 3DECA 2AERT 5ALBL 3SGEI 3RZCD 4S10A 4YK4B 4GUPA 4OKDA 1MWAB 1OCWL 5C9JB 3VJ6A 5LVEA 4NUJA 1FORL 2ZOLA 1FPTL 4JHAL 2XV6B 5HJ3B 1CBVL 3LD8B 3B9VA 5C09A 1XCTA 4H8WL 2YC1A 3O8XD 3VWJD 1ZS8A 2QADB 4PS4H 3MRGA 3ZMRA 1G7JA 2JB5H 2FH8A 2WP3O 1H8SA 3V0VA 4KTEH 1ZV5A 4PTUB 2FO4B 4O9HH 2IBZY 1QLEH 2VZ3A 3ULVF 4NO5A 4F3FA 2X9YA 1TXKA 4R4ND 4Y4HD 3P9MB 5F44A 3O6MH 4X99A 1ZGLP 4NZJA 4U2YA 3U4EA 4IS6A 2N7BA 4V1DB 2FBJL 3LPGA 5DMIL 1MFBL 1S5IH 4N0UA 1Q8MA 5BV7C 2E9IA 4HWUA 4Y2OA 1CXIA 3QI9B 1L0XA 2D0FA 3O11A 2D7OA 1U8JB 3H9SB 1I1YB 3ROLB 4M93B 1IM3A 3WXVL 2XN9D 1ED3A 4XHJC 5IVXE 3PWUB 3GO1H 5BOZG 2CIIA 2P5EB 3V7AE 1NFDF 4MNQA 2IC2A 2J8UF 3Q5OA 3F5WB 2NY4C 5FA3B 4I2XB 5AZ2H 4Z7UB 4PV9B 4RQQA 4TPRL 1Q9KA 1PEWA 2J6EA 5LJYH 1UXSA 4LOUC 4OCSL 2Q20A 4ELMF 5FK9A 4CU7A 5I19L 4NQCD 1A9EB 3BWAA 4RBPH 4WTZG 2EDQA 3PDDA 4JFFD 3GMPA 4KGJA 5AUMA 4E0RA 4ETYA 3KPRD 4HWZA 5FYJU 5ECJE 4GKSA 5J12C 3TF7C 3RKDD 1JYNA 4HULB 3A6OA 12E8L 4QRPE 5I18H 5IEHB 5L8KB 3VFWB 4KK5D 2VLKB 3LDBB 4MJIE 4EXKA 3WIHH 3D0LB 2QHRL 3EYFB 4I77H 1JRHI 3BH9A 1RMFH 4OV5A 5FV1L 4D9QE 1NGPL 4FNLL 3QDMA 1IEAB 3P11L 1JZ6A 4CRPA 4WU7B 3D87B 1ROWA 1A6AA 2RB8A 3HKFA 3TIEA 1IC5L 4RA0C 2IAMB 3R1GH 4Z95H 1CGVA 1MNUH 1NQBA 3AS0A 5D4QA 5IBLC 1TFHA 2FEEI 2XTJE 3BAEL 3GB7A 2R0ZL 3B3IB 3I85A 4NQUA 5ETUA 2VDPH 3BIKB 4RGNB 2VXVH 3GHEL 3LIZH 4WEBH 3V8CA 3OKDA 1EEZA 3SKJL 4XCYA 5E6IB 1CE1H 2ICCA 3PWVA 4YDLB 5ERWB 1T5XB 3G9VA 4Z7QE 3O4LD 1A1MB 3V4UL 3CUPB 3CSYA 4O4YL 4UT6L 3RNQA 2X4UA 4I4WA 4W4NA 1ZLVK 1RPQA 2EC8A 3QAZC 1A14L 3LRHA 4POZC 5JIKA 1J8HE 4YHOL 4Y5YA 4GOSA 2OMNA 4NO0A 3MUZ1 4WUUB 1Z6JT 5ALBH 4U6HA 4X80H 4RX4D 2CDEB 2WQ8A 4Y4KB 2YD9A 4XP5H 2GEEA 4U1LB 1SYVB 4YHNB 3TJEL 4F7MB 1FZJB 4OCXL 2ESVE 4WFFD 5LAXB 2H2PD 1QO3A 3IXTA 5J0BA 2OXHA 5HHQA 2YSSA 5FYLL 4WV1B 4P5MA 3RPIA 3ES6A 1MCOH 3ZKND 1ZLSH 4Z7WA 5JA8B 4PREB 4FQCH 5IQ9B 1DZBA 4L4VB 5EBLA 1QFOA 2NR6C 2WBJA 3K4AA 3MPCA 3LN9A 2YD2A 4FFWD 4J4PA 4NQSA 1U8NA 1LE5B 3TYFB 1VACB 4GG6B 3IAGC 2F53B 1AJ7L 2FBJH 5DMIH 3S35H 3MJ6A 3PQYA 1MFBH 3QEUB 4GSDL 4JAMB 5HYJD 4ZO9A 4JPIA 4UZGA 2J6EH 2AEPL 1H5BB 1KIPB 4E41B 2EDFA 5C6PB 1JPTL 4LCWB 4OLYL 1CZ8L 5TDNA 5IHUL 3X3GH 4P5TB 2R1XB 4LMQI 1F3DH 4GG8B 3INUL 4Y16C 3C60B 3UBXI 1Q72L 2C1OB 4U1JB 5E7BA 2Y72A 4D94A 5B38B 5DR5L 1YJDC 4YXHH 3WJLA 2W0PA 1DR9A 1KCSL 1MIML 4NJ9L 1JMXA 1R0AL 2WLZA 1FQ9C 4OZGA 4XXDA 3QIUD 4K3DH 1MAKA 3RI5F 2ENYA 3QDGD 3RWHB 5HVFB 4XX1E 2GK0A 1EHLH 3MRPB 4O2EB 2EDHA 3CX5K 2B1AL 4YDIH 3EYQD 4X4ZA 1IAOA 3SJVE 5ICXB 4MA3A 1K85A 3KJ4C 1H9VA 1DE4A 5CIPA 3MJ9L 2E7HA 1VEOA 3WD5H 3S37L 2HJFB 1S7UB 3IFNL 3SE4A 3KPSA 5HGAB 3BPOC 2AEWA 2YN3A 4ZXBA 4FNLH 4RMTA 5EPMA 3BO8B 2D7NA 2H6PB 3ARFB 3JV6A 4HLJA 5I1JL 4ZUTB 5HY9B 1IC5H 2XQBH 4OF6A 4RDQF 1I1FB 4QLRA 3TP4A 4P9ML 4OUOA 5ISZE 3CGTA 4QKXB 3MJ9A 5IFAL 5I9QB 4M1GL 3JXAA 4OZIF 3A6BH 3QXDB 1XEDA 2FEDD 4FQXB 1AHWA 5HXMA 3ZDZE 4KQ4H 4KK9D 1QD0A 2FX9H 3C9NB 3P4NB 3PNWB 4O4YH 1FFNB 1QQDB 5C0IB 1X5JA 2BVYA 1OT1A 1JNLH 4HKZA 3ETBF 5MENA 4QHKI 1YY9D 1DVFB 1XGPB 4NNPH 1IC7H 2BFVH 3QUML 5FOJA 1T2QH 4L4TA 5LGJB 1E6OL 2M8XA 2ZCHL 2IH1B 2F19L 4PRHD 4JO4L 3P4LA 4ZFOB 2B8OT 3I6GB 3OR6B 4P3CH 3UXFA 5GPRA 4ORGB 5C6TL 2WWMD 5I1CH 1QKZL 2AJVH 2FATL 2XPGA 4Z7UF 4HEPG 4QOKA 1CLYL 5HPMA 1T20B 3W9EB 5IJVA 2HYMA 5BOPA 3QEHB 4FQPA 1MFAL 4HF5L 2O5XL 4ZAKC 5AWNL 1VHPA 3MODL 1HI6A 4Y19A 2BMKA 3WUWG 1RZKL 3DX6A 1NCBL 4CDHA 3TVMB 1HOCA 1JYVA 3SDXF 1J1XL 5EU5A 1YN7B 5E9DD 1Q0XH 4RMSA 3CDCA 2W60A 1ZWIA 1FVEA 3AY4C 1AJ7H 4APQB 1MH5A 4G6AD 5HDBF 4LEOB 1F42A 2E9JA 4GSDH 5F9DC 1NKRA 5D72L 4PFEA 4TUKL 3V2AR 4K3EL 3PABA 4U05A 3FT3B 2AEPH 2XTJC 4Y0GA 5KSBA 1Z5LB 1S8DA 3Q5YA 4OZHB 5C0FB 4ESKA 1MCPH 1A6WL 4M7ZB 1DEEB 2ADGA 3I6KB 3OHXB 1Q72H 5CIPH 1ZHKA 5GGUB 2MQ3A 3RHWK 5DR5H 1KCSH 1U91B 1WCQA 4NJ9H 1R0AH 4ZPTB 3THML 1FNHA 1UWEH 1FP5A 5D7JD 3TT3L 5DUML 5DI8A 1NGWA 2RFXA 3BUTA 4XPGL 1CGWA 5DEZA 4AG4L 2AK4D 2D7TH 2M26A 2PYEB 2GI7A 1AGBA 3ULSB 4Z6AT 2A9MH 4MD0A 4NRYB 1MOEA 2QQQA 3MJ9H 2UZYB 1VPOH 2AJ3B 3ZSTA 4XNMA 3TV3L 4K7PX 1I8IB 3MRLB 3K0WA 4H1LG 4XP1L 3HS0A 5TF1H 1MJUH 5GJSL 3QRGH 2WBJD 2F74A 1A7BA 2EDRA 3OJ2C 1AY1H 4HK3J 2YWZA 4K07A 5D70L 3WKML 4PP1C 4Y4FA 2IPKA 4G8GD 1MRDL 5HHME 5IMKA 1JJUA 1NCWH 5FYLD 3HZMB 4PRDA 5E00B 3BD3A 4IBLT 4QRSB 2HLFC 4M1GH 1NGYB 3T0ED 5AYUH 1VFAA 1FBIL 2NNAA 1FLRL 4FXLA 3EKCA 5C3LD 4KKBC 1YMME 5F9WB 2P45B 5K9QG 5L0QC 5HYSB 1MFDL 1A6TA 1A1OA 2ZOKA 4HSQA 5KS9A 3DV4B 3DMMB 1E6OH 1CL7I 1LVEA 4Q6IC 2F19H 5GRJL 5IW6A 1OGTA 3GMLA 2AJXH 1G7MB 4WHTB 3UTSD 3L95A 2ADJB 1I9JL 2CUHA 4MXWH 3VI4E 1J8KA 4NNXB 4D2NA 3LQAL 1QKZH 3ALPA 3GM8A 2W0FB 3U9UA 3QWQB 3EO0B 5EULV 2H45A 2MOVA 3LN4B 1ZLVH 3MV9A 3NH7L 4ONHB 5ENWA 1U92A 2CRIA 2WUCH 4G8EA 1B0GA 4MD5A 1FSKC 3O9WC 3FTGA 2NCMA 3JWOC 3FFCA 1MFAH 1HQRB 2OJZL 1DTUA 2O5XH 5BZWA 5I8EB 2BY2A 4AH2A 4QXTA 1NCBH 3TT1H 5I76B 1BQHA 4X7EC 2PTVA 4P9HC 5FGCB 1A0QL 1RVFL 4K8RC 4AEEA 5HHOA 5DJ6B 2YPKA 1NBYB 3C5SA 3ZO0A 1CK0L 4PJ7E 1CFBA 1P5UA 1BFVL 4AT6A 4HKBB 3GSUA 1BHGA 3HC0B 2EDDA 4WWKA 4P3WA 2DWEA 3LS4H 3SDAD 4BZ1H 3B2UD 1CFNA 2DM2A 4X5XA 4N9OB 1QEWA 2WAHA 4CVZB 4LEXH 1UB5A 1ZT4B 4I1NB 4UV4L 3T1FA 3ZKSD 5H35B 1DANT 2ED8A 3DBXB 4XB7A 1G7IA 1SEBA 4U1SB 1E6JH 5L2KB 3BT2L 3TBSB 5MEND 5CSZB 2Q7YA 1S7WB 4HH9A 1KNOA 4ZFZB 5GJTL 3MRBB 3FQXA 3JTSB 4FHBD 2YUZA 4OTXH 3OJVC 4JZJC 5EUKB 3TT3H 2X4PB 5DLMH 1FNFA 4LKCA 1FYHB 5D7IF 4KUZL 3VH8A 3HPJB 3EYSH 5FFLA 4J8RB 4XNXL 2J3SA 1CD1A 4WVRA 4TTDC 3C5JB 3E6HA 1GIGL 2GJ6D 4PGDB 3I3DA 2VZVA 2A0LC 3SO3C 3TV3H 4CGTA 4Y19D 1DQDL 2NLJB 1CDHA 3VFTB 1ZE3C 2FD6H 1NUGA 5ANMA 2DLEA 4DCQA 5EU4A 4R3SA 3NMEA 3QDJB 4YZFE 2G9HB 3X3FL 5D2NC 4X4YB 1HINL 3ZKXB 4FXKB 5D1QD 4NP4H 3WKMH 1T7XA 4WEUD 3EAKA 3EJZC 5IFJA 3VRJA 3CLFL 1DSFL 3QCTH 4KHXL 5JHDA 5DK2A 1J0JA 3RVVC 1S9WA 4JPKL 3C09C 4KK8D 3D69A 2Z8VC 4GQPH 1D9KA 4JANA 2V5RA 3ZT7A 4FTVD 4GJTB 1JK8B 1FLRH 2IQAB 3GMMA 4KDWA 5JO5B 4YHLL 3Q2CA 4ZUWA 1U8MB 2Y06L 1MFDH 1MREH 4O02L 4YNYA 2BNRE 5D71L 3QH3B 3I75A 2FX8L 4JO1L 4XVJL 5DRWA 3O6FA 1UA6H 5GRJH 4OZHF 1RULH 4RAUB 2EDBA 3NPZB 4PJBA 1FIGH 4RMVA 1Z9OA 1UJTA 2L0DA 1V3JA 5EIQA 3KXFB 3NABH 2DQJH 1BVKB 2NXYD 2A38A 5GS0H 1DBKL 3C5ZA 1H3UA 4M5ZL 1HQ4A 2Q3AA 1MLCB 2NW3B 1CFTA 4PGCB 1YYMH 1M6OA 2ZUWA 2PO6A 5FA4B 3QYCA 2OJZH 4C83B 2ADFH 3SPVA 5D6CB 1TNNA 5D9SA 4HXAH 1KCLA 1KPRB 4GAYA 1WIPA 4I13B 1BZ9A 3TNMA 2Q87A 4G9FA 4HGWA 4XBGA 1A0QH 4JDVB 3OX8B 5C7XH 4R0LC 4R4FH 4Z78B 5DVKA 1F45A 1MRCH 3FT4A 4Z76A 5GGSB 3QIWA 1BFVH 3W0WB 1QUNA 4KKNA 4IRSA 4F15C 4GBXD 4HIHB 1I7RB 5EO0B 3NPSC 2M1KA 5JDSB 2ZSWB 3GSQB 5HDLA 5HGDA 4LGSB 5EA0L 3HLAA 4ZOCA 1EIBA 3QFDB 1UVQB 3MUGA 4X9FA 1RK0A 4NQEA 5EC1A 4BH7A 4Q74A 3BT2H 3IT8D 1C7SA 4WW1B 1IQDA 3MRIA 4GRLA 4JPWH 4YXKL 4PJGA 4KRPC 5C0AE 1QFWI 5DD1H 3P9LB 3RY4A 2EXYC 3RVUC 2UYLA 1BIHA 1QSEA 3CFDA 4PJHF 1CR9L 1JUFB 1OD7A 3ABZA 3BH8B 2GITA 5E03A 3QUYB 2Z4QA 3H3BC 2BVEA 4PD4J 1KELL 1RZGA 4AEIL 1IFHL 1RJZA 4HJJL 1K4CB 4KUZH 5E2VL 4AENB 1RY7B 4R6UA 4XNXH 4MJ6B 4P23A 1V3KA 4NZUL 4XVTL 4JRYB 3WHXA 5C0DB 1W0VA 4YBQC 3BPNC 2BVPA 3QO0A 3N1FC 4PBXA 3X14B 4Z9KB 1R3KB 5J1SC 1X7QA 2BOCA 2XY1A 4KKAC 3C8DA 4EOWL 5GS1B 4J3OC 2YXMA 3IFPA 5FYJH 5JXAL 4KMQA 4Z7VE 3HAEA 4N0FB 5D2LF 4IMLB 3G6AA 3IDJA 3HUJB 1KIQB 2YPLA 2EKJA 4G5ZL 3MYJA 1FGNL 4KI1A 1A8JH 1DSFH 1YPZE 4KHXH 1MF2H 3OKOB 4RMQA 3LKSA 4GKNB 3RPKA 1YQVH 5DEGB 5MEOA 3HZVB 1OTTD 1WEJL 4OSUH 4PJEA 2VL4A 3L3GA 3Q5TA 4ONFH 2AJYH 4NQVB 5KSVB 5IOPB 3MFFA 2VN7A 1HSBB 5TDPA 3HNVL 1NMCC 2HAZA 3B83A 3MOAH 3CFIC 1EAJA 3ZDYE 3DXAE 1OGAE 3JUYA 2CKBA 1CXHA 1TTFA 3Q6GH 4AMKH 1G9MC 4U6TA 5BZDB 2YPVH 2F54B 2FGZA 4XI5D 4EDWH 3UYOD 5SWQB 5D71H 3RTQB 1MI5E 4PTTB 5CS7A 5HYFA 5F8QC 5CKAA 2HFFA 5FYKE 4Z0XA 3DVGB 1R5IB 5DRXA 3AREC 1FAIL 2CIKA 1F8TL 1A7PL 2F15A 3LSOA 3NZ8A 4ZSOE 4A2LA 3P30H 4XC1H 5GHWL 3VDCA 4P2QB 4OLUH 2DBLL 5DRZB 2NX5E 3RVTC 5ITBL 4MX7B 1EO8L 4M5ZH 3UEZA 3L6FB 4RZCB 1YNTB 5FIEA 4Y1AB 5B8CB 3UPRA 2WINB 1SJVA 4TN9A 5CBAA 4BSWA 5F1SA 3CMOL 3MRFA 5SX4H 5L8LB 3RUGB 4JQIL 4NOFA 2FSEA 4DTGH 3TFKD 4CN1A 4U33A 5C09E 3U1SL 5DSCA 4M6ML 1MWAA 1PG7X 5C9JA 1KCRH 3IJSB 4NKMB 3MXVH 5DHXB 4TSAL 4EI5C 2GIYA 4EQ2A 3SDCC 1EFXB 1XIWD 2HT4D 4OLEA 1CLOL 4P49A 3L7EB 4O5LL 4E42B 1NAML 1FN4B 3W5MA 1N64H 4PRNB 1G9NL 1UYWH 1FYTD 2V7NA 5EA0H 1E4WL 4PJXB 1BBJB 4MA7L 4F2MB 4N0UE 4P4KA 3OB0H 3RVXC 2R29L 2QLVB 4R4NC 4HUUB 3KLHD 3P9MA 4KWUA 3ARBB 3OXRB 3S5LB 3I6LE 1LE9B 1KB5L 4V1DA 4I3RH 4TNVK 4L8SC 1N2RB 5ACZA 1FFOB 1NAMA 3OG4B 1CCZA 1P1ZB 4MNQE 3UJJH 5KZCD 1J0IA 1U8JA 2DJ4A 1I1YA 3H9SA 3VFSB 5CJQH 3LQZA 1Y6MR 1ZLWK 5F7KC 3HAEH 1HIMH 3FONA 4AEIH 3RVWD 4I0PD 3TA3B 4NDMB 2LU7A 3T1WA 5CGYC 4PY7B 4EXPX 5IR1B 4I2XA 2N56A 1KB5A 4PV9A 2EIBA 3ULUH 2VLRD 1CDJA 4J23A 1KCUL 1BEYH 3RWDA 1RURL 5KTEH 4KTYA 3RWFB 4E5XA 1FL3A 5DMKB 2WIIA 2BCKB 3O2VH 4IRJB 4XPFL 1CD9B 2CKBH 1M71A 3QDME 1KYOK 3A6CL 4CNIA 2XG5A 5IEHA 4UV7L 3VFWA 3EOTL 1ULVA 5KVFL 2VLKA 4F9PC 4KK6C 5FCSH 3ARGD 1HEZB 1F6AB 1IEBA 1U8HB 4X7TB 2VISA 1PX3A 2D7MA 1IEAA 2PNDA 3D25A 4HUNB 5CSGA 5BS0A 2UWEE 4GRLD 4XPAH 4X6DF 5IMMA 3BIBX 2IAMA 1S7XA 5GGQL 5ADOL 3JV4B 3PWPA 3L7FA 5JPNA 1QSED 3B3IA 2D3VA 1RIVL 3MBXL 1OM3H 4D9LH 2EECA 2A6IA 3WL9A 3GSOB 1FO0B 4OCWL 4Q0XL 1NJ9B 2CR3A 4R2GB 3OJDB 1KB9J 3GKWL 1FAIH 2Q76A 1F8TH 1FVDA 1NEZG 5E6IA 1U2HA 2YUXA 4LHUD 5GHWH 5F89B 1MWAH 1T5XA 3EGSB 1VFMA 4XVSH 3LEXB 1A1MA 2AABL 1UENA 3O3BB 3AXLB 4JVWA 4IOFD 3UCRA 4NKIH 2IJ0C 1A3RL 5I8KH 1EO8H 1EXUB 4KROD 3T0DA 4HZLB 4ALAL 2FX7L 4I18C 2H9GA 2VDOH 4JQIH 4FZEL 1T1WA 3ALWA 5D6DA 5E8EA 2CDEA 2OZ4L 4OF3A 1IC1A 1UWGH 4M6MH 4L3CB 1R3JB 5FGBA 3VXRB 3WFHA 4PRIB 1SYVA 2I25N 3R8QA 3SGJC 3JV0A 4YDJA 3RY6A 5LAXA 4ISVB 4XPTL 1AQKH 1UB6B 3MV7E 3T2OA 4XBPB 3D3VB 1CLOH 3ULUD 4WV1A 5EZOL 3IETB 2AVGA 1QFWM 1NAMH 4P2OC 4CUCA 5IQ9A 1FE8L 4EI6B 2ZUXA 4L4VA 1Z0MA 4MSWA 3BVNB 1QA9B 2MPAH 3HUJF 2DLTA 4JY4A 4MA7H 2AJSH 3PQYE 3VWKD 5EU6B 1BVLB 4FFWC 2JJTA 4LCCA 3V5DB 3TYFA 2L7UA 2M2DA 3TO4D 3WUZA 4LKXB 4GG6A 1I3GL 1PQZB 1KB5H 3NFPA 3CDYA 1I1AA 2ZUUA 3QEUA 1F3DJ 2V7HA 1WWWX 3Q3GB 3IXAA 2Z31A 1YUHB 3GSXB 5BXFA 2V5TA 4G6FB 1H5BA 1KIPA 4E41A 1EHNA 3UTZB 1JCKA 4LCWA 4UTBL 3GEWB 4Y16B 3KNBB 2HG5A 2NYYD 5HGBB 4P5TA 4OZGE 2R1XA 5DK0B 4NOBA 4UT7L 3EOBB 4U1JA 2C1OA 2D7QA 5DJDB 1F11B 3WDHA 4U1NB 3DX9B 2HT2D 5B38A 4EN3B 1MRFL 3FQTA 5IEKB 5IB3B 4N1EA 1RURH 2AEQH 4EZMA 3NFSL 3RWHA 5EU3B 4L8CB 2RCSL 3KPSE 4O2EA 4XPFH 1ITCA 3HHRB 5IESL 4HWEL 3CLEH 2E7MA 3C87A 1YMHB 5ICXA 3CAFA 1WBXB 4N8CL 3A6CH 3BGMB 2P5WE 4CVUA 2VDNL 5KVFH 4S0TD 5CJOL 1NCNA 4LLDB 1E4XL 5F7MC 4JG0L 4L4JA 5A16A 1S7QB 1UQSB 4ZQKA 3VG0H 3UC0L 5D1XD 4ZUTA 2X4SB 4X5WB 4X7FC 1S7RB 3CVIH 5D7LD 1EGJA 5ADOH 3CMGA 5E0QA 1YEGH 3WE6B 3GBNL 4W81A 5J6GB 1FFPB 1I7TB 3MRNB 2AK1H 2XTLA 4WJ5B 4YHZL 5CUSL 4PJXF 3GSNB 4LLVB 1OP5K 3D39B 1CD0A 2IH3B 4FQXA 4XNYL 3PGCB 2I27N 4IMKA 4L4TE 2C3VA 3C9NA 3P4NA 3QPQD 3PNWA 1HILB 3UO1H 4P99A 5C0IA 2JIXB 3LB6C 1A3RH 4OLVL 4MWFB 2NY2C 1XGPA 1GGIL 5DJYB 2WUBH 5LGJA 1JHLL 2V5MA 2IH1A 4LP5A 4LLQA 2FR4B 2X2YA 4HQQH 4QOKE 3T65B 4HS3B 3OR6A 3V5HB 5F8RC 4NBZB 3WNPA 4PYHA 3GKZA 4ORGA 2L7JA 2VDQL 3ZE2F 3CVHB 3OAYK 4C56D 2CD0A 1UADC 1ZT1A 3ET9F 3TBVB 2D4DA 1A4KB 3SHSA 4AYFA 5K9OB 4WFED 1T2XA 4HKJB 2E9BA 1RZJH 1SJXA 2O5YL 4RDQG 4UTAL 1EO5A 4GAFB 2C3WA 3CZJA 4ZDHA 2X4NA 1LEIA 1JGVH 5EZOH 3RGVB 5JW5B 1JFQL 2ERJC 4TNWF 3BRGC 5C07E 2IQ9H 4MCZB 3KPMB 3RL2B 5BS0D 2ZSVB 2I60H 3BYTA 2ICWA 4X6CB 4HPOH 1WT5A 3CDGB 3VD7A 3ZE0E 3BRDA 3PWPD 4LGPB 1BD2B 1IRAY 2IPUK 4HH8A 2DIAA 3TM6A 1ADQA 4APQA 1IGCL 4K9EH 4LEOA 4JFYB 3QQ4B 4A2MA 5F6HI 3U9PL 3UBXB 3OKNA 4NN6C 3N06B 5HI5D 1NCCL 1LK3L 3ARQA 5EU7E 4UTBH 5C0FA 5ESQA 5CJXA 2YK1H 2DL2A 3I3EA 3KPPB 4MVBC 3TPUB 1DEEA 4L1DA 4L3EA 2VJXA 3P2TA 3I6KA 3OHXA 4U0RB 2PW2B 2DQTH 3IKCA 4QXGH 4UNTA 5DEFB 1ZXQA 2AP2A 4Y5YC 4M6NH 2LQRA 3BQUB 4M7JL 3RWIB 4ZPTA 4ZUUB 4KZEL 4YDVA 4DAGL 1WUNT 3O81A 4C55A 3BUYB 4QY8A 1NBZB 5DD6B 1EGJH 3WIIL 3HR5B 5IROA 1JNNL 5I73C 1RHHB 3MJ7B 2YD3A 5B3JE 1MCBA 3KYKL 2X1XR 1GOGA 3ESUF 3MRLA 5BRZD 3TH4T 4PJAB 4F7CB 1CGYA 2WWKT 4CW1A 4K2UH 2WBJC 3L3JB 4TSCH 1Y0LA 3V7MA 3O3DB 5KSAC 2P49B 4HV8A 4J4PC 4FRWA 5DJCA 2BC4B 2VXQL 2HJLB 3IYLW 4G9DB 3HZMA 3GBNH 4JGMA 2R23A 3PGDB 1Z9LA 1LILA 3P4MB 5GGTL 4QCIB 2Z31D 1H3PH 1NGYA 2X6MA 4YHZH 4H5SB 4DVBA 2ZUQB 5L6YL 3BDBA 4QYOB 4XNYH 5DJ8B 5KS9E 4M3JA 1OB1B 4NZDA 2EYRB 4QGTA 3O41B 4Y5XB 3VXNB 1AO7A 2E6PA 1OTSC 4LLMB 1M4KA 2BRRH 2P47B 4GAGL 3H3KA 3VXTB 4LVOB 3DV4A 2QSCL 2QQLL 4TRPH 3WJLC 2QV2A 3UTPD 4BKLB 3MV9E 1JGUH 1SBBA 2J1KA 1G7MA 4WHTA 4AEHL 2ADJA 3IDYC 3FFCE 4OGYH 4NNXA 3EJYD 1UZ6F 1UKSA 3QULB 1N0XL 5B4MC 1UFUA 2MTPA 3EO0A 2ZCLH 3LN4A 3RWCB 3HZYB 5CEXB 4LIQL 4F33A 4IHOB 1ADQH 3AROA 2HRPL 1YEIH 5HHOE 4OD2A 1HQRA 3WNLA 1JGEB 3NVQA 2NY5H 1F6LL 4JFED 5HVHC 4ZXBC 5TFSL 2YRZA 2DQFA 1ND0A 2WK2A 5FF6B 3L5IA 4RWYL 3U0WL 5TQ0L 3QISA 5DJ6A 1NBYA 1NMAL 2PN5A 3HI5H 3DI2B 1M05A 2NY0C 4HKBA 4P57B 4MAUL 4PJ8C 3W2DL 4NIKB 1R3IH 3FB7B 3O3EB 1IM9D 4KHTL 4MDJA 4UT9H 4CVZA 2FHFA 5C3TA 5ISZB 2V2TB 1AHWC 2FO1A 4BFIB 2F8OA 3NCEB 5GGVL 5H35A 4OBRA 1BFOA 4U1SA 1G7LB 1CGSH 1YZZA 5KVGH 3TBSA 4ZS6C 3S88L 3UYRL 3EDFA 3NTCL 1S7WA 5DQDL 4ZFZA 5L88L 4KQ3H 4MQ7B 2Z93B 4JZJB 3MRBA 4PLJD 2VZSA 4O2CB 1QSZA 4NQDB 1U2CA 2KDGA 2VABB 5T5FL 4KZEH 2WNGA 1P7QB 5IT2L 4DAGH 4LL9A 2X4PA 5L7XL 5IVXF 4PBWD 3NIGE 1O5DT 4LBEB 4U7MA 2DF3A 5ANME 1T1YB 3WIIH 1Y6NR 4HBQA 5JIPA 4NZRL 1DEDA 3CX5J 5E2UL 5I30H 1PX4A 1IC4H 1AKJB 1UH4A 2AQ3A 1EVUA 3AB0B 3D0VA 1OWWA 2X1QA 2BSTB 4P2YA 1AI1H 1MELA 5FO9A 3UMTA 5D2NB 2FB4L 5C08A 3SGKA 4PP2B 4ZFFA 3V0WL 5JHDE 4PRPD 1TVDA 2YRPA 4X4YA 5ID0A 1MJ7L 5D1ZB 4HWBL 1HHJA 35C8L 3UJTH 1CQKA 1KJMA 2YZ1A 3BDYL 5H37H 1I8LA 4NO3B 2QEJA 3BP7B 5FYJE 4GXUM 4C57C 2DYPB 4U7KA 2Z91B 3UAJC 1LDPH 3SE3A 4JM2A 4HJGB 5KOVC 3O45B 1ES0B 5EOQH 5L6YH 4QRUB 4XNZC 3O6LL 2W92A 4AIZB 1U3HB 3IDGB 1FV1A 1I4FA 2IQAA 3B9KB 5JO5A 3SKUD 4L3ED 2R0LH 1U8MA 2BXYA 4GAGH 2FZ3B 2VXUL 3UROR 4WEMB 1ITBB 5EU7C 5HHPA 3UPAA 1IZKA 2DRUA 3OAZK 3QH3A 2BVOB 3ARWA 1B0WA 5DGRA 3ZKMC 1M7IB 4ZS7L 4RAUA 1F4YH 4GXVL 3KGRA 4AEHH 1MUJA 2HTKC 5I1IH 3KXFA 5FM4A 3GNML 1TQCC 3QWOA 4WUKL 5DURD 4U1GB 1B0RB 2B5IC 4FG6C 1PYWB 2NW3A 4G9FE 1PEZA 4EBQL 3ARDB 5FA4A 1QBBA 3MV11 3H7LA 3DIFB 3FAWA 2ZKHL 1QRNB 3FN0L 4ODUA 2X9WA 5D6CA 3NCJL 1Z9MA 1KPRA 1MJJB 3O0RL 3UX9B 1E4KA 1JPST 5TFSH 3EYVB 3OAYH 4K3JH 4BSVB 1KGCE 4JDVA 2UVFA 3FCTA 4Y4FC 5EUOA 3T3ME 1PLGL 1NMAH 1WC7B 1VKXA 2L4OA 2W9EL 5EDXA 1T3FB 4F15B 3H0TB 3G5VB 3W0WA 1P4BL 5T3ZL 2VDKH 3MLVH 2NY3C 4NQEE 4EQ3A 2P8MB 5EZJB