3OGCA

Kcsa e71a variant in presence of na+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism for selectivity-inactivation coupling in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2010-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ogcA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ogcA02
4PJHE 3DGGA 3RWEA 1F4XH 4UIKH 3V4UL 4P5TB 4Q9RH 1M05A 3IFPA 4HUWB 1QSVA 3AREC 2X42A 4X9BA 4ONFH 4M1CD 4PLJD 1NEZB 3BPCB 4HC1H 4X80H 4O2EB 4Y2DB 3B9AA 2P5WA 5K9JL 5KAQF 2C7UB 1MCPL 5I18L 3IYLW 4PRIB 4QRTA 3QIWC 4LASH 4RFNB 3MJ7B 2JJUA 2XZQL 1F3DJ 3LZFL 4PB0L 4YDIL 5F71A 3Q6FA 3LN5A 4GQ9L 5FUCC 1I9IH 5K59F 4G8IB 5F3BB 3FB6A 4HEPG 1ZGLM 2DKSA 5I2IB 1CU4L 2KQNA 5D7IA 2AK1H 5ENWB 5IW3A 3ZYIA 4YAQA 3MLUL 5TFSH 3MV9A 4IRZL 3TNMA 1C5DA 1Y6KR 1KEML 3CFEA 3L3JB 3STZA 4NKOB 3D3VA 3VXOB 3KHOA 3MRNA 1LK2A 4GRLA 3ARDD 3NCFB 3V4PH 3IXAB 4I8DA 4MA3B 1KLGA 3RWGA 1ZLVK 2BVQB 3MUGA 3OXRB 3ZHDA 3V6ZA 4WUKH 2F54A 2VZTA 3PP3H 4MJ4A 3RDTC 1A1NB 2VUYA 5MENE 1DQLH 1KPVB 1C5BH 5I66B 3S36X 1SJEA 3QWOA 5TQ2L 4AJ0A 3C8KA 3PP4L 1BZ9A 1NGPH 3WLWD 2YBRA 1S9XA 4KY1L 4LNRB 4NZJA 1JVKA 3F6LA 5J1AB 3IFNH 3SE4A 3U46A 3D39E 3QPXH 5TE7L 5DJZB 1HEZB 4U7KA 3VWJC 4PGBB 4I3SL 5I73B 2YK1H 3C09B 5HHOE 5DWUH 1XGQA 5C0AA 1UM4H 3P0YL 2NXZB 3T4YA 4G5ZL 1JFQL 3L5JA 1NCCH 1G7PA 3SDAC 3B8YA 1TQCC 5KVMC 3AY4A 5L2KD 2HJLB 1H3VA 4LCWD 1CICB 4OGYH 5BZDA 3ILPA 1NCUA 3KPSD 3PWUB 4JGMA 4Z0XA 3T4AA 3VXRA 3QDMB 1OTTC 5T33H 3HZMA 5E8OA 4OGAD 2VN4A 5F9JB 4U1NB 2IQ9L 1HYSC 4YHKH 4ZFOB 2QADC 4ZS6D 4ZUVB 5GSRB 4WHTA 4R7NA 1QEWB 3RVWC 3KNBA 5SWZB 2GT9A 1D7FA 3DSFH 3S5LG 5L7XL 4YC2C 1YY9C 5E5RB 1NBZB 5HSFA 5JPNA 2XFXA 1SQ2N 4HK3J 4Q9QH 3MV7B 2M2DA 3IDUA 5EO9A 1NEUA 3HI1B 3IDNA 5IOPA 1R5IA 5IMMA 1R5VA 2GSGA 4DTGL 2ARJB 3PWJA 3H42H 1F97A 4BYHA 1P84K 3LSOA 2RQ8A 1ADQA 1KBGL 3LY6A 1NUDA 1HH9A 5CBEB 5F3HB 5JZ7D 3WCYA 3OJMB 3TEUA 4B41A 4OLZH 5FFLA 1R24A 2DIAA 3BGMB 3IAPA 1FAIH 5D7JA 5FUCE 3HFMH 4GQPH 3CXDH 4OFIA 4JO2L 1KG0B 1LD9B 4KPHL 1JI2A 2DQHH 4ODBD 3SQBA 4NFCA 4JFOA 1FGNH 2F53B 1VKXA 2LFGA 1W0YT 3LKOA 1I8IA 2VAAB 2CKBH 5DZOA 4DW2H 3MOBL 5DK0B 3RPIB 4FQCL 3C6LB 5KVGL 4RA0C 3IDGA 3FO2A 1WIUA 2G9HB 2VTFA 5HHPB 3SJVB 1JF6A 1UH4A 4LQFL 5GRJH 1KN4L 3O4LE 4KXZI 4OLXH 1DDHB 4P2RB 1TVDA 4CW1B 4PR5B 1FNGA 3P4NA 1VADB 3OX8A 1QVOA 5CJ8A 3KLHC 4ZDHA 4OD2A 4XCFL 1T03L 1AQDB 4PRHE 4JRXA 3AU1A 2FIKB 3FOMA 3FQXB 4BA8A 2IQAA 4FFYL 3PQYE 5J9PA 3B9KB 1BX2B 4XCNA 4NCC2 1LDSA 1MQKL 4YHPA 4NGHH 2VO5A 1N26A 3WIFA 3WLBB 2BOCA 4GG6A 1DVFD 4HS6B 5ICYA 2LTQC 4EI5D 4ZXBA 4ELMF 4O2EA 4NUGH 1U8QA 2C7UA 5JOPD 3F58L 1TFHA 1PKQA 3T2NH 2DKUA 5MEND 2F5BH 4LPUA 5DYOA 1P9MA 3G04B 4ELMB 2FB4L 2XA8L 4G3YH 5MERB 5I9QC 3SKMA 4IMKA 1VESA 3WJLC 5DA4A 4U3HA 3AAZB 4YZFE 4XX1E 2VB5A 5CEXA 1XF3A 3MCKB 5TPWH 1PJ9A 4B5EA 5SV4A 3V8OA 3GHEH 3D39D 4YLQT 4OGXH 5EIVA 4JG1H 1IEBB 3CFJB 3EO0B 1FN4B 4G9DB 1VPOH 1ED3B 4H1LB 1VFBA 4UOJA 2VMFA 3TVMB 1V3LA 5JXEA 2CJUL 4PJDE 4CRPA 3CFBA 1IGTB 4RMWA 3V9FA 5J6HA 1P1ZB 1M7DB 1U41A 2BVQA 3SDDC 2MHAA 3S7GA 1JZ8A 2I5YL 5DRWB 1TJHL 3CGTA 3EHBC 1NANH 2ATKB 3I75B 2X70A 3QH3B 3SO5A 2HT3D 4FABH 5ICZB 5C0GB 3HC3L 2WWKO 1ERNA 4HJJL 4OGZA 5E99H 3S37H 3WE6A 4GFTB 2EE3A 32C2B 3HMXA 4H8WL 3MNVB 4HLZH 2V2TB 4X6CE 1NGWB 4QHKI 1WEJL 3ZTJG 3VFPA 1HINL 4MCYA 3ARED 2B2XL 2X4PB 5K9OB 4MDIB 2ID5A 4JM4L 3RHWK 4LU5H 12E8L 1T80A 4N1CA 5E6IB 4PJ5A 4XP5H 1U2CA 2EDLA 5DJ8A 1PQZB 6FABH 2NX5E 2Z4QB 3QIWD 4HS8H 3CVIH 3QI9B 1C12A 4KTEL 3ARFC 1S9VA 5M7QA 2EH8L 3FO0H 4CVWA 2OI9C 1M6OB 2DI8A 5E00B 5F7NC 3WEXA 3CK0H 5F9JA 5KJRH 1ZGLA 2GITB 2HG5B 1AHWC 1AE6H 3HC4L 3WMSA 4JFPB 2VL4A 2MQ0A 1N6QH 3QUMA 5IEHA 1LP9E 4HJ0C 5JW5A 1D5IL 4NJ9L 3MV7A 1N59A 1GL4B 3HNVL 2PTTB 3O6MH 1OM3H 5ETUB 4P57B 1C8PA 4XPGH 2ARJA 5SX5H 5JW4M 4X4ZA 5DI8A 3O4LD 5BS0B 1KV3A 4UB0H 1NJ9B 1S7QB 4DVRH 1EJOH 2VABB 2P48B 2DAVA 5CZVH 4LCCC 5F1SA 1W2KT 5TE6H 3IDIA 4P3WA 1A5FL 3RDTD 4YK4B 1F5WA 4PJGF 5I30L 4PRHD 1RZGA 3BGMA 3LRSB 4KQ4H 4NYLA 5I1LB 4GXUN 3Q6GH 3ZTNL 2IAMA 4TUKH 3K4DA 4Q0XH 3PQYD 4KI1A 3H0TB 5E9DB 5D7LD 5DMKA 1A6ZA 3QEUB 2A0LD 3ZKNC 1CN4A 1JZ3A 4DN3H 4WW2F 3L5XL 2AXHA 2FD6L 4KI5F 1CZ8L 1RULH 4MXWL 5I17B 3D0VA 1D5ZB 3GK8L 3LN4B 4XAKE 3VWJD 3VI4F 4WW2B 1CK0L 4Y88A 4G6JL 4QGTA 3ZYZA 3SKJL 3VJ6B 3SY0A 5I8CB 3QRGL 4P9MH 5KVFL 4RWHA 1AY1L 1NC4A 3SDAD 3WYRA 4PRAA 4XWGL 1GPOH 3REVB 4CW1A 4H8WC 4WHYG 1V7NL 4WV1C 5FGCB 1ODAA 4IDLA 2DLFH 1KCSH 1X4ZA 1OTTD 4I2XA 1AQDA 1CF8H 3FHQA 3O45A 4NN6B 5KW9L 2R56H 1A14H 4X5XB 4KJWC 3ZYOA 3FFCA 4I18B 1RHFA 4HC1A 3F5WB 1HYSD 2GUOB 3O2VL 5E8NB 2QADD 2ZCKL 4G8EA 4LGSB 5GGRA 4NBXB 4Z77A 2FCBA 3RVWD 5DK2A 2DTML 4LEXH 1IKNA 1BVKB 1KLUB 3KAAA 2R0LH 1MREL 2YN3A 4JM2F 4PJ7F 1YY9D 2GY5A 1TITA 4L9LC 1OAYL 3MLYL 2Q76B 1S8DB 4PJ7B 5IB4B 3T77B 4PJIF 1CR9L 5GS0C 4XVUC 1KCUL 1G9MC 5DEFA 1F13A 4TOYL 4PJIB 3SQOL 3RGHA 4OKVB 1C7SA 4LSTH 2OXGA 5GGSB 4L5FH 4ZO7A 5D6CB 5LXGH 3MCKA 4XVSH 1LO0H 2F58H 5I1HH 2FIRT 5C6WH 3TN0B 4L3CA 3OKDB 2YC1B 3VMNA 1KGCE 3HMWH 3D48R 1PG7H 1EO7A 4PPTA 4QRUA 3MV8E 4R97C 3DRTB 1U3HB 3KHQA 5IB2A 3E1F1 1SYSA 4UBDC 2CXGA 1S7SB 2EYTB 3F62A 2I27N 1P1ZA 1M7DA 2J8HA 4E41E 3DV4A 3ARBA 2I60H 2EDTA 3CMOH 1E4WL 2NX5D 3NCMA 4ZUUB 1CLZH 3MREA 4JHBA 3RGVB 3DUHA 2JTDA 4NSKA 1C16B 4R4FH 1KTLA 3VGGA 5H8DA 5IFJB 1PZ5A 5T3XH 4XPFH 4JKKA 4MB5A 4YDLC 3TV3L 3U36A 1KJ3H 3AMLA 3ZLQC 3WFEL 3KLHD 3SOBH 3QNYB 2G5BB 3B4NA 1BJ8A 5IB3B 4S1SH 2JCCF 4FXKA 1P84J 3U7YH 1FGVL 3I6GB 1BWWA 4G6AC 1KJVB 5I8KH 5JQ6L 2BNQA 1JRHL 3OAUL 4PJAF 2FX9H 3UTTE 1JGEA 3QJHA 3QUXC 3TIEA 2VDPL 2V7HB 1HI6A 4PJAB 4CKVX 1R3KA 5HYIA 4K7FB 3EW3B 5DQDL 2X4PA 3HAEH 4O2CA 4R2GB 4D8PA 3IKCB 4GKNB 4JFEA 4LPTA 5F44A 5E6IA 5DSCB 2DLEA 3FCTB 2AJZA 4M7LL 1MFCL 3WV0A 3QI9A 2D9CA 1BFOA 2R8SL 4M8VA 1QSFA 3GSOA 4UDTB 4M6MH 2GITA 1QLEL 2HG5A 3WNPA 5JQHC 3FHAA 5IP4A 1BZQK 4NO3A 4LSUH 3GMQB 2OL3L 3NA9H 5DFWH 1FLRH 4MZ2A 1GC1H 1A6PA 3DX6B 5C6TL 1DUZA 4NZRH 1I9JL 4P57A 4M00A 3KYMA 2XWBB 3JTTA 4TSBH 5F7LB 5C0CE 3ZHKA 4TVPE 4PREA 1YA5A 3CCHB 1C5CH 2VABA 3FTGA 3SDDD 3F8UB 3V0VA 1CLYH 4R26L 4TNVK 1OTUC 1U42A 2CKBA 5L6YL 2HT4C 3D1MC 3KPSB 3EHBD 1EEZB 3GJEA 4ONOA 5HI3C 3NH7H 2EDOA 4FZ8L 4R0LB 3H0TA 3MBEB 1YPZB 1BBDH 5EC2B 3ULVH 3ARGA 4G6KH 5IJKA 5EORL 2XN9A 1BM3H 3RUGF 5FHAH 2V5RA 3EO9H 1DANU 2B1AH 5E2WH 4F7EB 3I9GL 1F4YL 1TJIH 3RUGB 2RCSH 3B43A 1B90A 2R1XA 1LVEA 3ROOB 2RJMA 1FQ9C 1IE5A 4DGYL 1YYMH 1IAIH 5JO5B 1S7TB 4YR6A 2HRPH 4GW5A 4J6RH 4JQIL 3ARFD 4LPVA 3DX9B 1S9YB 1GAFH 1M7IA 4XMPL 3IETB 3GRWH 4BZ1H 1I3GH 2L4OA 5IB1B 1CVSC 3QHZH 2I9TB 1KGCD 4PJHF 5FA3B 3WUZA 3SDXE 2HH0L 1BVKA 2DM7A 3MV8D 2DIJA 2WLYA 5GS2D 4HJ0D 5F72S 4QCIB 4PJHB 2AI0L 3OAZK 1JHTB 4DFIA 1BFSA 4J3SA 4R4BA 3CD4A 4ZYKB 2PCPB 4E41D 1RZFH 3MFFB 3MZTA 3GB7B 1CQYA 4CU6A 3EYSL 2OK0H 4NQEA 1XGPA 4OZIE 2CSPA 5AD0A 1ZA3A 1MLCB 5JOFA 4NNPL 3C60B 5GGSA 2YD3A 5GXBB 1IGMH 5D6CA 4YJZL 1T3FB 4LSQL 3EOAB 3QXAA 5CMAB 4P4KC 4X6DB 1F90L 2X4RB 3ULSA 3IDMA 2F8XC 3M8OL 2CH8A 2ZUXA 3UTTD 3RNQA 5FYLL 3ZKND 1I7ZB 2XICA 5HYJA 1JPSH 1Y18B 1F4HA 3L7EA 2MSPA 2VLRE 1Q9WA 1HILA 2VIRB 1RJYB 4RRPG 1XGRA 1J0HA 3QJFB 2ZZUT 3OKOB 5F7WC 3X14B 1S7SA 2EYTA 2X4UA 3REWB 1A0QH 5DRXB 5F93C 4MNQA 4E5XA 3FN0L 5EC1A 4EI5B 2ZKHH 3STBA 3GSWA 4P3DB 3TT3L 1TZIB 3L3IB 4HULB 5HYSG 3L3DA 5EBGA 1RIVH 2VE6A 5C7XL 3HAEB 1BREA 4I1NB 4KJWD 1EFXA 5DJ0A 4YHZL 1E28A 4F7MB 2XY2A 2BOBB 5ID0A 3E2HC 3ARUA 4NKIL 4DKDC 5IFHL 1IAIM 1MFEH 1B2WL 3K80A 1C7TA 3D39B 4KROB 3GDBA 2DTSA 5KSUA 3PHOA 1UACL 3B9EA 3VMOA 5HHOB 5FO9A 2PYFB 4WU5B 4Y4FC 1U8KB 4QTHA 1PLGL 4QHUA 5GS0D 2R1WB 5K9QG 4XVUD 1HSBB 1NC2D 2OP4H 4F9PC 4R6UA 4UV7H 3G5VA 5ESAB 5DDHB 5FGSA 4LPWA 3TP4A 3KPOB 1HQ4B 5DJDA 1SM3H 1Q0YL 4UUJB 1UEMA 4K8RH 1S9WB 1MEXL 3ZT6A 3AROA 1YUHA 4XXDB 5D2NC 4M4RA 1J88A 4LRNH 3GIZL 3MROB 2EKJA 3F7YB 3OR6B 4PBXA 4ZOCA 1JHLH 5DD0H 2YA2A 5JHLH 4V2BA 1NPUA 3WSQL 4WDIB 5ALCL 4MQ7A 3IFLH 1B4JL 3VE0A 5CINL 4XWOC 1JNLH 3WNOA 3HE7C 5KTEH 1L9NA 2BK8A 4UBDD 4WIQA 2XI9A 2Z31A 3L6FA 1RU9H 4M61B 1MHCB 3VXSA 4UNTA 2EDRA 1ZMYA 4TYUA 3QG6B 1MWAB 5C9JB 3IJHA 1QKZH 5IEKB 3GJFK 3W9DB 5KSBA 3QIWB 1YN6B 5D1QA 1X4XA 5KG9A 1EEZA 1OGAE 4QEGA 1ZANL 2FX8H 4D0DB 4YDJB 4LBEA 4P2CG 3I3EA 4HBCH 3OZ9H 4G6AD 1NFDE 4Z7WE 1NMCB 3G5YB 4TULL 5HHXH 2EXWC 4HPYL 4LKXB 3QUXD 4PGDB 4OLYH 5ACLA 1V5JA 1OQXA 2OLDA 1MCWW 2G75A 3P4LA 2YPKA 2GJZA 4MX7B 3QA3A 4GMSH 1T7WA 4LRIA 1K8IB 4RQQA 1KJ2L 2PF6A 3F7VB 3O4LB 4EUPA 1B6UA 3DURB 4WFFE 5IQ7H 3I3BA 4C4KT 5MEQA 4PV8B 4R3SA 2E9WA 3DX9A 3MLZH 3RWFA 5CP3A 3O2WL 4F7PA 4PRHB 4CJ1A 5F7UA 4L8CA 4Z9KB 2I9TA 5DJYA 3PQYB 3OPZL 1DN0B 3AXLB 1INQA 1MFBL 4DAGH 5FA3A 3PDGA 3VFTB 3VXME 1EHLH 2VLRD 5B38A 4QCIA 2CXKA 5D70H 4PJCA 1JHTA 1F11B 1NMBL 3HUJE 4P9HL 1T1ZA 4K2UH 2YPVH 2R39A 3GMLA 1YEIH 1UGNA 4NO0B 5IW1B 1E4XL 1NAKL 4NRXA 1TQCB 3GNML 1MLCA 3D9AH 4YZFF 1OTUD 2A77L 3C60A 2B8OT 1I9RH 3QNZA 5DD1L 2HT4D 3GMPA 1ZT7B 4LARL 5FM5M 2Y25A 5CMAA 3LHPL 4HZAA 4Q2ZB 4AIOA 5HI3D 3UXFA 1TIUA 2ZP0T 5IV2A 1FCGA 4Y7MA 3QYCA 4TPRL 2QADB 4D9QE 4JPIB 4XCCL 4AT6B 1Y18A 1X5AA 3MFGB 1T5WB 5FYJE 2Q6WA 4Y5VB 4XCEB 4XP4L 1QHOA 4YC2B 1T22A 4PJDF 3NA4A 2MQ3A 3QJFA 2VXSL 5JLZB 2XV6B 2N7AA 4QTIH 3WHXB 2PW1A 4Y4KC 4H26A 1KIPA 4PJDB 1UA6H 4M03A 1SVCP 3DVNA 1BOGB 1VFUA 2HFEA 3JV6B 2HLFC 4OIIL 1JHKL 5FYLE 3UYOD 1TZIA 5DD5L 2AV1A 4KZDH 3KLAB 3CLEL 4MAYA 4FQ1H 4ZS7H 4X6CF 2KQMA 1A9BA 2NY0C 5EULV 3P0VH 5E08L 1BZ7B 1EGJL 4B50A 3U48A 2WV3A 3K46A 4HIIB 5B22A 1ZLWK 1X3DA 5IWLA 1DBML 3HG1B 2XOTA 1MCKA 1CI5A 1SJVA 3TBSA 4AIZB 2R23A 3OKLB 5FYKH 2R1WA 3L5IA 2FGWH 4ZOEA 2X9YA 1YN7B 2KUTA 5IVXE 5IMOB 4RWYH 2FZ3A 1RZJC 4WI2A 3KPOA 1YEHH 3GMOB 4JQXC 1HQ4A 2ICWJ 1VFAB 5GISH 1FE8L 4C57C 1S9WA 3L3HA 4GXVH 2J88L 4DCQB 1QPPA 2GK0B 3FQNA 4P9HC 1ORQB 1J1OH 1Q94B 5T1KA 2OSLB 4P4KD 1FG9C 3QT2A 5DHVB 5DTFA 4ALAL 2YUXA 1LP9F 4DZBB 3X12B 3MBXL 2LVCA 1P7KA 1A6UH 1UG9A 1QP1A 4WI4A 1XGYH 3BWUC 1T20B 3FB7B 1OLZA 1QBML 2VLKA 4QXTB 2HKHH 5L9DL 3MXVL 4OCXL 3WIHA 2WMPA 5TH2B 1MHCA 2PTVA 2N56A 4DUVA 2FATH 5ICXB 4WFFD 2LTQB 4EIGB 3KLSA 3QG6A 3KYOB 3VCLB 1JGUL 4WCYL 1QO3B 1G9NL 3K8MA 2C3GA 3SKNB 1ACYL 1E27B 3I50H 5E2JA 4NNYB 4PTUA 1GGIH 1YNLH 1FZMB 3KXFB 3IGAA 4YDVA 2ERJC 2Z8WC 4A6YL 1DLHB 2Q86B 1FNSH 3C2AH 3VXMD 5I76B 2DBLL 1NMAH 1QRNE 4L9DA 3BKMH 3UTSE 4HIHA 3S8WA 1LO4L 3G9VA 4LEOB 2FX7H 4JFXA 3GRWA 5I1CL 5CFHA 4U1SB 4Y4FD 1A7QL 4MX7A 3OB0K 1NBYA 1FPTL 5CHNB 4AZ8A 3QO0B 4XP9L 3DURA 2DQEL 1K8DB 4BSVB 4NQSA 1S3KL 3LQMA 4XAWH 3SDDB 3ARSA 5T3ZH 2A6KA 4P59L 3C2SA 4FTVB 5INDB 3OKKA 5JNYB 1ZHBA 3LD8C 3BH8A 3G08B 1KELH 4IRSA 1XH3B 4F15C 1OD9A 4D9QD 4OZHB 4D0CB 2BVPA 4LSVL 1VEOA 3C8HA 5FYJD 4HXBL 4YBQC 3AC0A 1F11A 3MGAA 4XWOD 3T3PF 4KDWA 3HE7D 5EZIL 4PGJA 4LVEA 1OT2A 1NL0L 3HI6L 5HDBE 4KK8C 3BGFB 4M43L 4BZYA 1Z9SA 1R3LA 2DLTA 5FYLD 1YYLH 2WBWB 4HV8B 4JZNB 2VDMH 4L3AA 4LHUA 5D72H 2FEDD 2VL5B 3QIUC 5EBLB 1MJJA 3VXUE 4M7LT 4WEBL 4FQIL 1RJZA 4U3XA 4DN4L 3EYQC 3P0GB 5EO1B 2PXYA 5HHVL 1IL1B 4P0DA 5GGVY 3S5LB 3JV5A 1AHWB 1T2XA 2C1PA 1SEQL 1UYWH 5I74C 3IDXL 1T5WA 1K5NA 1JF1B 3MV8B 2EXWD 2XG5A 4K7PL 2DD8H 4X9IA 2KH2B 5EPMA 2Q7YA 2L0DA 1EERB 1AP2B 5H37H 3WHE1 4J1UA 2XKSA 1CXHA 5I8EA 2R0ZL 1ZTXH 4E41B 1UB5A 4WO4B 5B39A 3MLVH 5FO8B 1E4KA 1KT2B 4P23C 4ZFFA 4YX2H 3CU1A 4RA3A 4BH7A 1KPRA 4HBQA 3E8UH 1QSEA 5GS1A 3VGBA 5J6GA 2R0WL 2VZUA 2Z8RA 4H20H 3O3EA 3ECBB 4CN1A 3KLAA 1DBJL 4GG8A 2GSIA 3CFDB 3WBDA 2DQJH 3CSBA 4HDIB 4HIXL 2AAVA 4KK9C 3WKNA 1RQ5A 1T04A 2C3HA 5C0EA 5HYEA 3I85A 4WEUD 1G1CA 1KNOA 2NY5L 5IQ9B 3QEHA 2NY2B 3IS0X 3VG0L 3MGOB 3MRIA 2EKSA 4GOSA 5GIRA 5C2BH 3RQ3A 2J6EL 3HG1A 1WSST 2CIKB 3GBML 1VFMA 3OKLA 1EXUB 2EDQA 1S7WB 3QB7C 4G6ML 1W72L 2GJ6B 3GMRB 4HIEB 1GOGA 2NTFB 3DHJA 1VFAA 4JFZL 3LMJL 1RPQA 3HKFA 4I13B 4U2ZA 5ESVA 4M5YH 3QBTB 1DUYA 3B8SA 4NRYB 1C08A 1F3JA 5IESH 4JPKL 3S3SA 3MQIA 4XNUL 2G60L 3BQUC 3KJ6L 4ZAKC 3T3MF 1CIUA 2R2CA 3MLRH 3S97C 2O5ZL 5T1MB 1QRND 3HNTH 3T0EC 1J05A 4ZTOL 2UY6A 4LPYA 3UTSD 4FZEL 2L7UA 1T20A 4KH2A 4PJXA 4U7SA 1AIFA 3VFUB 4OQTH 5C8JB 4M3KB 5BVPH 3LEXA 4L9LB 4Y4KD 1ZSDA 5C0CB 5ITBL 1XR8A 2DJUA 3P9LA 1QLFA 3H7BA 1NC2B 3VH8A 2HLFD 5ANME 3A6OA 2BNRB 3DROA 1TQBB 4X7SH 2EICA 4F37F 4PJFF 1FZJB 5EZJA 1PX3A 4LCUB 5JMOC 3ZDXE 2QQNH 5J11B 3NZ8B 3J7HA 4PJFB 1KSRA 3K2UH 4X8JB 1K9TA 2WBJA 1JPFA 2D0GA 2OTUA 1Q0XL 5D6DC 3BKJL 4WFEE 5I76A 2NY0D 4QHMA 4BSWB 3S36H 4JAMB 3ZKMD 1X7QB 4LEOA 5D4QA 3NACL 1CL7L 3MRBB 4LVOC 4MD0A 5FUZL 5DRZB 1RIHL 3C9NB 4M7ZB 3MCLH 3TPUA 1A7PH 3DX7B 7FABL 1DLFL 1K8DA 3MRJA 4R96B 4MJ5B 2IPUK 1BQSA 2MMXA 4KHTH 2NY5C 4LLUB 4HJGA 3KS0J 1U6AL 5EOCL 3T0WA 3GBNH 3NMEA 1UXSB 1CE1H 1KTRL 3VXUD 4FTVA 1WFOA 2OJZL 3EOBB 3ZHLA 3JWDC 2CGRL 4Z0BH 1ZHKA 1N64L 3NZHH 3BVNA 3L95B 4OZHA 2P8PA 4PGEB 2Z91A 1ORSA 4YE4L 5F7FA 5DD3H 3FN3A 4FFZL 1MI5A 3NFPB 1QFOA 4HT1H 4U1IB 1NGXB 4K94H 5CSGA 5CZXC 5INCA 4HAGA 5DUMH 5EU5A 1AXTL 4OZIF 1K3IA 4JLRA 4OZFG 4HF5L 4GXUM 2A6DB 3NOIA 1F8TH 4OZIB 3GM0A 3OF6D 2R1YA 2E6QA 4IOFC 1I8MA 2BSED 5JR1H 1GGCL 4GBXC 5EO1A 5DURD 4L1HA 3MRCA 4ERSL 4HKJA 1E6JH 3AMKA 4Q7DA 2PR4L 3MJGX 3T0EE 3NCJL 2VLRB 1RUPH 4JZJA 1CBVH 2Y5TB 3VWKC 4C58B 4X5LA 4K3DH 1ZEAL 5GGQH 4JRYB 3Q2CA 3BPOC 2WUBH 4N68A 4XP1H 2EDJA 3BAEH 2JJVA 4HX1B 2DYPA 1CG9B 4HPOH 5DFVD 4AL8L 2B1HL 4ENEC 4FQ2L 3JWNC 5FKPB 4A2LA 1UJ3B 4N90E 2Q8BH 4OTXH 1L7TL 1V3KA 1X5HA 8FABB 4HDIA 4GRMA 3K2MC 3QFJE 5C07E 3MOAH 5GGTL 5T5FH 5ECJE 5LKNA 1NUGA 3V6OC 4IDJH 3DUUA 3GSUB 4NQCE 2HA1A 1OW0C 4YBQD 3WXWL 4BQBA 2BNUB 1VEPA 3JWOL 2E8ZA 3GMNB 4M3JA 1GHFL 2A83B 4XNYH 1RZIA 3SGJA 2H32A 2OR9H 4QRSB 4KDTC 2D4DA 2XYCA 2ESVD 4KK8D 4I77L 3UDWC 2W0FB 2QV2A 2PN5A 2ZPKH 4KKAC 1K6QL 1JJUA 2JIXB 2C5DC 5F7EH 2V7NB 4XPHL 4A2MA 4GMTL 3WNMA 3QIUD 2ZOKB 1IZJA 1ZE3C 1FP5A 4HW6A 3VD3A 1MNUH 1G7HA 2IBGA 4QXGH 4WFED 3WL9B 3SPVB 3D18A 3WJJA 4NJAL 3PGDB 4MDJA 5KVEL 4POUB 5C8JA 1TJGH 3LEVH 5IJVB 3CVHL 4RGOH 5FK9B 3UBXG 4Y16A 5B8CC 3H3KA 1GJIA 3OKNB 2HAZA 5FOJA 2P42B 1CFBA 4LLDB 3L1OL 2YKLH 1A3RH 3WFZA 3C87A 2BNRA 3A67L 4U1HB 2CRYA 1RUKH 4HG4K 3V52L 5KSAB 3TWCL 1OGAB 1FZJA 3TJHC 1HH6B 4WWID 1WCQA 3PDOB 1JNNL 1GGTA 1DSFH 3OHXB 4G7YH 2B0SL 4Q6YA 1NFDF 3ZSTA 2VDLH 4FQHA 2UY7A 4KK9D 3AM8C 1HZHH 2OJEA 3C5ZC 4LIQE 5I19L 1XCQB 1NFDB 4OI8A 1JPTL 1A3LH 2F19H 4PS4L 5F89A 3BDBA 4IJ3C 4BK5A 3V95A 4KVNH 5EU6D 3WNLA 2AW2A 1KTDA 1OCWH 1RZ8B 5A16B 4Y0GA 2AXJA 2NW3A 3OG4B 2IANE 1NBVH 4MNHB 4M02A 4PBVC 1VGKB 4DGVL 3OJVC 3TA3A 4WUUA 4NKDB 3WDHA 4OLWH 3JWOC 3EOBA 3G5ZB 1MPAH 3FMGH 4LMQE 1Z5LB 3CIQA 4TUOB 3EOTH 3RWDA 5DC4B 3GMMB 4CADA 1UCBL 2CLZB 4ZAKD 1VGEL 1XT5A 1XF5B 4OM0H 2C4FU 3T0ED 3HUJF 1P7QA 3V6OE 3TF7C 2IPUG 4APQB 3GO1L 4N0FB 4Z7UA 3TFKD 4HUVA 1N8ZB 4L8SB 4HQQH 4N0UE 3LH2L 3RWHB 1UZ6E 2OTWB 4XB7A 1OP5H 3W0WE 2O5YL 1INEL 1YMME 1XZ0A 1A6VL 4EDWH 1KF9B 3OKMA 2EEAA 4OSUH 1P4LB 3FONA 4RISL 5LGHH 4FOMA 2BRRL 1ETZA 2NW2B 5SWSA 1SVZA 1I1FA 1IGIL 4NKMA 3MRGA 3EFDH 2AV7A 4EBQL 2XWJA 4QLRA 1T6WA 3MGTB 3QXUA 3QHFL 5C07D 4XPBL 4NRZA 4LLVA 3BP6B 1RI8A 4NQCD 3SGEH 5EUOE 1WVZA 5E8EB 4U7MA 4AM0B 5I1IH 1A4KA 3VRJA 3AS2A 1OQOA 5JW3H 4PP1D 2V6HA 3HE7B 4QRPE 1FIEA 1AGFB 1FCCA 4HXAH 1LDPH 4M7KL 2W9EL 2NLJB 4HX1A 3B2VH 1R3HB 3OJ2C 3EOYG 4NM8L 5F6HJ 3L3KB 4GJTB 1SY6H 5C71A 3GGWA 2ZUQC 5DD6B 1SBBA 2OZ4H 4XPTH 2A1WH 3L7FB 5TDPB 4IOSD 4HKXB 3BO8B 2C1OB 3SO3B 5CD3A 3OB8A 4XH2A 3JV4B 4G80B 3WIHL 3ZMRA 5C6PB 5A2KH 2WW8A 1F2XK 2BNUA 3BE1H 2IADB 3Q5OA 4YUEL 5C86A 1A7NH 1YEFL 1XGTB 1MHHB 4G8FA 3BIKB 3QDJE 1T83A 4UT9L 5IVXF 2P5EE 5DJ2B 5CZXD 1NLBH 1JWMB 4L8DA 2VJXA 5FKAB 4LSPH 2FJFA 5IVXB 3VFGL 3BXNA 3HRPA 2DMKA 1KXVC 2VLJA 1ZLUK 1P4IL 2I26N 3SE8H 4FFWC 1D5BB 2ADIB 3BWAA 3C5JA 2MQCA 4IOFD 3N1QC 3NCEB 1ITBB 2APVA 4XI5C 1JPGB 1EPFA 1WZMA 4ORGA 4GBXD 1TCRB 4EN3B 2G2RB 1T1XB 1T4KA 4JFDE 1A1OA 4O02H 1T0MB 1U36A 3W2DL 1FVEA 4QRQA 3V6BR 4LAJH 2CDFA 5DK3A 2F5AL 1WBYA 4PJEA 1OP3K 1S9KC 2X4SB 3VWKD 2H9GB 3V0WH 1EHAA 1WK0A 2DM2A 4WENB 4B0MM 2D7TL 2IAND 4CDHA 3EYFA 2DS4A 1FSKB 3QIBB 4XBEL 4RZCB 5I1DB 4G9FE 4O2FB 3QDGA 1CGSH 1AKJA 2ENSA 4JVWA 4G42A 1A1MA 4HWBA 1DBBH 4YBLC 1HH6A 4ENED 4NOBA 1I75A 5E2VL 3QO1A 3TIDB 3OR7B 4YHOL 2D7NA 3PGFL 3UTZB 1XCQA 2AEIT 3D2UB 2KKQA 4AEIH 2PO6A 3EIFA 3HA0A 5LJYH 2BVOB 2A73A 3PDDA 4KRPC 1Z9OA 5E2UH 1UXWB 1UVQB 1YMMD 2DJ4A 4PJGA 3V5DB 2X09A 4PRPA 3O8XA 4XBGB 4Y4KB 4MNHA 1VGKA 2E27L 2BY1A 1UWXH 5T1DH 3NCBB 3BT2L 2CPCA 4X7TB 3G5ZA 4TUOA 3LCYA 1CLOL 5BV7L 2DQCH 1INDL 1G7QA 2D4FA 3DMMA 5DRNA 2FBJL 5TF1L 3IU3B 4Y4HC 3FAWA 2DOCA 1XF5A 3UJJL 3IU4H 1N7ML 4F33B 2ZSWB 1YNKL 5CZKA 1A21A 2DQUH 2EH7H 3TO4B 5AAWA 4NQDE 1F6FB 1N8ZA 1I1AC 5D8JL 1BD2B 4JY5H 4MXQD 5HDBF 3O2DL 4HZLB 4QRPD 4K7PX 3RL1A 3WO4B 4EEEA 2I9LB 5CSZB 4MLIA 1RIUH 4G43A 1AJ7L 3BPLC 5DC0A 2Y5EA 1FO0B 1WCBA 3ARQA 4MHHG 3MNWB 4JN1L 1RSFA 4JCMA 4CN4A 3VXUB 2EC9U 4JM2A 3TJHD 5CP7B 2R69H 3V5KB 4EVNA 1K85A 1VHPA 4L3EB 1OB1B 2EIZA 4U1MA 4DQOL 4O51B 1MCLA 3U6RA 4LF3B 5K93A 1V3MA 3FB5A 4BK4A 3C5ZD 4M93C 5D1XB 4WI7A 4UTBH 1I7UB 3BN3B 1I1YB 4YHNA 3QDJD 2P5ED 4MCZB 4P2QE 2R2HB 1YY8B 3S9DB 4UAOC 5I1AB 4PJ9D 1YJDC 1IGJB 1R3HA 4GT7A 1LO2H 3WNKA 1JGDA 1QD0A 4FQQA 43C9B 5IR1A 4R90H 2AJYH 3GKWH 5C08A 2FSEB 1ZVYA 2RB8A 1TTGA 4LVHC 5TE4H 2QSTA 2E9JA 4ZNCD 4TNVF 2GYSA 4HKXA 3V4UH 5DURB 5C2UB 3R06B 1AFVL 4OF0A 4Y2OA 4G80A 3KYNA 3FQUA 5KOMC 4OZGE 5MHSE 3H9SB 4JY6B 2IADA 1LMKA 4HG4J 5F7MC 5I18H 1IAOB 4HH9A 1DFBL 3FO9A 1JNJA 3MO1A 5CLWA 4J7RA 5BV7C 3LZFH 4ZSOE 4NZTL 3GSQA 1O7SA 4PB0H 4G7VL 1RJCA 1NAML 2X40A 2V5MA 4W4OA 1EVTC 2D31B 4G9FD 4YGVB 1T89A 2OM5A 3B6SA 4MD5B 5SX4I 3CX2A 1UM6L 2ICWB 1CU4H 1XIWA 4OJFL 5KAQG 3BHBA 1FVDB 5I1EL 3MLUH 4K9EH 2CO6B 2EIBA 5DMYA 1KEMH 3GIVA 1CXLA 4NCC1 5DJXA 1MUJB 1T1XA 4JFYA 3WFHB 2VN7A 3ARDA 4I0PA 5KN5A 2ED9A 5JPMA 2V9RA 5IFAL 1VACA 3DI3B 4GRLC 4IMLA 2HRLA 5IB5B 4PRNB 4X7EC 4GRWH 3FRUB 1L4IA 3SKUD 1O0VA 4NQXA 2X4TB 1BQHA 2EECA 3FQWB 1IM9B 2A74B 3H7LA 4M9OA 4ZOBA 5IBLC 3VRIA 3AS1A 1F45A 3SDYH 3BMWA 1MOEA 5CJBA 2RFXB 3HZYA 3ZDXF 4Q74A 4NIKB 4PV9A 3SDCC 3D85B 4I3SH 1A6TA 3SE4C 3QIUB 4JDVB 4KUCD 3LKPA 2JELL 3LB6C 5ESQB 3KPNB 2VQTA 1AC6A 3P0YH 3UTZA 1GZQA 2WINA 5L2KA 1JFQH 4U1LB 3DO3A 2UZYB 3S4SA 4LCWA 2YPLD 2CD0A 4NQDD 4MB4A 1U8MA 4LLYA 1XCTB 4PTTB 3PWPA 4LAQH 1VEMA 2CMRL 2EDXA 3DO7A 1M7XA 2QJDA 3DX8B 2IQ9H 4S2SA 5AWNH 5EO0B 3G5XA 3DHMA 2X44D 4P23B 4F8TA 1I1CA 4FFWD 5L7XH 2AKRA 5FB8B 1BIHA 3GSXA 4QOKE 2ZUYA 4XI5D 3IU3A 5EN2A 4AEHL 1N0XL 4WRLA 4XMKL 5GGRY 2Z0BA 4F33A 1K3ZA 4Z5RB 1KXTB 2BY2A 4JN2A 3X13B 4Q6IC 1KBGH 3TO4A 1U58A 4GKZA 4CVZB 4P2QD 1I8KB 4GUPB 3KPMB 1EBPA 2P5WE 4S11A 1QHPA 1QNZL 3MJ9L 2VERN 4UV4L 1XR9B 1HHJB 4MNGA 1EX0A 5D7JC 4KQ3L 4K71B 5BRZA 2DF3A 2NY6C 4KPHH 3KYKH 3OKEA 2BMKB 1EEYA 5D7SL 4C83A 1A7OL 5D7IE 4NHUA 5CP7A 3MOBH 1MSPA 3MV9E 4HCRA 4FQCH 3BQUB 5MHSD 4ZAKB 3DV6B 5D1XA 4NN7B 3LKSB 4LQFH 3D3VE 4XMLL 1KN4H 1SY6A 4KKLC 1I3VA 3MRMB 1I1YA 3VXPB 5J7CC 1WAAA 1KIRB 2FWOA 4GSDL 5ERWA 4KRPD 2R2HA 1YY8A 4MA7L 3BMVA 5HY9A 1T0NA 5C0JB 4R7DA 4JREB 3FQRA 4Q97A 4XCFH 1T03H 2GAZB 2ZJSL 1KIUA 3RVVC 2DQTL 4HK0B 3VMPA 4FFYH 1MRCL 3QEQD 1Q72L 4HS3A 1TVHB 3KDMB 2RGSA 1MQKH 1DVFA 4NT6A 1CDUA 3SE9L 3QFJB 4GAYA 4Y4HD 1ZVSB 5C07B 4P5TC 3LN9A 4PY7B 3WFDH 3JBG7 3H9SA 1XEDA 3S6CA 4GKSB 4ZFOL 4QT5A 5MENA 3W39B 2COQA 3F58H 4U6XB 4Y2DC 3V5HB 5GS2H 2FB4H 1NUFA 2XA8H 3O3DA 3QUKB 1N5YH 3HHRB 1I1AD 1P9MC 3QULA 4UT6L 4J3VA 4MYWB 4IHOB 1Q9LB 1OSPL 4LVOB 4U1JA 4Z7OE 5JHDE 3IF1B 4N9OB 1LEIB 4CNIA 2XNAA 3L5WA 5E6YA 2DMCA 2H8PA 3VD7A 3PV6B 3K0WA 3UZVB 3R1GL 1I4FA 1R0AL 1LQSR 1JK8A 3MRQA 3BKYH 4IS6A 5E1AB 1CFVL 4KK6C 3V8CA 2HFGL 3BZFB 3WFHA 4FQJL 1KEGL 4X6BB 1U92B 3MRDB 3NIGE 3STLB 4YXKH 4NOFA 2CJUH 4OAWB 3I3DA 5IKCB 4OLEA 3RVXC 2WWKT 3RA7L 1JTOA 5F1NB 3MJ8A 3JTSA 1GH7A 4X9HA 2I5YH 1P2CB 3SHSA 1ZWIB 4BZ2H 1KB5B 1TJHH 1JP5A 4QF1A 1TCMA 5BCAA 3CDYA 5JORA 2FO4B 5FUOL 3RI5F 3HC3H 1Z9LA 3EDDA 4HJJH 5DO2C 3WFBL 3V7MA 1D5XA 5C1MB 4U6VL 1U8OB 1FORH 3NPZB 3T2QA 1B9ZA 3O6FA 4HWEL 3CXHK 3RAJL 3G6JB 2F8VA 2VXUL 2AJUH 4QOKD 5CIPH 4LLQB 1BJ1H 4EDXA 4XPAH 1WEJH 2IH1A 3F7QA 5ESQA 5GGUB 1HINH 4JKWA 5CAYB 4HGWB 2HJFA 3AREA 1Y6NR 3C09C 4U1LA 2B2XH 4JM4H 12E8H 2NXZC 2JK5B 1B0GB 2XACC 4H25A 2UV3A 1MJ7L 5DEGB 2P5WD 3MYJB 4KTEH 2ZCLH 3VWKB 3O3AA 1U3ZA 3RY6C 4JFFA 4NDMA 3DX8A 1EZVX 2DBJA 3PGCB 4PJBF 3U79A 5EO0A 3ROLA 5DEZA 1U3JA 5C0IA 1CCZA 4HMEA 3RWCA 1IRAY 4PJBB 2AK1L 4MLSA 4UDUA 5H2BA 4NJ9H 2X1QA 4LL9A 2P49B 3PWVB 2H2SD 3MV9D 4MJIE 3U0PA 3T8XB 3BW9B 4POZC 1FYTB 4ODUA 2W65A 4L4JA 2JJWA 2O26U 3V4PL 3ULUC 4GG6E 5EUKA 2V5SA 4GRLD 4PJ8A 4QHNB 1UZ6F 4WTZA 3MRHB 3RDTA 4ZO9A 1WGOA 2WQRA 4GUPA 3KPMA 1A5FH 4U0RB 5C0RL 2W07A 4PRIE 4UINL 3W0WB 5HPMA 3B2UC 4Z7NE 2AXFB 1YMMB 3ZTNH 1FFOB 1A9EB 2V2WB 1YDPB 4H88L 5D7LA 1YNTA 3GSVB 5IBLD 2JF1A 3L5XH 5GGSY 2FD6H 1FZOA 1CZ8H 1ES0A 5ITFB 4EOWL 4PGCA 4MXWH 3VWJA 5GJTL 3GK8H 2H3NA 1GZPB 3SDCD 4DKFH 2YRLA 3RKDC 3LB6D 2DL9A 3S34L 1FG2B 5EUOF 5DWUL 3SKJH 2CLRA 3SDAA 3QRGH 1ZLVH 4XNZB 5KVFH 1AY1H 3C6LC 2FHFA 4OV5A 3MODH 3RIFF 1KFAH 1NCCL 3BIBX 4XWGH 1IQWH 3MRMA 4I3GA 1HKLL 1V7NH 3DXAA 1MVUA 1JZ6A 1OAXH 1NDMA 3E3QC 2QHRL 4QRPB 5JHDD 5B8CB 5KW9H 2DLGA 3C6SA 4ZUWB 4UMGA 4OB5L 4I4WB 5BW7C 1QTYT 1ROWA 3TBWA 1RK0B 3O2VH 1BVLA 4OFKA 4RAVB 1J5OL 1A02N 2E9BA 2DTMH 4P5MA 1IQDB 1MREH 2VISB 2DLIA 1IKNC 4Q9QL 1OAYH 3MLYH 4UNUA 1ZVSA 2AEQL 1FC1A 1MCFA 2FDBP 3F7PC 4YFLF 4PY7A 1CR9H 3W39A 2D03H 4WFGE 3C5ZB 3V5HA 4TOYH 3SQOH 4JKMA 4IRJA 3HRZA 2LU3A 2HVKB 4IHOA 2P5EB 4PJ5E 3TBTA 1NGZB 1IEAB 3IAGC 4OF7A 4UTAL 4OLZL 4LSRL 4N0YL 5HHME 1PZUB 1FAIL 5DHYA 4X6CA 3WXVL 2Q3ZA 5D7JD 3E6FA 4S1RL 1J1XL 2NY6D 4CVXB 5TGBB 4D0BB 3BZFA 3OGOE 3CDGA 4X6BA 3MRDA 3DYOA 3STLA 4CMHC 4JFDB 4OFPA 1RURH 3LS4L 3MV7E 5AUMB 1TMCB 1CDYA 4OAWA 3TVMC 5K9QI 2D2OA 1AXIB 1A47A 1E4WH 4KKLD 4NQVB 2UUDH 2SEBA 4WI9A 3ULUE 3ARBC 2I07A 1P2CA 3DJ9A 2GHWB 3HZKA 3TV3H 4OZFB 1W0VA 1X5XA 4QHLB 4JHWL 3MMEB 4HLZG 3RVVD 3O3UN 1BECA 1FGVH 1LP9A 2Z8SA 1IM3B 2E8YA 3LIZL 3GHBL 1JRHH 3A0OA 3OAUH 2OCFD 4MJID 4JY4A 5A1AA 2AK4B 2EYSB 2W60A 2F53E 4NGHL 5DQDH 3MLTB 5EBMA 4P5TD 3GUTB 4LPCA 1N2RB 5E6IC 1BBJB 5DEGA 1MFCH 4Y2DD 2FL5A 1S7UB 2F5BL 2R8SH 4G3YL 1MHPL 4PRID 3WNNA 4POYA 3QI9C 2WBKA 1FL5B 3E3QE 1QLEH 5D2LA 3WO3B 4KKBC 4PY8J 3ARXA 4I2XE 3KWWA 4AH2A 2OL3H 3NAAL 4JGUA 4KUCF 4DOHB 4JG1L 3EYOB 2LV4A 1WIOA 4KK6D 5C6TH 4QWWC 2NQCA 1I9JH 3LKRA 4X6FA 4MJ6B 3QXDA 2I25N 3BZ4A 3RVXD 2V5TA 3MRHA 5DUBB 3CU7A 4R26H 3P30L 5L6YH 3GZKA 1RAMA 4DWHA 2AXFA 4YK4C 1T1YA 2VITB 1FFOA 1A9EA 3OJDB 1YDPA 3QXWA 5EB9A 2W38A 4CGTA 4FZ8H 3MCG1 1SJHA 5DO2D 1NDGA 3S37L 3F6IA 5T1LA 5IF0A 4NPYB 3VI3E 1QBBA 5ITFA 2HTLC 4IEFB 1DCLA 1DQQA 5EORH 2F74B 3ARGC 1RMFH 2EXYC 4HSQA 1MRFL 4HFUL 3I9GH 1F4YH 3MRFA 1G7IA 5GZOC 1FRGL 3BEVB 5JW4Q 3TJEL 4WFGD 1AGEA 2NXZD 1UQSB 3UBXB 1LE9B 2XKNA 1HHGB 4H5SA 6FABL 4GW1B 4JANB 4PJ5D 3DRQA 4JQIH 4PLOB 4P2QB 3VGHA 4LLMA 5JIKA 2X05A 3P9MB 4XMPH 3QDMD 4ZUWA 5ALBL 5HHMD 1RD6A 3ABZA 3HS0B 4NN6C 4Z7QF 5JDJA 1OWRM 4PFEA 4YWGL 4ZD3L 1AE6L 1N3NA 1N0LA 1OD7A 2DRUA 2HH0H 4JJ5B 1IQDA 4FXGA 5SWZD 4YBLB 5ISZA 4YDKH 2AI0H 2BNQE 1IT9H 4OZGF 5EOQL 5HGBA 1ZHLA 4POZD 3MV7D 5KOVC 3O6ML 4MSWB 4XPGL 4F3FA 1XF4B 1YEDA 4OF3A 3ULUD 1X5JA 5D5MB 2X1OA 3EAKA 1TENA 1EJOL 4JFEE 5CZVL 4NNPH 1JV5A 2HVKA 5TE6L 3KPPA 4UU9A 4LFHG 1Y6MR 4HEME 3B2UD 4LSQH 4KQ4L 1F90H 4JKLA 1F58L 3AGVA 1OF2B 2GTWB 3UTTA 2D7OA 2QKIB 5DJAB 3TN0C 1SYVB 5IW6B 4OFYD 4RGMB 4DN3L 5K9KB 3PUCA 1L7IH 4P2OB 4Y1AA 2F53D 4DUXA 3RKDD 1YC7A 4ZUSA 2W1NA 2ZNWA 3HR6A 1CGYA 5E7FA 1RK1A 2NYYC 2VNCA 1JL8A 3FN0H 3C6LD 2F15A 1I7TB 1GGBL 3MA7A 5LAXB 5KSVA 1GPOL 2JLLA 5FOBA 3SJVD 5CIPA 3WN5B 4P2RD 5BS0E 3NFNB 5C09A 3RGVC 3TT3H 4HWZA 3IFOB 1I1AB 2DLFL 2CDGB 1WZKA 1PYWB 3VFNB 1U8PB 2IH3A 1BGXL 1CF8L 5A3IC 4ODHL 4X0KB 5C7XH 3BFOA 1MY7A 1EIBA 1X6LA 5CILL 4YHZH 2R2EA 3U7WL 3TNNB 4AQ1B 4YBHA 4NKIH 1T5XB 5IGXH 1SHMA 1B2WH 2BY3A 2G5RA 3IDJB 4IOIB 3QCTL 4LEXL 1U8LA 3HAEG 3B9KD 3TLRA 4RFEB 2VLME 2C4FT 3M17B 4ELKB 1WJ3A 5IT2L 1JN6B 2ATPA 3L9RB 2JB6B 1PLGH 3PL6B 4OD3L 1Q1JL 2OL3B 4PUBL 1HQRA 4M93B 5EIIB 1S7UA 3RWIB 1OHQA 1Q0YH 5EZLB 1AGCB 2B4CH 5FGCE 1U2HA 4L5FL 3H3PL 3RX7A 1EAPB 2GQHA 3GIZH 3THMH 5DVLA 5LXGL 2VQ1A 2IALA 4UAOB 1LILA 5ALCH 5MEOB 2ZUTA 1PG7L 1B4JH 1NFKA 5CINH 5E6ZA 3ARVA 4J8RA 5CJXA 3DVGB 4NM4L 4WNQB 1AGDA 4MJ6A 3UYRL 3GSNB 4LNVA 1CXIA 2EYRA 2Y23A 1FVCA 3DGGB 3TZVB 4DVBA 2C3VB 2R9HC 3TVMD 3IFPB 4PJ7E 5DUBA 1RUMH 1WBZA 1BWMA 3CFCL 3RTQB 3BD3A 2VXQH 3ARBD 4OCLC 1MRDL 1A6AA 4R4FL 2LQRA 2ZG2A 4IM8A 2P5WB 5LCVH 3TH3T 5BOPA 3DVIA 4PJIE 4QRTB 1ZANH 4XHJC 5D1QC 4LP4A 4JZOA 3SDXA 3Q6FB 4S1SL 4R0LC 4WJ5A 3LN5B 3MBEC 3U7YL 5D7IF 3FB6B 1YECL 4BFIA 4TULH 1HE7A 3DIFA 4HPYH 5D7IB 3QSKB 3ILQC 4YEFA 4YAQB 3Q1SL 5DUPH 1U8IA 5HYJE 5F7KC 1UWGL 3BEVA 3TNMB 1C5DB 3CFEB 4YO0A 2YUWA 4PBWD 1KJ2H 4XT1C 3D3VB 4NN5C 4LRIC 3MRNB 3RRQA 1LK2B 4G8GA 4GRLB 5E6ID 2Q1EA 4MNQE 1KLGB 2QEJA 2W9DH 4LLWB 3RWGB 1BLNB 2ZOLA 5HVWA 3MUGB 3P9MA 3V6ZB 3QI9D 2F54B 3O2WH 1CFQA 2E6PA 2X4NA 3D0LB 4M6ML 1SJEB 4KKBD 3QWOB 3C8KB 1MFBH 3RVUC 2P24B 1BZ9B 1MFAL 1SBSL 1HXMA 4DEPB 1S9XB 2E6JA 1X5FA 3FRPG 2KZ1B 1YEGL 2LU4A 4UQ3A 2A6JA 1NMBH 3U46B 2E7LC 2IBZY 5TQ0L 1HN1A 3P4MA 4MSWA 2W0KA 3FJTA 3VU2A 4HUKB 4X7DC 5L0QB 1KYOJ 1XGQB 4YHML 2YD9A 1E4XH 5C0AB 1NAKH 5D5MA 5BS0D 3T4YB 2FLRT 1W0WA 3GNMH 3CFKB 3N9GL 1G7PB 1CLYL 2A77H 4Z7OF 4KTYA 4F7TA 2MKWA 4LARH 3C60C 4OD1H 1A7RL 5BZDB 3ILPB 3LHPH 4Z0XB 3T4AB 3VXRB 2AQ1A 4LMQI 1TETL 4Q9CA 4PRBA 5DF0A 3HZMB 3UTQA 3PABA 4WGVB 5E8OB 1HNGA 3OG6B 1CL7I 4TPRH 5E9DD 3E6HB 2HTLD 4XCCH 4P2OA 1MWAL 3AFLA 1QA9A 1YEEH 5IMKB 3NIGF 4FXLA 2HT2C 4WHTB 4R7NB 4XP4H 1EVUA 1BHGA 1OY3B 2EXYD 3KNBB 1RZ7H 3EO9L 2B1AL 5TDNA 2GT9B 2VXSH 3KR3L 5GZOD 5JPNB 2JKXA 2XFXB 1FFQA 3M07A 5I1GL 4Q58C 5EO9B 3IDNB 4TNWF 5IOPB 1R5IB 5IMMB 3HE6A 1R5VB 2GSGB 2EDBA 2PUQT 3PWJB 4OIIH 2VZ3A 3LSOB 2CKNA 5DD5H 1HH9B 5EG6C 1GCFA 5F7YC 1WUNT 2EO1A 1CGWA 5B39G 1VFOA 4BZ1L 2DB8A 1R24B 4UIMA 5D7JB 3ESUF 1YPZE 2NY6B 5E08H 1PY4A 1EGJH 4KROC 1S7RA 1DBMH 4JFOB 4ONHB 3LKOB 3WDIA 3UJIL 1U8NA 3PL6A 3X17A 1RZFL 1MCQA 2OL3A 5HGAA 3I02A 5HYQB 4XC1L 1U3YA 3FO2B 1CD9B 4KU1A 5F8RC 2J88H 1QR1B 1GC1C 2OTPA 4YHYC 1MCCA 4QKXB 1FNGB 3P4NB 3PWLA 1QOKA 4ALAH 3OX8B 1QVOB 3D5OF 4OD2B 4Z7WA 4JRXB 3AU1B 3FOMB 2EC9T 1SEBA 3TN0D 4JHAL 3ZO0A 3B83A 4KJQC 2NY7L 5J9PB 3AB0B 2V9TA 1KLFA 3W9EB 5IHZA 1CXFA 5HYJD 4JE4B 3TO2A 4XCNB 1WT5C 4GG6F 5L9DH 3MXVH 4OCXH 2GFBA 3TZVA 4YHPB 2C3VA 3NN8A 2X6MA 1FL3A 1RJLA 2NYYD 3WIFB 2BOCB 4L8BA 4GG6B 3KG5A 1S7VB 3OGCA 3RTQA 5ICYB 3U2SA 4F37K 3ULVC 1B0WA 1JGUH 2R4RL 4P46A 5HGHA 4Z7NF 4ZXBB 4WCYH 1G9NH 3RGVD 6CGTA 4KHXL 1U8QB 4P49A 1PKQB 2VQUA 1ACYH 5DYOB 1ZA6A 3CSGA 4KV5E 3SKMB 5A3ID 1MIEH 1UEYA 1O7VA 1QBLH 3VXMA 1KJMB 3QCVH 3INUL 1MF2L 5CEXB 4X6DE 1UKSA 4ODTH 2DBLH 1XF3B 5E4EC 1NGYA 2DQFB 2P45B 3VD5A 3ZE0E 2ZCHL 4ZFGL 1NMCC 2WZPD 2P47B 2E7MA 3QWRA 2FJGA 4Y4FA 5T3XE 5I1CH 3C8DA 1E6OL 1A7QH 4X5WA 1H3TA 4M62H 1KIQB 1FPTH 2NPLX 1L0YA 4R2GD 1VFBB 4M1GH 1BEYH 2DQEH 3RL2B 4RIRA 4UV7L 3CFBB 5J6HB 3QXTA 4LLWA 1BLNA 3VW3L 2GI7A 2DWDA 1CTNA 3BDYL 2MHAB 5D2NA 4QXUL 3D0LA 1WWBX 3LRGA 2D0HA 2AXGA 2NR6C 4LRNL 2A9MH 2X70B 4OF5A 2P24A 1F4AA 2PYEB 3IRZA 1NQBA 4LSVH 3WE6B 1HHHA 4HXBH 3BP4B 2APWA 3X11A 15C8H 4NUJA 1ZS8A 5EZIH 4R8WL 4UNVA 2R2BB 3S88L 3VFPB 1JYNA 4CAGA 3HI6H 2R9HD 4MCYB 4M43H 4DFHA 4YHIA 3HCVA 3CFKA 4RMVA 4PJ5B 1W8NA 4HKBA 5DJ8B 3V2AR 4FQIH 4DN4H 1C12B 4XHJD 5HHMB 1S9VB 5D1QD 5F7DA 5HHVH 3DBXB 3MBED 2PXYC 4Z7VA 4HBCL 4JQVA 4OCWL 3E6HA 3WEXB 1PVHA 1SEQH 1OAKL 1ZGLB 3IDXH 2EDEA 5IMKA 5KZCB 2NY4B 5HYFA 2IBBA 4K7PH 3ILQD 3MRRA 5CSBA 4Y5VC 3QUMB 5IEHB 3SE3A 1TNNA 4FA8A 1AXSB 5JW5B 3QFDA 2R0ZH 3QWQB 3ZL4L 3ULUF 1N59B 3PV7A 2NY3B 3GJFH 2JB5L 3NABL 5JW4R 5I6XB 5DI8B 1TZHA 1E4KC 3EFFA 3ULVE 1DQTA 2VZOA 2R0WH 4BFBD 1Z0NA 3MLZL 1IFHH 5GS1C 3IDIB 4HIXH 1RZGB 4NYLB 2IAMB 4M8QA 4I0KA 2BVTA 4C4KO 4DAGL 2AJSL 2CK0L 1MLBB 3RZCB 3VG0H 5DMKB 1A6ZB 1EHLL 1D9KB 4ONHA 4K8RC 3UBXI 2J6EH 1G7MA 3GBMH 1KENH 3D0VB 1NCBH 5CUSL 4QRRA 1NCNA 2YPVL 1PEZA 4U1GB 4ZO8A 1H3PL 1YEIL 2HFTA 4G6MH 1W72H 4LFHD 3X3FL 5HYQA 1AR1C 3SY0B 1XGUA 3OQ3B 3LMJH 1NC4B 4ONGL 5EFIA 1R6VA 4RFOL 4PRAB 1LE5A 2A6IA 1QR1A 1I9RL 4BH8A 2BSRB 3C60D 2DQGL 2Y07L 2X4OA 2AABL 4JPKH 1IC5L 3MR9B 4XNUH 2G60H 3KJ6H 4M6OL 1QRNA 4I2XB 3O45B 3VRLE 2FGZA 2WIMA 3UTSA 2O5ZH 3BP5A 2VWEC 5D96B 3RWJA 4ZTOH 3FFCB 4TRPL 3WIIH 5FYJU 2FEEI 3S37X 3EO1B 3W9EA 4G8EB 5GGRB 1DR9A 2HT2D 3U9PL 4Z77B 1J0ZA 5T3XD 5DK2B 3FQTA 4JKPL 1HHKA 3S3PA 5ITBH 1CTOA 5HYSA 1UA6L 3OAYK 5DJCA 1S7VA 2UYLA 4F2MA 1UZ8A 4JDZA 3NTCH 5DEFB 2AEPL 4PRDB 3SBWA 1RHHB 3VI3F 4KZDL 1H3UA 1KJ2A 3IVKA 1KJMA 2CIIB 5DMJB 1Q0XH 5BJTB 3BKJH 43CAA 2PTUA 1FIGL 2DQFA 5J06A 2V2XA 3P0VL 5IM7A 4L3CB 4KROD 5AZ2L 1BQLL 3NACH 2AP2A 4QRUB 5FUZH 1KIQA 4NC1C 5HHOD 1RIHH 4CMHB 2MOVA 3VXTA 7FABH 5IB2B 1G6VK 5ADPL 1SYSB 1DLFH 5FYKL 2FGWL 4F80A 3EGSA 3QAZB 3NGBB 3RL2A 4OCSL 5LG1A 1GSMA 4ZPTA 5EOCH 5LBSH 4EQ3A 3DV4B 3ARBB 2QBWA 4WTWA 1H5BA 2OJZH 3MREB 1JBJA 2QSVA 4NSKB 1KTLB 1PZ5B 2CGRH 4FP8L 1TTFA 25C8L 1IAMA 1YMHB 1J1OL 1QSEE 2XA3A 3U36B 3NCYS 5T1KD 2PYEA 3LKQA 3B3IA 3NVQA 4Y5XA 1JYWA 1ZLWH 4H0HB 3UAJC 3BP4A 3HPJA 4FXKB 4KJQD 4FFZH 1IJ9A 1N5AA 3PHSA 4Y8DC 3U30B 5H35A 1N6VA 2BNQB 4LHJB 1JGEB 2R2BA 3QJHB 1I8LA 3TIEB 1AXTH 1HI6B 2VH5L 3HG1E 1D6EA 1R3KB 4HF5H 1J8HB 2FATL 4O2CB 2E7BA 2Q20A 3Q48A 3BGFC 4D8PB 4JFEB 3ULVD 2Q7NA 5IIEA 1EO8H 2GY7B 4M5ZH 2AJZB 1H15B 1UJTA 4E0RA 1MJ8L 1GGCH 5FECA 1BFOB 2UVFA 5KVDL 1QSFB 1DQML 1GGIL 5E5MA 3BZEA 2FJHA 3GSOB 3DBXA 4ERSH 1YNLL 2E9IA 4LVNC 4TVPL 4UILH 4ZG1A 5GS0L 2PR4H 3C2AL 2IG2L 5H37G 5FHBL 2VWEE 1G9ML 3KPLA 4NO3B 1P5VA 3L3OB 5JIHA 2FX7L 1AXSA 1H3GA 3ZE2E 1JNHA 1ZEAH 2WAHA 3B5HA 4LQ1A 1DUZB 2LABA 3T2OA 3KYMB 2VDQH 3VFVA 4WO4C 3JTTB 1CGXA 1EGJA 3H2WA 4TVSa 4M6NL 3VGFA 4PREB 2NNAA 4AENA 4I5BA 2B1HH 3FTGB 1GYAA 5GQBA 3V0VB 4JB9H 4MA1B 2CKBB 5H94A 1L7TH 1QFWL 1WC7A 3CMGA 1V7ML 1YEKL 2NR6D 4NP4L 2EDYA 4JO3L 3GJEB 1MLBA 3KXFE 5IVOA 3RZCA 1F00I 1D9KA 3WXWH 2NY2C 1ONQA 1X5IA 3ARGB 3OB0H 5I16A 1GHFH 1JWUB 5HD8C 2XN9B 1BIIB 4X4YB 1PG7X 5GPRA 2DM3A 1MCOH 2ESVA 3SGJC 4NC1E 5ANMA 3MUZ1 4I77H 3GI9L 3FT4A 4NO0D 1K6QH 1I1RA 3PXJA 1IGYA 5M95B 3CC5A 5MP6L 2R1XB 4XNQA 4XPHH 4NNXB 2VDML 4GMTH 2BSRA 1G1YA 5D72L 1F6LL 4MAUL 3KPRB 4YR6B 4GW5B 3MR9A 4JCLA 3QPQC 1F4WL 4FTVE 5C0BA 1M7IB 3WFCH 4HKZA 2YSSA 2J4WL 2J5LB 4TTDC 3F12A 1IC7H 2CR3A 3U4EA 2PXYD 4NJAH 3O41A 1UYWL 3EO1A 3WJJC 4OZHE 4X99A 4EUPH 3CVHH 2Z93B 4MXVE 3P2TA 4CU7A 4HWUA 4Y16C 4ODWB 5EA0H 3L1OH 4A6YA 2QL1A 5CP3H 3UP1A 5CCKL 1J86A 4R4BB 3HZVA 4OUOA 3T3PE 3A67H 4PRDA 1RHHA 3TWCH 5ELIA 1TQBC 3U83A 5J1SC 4NQEB 1XGPB 2BSTA 1CDJA 1DQDL 3HN3A 5AD0B 1ZA3B 5JOFB 1JNNH 1QSED 2J8UA 3O9WB 4LSSL 2CIIA 4MQSB 5J11C 1WTLA 5BJTA 3QXAB 4Y19A 4V1DB 3WUWA 2PNDA 3HNSL 1JPTH 3ULSB 4N5EC 2VLLA 4PS4H 5EU6A 1EBAA 3IDMB 4NO2A 3FKUS 4FQLL 5FGBC 3SCMA 3RNQB 5GHWL 4K8RD 5HYJB 4LCYB 1TZGL 3V4VL 3L7EB 1Q9WB 3HG1D 1HILB 4GS7C 1XGRB 5I8OH 4M7ZC 4OV6F 4DGVH 2X4UB 1OP5K 4RAHA 3S96A 1AR1D 1LEGB 1C1EL 4MHHI 3N50A 4MNQB 1M4KA 4E5XB 5EC1B 4RSVA 3GSWB 3LQAL 4X83A 1YMHA 1UH2A 3FOLA 2EDWA 2CUIA 3QZWA 1UCBH 5FIEA 3L3DB 2YHGA 1QACA 1VGEH 3WS3A 2VE6B 2X10A 3T1FA 5FYKE 1EFXB 5DJ0B 1E28B 4PP2A 5ID0B 5C0DA 3PF2A 4OQTL 1MAKA 3LH2H 3CSYA 3MNZA 1OL0A 5E0QA 3PHOB 5KSUB 3IT8D 2O5YH 3TYGL 3N1MC 1INEH 5LQBH 4HGMA 5FO9B 4E9LA 1J8HA 2WK2A 3EZ8A 4FHBD 2DM4A 3EYVA 3TCXA 3Q3GA 4QTHB 2BRRH 3VG9B 1FZKA 1BJMA 1IGIH 2NXYC 4OCNC 2D9QB 4QHUB 1H15A 2GJ6E 4EBQH 3G5VB 2CRZA 5DJDB 1Z2KA 3ET9F 4U6YA 5AZEL 2LAGB 1EA9C 3QHFH 5D6DA 1YUHB 4KXZH 3GJFA 4NQCA 3HPLA 1JWSA 4J3WA 3KXFD 2EDKA 1HSAA 3U4BL 3O6KL 3L3OA 4XAKD 4FFVC 3T3ME 4MQ7B 2ICES 4K3JL 3EDFA 3VE0B 4F57H 4M7KH 3MCLL 4CJ0A 5KS9A 2O93L 1I85A 4K23H 2Z31B 3L6FB 3VXSB 2P8LA 2J6EA 2VAJA 3GBNL 3V6FB 1CE1L 3IJHB 5CJQH 3O3BB 2BNRE 2DICA 4YIQA 5KSBB 4FTVD 3VA2C 1UJ3C 1YPZF 5D1QB 5KG9B 1W72A 3BEWA 4LBEB 4EXKA 3WIHH 1X5LA 4PJFE 3OWEA 2KBGA 3UAJD 1ZOXA 4YUEH 1YEFH 2AJVL 1JWUA 3LQAC 4RMSA 4X4YA 1BIIA 4UT9H 4HT1L 4K94L 5T3ZE 1T83C 4D94A 2MKLC 3OKYA 3MLWL 5DUML 5GRVK 5F96H 3VFGH 1UWEH 2G75B 1H8NA 2YPKB 2GJZB 4NN5B 3QA3B 1P4IH 1VCAA 1X5GA 3O4OC 4RQQB 4NNXA 4XBPA 2VZ1A 4YXLL 4EUPB 1OTSC 3KPRA 2HJKA 4GBXA 4WUUE 5MEQB 2VXTL 4R3SB 4LDLB 3QUYB 1GOFA 3RWFB 4GLRI 4F7PB 4OFVA 3SGDI 1HOCA 3W2DH 5AEAA 4NBYB 4L8CB 5CBAA 5DJYB 2F5AH 3RVTC 1INQB 2Z93A 2BX5A 5GJSL 2GEEA 1JTTA 5AYUL 5B38B 2IANA 3DPBA 4OQ1A 5TDOB 4ODWA 2D7TH 2XQBL 5IVZB 4PJCB 4RX4A 4Z7UE 1MCIA 5LGJB 4XBEH 1EFQA 1T1ZB 3N85L 3LEYL 3GMLB 4WO4D 4XP1L 4PIRF 4P5KA 2BSSB 1BQHG 4KV5F 5FYJL 4NRXB 2DYPD 4HPOL 1UWXK 5KSAC 5SWSE 3QUZB 5FV2A 4XTRC 1BAFL 3O9WA 2DLHA 4X6DF 5E2VH 2Q8BL 3ETBF 3QNZB 2H26A 3GMPB 4YHOH 4V1DA 3ZE0F 2XXCB 5FYKD 3MOAL 4YPGA 2J1KA 5T5FL 1HK6A 4N0UA 5IV2B 4HFWA 2ADFL 2NY2D 3DYMA 2PO6C 1AI1H 4LCYA 5JXAL 3TM6A 3FZUC 4UOW1 5HD8D 2Q6WB 2X7LA 1A7BA 2OR9L 2HFFA 1T22B 1FFPA 35C8L 3UDWA 4Y8AA 3O8XC 3O6LL 1CT8A 2PW1B 4H26B 1LEGA 1KIPB 2ZUVA 2GJ6D 3BT2H 3DVNB 4JRYE 1JMZA 2HFEB 5JUEL 3S35H 5DJ6A 1CLOH 1OAZL 3RNKA 3PIQB 3U9UA 1JGLL 2FBJH 2LU7A 3SEPA 2QSCH 4K94C 4U1KA 1MNUL 3DMMC 4C59B 2AV1B 5EUOA 3QPQD 4XXCA 3UJJH 5I71C 1MCRA 1UB6B 1N7MH 4TTDD 3BSZL 2Q87A 1U93A 4MAYB 4ZMAT 1F6AA 1YNKH 1A9BB 2ORBL 3ARWA 4XZUB 1FNEA 4ZTPH 4N0RA 4APQC 3BX7C 3MLXL 3O2DH 2XY1A 4RGOL 4L8SC 2P4AB 1AGBB 4GAFB 4Y16D 1AJ7H 5C0CD 3TBSB 4TVPD 5F9OL 2R23B 4XC3L 3LQZA 1G0XA 3FB8A 4Y89A 4JN1H 2FZ3B 2BNRD 3ZZ1A 3G9AB 1FL6B 2B7DT 2VLJE 4O00A 5BXFA 1T1WA 4YHYB 5DT1L 3L3HB 1DEEA 1JUFB 4G7YL 1EMTH 3FQNB 3AM8A 1P53A 1BQUA 4DQOH 3IJSB 3MA9L 4D9RE 5T1KB 1FV1B 4S10A 5DTFB 1HZHL 4N5ED 1A3LL 2F19L 3ZSSA 5FDWA 1J18A 2FLBT 5CLTA 4F58H 3BESR 5B4MC 4KVNL 1P7KB 1Y0LA 2YOCA 4IIQA 3K7UA 4PJEE 1TTUA 5E94A 3RU8L 3KGRA 4PJ9A 2VLKB 3RP1A 5FEBA 2X4QA 8CGTA 4LDOB 5GGTA 4JO4H 3ULVF 3DVFA 1WQVT 1MHEB 2ZUSA 1A2YA 3V6FA 4KTDL 3QDGE 4U4BA 4OLWL 4WUUD 3O3BA 5IBTH 5EOTB 1FDLL 1GRWA 5GRUH 5I1JL 5DGQA 5CEYA 1AFVH 1WWCA 4PLJC 4PTUB 2UWEA 3SO3C 3IGAB 4YDVB 4ZOAA 1L0XA 1ND0B 4X4XB 5E4EB 1DFBH 1F42A 2ZSVB 4NZTH 4G7VH 2P46B 1NAMH 4HIHB 5L88H 3ARRA 4JFXB 1NCAH 4YHLH 1ZT4A 1UM6H 1WWWX 1T89C 1NBYB 4PRPE 1DBKH 2E7HA 2NXYD 3BJ91 1EAJA 4Z78A 3FAXA 1XIWC 3CVHA 1IGCH 4JJHA 4NQSB 3VRLF 5E03A 3QUYA 2A6KB 3CZFA 4GAJL 4EZMA 4EN3C 1MJUH 5GRYA 3OKKB 4XGZA 1ZHBB 3BH8B 4ODVL 4I0PC 3UJTH 3IJYA 5F8QC 3OTTA 4IRSB 2XPGA 4O4YH 1FO0L 5HGDA 3MRLA 1RZJL 2O61A 2BVPB 2BY0A 4FFVD 5DR5L 3RI5K 4OUUA 3C08L 5TDOA 5ADOL 5JW3L 2GCYA 5IVZA 1EH9A 4JG0H 5TJWK 5LGJA 1FLTX 3EDEA 1EJ6A 1LDPL 1P4BH 3QIBC 3VFMA 1FSKC 1IBGL 2XTJB 1M71A 4JRYD 3CPLA 2BSSA 1T0PB 1QQDA 3BH9A 3PHQB 1DQJA 5F7HA 4K3HA 1R3LB 3QUZA 1CD1A 1NCDH 2DQIL 2ZUUA 4KMQA 5HI4C 5DXWA 4LHUB 5DQ9A 1MJJB 3HR5A 3W5NA 2YPLA 1RJZB 2PXYB 2HN7A 3P4OA 3T0XA 3GKZA 1CDHA 3DETC 1QG3A 2C1PB 3BE1L 2H6PA 4DGIL 2VYRE 4WEMB 3UZEA 3N1PC 5D1ZA 1K5NB 4YGAB 3WHE0 4LKCA 5EPMB 2Q7YB 4EXPX 2YZ1A 4J1UB 4HIJA 5I8EB 2XKUA 1DL7L 3FL7A 4KJPC 2A2QT 4KAQL 1UB5B 4LCIL 1OSZA 5B39B 1OGTA 2JIXD 3PIQA 4ZFFB 3BI9X 1OTSD 2QQKH 4BH7B 4P3CL 1KPRB 4WU7A 1QSEB 5GS1B 1N0XH 5C08E 4XMKH 4D9RD 5J6GB 1UB6A 2DIBA 3O3EB 4WWKA 4Y5YB 4HLJA 4HUXA 5C3LD 5L2JA 4GG8B 2GSIB 3JZ7A 5IG7A 3RVTD 4XZUA 2FR4B 2BC4B 1T04B 5C0EB 3NIDE 3CSPA 3TO4C 1KNOB 1LO5B 3QG7L 3QEHB 3SN6N 3V0WL 1AGBA 4U6HA 5DVKA 4ZPVA 3MRIB 1IAKA 2EKSB 5E8DL 5GIRB 3WO4C 1ZLUH 3MJ9H 2WANA 3RPKA 2EC8A 4KQ3H 4AG4L 1CGSL 2FRGP 1YQVL 5D7SH 1FL6A 2IGFL 1V05A 1A7OH 4ODXA 5KSAD 1OGAD 4XTRD 1JUFA 5ESVB 1P6AB 4OZGA 1DUYB 3RIFK 1C08B 2IWGA 3IJSA 3MYZA 5EU4A 1F3JB 3CUPA 2H32H 1FV1A 2MFNA 1OP3H 5JTWA 1NCWL 4NZUL 3SKOA 4C54A 1NLDL 4ZSOA 3ZE2F 5D1XC 5DQJA 3DARA 1DBAL 1WLHA 1J05B 2PO6D 3G6AA 3VFWA 3Q5YA 5EBWA 4MA7H 1S5HA 4PJXB 1AIFB 2ZJSH 4KUZH 2DQTH 2E3VA 1UKQA 3LEXB 4PRPD 3O8XD 2QSQA 1ZSDB 3QEQA 4W81A 2W91A 1GOHA 1XR8B 1Q72H 4NWUL 5T1DL 1MHEA 3QQ4A 1Z3GL 3P9LB 1QLFB 3H7BB 3T04D 3VH8B 5EOTA 5CKAA 5GSVA 4XRCA 5IROA 3DROB 4Y4HA 3ARZA 5DMGC 3G6DL 1JYVA 3DMMD 5EZJB 5E70A 1UKTA 1MCNA 4CL7A 1MCJA 1ND0A 4X4XA 1CE6A 2WBJB 1JPFB 4L4VB 2OTUB 3MC0A 5L2KE 5HXMA 3NPSC 2ZSVA 4QHMB 4LCWE 4PLKC 4APQD 4UT6H 4LGPB 5FO7A 4S1DC 1OSPH 3BDXA 2R29H 4OZ4A 2BXZA 3PWPE 5BZWA 4MD0B 2I24N 1SJXA 2XZCL 3R1GH 3TPUB 3CLFL 1R0AH 1CXEA 3MRJB 1HDMA 2OMNA 4XVTH 3LS5L 2NCMA 4HJGB 2XWTA 4OM1L 2HFGH 5LGKA 5HDQH 1HKFA 4FQJH 1KEGH 2YD1A 3RJDA 4OF6A 2H41A 4OZHF 1MCEA 1ZHKB 3RA7H 3BVNB 4MXVF 1QFUL 3HI5L 4HK3N 5BMFL 2P8PB 5HVFB 1EUTA 4KC3B 2Z91B 4UTBL 1ORSB 2ZG1A 5B4MD 2FO1A 5JA8B 4OT1L 1MI5B 2Z9TA 1BD2E 5FUOH 1S5IH 1R3IL 4TUJA 4U6VH 1MQ8A 5INCB 1OT1A 4HWEH 4JDTL 1LO2L 5EU5B 4QOKA 2VXVL 4JLRB 1FFNA 3RAJH 3O6FC 1G7JA 3PHQA 2VXUH 3A6BL 5HVHB 5BRZE 2R1YB 3QNXB 1NSNH 5C92A 1ZT1A 1I8MB 1FFRA 4DZ8A 5DLML 5DVMA 4L3EE 3MX0A 4LVNB 4XCYA 3MRCB 1T21A 4HKJB 1CQKA 3BYYA 1MJ7H 2ED7A 1AO7A 3UPRA 1MH5A 3U0WL 1H8SA 3HB3C 4JZJB 1WAAE 4GW4A 2X9WA 1L0QA 1UM5H 3PJSA 4DUWA 3UTOA 3LOWA 1OAUL 1GGUA 1HHIA 5GZNC 1S7XA 3MRKA 3T65A 1XIWD 1K2DB 3O2DA 4K9EL 4KMTL 2DYPB 1CFTA 1WWAX 2FYYA 5HI5C 4YH6A 1BF8A 3IKKA 2WM0A 4Y5YA 1A22B 5FV1L 2Y7QA 4PYGA 1HYRC 4EN3D 4X8XA 4JRWA 1B0RA 1LEKA 4I0PD 4GRMB 3SGKA 5DVOA 5MEPA 2FR4A 2BC4A 3GI8L 1LO5A 3H3BC 4PJ8C 3H9SE 5JOPE 2JJTC 3DUUB 4OFDA 5ILTL 1I3RA 4CU8A 5C0RH 4UINH 4X98A 2CR6A 3RZWA 4H1LH 3JWDL 4H88H 3O11A 1RZIB 3R8BB 2H32B 4OLVL 4J2XA 3QIBD 5IUSA 2Y6SC 3SDYL 2A0LC 1BF2A 3SDCA 4K71C 1OARL 4EOWH 1NGQH 5GJTH 2WWMC 5F1IA 5EZOL 1R3JA 5HI4D 3DYPA 5HJ3A 3S34H 1E0OB 1KB5L 4F7CA 3IB4A 4K3GA 3MV11 1G7HB 4JFQA 5J56B 4WY7L 4UT7L 4NN7C 3ES6A 1HKLH 1W8OA 3D2UD 5CWSA 3D18B 3JVGA 4JPWH 4N8CH 3DETD 4J3TA 4N8VA 5JHDA 1K4DA 4MDJB 2QHRH 4L4TB 3O0RL 2P8MA 2ZUWA 4LAQL 3PWPD 4JREC 1HIML 4OB5H 4Y16B 4I3RH 5A43C 1GIGL 1J5OH 5AWNL 1TVBA 3UX9B 3D87B 4LIQL 4BQ8A 4RGNB 4KJPD 5E2TL 3U82B 3GSRB 2YRPA 3A6CH 2HVJA 2YUZA 1NAMA 3PWNA 3TBYA 4OBRA 3RBGA 1FHGA 2AEQH 5CEZH 4S1QL 4E42A 3FT3A 1FNAA 4Q6IA 4ISVB 4L4VA 1HXYA 4FQHB 4Z76A 1RUAL 2VSDA 2OJEB 3TO4D 4K9EC 5F89B 1OAQL 4IRJC 2VDRH 3VXNA 4XP6L 1BD2D 2UUDK 4HWBH 3I6KA 4UTAH 4LSRH 4N0YH 2B5IB 5EU3A 4GS7B 1KTDB 3WXVH 4JFFE 3RX8A 4S1RH 2NW3B 2WIIA 1J1XH 1OPGH 3KYKL 3UC0L 5BRZD 3TA3B 4RAUA 4YXHL 4WUUB 2DQDL 3QRFM 3D25A 1FJ1A 5CD5C 5IHUL 3LS4H 3BKCH 4X9GA 2Y06L 4L3ED 3RWDB 1AQKL 1H0DA 4CADB 5C0FA 1RZKH 2LE9A 5D1XD 5B3NA 3RBSA 4Z7UF 4MQXC 3MACL 3WS6C 1P7QB 5GGVL 4JHWH 4Z7UB 4HUVB 1Q9KA 4Z95L 2WSKA 2XQYG 1XZ0B 2AJXL 1RFDL 3LIZH 3GHBH 2BFVL 3OKMB 3QQ3A 4QO1A 4IBLT 2NXYB 5D7LE 3FONB 4MJIA 4UQ2A 1ETZB 3H9HA 5SWSB 1I1FB 4NKMB 3MRGB 3QNXA 4FQXB 2AV7B 2H1PL 3VD4A 5DMGD 4P5TA 2R4SL 4HUWA 7CGTA 2HWZL 2XWJB 4YQXH 3WFDL 1NEZA 1BFVL 3BPCA 1EEUA 4Y2DA 2HTKC 3QDHA 3VGAB 4P2YA 4NRZB 3WD5L 4LLVB 3H9SD 4KVCL 4PRIA 1U91B 4WVRA 3MJ7A 1EK3A 1MHPH 5FCUH 4PLKD 1N5YL 1A4KB 4S1DD 4OCYH 3DXAE 3VRJB 5DMIL 4G8IA 5F3BA 1QYGH 1FNLA 5I2IA 3MRPB 3NAAH 5ENWA 3CDCA 1K2DA 3RJQB 4O58L 3NIFE 3BKYL 3L3JA 2Q8AL 4NKOA 3MLPA 3GGWB 2H2PC 4M6AA 3VXOA 3MJ9A 1IAII 4YXKL 3ESVF 2OQJB 1I7RB 3IXAA 4MA3A 1JE6A 1JZ2A 3OXRA 5CD3B 2IPTH 1IARB 4XH2B 3P30H 1A1NA 2YMXH 4O5LH 3QEGL 1OLLA 3MTRA 1KPVA 4F9LA 3QDAA 4U0RC 5I66A 4BZ2L 4G8FB 4LPXA 5F9WC 3HC0B 2APFA 3TT1L 1IM9D 2QR0B 4LNRA 4L8DB 1FORL 2FJFB 5J1AA 3O6FD 3O4OB 3BXNB 5DZNA 5DJZA 1HEZA 2VLJB 2XRAL 2AJUL 1P69B 4PGBA 4XPAL 1MRFH 4GRWE 3D85D 4HFUH 3BWAB 3C5JB 1FRGH 2YD8A 5FF6B 3TJEH 3EYQD 4ORGB 4XNZC 4LLAA 2HJLA 1T4KB 4OLUH 4PJEF 1LHZA 1CICA 1A1OB 1FVEB 4QRQB 4TQEH 3PWUA 3RY6A 2CDFB 3QDMA 3KPQB 1WBYB 2ED8A 4L4TA 4PJEB 2ZCLL 4LSDA 3HB3D 5ALBH 1BJ1J 2CQVA 2MPAL 4C56B 3E0GA 4JFFD 4U1NA 4ZFOA 1A6WL 4YWGH 4ZD3H 3ZT7A 2A38A 4ZUVA 4ZFZB 5GSRA 1CWVA 1QEWA 2VDOL 5GZND 2HMIC 1WZ1L 3EYFB 1G6RL 3GSRA 4JR9L 5SWZA 3QDGB 4FQPA 2WP3T 4P23D 2ADGB 3MUY1 3U4AA 4D9LL 3CJJA 1AKJB 1NBZA 4G42B 1A1MB 3G6JE 3DUSB 5EOQH 3HI1A 5HI5D 3N0PB 3DI2B 3QO1B 4NFDA 3OSKA 2XTLA 4ISVA 1XFPA 1V8HA 5CBEA 5F3HA 4N5UA 2N7BA 4PJ8D 2PO6B 1K4CB 5E24E 1CDIA 2A73B 3PE9A 1F58H 5JMRA 4PJGB 1IGFH 1OVZA 4OFYA 4PRPB 4TTGA 3O8XB 1UFUA 2Y6SD 2MWCA 1Q9OB 1KG0A 1LD9A 2BJML 5D2LE 2F53A 2VAAA 2IJ0C 2WWMD 4PJBE 4DKFL 2OR8A 5DK0A 2QQLL 4GAGL 3RPIA 4TNWK 1G7QB 5ACZB 3C6LA 3DMMB 5DRNB 3V79C 5FGRA 1AC0A 2G9HA 3ZDYE 3BQUD 5HHPA 1FYTE 1GGBH 4WTXA 3MODL 3SJVA 5I71B 1KFAL 4P2RA 1DDHA 1IQWL 4PR5A 1VADA 1OAXL 3DXAD 1BGXH 5BW7A 1J1PL 4ODHH 2FIKA 3FQXA 4XVJL 5F6IB 5CILH 4FMKA 3U7WH 3RL1B 1CDCA 2OR7A 3T0AA 4G43B 3B9KA 1KCLA 3UO1H 1BX2A 3QCTH 1WCBB 4FQXA 2JJSA 4HUMB 4X4MA 2MCPL 3WLBA 4N90D 4HS6A 5IT2H 5FDYA 4JM2B 3QFJD 2DDQL 5EU7C 4OD3H 4EVNB 1Q1JH 2D03L 4PUBH 2EIZB 4U1MB 3U6RB 1U91A 3UZQA 3G04A 4ELMA 5MERA 4Z8FL 3FB5B 4K07A 4WI6A 4IRJD 5D7KE 1N4XH 4YHNB 3AAZA 3H3PH 4PB9H 4ZNEA 4J3XA 2X89D 2EIEA 2CRIA 1WICA 2FEEL 3MRPA 4HCRH 1IEBA 3CFJA 1JGDB 5IR1B 4FQQB 2HYMA 1CYGA 3EO0A 1FN4A 4G9DA 1ED3A 4H1LA