3OGCA

Kcsa e71a variant in presence of na+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism for selectivity-inactivation coupling in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2010-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ogcA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ogcA02
1S7WA 3PIQA 1IT9L 5HYSB 5SV3A 4IRSD 1KTLA 5FDWA 1M7XA 5IVNA 1CFSB 5I1EH 2HRPL 3LN9A 4K3JL 1II4E 3ES6B 3QDGB 4EDXA 4FFVD 4JN2A 4HIHA 3C8DA 4X6EA 5GZNC 1I9JL 3RRQA 1MH5B 4TVPE 2I60H 3WIHL 1P7QD 3GNMH 2NY0C 4X5WA 3WS6A 1RJLA 4KJYA 2BOBB 3V4PL 2ZUSA 3SGJC 1MAML 1ZV5A 3WLWD 4U05A 1MFDH 3DUHA 4UQ2A 4NKOB 2JB6A 4GG8B 5ITBH 4LIQL 5IWLC 4EQ3A 4D9RE 5DVNA 3MGTB 1NEZB 5C07B 4KK6C 25C8L 4XBEL 3M45A 3KPPA 3QG7L 2AJZB 3U4AA 4V1DA 2WUCH 5D7KE 2QV2A 3MNWA 5GGRY 3JZ7A 1I7TA 1AGCB 4Y1AE 1FNAA 4GRLB 3L7EA 1TZIB 3MTRA 3NZHH 1BVLB 1YYLH 4H20L 4MA7H 3FOMB 2F8OA 3ARGC 5I17B 2QQLH 4Z7OE 2ZOKB 3C6LA 1UT9A 3UZVB 2BSSA 4M7JH 1U8MB 2EXWC 1KENL 5JW4N 1KFAH 4PRHD 1CL7L 2F58H 3GI9L 4OFDA 5L0QB 1MHHA 3SE3A 1NAKL 4HH9B 2EDXA 1BGXL 2Q6WA 1IC5H 1MCPL 3L3KA 1MCLA 4KPHL 3E1F1 1NANH 3S34H 2KDGA 4JKLA 2H32H 3SDCD 5ANMB 4LRNL 3VWJB 1JMZA 1BEYL 5FO7B 1X5XA 1H3UA 3UEZA 4OCXL 3T4YB 3W9EB 4WW2C 1AKJA 3WNMA 2AGJL 2DI9A 1A7PH 3O2DA 4PV9A 1EHAA 2AQ2A 3ALPA 1SJXA 1TITA 4I3SH 2FJGB 1EFXD 1NGZB 1DDHB 3OV6A 1NCWL 1U8OA 2R69L 3QI9A 1VFMA 3GSNB 2FWOA 4JFQB 2VSCA 3HG1A 4O2EA 3WJJA 3TBYA 5L8KB 1OGTB 5JO5B 3LZFH 4HLZG 3H9SA 1S7TB 2XIDA 5GS2H 3RZCD 1AHWA 1KJVA 4ODUA 3GUTA 1QA9A 4WUUA 1IJ9A 1FPTL 2VDNL 5KJRL 5HHQA 4R4ND 4NQCE 1F45A 1IARB 1J05B 4JPIA 3TA3C 3RA7H 2A74A 1VEOA 3IJSA 1JP5A 3G6AB 4XZUA 2XFXB 5J56B 4RMWA 2GT9B 5TE7L 5FFLA 3H7LA 1LO3L 4KJQD 5ICYB 1IAOA 1FVDA 4LPWA 5CD3A 2W9DH 3DBXB 2Q1EA 2OQJA 1EUUA 2IANE 1OB1A 1YNLH 3OTTA 4I2XA 1CFQA 3KPNB 3FQNA 1J10A 3QJHB 1WAAA 4QO1A 4NWUH 2KH2B 1FN4B 1C8PA 2ICEA 3ZDZE 1HWHB 4QXGH 1U8KB 2HT4C 4RQQA 4M5YH 5D2NB 2J6EL 5B8CB 2ESVD 1FORH 3DUSA 4EVNA 1VFBB 5DJAB 1ZLWK 4D9LL 4ODHL 2NCMA 4OTXL 1MCJA 5D1ZA 4DFIA 1AD0A 4PJCE 2X4NB 1U8NA 5IMLB 1CU4L 1QRNA 3ET9F 5C0FA 2NY7L 2UV3A 2FR4A 2BOCB 4FRWA 4OZHB 5MP6L 2IQ9L 2F53B 3OB0K 3MJ9A 1TJIH 3KPLA 4BFEA 3BDXA 2BHUA 4YHPB 3IU4H 2VDKH 4X4XA 1UACL 4JO4L 1IQWH 2ZP0T 3MV11 2R56H 2YD3A 2VLKA 3VFUB 2AEWA 1NL0H 4P4KC 4M6ML 1PD6A 2E27L 2X70B 3CZFB 1MCWM 4NC0B 5HD8C 1LP9F 2MTPA 2FX8H 3SCMB 1NGQH 4JANA 2YA2A 2I9TB 4OV6F 3NCJH 3MRMB 3IDGB 3CC5B 1CLZH 3QFDB 3K81A 1I3UA 4MQTB 3MYJB 3ULUD 4G6KL 5IBLD 4ODSH 4QGTA 1I4FB 4ELKB 4LSPL 1RURL 3ZHKA 5FO8B 1FE8H 2DQFB 3CAFA 3RBSA 1JNHA 1J0JA 1I3RB 2LVEA 3GJFB 5EZJB 1WCQA 3QPQC 1LP9A 3KYOB 4G5ZL 3UTSA 4X6BB 4QWWC 4XT1C 1KCUL 1RUQL 3BKYH 3NAAH 2V9TA 4OLZH 3GI8H 3BZEA 1WZ1L 2R1WB 2W59A 3GKWH 2XZCH 3TNNB 5D1QB 3BH8A 4PJAF 4MXWH 4DN3L 1Y0LA 5EDXA 5J3HD 3FO9B 3OZ9H 4FQLL 3L3JA 2CQVA 3X3GL 3IDNA 4XVSL 3E8UL 3VGGA 3ZLQC 5BV7C 1Q9WA 4HWZB 4XNYH 2BC4B 4XNZB 4JLRB 1LGVA 1DANU 1WVZA 3RY6A 5E6ZA 5SWQA 3FB7A 5ID0A 3WE6B 5C86A 4KY1H 3WIIL 2NY6C 1S7SB 2D7NA 1YYML 4ZO8A 4LEXH 3OKNA 3LRSB 1UYWH 5MENA 5C09A 3RQ3A 4PRIA 5E8OA 5DA4A 1ZXQA 1KB5B 1G7HB 2FX7H 2VDLH 4PJAA 1DUYA 2FSEA 3FT4A 4G42B 1NGPL 2GAZB 5AZ2L 1URLA 4L3EA 4V1DD 5E2TH 4K3DL 1JTPA 1G6RL 1VENA 5EUOE 2O93L 1MLBA 5EU3B 5AYUH 4HK3J 3UTPD 4H0IA 3CFBB 2XPGA 1BREA 4XBPA 2Y06H 2JJTC 3QG6B 4JZJB 4F9PA 3EDJA 5EU6E 1CLOL 4YHKL 4MB4A 1OSPH 4GKSA 3VRLE 1JV5B 1ZT4B 4BQ8A 2HJFA 3LPGA 3O2DL 4KKBC 1EHXA 4WI3A 1FLTX 5FF6A 2NY4D 4GAJL 3BPOB 4YWGL 3TN0A 1M05A 4RGNB 3Q6GH 5DURB 3BSZH 3UCRA 2QHLA 1V7MH 3O3AA 4X7DC 1EAPA 3X12A 2X4UA 1IGYA 2ZKHL 3FFCE 2P46B 4PP2B 4AMKL 4OZGA 3LIZH 2YS4A 5GGRB 4D3CL 4LLUA 5GPRA 3TFKD 2CDGB 4XP6L 1A6WH 3BGMA 4FOMA 2YPKB 4MNHA 4EBQH 1NGWA 5KSUA 3IVKA 3RGVA 1MFCL 1AKJD 3MLXH 2NX5B 3GMNB 3X11B 1OGAE 1OQXA 4WW1B 2V2TB 4D94A 4TUOA 4AIXA 2IBZX 5MEPA 4LIQE 1BVKB 4JREB 4BZYA 3D0VB 3RUGF 3TO2A 2EYTA 5AAWA 1MCIA 3KPQB 4LQ1A 2PCPA 1MFBL 1DVFA 1MJ8H 5IESH 3X17A 4IM8A 3VXTA 4L8BB 3HG1D 4MAYD 4X98A 1A7RH 3BUYA 1T1WB 2DQUL 1T22B 3ARFA 3U0PA 2IPUK 5JPNB 3MO1B 1A1OB 3O9WC 4LKCB 4HIXL 1JZ2A 2I5YH 4MWFB 4JPWL 4U1IA 4UI2A 3TIEB 1GXEA 1MQ8A 4WUUD 1GGIL 1XF5B 1DE4B 3QDHA 4QHLB 5HHMB 1WLHA 2XG4A 5ETUA 5IB4B 3HHRB 2CK0H 1UVQB 2CUHA 3HC4L 4HXAL 4XVTL 2KPNA 3MXVL 3PWUA 1EEZB 3LY6A 4Z0BL 1OARH 5D4QA 3JWNC 1DANT 1R3HA 2OTUA 3MSPA 4RBPK 4MD0A 5SWSA 4G6AD 4YHMH 4LLVB 3V6OE 3H6JA 4DOHB 1VADB 4HS3A 4ELMA 4QGYA 3UJIH 4ZD3L 1WBZA 2YPVH 1ED3B 3H7BB 3QNXB 3MLWL 4ODVH 4AEFA 3UBXI 1QPPA 2FCBA 3ZTNL 3OAZH 3TPUA 1BBDL 4NO3B 4NRYB 1AQKL 1P4IH 1WT5A 5J12B 3U83A 1IGJB 4ZG1A 3O4LB 2EYRA 4OZHF 2QSCH 5D1ZD 3MCLH 1NCNA 4JG0H 5KBNC 4OZFG 1OPGH 1JF1B 4U1HA 4PD4J 1QRND 1OP9A 1A3LH 3SDCC 3C5SA 3T65A 4X7EC 5I1IH 5BVJB 2GJZA 1KXVC 5CGYD 3L5XL 1M6OA 3MFGB 1QEWA 4H8WH 2IBZY 4H25A 4YHLL 4P5MA 1HHHA 1G7PA 4JDVA 5GRXG 1S9YA 4HX1A 2WBJB 4ZUUA 2BNQA 5J0BA 4LQFL 4YFEA 3FQUA 4X9FA 2VLKD 3V6OC 1L7IH 5MEQA 3LRHA 1S8DA 5HDBE 3BI9X 5JOFB 1CR9L 4YDIH 1D9KA 1IL1A 1Z9MA 4NNYA 4OLVH 2FEEI 1KG0B 5AG9A 3FB6B 4IDJL 3RZCC 4POYA 3P4LA 5FCUL 1KCLA 2Y25A 2Y5EA 5IIEB 4R4NC 2Q3ZA 1H5BB 1B4RA 5FECA 1D5XB 4JFPB 5FGRA 4QOKB 3PXHA 4P9HL 1T21A 2CUIA 5EIVA 2O61B 1I7RB 1U3HC 4JFFE 1VFAA 4KJQC 5I30H 4HGKC 2VLJE 3BP5B 5GGSA 2F74A 3VFMA 4PRDA 5B21A 1F8TH 3CXDL 4FQQB 3S7GA 1T66D 4R4BB 1M7IA 2OL3A 3UTSD 1MQKL 3F7RA 1XFPA 3HAEB 3BE1H 2G60L 3MCKA 4KK9D 4V2CB 1YPZA 3LS4L 1N5YL 2FATH 4OCWL 4RDQF 1QKZL 1C16A 3G04B 3K2UL 4KKLD 3CX5J 2HWZH 1A1MB 1P2CB 5IEKB 5DFTA 5TF1H 3VGFA 2VABA 5L7XL 1IC7H 5I1CH 2VC2L 2GTWB 1NGYA 1T2XA 2GFBB 4X7TA 4XPAH 1ZGLA 2DIAA 3OKMA 3QQNA 3JWDL 4QHUA 2BVQB 1E27B 4YFLF 2NR6D 2D7TL 4M43L 3F7VA 2VN7A 1KN4L 3QAZB 1S5IH 4PGBA 4ZTPH 2BFVL 1J18A 5MEND 5C09D 3MRRA 4PRID 1BX2A 5HHPA 3HC3H 5AUMA 4P5TB 3R4DA 2FH6A 3QR2A 2R0ZH 4L3ED 4HHAB 5E1AA 1K8DA 1T1ZA 5HI5D 3OKDB 4K7FB 2AJVH 4BELD 1W0VA 2F8VA 1RK0A 1U6AH 8CGTA 4L29A 1IILE 1OY3B 3I85A 5E6IA 3CX5K 5DS8B 5I16B 1YNKL 4WHCA 1JWMA 5CJOL 4JO2L 2EEBA 3PJSA 3ARBB 2XICA 4F2MB 3P0GB 4PG2A 4FTVE 5HDQL 1R3KA 1NDGA 5JR1L 4PJ7E 2VDOL 4R96A 5DD5H 3P4MA 4HWBH 5D9SA 5MI0B 2GUOB 3TN0D 1VHPA 2WW8A 3RIFF 1Q1JL 3QIUB 4I9WD 2KQMA 1INDL 5BZDB 1ZHNB 3KLSA 1E4WL 2GHWB 4K7PL 1N64L 5GS0H 5T1MA 3ULVD 1MWAH 1WK0A 3GGWB 1DL7H 2DQJH 4GQ9H 1KGCE 3RGVD 3GMOB 5E7BA 2RFXA 5EBMB 4G8EB 1CGXA 5J3HC 3MBXL 4JHZA 2D03L 3WLBB 3VFGH 1HH9A 4P5KA 3MRGA 4KTEL 4S1SL 2ICWJ 2W0FB 1DVFD 4P2RA 3TNMB 2Z93B 1KXQE 1FAIH 4OCNC 1UM6H 3U0WL 3MNZB 3ARFD 1J86A 4OM0L 4YK4C 4CU8A 4TN9A 4BK4A 1CYGA 3NIFF 5D70H 3EJZD 4HC1H 5JQ6L 5FYLD 1U42A 1WSST 3VW3H 2CDEA 3WEXA 2GI7A 2N4IA 1BZ7B 3QO1A 4LLWB 1YUHB 3CXHK 4HKJB 3MJ7A 2VAAB 4FXKA 3VA2C 4K9EC 5F97E 2AI0L 3HZKA 3P3YA 5TDOA 5I6XC 5DYOA 5SWSD 2C3HA 2VDMH 4JJ5B 2YWZA 2W0PA 1QBML 4UU9B 3R0NA 4XNUH 3S8WA 5DK0B 1FO0B 3M07A 2MCPL 1BJ8A 5J06A 3S37H 3MLSL 3NACL 1F4XL 4OLUH 2EKJA 2B39A 1UGNA 2PETA 3EFDH 2HFGH 1HSAB 2F5BH 2YMXH 3C9NB 5I73C 2Y07H 4NJ9H 3HUJB 1OCWL 2VDPL 4YGVA 4IOFD 4M61A 1CICA 3BN9C 4ZFGL 3MRKB 4MQ7A 3SJVB 1I1FB 4MJ5B 2A6IB 1OLZA 3QRGL 6CGTA 2YXMA 4NT6A 4OD3H 4UDTB 1RV6X 3DETC 5DDHA 1QFOA 5F7EH 3I6LE 5F9WC 3PP3K 5INDB 1T4KB 1EHLL 5IHZA 1ONQB 5BCAA 5FO9B 3LKPA 1NCBL 3KLDA 3MLRH 3UC0L 4JAMA 1AXTL 2BNQD 4QYOA 5D7JA 2W07A 1PG7W 4F7PB 1FAKT 2EE9A 2VIRA 1RJYA 4FG6D 2CKBH 1D9KD 3L6FA 4MAYC 1UM5L 5IHUL 1NCDH 5F3HA 2E6JA 5DHYB 2ORBH 2HJLB 1UH2A 3NN8B 4Q9RH 4L1HA 4XAKD 4WY7H 4DFHA 4MA3B 5E9DB 4QRRA 3L5WB 1F90H 2PXYC 3FQRB 3IFNL 3P9MA 1QRNE 5K9OA 3GK8H 3DO7B 3FAXA 3IETA 3HFMH 2VXQH 3BJ91 1HHGB 4WGVB 1AQDB 4F57H 1HH6B 1A5FH 1SJEA 1Z3GL 2D7QA 1X6NA 2HVJB 2DIJA 3EDEA 2X89A 2XY1A 4K71C 5T1LB 4ZUTB 1P53A 4ZFZB 4M4RA 5JLZB 4NQEE 2P49B 3EYUH 2PO6B 2DKUA 3MFFA 1AJ7H 2WNGA 2X44D 3RVWD 2B1AH 4WFEE 1KLUA 5I8EB 4X4MA 1VACA 5TH2A 4PBWD 5E2UL 5JW3L 1UB6B 2R2BB 3VXPB 3VXUA 4E0RB 4AT6B 1KCSH 1T04B 1KEGH 3HI5L 5CZKA 4ONFL 5F96L 3VWKD 3TLRA 3QCUH 1WBYB 5I19L 1HI6A 5KTEL 4DKFL 5EBWA 3AAZA 1PG7H 3WD5H 3TBWB 1AIFB 1KCRL 4JDTL 5ACZB 2E9WA 5CEYA 1RY7B 2VB5A 4QTIL 1F02I 3CSPA 5L2JA 3DIFB 4DZBA 5IW1B 5CGYC 3UXFA 2MJWA 4P2QE 4Y4KA 2R1XA 4UAOB 4BZ2H 4ZFOL 4ZMAT 1LP9E 2EDBA 2H8PB 1MRCH 1IC4L 2F54A 2C9AA 1R0AL 1EBPA 5KOVC 5KANI 2VXSL 2BERA 3KR3H 3MRQA 1MEXH 5LCVL 5GRUL 4S1QH 2XQYK 1B0GB 5JQHC 2LAGB 2LU4A 1JMXA 1DSFH 2WIIA 4G8IB 1KPUB 5E6ID 5TFSL 2X6MA 1DCLA 2IPTL 1AXSB 4AL8L 4OLXH 3VFSB 1N7ML 3STLA 2IPUG 4OKVB 2C4FU 1FNSL 5BW7A 5FK9B 5I76A 3CLEH 4GBXB 3CVHH 2OJZL 3PWLA 2IWGA 4Y7MA 2VISB 1D5BA 2DLEA 4YJZL 4PJAE 4RGMC 4ETQA 3O4OB 3OXSB 1UC6A 3QQ4A 2HKFL 4QXTA 5FGCE 4FQ1H 5KSAA 4KK9C 2IALB 1UZ8B 3QDMA 3BD5A 4O9HH 3L3GA 3Q5OA 3E2HC 5I1AA 1RUPL 2CXKA 4P9HC 3MRPB 4H1LA 4OAWA 4JDZB 2VDQH 3P0VL 4WTZA 3S5LA 4XNXH 5EZIL 2VL4A 2IMNA 3UYPA 1S7XA 1KPRA 4P2RD 4FQXB 2VITB 1HXYA 5CIPA 3RWCA 4FQHB 1A7NH 1HHJB 2Y5TB 3RY6C 3RDTB 1Z0MA 4HWUA 4I9WE 4UV7L 2V5TA 2X9XA 3GBNL 4YIQA 1KIQA 3C8HA 1JPTL 4H26A 1CBVL 4M9PA 5IROC 1TQBB 2AEIT 1HZHL 5H35B 4LSTL 2G2RB 3IDUA 3F7QA 3L7FB 4U33A 3TBTA 4Z7VB 3MRBB 4Z7NF 3BX7C 5D7SH 3JWDC 3LPFA 4WUKL 4WIQA 3ZMRA 1NFIA 4A6YH 3FMGH 5T3XL 1LEKA 4GW4A 3FAWA 5ANME 3RIAF 4Q58C 2NXZB 3HUJF 5JPMB 2VLRA 4U1NA 3T77A 4F9PC 5E99H 3CJJA 5B39A 3D85A 3M1BB 4WU5A 4F9LA 4PJ5E 5FGBA 2DLGA 3FQXA 3OAUH 5L9DL 2CLVB 4X5XB 3IFOA 3GBML 1RZGB 1CICD 4RAVB 4YHOH 3KAAA 2GJJA 5T3XD 4POUB 5DR5L 2G9HA 2YZ8A 2HMIC 1AGDB 3MLUH 4PJDF 4N1CA 2OS7A 4XCNA 3RUGE 3T0VA 1CIDA 1NC4B 1NCTA 4ZOAA 3QPXH 1IBGH 1J8HE 1KEML 3TH3T 3E6HA 3H3PL 1I8IB 3EOBB 5IT2L 4YDVB 1TCRA 5D7JD 2ZOLA 2VXVH 3RWHB 4LDLB 1BZ9A 2ITCA 3LVEA 3RKPA 3OG4B 4TUJB 5DD6B 4AH2B 4L4TE 2MQCA 5DMGC 4QRRD 1ES0B 3SY0B 3CD4A 4CDGC 4RAUA 4X80H 4M8QA 2O5XL 3LQZB 5T3ZH 4GKNA 3RP1A 3EYFA 3GIZL 1ZLVH 1FC1A 3QUMA 3SDXF 2AP2A 3BW9A 5D2NE 3CFJA 2X89D 4XVJH 3JWOH 3OHXB 1B2WL 1MI5E 4RA0C 2BNQE 5GIRB 5DC4B 5DHVH 4MDIA 2CLZA 4CKVX 1WEJH 2Y7QB 5MEOA 3BKJL 4MQSB 2R8SH 3EFFB 4O5LH 3V5KA 4OZHE 4DAGH 1GGBL 5I71B 3UAJC 1UFUA 3NGBC 1B0WA 2CK2A 3EAKA 4GKZA 4PTTB 1P7HL 4LRIC 3SKMA 1DLFH 3SGDI 5F3BB 3BMWA 5DQ9A 3VXUD 2HKHH 4XAKE 1LE5A 1BFSA 3QCVH 1HKLH 4DKDC 5IB3A 1GC1L 1K4DA 3LCYA 4UNUA 4J4PA 3HTLX 4ZS6C 3HRZB 4OQ1A 4APQA 4OCRH 5FYKD 2X4QA 5CINL 4RGOH 4JQIL 1D6EB 3QSKB 3V52L 5F93C 2YSSA 4B0MM 1C08A 1YEGL 4F3FB 1ZVYA 5DLML 1SMAA 3Q1SL 1EJOL 1IGFH 4PJGB 4NC1E 5IQ7H 3HE6C 4YH6A 3WNLA 3GMQB 4I18B 4Y4KD 3WS3B 4YC2C 3BOVA 3SE9L 2R4SH 4LNRA 2X5PA 5D2NC 1J88A 4L8CB 1H3GA 2F54D 3C08L 4WEBH 3G5ZA 2OZ4H 4OF5A 3P77A 2APFA 1RMFL 4NBZB 4OT1L 1HHKB 4K3HA 1UKTA 3DSNA 1K85A 1OAXL 4PP1D 5TDNA 3H9HB 5EO9B 1RU9H 4CMHB 3B9KA 4LAQL 3PWVB 1L7TH 3PHOB 4X7CC 4IRJA 3O0RH 4EN3C 1U93B 4PJBA 5KS9F 1SEBB 2B1HH 3BT2L 1IRAY 4HIIA 3O45A 3JV6B 3TC9A 3N1PC 4QXUL 4ZOBA 5ESAB 2DBLH 3IS1X 1BIIA 1UZ6F 3NVQA 3PV6B 5HYJB 3SCMC 2OXGA 4LHJB 4UBDD 4NC1C 2A9ML 1JZ4A 3BP4A 4DQOL 1WIPA 5HYQB 2GK2A 4PTUA 2WWKT 3KYMA 1RJCA 1TVHA 3QH3B 1AI1H 2J88L 1UWGH 3L3IB 3S36X 2NY2B 5KSAD 4HG4J 3FOLA 1JZ3A 3QDMD 5C7XH 3MV7B 4KI1A 3FKUS 2B8OT 4OF0A 1NLBL 4F7MA 1QLRA 3PWJB 4UILL 1E0OB 1YEFH 4WDIB 4Z0XA 1K3IA 2PYEB 1I8KA 2N56A 3VWKC 1JI2A 2LQRA 2AJSL 4FQ2L 3S37X 3CMOH 3T08A 3VFRB 5D96C 1E4KA 2AJUL 5HTSA 3BZFB 2DYPA 3B3IA 4W4NA 4HBCH 2IH3B 3L3HB 1AY1L 4UUJB 2AV7B 1XGUA 2Z35A 4ODXA 3GSVA 3C60A 1YY8A 3BGFB 3EDFA 3VFNA 2OK0L 1T5WB 5J6GB 1I9RL 3QIBB 3UTQA 4PJ9B 1M7DB 4UOJA 1I7ZB 2ENYA 3MA7A 4U1MA 1BAFL 4XNZC 4FP8H 4G43B 4HG4K 3FRPA 5DJDA 3PE9A 2YKLH 4JO3L 4RGNE 5DHXB 2XQBH 4XI5D 5TQ2H 1IGCL 2AXHA 2PTTA 4WRLA 3T3PF 1OP5H 5IB1B 1FVEA 5GJSL 4U0RB 1A21A 1MNUH 3DVGA 3ISWA 4YPGA 2X4SB 1JTTA 2XKNA 1W72H 4Y16B 2HA1A 4OZ4B 1YMMA 2APTA 4P2RE 4Y4FB 4EDWH 2VLRD 1QBBA 4NZRL 1Q9OA 3QUZA 5ILTH 1Z5LA 3D85D 3MV9E 4PGEA 1A9EB 4MLIA 2DICA 2OR7A 1OWRM 1SJVA 3TT3H 2Y23A 1MREL 1NC2B 4FN0A 4UQ3B 3N0PB 4ZXBA 5IOPA 4OBSA 1FV1B 1IAKB 4G8GA 4OLWH 4YXKL 3NCMA 3FQTA 2IPKA 4D0BB 1V3MA 3MRDA 1HSBA 4P9ML 4WI9A 3PGFL 5CGTA 5J1AA 4YHNB 2J8UA 4Y8DC 1NCAL 4UV4H 2AJYL 3BXNB 4JR9H 3QDAA 4HIEA 2H32A 4LU5H 5A2IH 4JPVH 1FIEA 4RMQA 4RGNC 2D7OA 2RIKA 1G84A 3HCVB 2PR4L 4HUNB 4ZNCD 5EFIA 1OT1A 3NIFE 3BRDA 5EA0H 1A6VH 3QUML 3IAGC 1VGKB 4HZLB 4TNVF 1QO3A 5DJXA 1NFDF 4KZDL 3LKQA 4XWOC 4WEMB 1HDMA 1AGFB 1JHLH 5T33H 4BQBA 1OOAA 1MUJA 2MMXA 5DD3L 5T3XE 3GRWH 3BGAA 2DWEB 2F9BT 3DX6A 4JREC 4KAQH 3VE0A 3IGAB 4PJ8A 3C2AH 1HHIA 1JIBA 1PG7X 5F1NA 2EYSB 1DBML 4L9LC 5HHXL 1ZSDA 5DO2C 3SDAC 4L4VB 1H8NA 3QUXA 1G7MB 4JRXB 2YXFA 4LSQL 4ODBD 2AAVA 4W4OA 4XCEA 1WWAX 1EZVX 4NWTH 4JGJA 4XC3L 4XPGL 3KDMA 1YC8A 3ROOB 5EH1A 1GAFL 2XQYG 3ORJA 1FGVL 2XZQL 3NOIA 3EO9L 1UJ3C 4EUPH 5I1GL 3T0EB 3GHBH 4KK5D 1MFEH 4GSDL 1J5OL 2DJ4A 4N1EA 2YBRB 3BAEL 4OGXH 3O8XA 2GSIA 1JGVH 5EOTA 1MCOL 5BRZA 1T1YB 2Y6SD 4NQVB 2XV6B 4Z7UF 5L6YH 1OAKL 1PKQE 5C6WH 1WFNA 1MVUB 3D0LA 3BYYA 5GGVH 4IMKC 2PF6A 3DX7A 1S9VA 1CTOA 4RAHA 4APQD 5TF0A 1KJMB 3J8F7 4WNQA 5FKPA 4NPYB 3F12B 5CMAA 4N5UA 2NY1D 4XPHL 3CCHB 4PRNB 1FSKB 4FFYL 3CVIH 4JVPA 4M7ZC 4U7MA 4YBLC 4POZD 4Z76B 3VFTB 1DEEA 1DQMH 1FBIL 1JWUA 1RJZA 1A1NA 1P6FA 5TE4L 5DJ2B 5TDPB 3QDJA 3FT3A 3DRTB 1UKSA 4LMQI 4NO5A 1U58A 1PVHA 3ILPB 2XTJB 2QQQA 1J1PL 5DJ8A 3PQYB 2FO1A 1DQLH 2E9IA 1DBJH 3VXUE 1QUNA 2A6JB 2BVPB 4K94L 2P8LB 3B6SB 3P4NB 4KKAD 3WXWL 1RFDH 3B9KD 1XGRA 4JY4B 1R5IA 5E5MA 2NW3B 2UWEF 4NKQB 1NBVH 3AGVA 1TZHA 2DQHL 4IRJD 4X0KB 5GSVA 3DXAA 2P5WB 4MX7A 3SKOB 3ARDB 4Y19B 3F6LA 2VXTH 3ARPA 2FBJL 1X5ZA 3S5LG 4G9DB 2X40A 3WXVL 4NSKA 1OT2A 4DN4L 5KAQF 3B8SA 3CLFH 3KPSB 4JE4B 5HYSA 4M7LT 1OP3K 1EZVY 3GJEB 3S35H 1DZBA 5I1EL 1NAMB 3ES6A 3O2WH 3V8OA 1MHPH 4Z8FH 3S9DB 3OKLB 2UWEA 1MH5A 5BZWB 3RL1A 4JZNB 2XNAA 3GNML 1XH3B 1AGEA 3L95B 1S7QA 5IFAH 5GS1B 1MFDL 5H94A 4NKOA 3W0WA 2V7HB 4GG8A 5E94B 5ITBL 5E4EB 1NEZA 3MV8A 2FX9H 2BP3A 5C07A 1UXSA 2NLJA 4GMSL 1EEUA 4YHYC 3QXVA 3F7YB 3IJHB 4MA8H 2DYPD 4P57A 5BVPH 1U91A 1JWSB 2WUCL 1AGCA 1MAMH 3LHPH 1P4LA 4N0FA 1T20B 3C60D 3O6FC 4C56E 4I3GA 2HYMA 2R23B 3NZHL 1YYLL 5C0BB 1GC1C 4JB9H 4MA7L 2GSGA 4G6FB 5I17A 4P3WA 2QQLL 4J1UB 5LXGH 3MJGX 3KPRB 2GW5A 2ZOKA 3ZSTA 4CADB 5EC1B 2EXYC 4M7JL 3N85H 3QAZC 4U0QB 2H6PB 3KXFA 4ZAKC 1KFAL 4B7LA 3G6JF 2F58L 2D0HA 4YZFF 2MKWA 2ZUQB 1UCTA 4KDTA 3VU2A 2H2PC 1IC5L 5DJ6B 1BQHG 4YO0B 1LO0H 3QUZD 5C0AA 3S34L 2EKSB 4I5BA 4JJHA 4FHBD 4CN1A 3VWJA 1QSVA 5H37G 1I1AB 3QUYC 4HKXA 5IHLB 3GI9H 3TJEH 2VH5H 4JM2F 1JZ6A 5KVDH 4MVBD 1A7PL 1Z0NA 1NAKH 4I3SL 1NGZA 5CWSB 4G8GD 3SKUD 1GOGA 1DDHA 3D39A 3ARBC 3ARXA 4YBHA 3G6JA 3WDJA 4MA1B 2EDDA 3GSNA 4BSVA 3BRGC 3QEHA 4N1HB 3BWAB 1XCTB 4NOBA 5JO5A 5DMYA 4TSAH 3LZFL 1CN4A 5IVZB 1S7TA 4MJ2A 4LPYA 2ATKB 2VLRE 3TVMC 3DGGA 3SKJH 3VGAB 4OZIF 1ZHKA 3FJTA 3RA7L 3G6AA 4WFGD 5A2JH 4Z7NE 4K07A 5AD0A 3DBXA 1OAYH 3EYVB 2GTZB 1LK3H 4PJ8D 4N68A 1YNLL 4PRBB 4IBLT 2Z31D 3OSKA 3RBGA 2DB8A 1ZANH 3KPNA 4WWKC 4Y2DB 1QHPA 3QJHA 2ILLA 2EC9U 2FECI 3HUJE 1T0NB 4NWUL 4OZIA 2P8PB 1C5DB 4QXGL 1U8KA 5KVFH 2E7BA 2IH1B 4KVCH 4OIIH 5B8CA 3REVB 2NY3C 2WQRA 4N8PA 1AO7B 3F8UB 1VFBA 1FORL 3CU7A 2EDYA 5IMLA 3O8XD 4PJDE 5B3JF 3MREB 5BRZD 2HT2C 1IM9B 1RZ7L 3ZE2F 5CZXD 2F53A 4R97B 4X7FC 4YHPA 3I3BA 4PB9H 3IU4L 2VDKL 4D9LH 1SVCP 5CEXB 3VI4F 5DQDH 1IQWL 3VFUA 1VFOA 2R56L 4DCQA 3FFDA 4NQXA 5E00B 1NL0L 3VRJB 3HMXH 3CZFA 5ADPH 3V7MA 3PGCA 3DMMB 2FX8L 3GMMB 1GCFA 2MOVA 3MRMA 4BH8B 1A47A 2CKBB 1WBXB 3IDGA 2C3WA 3ULUH 1K5NB 3QDJD 1CLZL 3D3VB 2ADJB 3MYJA 4NO0B 1DLHB 1JNLH 2BSRB 1I4FA 4ELKA 4ODSL 2E27H 4I3RH 4QRQA 3O2VH 5FO8A 3T0WA 3VD4A 3LKOA 3SDDC 1FE8L 3O6LH 2QSVA 2DQFA 5C9KA 5IMKB 2CGRH 3QQ3B 4JY6A 4MD4A 3SDXE 4LCYA 4P46A 2D31B 3GJFA 1PGRB 2VXUL 3DXAD 5F7DA 2IQAA 1K8IB 1ZA6B 4X6BA 3TESA 4QCIA 4U3HA 3IKKA 3NZ8B 3BKYL 3NAAL 3LB6D 4OLZL 5C2BH 3GI8L 2R1WA 5CJ8A 3TNNA 1HXMA 2XZCL 3GKWL 5D1QA 4MHHI 1U36A 2IFGA 3PABB 3FO9A 3V8CA 4M7LL 2VKXA 2CXGA 3OZ9L 1AD9B 3SN6N 1YJDL 2DQEL 3CH1A 5BMFH 4OCYH 4TQEH 2CKNA 4KK5C 4NZUL 1QSFE 4JLRA 4XNYL 1SYVB 3OPZH 5FHBH 1W0WA 3FRPG 1KNOB 3WE6A 4EI5A 4KY1L 2EC9T 1S7SA 1G0DA 1I1CA 1SEQH 4LEXL 4G7YH 4I77H 3T4AA 3W0WD 5CLWA 5GISH 2HTKD 2PO6C 4QHMB 1UYWL 1T7XA 3W11D 1KB5A 3PHQB 2DL9A 3MV8D 2FX7L 2NQCA 2VDLL 4HFUH 4U6XA 5C07D 5CJ5A 2X1QA 2NY5H 3CFIC 2X4RB 3DRQB 4U6TA 5E2TL 5SX5H 1U3YA 5IP4A 3I75B 1XT5A 2RHEA 2ZCHL 1CD9B 5EU3A 4XHQA 2LFGA 1CGVA 1RIHH 5AYUL 1CDGA 1CXEA 1D5MB 3SGDH 2Y06L 1ZTXL 1N0LA 4I0CC 4WTXA 5AZ2H 3A6CH 5KS9E 2C7UB 1KF9B 1JV5A 1OSPL 1ZT4A 5DK3A 1GJIA 5L8LB 5DRXA 4KKAC 3KXFD 1UZ6E 3B9KC 3VXMA 4MNQB 1UXWB 2AKRB 3BSZL 1KULA 1V7ML 2GJ6B 1V3KA 2LTQB 1YEJH 3I2CH 1NSNH 4PP2A 5GGRA 5FA3B 5C0AD 4QRPB 3LIZL 1GL4B 4LCWA 1CDUA 1T1XA 3VWJD 4FABH 2YPKA 5IM7B 4EBQL 4UOW1 4YWGH 3WUWG 3SO3B 4K94C 3X11A 3MLXL 4WW1A 2V2TA 4Q74A 3MRCB 3RIFK 1BVKA 3D0VA 4GW5B 3D39D 1CVRA 3KPQA 4BFBD 3AY4C 1YEEL 5E5RB 1FL6A 3SDYL 5FUZH 5IESL 4WO4A 3QXTA 3S3JA 1PQZB 1L9MA 5JHLH 4LCUA 1T22A 1A7RL 1S7UB 5JORB 3JVGA 5JPNA 4ZDHB 1VKXA 3P73B 3MO1A 1A1OA 4G80B 4PBVC 2VZVA 1YN6B 3TIEA 4Z7WB 5J9PA 3IXAB 5IB4A 2CK0L 1WTLA 1I85A 2FJFA 4BQCA 5IV2B 3KWWB 3LEXA 1OARL 3OMZA 5ESQA 2GK0B 4HSQA 4RWYH 5GSRB 5A3ID 3HNVH 4JPWH 4GS7B 4ZYKB 3T3PE 2OLDA 1GGIH 4A6YB 1JGUH 4YHML 3CFKA 1VADA 4DVBA 1R3IH 4JQVC 4HXAH 4XVTH 4FQXC 3OWEA 4PY7A 1JUFA 4R26H 5JDSB 5JUEL 3UJIL 2OJEA 3H7BA 2YPVL 2XWBB 5LBSH 2H3NB 4N9GB 4ODVL 4E41B 1LEIA 1UWXH 1FYTA 4GOSA 4NO3A 2JIXB 5DRNB 3V0WH 2GCYA 5HXMA 1P4IL 1IGJA 4O2FB 1C5BH 3O4LA 3HI6H 3NFPA 4NC2B 1E28B 4LVHC 4XWGL 3GBLA 1JF1A 3MCLL 4G6MH 4JG0L 4I48B 5T1KA 1OPGL 3AS2A 3MLWH 1A3LL 3MJ9H 3ZTNH 4LDEB 3MRJA 2HFFB 1BBDH 5I1IL 1HIMH 1ZVSB 4LCCB 1IE5A 4NKMB 3SE4A 5TQ0H 4H8WL 4NRZB 1JPFB 2WBJA 2QKIB 4LVEA 2NXZC 5IB5B 2XN9E 3IDYB 3MLZH 2FO4A 2CIIA 2BSTA 4D0CB 1CDCA 2CJUH 3UO1L 2AK1H 4PR5A 5JOFA 2D2OA 2VO5A 1X9QA 3L5XH 1XF3A 3OJDB 4YDIL 3S35X 4OLVL 2X7LB 4Y5XB 1NFDE 3DVIA 1WZKA 4JFDB 1RZKH 2IGFH 3FB6A 4FFWD 1EGJH 5BJTA 4F7TA 1YEDB 1N59B 4LQFH 1KLFA 3QIWB 3IDIA 2AS5M 2W65B 2DD8H 5GGVY 2EICA 1I7RA 3SGKC 3I6GB 5EOQH 5FYJD 3O3BA 4UTBH 1G0XA 3BP5A 5I30L 5CP3A 1MY5A 4P46D 1F8TL 1FZMB 3FB5A 4R4BA 1IGIH 2P24B 3VRIB 2Z31C 4Y4HA 1T5XB 2EEAA 3BE1L 3QJFB 3VXNB 3WFEH 1JL8A 2NY0B 5JW5B 5D1QD 4W4OC 5ISZB 1G7IB 2R2CA 2FATL 2E8YA 3G04A 2RGSA 4KU1A 4Z7UE 4TTDC 1A1MA 1P2CA 5IEKA 2HWZL 3FN0H 2MNUA 3KYNA 3DYOA 1IC7L 4O2CA 2VLLB 1I9IL 1U8QB 3C2SA 4Z77B 2BVQA 4NO2B 2V7NB 4EI5D 1N5YH 3PHSA 3KPOB 4X8JB 1S5IL 1KACB 4BZ1H 4ZTPL 4UZGA 3WIFA 5IJKC 1T89A 2X4OB 4C4KT 2VNCA 1AP2B 4NRXB 1S7VB 3T2NH 1CDHA 3HC3L 3ARGB 4P5TA 3KS0H 2R0ZL 2BVEA 4HHAA 4OF8A 4JKPH 3OKDA 2YD1A 1KN4H 2DJSA 3UMTA 2AJVL 3VJ6A 1U6AL 5CCKH 4OFYA 4IIQA 4KRLB 3ZKMC 4ZODA 4LSSH 3FO0H 3FRUB 3VCLB 1QR1A 5FCSH 2UWEE 4N8VB 5FUOL 1XIWC 4NN5C 4XH2B 3UTTA 1IKNC 5D93B 3LKRB 5J13B 4AG4H 5BQ7B 4I18C 3HZYB 5DD5L 2GUOA 4HWBL 2QLVB 4N5ED 4WW2B 5DURD 3VXMD 3QIUA 1J0IA 5B38B 4EEEA 3MV8E 3M8OH 4Y1AB 4Q6IC 3U9UA 4NM8H 5IJVA 1NMAH 3ULVH 1YY9D 4LCWD 1ZOXA 5GS0L 4N90E 4YX2H 3GGWA 1MWAL 4LHUD 4JO1H 1DL7L 2DQJL 3KYKH 2WLYA 4GQ9L 5EBMA 4G8EA 1MCSA 1MCWW 1EPFA 3VFGL 2PW2B 5FUCE 3D6GA 1DQTA 2W0FA 3WBDA 2EDEA 2Z93A 5DXWA 3TA3B 1X4XA 5E1HB 4DK3A 4WO4D 3P4OA 2DKSA 3EO0B 5F71A 1FAIL 3MRNB 1UM6L 3MNZA 2AXGB 5GS0D 4KROB 1U8LB 4L5FH 1BJ1H 5DFVD 3ME0A 1JPGB 5FYLH 2D03H 4XGZB 2HTKC 3MRHB 5D70L 1TVBB 4HC1L 4RNRB 2H41A 2R29L 4KTEH 4S1SH 5C0AE 1ORQA 1NGXB 3OKEA 5IFJB 1YUHA 4HKJA 2MCG1 3BZ4B 3AU1A 2VAAA 5IW6A 3O11B 5JOPE 2D9CA 5GZOD 1KSRA 1TETH 3PNWA 3O41B 2AXFB 2X41A 3VFPB 5D1XD 3D39E 4YHZH 3MQIA 5E2WH 3G6JE 3H9ZA 4JJ5A 2QADD 4MD5B 2VDML 4JFEA 4UU9A 1O5DT 3P30H 1CTNA 4YZFE 4XNUL 5INCB 5FM4A 3IDXH 5FUCC 4PJEF 3N50A 4NQCB 5DJCB 2ICWB 4OLUL 1FYTD 3C9NA 3EFDL 2HFGL 2YMXL 2E7LC 2Y07L 2OR9H 4NJ9L 4LPVA 2CMRH 1BM3L 3QIBC 4ORGA 4KHXH 4MJ5A 3GM0A 2A6IA 5H2BB 4W70A 5C8JB 1ODAA 3RIAK 4OD3L 5I2IB 3G9AB 4WHDA 5T1KD 5F7EL 2IANB 5C2UB 4P4KB 3GSUB 6FABH 3VXOB 3RTQA 4NBXB 1T4KA 2IG2H 1LWRA 3BPLC 4LDOB 1X4ZA 5FO9A 3QNZB 4WI8A 2EDHA 4P23C 2EO1A 4PJEA 1FFRA 1X5YA 4WHTB 1IAMA 4IOIA 3MLRL 2WBJD 2HT3C 3X3FH 4XHJD 1G7LA 2EIZA 5LAXB 1YQVH 4GFTB 4OZIE 1KJ2B 1IEBA 4PJCB 3D18B 4LOUD 3KLAB 3TO4C 3S3SA 1NCDL 5DHYA 1BBJB 2ORBL 3GO1H 3IXTB 5C0CB 4KUZH 4MA3A 4AQOA 3RI5F 4WY7L 3L5WA 3FQRA 4L4VE 3MMEB 1V3LA 4JM2C 5E08H 3GK8L 3ARWA 3HFML 1HHGA 2VXQL 1AQDA 3JBG7 4NBYB 3MYZA 1HH6A 3O3EB 4XNMB 1EA9C 4F57L 4F37F 43C9B 5A3IC 3QRFM 2OL3H 4ZFZA 3QWRA 1I75A 1BF2A 1ZS8B 2ZJSL 2GITA 3KPMA 3EYUL 5HPOA 1AJ7L 1TPXC 4Y4HD 5BV7B 2B1AL 4HIJA 5I8EA 4IEFB 4EUPB 5IEHA 5I1DB 1UB6A 3VXPA 3DVNB 4FQIH 4LBEB 5B3JE 2NY6B 5FEBA 2N7BA 3BQUC 3HMWH 1T04A 3QQ9C 1TVDA 1KCSL 3ZE2E 1CG9B 1KEGL 5TE6H 1HK6A 5HVWA 4GUPA 3QCUL 1CDJA 4YAQB 4JQXC 4UDUA 3WD5L 5HVGB 3VI4E 3U36A 2ITDB 3DJ9A 3DIFA 5IW1A 1KPVB 3JUZA 3NCYP 3QFJA 2NNAA 1FFQA 4BZ2L 2H8PA 4AM0A 3BYTA 1MRCL 1WIOA 3PQYE 4Z95H 1YECH 4ODWB 3KR3L 2O26U 1MEXL 2J2ZA 4FXGB 2C3GA 4OI9A 1DQDL 4S1QL 1PEZA 2GEEA 4DJMA 4MJIE 4G8IA 4FQCH 4CMMB 1KPUA 4OFYD 3WO4C 2P5WE 5E8PB 4NZTH 2XXMB 4G3YH 1UWEL 4FFWC 1AXSA 1I8LC 3LSOA 4F15B 2VXSH 4H8WC 3UTTD 4HS6A 3DOSA 4OLXL 3WFBH 1NLDH 3KPSE 1RUAL 2UYLA 4YDLC 3HS0B 3ARQA 3CLEL 1U8IA 5TGBB 5HHOA 4GBXA 1X5AA 3OAYK 3CVHL 1ZHLB 2VISA 4IRSB 5TFSH 5CBEB 4AL8H 5TJWK 3MOBH 3HA0A 4D8PB 4GAYB 2V2XB 5EUOB 3OXSA 1H3PH 4TSCH 1NCCH 2G5RA 3V0VA 3REWB 4FQ1L 2IALA 1UZ8A 2BDNH 1YMHB 1ZT1B 3FTGA 5EU6B 4PYHA 5F1SA 4R2GC 2VE6B 5DRWA 3NA4A 3MRPA 3MX0A 4JDZA 1N8ZA 3V95A 4PV8A 2VDQL 4PY8J 3W9DB 3LKNB 3I6KA 5GGTH 3WN5A 3ARDC 3I84A 5HYIA 4F7EA 3RWIB 1K2DA 4XNXL 5T1DH 3MLVH 1XCQB 3MJ8A 2DWDA 3FFCB 2Y5TA 3RDTA 1A7NL 5JXAH 1JI1A 1FDLH 1L0XA 4LLDB 3MLYH 3TZVA 5HGBB 4CVZA 1RK1B 4GRWH 5H35A 5EIIB 1BD2E 4F7CB 3L7FA 2W38A 4Z7VA 5F21B 3U6RB 3MRBA 2WP3O 1FFOB 3IFPA 5MHSE 5D7SL 1F58H 3TCLA 1XF4B 8FABB 3FMGL 2WV3A 5EU5A 1TTFA 3MLTA 1J8KA 3WNPA 2ZG3A 4JFED 1BZQK 4U6YB 4YR6B 5JPMA 4JRYE 5GXBB 3KHQA 5E99L 5C08E 2XWTA 3SDCB 1F6AA 3C6SA 3MROA 4KXZH 2JCCF 3DHJA 3QNYB 3G6DL 1ND0A 4YDKH 3OAUL 2CLVA 4X5XA 4N5EC 4RAVA 2P7TB 4YHOL 2X1OA 2X1XR 1EFXB 3U4EB 4QF1A 5I1HH 3NFNB 3RVVD 2B7DT 43CAB 4AEIH 1FNFA 2HFEB 3RTQD 3RX7A 3OKKB 3UP1A 5ITFB 3QPXL 1IBGL 3AB0C 4NQUA 1I8IA 2CSPA 3K7UA 1FFPB 3PF2A 1T83C 2WAHA 4YDVA 5DEFB 3RZCB 5I0DA 2PYFB 3RWHA 1BOGB 5IVXA 2VXVL 4NYLA 5KSBF 2NZ9C 3HAEG 3VDCA 2AERT 1I1AC 4WO4C 5C9JA 5ICZA 2M2DA 5GS0C 1U3HB 2K9UA 2ZZUT 3FL7A 3JVGC 1FNEB 1YNTB 3T2QA 4HEPG 5JA9A 1U8JB 5ENWB 4HK0A 2FIKA 1ES0A 4JHWH 4P59H 3SE8H 4MXQD 4WWID 1BECA 1BQHB 4MA1C 3ETBF 5CD5D 3OXRB 2IJ0C 1N4XH 1GH7A 2ERJC 2YD5A 1MCCA 4X80L 4WI4A 1UKQA 2VZOA 4GMTH 4JFYA 5GJTH 4EZMA 5T3ZL 4TNVK 3IAPA 4TVSa 4HJ0D 4XVJL 1C7SA 4JM4H 4ZO9A 3QWRD 4OJFH 5D1XC 4A2LA 5C0IA 2YEZB 1R6VA 3ZT5A 1G7JB 4U1GC 4LEOB 2Y7QA 3HE7A 2HAZA 1WEJL 3IDMA 2IEPA 4LSRH 3EFFA 1FGNH 2R8SL 4NUGL 4O5LL 1NJ9B 4WU7B 4DAGL 3QULB 3VH8B 4PTTA 4GXUM 1R3JB 5F3BA 4XPBH 1DLFL 5T3ZD 2CUMA 3QCVL 5FYKH 3RU8H 1HKLL 1X44A 5FOBB 4JFFB 3HRZA 2ZSWA 3OR7B 2VLJB 3RX5A 3BKJH 4OCRL 1D6EA 4GXVH 4RGOL 5F6IC 9CGTA 2BY3A 3IU3B 1B9ZA 1HQRA 4OF6A 4F3FA 3ILQD 4UIKH 5IMOB 3ECBB 4HKZB 2VOTA 4PJGA 1IGFL 5IQ7L 3GMQA 3QFJD 5HGAA 1H3VA 1ZEAH 2R4SL 5EU7E 3V6BR 3VD9A 4PG9B 2H2SD 3HPJB 1E4XI 2R2EB 1WZMA 4JQIH 3L9RB 4PGCA 2SEBB 2WM0A 2JJUA 4LLAA 4OUUB 5J8OA 4MB3A 5BS0E 2AQ1A 5EO9A 1RU9L 4R97C 1RZFH 4JCMA 1CDIA 4CJ0A 3KLHC 2D0FA 1L7TL 2CLRB 2WMPA 3DSFH 3O0RL 1HYSD 1TTUA 1K3ZA 1RMFH 4K7PX 3GSXB 5HPMA 3GSRB 1NQBA 2B1HL 1NPUA 3PV6A 5D72L 2DBLL 4GG6A 5HHOD 1JPSH 2DTMH 4GBXD 1ORSB 2AK4E 1S7WB 3PIQB 4R6UA 4X6FB 1KN2H 3E0GA 1KTLB 4NNXB 1BQSA 2YRPA 3G5XA 4HQQH 4ZFFB 3HNTH 3OGCA 5EU7C 4EDXB 3QHZH 4JN2B 4HIHB 3MRFB 2FEDD 2FEEL 1AI1L 3AROA 1UWGL 3KJ4C 2LABA 2IAMA 3P9LA 4LPCA 3MV7A 5C7XL 4H1LH 4X5WB 4OIAA 1LNUB 1RHHA 4HUXB 3PWJA 4M48H 3UX9B 2Q76A 4FTVB 5JNYA 4WDIA 4PJ7B 1QQDA 3L1OH 1YEFL 4HWNA 2PYEA 4GRMA 4UQ2B 1NBYB 2JB6B 4R7NB 5CIPH 4L8SC 4MS8C 4PJHA 3CMOL 4HPOH 1EO8H 2WBWB 3BKCL 3BZFA 3RDTD 3KPPB 4L8DB 1G1YA 4V1DB 3L3HA 2VSDA 3F58H 2AV7A 3OL2A 3TZVD 2MKLC 4YNYB 1I7TB 4HFWB 4HGMA 3OKOA 5I6XB 4NUJB 3EZJB 2RB8A 5J6GA 1VEMA 4PGZA 4PJ9A 1M7DA 4FQ2H 3ZTJG 1MELA 4F33A 4YPJA 4CVWA 4U7KA 2ZSVB 4FP8L 4TOYH 4NKIH 2YKLL 4MNQE 2BSSB 1X5LA 2XQBL 7FABH 3FO2B 1RPQA 2ED8A 4XNQB 4KFZC 5I73B 3T0DA 2DKMA 2NY4B 3NFSL 2HTLD 2WANA 1MNUL 2WWKO 4K7PY 3LDBC 2DAVA 3CX2A 4Y16A 1I9RH 1HILA 1W72L 4OZ4A 1XR8B 4QRPE 3Q6FA 1VGEH 2Q6WB 4EDWL 3L3KB 5ILTL 4JO3H 3A6BH 5E7FA 1P9MC 3EYQD 3TT3L 1NUNB 2Z0BA 4PV9B 1FV1A 3TP4A 4DGVH 1A6TB 1IAKA 2KUTA 4Q97A 5BXFB 4D0BA 4NZRH 2EDKA 3VMOA 5DUBB 3I9GH 2FWOB 4YHNA 3BXNA 3HG1B 2VLMD 2HFTA 4UV4L 4JR9L 4LU5L 1CLYH 4MAYB 3TBYB 4JPVL 5FXCH 2WWMC 1NH6A 2V17H 4JFEE 2BXZA 2BNRE 2VERN 3EJYD 2LTQC 1AHWB 2GIYA 3QB7C 1QA9B 4WUUB 5D2LF 1ZGLP 5HHQB 3MBEA 5EO0B 4CVUA 4HZLA 4JPIB 1A6VL 4PJXF 5EA0L 2A74B 1KT2A 3H3KA 1NCAH 3IJSB 4XZUB 1H3XA 1F2XK 4KVNH 5HSFA 3TT1L 3SO3C 3ZZ1A 5T33L 1JHLL 2DM7A 3PL6C 3GRWL 3ZSSA 3JTTB 5CD3B 1EUTA 3IGAA 4KAQL 1P6AB 4MCYB 4QY8B 3C2AL 1JCKA 4I2XB 4P49A 5AWNH 1CFQB 3QUMH 2OR8A 4KMLB 3GHEH 4P0DA 4KZDH 1F4YH 4UT7H 2VMFA 5HHNA 4CW1A 4PJEE 5DT1H 2ICEB 3BPNB 4ETYA 1SQ2N 4PGDB 4NWTL 3U9PL 1CWVA 4RZCB 5I1JH 1VB9A 1I7UB 4Y89A 5SWZA 3HE7D 2M8XA 1Q0YH 3DV6A 2VQUA 2Z8WC 3GHBL 5D1ZB 2YBRA 3QHFH 5CHNB 4PJFF 3C5ZC 4OGXL 2HVKA 1JGVL 1QRNB 1T1YA 5C0FB 4J3OC 3OAZK 4KRPC 5L6YL 1G6VK 2COQA 4G6JH 1MVUA 2IADB 4HD9A 4NCDA 3TJHD 4GS7C 3KPLB 1HINH 4M9OA 1KJMA 4X4XB 1ZLSH 1XR9B 1KJ3H 2P42B 3F12A 1J5OH 5GGSY 3CCHA 4PRNA 1W0YT 3CVIL 2EDNA 5EO1B 3QWQB 1JGDB 3RTQC 5D7LE 4M5ZH 3ULUF 1DQML 1CGWA 4WFHD 4JANB 4PJFA 1IC1A 5DJ2A 3ZL4H 4UB0H 4XXCC 2A0LC 3DRTA 4ZQKA 3RWDB 1OW0C 3ILPA 1F3DH 3BIBX 1NMCC 1GGCH 1RQ5A 5A1AA 5T3ZE 1DQLL 2BVPA 1DBJL 2A6JA 3P4NA 4OFVA 3B4NA 1BWMA 1RFDL 1JNHB 1NBVL 1OVZA 4X0KA 5TPWL 1EHNA 4HKBB 1BMGA 3AREA 4P2QB 4ZS7H 4X7SL 4RGMB 3SKOA 3QISA 3AS1A 1LP9B 3E3QE 4NFCA 4OZFA 35C8H 2DDQH 2VXTL 3UTSB 2NYYC 1S7RB 5A2LH 3QFJE 3CLFL 3BZEB 3WXWH 4PRAB 4M6OH 1L6XA 3BH8B 4HJ0C 4X99A 1E6JH 2HH0H 1Y0LB 4ZUSA 4EXKA 3O2WL 3L3JB 1MHPL 5FKAB 1I8MB 3N9GH 3MZGB 1CQKA 1Q9WB 4JZNA 2NY2D 4DN4H 4IMLB 5FV2A 2IAMD 2ZG1A 4ZNEE 5HBBA 5SWQB 3FB7B 5BO1L 2XI9A 1LO2H 3T0BA 5IFAL 3OKNB 4M3JA 2PYED 3JWOC 3OKYA 3P11H 5E94A 1KCKA 4PRIB 3DECA 5EBLA 3D48R 4PJAB 2FX9L 4P2OA 1DUYB 3PWPD 2FSEB 5E24E 5HHOE 3FT4B 3E3QC 2FJHA 3F7YA 3IJHA 3ZE0F 4MA8L 1QR4A 5BVPL 2BVUA 4K8RD 4LKXB 5FGCB 4G9FA 3LHPL 1T20A 4XTRC 1MLBB 5C0BA 4JB9L 1S3KH 3U82B 2R0KH 1TENA 4GMSH 3KPRA 5LXGL 4RX4A 4CADA 5EC1A 3V5DA 1EBAA 4PRPA 4HUWA 2HJKB 3NH7H 3N85L 1VPOH 5DTFB 1A2YB 5FF6B 1LE9A 2B0SH 3TN0B 4YLQT 4LFHG 4Y16D 1A9BB 5HI4D 1MHEB 3QXDB 3X12B 5CEZD 1CCZA 1IGYB 2D7PA 4YO0A 5DJ6A 4S1DC 1LO0L 4LLUB 1OWWA 2Q86A 3BMVA 4UTAH 2JJSC 5KSVB 4UOW0 1HCVA 3BGMB 4MNHB 1NGWB 3TJEL 2VH5L 2X05A 3IVKB 3RGVB 5KVDL 4AIZB 1BFTA 3M17A 5CWSA 4HEME 5MEPB 4HV8A 4M03A 5JXEA 4R9HA 4Q9BA 2PCPB 5D93C 1C5CH 3RL2B 5IBTL 5J13C 1DVFB 5ACLA 4ZSOE 1XCTA 3AMLA 5JW4Q 5DQJA 1FHGA 4WGWB 4X98B 4C57C 3THMH 5ICXA 1KYOJ 5IVZA 3U0PB 4GKOA 4TSAL 4PJ5B 3G5VA 1RUMH 1P84J 2QR0B 3LOWA 2OTPA 3ZT7A 1RIUL 1GRWA 4Y2OA 3SKJL 3FCTB 3OBAA 2FZ3B 3MBED 1XGTA 1ERNA 3N1QC 5DZLA 4N0UA 1REIA 4WFFD 3RUGB 3SOBH 3R0MA 3U46A 4N0YH 4Y5YC 5JIHA 3DYMA 5CAYB 1TCMA 2GTZA 4JG1L 1OAYL 2BHZA 1J8HB 1WAAF 4MD0B 5SWSB 4WV1A 1LK3L 3WFCL 4KTYA 1J1OL 4PS4H 3CK0H 2A73A 3LD8C 4FNLH 1ZANL 4HS3B 4X9HA 4ELMB 2HN7B 4KDWA 4PB0H 4MJ6B 2VLME 3L3DA 1WBZB 2HP4A 1F6FB 3NGBB 3V4VH 1HCFX 1T0NA 2W60A 2VL5A 4KROC 5I66A 2NZIA 2P8PA 1C5DA 4MNGE 1TMCB 4X83A 4L4TB 4ORZC 4Z78A 2IH1A 5KVFL 2HTLC 3UYRH 2JCCE 4KVCL 4OIIL 3UTOA 4PREA 1AO7A 5SWZD 2MFNA 4PLJC 4CRPA 1A6ZB 1A4KB 5EWIH 4AYFA 2I24N 3MREA 1Y6MR 3C5SB 3U0TB 4TPRL 3T65B 5IMMA 1MIEH 4N0CD 5IFHH 3HE6B 4XPFH 1A02N 5GGQH 4LLYB 2Z8RA 5IK3B 3KGRA 4IDLA 4YC2B 1QEWB 3U30C 5ESVB 3GMLA 3NCYS 4PB9L 1MI5B 1HHHB 1SY6A 4JDVB 1F3JA 1S9YB 5A16B 5CEXA 2BNQB 2O5YL 5DQDL 3FQUB 5T5NF 1YDPB 4BH7B 1GOHA 3TYFB 5KSBE 3HMXL 1RZ7H 1S8DB 5ADPL 5C0CE 4NNYB 5HI3C 2IFFL 5SX4H 4BH8A 5K9QI 2FHCA 1WBXA 4GXUN 2Z9TA 3EJYC 3ULUL 4YQXH 3PG2A 2XWJB 5KAQG 4EN3B 1OAQL 2ADJA 4LPUA 1DLHA 2XTJD 4FQJH 2ADIB 2BSRA 1JNLL 5IGXL 1QFWI 3BIKB 4NHCH 1U95B 4I3RL 3O2VL 1SBSH 2M1KA 1T21B 3EOTH 3O6LL 3RVUD 3WJLA 5DJ0B 1VFAB 2CGRL 4I0KA 3IKCB 5GGSB 2F74B 4PRDB 3ARED 3CFCH 3Q3GB 5HHVL 1ZA6A 1EGJA 1M7IB 2OL3B 3ROLA 4ONHA 5C2BL 4X5LA 3WFHA 2P5EA 1UCBH 4HMDA 3PABA 3GSOA 1XZ0A 2ICES 2YUXA 1AD9A 4NFBA 2VXUH 5D71H 2VABB 3HE7C 1MF2H 1UM4H 3VWKB 3FZUC 5BMFL 4J3UA 4OGYH 5IR1A 4OCYL 1NGYB 4TQEL 1D3CA 3F6IA 1SYVA 2OMBA 5D96B 3OPZL 4QHUB 3VDBA 5FHBL 1KNOA 3PDDA 1N5AA 1QLFB 3F7VB 3IS0X 1FZOB 4M7LH 4PGBB 1SEQL 4KKCD 4G7YL 4I77L 1KIRB 5F9AC 1YJDH 5GISL 2DQEH 3T09A 3MRRB 3U48A 1BX2B 5HHPB 2A9NH 3WUZA 4NZUH 4P2OD 4HFUL 5FA4B 2NY5L 2NTSP 2X4RA 3DRQA 3LH2H 5E1AB 5IB2B 1SYSA 4G9FD 2FNBA 4L29B 1KTDB 1LD9A 1RIHL 1JN6B 1A64A 4OGAD 1JWMB 4ZFOB 4LP4A 1D5MA 4HS8H 4ENEC 1M4KA 3MRLA 4RX4D 4L3CB 3A6CL 2C7UA 1FYHB 1ZGLM 4PRPD 5DK2B 5C0RH 1NDGB 2ZCHH 5DUPH 4R96B 2HLFD 1I3GL 4QRUA 4RFNC 1T80A 4LPXA 4OZGF 1OTTC 3EYSH 3ZKXC 3MR9B 3X14A 2AKRA 1FNLA 3RWGA 4PJHE 3QEQA 4BFIB 3EIFA 3RNQB 3ULVF 3PWPE 1ZWIB 1YEJL 1ZTXH 4W68A 3I2CL 1NSNL 5FA3A 2K1MA 1OSZA 3C6LD 3SQOH 5HJ3A 5T1MB 4FABL 5IM7A 2DLHA 1E4XH 2CD0A 4TTGA 5E95B 2YD9A 1JF6A 2AEPH 2Q7YB 3MRCA 4KI5D 4CBPA 4F15C 4Z9KB 1UH3A 5CZVH 3DNKA 3GSNH 3RVTC 3RNKB 3IF1B 4P5KB 1OAZH 3MRGB 3HC0B 1PLGH 5L2KA 5JXED 3RKDD 3QCTH 4P2RB 4HZAA 5FUZL 2XZAH 1QFPA 2IAMC 2ZPKH 1PQZA 2ATPB 5JHLL 3MV9B 4IRSC 2EDJA 3P73A 4NHUA 4DEPC 5LJYH 4G80A 1I1RA 3KVQA 5LGHH 4Z7WA 5EN2A 5A2FA 3CDFA 4KJWD 1PFCA 3U1SH 1JHTB 4FFVC 4NN6C 3B9EA 1G9EA 2L0DA 4R0LC 1YEEH 3QI9D 1CVSC 4KHTH 5FHAL 1F13A 4L9LB 3SDYH 1ZKAA 1FVCA 3SDAB 2VYRE 4PRHE 3QO1B 2FGWH 1DFBH 3MJ7B 2GK0A 5GSRA 4JFXB 3TV3H 5E2VH 4RWYL 3HNVL 3WLWC 4ELMF 3H9SD 1NFKA 5EOCH 4XP9L 4ZYKA 5DYOB 5I15H 4QT5A 1JGUL 1C12B 1UJ3B 1DN0B 4OFPA 1R3IL 2J3SA 4YXHH 4ODTH 4R26L 2XWBA 2FD6H 2H3NA 1JGEA 4N9GA 4E41A 5LBSL 4U1JA 1U9KA 2CH8A 4JGUA 2JIXA 4QHNA 3V0WL 4LSVH 2M26A 4O2FA 2AEQH 2MPAH 4RIRA 1C5BL 4M61B 1CICB 1AO7D 3HI6L 4IS6A 3ARVA 3QO0A 5F70A 3LV3B 2I07B 2WUBH 1BHGA 3CUPB 4WFFE 1JYXA 5JUEH 5DDHB 1MCQA 4G6ML 2YR3A 4M7ZB 4OB5H 3U7WH 3MJ9L 3WKMH 4YBLB 4ZUVA 1ZVSA 4TNWF 3BP6A 2DRUA 4EI6A 1HIML 1TFHA 4DUWA 4LCCA 4NKMA 5IHZB 3DTXB 3WHE0 3LKPB 5TQ0L 4XP4H 4KC3B 4NRZA 2YZ1A 3IYLW 2KBGA 4JAMB 4M1DH 4N8CH 4XWGH 5IB5A 4QYOB 5D7JB 32C2B 3MLZL 4KV5F 3TIDB 2QEJA 4E5XA 1JNNL 2CJUL 3BJLA 5D2LE 2AK1L 1M71B 5C0ND 4PJXE 1SM3H 2QBWA 4OBRA 3DROA 2OTWA 2X7LA 4Y5XA 3OJ2C 4JFDA 3K4ZA 3DI3B 1RZKL 2IGFL 5D6DA 1PKQB 1EGJL 1T7WA 1YEDA 4QRRB 2D3VA 2DLFH 3QIWA 5C0JA 3P9MB 4KJPD 5JOEA 4GQPH 1MPAH 3UO1H 5K9OB 4OF3A 1X5JA 5FYJH 2W65A 2DD8L 3RVXD 3I6GA 3GJFH 2EZ0D 5EOQL 3ARYA 4UTBL 3LQAL 3MA9H 2ESVE 4OCMC 5CJXA 2R0LH 3WFDH 3W82A 3RI5K 4J3TA 2P24A 4B53A 1YPZF 1IGIL 4KTDH 1T5XA 2L4OA 4PD4K 5FB8B 1IEAA 2BJMH 1KLUB 3QXAB 1ZLVK 4X6DF 3WFEL 5TH2B 2NXYD 2P5ED 4HT1H 3CPLB 4PJFE 5KN5A 5ISZA 3H42H 1EV2E 5IF0B 3SGJA 3VXUB 4F37K 1CT8B 1B3JA 4HMCA 3KNBA 3FN0L 3BO8B 5IWLA 1VEPA 2VLLA 3MUHL 3K80A 3GSWA 1HI6B 2Y36H 3UPRA 4Z77A 5D5MA 4NO2A 4YHYB 2CDFA 4HCRA 1SBBA 5IBUB 3HR5B 3LMJL 1JK8A 1RSFA 4YEEA 5L2JB 4X8JA 3ZKND 2OI9B 2R1XB 1G9MH 1KB5H 4BZ1L 1CXLA 1BOYA 2X4OA 3O6FB 3U2SA 4X6DA 1AP2A 1FL5B 3ULUE 3Q0HA 1P5VA 2F54B 2R2HA 3T2NL 3ARGA 1I9IH 4XMLH 3MRQB 3OX8A 3WCYA 4JKPL 1T6VN 3U79A 1FG2B 1KUMA 4Y5VC 3O3DA 3RFZC 2WIIB 4ZAKB 5CCKL 5DEZA 3TWCH 2LV4A 1CF8H 4MLSA 4LSSL 3VCLA 3FO0L 4OGZA 4JN1L 4N8VA 2VUYA 3STLB 3QZWB 4AZ8A 2DBJA 4XBGA 3LKRA 4AG4L 5BQ7A 5CJQH 3QUYB 3HZYA 2D4DA 3MXWL 4XVUD 1EO5A 4MJ4A 4WW2A 1DBKH 3HZMA 5B38A 3QBTB 1UQSB 3QEQD 3AREC 4QTHA 4Y1AA 3M8OL 3FN3A 2MHAA 5FUOH 4C56B 4NM8L 3ULUC 4HJJL 4OQTA 1NMAL 5IBLC 3ULVL 2Q3AA 4QXTB 1B0RA 4OV5A 1YEKH 5KSAB 3GMRB 4PFEA 4YX2L 4JO1L 3L3GB 5I1AB 3VFVA 3KYKL 1K6QH 1R5VB 3FQWB 3VXSA 3NIGF 2N7AA 2EECA 4RMRA 4OAWB 3UJJH 3RWEB 3TVMB 5L2KD 4Y8AA 4V1DE 4ONOA 3TA3A 4DW2H 4PRPE 1ROWA 5CIPB 1HXYB 1N2RA 1U41A 3MRNA 2AXGA 1PDKA 1U8LA 3ZE0E 3UTPE 4L5FL 2B2XH 1JPGA 4GRWF 1XEDA 2YRLA 4U6HB 5FYLL 3B5TA 4TUKH 4XGZA 3Q5TA 4KMTH 3MRHA 2DLTA 3KJ6H 1DR9A 1Q9KA 1H3TA 1TVBA 4RNRA 1FIGH 2AV1B 4P2OC 1AE6H 2EDRA 5GGTA 4WWKB 5IFJA 5FYKU 1P4BL 3SO5A 2A38A 3FHAA 3WS6C 2C1PB 1JHKH 3O41A 1A4JB 1TETL 1U2HA 1Q94B 3EBAA 3V7AE 4MD5A 1ZLUH 1LEKB 2NY3B 4YHZL 5E2WL 4KRNA 2R29H 3UDWA 3V6ZB 4YEFA 3P30L 5INCA 1MRDH 3UZQA 2VLRB 4U1NB 3IDXL 1L6ZA 5DRZB 5B39B 3D85B 4QLRA 3ZKQD 4WU5B 2ICWA 1N6VA 1A6UH 2JIXD 2NY5C 2HLFC 5DVLA 5D7IF 5J6HA 2OR9L 2YPLA 2AJ3A 4ZTOH 2CMRL 4KHXL 1SJHA 2G9HB 1LHZA 5C8JA 1A3RH 1J11A 2F19H 4N0UE 4W81A 3HG1E 5DF0A 2IANA 4B5EA 1WJ3A 3C6LC 6FABL 3LS5L 3VXOA 1IAII 3F5WB 4MB5A 3SPVA 3H9SE 5IUSA 2V5RA 2IG2L 2NY4C 3ZYJA 3SKNA 1RZJL 3E6HB 4WUUE 4WHTA 1BM3H 3SE3C 4OLYH 3BH9A 4NN7B 3QXWA 3X3FL 5D7IA 2VZTA 1MCBA 1YQVL 5CP7B 5F9DC 3TFKC 4DWHA 1KJ2A 1JVKA 1P1ZA 4PJCA 2OYPA 5DD1H 3SDDB 4AY0A 3D18A 1X7QB 3KLAA 1HEZB 4PJDB 4JFDD 1BBJA 4OFIA 3IXTA 4I2XE 2RAMA 3GO1L 4KUZL 5KVGH 4KJWC 2H9GB 3QIWD 3QI9C 5ALCL 1WAAE 5E08L 1S9XA 1ADQA 4M8QB 4O51A 4KK8D 1TNMA 1PSKH 3DUUB 4GKNB 3O3EA 3TBSB 3WJJC 5CP3H 3QUMB 1GZQB 3CFJB 1CI5A 4JZOB 3MUGA 1TQCB 3L3OB 2OL3L 1AHWC 1ZS8A 1ULVA 1ZT7A 4MDIB 2CLZB 5MEOB 4XP1L 1XF2A 5JHDA 4JFOB 1MLCA 5L8JB 4JPKH 4Q7DA 2W1NA 2NY0D 1AC6A 4NJAH 3SKMB 1A6PA 3DVNA 5ISZD 5DQ9B 4FQIL 4PYGA 3HMWL 1CG9A 2ZJSH 2CR6A 5TE6L 1CD1A 4G6AC 5HYFA 2VLKE 3BP7B 3MUZ1 3Q5YA 3SDXB 4APQB 2X4QB 4YAQA 2P44B 4F8QA 1KXTB 3VGHA 2BVOB 3R06B 2PTVA 2UUDH 2YSSB 2AABH 1FJ1A 3VI3F 3BPNC 4ESKA 4NNPH 1OTSD 5JIIA 1BPVA 4LNRB 2QTEA 3PWNA 5F88A 4RISH 2FECL 5I75C 3TPKA 3P77B 3ARGD 4ODWA 4Z95L 5D1ZC 1YECL 1MCHA 2JJTA 1MHCB 2YRZA 1BIHA 2P5EE 4FXGA 5TDNB 3CDYA 4TVPD 1QSFB 2EXWD 3VA6A 2PW1B 4CMMA 4FQCL 1GIGH 5E8PA 3B9KB 4NZTL 4G3YL 3UTSE 3MODH 4IRJB 3IRZA 4ISVB 3B9DA 2OBGA 4X8XA 3WFBL 1NLDL 4KJPC 4D9RD 1D5IH 3O45B 1JPST 4K3EH 3CFDB 1DQDH 5TGBA 1BIIB 5EZOL 3RVXC 1BLNA 2H26A 1IQDB 1BFOB 1D5ZB 5D7KD 5DGQA 2O5ZH 5F6HI 1UWEH 4NFDA 4Y1AD 2VR4A 2CIKB 4GAYA 3BP4B 3MOBL 5EUOA 1IFHL 1RZKC 3CH8A 1RUAH 3KYMB 4NCC1 4O4YH 3B2VH 1H3PL 4TSCL 1NCCL 3D2UB 3FO1B 1JZ7A 5D6CB 3WO3B 4HGWA 4X4ZA 3FOLB 1U0QA 2BDNL 5EU6A 4OD1H 3SHSA 1UEMA 2VE6A 3JUYA 1ZA3A 1LEGA 5KS9B 5MENE 5C09E 5I8CB 1QLRB 4PRIE 1YZZA 3VXSD 2LVCA 3O9WA 4JKWA 1QFWH 3LKNA 4Z0XB 3RWJB 3K8MA 1I8KB 3LRGA 1MJJB 5GGTL 1T66C 1BQLH 4L3EE 5CUSH 2B4CH 5T1DL 2BNUA 2X1WL 3MLVL 3TA3D 3FFCA 2Z92B 3ZYZA 2GY5A 2APVA 5JXAL 4LLDA 3ULSA 2GKIA 1FDLL 2EH8L 3WIHA 3MLYL 3B3IB 3WNNA 3ZKNC 4F80A 3QEQE 3MUJA 5EIQA 2Z35B 2DI7A 4KKLC 3GSVB 1LK2B 3C60B 3UZEA 5HGBA 5FM5M 1RK1A 5M94B 4F7CA 3VFNB 1OGAA 3MNVA 1GOFA 4OI8A 2LE9A 4U1MB 3V79C 4YUEH 2NR6C 4RFOH 1FRGH 1XF4A 1F58L 8FABA 1JYNA 1P69B 1EX0A 1FO0H 2HT4D 3K4AA 3DVGB 5HGGS 2XKNB 4OZGE 1U8PA 5E8DH 4LVHB 3ULVE 1DQJA 1Q9OB 3QUZB 1Z5LB 5HI5C 3DVFA 1CDBA 2UZXB 3O6KH 5F89B 3AUVA 1INEH 1X5GA 4LMQE 3ZTJH 1WZLA 3KYAA 4YDKL 2P7TA 1P5UA 2YPLD 2ADGA 2ZUTA 2UVFA 2C3VA 3I02B 1B90A 5I1LA 4XMKH 3NFNA 3V2AR 4FFZH 5I1HL 2IAND 3MRDB 3V6OA 4AEIL 1HSBB 5HVFB 3AVEA 1NBZB 1L0YA 5F8RC 5J1AB 2J8UB 5JIKA 3OKKA 5ITFA 5HD8D 2N1KA 3G6DH 2H32B 4W6YB 4BSJA 3TN0C 2UZIH 5EG6C 2HLAA 3I50H 1A22B 5FYLE 1FFPA 2G5BA 4HJGB 3NIDE 4AQ1B 4S0SD 1BOGA 5I9QC 1R5WA 1VDGA 1DUZB 5EFIB 3HPLA 2RBLA 4NQDA 4HPYL 1CQYA 1QO3B 4PLKD 5HGDB 3ULVC 1RIVH 3LKQB 1U3HA 1AXIB 1HDMB 3RGVC 5SWSE 4DVRH 1H8SA 2NTFA 1U8JA 4HAGA 5DMIH 5ENWA 5C0DB 5I8KH 5I74C 3DX6B 4P59L 4JHWL 3VE0B 4ELME 1WF5A 3SE8L 3QPQD 1BQHA 1HHIB 4CN4A 15C8H 2Z31B 4QWWD 1DVFC 4D9QD 1N4XL 1CDYA 1S78D 4MSWB 4KZEH 2XN9B 4GMTL 5GJTL 5DEGB 1ITBB 2QHRH 4JFZL 5DJYA 1KB9J 2JF1A 3ARFC 4XCEB 4JM4L 1MFAL 4KH2A 3GIVB 3KDMB 4OJFL 4WCYH 1NFDB 1G7JA 3EJZC 2WK2A 2R4RL 3OF6A 4LSRL 4XCFH 3WV0A 4WU7A 1FGNL 1Z6JT 1F4WH 1T0MB 5JHDD 2GSIB 3UBXG 5EOTB 1R3JA 1CZ8H 5BRZB 5JMRA 2YD4A 5ACMA 2RCSL 4XPBL 2NY6D 5LWYH 1N6QL 5FYKL 4JFFA 4JFHD 3RU8L 3MRIA 4XCCH 2VLJA 1F97A 3DX7B 1S9VB 3WKNA 4N8VG 4NUGH 4WNQB 5DVOA 2J6EA 3IU3A 4GXVL 4UIMA 4UIKL 2EE6A 1BVZA 3ECBA 4JHAH 4HKZA 4KV5E 1U2CA 1WT5C 1DEEB 4IOFC 1JWUB 1ZEAL 1RJZB 1A1NB 3A0OA 5B38G 5EU4B 5DZNA 3QDJB 3FT3B 4QKXB 4Z7UB 3L9RA 1XIWB 3BPCB 4NN5B 2DQTH 4NO5B 4OUUA 4OI7A 5GGUA 1U92B 2YC1B 5DJ8B 1PYWB 4PJBF 4KKBD 4X6CF 4MYWB 3V5HB 2BMKB 1RZFL 1FCCA 3UYOD 1R5IB 3VMNA 4PJIF 1OL0A 1Z9OA 3DSFL 5GSVB 5E0QA 4Q6IB 1FNGA 5D5ME 2CRIA 2Z91B 1YPZE 4NSKB 4FG6C 5J4MA 1IGTA 1D9KC 1JPSL 2DTML 3IJYA 4X6FA 4MZ2A 5HY9B 4X6DE 1IEHA 1KN2L 4NNXA 4O02H 1LO5B 5F7NC 4ZFFA 1CS6A 4HQQL 5F7KC 5CJXC 1WWCA 1Q8MA 3HNTL 4X6CA 3QHZL 3MRFA 4PJIA 2UWEB 3RL1B 5FOJA 2XNAB 3CIQA 5D72H 4K3GA 5EU6D 1LNUA 4HUXA 3EGSA 4FTVA 5KOMC 4M48L 2APXA 1AGEB 4PJ7A 5C0GB 5DA0B 3O9WD 1S7QB 3L1OL 2YD2A 5H94B 1NBYA 4R7NA 3W0WB 5F7WC 3WHXA 2VQTA 1X5IA 2WIMA 5J89A 2A1WH 3RVWC 3MV8B 4HPOL 1UXSB 1CFNB 2NLJB 1EO8L 3FFCD 4J8RB 2P4AB 4L8DA 4P57B 5M7QA 1U91B 3BEVA 1XGQA 3NCFB 1J0YA 3F58L 5E8NB 4YNYA 4HFWA 1P4LB 4N0FB 1OTSC 3VD5A 4NUJA 4QNPF 1OGAD 5JDJA 3LQMA 2GSGB 3MOAL 3V6FA 3BKCH 2ZSVA 1Z9LA 3GSQA 4TOYL 5SX5K 4NKIL 5I1KH 3FO2A 4XNQA 3VXSE 7FABL 4OUOA 3KXFB 4W6WB 3X13A 2XRAH 2R1YA 4FQPA 2BX5A 3EW3B 1XR8A 3BWUC 1G6RA 4EOWH 4P4RA 2A77H 1VGEL 4X9GA 2W9EH 4XCYA 3BUTA 5C0AB 1Z2KA 5ALBL 4C83B 4I5BB 4CNIB 3AS0A 3A6BL 3G08A 3DX9A 5JMOC 1XGPB 1DBBL 2W92A 4HKXB 1NMBH 1EK3A 2FLRT 3NFSH 4CL7A 3NABH 3BPLB 1KV3A 5E6IC 4CVXA 1S9WA 2E9BA 4P23B 4YXLL 4UT6L 1QNZL 1A6TA 2J8UF 4DGVL 3T8XB 3AFLA 5BXFA 4R8WH 3NIGE 4RMVA 4Z5RB 5H8DA 3D39B 3G6JB 5DUBA 2FH8A 3I9GL 4BSVB 1DP0A 4PG2C 1CE6B 3QEHB 1AGBB 1CFTB 4MAYA 4HULB 1CLYL 4R7DB 1FLRH 3TO4B 3QEUB 1NCUA 2V17L 1T3FA 4OD2B 3BDYH 3ZYIA 4AJ0A 4GRWE 2PXYA 3DGGB 4BSWA 4JM2B 2X4PB 5EO0A 3LEYH 1ZHKB 4NQDD 4Q0XH 4HUUA 2OP4H 4LSUH 5EZLB 3VXRA 4EUPG 1JBJA 1KBGH 1P7KA 1U3HD 4KVNL 2YPLE 3B9AA 3INUH 1A7BA 4K55A 4WJ5A 5LKNA 3JTTA 3VXQB 5AD0B 4TULH 4MCYA 1FL3B 4QY8A 1PEWA 4PLNC 4BUGA 1TPXB 5AWNL 3EOAB 1PKOA 3GHEL 4I1NB 3S3PA 5DC9B 3TGXA 2XA8H 1F4YL 4NQSA 3TT1H 4UT7L 3WUWA 4OZIB 4HUVA 5DT1L 4PGDA 1PZ5B 3BQUB 5MERB 2EDWA 4RZCA 1MVFA 5D7IE 5I1JL 3W39B 1RVFL 1I7UA 2NPLX 3UDWC 2PN5A 3OF6D 1QLEH 4C54A 4YFDB 1Q0YL 5F9OH 5CHNA 3G5YB 3QHFL 4HLZH 1ZHBB 3K0WA 1UWXK 3DO3A 2QSQA 2IADA 4UT9H 4B50A 4G6JL 3U9PH 3SBWA 1GZPA 4JFFD 2G75B 2KZWA 2VLJD 1HINL 1XR9A 1ZLSL 4C59B 4D9QE 1KJ3L 3HLAA 1WICA 4NQEA 5C3LD 3RY5A 4U31A 3UPCA 4E42B 4DCQB 3FFDB 4ZUWA 4NQXB 3S4SB 5EO1A 5JA8B 1JGDA 3QT2A 3N1GC 1G7QA 3CDCA 3PGCB 3BHBA 4QRRE 3BFOA 4GAGH 4M3KB 4M5ZL 5C6PB 3WO4B 1CICC 4J4PD 3ZL4L 4UB0L 5CSZA 3VFWB 1CFVH 4FZEH 3RWDA 5JHDE 1N6UA 4OIBA 1JFQH 5C0EA 1GGCL 3DLQR 3LKSA 4L1DA 4YDLB 2XYCA 4QRQB 4PLKC 2EH7H 4LHQB 1GGTA 3LKOB 3BN3B 4KQ3H 4JFHE 4XMPH 4JY6B 1JGLH 4MD4B 5KW9H 2ZNWA 4HKBA 4DZ8A 4LCYB 4Q2ZB 4P46B 4P2QA 1QPXA 4RA3A 4JEGB 4ZS7L 5D7JC 2X4TA 1IAIH 2EEDA 5F7DB 4X4YB 4K2UH 2IQAB 4X4ME 35C8L 2DDQL 1S7RA 4QCIB 1S78C 4BA8A 4M1GH 1QSEA 4PRAA 5LQBH 2X2YA 5K9KA 3OR6B 1HXMB 5CFHA 2JB5H 4R2GB 1R3LA 4M6OL 4GW1A 2VQ1B 1E6JL 2APWA 5TPWH 2HH0L 5FYKE 4MJIB 4X7SH 4I0PA 5FKAA 1I8MA 3CH1B 3N9GL 1QYGH 1ETZA 4LLQB 3KS0J 2XT1B 3SEPA 3PP4H 3WL9A 2WINB 4IMLA 4OSUH 1RHFA 4K9EL 1W0WB 5CSBA 2MWCA 3DV4B 4ERSH 4EI5B 2FL5B 4FTVD 5C6TH 1CFSA 2F54E 3VI3E 1LO2L 3O6MH 5IROA 3QDGA 3T4AB 3P11L 4KGLA 4NQTA 3CSYB 3UTZB 1PAMA 4U6XB 5ADOH 4K8RH 4C58B 3WSQH 1FZJB 1UG9A 5BO1H 4LKXA 1T03H 1AFVH 2BOBA 2XG5A 4RRPG 3S6CA 1KGCD 2UY6A 3MGTA 5KANG 3F65A 4P3DB 1S3KL 1U8HB 2A6DB 2R0KL 1FCGA 2AJZA 3GEWB 2HJKA 3SGEI 5DTFA 3NH7L 1VPOL 2OI9C 1A2YA 4Y4KC 5DRXB 3ARUA 4GRLA 1TZIA 1QD0A 2B0SL 3K1DA 4M1CD 3D5OF 1BVLA 3BN9D 3VXMB 5CEZH 1A9BA 1MHEA 3FOMA 3QXDA 1NUGA 2P8MB 3DETD 1D6VL 3QDME 1BD2B 4PP1C 2BRRH 4J3XA 2E7HA 3VD3A 4LCWB 2OCFD 4UTAL 4J3WA 1WC7B 1U8MA 5KSVA 1T1XB 2OXHA 1BJ1J 3ZO0A 4LHUB 1QSZA 4EQ2A 3AB0B 2PKDA 1BWWA 4AIZA 5FYJU 4HH9A 1YMMD 1CE1H 2DS4A 1DEDA 2X1PA 3RL2A 3STZB 5ANMA 1UB5B 1C5CL 5BW7C 1FL6B 4FZ8H 5KZCB 2MQ3A 3TYGH 1NDMB 2CRMA 3FHQA 5FO7A 3K4DA 4JRYB 4WO4B 5C08B 2AXJA 3T4YA 4LCUB 3W9EA 4UBDC 3THML 3H0TB 4ZXBD 1VKXB 1WFUA 4PJ5A 1MWAB 4WVRA 2FJGA 1RUML 2QR0A 3LN4B 1PX3A 2BY1A 5J9PB 2PXYD 1WGOA 3FCTA 2FZ3A 2JTDA 4JFQA 5IBTH 3ARTA 1KELH 2ERJB 4J12A 5KSAC 1MAJA 4HF5H 4U4BA 1NBQA 3VH8G 2FJFB 3VXRD 3RUGA 1OGTA 3LEXB 3I6LD 3SOBL 4N0YL 3N1MC 5ESQB 4TRPH 3MPCA 2VZ3A 1J8HA 4EIGB 5D1XB 1RIUH 4M93B 2QADB 4U1GB 4PS4L 3EZ8A 3CFKB 3CK0L 1J05A 4DVBB 1CFBA 4FNLL 3GZKA 2HN7A 4MJ6A 4PY7B 1JUFB 2XFXA 4PB0L 2OJEB 2GT9A 3NA9H 3V4VL 1XMWA 4LRIA 1LEIB 5ICYA 4LCIH 4QRTB 1FYTB 4L4TA 2GCYB 4JG1H 4HWEL 3RJDA 1GYAA 3HRPA 3UYRL 4FS0A 4GLRI 3WFCH 3NFPB 3N06B 1NKRA 1J1OH 1QP1A 4AENB 4NQDE 1QTYT 1A6ZA 1A4KA 1WFTA 5F6IB 5EUKB 2VWEE 3TF7C 5A40E 5T1KB 5EWIL 3QUXD 3U0TA 3B83A 3RHWF 1FN4A 4XI5C 4QHKI 3MRJB 3HE6A 5D8JH 1MIEL 3F7PC 2XOTA 4LLYA 4MDJB 4XPFL 5IK3A 5IFHL 5GGQL 5DJZB 1K4CB 5D2NA 5ESVA 3MJ6A 1A0QH 2E9JA 1MI5A 1MCDA