3OGCA

Kcsa e71a variant in presence of na+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
b'QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism for selectivity-inactivation coupling in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2010-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ogcA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ogcA02
2DS4A 2HFFB 1F6AA 4HWUA 2BOBA 3LKPB 3NCYP 2A2QT 2P8MB 3LS5H 1P7KB 1S7TB 1UZ6E 4Y1AE 4OZFH 3HUJB 1AD0B 2X4NA 2X4RA 2EDDA 3V7MA 4WU5B 2X1QA 1EAPA 4P2OC 5I1DB 5CUSH 4Z7QE 1I7ZB 1NCWH 4AZ8A 1Z5LB 2NY6C 2D7QA 5HGAB 1MF2H 2QTEA 1L4IA 5F1OB 2ZOLA 4LPXA 3Q0HA 4CADA 4M62H 1XT5A 5HYEA 1KXQE 2WQRA 3VXSB 2PYED 3UTTA 1Q9WB 3O3AA 3HMWL 4WFED 3U82B 4F7MA 5EPMA 1I8KA 1KJ3L 1U8MB 2GT9A 2YSSA 5FA3A 3L5IA 4XPAH 3O8XD 5F9WC 4BSVB 4U1GB 1LO3H 2VLRA 4MZ3A 1F4HA 2O61B 2WIMA 1NAKH 3FFDA 3MRQB 4JDTH 2F5BL 2F58L 4K94C 3ULUE 1QUNA 2DOCA 1T3FB 2HKHL 1J8HB 5F6HI 1ZLUK 1OCWL 1HCFX 3PIQA 4HLJA 4NJAL 4EDWL 3BKML 4JRXD 4JFXA 2W0FA 1HQRB 1NBYB 2FX9L 1CDHA 5IEHA 4ZXBA 3OKDA 1T5XA 3RTQA 1MJJB 3U7WL 4RCAA 3WUWG 5JW5A 2VDOL 3CCHA 4G9FD 3I6KA 5JPMA 3D9AL 1A2YB 5AZ2L 3UZQA 5IBUG 32C2B 5DQDH 3QIWC 2W60A 3P0YH 1X5HA 4GXVH 3RWCA 1QBML 1ND0B 2YC1B 3C2AH 1M6OA 5HHME 1U3YA 4HWBH 3F7YA 1S9XA 5CMAA 2VQUA 1GYAA 1CLCA 5TDPB 3VDBA 4U1NA 3NACH 2ARJB 3SDAD 5GRUL 2EYTB 2HT2C 5EG6C 1NLBH 1CFNA 5ERWA 2IMNA 4AMKH 1G6RA 3OR7B 4NPYB 4X7EC 5H35B 1U8NA 3DYPA 1W2KT 3LPFA 1T04B 2DQCH 1EO8L 4XNXH 4H8WL 4OFKA 4ELMB 1HQ4A 3MLWH 5HHQA 1GPOH 3V79C 3TIEA 1NAMA 1TETH 4MD5B 4PJBE 3QO1A 5T33H 1X9QA 2X4PB 1BM3L 3VFSB 5MENE 1VGEH 2LU4A 4EI5C 1K8IA 4XP4H 5D1ZA 5DFWH 4YWGH 3KXFE 5JPNA 4R7DB 4L9LC 1S7QA 4F2MA 3O3EB 1DBKL 3RVWC 1ZA3A 4NBZB 5FM4A 3FHAA 4PJAF 2OJEB 5IFJA 2NX5D 4WNQB 1MNUH 4H1LG 5IM7B 5I1KH 1F97A 3VFRA 4XP9L 2Q3ZA 4XVUD 1T0NA 1CL7I 4WI5A 1GOFA 3CX2A 5GZND 2YUVA 1CL7H 4BSWB 5C0AD 4HBCL 4P4RB 4PGCB 1R6VA 2UYLB 5JHLL 4L8BA 4JKKA 4ODUB 3U1SL 1HHJB 2ADJB 2R0WH 1YEKH 3OKOA 1IGTA 3DSFH 4UUJB 3ES6B 5C6TL 4C56B 4PJIB 4ZOAA 4X5WA 1HNGA 4JFPB 1JNLL 5B4MD 1IARB 4AT6A 5BS0B 1EIBA 4DN3H 2E7HA 2VLLB 2XWBB 4HS8L 1VFUA 1KEGL 1KPRA 5CILL 3VXUD 2BSTA 1KIRB 3RWJB 3DUUB 5ETUB 3PP4L 5J9PA 5LBSH 3EDKA 3GSWB 4IRSB 3QUYD 3BDBA 4WHYH 5A2KH 2DQDH 4HT1H 3ALPA 4NN5B 3SKOA 4JY5L 3FT4A 4RBPH 1T2QH 3MUJA 1A6UH 2PUQT 2HJLB 5E8EB 4CGTA 1QLFB 1JWSA 4ALAL 4LPCA 4QXUH 4ODSL 1E4KA 5CWSA 5I15H 5L88H 1A14H 1N64L 2CRYA 2BDNL 3EYUH 2PXYA 3NIFF 1OTTD 2CLZA 3IFOA 4JPWH 5LGHH 4JFFD 3WFDH 4W6YB 1MH5B 4I18B 4JGMA 4Z95L 1C12B 2QSCH 2B8OT 2B5IC 2YUXA 5CJ5A 1NBQA 1Q72L 5FYJH 3RFZC 2FZ3B 2ICEA 2AEQL 1MHPL 5SWQA 3RY5A 3L3GA 3S4SG 1HOCA 2XZAH 1D9KA 1Q0XL 2VDLL 1YNTA 1JZ4A 5T3ZD 2XY2A 3AAZA 5GISL 4H0GA 4CMMA 1DLHB 1MWAH 2PKDA 3IETB 5HVHC 2VUYA 3QP3A 4XNZB 3C60A 3NBNA 1F3DH 4OSUH 5BQ7A 4LIQL 4G42A 4RISH 4OM0L 3RNKA 3PHSA 3K3QA 4BFIB 2IPUK 4WFGD 5I9QC 4XC3H 2A6DA 3I02B 4FQHA 4IS6B 2P24B 1G0DA 4P49A 4P59L 3TCLB 2VL4A 4P23B 3O9WD 4AIOA 3WJJC 5IB4B 5KG9B 3G6DH 4YDVB 5J6HA 2P44B 2IALB 4P2RB 5KBNC 3LIZL 4BH8A 1KIPA 2ZUUA 4ZUUB 4E42B 4L8DA 1QZ1A 1TJIH 5L8KB 1FP5A 3BVNA 1UB5B 3F7QA 5DUPL 5C0FA 3ZKXC 1WQVT 2Q86B 1I8IB 4M48H 3TP4A 2YUZA 4YXLL 3PHQB 2VJXA 3VFGH 5I17A 4DKDC 2DWEA 1NAMH 5E5MB 3T1WA 2X44D 1VKXB 5BOPA 2X41A 5KOMC 4YXKH 3GB7A 3QNYA 2EICA 2NY3B 3CVHB 4WTWA 1ZLWK 2VXTL 3H2WA 1FVDA 1JZ6A 4MA1C 1NMAH 1EGJL 2HT4D 1F4YH 3BD5A 5D1XD 2EYRB 4PRID 2YPKB 2YA2A 2Z4QB 1S7XB 3HAEG 4F9LA 4JPKL 5JOFA 1BHGA 3PWPA 3IJSB 2HJFB 4J6RH 5FO9B 4C58B 1L7TH 3LKRB 4GS7C 1RY7B 4ZUSA 4BSJA 5ICXB 3EZJB 2DTMH 3NA4A 3HE7C 1IEBA 4OCSL 1ZTXL 2RFXA 3IDMA 3MODL 3QUXC 5DEFA 3U0PA 2FIKB 5AD0B 4F7TA 1NCBL 3KYOA 2B4CL 1W0WB 1MJ8H 3H0TB 4U1JB 1TZIB 3OXSB 1J1PL 2OTWA 3HMXA 4QT5B 3NCBB 2ZG3A 4HX1B 5EZLB 4HK3N 4Y88A 5E9DD 2OJZH 4K2UH 4MQ7A 4NQVB 3DYOA 2IPUG 4OKVB 3H7BA 1KBGL 5E08H 4CJ1A 4PJAB 5DYOB 1OQXA 4K71C 1RZKC 4H25A 4LPUA 2QHLA 5B38A 3D2UB 1CICD 2HFGH 4GFTB 3QXWA 4M7ZC 4JY4A 5HYSA 5F7NC 5BJTA 2XIDA 4OFVA 4PJXA 1K4CA 2VZTA 3B3IB 2XI9A 1QRNA 5SWSB 1HXMA 1RZGB 4NQED 5CZXC 3SO5A 1T0PB 4UT9L 1K85A 3UAJD 4OCMC 3TFKD 3IGAA 2P47B 1A6WL 4RWYH 4NNPL 1MCCA 2O5YL 2HTLC 5C0RL 2BSRB 3DGCR 1PZ5A 4XNUH 2WM0A 5DURB 2F8VA 1YC8A 4F33B 2BOCB 4ZPTA 3O81A 4LQFH 1MFCH 1BFVL 1QSVA 2CMRH 2X4QB 3BE1H 5GGQL 3HKFA 3ARFA 3VFNA 3SGEI 4X6EA 2WAHA 1G7QA 2O93L 4XCFH 3SGEH 2A38A 1XH3A 1H5BA 5IJVB 4M43L 2NXZD 3L3DA 1WSST 4OF8A 5JZ7C 3LKQB 4YR6A 1B6UA 1NDMA 3RKDD 1C8PA 4AH2B 1YN6A 4PJEA 1DQDH 2DQEL 2KZ1B 3NH7L 4N0UE 3KHOA 3GUTB 1QACA 3JWDH 4G3YL 5CCKL 4UDTA 1I1AD 1GGCH 4R97B 5JDJA 1BD2B 4D0DB 3HG1A 5EIQA 4K8RH 3GSQB 4CAGA 2ZSVB 5TDNA 4J3WA 4YIQA 1DQLL 5EULV 2DBLL 5DUBA 1R3HA 3B5GA 3O2VL 3BO8B 3FJTA 2V2TB 3SPVA 1K6QL 1DQJB 3PWVB 1MHEB 4PBXA 4Z5RB 1R0AL 5EO1A 5HPMA 3GK8L 1BAFL 3QHFH 4I13B 3FONA 1MCJA 3TBTA 4LLMB 3EBAA 2CKBA 1I75A 4WI9A 3MRFB 3VXNA 3V6ZB 4KI5E 3MOQA 4Y5XC 2YD3A 1A4JA 3N0PB 5DD1H 3V8OA 2DIAA 2F54E 5ANMA 3KLDA 3CFCH 5L6YH 1EFXD 4KHXL 4Z76B 4KJWD 4LAQH 1X4YA 4U1SB 3SHSA 4QRTA 3PV6B 5J3HD 5HDBF 3IDNB 2FR4A 2C26A 3C2SA 5DK3A 2BNRB 3STZA 2EEDA 4U05A 5E56A 2VLKB 2P5WD 4JLRB 1OP9A 3PHOA 4HFUL 4PS4H 3QQNA 1OPGL 1NCTA 1W0VB 2XQYG 1NC4A 3FO9B 3T2NL 4KAQH 3EYVA 4N8VA 2ZUSA 2EKSA 2JCCA 4N0CD 1FNLA 2DL2A 1IGFL 3QUZB 1DCLA 4ELKA 3LCYA 4F58H 2NZ9D 1AO7A 3HMXH 1T1WB 3LEVL 4M1DL 5K33A 1UA6H 1YJDH 4LP5A 2BMKB 1HHKA 3B9KD 1TZGL 2CJUH 2GSGB 4HUMB 4PJCF 4L9LA 5T3ZL 3LDBC 3S88L 1QTYT 3DVFA 3QG6B 1Q9LA 2Q3AA 3L5XH 3QJFA 2GJZB 2QHRH 2CH8A 5C7XH 2VZ1A 1J1OH 3MGTB 5J1AB 5HI3C 2CLRB 5JNYB 2ZKHL 4PREA 2EEBA 1CE6A 1ETZA 1D5XA 1XGRB 1Y18B 3WCYA 1UADC 5I19L 2NY7L 5IQ9A 5CBEB 5K9QG 4FTVA 2RJMA 2WINA 1AGDA 1FNAA 3VD3A 5K59E 1PKQA 4JRYA 3W5NA 1K8DA 3AVEA 5CGTA 1HKFA 4DK6A 4HJ0C 1YEJL 4MD4A 4L8CB 2WNGA 4NO0A 3IXAA 2BNQA 4TQEH 3KPTA 2BSSA 5I66B 2ZZUT 3DVGA 4FHBD 4DK3A 2GTZA 1Z9OA 5KSAB 4AYFA 5F9OL 4HAGA 4LU5H 2C3HA 4MQTB 4OD1H 2EE9A 2BY1A 4P2QB 1FL5A 3UZVB 1FFNA 1PSKL 2K3TA 3VG9C 5JOPE 2EIBA 1DBJH 4WW2C 1ES0B 1N0XH 4IIQB 4OCRL 5C07D 3SY0A 4M5YH 1U8KB 5F7HA 4Y89A 1OGAE 1HXYB 2Y06L 1GGUA 4JN1H 4RAVA 3RU8H 1NEZB 2O5XH 4POUB 5JO5A 5T3XL 1XCTA 4C55A 4WFHD 3CDYA 4MCYB 4NQUA 2A0LD 1UZ6F 3WNNA 3KPNB 4EIZC 2EZ0C 4MNQD 3VD5A 3PE9A 3BQUB 3OHXA 3EYFA 5EBMB 2NXYD 1KYOJ 4Z7QF 1FIGH 5FUCE 3ROOA 1NPUA 2QADB 4KFZC 3LSOB 4K94H 2GUOB 3GJEB 4PG9B 2H32A 4WWKC 2R69L 3QULB 3BP7B 1I9JH 4BH7A 4G8GB 3WXWL 3WNOA 1DQQB 3UZEA 2CKBH 3WNKA 1ULVA 5KVDH 3UBXB 1DEEA 1KCKA 3C6LB 5IVXE 5GS0H 1ED3A 4V1DE 5D7LE 4O4YL 3U46B 3U30B 4M7LT 1NC2A 4QEGA 3O6MH 2VERN 4U3CA 2DRUA 3TLRA 4S0TD 4FXKB 4R2GD 2C9AA 3MPCA 4TVPD 5C0JB 5SV4A 3BJLA 4GW5A 3SE4C 1RD6A 4N1CA 1F8TL 3U6RA 3WJJA 3BZ4B 3P73A 4HLZG 5SV3A 2EH7H 3IJYB 2V5MA 4JB9L 5EO0B 1ZMYA 2CR3A 4Z7UB 3V0WL 4RFOL 2WZPD 3CVHL 1ORSB 4JREB 4HS3A 5C08D 2IAMB 3MV9E 2P46B 5E4IA 3PJSA 2DI8A 3DBXB 4HUUA 4GKSB 5EB9A 4KK9C 4QHKI 4X6BA 4YBLB 4I2XB 3AUVA 3O4LD 5D7SL 4OFDA 1B2WH 1QFUL 5L7XL 3BZDA 3O41A 1VPOH 4NOBA 4BYHA 1A0QH 3IFPB 3QPQC 4NP4L 5IV2B 3RVVC 5J12B 3BKYH 1BJ8A 3BT2H 2N4IA 3RBSA 4S0SD 4YHKL 2IPKA 1IAOA 4QXTA 1CBVL 1KCSL 5C0GB 3S5LA 1P4LB 3OKKA 3O6FC 4KDTA 3PNWA 2W0KA 5CZKA 4JJHA 4MJ2A 1HHGB 1BQUA 2A6IB 3ULVE 1KPVB 3ZDZE 2NR6D 4JEGB 1FE8H 2K7PA 3RJQB 1A7BA 1LEGA 1G7HA 4PYGA 4LQ1A 3HE7A 2NW3B 1IGML 4C83B 5EZOH 3BN9D 4PJCB 1TVDA 4PJBF 3RJDA 1AGBA 1WZ1H 2CUHA 3NTCH 1S5HB 2D31B 3WFBH 5ADOH 4UDUA 4KVCL 5DFVC 4FG6C 2DYPB 1BFOB 2P1YA 1T83C 5C0IB 3ZSTA 5EU4B 4IRJB 4FQ2H 1KCVL 3BSZL 4NC2B 1MCHA 3DXAB 5D6CA 5FM8A 2VAAB 5DDHA 2GY7B 1BEYH 4NQDD 2EYSB 4Z18A 4QY8A 1AGFA 2MCPH 3TIDA 4D9QD 3OF6A 2CLVA 1BIIB 1ZHBA 5HXMA 5ELIA 5L0QB 2ITCA 5IF0B 1QBAA 3TNMA 1MCWM 4PRHA 5FYLD 1HYSC 1Y0LA 2AV1B 5HHOE 3GBMH 4AG4H 4E41A 5E8DL 4JFHE 5DK2A 4NDMA 4OZHA 5I18H 3QBTB 2IH3A 4WTXA 5LGJB 4KK8D 1UEYA 2PTTB 3RWEB 1FZOA 2H32H 4Z0BL 5ABDE 4BZ2H 4OJFH 3DMMB 5IIEB 1WV7T 3SOBH 3ZL4H 4IJ3B 5TGBB 1IAKA 1U8QA 4WUUD 2FH6A 4JFDD 2A6KA 5E2UL 4AEHH 1OAZL 4XCYB 5I8OH 3CUPB 4DQOH 1Q1JL 4LOUD 2RGSA 2FWOB 1SHMA 3HC0B 1IEAB 4I48B 4MJ4A 1KC5L 4MAYB 3CNKA 5IMLB 4ZS7H 4Q2ZA 1KJMB 2A1WL 3O3BA 5I8CB 3T0EB 4XC1L 5J1TC 4HXBH 4YHNB 1HILB 5GGUA 3MUZ1 5GRZA 2J12B 4XB8A 3BD4A 3CSPA 25C8H 2VUOA 1G6VK 3QCUL 2YWZA 1GOHA 4O02L 4QCIB 4O51B 2IGFL 1YDPA 4PLJC 4NQCA 2VDRL 5TE6L 3QQ3A 4E5XB 4MVBC 4N5ED 5E5RB 4PJ9B 5FUOL 2VXUL 4FXGA 3VMOA 4Y5XA 1LILA 4UV4L 2JJSC 1NBVH 4U49A 3RWGB 3ARGD 1F2QA 1VGKA 1T20B 4NZDA 2H45A 1OP5H 2IG2H 5DMYA 3OKEA 5D5MA 3CVIH 4JM2F 4IEFB 1A1NB 1U91A 3TO4D 3ARBD 4ZMAT 2NYYC 1S8DB 4MXQD 1KXVC 2DBJA 3MA9L 5I0DA 5C9KA 2I5YL 1P9MC 4P0DA 5C0EA 1T1XB 2OCFD 2HKFL 5IB5A 1A6AA 2VYRE 4D8PB 3G5VB 1A9EB 4Y1AD 4L4VD 3DX9A 3IF1B 2VC2L 1KXTB 4LSSH 1LD9A 3R06B 4KMTH 2FATH 1FRGH 2WUCL 1MCFA 4KXZI 1F4WH 5L8JB 3C9NB 5I1IH 4XWOD 3UTSA 1NFIA 3DO7B 5GGRB 1YYLH 4KXZH 5HHMB 1MCNA 2D7NA 5EOQH 5FYKL 1CD9B 3AS1A 5TPWL 2J8HA 3BYTA 3V95A 1F00I 1WWWX 3R8QA 2XFXA 2COQA 3GI8L 4HIJB 4HCRL 5AUMA 4M3KB 4DUVA 3F7RA 2X5PA 1KB5B 4YUEL 1EK3A 1U2HA 4FABH 1JF6A 3UO1L 3P4OB 4P2CG 4Y16D 1DN2A 1QFWI 4O2CB 4MA3A 3U2SB 3F6IA 1BZQK 1LGVA 2HVJB 2NW2A 35C8H 5FV1L 1C16A 4PUBL 1QFWH 2X6MA 3B6SB 3CFEB 3FQXA 3LPWA 4PJBB 5I74C 4TVPL 1QEWB 5F9JB 3ULUD 4BZ1L 4B53A 3QIUA 3KXFB 3VMPA 4OI7A 1UJ3B 2D3VA 4NO3A 2JELH 1NEZG 2FNBA 1FGVH 2GI7A 4XBGB 4AK1A 4OD2A 1KGCE 5JUEL 1ZT4B 1JK8B 4KKCD 5ITFB 3SKUD 4JFYA 3D0LA 1PZUB 3E6FA 4R0LB 2E6QA 1I85A 1AY1H 4I0CC 1FC2D 1P53A 2KUTA 3UYPA 4RAUB 1CR9L 4K3DH 1TQCB 3K8LA 3RNQB 5FFLA 5DJXA 1FSKB 4X4YA 5CJXC 4LSRH 1PG7L 4KK6D 1QVOA 2B20A 3VFUA 4HHAA 1IGYA 2DLHA 5JDSA 1MCIA 5DRWA 1C1EL 3PQYE 2AGJL 3DV6B 3IDJA 3W5MA 4RSVA 3UBXG 3L7EB 4JKPH 4JPIB 2HWZL 5IQ7L 3H6JA 2VE6B 5HGGS 2ZUTA 1J10A 4JQVC 1ZLSL 2WBKA 1KTKE 4BQ8A 1S9YB 2F8OA 4Y7MA 3P30H 3B2UC 1CLOL 1H15A 3G5XB 4EZMA 5KAQF 4ODXB 3C08L 4WWKA 1NGQH 1INQA 5J8OA 5IKCA 1NQBA 3KPSA 2C1OB 5DHVB 2M1KA 4DN4L 1WZKA 4HW6A 1JHTA 4HXAL 3GIVA 5MEND 1WIUA 4JHWL 4KQ4L 1WVZA 5EN2B 3KLAB 2X40A 1KTDA 4YDLB 3HNVL 4FP8L 3ZT7A 1EBAA 4QRPE 1IKFL 4S1QH 1UCTA 4C54A 3DOSA 3HE6D 5HGBB 3B9AA 4QOKD 3WIFB 4LEXH 4HIIA 4L3CB 4LASL 1S9WB 4FQQB 4ZUVB 1G7IA 5JR1L 3KPRD 1NMBH 3MC0A 5JIIA 1AJ7H 1FLTX 1N7ML 2BVUA 4NN5C 4ODWB 3TNNA 1AP2B 1JWMA 2KKQA 2XA3A 5JW4Q 4OZIA 1KN4L 4H20H 2APTA 3GMLB 5GS2D 5D1QC 1CXHA 1A21A 1SMOA 5IFHL 4PJFA 4LLWB 1HHHA 1TQBB 1I4FB 3GI9L 5EU6D 4A2LA 2YMXL 3IKKA 5FOBA 3QDHA 2AK4A 2NCMA 4GKNA 4XPHL 4NJ9H 5KZCB 4KI5F 3ILPA 5LQBL 4BFGA 5EC1B 2MMXA 4NRYB 3SCMC 5JXAH 4BZYA 1T7YA 2BFVH 3HMWH 3QEQA 5FA4A 3KPLB 4QHNB 3GO1L 1F02I 3GJFK 1AI1L 3IDIB 1JZ8A 2LTQC 1AGEA 1FVEA 1QLEL 3UJTH 3G6AA 3MRJB 1IAIL 5EFIA 5D8JL 5DC9B 3U4BL 4PJGA 1JTOA 4F8QA 5DMKA 4AL8L 4JY6B 5FKAA 3N9GL 2F5BH 3QDJD 2F58H 3EUUA 3QCTH 1LQSR 3FTGB 1P69B 3WJLC 3W81A 2B0SL 3PWPE 1NL0H 3GDBA 2HRLA 1YMME 1OCWH 4R3SB 3WO3B 2Z8RA 4NJAH 2JIXB 1ZA6B 2ITDB 4EDWH 1JF1B 1V5JA 4WV1B 1H8SA 4KROD 3W9DA 5KN5A 3TN0A 4P23C 4WUKL 4UMGA 4UOJA 3S4SA 4JDVA 3ISWA 3PDGA 3VFTB 2BXYA 4F57H 5AZ2H 1LDSA 3Q6GL 5FB8A 2QR0B 1CQKA 4P9ML 1FL6A 4HJGA 1QBMH 1XF2B 1T83A 3QQ9C 2E6PA 3RX5A 2C3XA 4HAFA 4PJ7A 1GAFL 1E28B 5ESAA 2GAZA 3PGDB 5GGVH 5GRUH 4HKXB 1CFSA 1ZGLA 1A47A 1BP3B 2L0DA 2IAND 3SDDA 4NSKA 2BX5A 4JM2D 1MCSA 4PJXE 5DT1L 2FL5B 4AIZA 1GGTA 5C71A 3ZYJA 3HCVB 4I4WB 2VQ1B 5K59F 1R5VB 3EYQC 4H8WH 1IM3A 4PG2C 1VENA 4CJ0A 4AEFA 3MLYH 4NBXB 1P7QD 4LHUD 4P3DB 4U1LA 2X1WL 5DEZA 2RCSH 5C8JB 2EDEA 3SJVD 1JYWA 4X6FA 3L1OL 1CGYA 4LCWA 4NNXA 3E8UL 3KNBB 1LNUA 3Q48A 4CU7A 2AKRB 3MMEA 4DGIH 5HD8C 1RULL 3F8UB 2XTLA 2BNUB 3S36X 4NHUA 4XP9H 4M03A 4GRLD 5BZWA 3HAEA 5CS7A 3MJ8A 5FECB 3LRGA 3QXAB 2YEZA 4UTAL 1YA5A 1ZLUH 2XV6B 2HJKB 3ME0A 5E6ZA 4TTGA 1ZEAH 4EOWL 2CIKB 1A1MB 5D2LB 3KJ4B 4HBCH 3GMNA 4RIRB 3MR9A 1T7WA 2MQ3A 5JHLH 2Z93B 3EO9L 1HINH 4X4MA 3U1SH 1D3CA 4AIXA 5ISZD 1G9MC 1YNKL 3BGFC 3UJIL 1RZ7L 3O6LL 3HG1E 3U7YL 5IHUL 4N9GA 5T1LD 3GHBH 2HFFA 3ULUL 5IW3A 1JNLH 3BH9B 4LCCB 2D7MA 2P8MA 3VGGA 1YUHA 1EH9A 4HS8H 1KEGH 5F9DC 4L3AA 5CILH 2I07B 4WU5A 4ODVL 1IGIL 4N0UB 5I1DA 3UTPE 4X80L 2BVPB 3PP4H 2D0GA 1TENA 5IVXF 3RVTD 4JY5H 1Z5LA 3DHJA 3I2CL 1JV5B 4ALAH 5HGAA 5ANME 1A7RL 3QEUB 1CF8H 5DR5L 3TH4T 1QFWM 4YE4L 2BDNH 4KHTH 4KVNH 1QSFD 2UVEA 1P9MA 1RUKL 1NGXB 2N1KA 4FQLH 1U8MA 4Z95H 4MGXA 2LU7A 4GAFB 4BSVA 4CUCA 1CLYL 1Q72H 1ROWA 3TCXA 1KCUL 3QR2A 4LVOC 2F54B 1OQOA 5ICYA 1MHPH 4WTZG 2JCCE 3MRQA 1OP3K 1KB5L 4UB0L 3DVNB 5GISH 1T3FA 1WIPA 3VWJC 3WIHA 1J1XL 3TEUA 4WENB 1J8HA 1SEQH 4GSDL 4LIQH 1LEKB 1MPAL 1F2XK 1HQRA 1HSBB 1NBYA 5JOEA 3V7AE 2V2WB 5I1LA 4K07A 1MJJA 1X4ZA 3D48R 4U1IA 4LLAA 3BDYH 3TVMD 4S2SB 1A2YA 1HNFA 3ULVF 3ZDZF 32C2A 1C7TA 3ALWA 2A77L 2D0FA 1FQ9C 2M8XA 4UIMB 5MHSE 1JPTL 1IVLA 3GMMB 3R0NA 5I75C 1ND0A 3H3KA 5HYQB 2V7NB 1TTGA 3PGFL 4Y4HC 2HLFD 3OWEA 5HYIA 3CDFA 5TDPA 1CVRA 4P4KC 4G8IA 3VH8A 1VACB 3MBXL 3CAFA 3RIFK 5GSRB 2VISA 4XNYL 2EYTA 3HR5B 4FTVE 4LDLB 4NZJA 5GS1B 4W4OC 4YXLH 4NPYA 4JRYE 4G7VL 4PGDA 3REVB 3SBWA 2VDKL 2GKIA 3T0VA 3HA0A 3DX8A 1A6TB 1QR1B 2BNQE 5JW4R 5L9DL 4OB5H 4OLEA 4ELMA 5MI0C 1K2DB 1HK6A 4FNLL 3WBDA 1FBIL 3WS6C 2V17L 1L9MA 1J5OL 1ZV5A 2X4PA 3C5SB 4RQQB 3HAEH 1NGWA 4R7DA 1RZJC 4W70A 1YEGL 3RY6A 1W72B 3L5JA 3MODH 3W2DH 2OJEA 1J1PH 4WNQA 5IM7A 1JNHA 4JVPA 4U1HA 5ALCL 1BF2A 2EDLA 4JQVA 4GXUN 1F6FB 3QIBC 4O5LH 5ACMA 2NY4D 4M1GL 5T1KA 1NCAL 3S97C 4BSWA 5M7QA 5E2TL 1JHKL 1OGAB 3WE6B 2UYLA 1VHPA 5IVZB 3D87B 4OM1L 4ODUA 5J57B 1HHJA 2ADJA 3ZTJG 5DS8B 5CHNB 3T2OA 4H0IA 5L2JB 3M07A 3O3UN 1RZFL 3ES6A 3L3IA 4OZFB 1MCOL 3CPLB 4PJIA 5I73B 4JFPA 3KYMB 1WCQA 4LLYB 2F53A 2JB6B 2VLLA 2XWBA 4UT9H 1FYTB 1A3LL 4EN3B 2EKJA 3BIBX 3VGAB 1KIRA 3BW9A 3DUUA 1JPSH 5ETUA 1BZ9B 4IIQC 4NNPH 2O5YH 3OAYH 3F7VB 2BC4B 3GSWA 4IRSA 2MKLC 4X5XB 2X4OB 3PWLB 3FMGH 3W11C 5DC4B 43CAB 4FQCH 5D1QA 3CFJA 4OGAD 1JGLH 2HJLA 5E8EA 3H42L 1QLFA 3FT2B 1ZLWH 1BFVH 1X5JA 3OR6B 2KQNA 4Y2DB 5IVXB 4V1DB 2ZNWA 3EJYD 1J0JA 1YY9D 1RUML 1U93B 2Y72A 1CDJA 4HUVB 5FHBL 3ZKMD 4YC2B 1MCLA 1RZ8B 4M43H 4DGVH 4N0RA 6CGTA 3CC5B 5HHXH 3ECBB 5AYUL 5IBLC 3I50H 2ZG2A 3WIHH 1BGXL 4M6NL 4OF0A 3PXJA 2C5DC 2DQIL 2VZOA 5CCKH 1MFAL 3D3VD 4PJ8C 4PP2A 2QKIB 4HUXB 2XKUA 4PLOB 5FO8B 3MV9B 3U30C 4JR9L 2OK0L 3LB6C 3L6FB 1DQLH 3WJLA 3HB3D 1RK1B 2XZQL 5E8NB 1K6QH 1JYNA 4LCUB 1K3ZA 3CDGB 2J6EA 3GK8H 3D39D 3QDAA 1DVFB 1BAFH 2IQAA 4IS6A 1IT9H 2P24A 3BIAX 4JQXC 3RDTD 1M1SA 3WKML 1NBZB 4HKJB 4NRXB 3TCLA 4P23A 3OZ9H 2B2XH 3VE0B 1S78D 4YDVA 2W9DH 3MREB 3A0OA 3IU3B 4P2RA 3S96B 1FIEA 3MXWL 3ZDXE 4ZUUA 1KT2A 4MQXD 4GUPA 4M7LH 4WI3A 4KHXH 2EXYD 2IAMC 3ZKSD 1L6ZA 8FABB 5AWNL 1FJ1A 4G6JH 1UB5A 1BX2B 2Q86A 1GIGL 3MJ9L 4I8DA 4YBLC 2AJZB 5D7LD 5EC2A 3PHQA 2VLMD 2D2OA 5E5MA 4GMSL 1VKXA 2PETA 4HFUH 2X89D 1FNSL 3QZWB 4L9DA 3X12B 3UDWC 5KSUB 5I1GL 4Q74A 5I1AB 5MEOB 4IHOB 5BRZD 2HLAB 4I5BB 1IGFH 2EYRA 4MLSA 4YHYC 4KTEL 2YPKA 1JRHL 4XVSL 2Z4QA 5HI5C 1QR4A 3V6BR 4KY1H 4IDJH 5IW1B 1BLNA 4PG2A 3IJSA 4WGWB 2ZCHL 5FO9A 1NCNA 1CDUA 1EDQA 2BRQA 5ICXA 4MLIA 4UT7L 4UIKH 3IAGC 4OLUL 2YBRB 1GVIA 3VWKD 4BUHA 2FIKA 5AD0A 3QI9B 5KAQG 3EJZC 4XP1L 1W0WA 3H0TA 1EJOH 1TZIA 3OXSA 1QYGL 1T21B 2DDQL 4HX1A 1D5IL 2EDBA 2NY0C 4CL7A 3S88H 5E99L 2Y07H 1H3XA 4NQVA 3SDCB 2DB8A 2VB5A 3BUYB 3QWRA 5IESL 5HHOB 1UYWL 4JCMA 2Z31B 2ATKA 2NY7H 4Q7DA 1KEML 5K9QI 1QD0A 1D5MA 1B0WA 4DUXA 5KVGH 3RA7H 5D7KD 1XIWD 4XHJD 4A2MA 4PJ5E 1YEJH 3LD8B 5SWSA 3QDME 4WIQA 4RAHA 4HGMA 2M26A 3VD9A 1J0IA 2ZOLB 4P46B 4RNRA 5JQHC 4DFIA 2OTUA 2D9CA 4CADB 4Y4FD 4MJ5B 2M2DA 3NPSC 4ZFGL 1A3RL 5F9OH 2K7QA 3SN6N 2I27N 1HWHB 4F7MB 2ARJQ 4NQCE 4TPRL 1I8KB 3E2HC 2OSLB 1NGPH 3B8YA 3WNMA 4PJHA 5H8DA 2CDGB 1TZHA 4F33A 3UXFA 2PO6D 2NMSA 2X4QA 1S9VB 3IT8D 1CIDA 3SQBA 5T3XH 1FO0A 2AEPL 4K7PL 1ZGLM 4IJ3C 4CVXA 1WITA 3OKLA 5IJVA 2AXHA 4Z7NE 1I3RA 3KYNA 3T65A 1IBGH 1XF5B 1Z3GH 4L1DA 4S1DD 2EXWC 4XBEH 5CIPA 4AH2A 1F5WA 4JFXB 4D0CA 2OMBA 1BOGB 1ZVYA 3B5TA 1WFTA 2XOTA 3S35L 1N3NB 5I1EL 3U0TB 2R69H 2O5ZL 3GUTA 1AGCA 4QRRA 2Q8BL 1CDIA 2YRLA 1C7SA 3T0EC 1P6FA 2QV2A 4JFHD 4ZAKC 3NPZB 4QKXB 5JPMB 2FD6L 4LBEB 4ZYKA 5CD5D 1BD2A 3OAUL 4D0DA 3MOBL 3EOTL 3GSQA 1NMCB 1MIEH 4GQ9H 2DJUA 4FFZH 3OKMB 1JZ5A 3F7YB 1S9XB 3BO8A 2V2TA 5TQ2H 3PWVA 1MHEA 4Z5RA 3GKWL 1UM5L 3MZGB 5E7BA 3NOIA 1CG9A 2AEWA 3MRFA 3V6ZA 5ERWB 1G6RB 4KUCF 2AXFB 1BVLA 1U8NB 1MCEA 4F37K 3UTTD 1OSZB 3MROB 5FAAA 5E8OB 3UTQB 2MKWA 1F8TH 1OW0C 4U0RB 1HZHL 3NCFB 1A7QL 4JB9H 4R96B 4AEEA 3V0WH 4U1SA 2YS4A 5GZOD 2VLRD 5HYJE 3IRZA 4QTIL 2VO5A 3CVHH 3MYJB 5A43C 4HLZH 3PV6A 3BI9X 4Y4HA 3SKMB 3IDNA 1KIUA 4YPGB 3S37X 1JNJA 3QO1B 5F93C 4RMVA 1MJUL 2GTWB 4OLVL 4JLRA 2ZUWA 4ZS6C 1CGWA 4U3HA 2Z9TA 5JPNB 1KLFA 4K7PY 4W4OA 3CDCA 1S7QB 1QFUH 5JIKA 5L7XH 5FYJD 1A7PL 1V7ML 4NHCL 1ZA3B 3LKNA 3IFLL 1IZJA 2IF7A 4TVSa 2VABA 3MBEB 4XCEB 3VJ6B 4JO2L 2ZUVA 1W72L 4ETYA 1NUGA 1MCQA 2J5LB 2VKXA 3A67L 4ZXBD 4YHKH 1JHLH 3OAZK 3RTQD 3MTRA 3DECA 3GEWB 3WS6A 1XMWA 1KFAL 5I8KH 5TF1L 2PYFA 5H94B 3GIZL 4PJXF 2BMKA 4QWWD 2GSGA 2VH5L 2XPGB 1T89C 2C4FU 2V7HB 4YDKH 3RZCD 2I60L 5C09E 3WO4B 3S34L 1IGMH 1QNZL 1QFOA 2E7LC 4RMUA 3D25B 1L7IL 5DUML 4OZFG 4X5WB 3MGTA 2CLRA 2OI9C 1PQZB 1AKJB 1EEUA 1XGRA 4KVCH 5EH1A 1JJUA 5GRXG 4XI5D 4HCRA 3RQ3A 5CBEA 1F4AA 4N90D 5CUSL 5A16B 4LLQB 5AG8A 3SKOB 1UJ3C 2V6HA 3FT4B 4HFWB 2NTFA 3PQYB 2LVEA 3KPSE 4L8CA 4KMQA 3ILQD 4ONOA 5I66A 5D1ZD 4XRCA 2NY2D 3KLHD 5FGBC 4D3CH 4ENED 3BWUC 2PXYB 3BP5A 4P2QA 4M7KL 1TQCC 4JGJA 1FO0H 3MQIA 3C8DA 4RFEB 3O2WH 4U31A 1ES0A 4IIQA 3E1F1 1U8KA 3ARDC 3FB5B 3RKPA 1HXYA 3SE9H 1KF9B 4WU7B 3L3GB 3CFKB 3EGSA 4MCYA 4PJFE 3KPNA 4LSVH 5J7CC 1GOGA 5JTWA 3DYMA 4QRPB 4HG4J 4OIAA 3ARWA 3C60B 3EFFA 2GW5A 4AJ0A 1PG7X 5F88B 5E2UH 1EXUB 5SWZB 2QSVA 1OAZH 4LEOB 3RNKB 1U3HD 1Q1JH 3VCLB 3QA3B 3GJEA 4PG9A 2XRAL 3QULA 3BP7A 1AR1D 2BJMH 1MHHB 2HYMA 4RGMB 2AXJA 1KYOK 2IEPA 1DQQA 5J6HB 1HSAB 4F8TA 1O5DT 1E4JA 2Z91B 4PJ8A 3UBXA 3MV01 3C2AL 2DQJH 4KV5E 4LFHD 3U46A 4YHML 3X13B 1XF4A 5F1KC 2E9BA 1KUMA 4O02H 3NACL 5C0FB 3JV4B 4AQOA 1NLBL 2VDRH 4RGOH 3ARED 2JCCF 4AMKL 5I17B 3H7LA 5D4QA 3V4PL 4YBQD 4KTYA 5FUOH 3QZWG 2VXUH 3UYRH 3QNYB 5DMGD 4UV4H 3BZ4A 4MA7L 4YHZH 5E7FA 5EO0A 2H9GA 4XNXL 1U6AL 4Z7UA 2PR4L 4Q9CA 2ZCLH 1ORSA 1XZ0A 3N1GC 1TETL 2ADIB 2IAMA 1D9KD 5E1AB 5T33L 1YMMB 3INUL 1FFOB 3O8XC 4GKSA 3TJHC 4V2BA 4XP4L 3MA9H 3STBA 2R23A 3TA3B 4I2XA 2F19H 4MJIE 1NSNH 4PJ7E 2HKFH 2C1PB 1IEBB 3IFPA 4F7TB 4NN6B 5IV2A 1LVEA 2VC2H 1F58H 5I1KL 3BPNB 5GRVL 4I77L 2WUCH 5C0GA 4RGND 4YGAB 1NGYA 5B38B 2BY0A 4M6ML 4I0PB 1CL7L 4DFHA 1UG9A 1HHGA 4LGRB 5FYKH 4M5ZH 2A6IA 5MEPB 1KPVA 3THMH 3NAAL 5TPWH 2JJVA 1F90L 4JY4B 5HYSB 2FDBP 4LSDA 4U7MA 2ICWA 1YEKL 5DO2D 4MX7B 4WV1C 5BJTB 4F7CA 4HCRH 2BXZA 2NW3A 2GK0A 4PJXB 1EEYB 4LCWE 4C83A 3B4NA 2UWEB 4YUEH 3TT1H 1INEH 3UO1H 2EDFA 4KRMB 2D31A 5F70A 4YH6A 5FGCE 2PN5A 3IGAB 4WVRA 1BFOA 1N4XH 1CFQA 5GJSL 3VRLE 5C0IA 1SYVB 4J3TA 4XGZB 4IRJA 5EU4A 1IC5L 4KUCD 5LBSL 4HT1L 2NTSP 2Y1VA 2GY5A 4P2OB 3C87A 3CXHK 1T2QL 3DXAA 4PY8I 1SJVA 5DEGA 3PWPD 4OF7A 5B8CC 1UXSB 4O2FB 3VG0H 3VFNB 4X4ME 4X6EB 4P9HC 1PYWB 1GC1C 4JO1L 5JUEH 2RHEA 3D1MC 1XH3B 4LGSB 3CIQA 5IF0A 4QHMB 3Q5YA 1RURL 1CR9H 2QSCL 2AV1A 1MFBH 4ODHL 2R8SL 3BRGC 1LDPH 4PRPA 3UJJL 1BBDH 5TFSH 1TXKA 5F9WB 2Y25A 2XZAL 4X6CE 3BIKA 2PTTA 3RWEA 2Y23A 2YN5A 4XVUC 3HG1B 2A9NH 3DMMA 5TGBA 5TDNB 5GZNC 4OSUL 3UBXI 2N7AA 2HWZH 2ADGB 4RISL 5IQ7H 4EQ2A 4XCYA 2ESVD 3CUPA 3GJFA 3SPVB 1RUAH 1U58B 5DJCB 2FWOA 5H37G 3PL6D 1ZLSH 1PY4A 1IEAA 1QRND 5EO1B 1PX3A 4I48A 4YK4C 3TBTB 1J87A 3VXNB 3KJ4C 1QSED 4FZ8L 5IMLA 2E7BA 3VFMA 1A4JB 1DBML 1KJMA 3MNZA 1AD9B 2FHCA 5I8CA 1BQLL 3T0EA 3FB8B 4OI9A 4XT1C 1HILA 4YHNA 4ZAKA 1G6RL 2Y7QB 4FFVC 1XFPA 4HXAH 3QIWB 4JHWH 6FABH 1E6JH 5KJRL 2P8PB 4QRTB 4LARL 4H88H 2NY6D 4XMKL 4FP8H 4MCZA 4O51A 4QCIA 3ARFD 1IKFH 3QUYC 4M48L 1J8HE 3AS0A 4IMLA 4JFEA 4LASH 4ZFOB 4E5XA 5CEYB 4UZGA 3QUMB 5CINH 1N7MH 2ORBL 3MRNB 3MCLH 1H3WM 1KN4H 3RWGA 2QQKL 3P4MB 1NMAL 4EIGB 1F4YL 1OW0A 1U42A 4K23L 4MJ6B 4ELKB 1OTTC 1BVKB 1R3LB 1TVBB 2OX5A 2CO6B 2EE2A 3VW3H 4OGXH 2HFTA 4XPHH 1S8DA 3TPUA 4OLZL 4NUGH 4WW1B 3LRHA 1T1XA 2BHZA 5CGYC 5C6PB 2BVQA 3PF2A 4KI5C 3CLEH 4EI5B 1F45A 1I7TA 3ZDXF 1SVCP 4L9LB 3G5VA 4D8PA 2Q76B 1A9EA 1IAII 1TJGH 3GO1H 2E27L 3MLSH 1AI1H 5DI8B 5HY9A 1FFQA 5MERA 2OJZL 3KYKH 1Q9LB 1OT1A 1IAIH 2FX8H 1U41A 3ZTNL 5E08L 3SE3A 2IBZY 4L3EA 2MSPA 3U4BH 3DROB 4PREB 3DO7A 5GGRA 4QHLB 4AL8H 1EBPA 4NWUL 3U36B 3N9GH 5GS0D 1UWGL 5I6XB 4N0YH 5C0ND 4FTVB 2B0SH 4S11A 2WV3A 4HIJA 3O9WC 1NGZA 1G0XA 4JRYB 3OJMB 1T89A 4M8QB 4GW1B 4R4ND 1KB5A 4ONFL 4MD4B 2BNQB 2E7LA 2ZCKH 3P4OA 4BFEA 4HMCA 4R8WL 4KKNA 4O2CA 3DVGB 4POYA 3U2SA 2MFNA 2HVJA 3V0VA 1NC4D 3Q6GH 4PJBA 1FL5B 1U8OB 2IFFL 1FFNB 2E3VA 3IDXH 3R0MA 4KJYB 5F9JA 3HFMH 4OQ1A 3KJ6H 5F3HA 1XR8B 1G7LB 4JHBA 3FAWA 1AO7D 1JVKA 1GAFH 1UJ3A 4LQFL 3VRJB 3MLXH 3HZYA 4RAVB 1YEDA 2HT4C 1A7NL 3H3PL 1TIUA 1ZANL 5D1XC 4JQIH 1LO4H 4PGEB 1ZT4A 1JK8A 5ACZB 5DT1H 2P43B 2XTJB 1IL1A 3I6LE 5FGBA 4R0LA 4ZOCA 1VSCA 4RAUA 2F53E 5KVMC 3K74B 3RVWD 3ROOB 3RNQA 4I1NB 3D18B 5MEQB 1PJ9A 1DQDL 2H32B 3W39A 2NY1C 5CD3B 4NCC1 1MHCB 3JWDL 3ARDA 3E3QC 4NZTL 1Z2KA 4C4KO 3L1OH 4BH7B 2N56A 3T3ME 4BM7A 3RP1A 4NUJB 3E8UH 5ADPH 4K8RL 3DV6A 5IWLC 4JPIA 5DZOA 5AEAA 1RULH 1OLLA 5HVHB 2VLJB 1ED3B 2VE6A 3K8MA 3IFNH 4NO0D 4MNGE 3QHFL 3RVUD 1JN6B 3S3JA 3HZVB 1SM3L 4DEPC 2H6PA 5JA8B 3G5XA 5IG7A 4EOWH 3ARQA 4GW5B 1MREL 3WLWC 2C1OA 4NNYB 5DHVA 3JTTA 3P73B 4Z7NF 1KNOB 3CFCL 5L6YL 4PRBB 5GQBA 5EN2A 3OTTA 3TFKC 1YNKH 3MRDA 3UJIH 1RZ7H 4HS3B 4CVZB 5F89A 3U7YH 5IHUH 5FUZH 1ORQB 3IYLW 3WIFA 5HGBA 4L3CA 3BPLC 3U7AA 1S9WA 3ZKXB 3HRZB 1I8MB 2R56L 3PP3K 3MRCA 1O7VA 4M93B 5DVMA 4ODWA 3K46A 1AP2A 4KAQL 1IGIH 3GMLA 1DFBL 4X80H 4LLWA 3P0GB 3A6BH 3H8NA 1UM4L 4X83A 4MA1B 2IPKB 2NXZC 1IAOB 5INDA 3HMXL 2DMCA 1A7RH 3VGBA 2FJFA 1UA6L 1YJDL 4NRYA 4KZEL 3UC0H 2CJUL 4GS7B 5HYSG 4XZUA 1LEGB 43C9B 2OYPA 4HGKC 3HE7B 3QUXB 1NC2D 1O7SA 4YHPB 1KJ2A 3MRJA 3X14B 1CLYH 1N2RA 1J1OL 2A6JA 4L4TE 5D9SA 1JPFA 4N8CL 2EDNA 4DKEL 4FQXB 4JY6A 3IDGB 4UDUB 1KB5H 2FJHA 3NIDE 1SYSA 5DZNA 4K71B 4F80A 3FTGA 1LMKA 1YNLL 5FIEA 4NZUH 4GSDH 4R3SA 2BVYA 1FV1B 1ZHKA 5JXEA 2JIXA 1ZA6A 3EOBB 2ITDA 4Z7OE 5D7JB 1U8JA 4WV1A 5EOCJ 3ZSSA 4TQEL 3GBNH 1G84A 4BK4A 3TIDB 4KJWC 4PV9B 2CLVB 3O2DL 3RI5F 1T7VA 5D7IA 3VFTA 1SVZA 4LU5L 4FQPA 2X7LA 2E9WA 2NQCA 4WW2F 3G5YB 1JPTH 3TNMB 1I1CA 1TFHA 3ULVC 1XF2A 1DBJL 1WK0A 3EDFA 3PV7A 4XPFH 5DK2B 4A6YA 1DR9A 4JN1L 3IS0X 3MBXH 3RU8L 3AFLA 3KDMB 3PGDA 2YA1A 5EORL 4HKXA 4N0CC 2WLYA 4XNYH 4NO5A 5F96L 3MRKA 1YMHB 5FF6B 4B7IA 3M17A 4G7VH 3EOYG 3TBWA 3CU7A 2FL5A 2VDKH 2NZ9C 5EU5B 5LG1A 3VGFA 3HCVA 5L9DH 2A6KB 3PXHA 4I4WA 2VQ1A 2XN9E 1RV6X 1R5VA 3EFDH 3MJ9A 1BF8A 5T1MB 2OZ4A 2BVOB 4K94L 3TESA 3W0WE 4FNLH 3B9KC 5EA0L 2E7CA 1FBIH 4P3DA 2X9XA 5C8JA 1J5OH 3EO1B 4NCDA 1TVHA 1UEMA 3FQTA 5F7YC 1B0GB 4PJ5B 4PJHE 3O3BB 3KNBA 1YEGH 2CKBL 5GGUB 3QDMB 5KVDL 2AKRA 1IRAY 3CH1A 1OP3H 3MV7D 2BNUA 2WBJB 5DHVH 1YEIL 3J7HA 2YD1A 3QJHA 5FECA 3QXAA 4NQCB 2HJKA 4DVRL 2Z31C 2OXGA 5E24E 5CZXD 5FK9A 4PJFF 3QFJD 1A1MA 5D2LA 1F4XH 5E2TH 4RIRA 4FXGB 1HH6B 4Y5XB 4PRHD 4ZFOL 2LABA 1MCWW 4OM1H 2Z93A 4YEEA 1CTOA 2A73B 4QRRE 3QUML 5FCUH 4E41D 3BX7C 4Y4KB 4X7TB 5TF0A 1UGNA 4S1SH 3ZTJH 3KHQA 1U91B 3VXUA 4ONGH 5CGMA 3BH9A 2DLIA 2IQ9H 1A3LH 1A0QL 5DRZB 1A6AB 2I07A 2L4OA 4HMEA 1EPFA 2KPNA 2BVPA 4M1CD 2A0LC 1LD9B 5JZ7D 3BT2L 4KV5F 4MHHG 3VI4E 4ODBD 1CGTA 5CEZE 1I9EA 1JV5A 3FT3B 3H42H 4KU1A 1NKOA 1Z0NA 3DI2B 3FCTA 5E00A 2NXYC 3G08B 4JFFA 3QEUA 3P2TA 2DM4A 2Q7YA 2YD8A 1UVQB 4WRLA 3QEHB 5AUMB 4P5KB 1FORH 1A6ZB 3TYFA 4M00A 1GHFH 1CD0A 1RHFA 4K7PX 3CFDA 5EZOL 1BGXH 4KJPD 1YYMH 2F54A 3LDBB 5I16B 3NTCL 2DQIH 1T03L 1L0XA 3WFBL 1XGTA 3MCG1 5HYJB 1MFAH 2G5RA 3UMTA 4M4RA 2ZOKB 4Q6IC 3B9VA 2W9EL 2V9TA 4R2GC 3K4ZA 3S35X 4H0HB 4JR9H 2OK0H 3P9LA 1CI5A 2P5EB 1LEKA 2LAGB 4LSTH 1HSBA 3O9WA 1OB1B 5ALBH 5BZDB 3WKMH 2V2WA 2MCPL 4APQB 5DMIH 1CDYA 5IBTL 3TH3T 4QTHB 4F3FB 5CJBA 4S2SA 3STLA 5BVJB 1HDMB 4YNYB 3D0LB 4UIMA 3E6FB 2ILLA 3GMMA 1X5FA 4FS0A 2V7NA 1J9CT 3QAZC 4UINL 5I71C 4P9HH 2WWKO 3VU2A 4AG4L 4OD3L 5J56B 1GC1H 4FFYH 2ICWJ 3VG9B 4X7SH 4PRAB 4WW2B 5DJXB 1VACA 5HGHA 1TMCB 3UTSD 5GSRA 2HTKD 3MJ9H 4FRWA 3MRGB 3GRWL 1CZ8H 2OZ4H 2ZWLT 1VADB 4HHAB 5C09B 3VXMB 1P84J 1RU9L 3DO3A 5IB1B 3REVA 4DW2L 4BZ2L 5D1XA 1ZT1B 5C86A 3SOBL 1A6TA 3VRLF 1M7XA 2DM2A 4YFDB 5TH2A 5I1GH 2O26U 1JRHI 4AEHL 2J5LC 1YECL 1CDBA 1VA9A 1K2DA 1T6VN 2NR6C 1JRHH 5A2FA 2BSED 3WN5C 5JORB 1AC0A 4EQ3A 4HJJH 3MRRA 4EBQH 5LGKA 2ZCHH 2IH1A 1VEOA 3C5SA 4L29B 4ZS7L 4RQQA 5DLML 1MAMH 3J8F7 3BN9C 4UT7H 1W72A 4KJQD 4LF3B 3QIUD 3VGEA 1QYGH 3EJJX 5IWLA 2DDQH 1D5IH 1KTDB 3HC4L 5F7LB 5E6IB 5E99H 3MNVB 3NN8B 4QYOB 4X6CF 4XAKE 5C3TA 2FEEL 3GMQB 5HI4D 2DI7A 1ZT7B 2YPLE 1JCKA 1NDGA 4X6DA 4U7SA 1OGAA 1JWMB 2DKSA 5IVZA 1NBVL 3BKJH 1FDLL 4UV7L 4G6KL 5CHNA 4PJFB 1HHHB 2G2RA 4FMKA 4NQEA 2CSPA 1SJEB 4MA8H 1WZLA 4FQ1L 5FOBB 5FHAH 3KYMA 1W8OA 3LN5B 3ULSA 3L9RA 3TZVD 2NZIA 3QG7H 1RJZB 1FYTA 4XB7A 4EN3A 4ZFGH 1A3RH 2VDNL 4N68A 2EZ0D 1BZ9A 3FFCB 2BC4A 3B2VH 4ETQB 4LSSL 1B4RA 4KK8C 3DETC 4LSQL 4X5XA 3PWLA 1ZGLP 1FRGL 4KKAD 43CAA 1BVZA 4XCNB 3C09C 1WISA 4HIEB 5E6YA 4WWKD 3OR6A 5IVXA 4Y2DA 1FH5L 4Z7UE 4LOUC 4K7PH 2DJSA 5EOTB 2E8YA 3KPSD 3O6FB 1U93A 5IP4A 4HUVA 2APBA 4HUNB 4XBPA 1RZ8A 4XP5H 4YO0A 1RZKL 7CGTA 1S7WB 1V05A 3KLSA 4FABL 5KN5B 5I1EH 2O5ZH 4QF1B 4RGMC 4JDVB 5F1IB 4M9OA 2Q8BH 2P49B 35C8L 1JI1A 2FD6H 1H8OA 1QFWL 2SEBA 2QKIA 1II4E 3MOBH 5FO8A 3MV9A 2NNAB 3NZ8B 3L6FA 4ZTOL 1ITCA 1RQ5A 4N5EC 1RK1A 5E8NA 4MJIB 3MRLA 3RPIB 4HF5L 4N1EA 4C4KT 4PJDE 3GKWH 1MQ8A 1CFTA 1UM5H 2AK4D 5DJAA 1DVFA 3ARGC 3MNWB 1NBZA 4HKJA 2GJ6D 4NSKB 1NJ9B 3QEQD 3MREA 3IU3A 5C0CD 4TUKL 3TO4C 3ARBC 4HZLA 1AY1L 1JWUA 4MXQC 1A7QH 3QPQD 4XMLL 3D85B 5C0BB 3RVVD 4QTIH 2WMPA 1BX2A 4U1LB 2X70B 3OV6A 1G1CA 4X98A 3TA3C 2AJZA 4HH8A 1MJUH 3RPKA 4PY7B 1I7RA 4X6FB 2YHGA 4F7PA 3C5ZD 4LCWB 4K3EL 2FJGA 2EDKA 4WI2A 1HI6B 1A7PH 4G6MH 5KSUA 3MMEB 1EAJA 5I1AA 3IFLH 4IOSD 4IHOA 1DDHA 2HLAA 4RWHA 5FGCB 4PTTA 4JO2H 1W72H 1OSPL 2ATPB 5GRYA 3TN0D 1T1YB 3P30L 4QRQA 2J4WH 3L5HA 2YEZB 5IW1A 3OJDA 3B9KA 1XAUA 2R2HA 4JZNB 1NGQL 5TF1H 5L2KE 4HBQA 4JRWA 4PRPE 3MR9B 2XNAA 1IM9B 1KCRL 2YBRA 4Y16C 2ARWA 2NY5C 2FB4H 3JWOC 1I3VA 1UENA 3SKJH 2VQTA 4JDZB 1T21A 2VL5B 2I60H 1QNZH 3HPJB 1S7RA 1L7IH 2FRGP 4S1QL 5DUMH 3SDCA 5IGXL 4YHOH 5IMKB 4LEXL 5DQJB 3BUYA 2GFBA 3SDDD 5HHOA 4ACPA 1YUHB 1KENH 1NMBL 3T3MF 1AJ7L 2Z31A 3FQNA 1N8ZB 3RI5K 4H20L 4X6CB 5F8RC 1FAKT 1EA9C 4RMWA 1JZ7A 4J3UA 5F7UA 4GH7B 1HYSD 4KKCC 1UACL 4Q9QH 1OAYH 3T0EE 4H5SA 4LLDA 4NJ9L 4P46A 2EE6A 4XXDB 3ARRA 4MJ5A 4RMTA 2FIRT 5JXAL 4LDOB 3P4LA 5GGSA 2BFVL 3UPAA 4M7KH 1UXWB 1N5YL 4X5LA 3ZZ1A 4M7JL 2OSLA 4JFEE 2H2SD 3QCVL 3UJTL 2Q8AH 4Z8FL 2CDGA 4Z7VF 2WUBH 1UWXK 3AXLA 1UFUA 3CSYB 3LH2H 4MNQA 4WI6A 5ICYB 1R5IB 4PFEA 4CW1B 5I1CH 1S9VA 1D5ZB 2E6JA 4EUPA 3QCTL 1WIOA 5EBLA 3OAZH 2A9ML 3U83A 4ZSOE 1NL0L 3JV6A 4X9FA 1MY5A 1XF5A 5DD3L 1MI5D 1YEFL 2AABL 1BOGA 1N3NA 2BVTA 2XRAH 2EDRA 3V6OC 3U0TA 5D70H 1EVUA 5I1LB 3FQWB 1AIFB 5LAXA 4XCCL 3V8CA 4U1IB 4F57L 3DRTA 1CXEA 3O4OC 1JGEB 4LBEA 4CDHA 1KCLA 1M7IA 2OTPA 4XTRC 3HE6C 4L3EE 4RZCB 1YN7B 3M45A 3OKMA 3OG4B 5I74B 4YHMH 4G8IB 3VH8B 2XKNA 3C6SB 1ZKAA 1A6PA 2VISB 5GGVL 4D2NA 5FOJA 3AGVA 4Y5VB 3ULVH 5HGDA 2AXFA 2R9HC 4PGDB 3VXSD 3NIDF 3V4PH 5IJKC 1PVHA 1OSZA 3MROA 3K1DA 3RGHA 5E8OA 3RGVB 3DX8B 3UTQA 5BMFL 2Y6SD 3IXTB 1U8LB 4MA7H 2RB8A 4GG6A 1Q0YH 3F12B 4Y8DC 4R96A 4GG6E 1U6AH 2PR4H 1WCBB 3MYJA 4G43B 3MLYL 4NM8H 4DCQB 3F65A 4Z7OF 2XWJB 1CLZH 3SKMA 4YPGA 2RCSL 1CIUA 3ZT5A 1MLBA 2GTWA 2R39A 3INUH 4WFFD 2CRIA 3TBVA 1NGWB 4OF5A 3N1MC 1J8HD 4GBXB 4DGIL 2BY3A 4WI7A 1QP1A 1K9TA 3FB7A 2HA1A 3MBEA 3MV8B 4XCEA 3VJ6A 3VXRB 1JNHB 1NKRA 4U1HB 5IROC 3H9SB 3WLBB 4I77H 5IK3B 2FLRT 5JA9A 1XF3A 1ZEAL 3WN5A 5T1KB 5I6XC 3OKYA 4M6MH 1T5WB 2AK1H 5A3ID 3NZHL 5H94A 2Z8WC 4KROC 3NAAH 1F90H 2XPGA 2E7MA 5IB2B 1HINL 4I9WD 1PGRB 3L5WB 2V7HA 1MCKA 2C4FT 1X6LA 2R2BA 1RAMA 1CE1L 3PUCA 4PLNC 4RBPK 3TPKA 3D25A 5JMRA 3L3IB 3GHBL 1ODAA 2EEAA 3CMGA 3QDGE 1PQZA 2F53B 5GGVY 1AKJA 3HRPA 4YXHL 2RAMA 4PJHF 2VKWA 3BW9B 3P77A 5GJSH 2J8UB 3BZFB 1GRWA 5A16A 1IC5H 4LLQA 2L7UA 1RK0B 2YUWA 3EIFA 4HFWA 3PQYA 5D1QB 3CFJB 3WHE1 2E9JA 4MB3A 5DJ2A 1G9EA 2PW1B 1CF8L 3G9AB 2XTJC 1DLFL 4JO1H 2VOTA 4KHTL 3SDXE 4KVNL 4MNGB 4XWGH 1RPQA 3SCMB 4FQLL 4RFEA 1RURH 3LS4L 3JWNC 2R8SH 4ODHH 3FB5A 3UJJH 4MWFA 2LTQB 5ID0B 4WU7A 4UI2A 2F74A 3B2UD 3CFKA 3VXQA 5BW7C 1XR9B 4NFCA 5L8LB 4M4PA 2WWKT 4Z7VB 4PP2B 4OCWL 5IW6B 4QRPA 2AJ3B 5HVWA 1SEQL 2PYEE 2MQ0A 5F88A 5SWZA 1EXUA 4WFEE 4OZGA 1YQVH 4LEOA 1DN0B 5ACLA 3VI4F 1HIMH 3VCLA 4C56D 3QA3A 2FSEB 4U2YA 4YZFE 4CNIA 2IQAB 3DHMA 5BS0D 4HG4K 1MHHA 4FZ8H 5H37H 3GSRA 3Q2CA 3BDYL 1JTTA 2XG4A 1DBMH 3LOWA 1XCQA 1FHGA 4EKXA 1CXIA 1HSAA 4PBVC 1BQLH 4LPYA 2B1AH 1PAMA 4GAJL 2Z91A 4IRSD 1KT2B 1G6RH 2Z8SA 4KRNA 4GUPB 5DVLA 2DI9A 4LGPB 4QRSB 5KJRH 3X13A 1FJ1B 1FFPA 4IMKC 5CEXB 1BREA 4LARH 4XMKH 4JG1L 4JRXE 3JV4A 5ID1B 4GMTH 4OQTL 5EC2B 5F9AC 4M93C 3H9YA 1A9BA 3TF7C 5DRXA 3FRUB 4MSWB 2VXQL 4G9FE 4OIIH 1GXEA 1JPGB 3F6LA 4L4TB 2ORBH 4WHTB 4OB5L 4QRUA 4Q58C 2QQKH 3P0VH 3G5ZA 5T3XD 1M4KA 5D7IE 3PWJB 4K23H 2P4AB 2ADIA 5E1AA 2AI0H 1BLNB 4DAGH 1EVTC 1YMMA 4EI6B 1FFOA 2HG5B 4OLZH 1GZPB 3SDYL 3TA3A 3KVQA 4GRWE 3V4VL 3BXNA 2C1PA 4UQ2B 3W2DL 1G9NC 1CFBA 3MFGB 2E27H 3EW3B 3I84A 1NANI 4UNUA 4HH9B 1C5BL 4QHUB 4ZUTB 4NKQB 2CUMA 4FQXC 3ZTNH 2BCKB 1J86A 1NANH 4KUZL 1OTSD 2J8OA 4ZFFA 3LKSA 4O5LL 4P23D 2IBGA 3EYOB 4I0PA 4NWUH 2FGWL 4P2RD 5MEPA 4PRNB 1UWGH 2ATKB 1X44A 4LNRA 2UUDK 1R3IH 4MB5A 5D7JC 1D5MB 1PDKA 2EECA 4MX7A 3TVMC 3QQ9D 2CK2A 1EEYA 3S6CA 2NX5E 2UWEA 3TH2T 4ONFH 3OB8A 1BBJB 3BGFB 3JVGC 3W9EB 2XN9B 1VFAA 4R8WH 4RNRB 2JTDA 4TSCH 2OTUB 3QNXA 4M9PA 3HI6L 3W0WB 2NY3D 4FZEH 2DAVA 1JPSL 5C0AE 1SYVA 4XGZA 4NFBA 2IFFH 5FYLH 1K4DB 3Q6FB 3FMGL 4P2OA 3G6JB 1H3PL 2E8ZA 4FQCL 4PJHB 5D2LE 5TJWK 3O2DA 1JGLL 1TZHB 2MJWA 5A2JH 1SY6A 1I1YA 5H2BB 1UXSA 4O2FA 3ZE0E 3H3PH 1A7NH 4UBDD 1ZANH 1FO0B 1PYWA 5DK0A 1G7PB 4CVXB 1FNGA 4X8JA 5CBAB 3OKLB 2D03L 2UV3A 1I3RB 4DGVL 3KYNB 3T65B 1HH9B 4KGLA 4QHMA 3VXUE 3F5WA 5HHXL 4YX2H 1WWBX 3H9HB 4LNVA 3I50L 2Q7NA 1ZHLB 2VZSA 3WIHL 5CIPB 3ZHLA 4D0CB 1A1OA 1A64A 1LP9B 3QWRD 1CXLA 1AGCB 4QRRB 2FH8A 2K1MA 3D2UD 4NZTH 2F9BT 4LVOB 4N1HB 3QWOA 2DLFL 4ZYKB 2OR8A 3EAKA 1R5WA 2GHWB 2WBJC 4Z7WF 1MLCA 1TCRB 3CU1A 5KOVC 3VWJB 2ADGA 4JFFE 1RJLB 1U58A 5DJCA 3SGJC 5CJOH 3VH8G 1RIVH 2X4TB 2HAZA 5SWSD 4BQBA 1P4BH 1C5DB 1IT9L 1ZOXA 4HWEL 1CG9B 1SM3H 4L4JA 4LCIL 2ZSWA 3OZ9L 2B2XL 1MRCH 1QLRA 3V6OA 1BVLB 4Z7UF 1UCBL 3RVXD 2W9DL 2LU3A 4J1UA 1AD9A 5JW3L 5T3ZE 1MREH 3FB8A 5TQ0L 2VDPH 4TRPH 4ZO7A 2Y7QA 4Y4KC 5K9JH 4G6FB 4M7LL 3QIWA 5DURD 3T3PE 3HE6A 4QOKA 5I75B 2MTPA 4G6JL 1JMXA 2P8PA 3DSNA 3DVIA 4Y4HB 4FFWD 2X9YA 3KPRA 4P48A 4P5TB 4P4KB 2QBWA 4ZFOA 3G9VA 1UH4A 4JAMB 4HUWA 5CEYA 3BFOA 4OGYL 2OQJA 1TNNA 2R56H 4OGAC 4Z78B 3QUMA 1MUJB 4J23A 3MRMA 3MRNA 5IJKA 3LKNB 4HEME 1WBXB 3P4MA 1DFBH 1DL7L 2VABB 3EJYC 1YY9C 4LLVB 3MRBB 4MJ6A 1UM4H 2H3NB 4PJDF 1BVKA 5MI0B 4KY1L 4IDJL 1R3LA 1TVBA 5DJYB 2FLBT 1CD1B 3IVKB 3FN0H 3MOAL 4WW1A 2PYFB 1BD2D 2VIRB 4UIKL 4KZEH 3LV3B 4EI5A 1DUZB 5FGSA 2AJUH 2Q76A 1EJOL 5DI8A 3QUKA 3WL9A 1UH2A 1X5ZA 3DURA 4NQTA 2JF1A 4J3XA 1OAQL 1TPXC 5M94B 2Y07L 3QDJA 5J0BA 1FG2B 1TJHL 4PRIE 3GBLA 1UH3A 3DROA 3VI3E 5IROA 1QBLH 4N8CH 3HB3C 4DKEH 4QHLA 3U36A 2FBJL 3QIBB 4S1RH 4YFLF 4OZ4A 4XMPL 1I8LC 2RIKA 4LKCB 3RDTC 1YNLH 2XQBH 4OFYA 1GZQA 4LPWA 3DRQB 1JPST 2X1PA 4J3OC 3HR6A 3WMSA 1RVFH 5KVGL 3RA7L 1RHHB 4HSQA 3ABZA 1YEHL 1S78C 1BFTA 2NTFB 4GW1A 3E3QE 4M8QA 3AM8C 4APQC 4GW4B 2AJYH 1SJXA 2I9TA 3GSUB 5E9DE 2BNRD 4MQXC 4OTXL 5DA4A 2EXYC 2VLKD 1RFDH 1INDL 4XRCB 3O2DH 5EBWA 4JANB 1SY6H 3S3SA 5INCB 2DQFB 3BP5B 4TOYL 1U8OA 1R24B 4KJYA 1F13A 1NGPL 2I9LB 3QUZD 3PP3H 1XR8A 4X6DE 1EHXA 4NC0B 1G7LA 1MCDA 3VRJA 1QFHA 3T1FB 4OUUB 5EORH 3ET9F 5F96H 3EGSB 1FNEB 2ZPKH 4NQXA 3WHE0 4PGEA 1DBBH 4NQEE 5ACZA 5HBBA 5CFHA 2AW2A 5T1DH 3EFFB 3M1BA 4LHUA 1IBGL 1Z3GL 4KRPB 2YPLB 4XBEL 1FYTE 3GRWA 3D18A 5FYKD 4CU8A 5MEQA 5EA0H 3VWKC 5CD3A 1MHCA 5F3BB 1EHLH 4PGBB 4NN7C 5EWIL 2J6EL 5F44A 4WCYL 3BPOC 4NUJA 2X1XR 5ICZB 3RX8A 4PJ8B 1MIEL 4GQ9L 3R1GH 4FFZL 5DVNA 1X5IA 2VLJA 5E6IC 1FZKB 5TQ2L 1MCPH 1XF4B 1E6OL 1HYRC 1YEIH 4Z7WB 1JN6A 1MVUB 3HZVA 3RRQA 2XA8H 4DVRH 1FNFA 5KSAD 1XIWC 3BH8B 5C6WH 4HIHB 5ISZA 1JGVH 1S9KC 4P2QD 4NNYA 4DJMA 5IR1B 4ESKA 1KNOA 2GJJA 1I3UA 2JJTC 2H9GB 1ZSDB 4PRBA 3QUMH 4Y4FC 4XAWL 2QJDA 3N1FC 4XNQA 1XZ0B 5E2JA 5F1NA 4CVZA 2VZ3A 1OWRM 4K7FB 4NZRL 5AG9A 4IMKA 3MA7B 1ORQA 1KIQB 1I8MA 3HRZA 4OAWB 5EU7E 3GMOB 2R23B 3BQUD 3W82A 3LEYH 3T0WA 5CLTA 3BD3A 5IT2L 4MS8D 2XYCA 3CFBB 2QADD 3OGOE 1T4KA 4MHHI 1JHLL 3DIFA 2GSIA 4YHYB 2EDHA 4J4PD 4HGWB 4S1DC 1QSFA 3WD5L 2Z0BA 1NGYB 3NFNB 4G8GD 3IDYC 5I8KL 3VXOB 1BQHA 3T2PA 4PJDB 5FXCH 1IC4H 5D2NC 3C6LD 43C9A 1YQ2A 5KSVA 4UQ3A 2ICWB 3QQ4A 4YDKL 4D94A 4F7CB 3QUXA 4GG6F 1U9KA 4WO4B 1XF1A 2GK0B 4YHPA 5CD5C 5HDQH 3X14A 5GHWH 4Z77B 2NY0B 1SBBA 4X9IA 2FO4A 3CXHJ 4FQXA 1AH1A 4BQ6A 1T03H 3IDGA 4XPTH 1G9ML 3NCJL 1CYGA 5D72H 1CFQB 1OARH 3Q1SH 4OKDA 2W9EH 3VA6A 3MRIA 1NFDA 1FV1A 3IAQA 3EOBA 2CQVA 3FAXA 4GLRI 5D7JA 5DEGB 2IAMD 1CWVA 3MSPA 4F7EA 3CXDL 3TVMA 5DJZB 3RWDB 4GLRH 4PV9A 5IBTH 5GZOC 2CDEB 5DJ6B 4D3CL 4IDLA 1RJYB 1QPPA 3OMZA 1HEZA 5DGRA 3HN3A 2DN7A 4RMQA 5I8EB 1ONQB 1FO0L 2PCPB 3G5YA 4G9DB 1S3KH 4B41A 3NPSB 4LL9A 3DTXA 3O2WL 3LEXB 4EXKA 4UINH 5DJDA 4ONHA 1H3TA 3WFZA 5L2KB 4OD3H 3E2HB 3TC9A 4PRPB 4J2XA 2VWEE 5SX5K 5JQ6H 3SE9L 1JP5A 4TSBL 3E0GA 3KDMA 5FF6A 3O0RL 5JHDB 1YMHA 5K9OA 1ZLVK 3GRWH 3BIKB 1AQDB 1PX4A 4KKLD 5IEKB 2P48B 1RU9H 4LSVL 1KELH 1WAAF 4DW2H 4J3VA 4X9BA 5EU5A 4CVUA 2Z8VC 3U79A 5I30H 1EO7A 5J11C 1OAXH 5FKPA 2XICA 1YECH 2LQRA 3GJFB 5T1MA 2BVOA 4QWWC 5C07E 4R26L 1V3JA 1E4WH 2BJML 2UY6A 3D69B 3RZCC 3EO1A 2DYPD 3VFMB 3BZEB 5DLMH 1B0GA 1Z9LA 4PJ5A 3MNZB 2HT3D 4WFHE 3SDXF 4IRJD 5AYQA 4ZAKB 2OL3B 4HK0B 3QDMA 4MNQE 5CEZL 1MSPA 2DQJL 2W07A 3DXAD 2WBJA 1WF5A 2V9RA 3HC4H 2FEEI 4MCZB 4NM4L 2APFA 3RBGA 3SGJA 4Y19B 1KLGB 4RGOL 4IMLB 4JFEB 4PV8B 1UM6L 3WFEH 4RX4A 3UYRL 1HH6A 5GRWA 4ZOBA 1KTLA 3U9UA 1JNNL 2G75B 3KS0J 4YHZL 1FDLH 4FQJH 2A73A 4UV7H 2NY2C 4G6KH 3RIFF 3LN9A 2ZCLL 4Y4KA 4X7TA 4YZFF 4FQ1H 4OV6F 1NFKA 4ZSOB 1JGDA 5CSZB 3WIIH 5HPOA 3TPUB 1K3IA 1M71B 4MB4A 3WUZA 2F19L 5LVEA 4KTDH 1NSNL 3DMMD 1B9ZA 2BVQB 3L3OA 2YPVL 3L95A 2VDNH 1DANU 4YDIL 5DRZA 4Z0XA 3SE8H 1I7TB 5T5NF 2DD8H 1PLGL 4LRIC 3ARXA 1FPTH 1MRFH 1DQTA 4LSQH 5HY9B 5MERB 1F58L 2GITA 3F7PC 2F15A 2EXWD 3RIAK 1RZJL 3FT3A 4MAYD 4L3EB 1HHIB 5C08E 3WHXB 1U95A 1G9NH 2FCBA 3G08A 1FH5H 2J88L 1JZ3A 1U3HC 4M5ZL 1AXSB 3T0ED 3THML 3O4LE 1AR1C 1UVQA 3QEHA 1B90A 4P5KA 1A6ZA 1NGZB 1RZKH 2YR3A 3UPCA 5D7IF 4JHAH 2R29L 2ZJSH 4M8VA 3MLVH 4YHIB 3TT1L 1INEL 3D3VA 4TUOB 3Q5TA 1OF2B 2UZYB 1Y6KR 5E2VL 5I16A 3ARYA 4GG6B 3P40A 4PJ9D 5D93C 4F15B 5HYJA 3V0VB 2OI9B 1N4XL 2ZOKA 3IRPX 4GRWF 1IE5A 3DX7B 4G8FB 1RUPL 2WWMD 1WZMA 3AREC 4RMRA 1JL8A 3D39A 1YEEH 4ZTOH 1I8LA 3RDTA 5E4EB 5F3HB 5F7DB 2P5EA 3NCMA 5GSVA 3L3KA 4HF5H 2W65B 5DMGC 4Y5VC 4XVJL 1OB1A 5TE4L 3BDXA 3HZYB 3K2MC 1YEDB 5BZDA 3VG0L 3AM8A 4APQA 3RGVC 4QTHA 4F3FA 1E4XI 2HFEB 4I3SH 4MXVE 5BVJA 2FO1A 1HDMA 4YNYA 4AM0A 1D9KC 1IL1B 3HPLB 2CIIB 3GNML 4TUKH 3RZWA 1LE5A 1E4XH 3V6FB 3K7UA 4XMLH 4X99A 1CT8B 1MFBL 1LDPL 4PRAA 4WW2A 1BBDL 5TFSL 5C9JB 3PGCA 3SGKC 3W39B 3WDIA 2X89A 5C0DB 3FN3A 3ARDB 3QWQB 5HHMD 3MRGA 4PR5B 4NQDE 1VADA 3VXMA 5C09A 1JYVA 5IB1A 4GBXC 5BRZA 4D9QE 4I3RL 1ZT1A 2A9NL 2LAAA 4K3EH 5KVFL 3LQAC 3MO1A 3RHWK 4RGNC 3LY6A 3QDGB 4JJ5B 4GQPH 5FYLE 1RUAL 1OSPH 1ADQL 5D2LF 1P84K 4KZDH 5JORA 5FO7B 3B9EA 3HC3H 1WT5C 5DO2C 2H6PB 3ZE0F 3L3HB 4L29A 1RIUH 3VWKA 5IG7B 4BA8A 1AFVH 4G80A 2Q87A 3JTTB 1KCRH 4LF3A 1IGCL 1MFNA 1RMFH 2UZXB 1LEIB 1QHOA 3KXFD 6FABL 1E6JL 3MUHL 4WUUE 3MRDB 3SDXB 4H88L 1V3LA 4NGHL 5E6IA 3U4AA 4HWBA 5F89B 3MNVA 5E94B 3NN8A 5IGXH 1U8IA 3JTSA 1IZKA 1UJTA 4QYOA 3GSVA 5SWZE 3GMQA 4OZGE 1ZT7A 2D7TH 3MRCB 4TYUA 3DJ9A 5CINL 2ED9A 2YZ8A 3MCLL 1KLUB 4H26B 4NO2B 5EU3B 2R1XB 3SE4A 3VD7A 4GO6B 3DV4B 3VMNA 2BVEA 2YRZA 1IILE 1SJEA 4UILL 1UACH 3ZO0A 1P5UA 5BV7C 1UZ8B 2H2PD 2R4SH 5INDB 1LHZA 1OVZA 3VW3L 2PYEB 2WW8A 3LN5A 4OGXL 2R0LH 4NUGL 2FHFA 2FJFB 2X1OA 1RJZA 2W38A 3WXVH 3O8XB 3CLEL 2Z92A 4XZUB 1N5YH 3FFCA 1TJGL 3MLSL 4ETQA 3WV0A 4JHZA 4M7JH 3T3PF 3QCVH 1KJ2B 3KYKL 2FX8L 4Z8FH 1WC7B 3MACH 1N2RB 2A6JB 4XCNA 3T2QA 5KW9L 5D9SB 4HIEA 1DUYB 1JPFB 2P8LB 4XHQA 2FJHB 2PF6A 3PL6C 1SYSB 5EOTA 5IHLB 3ALXA 3O6FA 4JRXB 4N0YL 2A9MH 1LO2H 1EUUA 5D2NA 1NLDH 5IB3B 1D6EA 1ZHKB 5DD3H 1S7WA 1YEFH 4L4VE 2AABH 1U8JB 4G9FB 2C7UA 2ZCKL 4QF1A 1TDQA 1YPZE 5F1IA 5ILTH 4XCCH 1IQWL 5D7IB 2DQGL 4CRPA 2X7LB 3ARFC 1S7UB 3SO3C 3WSQH 4HEPG 3IDXL 4HDIA 3HLAB 2NNAA 3NZ8A 4JKLA 3SDAB 3HFML 3T4YB 3KJ6L 1H5BC 1FNHA 1OD9A 4MJIA 3RPIA 4GRWB 4A6YB 3MLXL 2Q1EA 5KZCD 5LWYL 4IOFD 3MNWA 4NO5B 3MRKB 3VI3F 4JQIL 1LO4L 5J6GB 3M17B 5B8CB 4BQCA 2KH2B 1G7JA 3E6HA 3TBWB 3TJHD 1NJ9A 1ZHNA 4YDJA 2UWEE 1AE6H 4HWZB 5BMFH 3FOLA 5E1HB 3G04A 4Z9KB 3MLRH 5HHPB 4BQ9A 4PTUB 1S7VB 3D85A 2EDXA 4EDXA 5C0BA 4OQTA 1Q9OB 2I25N 2X70A 3VGDA 4NT6A 4LSUL 4D9LL 3FO1B 4PY7A 4AY0A 3U4EA 1TVHB 3WKNA 1MCRA 3FQTB 2I24N 2IBBA 3OPZL 3U0WL 2NX5B 5ADPL 3T0XA 5CJQH 1UWXH 1HI6A 3ARSA 1MWAA 4R4FL 3EHBD 2EE3A 2AS5M 2VITA 2JIXD 2Y36L 3CH1B 5GS0C 3TBSA 5JXED 1FC1A 3VGHA 3UTZB 3IFNL 1NH6A 2OL3L 2Q20A 2ATPA 4JGUA 3GZKA 1PG7W 1T1YA 4X6DF 5FV2A 3QJHB 1WTGT 5C0AB 5C0NC 4PP1C 2IJ0C 2B1HL 3KPQA 5SX4I 4JZNA 4YK4B 5FK9B 3BN3B 4R4NC 3NZHH 4NKIL 3RZCA 5SX4H 4CBPA 2WP3O 1IM9A 4BK5A 4W81A 1X4XA 2EDYA 4JDZA 2VL5A 1KG0A 2AQ3A 2DMKA 1CE1H 3ARTA 4XNMA 3HPJA 3VFPB 3K4AA 1UT9A 4UNVA 5FUZL 4U1MB 4F37F 3VXUB 5IMKA 5DQJA 4K9EC 4F9PC 3QUYB 4BKLB 4YXHH 3Q5OA 1N8ZA 1I3GL 1MAJA 4X6CA 3OKNA 1MAKA 1OY3B 2JJSA 4KK5C 3A6BL 3V6OE 4HKZA 3CGTA 5GRJL 3FCTB 5E00B 3O6KH 1LO0H 3BWAA 4JFFB 4QOKE 4XXDA 1EEZB 5J13B 1DLFH 1CS6A 3UC0L 4ZNEE 5JW4N 5EUOE 5JLZA 2DIJA 2Q7YB 5MP6L 3KPRE 1UXWA 3NA9L 1BJ1J 2EIEA 1OGTA 4HKBB 4XH2B 3TYFB 4HQQH 1QKZL 4LRIA 3LS4H 4QXWA 3CFDB 3PWNB 3CSYA 5EU6E 4M61B 1R5IA 4CW1A 2GYSA 4UOW1 2YK1L 1I7UB 1Q94A 1XGTB 1D5ZA 2VN4A 4OF6A 4OCWH 5EUKA 3RVUC 5A1AA 1CGVA 2H26B 1U3HA 4X4ZA 4NZUL 4U6XB 3P9LB 4FFVD 1HWGB 1QA9B 3T04D 1PEWA 1V3KA 3JBG7 3MRHB 1Y6MR 3O9WB 5LKNA 3WEXA 5DGQA 3GBNL 5D71H 3FQWA 1AIFA 1VEMA 2IPTL 1FVCA 2KBGA 3N50A 3T0BA 2YXMA 3STLB 1JGEA 3MLPA 3QDJE 3HI1A 2X10A 4TN9A 4CMHC 2ADFL 4GAJH 4RZCA 2W9LA 1YN7A 4YHLL 5EIIB 3LVEA 4XPFL 2YOCA 3X3FH 3AREA 4P5TC 5HGHB 3C6SA 4JG1H 4KDVA 7FABL 4G6AD 4P3CH 4W68A 4Y5VA 2X42A 4OQTH 1ITBB 5T5FH 1OAKH 2X4UB 4YLQT 5D1XB 2VXQH 3RGVA 1PW3A 4PRIB 2QL1A 5CGYD 5B39A 3IXTA 1JMZA 4KI5D 5TH2B 1U8LA 2AQ2A 3P4NB 5GGRY 1TTUA 3EFDL 3F12A 1AR2A 3EYSH 1WCBA 5DFTA 4G43A 2F54D 4DCQA 1RZIA 2XWJA 1BPVA 3V5KA 3OL2A 4X9HA 5ESVB 2W59A 3MRRB 2ERJB 2IH1B 4U2ZA 3SGKA 2NY1B 4KQ3H 5CJXA 3SDYH 4MNHA 3V4VH 2IANE 3UX9B 5DRNB 4WHCA 5E9DB 4GBXA 4Q0XH 4KPHL 2DJ4A 3KPMA 3MV8A 5IFAL 3BP6A 2A83A 4ZD3L 3VXRA 4Q6YA 1CGSL 3H9SA 1CICB 1C5BH 3WLBA 1QPXA 2XTJE 5IK3A 4KUZH 4POZC 5BO1L 2AJSH 1SBSH 1T5WA 1NDGB 1WT5A 4X6DB 4DEPB 1F4XL 3SJVE 2FGWH 3BKCH 4O00A 1RUQL 1FZJA 3QHTC 3EOAA 5LJYH 3KAAA 4CN4A 5IB2A 3MJ7B 3I85A 3L5WA 3OAYK 1M05B 3L3JA 4XX1E 5FCUL 5KSBA 2G2RB 4NQEB 1ERNA 4OFIA 4S1SL 1V7NH 4W6WB 3F58L 2JJWA 1N6UA 4ONGL 3X11B 3ULSB 3L9RB 3ZHDA 2IQ9L 5I1JH 2VLJE 3ZKND 1RSFA 1CK0L 3HI6H 2CXGA 3BPLB 2ZG1A 3TWCH 5FEBA 3OB0K 4FMFA 4RDQF 2BRRH 2GK2A 2J8UA 4KDTC 4PB9H 3BZFA 2X05A 3UPRB 3MXVH 4GG8B 4O58L 3NFPB 3S36L 1RK0A 4HMDA 1QO3B 2GCYA 1H3PH 1VB9A 5ISZE 2QQLH 4TNWF 3CFIC 1WBZB 2CPCA 4HD9A 5T5NG 1KJ2L 2NY1D 2NXZB 2PW1A 4DGYH 1W0YT 4CVWA 4KRPC 1W8NA 2D03H 4JPVH 4MNGA 4XBPB 1EUTA 2CDFA 3SCMA 4YO0B 1FORL 2EC9U 2JLLA 2VZVA 1GHFL 2R2EB 4L5FH 4ZQKB 1YYML 1I1AB 5I2IB 1OWWA 5DVKA 5ESQB 3WNLA 5ID0A 1TNMA 1CFVH 5JOPD 2ZUYA 1V8HA 2DQHL 1XR9A 4WEBL 4LRNH 1VFOA 1OGAD 3NCCB 3LKOA 2DLFH 4Z7VA 2ESVA 2SEBB 5IW6A 2R1YB 4JO3L 2OM5A 2MHAB 2AJ3A 5DHXB 3QRFM 3PL6A 5F6IC 5F7MC 3P11H 3WLWD 1QSFE 4WEUD 1DN0A 1I9RL 1QSEA 3MRLB 4LSTL 2YZ1A 5DHYB 2FSEA 1CFTB 2UUDH 5DJAB 5ALBL 3HI5L 4JVWA 4HWEH 3FZUD 4HV8B 4QXGH 5DMIL 1FYTD 4HC1L 4EN3D 4LCIH 4BJLA 4A6YL 1EFXB 1UCBH 5GGTA 1X5LA 3KPPA 4K3JH 3CSGA 5JW3H 1F3RB 4HZLB 5TQ0H 3MCKB 1JWUB 2J7LA 3KWWA 2DF3A 2V2XB 4OLWL 3ZKQD 4P9HL 4QRSA 1GC1L 4FFYL 3FHQA 4X7SL 5CEXA 2XQYK 2P5WB 3CSBA 2VMFA 5ID1A 4M1CC 4Y2DD 3BAEL 4X98B 3V5HA 4V1DD 1CZ8L 2OZ4L 3QEGL 1I7RB 1NFDE 2G60L 4F7PB 3TYGH 4OGYH 3FRUA 4MSWA 5DA0B 2FJGB 3MFFB 4LPVA 2EDWA 1JPGA 4L4TA 4WHTA 1DL7H 1DDHB 3IU4L 4PTTB 4ZUWB 1MFEH 3PWJA 3DWTA 4U33A 4QRQB 3LQAH 3MUY1 4HJJL 4EBQL 3OJDB 1VDGA 2DM3A 1FLRL 3B9KB 4I3GA 4EI6A 2R2HB 2HG5A 1J12A 1GZPA 1MAML 3MOAH 1SEBA 3DPBA 4KJPC 3MV9D 4MXVF 2XNAB 5HJ3B 4UQ2A 1MQKL