3OGCA

Kcsa e71a variant in presence of na+
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism for selectivity-inactivation coupling in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 39
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2010-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ogcA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ogcA02
4G42B 4NPYB 4HH9B 4JFOA 4S2SB 4MLSA 4BZYA 3QQNA 4PP1C 4KJPC 5D1ZD 4Z95L 1DEEA 3DVGB 1G1CA 1PKQA 2PXYB 3UTSD 1J0JA 1LO4H 1H5BA 5DZOA 5HI3C 2MCG1 4NZJA 1GSMA 2YN3A 1P4IH 1NAML 5GS1C 1MCWM 4WIQA 4YNYA 5HHMD 3HC4H 3VA6A 1U8MA 4NZRH 5IV2A 3DRTB 3U0PA 1RUML 3C9NB 4NQDD 4JEGB 4KZEH 5JIIA 4X80L 3KPQB 3E6FA 3FQUB 1KTRL 5A2LH 3DYMA 5HTSA 4WV1C 4JFYA 3MA9H 1G7PB 4EKXA 3TT3H 1TZGH 2JIXA 3QNYA 5C0CA 3FL7A 4FMKA 4XRCB 2EKJA 5E1HB 4LGSB 3RVVC 3LS5L 2HFFA 1PYWB 1CLOL 3BKJH 1AQDB 2OR9H 2ITCB 3QAZB 1QQDB 3UTZA 4KAQH 2R0WL 3QULB 4OFYA 4J3VA 4UI2A 1U8NA 1AI1L 4X6CA 3IDUA 5AZ2L 3EOTL 4Y19A 2AJYL 4P99A 5DUML 4GUPA 1KCRH 4WI9A 4WW1B 4PJAF 4TTDC 1HHIB 4M7KH 4M6OL 5IW1B 4NKOB 4PJCE 2G9HA 2UY6A 5HYJE 3EFDH 5DC9B 5IB4B 2A83B 4JZNB 1MRCH 4PV9A 5FV1L 1R3JB 3BZ4B 2KZWA 5GZND 2VDKH 3H3PL 4RFNC 3L3JA 4R2GD 4PLKC 3W0WD 4PJBE 4XZUA 1XF4A 2AV1A 1FLRL 4PYGA 5KW9H 1H8SA 2APXA 5ESVB 3ZZ1A 2ICCA 5IB3B 3TZVA 3I2CL 1EDQA 1A7NL 3QUXA 3MLZH 3HR5A 4M1CD 2VTFA 5KAQF 1RFDH 4YFEA 2VUYA 5I1JL 1RZKC 7FABL 1QRND 5L9DH 4TOYH 4P57A 4HQQL 2QHRH 3IDGB 4GG6E 2M8XA 2ZSVB 3F7RA 4KXZI 4S0TD 3EYQD 4GXVH 4LIQH 1UYWL 3MYJB 1BREA 3C2AL 1BGXH 5K9QI 3WNNA 3PWPE 4NUJB 3MJ6A 3ARVA 4PGBA 4QYOA 4PJGA 3MFFB 1X7QA 1KCSH 3TV3H 5E00B 4GKZB 4U6TA 3NAAL 4XXDA 1MFDH 2OMNA 4WU5A 1XH3A 5TFSH 1D9KA 4KVCL 4LP4A 4F7EA 2EDFA 3OAYH 4QTHB 4UT7H 2CDFA 1GC1H 3NIFF 3QO1A 2EE2A 5DUBA 1FNGB 1FVEA 1Q9OA 3PWJB 1NFIA 4PJFE 4ZNEE 1WZKA 2GTWA 3M17A 3RVWD 1KXTB 3UX9B 3BO8B 4RFEB 5TDOA 5IQ9A 2IBBA 3KGRA 4N90E 3T0BA 1KPRB 2BSRA 1UKSA 3HTLX 2ARWA 3OR6A 3AM8A 1QSFD 1EPFA 3AUVA 1KLGA 3KPOA 1MI5B 1TJIH 4UB0L 4BQCA 4KKBC 5IVZA 1BQLH 2JJWA 1UM4H 4G80A 1DBMH 2H41A 2XN9A 4HWZB 2V9QA 4EBQL 4M43H 2P24A 3G6JF 2OJZL 2HT4C 4RA0C 4Y16B 4D9LH 1JYXA 2B2XL 3EBAA 2PO6D 1OCWH 3DVNA 3RL2B 3TF7C 5TQ2H 4JANA 4DFIA 3RX7A 1B4JL 1YNTB 1JZ4A 1G7MB 1TDQA 5I2IB 5E08H 3RPKA 4N8CL 4WI6A 4K8RD 3DURA 4AIOA 3WFEH 3DBXA 3DGGB 4WFFD 4BFIB 4R7NB 1FFRA 4KY1H 5SWZA 4KVNL 5IWLA 5JIKA 4DEPB 2V2XA 3W9EA 1QBML 3PQYE 4M7JL 5D2NA 3L3OA 1MJ7L 4JPKH 1E28B 4WUUB 5EO1B 2FYYB 1LD9B 1NDMB 5C0FA 3SDYH 3V2AR 4ONFL 4ZFOB 5D93B 3U4EB 4CBPA 5KSVA 1DQQB 4EJ1C 4K3DH 3T4YB 3SO3C 2QKIB 3PE9A 2DQEL 3VGHA 5I1KL 2YEZB 4JN2A 4FQ2L 1P5VA 3P0GB 4B5EA 2XWBB 3HZKB 4P2RA 3CU7A 5KSAA 2D7MA 1BLNB 1JZ7A 1I3VA 4YLQT 3PNWB 2H32H 4XP9L 3IXAB 5D72H 1HZHH 1CFNB 2EYTA 2X70B 3OZ9L 4KRLB 5FCUH 4PJHE 1WBZA 3CX5K 2VR4A 5A43C 5GRVK 4WU7B 3V0AC 3WE6B 1J8HE 1KG0B 3LN4B 4P59H 4ODTL 1YY8A 4K8RC 1L7IH 3KPSD 4OUUB 4BZ1H 1MAJA 5EOCL 3SDDA 4OCRL 1SYSB 2F58L 3D18B 1IKNA 4N0YH 5D71H 4M8QA 5LBSH 4POZD 4MS8D 4XB7A 4RAUB 3GEWB 2X89A 3QDMB 2LAGB 5E8PA 1HXMB 2FWOB 4ONGL 3UTSB 5ANMA 4JO4L 3OKEB 3QFJE 5D4QA 3B9EA 2G60H 4RDQG 3QXVA 5CHNB 2FNBA 1RK0A 1Z9LA 4K23L 5F7KC 5DUPH 1Z9OA 2GYSA 3GMPB 1MCRA 4I77H 4JY6A 5EUOB 2Q8AL 1ZVSA 4V1DD 1ZSDB 4K3EH 5EIQA 4I9WE 4QRRB 2VZOA 4YXLH 4FQ1L 2ADGB 2EIEA 1Q9WA 2IC2A 1OD7A 2P8PB 4UV7H 5F1SA 4HKXB 1CWVA 3V4PH 1IC7L 1CN4A 2CQVA 2NY4D 4YX2L 2X44D 4OKVA 4LCWD 4RRPA 3VXRA 2XWTB 4BFGA 1DDHB 3TBTB 1CXFA 4ZO7A 2ZOKB 1S7UB 4WW2A 3GO1L 1MY7A 1JN6A 2XICA 2ARJA 4QRSB 4ZFZB 2ATKA 3TGXA 1GGIL 5FB8B 3QIUB 1TTUA 4Z7QF 4KK5C 4POZC 4GRWH 3SDAA 1IQDA 2X4PA 5E9DD 3QPXH 1T5XA 1SY6A 3EGSB 1N8ZA 4HUUB 4MXQC 1JMXA 2IBGA 1HI6B 1HYRC 3MUY1 3BPOB 3QZWA 4ORGA 2P47B 2XNAA 1KPVB 3TBYB 5LWYH 2R0LH 4MNHB 4PFEA 3ZYZA 1GGCL 1PJ9A 4YUEL 5IQ7L 4OD3L 1HHKB 4GW1A 1E6JH 4YBQD 1DVFB 2R4RL 1FYTE 2DQIH 2ZWLT 1RUAH 1BPVA 4JKWA 3HAEH 3SGJC 4HKZB 3GBLA 5JR1L 1ZT1A 1U8HB 4RFOH 3NCMA 2R1YA 3V5HB 1DFBL 4POYA 3UJTH 2C3GA 3MXWH 5GISL 1NMAL 1MRDL 3D2UA 3BH8B 4FFYL 4DGVL 4X7TB 3X13A 1W0VA 3KPMA 1OGAD 5T5NF 5AZEL 4LNVA 4L8CB 1LO3L 2DQGL 1TTGA 4RGMB 4N0UE 5DC4B 1OM3H 3NCCB 3EOAA 3VDBA 1AQKL 3QEUB 4XGZA 1DP0A 3TNMB 4DKEL 1YMME 4Q2ZB 1CICB 3QIWA 2Q8BL 4H1LA 3MLSL 4OLZL 4RGNB 5I0ZA 4X99A 4P23D 3P4MB 5HHOD 1ES0A 4PRPB 3BN9D 3GNML 4PY7B 4WY7H 4NRZB 5SX5H 3QRFM 5GXBB 3WKML 3DXAB 3KNBB 4OV5B 3Q5TA 4YBQC 4ZSOA 4IRJC 4W70A 1QLEH 2DQUH 3F65A 4XVUD 4R4ND 1CE6B 2A6KA 4D9RE 1XFPA 1E6OL 3NFNA 4RIRB 2VXQL 3B43A 1FSKB 2ZSWB 2E6JA 1CVRA 3O9WA 3HAEB 2OX5A 1FVCA 4QNPF 3RL1B 4ZUUB 4OD1H 1SMAA 3DLQR 3C6LD 4OF7A 1DL7H 3L1OL 1MCIA 1ETZB 5BRZA 5MEOB 2YWZA 3D5OF 2QSCH 1CDHA 4W4OC 2VN7A 5DJ6A 2PW1B 5EWIH 5KZCD 1KB5A 4JFPA 5I1LB 2ERJB 1HEZB 1LP9A 1B6DA 1I8IA 3T3ME 1AJ7L 4ALAH 3I6GB 3GJFA 43CAB 3GRWA 3JWOL 2BNQD 1XGYL 1CD1A 2R8SH 3MV9E 1QFUH 4FQIH 3F6IA 2UZIH 2BSTA 3S35H 5ERWA 4XVSH 1UXSA 1CZ8H 3MNWA 5DJAB 3ZSTA 2C1OA 3ILPA 1TVDA 5F1IA 3UC0H 4HS3B 5GGVH 3LIZH 3QHZL 4HWEL 4HXAL 1JWUB 4J4PD 4M1DH 1JYVA 1K4DA 3DMMC 3EJZC 4D2NA 3DI3B 2DKUA 2UUDK 1AKJB 3O11B 3S96B 3MRNA 3JXAA 1T04A 1A9BB 4C4KO 3A6CL 5BS0A 2DQTH 1MFEH 3O8XB 3HG1B 3FHAA 2DLFH 5DHYA 5IW3A 4OFDA 4MNQA 3QR2A 3CU1A 3CVHH 1NC4B 2IH3B 3PDGA 4D94A 2DQDL 3ZLQC 4DVRH 3VG9B 5D5ME 2AXFA 1CYGA 4FNLH 5DJ8B 2NY2B 4D8PB 3QEQD 2H6PA 5D6DA 2J8UA 4P9HL 4XCFL 4LAQL 4ZD3L 5T1KB 3JTTA 3MV11 5DLML 4F9PC 5IKCB 1YA5A 3QJFB 3ZL4L 3Q1SL 3U46A 4LLVA 4C83A 4L8SC 4PREB 4DN3L 2J5LC 2PYEB 4G6ML 4LDLB 2H2PD 2DBJA 3PWVB 3C5JB 5EO0B 2LVEA 4JZOA 3SBWC 4EIZC 2RIKA 4WW2F 2XYCA 1T20B 5D1QC 1S3KH 4JLRB 3V0VA 4R8WH 1I1AB 3RTQB 2EO1A 1XCQB 3MRQA 5MENE 3WLBA 4PJ5D 5J6GA 1K5NA 2EIBA 3BDBA 2VLKA 5GGSB 5ITBH 2MPAH 1G6VK 4MDIB 1UM6H 4UT6L 3SJVD 3VXQA 5EA0L 3OGCA 4YDVB 4MNGA 1C12B 5F3HB 3RGHA 3LZFH 1KB9J 2F8XC 1MIEL 3SHSA 3BGMB 4MQXC 5CZVH 1MRFH 1WUNT 4HIHB 4FABH 4XNYH 4H0HB 3LV3A 5J6HA 4ZO9A 1UH4A 4EN3D 1NCUA 4AG4L 2VXSL 3HZVA 5H94B 3SE8H 2CD0A 4LLYB 3HAEG 2EO9A 2V7HA 2VDNH 4Q6IC 2CJUL 3BH9B 3VXOB 1BFTA 3GMMB 2Z31D 1XIWA 5D8JL 4OCSH 4NKIL 2Y4SA 3IFOA 4FQXB 4AQOA 3E8UL 1KENH 4XPAL 5FM5O 2W91A 5DO2D 1CDUA 3K4ZA 3OJVC 1Q9LA 1OSPH 4V2BA 4C59B 1MIML 3IVKA 3VE0A 1NEZA 4GBXC 5BW7A 4LVOC 4K94C 1NBZA 5DS8B 4MA1C 4CRPA 3MRRB 1MCBA 4W6XB 2C5DC 3Q3GA 1RY7B 3MNVA 5L88H 5HHQB 5KVGH 1WBYA 2EKSB 5E8OB 4QGTA 5IGXL 4XXCC 5EOCJ 4GMSL 3CUPB 3SQOH 4M3KB 1IGJA 3FB8A 5D7LA 4F15B 2IAMA 2G75A 3MUHL 4Y4HB 3MFGB 4XC3L 4L5FL 3WFHA 1CS6A 3H7BB 2X4QB 5IEKA 2N56A 2Y07H 3BT2H 1GYAA 3VFMA 3KPNA 1EO7A 3HNVH 2O5XH 3DV6B 3V0WH 3BD4A 4KHTH 3UZEA 5HPMB 2EYSA 5ICXA 3FFCA 4ETQA 1MFBH 3TN0B 4QRPB 1CQYA 3B6SA 1IZKA 3TO4D 4AEHH 3KLDA 6CGTA 2MNUA 3CDFA 3MXVH 2VLMD 4OUOA 4EZMA 1NGZA 3T0AA 5I15H 3WBDA 5DO2C 2NTSP 2VAAB 4YIQA 1QSED 2NNAB 4HMDA 4OF5A 1H8OA 2XKUA 3CFBA 3NN8B 3BGFB 3VRLF 4JM4L 4G8EB 4PLNC 2OK0L 1LP9F 1UM5H 5GGTL 2VQTA 4F37F 4HKBB 2IQ9H 1MUJB 3GHBL 1QA9A 2FJGB 4JPIA 4NYLA 1F42A 1LVEA 4Y5YA 5C09B 1IKFH 3LVEA 4GFTB 2EXWC 1ZLUK 1G7LB 1UZ8A 2EC8A 1A7QH 1BZ7B 1QR1B 5CJ8A 1GPOL 3OB0K 1S7SA 4OQTA 2FJHA 3CFDB 2HTKC 3R06A 3MRIA 4AL8H 3MV01 3RWCB 5HBBA 1F58L 1EAPA 4K9EC 4U6HA 5CILL 4R4FL 2F53D 4NZDA 4IOFC 4MJ4A 4LAJH 4QLRA 5F9AC 4MD0B 3SKMA 2C1PB 3DUSA 4KKLC 3L5IA 4PTUA 2X1PA 5F72S 5DJDB 3OKMB 4JDZB 3T0EE 1LWRA 1ZLVH 1DLFH 1T7WA 3GMNB 1VENA 5DRNB 3V7MA 3KYAA 3P4NB 1NGQH 5GSRB 2VWEE 3TYGH 1NUFA 1M71A 2FSEB 3FONA 4JJ5A 4LGRB 4NBZB 4OLVH 3RWEB 5HGBB 4JQIL 3WFZA 5EZOL 3O81A 3VFNA 3CK0H 1RUPL 1HKLL 5L7XH 3X12A 1I1CA 4OGXH 5BCAA 4YGVB 2BMKA 2F15A 1D5XA 1OTTD 1TJGL 3Q6FB 2YK1H 4ZQKB 1EUUA 4YZFF 3MJ9H 3CJJA 3C60D 3UDWC 3F8UB 5BV7H 1DSFL 2Z8RA 4BZ2L 1S78C 1AE6L 4NQTA 3HFMH 4GLRH 5F9WB 4P49A 1HSBA 1XF5A 1JPTH 3W0WA 4PRAA 1S9VB 2BNRE 4P2YA 2B1HH 3X3GH 2P5ED 3TH2T 5C0ND 5AEAA 1KN2L 3GSRA 3PDDA 1N64L 1T89C 4MD5B 4KHXH 2J4WL 1YEFH 3T2NL 1EFXB 5LGJA 1SYVB 5JOFA 2DB8A 4KKCC 3VI3F 1R3HA 1QRNA 3P4OB 4J6RL 2BXZA 2PXYD 4J3OC 4MJ6A 4JM2B 1U9KA 3FO2A 1WJ3A 5H37H 1U8LA 2VDRL 3H0TA 3OWEA 4LNRA 2CRYA 5J57B 4OCYH 1X5HA 5ITFB 5SWSE 1J05A 2VITB 4XAWL 3HLAB 2A6DB 4XCEA 2ENSA 1RJLB 1UB6A 1RZJC 4PJIA 4HK3N 3VG0L 2HVKB 5H35A 4PS4L 4FOMA 4I0PC 3S35X 2UY7A 4YGAB 4Q97A 2NX5B 1ZHLA 4Z7UF 3I02B 4OT1H 4RMRA 1HHGB 5DI8A 3ZDZE 4PJDF 3D0VB 5C0BA 1D5IH 4Y5VC 1MCQA 5J13C 1R3LB 5BV7B 2VMFA 4PRNB 1T2JA 1U3HC 1JGEA 1ZV5A 1YEEH 2YD6A 4K94H 1NMCB 1L0YA 1GL4B 2X05A 1OP9A 3RI5F 5IJKC 2IPTL 1VPOH 3ZE0F 2LU7A 3P9MB 5F96H 1U8QB 2X2YA 3H7LA 2CLRA 2E9BA 3VFTB 3QXDB 1VEMA 5IB2B 1YYLH 3OKOA 4FP8L 5IMLB 5FA4B 5BO1L 3QA3A 3GI9H 1KEMH 3HI1B 1JNLH 2PO6A 4U1IA 1GZPA 4ZAKD 5DEFB 5I1IL 2WP3T 2EDWA 1NFDF 2X4NA 2YPLB 1T1ZB 3JZ7A 3GFUA 3D25A 5F7EL 1U8PB 5B21A 3TFKC 5K9JH 2BY2A 3CCHB 1LO5A 4ZFGL 4PBXA 3PL6B 3BDXA 1ULVA 5CCKH 1NLBH 5DK0B 3ARQA 1ZAGA 3JV6B 3ZKXB 3PGDB 5IFJB 4IOSD 4IRSA 4ELMF 3TBWA 3JUYA 4CVZB 3OG4B 5MEPA 1QFPA 1J0KA 2NY3C 2ZJSH 4DZBA 4XP6L 4KK9C 4J8RA 3DETC 5CJOL 4HAFA 4G7YH 3TC9A 2PTTA 5JDSB 3I3EA 4LCUB 3UTTE 3RA7L 3IDIA 4YQXL 4RWYH 1UT9A 5E5RB 4G8IA 3FT3A 5FAAA 4EUPH 4JY5L 5FYLH 1HKFA 4EDXB 3KJ4B 5D70L 3EYUL 2YBRB 3BOVA 3QQ3A 4LCIH 4TYUA 3JVGC 3SE9L 5F7FA 2CKBL 1ED3A 4NCC1 3DTXA 3C5ZD 4P2OB 4HC1L 2RFXB 2NY6B 3NBNA 1PY9A 3RKPA 1I7ZA 4WTZA 2DIJA 3OF6D 3VH8A 4YR6A 5HHXL 1A6WH 5I1AB 1MHCB 3FN0L 4PP2B 3A0OA 3CSYA 5I8KL 1Z9MA 5D7IE 3S88H 1KJ3L 4PJEA 2FDBP 5JW3H 4Y1AB 4YHZH 4AMKL 5J1SC 5HI5C 4JO1L 1X3DA 3O2WL 4HG4J 1HH6B 3QQ9C 3E6HB 3LQAH 4TSBH 4V1DA 3MGTB 5IBTH 1INEH 3HNTL 3MRGA 3S5LA 1MI5D 1T1WA 2Z92B 1FG2A 4XPGH 4YDKL 4EVNB 1KCUL 4NKDB 2HVJA 4UUJB 4BSWA 4LCWA 3PXHA 4Y2DC 1PY4A 2NY0B 2EEDA 43C9B 1QVOA 5D6CB 3BHBA 1II4E 1JIBA 3PWPA 3SDCA 2X4RA 4X7FC 3SKNA 3AY4A 4Y4KB 4MB4A 3WFCH 4UQ2A 4TUOB 5E9DA 1XGTB 1YEGL 4QRTB 5CP7A 4RZCB 3M45A 3KPRE 1R5VA 4LSSL 4L4TB 2WBJA 1TVHA 4M03A 4UAOB 4PJ9B 1OARH 2MKLC 3QWOA 3QUMA 4YXKH 2KH2B 1JTTA 4XBGA 5E8NB 4QXWA 1RZJH 1FIGH 4LLDA 4AEIL 4WUUD 4Z77A 5H37G 4BQ6A 4NIKB 1INQA 3I9GH 4M6NH 3V6ZA 2ZG2A 5E4EB 3VXPA 3GSOA 1AP2B 2CLZA 1UXWB 1DBBH 1KTDB 1TNMA 1MLBA 1TQBB 5GJTH 3N1GC 1ZA6B 2GT9B 1G6RA 1EMTH 3FB7A 3K2UH 4BH8B 1ZLSL 3CFIC 4HMEA 4P3DA 4G7VL 4Y16C 4LKCB 1OGAA 5C0IB 5TGBA 1Y0LA 4XPTL 3O6KH 3EKCA 2QQLH 5A2KH 4O4YL 3WS6C 3KYOB 5HDBF 4NO5B 1YY9D 2Q7YB 4HFWA 3O6FB 4YBHA 2VDPH 3WLWC 3Q6GH 3D3VE 1ZA3B 1DN2A 4C55A 4M7LL 4R90L 3FO9B 3QDMD 2ZUXA 2DD8H 3MZTA 1CR9L 1FORH 3EO1A 1UJ3A 3ARDB 5GGUB 4LHQB 4XBPA 3PQYA 1CGSH 2BSSA 1Z0MA 5JQ6L 1ACZA 4X6DB 2X9WA 1A8JH 4HHAA 1XR9A 1J5OH 2F54B 5D93C 4GKNA 3HUJE 2Y7QB 4J1UB 1MNUH 2G5RA 4K8RL 1YN7A 5DURB 1FBIH 1NCDL 4CDGC 5JIPA 1RZGA 1T5WA 1MPAH 4QRRD 5CINH 3U2SA 2AEQL 4ZTPH 4QHLA 4QRUB 1KCVL 1RU9H 2BVUA 1R5WB 1IM9B 4P4KB 2C9AA 4Q9CA 5IHUH 2VQ1B 1LEKA 4ZYKA 2ESVD 1MLCA 4KRMB 2R29L 4NGHL 5CZXD 5ISZB 1MJJB 5B4MC 1GZQB 3BEVB 4E42B 1T66D 2GY5A 1BM3L 4PBWD 3LS4L 1FFNA 3QUZA 3UPAA 4BUGA 5I8EB 3RUGA 1F4XH 5HD8C 3QFJA 1CFVL 1HINH 4OLXH 4RQQB 3QDGB 1IEAB 2BZDA 4F7CA 5A3IC 2HLFD 1LK3H 1AXTH 4EXKA 3KDMA 5E94A 3IDJB 1N6VA 4PJCF 5EUKA 3BKMH 3J7HA 1JHKL 1DVFD 5FA3A 5ID0B 1JNHA 3DX8A 4FFVC 1KYOJ 4EI5C 5EZLA 1QTYT 4DWHA 3F5WB 2JJSC 1YDPB 4LP5A 1TMCB 4JFFA 2LABA 4NM8L 1YYML 1JVKA 2O5YL 2J6EH 3JV0A 3TJEL 4PJBF 4OLYL 2Q7NA 5HYSB 3QHTC 1FNSH 4XHQA 4JRWA 1KC5H 1DCLA 3O4LE 1JPGB 4JDTH 4HWBL 1NCAH 3QIUC 5EN2B 2W07A 1OP5K 4P3CL 1EO8H 1U8KA 5L2KE 3G5XA 3QEQA 2HKFH 1FDLH 4PB9L 4UBDC 1I8LC 4EOWH 3HZMB 1KJ2L 4X4YA 1QR4A 3BPOC 1CICD 5BJTB 3T09A 4FQCL 3MX0A 5KSBB 4RGND 1F13A 4GG6F 3BP5B 1G0YR 4XI5D 4PRPD 4XH2A 1U6AH 4OTXL 1NAKL 3DXAD 2OS7A 3ULVC 1FYTA 2NLJB 4OGAD 5DD3H 5ADPL 5DMJB 3HNSL 1IQWL 4HJJL 3FO1A 3A67H 4G9FE 3RNQA 3WDJA 1LILA 3DUUA 1JTPA 4M6AA 5JZ7D 2WINB 4NUGL 5DD1H 1BJ1H 2X41A 5CBAB 1NMBL 1Q1JL 4ZOEA 4PJFF 4N1HB 4RX4A 5ETUB 4NT6B 2Q76A 5CP3H 4M62H 4KUZH 5DR5H 4EN3A 3B9DA 2VZTA 2BY3A 2WZPD 4P5TD 4CU6A 2OJEB 3ARYA 4RGOL 2GY7B 3RU8H 5JLZA 3ARXA 4BFEA 1G6RL 3NA9L 3TH3T 4O2CA 3UTPD 3ROLB 4O00A 2Z31A 2ZZUT 4KROB 4B50A 2QQNL 1S7VB 4PJAB 3NIDE 4M8VA 5GZOC 1KBGH 4R7DA 2YHGA 4I5BA 4OZGA 1AKJD 1FGVH 1VACB 3V52H 4FQLL 3AU1A 2D2OA 5K33A 4Z7VA 1G9NL 1IAKA 2DQCL 1VCAA 3RHWF 5I16B 2VO5A 5AD0B 5KTEL 3O8XD 1KEGL 3HG1D 3P73B 3QUYB 5CGTA 3M1BB 1IMHC 1JUFA 1U3ZA 1WSST 5C9JA 3PIQB 1NC4D 4U1JA 1IE5A 4LSTH 2DI7A 1MCCA 4JN1L 4FQQA 5I1CL 4O2FB 2PKDA 1UQSA 5TE4H 2P8LA 2ERJC 3SGKA 2D7TH 2VH5H 3GMLB 2JCCE 3HB3D 2NY2D 2NW2A 2IADA 1H15A 2X4SB 1P7QA 1PW3A 4UINL 3IU3A 2G5BA 1A4JB 1I8KA 1DBKH 4Y8DC 5EZJA 1FL3B 2PYED 1YC7A 3G5VA 3UYOD 5IEHA 1NBQA 2FL5A 2WM0A 1UVQA 5JW5B 2GSIB 2WAHA 4MWFA 1YECH 4HJ0C 1D5MB 1V8HA 2DYPB 4PJHF 1E4KA 5F7UA 1SBSL 2IFFL 1QSEA 3VXUB 4A2LA 2UYLB 1ZHBA 3ARZA 2YD5A 1I1AD 3JBG7 2BOBB 5GS0H 1R0AL 5J8OA 3KPTA 1BQHB 3D87B 4HUWA 4F2MA 4XVTH 1JGDA 1FL5A 5HHOE 1HXYB 2X1OA 4HS6A 5I1GH 1B2WL 4PV8B 1EGJH 2FX8L 3MCLH 2APTA 3HMXA 4XVJH 4G8GE 3BXNA 4FXKB 3VG9C 3GSNA 3TYFA 3OKKA 3MLTB 2JK5A 3O41A 3STLA 1A3RL 1JRHH 3MV8B 3R1GH 4NHCH 4X5XA 5DGQA 1JHLH 4DZ8B 5CSZA 3KXFB 2BHYA 2F53A 3EDJA 3TNNB 3F12B 4QHMB 3QO0A 2V5RA 4WWKC 1CDIA 3TA3D 3S36H 1EVTC 3CMGA 3OAUL 2LAAA 4WI2A 4IOIB 4OFKA 1HCFX 3G6JB 1AO7B 4JHAH 1WAAA 4FQXD 5I18H 3C5SA 3BD5A 3IETB 2HKHL 5C7XL 4YHOH 3SCMB 5HGDA 3RTQC 1UH2A 3VW3H 1WQVT 4ZUWA 3DOSA 1T2QL 2ZP0T 1CBVL 2BNQE 4JFOB 3SKJH 1NBVL 3JTSB 3SDXE 4LEOB 1HHHB 3B9KD 2FX9H 1DEEB 4FHBD 4M9PA 3C60A 1PKQB 4EIGB 1F11A 1IZJA 1QKZH 4FFZL 3LDBB 1H5BB 4LPWA 3MRDA 3FB5A 5D7JD 5C0RL 4Y4HD 5BZDB 2DMCA 3QDAA 3BKYH 5E2WL 2ATPA 2P5EA 4YNYB 2XZQH 1U8MB 4JRXA 4ODBD 5IV2B 1CXKA 3U0PB 2QTEA 1NCTA 2MFNA 2MKWA 3TN0D 2QADC 3E6FB 3BD3A 4QRPD 5CJXC 1BAFH 4U6VH 4HH9A 1QFWM 4JFYB 4S2SA 5IM7A 1X4XA 3OB8A 1K6QH 4KK6D 1NPUA 2GJZA 5C0CB 5J89A 1REIA 1RUKL 3NZHL 5C8JA 4DAGH 4JREC 1D5BA 2ZUQB 3BUTA 2HFFB 1PVHA 3K0WA 1AHWC 3MUZ1 5KAQG 2YD4A 1GOGA 1U8IB 3UTZB 5JXED 5FCSH 1U8NB 3BJ91 1YEHL 4CDHA 2X4OA 4X6CB 4PG2A 4N68A 1LDPH 3C9NA 4MAYA 4HS8L 1MCOL 2WWKO 4Y19B 5FUOH 3U7YL 5HDQL 4GUPB 5ELIA 4UOW1 4F15C 3ARWA 5HXMA 4YHMH 5EFIA 2VL4A 4N1EA 3CFKB 5HGAA 1GGYA 1IBGH 2G9HB 2ITDA 3H3BC 2EDYA 2GSGB 4JFEE 4PV9B 2UUDH 5B39G 4MA7L 3LN5B 1I9JL 3TN0C 5SWQA 4HWUA 3DYPA 5IT2H 4F7MA 3DECA 5JOEA 3QULA 3WD5L 4LRNL 1M7DA 3SJVE 1NUGA 3L3JB 1JNNL 3TO2B 2O5ZH 5EU6E 1EK3A 1UC6A 4KMLB 4XZUB 3VFGH 2AV1B 2RHEA 4EQ3A 3IFNL 1KN4L 1RJYA 3TVMC 3BGFC 5L6YH 1FPTH 1UWGH 1F4YL 4OM1L 3CFEA 2BFVL 4OLWH 3QUXB 1NANI 4ZAKA 4BELD 4MAUL 3T3MF 3HR5B 1LO0H 1J0IA 2DLEA 3V7AE 5I6XB 1P4BH 4OCWH 1U93B 3BDYL 1V05A 5F6IC 4F8QA 1JGUH 4JZNA 4M00A 3DV4A 4NN5C 3FMGL 4ZOAA 3QI9A 3RGVC 3A6BL 3K74B 3QNZA 4OD2A 1TCMA 2HT3D 5KVEH 5BOZG 2FEDC 4B0MM 1ZGLP 4H20H 1PZ5A 3LPGA 3QXAA 4PGBB 4QYOB 3ARSA 4PJGB 1X7QB 5KVDH 2ARJQ 3GBML 1CD9B 3WO4B 4M7ZB 4N5ED 3UPRA 4WU5B 1CXHA 1EFXD 1XH3B 1D9KB 3P0YH 4ENEC 3T0EA 4JG0H 4F7EB 4BFBD 3DX6A 3QO1B 4DOHB 1FVEB 2NW3B 2GW5A 1Q9OB 2WUCH 1NFIB 2GTWB 3M17B 3VFWA 3GSNL 3LEYH 3E1F1 1X5KA 1T0NA 5D5MF 5JHDA 5TDOB 5IQ9B 1FGNH 4HGWB 2BERA 2BSRB 3OR6B 2D7OA 1KLGB 1EBPA 3EDFA 4NUJA 3C5ZA 5FYLE 3C87A 1LGVA 3MFFA 5IVZB 1OW0A 1M7XA 3EJYD 2AJUL 5I1EL 4G80B 2XN9B 4NKMA 2VLME 2P24B 2NX5D 5KN5B 4OGZA 4QTHA 3RWHA 2BNRA 1CDCA 3DVNB 4U4BA 5F7HA 4JANB 4CL7A 5C0GB 1FNGA 4O5LH 4HKJA 4I1NB 5CMAB 1QFWL 3BO8A 1NLDL 3DURB 4L3EE 1QEWA 3SGDI 2B4CC 3THMH 4MGXA 5B3JE 5SWZB 1GGBL 2KPNA 2DQJH 3S3SA 1V3LA 1NC2A 4HPOH 4MMXC 3I3DA 2V2XB 5DF0A 4I3GA 2XFXB 4JPVL 4OFIA 4HWZA 1K2DA 4M6MH 3E2HC 4Z7WE 1I3GH 1Y6KR 4JM2C 5CGMA 4MXVF 2IG2H 3L3OB 4QKXB 3CAFA 3L95B 5C0FB 3WFBH 5B38B 4KI5D 3RL2A 3HI5L 5HHPA 2NXYC 1ORQA 5KSVB 2YPLD 3IU4H 1YNTA 4PGEA 4N0CC 1HIML 5CLTA 2EE6A 4P2RB 1JWMA 2E7MA 3BWUC 5KSAB 3PL6D 1JI1A 3JWDH 5KG9A 1R3KA 2EYTB 1BVZA 1WBZB 4K2UL 4XP4L 1B0GA 4U1KA 2BC4A 1YY8B 3MBXL 5M94B 1OAYL 4D0DA 2EDNA 2YD1A 5EO1A 4M8QB 4R6UA 1T03L 1MQKL 1N0XL 5J0BA 1DQQA 5A1AA 2R9HD 3ETBF 3HS0B 3T4YA 4U6YA 5ACZA 4NJ9H 4HCRA 5C6TL 1GJIA 1H9VA 1MY5A 4JHWL 5ANMB 2YEZA 2DIBA 5ILTL 1N6QL 2IBZX 2R0KH 5I9QB 1ZLUH 1RK0B 2FO4B 3DX9A 1IGTB 1KGCD 3PNWA 2R69L 3U9PH 4PJ8C 4JY6B 2X70A 1Q72L 4FZ8L 1MF2H 1ZVSB 4NWUL 4WU7A 5CGYD 2EXYD 1VHPA 1IGML 1F00I 2MCPH 5JW4M 3BSZL 4P2OD 3U4BH 2NY6D 2JLLA 3ESVF 1Q9WB 1EEYB 5C71A 4J3SA 3PL6C 3CDYA 2P44B 3MLUH 4QOKD 5T5NG 5J7CC 2IGFH 3ZO0A 4OKVB 2FWOA 3QCUH 4JKPH 1WFNA 4WW2B 3OKEA 2ATKB 2VC2H 4Y1AD 1FFQA 1PGRB 4BUHA 1IQDB 1LO4L 2X4PB 4H88L 1T5XB 2D7QA 4F80A 1N8ZB 1P4IL 5DK3A 3QZWB 4ORGB 1DANT 4QRRA 4DKAA 3G6AA 2XNAB 2W0FA 2DQHH 3WJJA 3ILQC 3V4UH 4HKXA 4KZEL 1IC4H 3KJ4C 5HDLA 1MH5A 4GW1B 4NNPH 1OVZA 3MA9L 2NY0D 4Q9BA 2ESVA 3TT3L 1A6UH 5IVXE 2H32A 4CJ1A 4ZFZA 1ZT1B 2FATH 2HFGL 3V5DA 4AT6B 5I30H 4X6BA 3OG6B 2R1YB 4Y4KD 1URLA 2B1AH 3PP4H 2GJJA 3BPCA 3BAEH 1JGLH 1L7TH 3BKJL 3PXJA 2OR9L 3D2UB 4YC2B 1H3VA 3X13B 1W0VB 3IJSA 2WWMC 2IF7A 5D7IA 1P7KB 1KB5H 3O2DH 4PJ9D 4Q9QH 5F9OH 2EE3A 2E6PA 1CK0H 2FGWH 5B38G 1A7PH 1HQRA 5T3ZD 1KPUB 5CKAA 1KNOB 1LMKA 1J1XH 3EOAB 4C57C 1RVFH 3AVEA 1N2RB 4XGZB 1MREH 4X5LA 3QIWB 2XWJA 1U8HA 1EEQA 4H1LB 1GH7A 4X99B 1W0YT 1A7RL 2VZSA 4BM7A 2VDKL 1A14L 2E8ZA 2NY0C 2F19H 4XHJC 1XR8B 4F57L 1KFAL 4Q0XH 3NFNB 3KLAA 3WS3B 4Y4KC 4LSUH 1G7JA 2J12B 4FRWA 4HJGA 1D6VH 3O9WB 5CLWA 3O6FD 2YRZA 4UILL 1FVCB 4IIQB 1OTUD 1FP5A 3MLZL 2R23B 4LFHG 1CICA 5FHBH 5EO9A 4UAOC 4PJ9C 4AK1A 1MJUH 1SM3H 3VXTA 2R2HA 3FZUD 5EBMA 4PRPA 15C8H 4HDIA 1OAZH 3BVNA 5DJ6B 5L9DL 4TOYL 2ZNXA 3EHBD 2OZ4H 1KB5B 4JFPB 5J3HC 2QHRL 2AK1H 2IAND 1LP9B 5C0AE 5EBLA 1I8IB 3RAJL 1QFWI 1CE6A 5E4EC 2F54D 3GJFB 2ZCLH 1CD1B 5DURD 1F4WL 4XC1L 1TZHB 2BSTB 1M05B 5ERWB 1UXSB 2CLVA 3KG5A 3HAEA 2VDLH 1AY1L 3MNWB 4QHKI 3ILPB 3TV3L 3ZDZF 4RRPG 1NCWL 5F1IB 3RL1A 4YDIH 4ZUUA 2I07A 4JKLA 4OF6A 1IM9D 4P4KD 1K4DB 3W2DH 5TFSL 1BWWA 3WXVL 2BXYA 5KS9E 1QNZL 2B5IC 1GC1L 2EIDA 3MRNB 1T04B 3MLXH 3UTOA 3W39A 5ISZD 4HH8A 4KFZC 1FC2D 1NDGA 5F8RC 2HTLC 4ZFOL 5BS0B 1ACYL 1BFOA 4P5TA 3D3VA 3I6GA 4YDJA 5DHYB 3SKUD 4XPBH 1MI5E 4MNQB 3U4AA 3LKSA 1WZ1H 4RAVA 1S5IH 3ARDC 4I8DA 2R1XB 3CIQA 1JHTB 3GJFK 2OYPA 1TJIL 4F37K 1OQXA 1BQLL 2N4IA 2ZUWA 3QDGD 4HS3A 2AXFB 4HT1H 2IEPA 2Z8SA 4ORZC 3K8LA 2J8UB 4D9LL 2P5WE 3JTTB 4C56E 1AKJA 3S96A 5TQ2L 4LBEB 3V6OC 4C83B 5DYOB 3TH4T 2A9NL 2PW2A 4GS7C 5E08L 2V2TB 2BNUB 3SGEH 3O8XA 3HG1A 4JZOB 1A3LH 4JFDA 4DW2H 2AQ3A 1UKTA 2IH3A 4LK4A 3W11D 4RSVA 3MRQB 4WUUE 4HLJA 2DN7A 3WLBB 5J6GB 1K5NB 3NVQA 3AMKA 3MLYL 4X8JA 4JPKL 4H1LG 4NQUA 3EFFA 2VDQL 5EU7C 3BZFB 1ADQH 4YFLI 3VXQB 4UNUA 4FFWC 3OGCB 4MNGB 4Y89A 3GKWH 3LV3B 4HIIA 2CXKA 5J6HB 4QHKJ 4XCCH 3QB7C 1IC5L 2A38A 1HZHL 2I9LA 1T20A 3HZVB 2PCPA 4CGTA 2V7HB 4NQXA 2YSSA 3QRGH 5M7QA 4U49A 5MHSD 1KV3A 1E27A 1JV5B 1XIWB 4S1RL 4LRIC 3IFOB 3MCKA 5D71L 1A4KB 1LE5A 3CLEH 4MDIA 3FQNA 3UTSE 5D7IF 5ACLA 1X5FA 4YDVA 3HMWH 5DJCA 5E6YA 1C12A 3O4LA 5F3HA 3ZKND 3IVKB 4A6YA 1U58A 1XEDA 3CVHA 3BRDA 3RDTD 3VGEA 1A1OB 1UWEL 4XX1G 3QG6B 2G60L 4HIHA 1NKRA 5EUOE 2WIMA 5DUPL 1CFQA 3AB0B 5I1HH 5D2LA 1F6LL 2LU4A 3Q3GB 1YPZE 3P9WB 1WBYB 4K3EL 2PNDA 1GAFL 3HZYA 1RIHL 3BH9A 4K07A 3TA3A 4Z6AT 4MYWB 1MVFA 2I60H 5A2IH 1IGJB 3FRPG 3GMMA 5D7LB 1MCPL 1EHXA 2IAMB 3UYRH 5IEKB 2JB5H 1NFDB 3KPNB 3VFMB 2R0ZL 4H0IA 3RY6C 4KDTC 2NR6D 4OZFH 3QHFH 5ICXB 2VUOA 3FFCB 5E5MA 1TTFA 5EH1A 1CFTA 3PP3H 2IPUK 3B6SB 4LL9A 4KJQD 3WIHA 3MYZA 1YZZA 1V3KA 5DD5L 3MRRA 3NIGE 5JOPD 4X9GA 1NGZB 3B9KA 2VISA 2AABL 3QPXL 3QUYD 4LVEA 4HK0B 2EKSA 4YIQB 5E8OA 3ZKNC 4HIXH 3IKCA 5FIEA 1EEZA 3CFBB 5LWYL 5D7JA 4Y4HA 1KXVC 4R4BA 1WWWX 2CK2A 3VD9A 4RMQA 3ULVE 2C7UB 4I2XA 2X4TA 2FHCA 3SGJA 4NYLB 4JPIB 2NY7H 3VI4E 5HPMA 4Y5YB 3CC5A 1H8NA 2DQIL 6FABH 2ZKHH 5GIRA 4JRYA 4JR9H 4KROC 1L0XA 5HHVH 2DYPD 2VR9A 3G04A 1S7SB 4ODWB 3R06B 3MRIB 4OCXH 1OAKL 3VXUD 1EAPB 4DVBA 4JZJC 5CD5D 3AFLA 1Z3GL 3CFCH 4G8EA 3VWJC 1QUNA 3QYCA 3DUSB 1IGFH 2YWYA 4KXZH 4OZFB 1EH9A 2PF6A 3LEXA 4PTUB 1H3XA 1BD2A 1Q0YH 2V7NA 2FJGA 2GUOA 5D9SB 3ARGD 4TULH 3W5MA 1HWGB 5FOJA 5GGQL 1HHJA 1UG9A 1OAUH 5H2BB 1G7LA 3IB4A 1M71B 3FONB 4JJ5B 3MREA 4NN6B 3K1KC 4YO0B 3VFNB 4WY7L 5DA0B 3HUJF 1B6UA 2VLRB 3MV8D 5DFVD 3X12B 1JCKA 2BMKB 1QLEL 3KXFD 3S97C 1D5XB 1Q0XL 4NNXA 4NWTH 4Y2OA 4CNIB 1U41A 4MD0A 5FGSA 5B3NA 5FO7A 1F3JA 3OV6A 3D9AL 4YHKL 1HSBB 1X5YA 3W0WB 4PRAB 2L4OA 3GMNA 5HVWA 3P4NA 4XMLL 1DL7L 3NABH 2YKLH 1RIVL 3GSRB 2A74B 2EDLA 2Y36H 2MQCA 3SCMD 1RMFH 1VGEL 1N5YL 1IEBA 3OQ3B 2JB6A 2BHZA 1TQCB 2A77H 5FYKL 5LGJB 1K3ZA 5EWIL 5JOFB 4HF5H 5GS0D 3Q6FA 1LO2H 1Q94A 4RMTA 5I74C 4MJ6B 1HYSD 3QH3A 1ZT4B 3FO2B 1BIIA 3BQUC 4OI9A 1OTSC 1U8LB 3JWNC 3H0TB 1DQLL 1FLTX 1NKOA 3OBAA 1J05B 3O6LL 4M1DL 2DI9A 4XCEB 3TJHC 4PJIB 2QSQA 5H35B 4K7PH 2L7JA 1AGDA 1ZHLB 3L3HB 1EFXA 1SYVA 5DI8B 4ZO6A 4ZS6D 5C0BB 2DQTL 1MFEL 3IS0X 2YXFA 5C0CD 1JGEB 1R6VA 1UH3A 4WHTA 5T3XD 3CX5J 1FCCA 2C3HA 2XV6B 4J3UA 3S37L 3MA7A 2G2RA 3LY6A 5DHXB 1TXKA 4G6JH 1P84K 1BJ8A 4F9PA 4Z95H 1W0WA 2CO7B 5FYKE 3ZKMC 4OFYD 2CLRB 3LKQB 3DVIA 1EZVX 1AFVH 4UIKH 2CSPA 4MB3A 2PYEE 1A7OL 3OKOB 2FBJH 4ZFFA 4MHHG 4Y19D 3QA3B 1NAMH 2F5AL 2FIKB 3WEXA 2PO6B 1ZWIA 4XCNA 1GZPB 3SOBL 3MJ9A 1L6XA 1RUMH 2X4NB 1PBYA 3PWLA 3D25B 4X80H 1L9MA 3U0WL 3RFZC 4P9MH 1CDGA 4HGMA 4OZFG 1G7HA 1S3KL 4PUBH 2X4UA 1G9ML 1ZT7A 2J3SA 3FAWA 1UFUA 3LS5H 5ITBL 5GGVY 1CLOH 4IRSB 4GRLC 1AGEA 5AAMA 3TBWB 5MEPB 2R0WH 2H3NA 4FQPA 5C0JA 3T0WA 4ZUVA 2HRLA 2R4SL 5GGSY 3LZFL 4JPWH 3EYOB 2HFTA 3QUXD 4XPHH 3QDJD 3EOTH 2YPLA 1YQ2A 5ALCH 2EH8H 2AJYH 3IDIB 5DUMH 4U1GB 4Q6IA 1N26A 4M6OH 4MZ3A 4YFDB 4DGYH 5I71B 3FT3B 2VDNL 3NIDF 1DLHB 2RCSH 4JFXB 4U7KA 2E7CA 3CMOH 5IFJA 4OCSL 4KTYA 2YUXA 2APWA 3L3DA 1ED3B 3QXWA 3DTXB 4L29A 1TIUA 5FO9A 1OSPL 1V3MA 4UTAH 1JWSA 1IAOB 4NQVA 1I7ZB 5I0DA 3VH8B 2OTUA 1FLRH 3RVXD 4YR6B 1CF8L 4AIXA 4G3YH 4CKVX 4YE4H 3I2CH 3CSYB 4XXCA 3RVTC 1U91A 4PJEB 1LNUA 3TZVC 4F9LC 4XT1C 4U33A 32C2B 4EDXA 2JCCF 1AD0A 4ACPA 4V1DB 7FABH 4UOW0 4NO0A 4HQQH 5IBLC 4HZAA 2P42B 1T1WB 4QHNA 4JFZH 3HNVL 5E7BA 1OPGL 3WUWG 4R26L 4U3XA 3V0WL 2RR3A 4QRPE 1AGBA 1FG2B 1UYWH 2XN9D 3H42L 5T1MA 3V79C 4GG6B 3C2AH 1S7RB 4QOKA 5BVPL 4LPTA 2HVJB 5FYJL 4BSWB 5E6IC 5IHZB 3C2SA 4IDJL 4PY8I 1QVOB 5F6HI 4KDVA 5FUZL 2E27L 3PWPB 3SDCB 3ZYJA 3C09C 3RWDA 3SKNB 2JELH 2VDOL 2DMKA 4UQ2B 4KVCH 4LVNC 2AJSH 3E6HA 2AK4A 4N9GA 4HWNA 4P2QE 5SWZD 1D9KC 3KS0J 4UMGA 2FX7L 5C09E 2I5YH 2WBJB 1TVHB 5HYEA 2V9RA 3QUMB 2NY5L 5DRXA 2HJLA 3FOLA 1IKFL 4XBGB 4G6AC 4B53A 2YRPA 3INUL 4LLDB 4UB0H 3WUZA 4Z77B 1INQB 3V6ZB 1DQDL 43C9A 4Q74A 3VXPB 1A7QL 4EUPA 2NYYD 3GSOB 2I24N 4EBQH 2CLZB 4XTRD 5IBUG 1J88A 3F7PC 2OJZH 2B4CL 5F44A 2DOCA 3FB7B 1XGTA 1ORSA 1UWXK 4QRTA 4P3DB 4P2RD 1B4JH 5KSAD 1WCBB 1OGAB 1PLGH 1CD8A 5FYJE 5TGBB 1Y0LB 4N8CH 1MCSA 3DNKA 2PR4L 3QNXA 3MO1A 2FHFA 5E8NA 4OZIE 3TYGL 4HFWB 2GJ6D 1YEJL 4OLVL 3ARBC 4I18C 3PHOA 3SDXF 4H8WL 4APQA 1OAXL 2NY1C 2J8HA 1QBMH 2X89D 3CK0L 4M7JH 3GSWA 4MQTB 4XBEL 1KTDA 3I3BA 3VXSA 3EO1B 1UJ3B 5GHWH 5J06A 1PQZA 4OGXL 4XBPB 4QY8A 3PQYB 1OWWA 4LFHD 2GT9A 2BSSB 5D2NC 2FLBT 4ONFH 4BH8A 1XGPA 2EDEA 3B2VL 4MDJA 4Y5XB 5BV7L 4HHAB 2XZCL 4G8FA 3O6ML 2Y6SD 5I1KH 2NYYC 4QRQB 1JPTL 3KYOA 5C07D 1YN7B 1XF1A 3JWOC 1T89A 4O9HH 2B1HL 2YUZA 4PY8J 5F6HJ 1RZGB 1T5WB 4ZXBC 3D1MC 3VH8G 1Y6NR 2IQAA 5TF1L 3O4OB 1M4KA 4KHXL 1SMOA 4ODTH 4PJHB 1E4XH 1OB1B 4WFEE 1I9IH 3EO0A 5EOCH 4NJAL 4YWGL 1LEKB 4PLOB 4RMWA 4ZYKB 4OCRH 5IR1B 2F58H 2M1KA 1MEXL 3KPPB 1XF2A 4OKDA 2VAJA 3SDDC 3MBEA 4Q9RL 3V6FA 2E7BA 2IANA 1IKNC 2RGSA 1XGRA 1NFKA 5K93A 4G6FD 2Y7QA 5GSVB 4BQBA 4LLQB 3QUZB 4MLIA 4IMLB 5C86A 3VFUA 3RUGB 3QFJB 5I9QC 2NX5E 2Q8AH 2EDJA 3TM6A 1HQ4A 3KDMB 4Y5VA 5E94B 4DKDC 5EUKB 3WCYA 2Y6SC 3MUJA 4FQ1H 4OT1L 4UDTA 5FA3B 1JNHB 1D5IL 3DX8B 4P9HC 5EZLB 3ZKSD 1ND0A 5IJKA 3IDXH 4YXHL 1VSCA 1IC7H 4K7FA 3FT4A 3BEVA 3MROB 4AENB 4JFFB 4ZPTA 2ICWA 3QEHB 2XIDA 1QFHA 4JB9L 1UB5A 1VPOL 3D2UD 4UTBL 4Y8AA 5IUSA 1GGIH 1QLFA 5T1DH 2EDDA 1QBLL 3GMRB 2F8OA 1G0DA 2BRRL 4RQQA 1EJOH 1T80A 1CD0A 4KI5E 1FE8L 3H3KA 5EDXA 3SDAC 3IDJA 1U8KB 4NHUB 3G5XB 3ARFA 1WFOA 3OKDA 5ID0A 2XTJC 4NN7C 4X4YB 5INDA 4YUEH 5IQ7H 3QIWD 2CUIA 1YDPA 4OD3H 3C6SA 4UU9A 4JFQA 5K9JL 3VFSA 5B8CC 1FAIH 4FTVA 1YEDA 2Y06L 2R4RH 2HLAB 2R1WA 4XH2B 4X7SH 1I9EA 3I6LE 4M93B 1BFVL 4NM4L 1FYTB 1PG7W 1DFBH 4TPRL 5IVXA 1JPGA 2KDGA 2NZ9C 5GISH 4IJ3C 1NMAH 1MRDH 4Z7OE 4FFYH 4WI7A 5C0EA 3OTTA 3FO1B 4FA8A 4I13B 4FXGA 3RNQB 3O9WD 2XG5A 3BMWA 1JE6A 3DUUB 4NQCA 5AZEH 1LO3H 2DQGH 5JORA 5DMKA 1WISA 3IGAA 5BJTA 4LOUD 5DMGC 2X7LA 3G6DH 5FM4A 2ZUVA 3VFPA 4M1GH 2BCKA 2HMID 1AQKH 1VB9A 1T3FA 2GAZB 2OL3A 4N0UB 1DQTA 5TE7L 2IH1A 5DSCB 4EN3B 1BWMA 2E6QA 4OLZH 5JUEH 5L8JB 1OY3B 5DVKA 2IWGA 3RIFF 5JMOC 1S9YA 4LCIL 5JLZB 3PJSA 3WKMH 1A5FH 3RVUD 4O2CB 2P8MA 3D39A 1A6AA 2DM7A 5L8LB 4F33A 1KELH 5A40E 1E6OH 4GAJL 5FK9A 2VXQH 4R7DB 3HI6H 4ODUB 2J6EA 1HILA 1M7IA 4JCMA 2MWCA 2YRLA 4I5BB 4OZGB 3S9DB 5T3ZL 4PRID 5ETUA 3RDTA 5IOPA 5ADOL 3S88L 3IFLL 4BH7A 3AU1B 4Z7VB 4D9QD 1IAKB 3VJ6A 5B3JF 3G9VA 3L1OH 1CIDA 3NA4A 5EIIB 5BS0D 1JNJA 2R56L 1I1FB 4MQ7A 2OJEA 4MNQD 2D3VA 3ULUD 1QRKA 4LVHB 4TNWF 4R97B 1JUFB 3RKDC 5DQDL 1RURL 5C9JB 2C4XA 4U1JB 4Z7WF 3MLRL 3IDYC 3MRKA 3ROLA 3CZFA 1AJ7H 3LOWA 4FQQB 4PJAA 3JWOH 1XGYH 4MA8H 4P3WA 2P8LB 4Y2DA 5C0AA 3O0RH 3KLHC 2NW2B 1FNHA 2IADB 1NGXA 1H15B 1P6AB 1P7QB 3IU3B 4E5XB 1P53A 2G5BB 3IJHA 3FQTB 1P69B 4PLJC 2A9MH 2CMRH 4HXAH 5EZJB 3RWJA 5I16A 5IEHB 3G5VB 2FL5B 1UVQB 4MWFB 5C2BL 2H1PL 3WMSA 3V4VH 4LLWA 4L4TE 1G0XA 2R2BB 2COQA 2FGZA 1QSEB 5IHLB 2VKXA 1ZHBB 5KS9A 3DO3A 2OI9C 5T3ZE 2D9QB 1OARL 4TN9A 3U82B 2FRGP 3CSBA 4N9OB 5HI4C 1FZOA 5CP3A 5T1LB 5EG6C 4F2MB 3T1FA 2V5YA 3ZE1E 1JGDB 1INDL 1FL5B 2DQDH 3BUYA 2Z0BA 2YUVA 4HS6B 3MV7A 2YXMA 4WFHE 3R8QA 1KJMB 3BXNB 1DBBL 3VRIB 5JW5A 5GJTL 4P9HH 4XCFH 4ZD3H 5D5MB 5FO8A 5BQ7A 1BJMA 3O41B 3STLB 5GGRA 5D6DC 2EYRA 3VXUA 2FZ3A 4NC1C 4U0RB 1M1SA 4G6MH 3TESA 1DUZB 4OLEA 4YAQA 3HRZA 3LQMA 4HEPG 5B39A 3CXHK 2DLHA 4Z7NE 1HWHB 4LSRH 4P46B 3NCJL 3ARGA 3C5SB 4IRZL 2VDPL 5IIEB 4ODSH 1HXYA 5I75B 3WO3B 2X1XR 2DD8L 1OT1A 4KK8C 1KCKA 5HGDB 5IFHH 4Z78A 2QJDA 1GVIA 1ONQA 4HMCA 3G5YA 1CGSL 5MENB 1A9EA 2AGJH 1FL6A 2F54E 3MOBL 4WFGD 3LD8B 1N59A 3KXFA 3TNNA 1MIEH 3K46A 4P48A 3V6OE 4KMTL 1A0QL 1MNUL 3C60B 1FBIL 3NPSC 3ARTA 3N85L 35C8H 4H5SA 1SEBA 5DRWA 5D7LD 1X5JA 3UEZA 3BZEA 4AG4H 2VXSH 4ONHA 3FB5B 1RV6X 4HZLA 2ATPB 2P5EB 5IVXF 2CJUH 4WGVB 3HE6B 2VSCA 4U05A 4GJTB 4JKMA 5IHUL 3BYYA 3VMPA 4JRXB 5ISZE 5D8JH 4NKIH 4M4RA 1F3DJ 3E8UH 4O02L 3FFCD 4L4VA 5EZIH 1WBXA 4EEEA 4XPAH 1XIWC 4TVPE 4UV4H 1UENA 5IM7B 1DQMH 1CXIA 3JTSA 5EU7E 4LEOA 3CNKA 4FN0A 3CXDH 2GJZB 1HHHA 1AR1D 3NGBB 4ODHH 5C8JB 5C0DB 2VE6A 4GKSA 1PEZA 4ZUTA 1D5BB 3HE7B 5JXAL 3O3UN 5BW7C 4YHPA 1U42A 1C5BL 1EGJA 5BZDA 1QHPA 1KIQA 1IT9L 4ZG1A 1LK3L 1AXTL 2I26N 1ZTXH 4GMSH 5K59E 1Z5LB 1YPZA 2X4OB 1A7BA 4MAYB 4L5FH 1AC6A 3MRPA 4U1MA 1MCNA 2SEBA 5EFIB 2IAMC 1OF2A 5HGAB 5FDWB 3SPVA 5EIVA 2ITDB 2ADJA 3WXWL 12E8L 4PGJA 4EDWL 5MEQB 1OP3K 5JW4Q 3BPLB 1CI5A 5F71A 4KKAD 1KC5L 4OB5L 5SWQB 4JDTL 1VGKB 2JE8A 1B0RA 3RIAK 1U8IA 4F7MB 4QEGA 1M7DB 3UMTA 1ZGLA 5KOMC 5D1ZC 1LEIA 5KSBE 4GW5B 1HCVA 1RJYB 2P1YA 3CFEB 3AMLA 3CFKA 4ZAKB 5J9PA 1UZ6E 4BQ9A 4PJXE 5E99H 2VLRD 2GSGA 1KACB 4Y5YC 3RRQA 5DD3L 3U7WL 1J1PL 3DV4B 3LN5A 2BDNH 1YUHA 1GPOH 1C8PA 3QI9B 1Z2KA 1F58H 3QNZB 3QP3A 3S98A 4OD2B 4TVSa 3TO2A 4XPFL 5CILH 2YC1A 4OBSA 2E7LA 4WO4B 5BMFH 5KS9F 1A1NA 1PZ5B 3CX2A 5DD1L 3QXAB 3HA0A 3MZGB 2K7QA 4FQHA 4LSPL 4L9DA 3EDEA 5TH2B 3QDJA 3UPRB 4R0LB 5DHVH 3P0VL 1Z6JT 1U93A 2BK8A 3T0EB 2D0GA 4ISVB 1X4YA 4KUZL 5DR5L 1S9XA 3CSPA 3DX6B 3DGCR 1N4XL 5EZOH 2F74B 2BVEA 4NNYA 3CPLA 3ET9F 1RUPH 2P48B 1HKLH 3RU8L 3VFWB 3P30H 1T0NB 4XNXL 4NN6C 5JHDB 4NRYA 2VXUL 4LPUA 1U2CA 1TJGH 1FJ1B 4OI7A 3U30C 2EC9T 4R96B 3C5ZB 4XNQA 1DSFH 4KGJA 4WNQB 4BZ2H 5GZNC 3HPLA 3NPZB 3M8OL 3GMQA 1FGVL 3S3PA 2MMXA 2GEEA 4NKMB 3V52L 2KUTA 3P77B 2UWEE 4HIJB 5DJ0B 4R2GC 3GSUA 1TLKA 2AEPL 1BIHA 4MJ2A 1OLLA 1KN2H 3SE3A 5C0BD 3RWHB 2BNRB 2JJTC 5C08D 3MRBA 3L3KA 5J1AB 3T2NH 3AAZA 2NW3A 2OM5A 4HKJB 3GJEA 2YD3A 5GRUL 1A2YA 5DZLA 1B88A 1F4AA 3WIIL 3W81A 4LSTL 4HGWA 2EEAA 4ZMAT 1QEWB 4M1CC 5D1XD 5CWSA 1RK1A 3RX8A 4HCRH 1CGWA 1UCBL 3DIFA 3DO7A 4OBRA 3U7AA 5TE4L 4PD4K 3CDCA 1MAMH 1C1EL 1NC2B 2CR6A 3C8KB 1K2DB 5J11C 1DBKL 5KN5A 2J88L 4XAWH 3EYQC 5ICZA 5DEGA 1MWAH 4YPGA 5HHPB 4X8XA 1YECL 1ORQB 5SWSB 3VG0H 3HC3L 5C0GA 4PGEB 5CMAA 5I73B 4H25A 2BOCA 2AEWA 3FN3A 1WT5A 3BFOA 1S7WB 1JWMB 2W9LA 5GS0L 4U1SB 2H2SD 5GGRY 5KG9B 1R3KB 4KU1A 4RISL 4IRSD 2KL6A 5DRZA 5ALBH 2XFXA 2IPTH 1B0GB 4U1KB 2BC4B 3RVWC 5I1GL 2AXGA 3TWCH 1EGJL 5EUOF 4XVJL 3L95A 4D0DB 5B38A 3MV8E 3CSGA 4U6XA 4FP8H 1YPZF 2CIKA 4TSAL 5BO1H 4S1DD 1JRHL 4U6YB 5ACZB 4JHZA 1JHLL 4WWKA 1XGUA 1AO7E 2PO6C 3DX9B 5MI0B 1MAKA 1Y6MR 3CLFL 5T3XL 5ESAA 3RPIA 3QIBD 5HYJD 2QSVA 5I18L 3MJGX 4M48L 1MWAB 5D7KE 1YJDC 2GJ6A 1EHAA 4F3FA 2CGRL 3OAYK 3VWKD 2JTDA 2OP4H 3HCVA 3HS0A 4IRSC 3SKJL 1ZS8B 4QTIL 4XP6H 1PKQE 3PABA 3GM8A 3OXRA 5CJOH 2Y5EA 1FZKB 4KTEL 5DJZA 1FNFA 4HAGA 2FO4A 1IGTA 3ULVF 5GS1B 1VADB 2ZPKH 2QSTA 5C07A 3VI4F 3BKYL 4U1GC 1FFOA 2WQRA 4BQ8A 3G6AB 3KYKH 4JY5H 2W0FB 5E2VL 4GW4B 5D70H 1EEYA 3UZQA 3EYUH 4WV1B 5LAXB 4YHIA 3OKNA 3LEVH 3SE9H 4HXBL 2CKBH 2XXCB 3HKFA 4KWUA 1MH5B 3VGGA 1BAFL 4HC1H 5T3XE 5BZWA 5DWUL 1FQ9C 2CRIA 2ESVB 2GIYA 2VXTL 2C26A 4NSKB 3PWPD 2H32B 3SDCD 2EEBA 3UYPA 1MHHA 2CK0H 3V5DB 1KIPA 1PG7L 1AHWA 3VMOA 4X6BB 5HHXH 4K3HA 3FN0H 4KGLA 2XQYG 4MS8C 1RZKH 3BPCB 1KSRA 5I8KH 3HPJA 1BEYL 4X6CE 3IJSB 1HNGA 1EVUA 4JO1H 4Y19E 3O3EB 2WBJD 5D7IB 1UACL 1W2KT 4KQ4H 4D3CL 4LSVL 2CUHA 2FLRT 1LDPL 1FV1B 5TPWL 3V95A 1HQRB 3HNTH 1CGYA 1MHPL 1NSNH 5EBWB 3T2PA 2Z35B 2DTML 2XWJB 3V5KA 4AT6A 1N5AA 1RUQH 1K9TA 3EYFA 1WIUA 3WIFA 4M7LT 1U3JA 5IMOB 5F7LB 4RFNB 2NY4C 3B83A 4IM8A 2VL5A 2WV3A 3SQBA 3GGWA 4JGMA 3L6FA 1P7KA 2O5ZL 3TVMA 2Z9TA 1YEGH 2DICA 3KLAB 1E4JA 1GOHA 1G7JB 1KPUA 4HJGB 1KNOA 5E0QA 4LSSH 4BYHA 4X7EC 5ABDE 4X4MA 4P2QA 1N2RA 3FFDA 4NCDA 1LHZA 3NH7L 2AERT 4GRWB 1LO0L 1AH1A 2WBJC 1P4BL 4OCWL 5EO9B 4HX1A 4AEIH 3VXTB 2R2HB 5EBMB 4ODVL 3PQYD 3RGVA 1NUDA 2P7TB 4HDIB 4TUKH 3BVNB 2EZ0D 4PBVC 3TCXA 5A2JH 4LCCA 5EBLB 4CADA 1GGTA 2OR8A 1XR8A 3GK8H 3OPZL 4WTXA 3U36A 5KVEL 3GDBA 4PJGE 3LH2L 1ZLSH 5T5FH 3WS3A 4G7VH 5GS2H 4OCNC 1XCTA 2CLVB 1VFAA 2MJWA 5ACMA 5KVDL 4IIQA 5CEZL 2V17H 2I07B 4E41A 2A73A 2R23A 4DOHE 3MJ8A 2YA2A 3MRCA 5E8DL 3KAAA 4TNVK 3VCLA 3C08L 4Z76A 5GS3A 1QP1A 3W39B 4MQSB 4R90H 5CEXA 2NXZD 1NDGB 3O2DA 3DRQB 3KVQA 4MCYB 1G9NC 1BFOB 4TRPH 4P5TB 1FGNL 3D3VB 4YDJB 3LKSB 3QUZD 4RAVB 1TZIA 1WTGT 1UJ3C 3LKPA 1TZHA 4P23C 2XN9E 1M05A 4DN4L 4DK6A 3QQ4A 3BN9C 5L0QB 1J1OH 5LCVL 3QFJD 1U8OA 4J12A 1BP3B 4K8RH 3FRPA 3OKLA 4GAGL 4KRNA 1NCDH 4XVUC 4R4NC 4XP5L 4P5KA 2AEQH 3MRLA 1S5HA 2QV2A 2WUBH 4PRIA 3VD3A 2OXHA 2A0LD 5DDHA 3SY0A 4I9WD 1KCVH 1TETL 4PG9A 2PW2B 4ELKA 1R24A 3Q0HA 4E0RA 3FHQA 2WQ8A 4JFFD 1JRHI 5K9OA 5CEZE 3C6LC 3K3QA 3TP4A 2R29H 4JFDB 4A6YH 4NGHH 2R1XA 5EC1A 2YPVH 1JHTA 1KCLA 3ARED 5D2NE 3LS4H 3UBXG 1FH5H 1ZOXA 3IDMB 2FD6H 2YD8A 5JW4N 4X8JB 3O2VH 2WIIA 3S4SG 2ADFH 3EFFB 4QHUA 3SO3B 2OZ4A 3WFBL 1GXEA 1L9NA 4Y4FD 4LBEA 5DYOA 2DWEA 5SX5K 2V2TA 2BNUA 2WP3O 3N06B 5HDOA 1JHKH 4AJ0A 4J4PC 1WZMA 4HIIB 4QWWD 2B0SH 3JWDL 4AYFA 1YQVH 1FYTD 2I9LB 1Q8MA 3WIHH 1YYMH 2PCPB 3JV4A 4OZHE 4NQXB 2YSSB 3TJEH 1C5DA 4LPCA 1E27B 4OLYH 1SY6L 2RJMA 3MPCA 3MCKB 4H0GA 5DZNA 1LE5B 3LSOA 3BZFA 2XQBL 3FQNB 2LTQC 3REVA 5ANME 2VLJE 5DJCB 4C58B 3KJ6L 4P3CH 5IJVA 3O4LB 3LRGA 3I50H 2ADIA 4NJ9L 4A6YB 1U58B 2YD9A 4MZ2A 4PB9H 4RX4D 3CVHB 1W72A 4NQEA 2R0KL 1KJ2H 4WUKL 5L2KB 1DQJB 4FQCH 2LU3A 1CFQB 1X5GA 5DGRA 1K4CA 5D2LB 4FXLA 1HOCB 2MTPA 4LEXH 2YN5A 5HPOA 4K71B 4OTXH 4GH7B 3HZYB 1RJCA 1HSAA 4NOFA 5F7YC 1FYHB 4JFHE 3TA3B 2H2PC 1JV5A 3L5JA 5EOQL 5LGKA 3U4BL 4NO3A 3VFOB 4Z7UA 5ADPH 1OSZB 1JPST 3KR3L 1QLRA 1A4KA 5E95B 3HNSH 4PJDA 3VXRE 1DZBA 1IQWH 3MLUL 4HJJH 4D9RD 3Q5YA 5AYUH 1S7XA 4MJIE 3QCUL 4JKPL 4X4XB 5E5MB 3ZE2E 1CFTB 1A1OA 1KUMA 1KTLA 4NUGH 3QG6A 2XI9A 3ALXA 3VXME 4DK3A 1NMBH 3LKNB 1Q1JH 3VMNA 2XTJE 3REWA 5E70A 3B9KB 2VISB 5LGHH 2FR4A 3IKCB 5JTWA 1EEZB 3MMEB 1ADQA 1IFHL 4XP1L 1P4LB 4KDWA 2WK2A 5D7JB 4R4BB 4RGOH 4OFVA 4I2XB 4EN3C 1NFDA 2X4TB 3NA9H 4MXWL 1F2XK 1IC4L 2J7LA 1D7FA 4NZUH 5ENWA 1BBDH 1P7QD 5DQJA 2K3TA 3CC5B 3MV9D 1UADC 2QQNH 1A6UL 5GIRB 4ESKA 2Z31C 2HH0H 4JRYB 4OSUL 2Y23A 2MOVA 1NANH 2B1AL 1FNAA 3BAEL 3UAJD 3VRJA 3G04B 2DQFA 1A47A 5AWNL 4HK0A 4ELMA 1G9NH 3EDKA 4DVBB 5IMMA 1DBAH 5J56B 3T65A 5KTEH 4EXPX 4OZIF 1KB5L 3BRGC 3MNZA 1NBYA 2X9XA 1CK0L 4LLUA 2C7UA 3GRWL 3LEXB 1BD2B 3QT2A 2V7NB 2GUOB 5T1LD 4NZTL 1SHMA 5HYQA 1Y18B 1C08A 4LVHC 4R97C 5I1CH 1HHJB 3F62A 2DDQL 3GI8L 5E2UH 3C8DA 4ODXA 2W65A 3MREB 4ZSOE 1V3JA 1WTLA 2FH8A 3SGKC 2JCCB 4ODWA 1TPXC 5HVHB 2XACC 1C5CL 3WJLA 3MCG1 5INCA 3WKNA 1H3GA 3OR7A 4ZUSB 4LF3A 4NNXB 2WLYA 2W9DL 5IF0A 4PRHE 1FRGH 2FH6A 3TO4C 1EHLL 2IFFH 1CFBA 1EV2E 4LSUL 5DMIL 4OZFA 5FO7B 1D6VL 3ULUL 4P46D 1F3JB 3H9YA 1E4KC 5D9SA 4JQXC 5BRZE 4KRPD 2HT2D 4IDLA 2Y9RT 4JM2F 1R0AH 1RZ7H 5H2BA 3EOBA 2AQ1A 1J10A 3H9SA 3VRLE 4HGKC 3V8CA 1IEBB 5MEND 2JB6B 4YO0A 2DRUA 3UO1L 1JF1A 1IILE 1B2WH 2VLRA 3EIFA 2FX8H 5EORL 3GMOB 1Q94B 2ZCLL 1CL7H 1NCCL 2AKRB 1WFTA 4CNIA 1J9CT 5CAYB 1A3RH 2IMNA 3QH3B 3SGDH 3WDIA 1BIIB 1ZHNA 2AAVA 3I84A 5JO5A 3MRJA 4YDIL 2VIRA 3U83A 3HE6D 2A74A 4XCYB 3OAUH 4JRXD 5JPNA 2DBLL 2K7PA 3DSFL 5BS0E 4JQVC 2Q86B 3MLXL 5I76A 1AGDB 2HKHH 1F8TL 2DM3A 5C7XH 2HRPL 2ZCKL 1CXEA 4MNQE 3ULUE 2AJXL 4NP4L 4IHOA 2WMPA 4WHTB 2E5EA 1S5IL 1CBVH 1OGTA 4WTWA 3HE7D 4KI5F 1ZT4A 3MA7B 4Q58C 1NBVH 5FKAB 4YBLC 2G2RB 4U2ZA 3MQIA 4G43A 4OAWA 4NDMA 2OTPA 1T6VN 5KJRL 1ZLWH 2J8UE 1W0WB 4NC1E 4RAHA 1OTTC 5FECB 4UQ3B 5IB5A 4L8SB 4F7PA 4FFZH 3WNOA 2J5LB 3TBVB 3C60C 4MAYD 1P9MC 4ZFFB 2CKNA 2BVOB 1T0MA 4Z5RA 1F6FB 5E2WH 2VXVL 1KT2A 3WUWA 3L3HA 5ICYA 4I3SH 5D96C 3WEXB 2AP2A 3X3FH 1ZWIB 4XCNB 4NC2B 1CIUA 5C08A 3S3JA 3PWLB 5C0NC 2XRAH 4WHYH 2P49B 2CRZA 1A3LL 3G5ZA 2CH8A 3MJ7A 1P1ZA 4Z7OF 3WNKA 1G7HB 5D1XA 2HFEB 1CQKA 2VLKE 2X4UB 4FG6D 4IMKA 4X4ZA 1IC1A 1ZT7B 1ZLVK 3DX7A 4TQEL 4I3RL 3LKQA 2GCYB 5TJWK 1BF2A 1OOAA 4DQOL 1AGEB 4RBPH 2DM2A 1ZKAA 4MNGE 4Z9KB 2B20A 2PXYC 1V7ML 1SVZA 2H3NB 5C0JB 2FIKA 5E1AB 4ZUVB 2C3VB 1YEHH 3WHXA 1NH6A 4HS8H 3PWUB 1MCOH 4G9DB 3GKWL 3U7YH 2AI0H 4PG2C 1SJEB 3VD7A 4Q6IB 2CO6B 4MAYC 3MLVH 3AC0A 3LHPH 3EZ8A 3TCLA 1GGUA 4HFUL 3QI9D 3WV0A 4NFBA 1I1RA 2Y25A 4JY4A 3TBSA 1VEOA 3OKYA 4MA7H 1CTNA 1I9JH 2XG4A 4WO4D 3CLEL 3L3DB 4JFEB 1X9QA 4L29B 5FO9B 1RSFA 3WD5H 3HMWL 1AC0A 4LVOB 3QAZC 1XGQB 3OX8A 3MR9A 3EYOA 1JWSB 4HD9A 4NQVB 4LARL 4ZTOL 4MA1B 1BVKB 4OM0L 2OTUB 3OAZH 4HBCL 1MJ8L 3IFNH 1KN4H 5EU6B 5JMRA 4DTGH 3T0ED 1F4YH 4OM1H 2BFVH 2QHLA 2V2WA 4MAUH 1U91B 3HHRB 4OFPA 4CW1A 5KVFL 4LLAA 5HGGS 1LNUB 2XPGB 1DLHA 1NQBA 1UEYA 4K9EH 4JFXA 5JHDD 4ZAKC 2I60L 4OQTL 1H3PH 5DTFA 5F88A 4PJCA 3BJLA 3QIBA 5HYJA 1NAMA 5ID1A 1AD0B 4PJXA 1T83A 4LSDA 4K3JH 4NO0B 1R3IL 3UYRL 4OJFL 1I3RB 3A6BH 5F21B 4QHNB 3FFCE 1PX4A 2ZCHL 4GQ9L 2X1WL 1AGBB 3ELAT 4N0FA 2L0DA 1IAOA 5T1MB 3VWKA 4LSQL 1F90H 4QOKB 4U2YA 3PV7A 3U1SL 3AS0A 4PJBA 3NMEA 5IG7A 2BNRD 1V7NL 3CH1A 3BW9A 3RWDB 2Y72A 3CH8A 1G7QB 1RZ8B 4HIXL 2JJVA 4XMPH 32C2A 1IL1A 2WSKA 4MCZA 3DI2B 5HHME 1UA6L 2AK4B 4KUCF 4N9GB 3MSPA 1C7TA 3ZE1F 3GIVA 4NQDE 1RZFL 2F5BH 1NC2D 3MGOA 4RMVA 3CVIL 5EOTB 2NY7L 3MTRA 2FBOJ 3IDNB 2L7UA 2H8PA 5DRXB 4GG6A 2HJLB 3FOLB 2ZG3A 1S7RA 2ZKHL 4YHYB 2ORBL 3ARUA 3O45A 4L3CB 5IHZA 4AH2A 3K8MA 3NFPA 4TSCH 5I1EH 5SWSD 4M5ZL 1K8DA 4EUPB 4JZJA 3C5ZC 4N8VG 1OW0C 2ZNWA 1NUNB 2JF1A 4Z7NF 2ED8A 3VFRA 2Y5TA 2GFBB 1TJHL 4JDVA 3KYMA 1ORSB 3U6RA 3QDHA 1IGFL 1QFWH 4PB0H 4XNUL 3QNXB 4KTDL 1IJ9A 4PJFA 4ZNEA 5HHNA 1GGBH 1MQ8A 3MO1B 3QUKA 1VFBA 4LMQE 5LXGL 2HP4A 3PHOB 1YNLH 3VGFA 1RULL 5CS7A 4APQB 2QEJA 4JPVH 1B3JA 5D7SH 5KSUA 3GSWB 4FMFA 3H9HA 3VXSB 3RWFB 1PQZB 4QY8B 5JQHC 5MP6H 4NBYB 3RIFK 4M4PA 1YMHA 1XGPB 3W0WE 1WCBA 4MDJB 4TUJB 2KBGA 4S1SH 1Z0NA 4G8FB 4ZS7L 3MRHB 1HIMH 5DD6B 3NFSL 3QPQD 1MFAL 2ZOLB 2YKLL 4LDOB 2IQAB 2DTSA 4K2UH 4XP4H 4CVUA 1C16A 4DEPC 1NGPL 1QRNE 4JO2H 3EO0B 3MBXH 4KJPD 4PP1D 4LQFH 3BMVA 1CLZL 3SGEI 1T03H 4RNRA 3EUUA 1MQKH 2J8OA 5F3BA 2WW8A 1GC1C 1N0XH 1XF2B 3BQUA 3MBEB 3V7AG 3V6FB 2IANB 4Y5XA 1XGRB 5HI3D 2O61B 3DWTA 3B8YA 5C6TH 3OL2A 4JHWH 5K59F 3T3PE 4QRQA 5ILTH 3VGDA 1XF3A 3ZHLA 1YJDL 4PJIE 3VFUB 3E3QC 2R2CA 1FIEA 2M26A 1AIFA 5EU4A 1Q72H 4FZ8H 2GKIA 4HIEA 4F58H 4NWUH 4PTTA 1HQ4B 5C0BE 4K7PL 4Y5VB 5J13B 5MI0C 1T4KA 1IGMH 2BVPA 4PJHA 1OB1A 1U3HB 1XMWA 3BSZH 1F6AA 4UDTB 1J8HA 3RVVD 5IR1A 2QL1A 1YY9C 3KPPA 1ND0B 3LKRA 3UJIH 2A1WH 2EECA 4P5MA 4K7FB 3FT4B 2LVCA 2GK0A 4ZPTB 2ICWB 1QSFE 4UT9H 3BIKA 1UB5B 2VSDA 5GSVA 1DUYA 3P9LA 3S6CA 4LLQA 4G6JL 4L1DA 3F7VA 4IMLA 5KSBF 1S7TA 3MACH 1QLFB 2OL3H 3BEWB 4GMTH 1AFVL 4UIKL 4H88H 4X0KA 5F9DC 4TTDD 2FBJL 5FYKU 3Q5OA 4PRDB 2WBWB 1UZ6F 4EUPG 3ARFB 4PJXF 1A6VL 3IF1A 3OKDB 4EQ2A 5INDB 4DKFH 3ABZA 1CLYL 2HJKB 4WFFE 3C6SB 4UU9B 3WJJC 1DBJL 4JFQB 1CDYA 4P9ML 3MROA 4FTVB 3VFSB 4AENA 3O3BA 1YEDB 1AXSB 3QEHA 2R1WB 4PUBL 4WDIB 4X6FA 3NZ8A 3TIEA 4PLKD 2HFGH 4GRLA 1VFOA 4LU5H 3TT1L 4MHHI 4PGCA 5JA9A 3AREA 2XZAH 5IVXB 3GMRA 5T33L 2VYRE 5CZXC 5B22A 5EULV 2NY3B 1BMGA 3LMJL 1T66C 5C0EB 5LQBL 4NHUA 4FXGB 4NQCB 4K7PY 2W59A 4JPWL 4XPHL 4Y4FA 2FJFB 5JORB 3KPRD 5DMKB 3IGAB 5ALCL 2EH8L 4AM0B 2X7LB 3BP4A 3VFPB 4BSJA 5HY9A 2BCKB 4WENB 2HLAA 2HLFC 1T3FB 2OL3B 4DGYL 3P3YA 3T0XA 4X9FA 3B9AA 2IH1B 1DVFC 2RCSL 3FOMA 4LGPB 1VEPA 3CMOL 3KPSE 1T21A 4LMQI 1A7RH 1S9YB 3AS3A 1ZEAL 2ENYA 2B7DT 3PJSB 4X7CC 2W9EL 5FKPA 1A14H 2P8MB 1A6AB 3D39B 1GHFL 4G6KL 2UWEF 5SX4I 5I66A 3BE1H 4UTAL 3IXTA 4F57H 4F33B 3ZT7A 1KFAH 2A6JB 4L8BA 5FK9B 2XA8H 5FGCB 4HSQA 3QUML 1I85A 1ODAA 4PJEE 4G3YL 1HILB 1M7IB 4YDLB 4YE4L 4F9LA 4UILH 3RDTB 5IOPB 2AS5M 2GAZA 4RGMC 4N0UA 4BH7B 3VJ6B 3RBGA 4V1DE 5DSCA 1IGIL 5HJ3B 1HN1A 4WCYL 5IESL 3D3VD 1MFCL 1YMMA 4MQ7B 1CICC 4KKBD 5C6PB 4IS6B 5TQ0L 4RGNC 4XI5C 3MRKB 3CZFB 4JFZL 2P4AB 3RAJH 1ITBB 3F58L 1YEKL 2HT4D 4LCWE 4WWID 5E6IA 4Y2DB 3MOAH 2IFGA 5C0AB 4G5ZL 1F4WH 4XC1H 4OGAC 5JA8B 3BP6A 3O3DA 4ODUA 1NGXB 1AY1H 4X83A 3IKKA 1NCWH 1U8JA 2OSLB 1FSKC 3IJHB 4BK4A 5E9DE 3RWJB 3PGFL 2JELL 1FCGA 5EIIA 4KH2A 5JZ7C 2AJSL 3ORJA 1N7MH 4M02A 3WXVH 1I1FA 1QNZH 3NOIA 4LLWB 5GS2D 1EXUA 1ZMYA 4JFDD 3ZKQD 1JPSL 5ESQB 1O0VA 1DE4A 5KS9B 2NTFB 1ACYH 2I5YL 3DROA 3SKOA 4D0CB 5EBGA 3GIZL 1WEJL 5GRWA 1FZOB 2DL2A 3LRSB 3U9UA 4P5TC 1HE7A 3GUTA 4QXGL 3T1FB 1S8DA 4X5WA 3MV9A 4JG1H 4E5XA 3BUYB 3FQTA 3MV7B 5L0QC 1JZ3A 1RI8A 1YN6B 4I0KA 1OGAE 5FO8B 5BQ7B 2R2BA 5GGRB 2EYRB 2FZ3B 2A9NH 2P5WB 1PLGL 5E24E 4C56B 5I8CB 4XWGL 1X5IA 2IPKB 5C2UB 3IFPA 3HRZB 4YAQB 5FYJU 3ARBA 5B39B 4I18A 4UOJA 3O8XC 2AXJA 4FZEH 5T1LA 3ARGB 2HWZL 3IAQA 2HYMA 4GAYA 4LASL 3P11L 4HV8B 5DT1L 1KJMA 3MLYH 3VRIA 3O4LD 4Z78B 5GHWL 1ONQB 1TCRA 3G5YB 2NQCA 5D5MA 4N0RA 2EH7L 2VDQH 1A9EB 3QJHB 1FL6B 3HB3C 2NY2C 5L2KD 9CGTA 2YPKA 3FT2A 2KQMA 5GJSH 1N59B 1EJ6A 1P84J 1K85A 1A64A 1DUZA 3MODL 4ZXBA 1A6PA 5IB1A 4POUB 4O9HL 3N9GL 4QXUH 4H5SB 1SEBB 5DRWB 3FAXA 4P46A 1IC5H 1ZANH 4EI6B 3K1DA 1T1YA 4ONHB 3BZEB 1FVDA 4OIIL 4U1NA 5IIEA 1EA9C 4HZLB 4JE4B 1WC7A 5IROA 2HJFA 5CIPA 1E4XL 1PFCA 1I9IL 1DANU 1JZ8A 1I1AC 4S1RH 4OZHA 3IJYA 3L3GA 5MENA 3VXNB 4KK5D 1CCZA 3L9RA 4L4VB 3TPUB 5A16A 1WBXB 2FB4L 5FGBA 3WN5A 1ZVYA 4G9FD 2OLDA 4MXQD 4X6CF 3VDAA 2C4FU 4H26A 3RUGE 5E6ZA 1F02I 3RY5A 2VLJA 2LE9A 4WEBL 1UWEH 2VE6B 2AJVL 4GKSB 4ZUTB 3ULVH 1G7IB 2YD7A 1FZMA 2NPLX 4M61B 2FHBA 4YHPB 5F9JB 2QR0A 3PGCA 1KIQB 2P46B 1CFSA 4PJ7E 1GAFH 2W92A 1RIHH 3F6LA 3HE6A 4EI5B 2E9IA 1YPZB 1TNNA 1MCPH 3OSKA 3S7GA 3ALWA 4K71C 1NCBL 5TE6H 3TA3C 4JFFE 3MRPB 3DHMA 5MERA 4U1MB 3IDXL 4JRYD 2SEBB 3KS0H 4FQXC 1CG9B 2R0ZH 1OF2B 2C3WA 4BA8A 3SPVB 2ADJB 5C0DA 4GG8A 3HE7A 4MJIA 1OAQL 5GRJH 5T1DL 5DD5H 4W81A 3R0MA 3EO9L 3FQRA 2AABH 3QEQE 4BSVA 1B0RB 2N1KA 1EJOL 4PRBA 5EC2A 3VXMA 1I9RH 5EU3A 1G9MC 1EUTA 1ZGLB 5GQBA 1BD2D 3B9KC 3RZCA 1Z5LA 1LEIB 5B8CA 4I48A 3MUGA 1C7SA 5D7JC 4Y4HC 5J9PB 4KQ3H 1HNFA 1FAIL 5JNYA 4IRJD 5FDWA 4X7SL 3UXFA 1SEQL 4M9OA 4PJGF 5MEQA 5DK2A 2OQJB 2IALA 3QG7L 4MMZC 4PJ5E 3UP1A 1YUHB 1VGKA 4M5YH 2VQUA 1OAKH 4KK6C 2BJML 2YC1B 3GHEL 1JTOA 1Z3GH 1A1NB 1X6NA 3FB6B 4GW5A 3EYSH 3LKOB 4PGZA 2VDMH 4LKXB 3L7EA 3G6DL 1QFOA 4FQHB 1MCKA 4M1GL 3LQZA 5JXEC 3QDJB 3UROR 5KBNC 1I7UA 3BX7C 1FO0H 5GGQH 4CN6A 3RY4A 3WSQH 2CPCA 2KZ1B 3M07A 4HLZH 1U92A 1S9XB 5JUEL 3STZA 4PPTA 2P45B 5FXCH 4NNYB 3CPLB 1CTOA 4G8GD 1PSKL 1A5FL 4KZDH 4NRYB 1JZ6A 1Q0XH 2H9GA 1LEGB 3P4LA 4OGYL 2OBGA 3DMMD 1EBAA 3EJZD 1JGVL 4WO4A 5HVHC 1KELL 4OZGE 5KANI 3RX5A 4XNQB 3HI6L 3D69B 2CDGB 4Z7VE 3HPLB 4PRHA 4YHKH 3D9AH 1EHNA 3GMQB 1HH9A 1T7VA 2BY1A 5TH2A 1D6EA 4R0LA 3V8OA 3GSUB 4XMLH 5CUSH 3A6OA 1RIVH 1RPQA 4ISVA 5KVMC 1X6LA 2YUWA 1VGEH 3MRBB 2XA3A 1N5YH 3L3KB 2X9YA 3HMXL 2F74A 3AAZB 1Q9KB 3GJEB 1A2YB 2VZ1A 5FYKH 1PX3A 4LCYA 3WYRA 2DJUA 4CN4A 2ICES 3U0TA 5EU5A 3WNLA 3B3IA 1NGYB 4X98B 5CWSB 1RK1B 2CDEA 1FJ1A 5GGTA 3FO0L 3DIFB 5JHLL 2VLLA 3DO7B 1NL0L 1VKXA 4MA8L 2YS4A 4R96A