4NBZB

Crystal structure of tcda-a1 bound to a26.8 vhh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
VKLEESGGGLVQAGGSLRLSCAASERTFSRYPVAWFRQAPGAEREFVAVISSTGTSTYYADSVKGRFTISRDNAKVTVYLQMNNLKREDTAVYFCAVNSQRTRLQDPNEYDYWGQGTQVTVSSGSEQKLISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Immune system
molecule keywords TcdA
total genus 32
structure length 132
sequence length 132
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nbzB00
4NC1E 3IKKA 4LHUG 1RUPH 1IGCL 5DJYA 1H9VA 1YMHA 4XRCA 2CXGA 4PREB 2AKRA 3I9GH 1K6QL 1ZOXA 2NNAB 1C5DA 1MQ8A 2BY2A 5DD5H 2D31B 5GRVK 3ZLQC 5KSBA 4NSKB 2YR3A 2J7LA 4HGMA 4ZFOB 3WDHA 5LXGL 2DKSA 2V2XB 2PN5A 3MV8E 2QQLL 3O45A 4JZOA 3CVHB 3NCJH 1CXIA 2AQ3A 5EIIA 1IGIL 4YLQT 3MV9E 5CWSB 5SV4A 4D9RD 3H7BA 4KQ3H 2J2ZA 4PTUB 4NQEE 2O61A 1MRCH 4N1HB 4DK6A 4PB0H 4H8WH 3LY6A 4QCIA 1KJVA 4P2QA 4XP4L 1WC7B 2A9MH 2VDOL 4HJJL 2WWKT 1U3YA 4YDVA 1EBAA 1RFDL 2MMXA 5IT2L 5I74C 1CK0L 3C8KA 1JGUL 1H3XA 1N59B 4JVUA 4M9PA 4OZGE 4XWOC 2I27N 1WK0A 5T5NG 1L9MA 3SPVB 1EHAA 3EYOB 4AM0A 1WFUA 3I6GB 1HE7A 3LKPA 4JPKH 3X12B 3QUZA 3CX2A 3WN5A 5BMFL 5HD8C 1A1MB 4IHOA 1JUFB 4DKDC 3O3EB 3GMMB 1S7QB 1YEFH 2YS4A 4H1LA 3T0XA 2CMRL 1Q9KB 4ZSOB 3L3OA 1AP2B 3GMNA 4LPYA 2H32H 5C2BH 5DR5H 1ZSDA 4WW2C 4QRRA 1NQBA 4KKAD 5IJVB 3DUHA 5CGYD 2IANB 3P77B 3LRSA 4LSVL 1X44A 1LO4H 1EH9A 1A1NB 1FL6B 1IFHL 1YNKL 4GKNA 1BJ1H 4YBQD 5C9KA 3S88H 1TJHL 3BQUB 3E6FB 2D7TH 3B3IB 2VC2H 3G6AA 4G8FB 3D9AH 3M1BA 4EI6B 4NQDD 4FZ8L 3I3DA 1N7MH 1A7QH 3PV6B 3JV0A 2CSPA 4OKVA 4LKXB 3V5HA 3H9HB 4HBCH 2XI9A 3K46A 3O81A 5D1XC 1QSZA 2Q7YB 3SKOA 3MRBB 3U48A 4ETQA 3OGCB 4OCMC 1F6LL 5D72L 3FN9A 1KLUA 1QSFB 1I1CA 2AJ3A 3D2UD 2VLKA 3H42H 2GTZB 2X4RB 4IRSA 3BIAX 4TSAL 4CU8A 4FNLL 2APBA 4QTIL 5DA4A 4WU7A 4NQDE 1JPGB 3VA6A 5DWUL 3VXTB 5D1ZB 3Q3GA 5FYKE 2DLGA 4JFED 3FQRB 3TH3T 3UTSA 2EYRB 2R0LH 5AUMA 4JFEB 3QNYA 4PJ7E 3A67H 4ORGB 2IADB 4WTZG 2E5EA 3AB0B 4NOBA 3IU4L 2CUMA 2B20A 1TZHA 3ARGC 1BZ7A 1DZBA 4P2QE 3TIEB 3INUH 4KK9C 1S3KH 1OAXL 4OD3H 4PGCB 4EDWL 4YHML 3MFFA 2BVOA 4G8GD 3G9AB 3OXSB 4QRRD 5IFJA 1Z3GH 4ONHB 4YK4B 1P4IL 1HI6B 4LLAA 4I2XB 1Q9LB 1YN6A 2DI9A 4C58B 3SE3C 2PXYC 1HKFA 3BZEA 1IL1A 4PJHE 1SJVA 4PJEB 4GKZA 4V2CB 4BK5A 3EO9L 3HN3A 1A3QA 3TVMA 4OZFB 4U49A 3B4NA 4PLOB 5EIQA 4KK9D 4QRRE 4IRZH 4R96B 3UEZA 4KU1A 4UT6H 1UADC 5B39A 3GO1L 3IJSA 1FV1B 4I48B 1GXEA 4P2QD 1G84A 4QXTA 4OCLC 1UB5A 4RGND 5FA3A 1K4DB 2QQKH 2Y7QA 4M6AA 4OJFH 4TNWF 4XP6L 3S98A 2X4TB 4D0BA 2DLFH 1P4LB 3NCBB 4NQUA 5HHOB 4D8PB 1PVHA 2BSSA 3K8KA 4X7EC 3ZKMC 3MRPA 2XG4A 3QCUL 3RVUC 1N5YH 1XGYL 2DYPA 4PJEE 3AREC 1L7IH 1ZEAH 4PPTA 4XCCH 2DD8H 4JN1L 2EDBA 3WXVH 3V4VH 4BQCA 4Y5YA 3LPFA 1R3LB 4XCNB 4I5BB 4RGNE 5C2UB 3CVHL 3NFPA 3WFHB 2EDXA 4JHWL 4P49A 1C08A 3T0EC 3SGKC 4GRMB 3BDXA 3S88L 4JO1L 1OVZA 2I5YH 4NKOA 1U8NB 2XTJD 1HK6A 1KF9B 3K0WA 2YD3A 2DQIL 3KPTA 3TLRA 3FRUB 3QUXA 4X7TA 1KGCE 4PJ9D 3QQ9C 4KAQL 3BGMB 2GTWA 3U9UB 4TULH 2ENSA 5BJTA 2W65A 1T21A 1R3KB 3UROR 3OJDB 5BS0B 4X4XA 4OLVH 3W0WB 1T5WA 3GRWH 1EPFA 4JVPA 4O58H 5IHBA 5CLWA 2R15A 3W9DA 1KTLA 2YWYA 3TC9A 1U93B 5E9DA 1QFWH 1UB5B 5FA3B 4PJIE 5E24E 4JQIL 4UTBH 5GS2H 2GTWB 2OTWB 4KRPB 1C16A 3VRIA 1QLEH 3PHSA 4F57H 1BZQK 4IEFB 4GG6E 3G6JE 4G7YH 3DETD 2JF1A 1Z9LA 2P8MA 5ANME 3UP1A 2IAMB 3VXRD 3DPBA 5BW7A 4H0HB 1OY3B 1DVFC 3HMXH 4CAGA 3EYUH 4M6OL 4U1IA 5E5RB 2R8SH 3FQRA 1EHLL 2P49B 3BD4A 3O6LH 4IOSD 5GRJL 2OYPA 3O8XC 4MHHG 3KPNA 3X3GL 4YK4C 3VXMD 3JVGC 1YN7A 1CLCA 5KANG 1BF2A 3JWNC 3C5SA 3BGAA 4NUJB 1WFNA 3V52L 2IADA 1EEUA 1KENH 1XIWB 4R90L 4YHLL 2AEPL 3AFLA 3RP1A 4ZTPL 5EWIH 4P3CH 1S5IL 1HCVA 2BCKB 1ZWIA 2EYRA 3D69A 4ODXB 4XBEL 3N1GC 2Q7NA 1CQYA 1GSMA 3OKEA 4G5ZL 3Q5OA 5JDSA 1DQQA 1GGCL 2EZ0D 1XF1A 3VU2A 3OTTA 5ABDE 5CGYC 3MLVL 2H9GA 4XNXL 3LDBB 4RA3A 1HHGA 1G9NC 2MPAL 5KTEL 3VA2C 4X4YB 5CIPH 3F5WB 3NIDE 2X4SB 4OLZH 3WFBH 2NY6C 2ZCHH 2VWEC 5IWLC 1IGJA 2DTML 5IW6B 3KR3L 5D7IA 2KDGA 3FMGH 3VI3F 4DOHE 2DQGH 2EICA 2G75A 1HIMH 3HFML 5IROC 3C8HA 3RA7L 4S1RL 4M61A 1A5FL 4OLYH 4GG6F 4R0LC 2FX7L 5E4EC 4XHJC 3DXAD 2CDEB 4G8IA 5FYJU 4KK6C 4S10A 2DQCH 3NIFE 5H8DA 3IVKA 4UNTA 3T4AB 1XR9B 1TETL 1K3ZA 3CFJA 4YXLH 4X6FA 1XGTA 4BFBD 3UJIH 1NC2B 1LP9F 2VDKL 4N8VG 4NO5A 1MCEA 5F7EL 2I9TB 1FJ1B 4LK4A 3H0TB 5HDQL 5CMAA 3G5ZA 3LKRA 1CDGA 5CEXB 1FGNL 3ZTNH 5DK0A 3TM6A 3U0WH 1KPRB 1YMMA 2M8XA 4EZMA 1VFAB 4Y5YC 3WJLC 1GGIH 3CPLB 2NNAA 4UBDD 2DM2A 3HMWH 1KN4H 3VI4F 4LCIL 1WWWX 4KI5C 4L3EE 4Y4FA 3UPRB 4JPIB 1S5HA 3PXHA 4EN3D 1A7RL 4RNRB 3T04D 3VD4A 5CBAB 2BNQB 3FOMB 5SWSB 2ED7A 2FECL 1EDQA 4MQ7B 5JR1H 3SPVA 1LWRA 3QHFL 4JY5L 4QRSB 3GZKA 3MJ9A 2J6EL 4AH2A 2HT3C 3LEXA 4WFHE 2ICWJ 4MCZA 3VXSE 3V5KA 2EEDA 1KPVB 1JZ3A 3RWCA 1EK3A 2BHUA 1QO3A 4Z78A 1FHGA 4KVNL 3MRLA 5IOPB 4OZHE 4CADA 1WGOA 5DRXA 1U93A 1K3IA 1OWWA 4LSSH 4MVBD 3TT1L 4WEBH 4XAWL 1T1WB 3GJEA 5F72S 1DBML 5EULV 3O3BA 3MGAA 5TFSH 2VLRB 3MR9A 4CN4A 4PG2A 1MFCL 2ADGA 4N0UA 1DBJL 4M3KB 2OL3A 1A1MA 4D94A 4JN2A 5C0ND 5D93B 3MV8A 2HJFA 2CXKA 4PB9L 2RGSA 3W39A 2XICA 3EJZD 3K1DA 1WBZB 4YHNB 2NY4B 1Q9KA 2N7AA 4IIQC 1FNEB 4MDIB 3SHSA 1H15B 3LKSB 4OGYL 3SOBH 2MCPL 2GK0B 3S4SG 1UWXH 4U1IB 1EHNA 4XVUD 5CZVH 5KVGH 1ULVA 1QPXA 3BISA 4Y4HD 4FQCL 3G5XB 1KJ2B 2AJSH 1N3NA 3V0WL 1YQ2A 4IRSB 5GS2D 1IM9A 3QQNA 2WP3O 5HI3D 4DGIL 4X9IA 2MSPA 1TTUA 2XKNA 2Y4SA 2DL9A 1VERA 2VQ1A 4NQCE 3KR3H 4HDIA 5EU6A 1UA6L 4JANB 1PKQE 3DROA 5C2BL 5T1KA 3MGTB 2VR4A 4K23L 5BRZA 1AD9B 1H3UA 1YEIL 1I75A 5IQ9A 2ADIA 4MQSB 5C08A 1PAMA 1IAIL 3IDJB 4HWNA 1FBIL 5A43C 7FABH 1CICB 2I9LB 3Q0HA 1DBBH 1I9EA 1N64L 2F8OA 2OR9H 1TZHB 3WO3B 4PJFB 5C9JB 3L5WB 2XQBL 4FP8H 1AQKH 1R5VA 1OW0C 4M7ZB 5INDA 5L88L 4XMPH 4HKZA 1NCCH 4TUJA 4HS3A 1MFAH 5DJ0B 3FT3A 4O00A 3TP4A 5FUOH 2OZ4H 2OLDA 4G6JH 5C09B 4L3EA 3FTGA 4Q0XH 3PWJA 3CXDL 1KOAA 2G75B 1MHEB 3EJJX 1GGBH 4O2FB 2DRUA 5AD0A 1F00I 4NQVA 2ZUQB 2VLME 4ODBD 3MJ9L 3P0VH 3RUGE 1AE6L 3G5ZB 3LKRB 2PR4H 5IG7A 1UH2A 5J3HD 2B5IB 4F9PC 1VFAA 4P23D 1XGTB 7CGTA 2I07B 1IGCH 1OOAA 3PP3H 1J0KA 8FABA 4K9EH 1KIRA 5E8NB 2APVA 1MHCA 4PJCF 3BQUD 1JGDB 4L4VD 5C09E 4NP4L 1I7UB 5JTWA 4KMLB 2BFVH 3A6BH 1JI1A 5CEYA 4LLVB 4MQTB 5MENE 4PV8A 5D1ZC 4QOKE 3U2SA 4K3JH 4KH2A 5SWZD 5I1CH 1F8TH 3VFGL 3S37X 4MNQA 2IGFL 3UPRA 5LWYH 3HUJE 1BQLH 4OT1H 3QYCA 2C4FT 2Z4QA 4L8CA 5FCSH 3U9PH 4I2XA 3QUXC 5J6GB 5KBNC 2IFGA 5I30L 3P4OB 1AGCB 2DL2A 4N5ED 4W70A 4ZPVA 1OP5H 4YHOL 5JMOC 1AQDA 5HD8D 4DWHA 5GSVA 4X99A 1NGYA 4M3JA 3M17B 1NSNL 3SKMB 1XGRA 4KQ4H 2OP4H 4XZUA 5B38B 4JAMB 3QULA 4RIRB 3VJ6A 4MJIB 3PDOB 2BVPA 1X5IA 1W2KT 1CXEA 4MSWB 1Z9SA 3V0VB 2AQ2A 4PJXE 4XCEA 3QAZC 2EYTB 5GGSB 3FFDA 1KCRL 3KPRA 3KYOB 5DD0H 3QB7C 3C5ZD 1TJIL 2CDEA 3BJLA 4UB0L 4PRNB 2ESVB 4NKIH 2XXCB 1VEPA 4I77H 4XRCB 3LMJH 2X4NA 1CVRA 3FO9B 4FRWA 1A2YB 3ZT5A 4QT5B 2V5SA 1T04B 2WZPD 4P5TD 5EOQH 2BOBA 4XWGH 3VI3E 3BKJH 2IH1B 4LQFH 1T3FA 1KJ2A 1NLBH 1TVBA 1CL7H 3MXVL 4LU5H 5DQ9A 3SDAA 1HH6A 1N59A 2CD0A 4MS8C 5L7XL 3QDJB 4G7VL 2DF3A 1D5ZA 1RIVL 3GBML 2OM5A 4A6YA 1EVUA 4ZYKA 3QDGB 4G8GB 3E8UL 3DMMC 3CDGA 3D85B 1J05B 1QSVA 5JQHC 4GLRH 3C5SB 4PS4H 3DV4A 1VA9A 1S7RA 5I15H 4P5KA 1AQKL 1OGTA 4TSBL 3GGWB 1ERNA 1S3KL 4NNPH 2YPLD 2X1WL 1AD9A 3MLWL 4X8JB 1JGEA 4Z77B 4J1UA 3SDDC 1E4XL 4MWFA 3D2UA 1YNTB 3W11D 1A1OB 4U3HA 1A21A 1KPVA 2EE3A 3UAJC 3OHXB 4JFHE 1FH5L 4PJEA 1ZT4B 1GC1C 4Y16B 1JZ7A 2VDKH 4WHCA 4PG9B 1EZVY 1A6PA 5HDLA 1QFOA 4I77L 4JZNB 3HE6C 1J8HB 2YPLE 3EYVA 4HUKB 5I1EH 3KJ4B 3KPSB 4OLEA 5CUSL 3NACH 3JVGA 4NM8L 3IFOA 2YD1A 2PO6A 1J1PH 5TF1L 2V5MA 4CN6A 3GNMH 5JOEA 2XN9A 1ZT4A 3X11A 4XX1G 2X4OA 5SX4I 4L9LC 4PJGB 3NZ8A 1LK3H 3RWEB 2DS4A 4G8GA 1RZIB 3BW9A 2EIBA 3HC4H 1JMXA 4Y4FD 4PRHB 1J1XL 1R5WA 3QEQA 3WIIL 4LLYA 5FO8A 3QUMH 1FN4A 1W0WA 2XNAB 3Q3GB 3KPOB 3SCMD 1FZMA 1WJ3A 2ZCLH 5LWYL 1IAIH 3O8XB 1MHHB 3MRRB 3Q6FA 3FFCB 4WEBL 5I8KH 3LRHA 2BJML 1P5VA 3UC0H 1JYNA 5K93A 4X6DB 4G9FE 1HI6A 1ITCA 4K9EL 4LCWE 3FQNB 1IAIM 4H20H 5C0DA 1KPRA 4IJ3C 2C3WA 3MFFB 4U6XA 4NWTL 2AK4B 3TZVB 1MRFH 2CRYA 4HUVA 2R69H 4OQTH 2VISB 4RIRA 1JGUH 3FQUA 3MRGA 1IC7H 4KGLA 3PXJA 5GSVB 5JO5A 3G6JF 5DEZA 1L4IA 5DJ6A 2R1WA 3QIBC 1W8OA 5T1LB 4UTBL 2GAZA 5T3ZD 2UV3A 4AY0A 1ED3A 3U36B 3VGHA 3UBXA 3ARFB 5J4MA 4OD2B 5DFTA 4LCWB 4LRNH 2OCFD 5IVXA 4M4PA 2DOCA 2FZ3A 2ATPA 2FJFA 2RJMA 3CH1B 2X44D 4EUPG 4TVPL 2HTKD 4J8RB 4DGVL 1AXTH 2NY1C 1KJMA 1E6JH 1UM6H 3FONA 4RGOL 2AV7B 3BSZL 3BPOC 4X9FA 4JLRB 2WBJC 1NDGB 5T1KD 4RFOL 1F4YH 2DQIH 5C1MB 3N50A 3U46A 4XNMB 4OIIL 2NY5L 5K9OB 3KXFB 5JLZA 2DQJH 2ZJSH 1K85A 5K9JL 5EORL 4EBQH 4UDUA 3SDCA 3NN8B 1WFOA 5TE7L 3QG7H 2OK0H 1NLBL 4F8QA 3OF6D 4PJ8C 3IDXL 3WXVL 3FB8A 5BW7C 2E7MA 2AS5M 3CD4A 3TNNB 1A7NH 3WNOA 2Y36H 4WTXA 4MVBC 1J1PL 5TF1H 5GXBB 1YEDB 1FIEA 4H25A 3F6IA 3CK0H 4B7IA 4RRPA 2IPTH 4NZJA 3U9UA 2D2OA 4IDJL 1EAJA 4UILL 1CZ8H 4UMGA 2XY1A 4OLVL 1KCVL 1QBAA 2VUOA 5DK2A 2E6PA 3HLAA 2J8HA 1BVLA 1CE6B 3P4MB 4PR5B 4TVPH 3L3IA 4RMWA 4OZFG 3DX8A 2ZSWB 5TDPA 4FXKB 5I8EB 1DEEB 1F3DH 2DQCL 1NGXB 3MA9L 4KKBC 1T03H 3MBXH 3S4SA 1BWMA 3HR5A 1QLFA 4G9FA 2B1AL 5L2JB 2XACC 3MLPA 4PRID 4PJ8A 4LVNC 5F9WC 1H8OA 2DKUA 2VNCA 4XXCC 3V9FA 1DLFH 3IT8D 2GI7A 2XKNB 4M5YL 1NCWL 4W6WB 2RCSH 4MXWL 5IBUG 2F5BL 4POZD 3KPNB 1FZMB 1RZIA 4EDWH 5T3ZH 1FPTL 4QY8B 5KS9B 1G7IA 3VWKD 5MEQA 1DBKH 5TQ0L 1CF8L 4N0UE 3RX8A 4R26L 4DAGL 3HCVB 3VXRE 1C12A 3C09B 1IKNA 1X5YA 1P2CA 2EYSB 3VFMA 3AREA 1G7QB 4IOIB 4YDKL 5F1OB 2AGJH 5JXAH 2GJ6D 4ZTPH 1EV2E 1BPVA 4J3TA 3PHOA 5EBGA 1FVCA 3C6SA 4NO0B 1C1EL 1J5OL 1YEKL 4JG1H 3C08L 4POZC 3V4PH 2CDGB 1XR8B 2BHZA 2F53D 1U8QB 3TVMD 4AIOA 1TPXB 3BIKB 2P5EA 2D03H 1U8MB 2EDFA 2SEBB 3X13A 4LSQH 1K4DA 1DQLL 2GKIA 3BPOB 4HIJA 4GAYA 5DJYB 3TIEA 2ORBH 1QG3A 4OZIB 4NQCA 4YFDB 3L5HA 4ZFOA 2AEWA 3MV8B 5F9AC 1OGAE 4PY8J 2FYYB 1GOHA 4ZUSA 3M8OL 43CAB 4D0DA 3TV3H 4EIGB 4F7MB 4KHXL 4HUNB 4G6FB 4NRXB 4XP1H 1G7LA 3RIAK 2LAAA 4O58L 1EO5A 4PJAB 1KIQA 1X3DA 2W92A 3UTOA 3BAEL 4Y19E 4GLRI 4Q58C 3CVHH 1M7IB 5HDBF 2CO7B 3VFRA 1DFBL 5B8CC 3FB7B 2IEPA 2FX8H 5EU3A 1JPFB 3MUGB 5DK3A 4I0KA 1SJHB 3MRCB 1RJZA 2Q6WB 1YDPA 3OKMA 1HOCA 3GSOA 3W5MA 2BNQA 1KPUA 4YDIL 1ZA3A 2DBLH 3N1FC 3V4UL 3CC5B 3C60C 2M2DA 2ZUSA 3DRQA 3ARGB 1J1XH 2P5WB 3G6DL 1H5BB 2X9WA 3ZKND 2CO6B 2CKBA 2VXTL 1PX4A 2DQFB 1RK0A 2GW5A 1EZVX 5MERB 2VZ1A 1GC1H 4MA7L 3TA3B 3UJTL 2ESVA 4JRYA 4YJZL 5DJXA 4G7VH 3SKUD 4QXGL 4YEFA 5AAMA 5HYIA 1VFUA 4KKLD 2X42A 5B8CA 1ONQB 2B7DT 4PJXA 1TTFA 1XMWA 3HZKA 1RJLA 3QSKB 2QKIB 4ZUUB 2E8ZA 4LCCA 5ID1A 3QDJA 1OARH 1JGLH 4OLUL 1U8HA 1V7NL 2VAJA 5CS7A 5I17A 4P57B 5HDOA 5DJ6B 5JXED 4EOWH 4DVRH 1UZ6F 2V7NB 4NQVB 4WI8A 5F88A 5E99H 5KVMC 1NGPL 3TZVD 5IR1A 3QZWA 4TUOA 3NCYP 3MRDB 4P46B 4L8BA 4NOFA 5L2KD 3ARED 4LVHB 4BELD 2J1KA 5FV1L 3BI9X 2LFGA 5J7CC 4UIKH 1YEIH 1FZKA 4OGXL 1MNUH 4S1DD 4TUKH 2RCSL 4PTUA 2O61B 1R3IH 5IF0A 3DX9A 1D9KB 4NN6C 3QDHA 2E7LC 1HEZA 4Z7WF 1FNLA 4HAGA 1XF2A 1AO7E 3PQYD 3NCMA 1ORQB 3CZJA 4P46A 4YFLI 4PRPE 5I6XB 4AL8L 2X09A 2CKBH 1JL8A 5GGVY 3BO8A 2PXYD 3O6ML 5GJTL 1UZ6E 3ROLA 3ZTNL 1QLRB 3BPNB 2R2BB 5GGQH 4PJGA 43C9B 4F7TA 1S7SB 3QUZB 5K9QG 1YN7B 5ILTL 1KXQE 5L2KE 3VXOB 2XTJB 5CGTA 3AS2A 2BSTB 4OZ4A 3TN0C 3WIHH 1CZ8L 4PJIA 3QUZD 3WEXB 4JPKL 4QHLB 4EVNA 2Y06H 4K8RC 1NGPH 5E56A 4WEUD 3VE0A 1ADQA 4AG4L 4DVRL 3X3FH 4OCWL 3MBEC 2XKSA 4XXDB 1VACA 1O0VA 5MEND 1ZK9A 5MI0B 1NGZA 4KV5F 4HV8B 2FL5A 1FL3A 2HJKB 3BD3A 2CR6A 4FQQA 5KSUA 3THMH 2X4OB 2F8XC 5B4MD 1Z5LB 4LF3A 4KQ3L 2PW2B 3P9MA 2CGRH 2VXVL 1UKQA 2LV4A 3HRZB 1N4XH 1MQKH 1VACB 1S8DA 1SJHA 3T0WA 4JY6A 4UTAL 2CK0H 1WAAA 3MFGB 5ESVA 1P4IH 2FDBP 1KCUL 2Z8SA 2MKWA 3FHAA 5DR5L 2ZOKB 1UWEL 2ICWB 4AJ0A 3CXHJ 5TGBA 2YSSA 5DJ8B 1TFHA 2AK4A 2MQ3A 4MAYB 1YEFL 4OCNC 4R90H 3HE6A 3QHTC 4D8PA 1P7QD 2NY4C 5C3LD 4GRMA 4XVJL 1QSFD 4U6VL 1NEZG 1R5IB 5ID0B 5I9QB 5AZEH 3W0WD 1KIPA 4JRYD 5ACZB 1MJ8L 2BZDA 1WTLA 4RFNB 3RWFB 1MLCA 2EDQA 4K9EC 4PRHD 3VH8A 3C6LB 1EFQA 3C2AH 2VL5B 2WBWB 3TEUA 1DUZB 3HPLA 4JHZA 1KB5L 2R2EA 5C0EA 2CIKA 1UACL 3EYSH 4BZ2L 3DV6B 2Y07L 5TQ2L 3TNNA 2BRRH 4WY7L 4ELKB 5DD3H 3HA0A 5IEKB 1CR9H 1QHPA 2V9RA 3S34H 2W9EL 4PJGE 1IBGH 4H25B 1UH3A 4WFGE 4MB4A 5CSZA 1E27A 4QKXB 1U8MA 2F5BH 1I3RB 3KYOA 1BZ9B 3BRDA 1KG0B 5D1QC 3CIQA 5IM7B 4FQJL 2VB5A 1OAQL 3G6JB 1SBBA 4E42B 3KPLB 3ALXA 4QRPE 3QJFB 2WIMA 4OLZL 1MCLA 5DD6A 3I6LD 4MLSA 3RVVD 1MREH 3QIBB 2N7BA 3EOTL 1MCWM 4WFED 1C5CH 2R9HD 5GISH 1BGXH 5IHZA 7FABL 1RI8A 1C1EH 4HXBH 2DDQL 3QIWA 4NZRL 1T04A 3PWNA 3VXSD 2AJUL 4H0IA 3WHE1 3A6CL 3NABH 1NL0L 4F3FA 1FNSL 4JFFA 2DM4A 1JF1B 5DC4B 3WHE0 5F7UA 2AABH 1LO3H 3RU8H 4DK3A 3OR7A 4P9HL 2PETA 4GS7C 3DV4B 1L7TH 5TE6H 3VMPA 2XWBA 3BZFB 1G9MH 3P4NA 3OX8B 4OIIH 1IKNC 3SDXF 3QCUH 5MEPA 4CW1B 3GUTA 4RISH 3DRQB 2BRRL 4D9QE 3B2UD 1KCLA 5A2FA 5F96H 2Z31C 1RFDH 3UTPE 1U8KA 4B50A 4XNYH 5CD5C 3VFMB 3V7MA 2A38A 3GB7A 5EUKA 3CFKB 4Y1AA 4ZS7H 5CSBA 1OF2A 1SEQH 3MLRH 3KJ6L 1HKLL 2JJSA 3N9GH 3BEVA 3MV7D 5SV3A 3DMMD 1KLUB 2AJ3B 1F97A 1BVLB 4PR5A 5DGRA 1A1OA 1T03L 3FT2B 3O3AA 1NEZB 4HIEA 4OGAD 2PYEE 3OKYA 3QEQD 2X4SA 1VADA 3VXME 4K8RL 1QKZL 3CLEL 2W0PA 2C1OA 1CXHA 4X9BA 1CD9B 3SY0A 5HYFA 4HIHB 1I4FA 3ARSA 3KPQB 3VWKB 2APTA 4RGMB 3BGFC 3GBLA 4NRZA 3L5WA 1EEYB 3C5JB 4XCYA 3DWTA 4R8WL 5CBEB 3HPJA 1FL5B 4D9QD 3QUKB 2XWTB 3EKCA 5DFVC 3VW3H 4YBHA 1JNHB 1A5FH 3O2DA 5DS8B 4P4KB 1AD0A 4W4OC 5HGGS 5D7JB 5FA4B 1U6AH 3VFNB 3EOAA 1Q0XL 3DRTB 4PRIB 3RTQD 4CJ0A 3D1MC 2DQHH 4KV5E 4JHWH 2XN9B 5EU6B 1JRHH 1XGUB 4TSCL 5BOPA 4PYGA 4LOUC 4OV6F 5IEHA 3GMRA 2C9AA 2QQNH 3WLBA 1IQDB 2J5LC 2IQ9H 3O4LE 5EZLA 2RHEA 1G6RB 3JSSA 3CX5J 5FKAA 1HYSC 5DFWH 2H3NB 2NX5E 5I71B 3MMEA 4L4VB 5K9KA 1MCQA 1GGCH 1OTTC 1S7TA 5GGUA 2J12B 3BN3B 5JDJA 2VXSL 1QD0A 3GK8L 5JORA 5IK3B 3Q6FB 5IP4A 3FFCA 2Z35A 1UM4L 3VFVA 1FORL 3T2PA 4WHDA 3TBYA 3O8XA 1HSAB 4EI5B 2WBKA 2W38A 2X05A 4P3CL 3BP5A 5KVDL 1DQQB 4ENED 5CEZL 2JK5A 4I4WB 3LOWA 1JHKH 5DRWA 3EJZC 3QUMA 1U91B 2DQFA 3QO1A 3WS3B 4ZPTA 2NCMA 4BH8B 1RZ7H 1RIHH 2QSQA 1AJ7H 2FX7H 1E6OL 3KYNA 4JHBA 5ENWA 5T1DL 1EA9C 3BRGC 4IS6A 4Y4HA 1PLGH 3B8YA 4QNPF 4H1LG 3RUGA 3QUML 1UXSA 1MREL 4YC2B 1RULL 2GCYB 4OFIA 1CD1B 4X4XB 1F3JB 1XGPB 4LSVH 1KB5B 2N4IA 1DN0B 1WFTA 4O9HH 1JV5A 4UIMA 4OM1L 3UAJD 4E5XB 2FO4B 3T4YB 3T1FB 1J86A 3D0LB 2BSED 1G6RH 3OJ2C 4F7EA 5GS0D 1FP5A 5DI8A 4UIKL 3VD3A 5D71H 3DO3A 1J8HA 5K9JH 1PSKL 3G5XA 3LSOA 3WUWA 4Z76B 4OFDA 3PE9A 1WBZA 1KNOA 1RUQH 3BPCA 4MD0B 1IEAA 4YX2H 2EH8H 2PKDA 4KTYA 4KY1H 5GRYA 4P23B 2UVFA 5E9DB 4XCNA 3HR6A 3BN9D 5K33A 4X0KA 4DGVH 2HVJB 5KN5A 3ZSSA 4FMKA 2GITA 3ARBB 4XCFH 3FO9A 5KVEH 4X6EB 5KS9E 2W9DH 5SWQA 4WU5A 3HZYA 3S96A 1Y0LA 1U42A 3STZA 5C7XL 1T1YB 1F58L 1JTOA 1BZ7B 4FQIH 3HE6D 3QFJB 4Z0XA 3T1WA 4LLWA 5HHMB 3CMGA 4P5MB 3PHOB 2X1XR 4U1MB 4ERSH 2JELH 4GUPA 2AAVA 3GIVA 4UDUB 4YFEA 2XRAL 4LGSB 1N0XL 3VFOB 3SGJC 4UAOB 2D9CA 2Q8AH 1N6QH 1CTNA 3L5JA 5GHWH 5LXGH 4A6YH 5T33L 3UPCA 1UQSA 4A6YB 5DJAA 4KKLC 4JRXB 3TH2T 4NT6A 3QXWA 5CP3A 1OTTD 2Q76A 4BKLB 3HI1B 5J6HA 5CD3A 3D9AL 3RHWK 4ISVB 4QTHA 4DN4H 1ZXQA 3VXRA 4TNWK 1OAUH 3UDWA 3L3DA 3O4LA 1FLTX 1T0NB 2PUQT 4LDOB 1HDMA 4U6YA 1J88A 5JHDE 4KJWD 5HVFB 3ZKSD 4NDMB 1KC5L 1YQVL 3E2HB 2VERN 4LAQH 4WV1A 5KG9B 4G9DA 4WDIA 3RIFK 4IM8A 2FRGP 3UTSD 1QYGH 5IMOA 1T1XA 1JWSB 1YEGH 2X9YA 3EJYD 5I2IB 4EI6A 1IGJB 3KLAA 1XGUA 2YN5A 4XH2A 4O02H 2BMKB 3U4EA 4DGIH 2CK2A 4H0GA 2IANE 1LO5A 3LS5L 1CU4H 5IMMB 5LG1A 4E41E 4HD9A 5GS0C 5DC0A 3DTXA 1MIMH 1TCRB 1EERB 5ALCL 4F7PA 2AQ1A 3DVFA 2Z91A 3TNMB 5TPWL 2X4RA 2Z92B 2J5LB 4RBPH 5JORB 4ZQKB 5BV7L 4B53A 4NN7B 1YJDH 3FONB 1N6QL 4JJHA 4NJAL 4PG2C 3VXTA 4QOKB 5E8DL 2NTFA 5C3TA 4POUB 2DICA 2QEJA 2XPGB 4K71B 3PWUA 2NZ9C 3Q5TA 3RDTB 5I6XC 2D0HA 4O02L 4R4BB 3RNQB 5I66B 3DTXB 1DBJH 1FSKB 5D7LB 3L7FB 4JFEE 1U3JA 5D6DA 2JJTA 5FGBA 3QULB 5FM5O 3QP3A 5KAQG 3VFSA 1XGRB 4XZUB 5B38A 9CGTA 4OGZA 5E8OA 1DQJA 4Q2ZB 3P30L 2CKNA 4PJXB 5DZLA 4U1SB 1BVKB 2RB8A 4MJIA 5CEXA 5HGAA 4Q0XL 4U6VH 3MRJA 1CVSC 1KJ3H 1DBKL 5CWSA 4CU6A 1HN1A 4GH7B 1RZKH 1NFKA 1A3RL 5SX5K 4LLQB 5T3ZL 3L7FA 3MV7A 2ITDB 2V7NA 1ZHBB 2C1PA 3PWJB 4DTGL 1A7QL 1YECL 3DUUA 2ESVE 1AC6A 4R2GD 5BVPH 4QRUA 4QHMA 3HAEA 3UO1H 3LQAH 4PGJA 4NQXB 3LQZB 5D2LF 3TA3D 4JJ5A 2VWEE 4PJ8D 4C4KT 1FRGH 4LLUB 2Z92A 4JB9L 4D9LL 2JELL 4MAYD 3IJHB 4IRSD 2Q6WA 1HYSD 1BHGA 5DUML 2V9QA 5GPRA 4GQ9L 4OZFH 3EOBB 1R3LA 4FTVE 2H6PB 1MFEL 3CZFB 3SJVB 3PUCA 4XPBH 4YHPB 4GSDL 4FXGA 2R0WL 5D7LD 2AVGA 2FBJH 4X4ZA 5C0RH 2BY3A 3SBWA 1RAMA 2OQJA 1AO7B 4NCC1 3S5LG 3VFOA 5IJVA 4BUHA 1HSBA 4FP8L 1CT8A 4LVNB 4GUPB 3JUYA 4KKNA 5T3ZE 1R3JB 1SBSH 2W0FA 4HDIB 5FHBL 3I3BA 3BUTA 3RGVB 5IGXL 3RL1B 4MNQB 3S36X 3ZZ1A 5C0CD 4RGNB 5LVEA 4HXAH 4H8WC 4NKOB 3KGRA 3VXNA 1R3HA 3B5TA 3GMQB 4LEOB 4X6CE 4Y8DC 4JKKA 2FR4B 2YD2A 3GJEB 3L3DB 4X7TB 3B9KD 1A02N 3EFDH 1DFBH 5FCUL 5ADPL 4JZNA 2DTMH 2H2PD 3SJVE 1KN2H 1RHFA 3EYQC 1NKRA 4K7FB 1Z2KA 2VLLA 4LHQB 3RGHA 1T6WA 3G08B 1A7BA 2YMXL 1ZS8B 1WISA 5CP3H 1CFBA 3RL1A 1J5OH 2HFTA 5GZND 1JWSA 2UZIH 1F4YL 3BMWA 2LU7A 3LV3B 5D93C 5C0GA 4GBXC 3QWOA 5KVGL 2FR4A 4OD1L 1A8JH 5DMJB 2IG2H 1U8IA 4Y4KD 2P5EE 3IDIB 4RGOH 5E4EB 2J8UF 2MCPH 3I84A 4V1DA 3RTQB 5ACLA 2OL3H 1WF5A 1SM3H 5MEPB 2D7QA 3QUYC 4YBLC 3HB3C 3QIUC 3O6KL 1AGFA 5JPNA 3GKZA 4KI5D 5T3XE 3UDWC 1B6UA 1UZ8B 1HWHB 4YHIA 1HHJA 1S9VB 5EOCJ 3DECA 4HIXH 5I1GL 1P6FA 3RZCA 5JUEL 2ZUTA 2GYSA 5ESAA 3TPUB 3QCTL 3D5OF 5AWNH 3IFPA 1LEKB 1X4XA 2IPKA 5KVEL 4PJBE 1WWBX 1U8IB 4MXWH 4ZOCA 5E2VL 5DJDA 2F5AH 3RY4A 2BRQA 4FMFA 1FC1A 1NAMB 2NY3C 4LRIC 3QISA 5D6CB 5CHNA 2COQA 4ZXBC 1UJTA 4WFFD 3RNQA 4Z8FL 4P4RA 3Q1SL 3FOMA 4DKAA 3I50L 5I18H 1G6RA 1H3GA 1DSFH 3ILPB 5LAXA 4RAVA 2X4PB 1TVHB 3BKML 4FFVD 4M7KH 4ZDHA 2YRLA 4QHKJ 1REIA 5F89A 2YPKB 3HE7B 5EZOL 3C60D 2I25N 1WZKA 2FATH 3P4MA 2EC9T 5TE4L 1AD0B 4JFEA 2EDTA 2UY6A 4L8SB 3BP4A 2KUTA 4LLQA 1FZJA 4YE4L 3BKYH 3RJDA 4X4YA 2JJSC 4FQHB 5D9SA 4YFLF 5D5MA 1KEGH 3DYPA 4HG4J 4PJ5D 5FF6B 4ZXBB 1IKFH 1XFPA 4U1SA 4TPRL 5ITBL 3IFLH 4GW4B 3EO0B 2Y36L 1KT2B 3F7YA 4HQQH 1QFWI 3RRQA 2Y5TA 2F54B 4M1CD 1NFDF 3SQOL 4JM4H 4XAKD 2HTLC 1JTPA 1DN0A 4P59H 5C70A 1Q9LA 5BQ7B 4WU7B 5E2UL 4L29B 4OZGF 1JZ2A 2NXZD 1CD8A 3UBXI 3WLWD 5DSCA 3OF6A 5E1HB 4OTXH 4JZJB 4YWGL 3GMRB 4K7PX 1CDBA 3BPLC 1QR4A 1WZMA 3C8DA 4FQCH 3QRGH 5D7IE 5A40E 1CD1A 4JFXB 3U4BL 4FXGB 1A7RH 3BVNA 4NKDA 3VFPA 1B0RA 4AT6A 3ZHKA 1UB6A 1ZVSA 4XAKE 2UYLA 1L7TL 1UM6L 4QRPD 2VLKE 2NXZB 5EBWB 4YHLH 3DSFL 3C2SA 5IQ9B 4R3SA 3WNMA 4FFWD 4PB9H 1EBPA 3WLWC 4Y4FC 3T0BA 1LP9E 1UCBL 2VN4A 4MJ5B 4S1QL 5EA0L 1GIGH 1NKOA 3STLA 5SWQB 3I85A 6FABL 3AXLB 1EHLH 2B1HH 1IARB 3PWUB 4NM4L 4G8EA 4ZS7L 4PJ5B 4ZXBD 5HY9A 2QR0A 1I9JH 3QPXH 4HWBH 4RZCB 1F6AA 1WBXB 3QQ4A 3T8XA 3S7GA 2LAGB 3TBSB 2LU4A 3FT2A 4GJTB 3ARGA 3IDUA 1CLYH 1JZ5A 4YPGB 4Z7OE 4Z7OF 3SQBA 1QFPA 2IAMA 3E8UH 3P2TA 5B3JE 1PG7X 1E28B 2DQUL 2PYEB 5BQ7A 1KCSL 4NO0D 4YGVA 5DI8B 2ZWLT 2YPVL 1OAYL 1AR2A 4LIQL 1S9WA 3LIZH 1LO3L 3RU8L 3BRFA 3QJFA 2OJEB 3UC0L 3WFBL 1NCBH 1I3VA 5I1AB 1HHJB 1S9VA 1B0RB 4I0PC 1T5WB 4LKCB 1DN2A 1NC2D 5E2VH 4LEXL 4XVTH 5L0QC 4M5ZL 4WTZA 3QCTH 4WRLA 3KS0J 1JZ8A 4JO3H 1X5XA 1K4CA 4LLMB 1CXKA 1MJUH 1KYOK 2VJXA 4YDJA 3ABZA 3EFFB 1ZKAA 1HHHA 5C6PB 1DR9A 1AI1L 5HI4C 2FEDC 4L8SC 4M48H 3MRKB 1NGWA 3ILPA 4X6BA 2XZCL 2AV1A 1U8LA 3GSNB 3GB7B 4P5TB 5CJXC 3KDMA 3V5DA 1CGSH 5FYJH 4ZFFB 3SDDD 2HWZL 3IFOB 4CVUA 3RA7H 3EYQD 3MGTA 3BIKA 3T2QA 4R7NA 2CGRL 3T65A 3WJJC 4LSRL 1RZ8A 3B9AA 1U8QA 1XT5A 2R4RL 1BM3L 5F7NC 4FFWC 4R7DB 1YN6B 1HQ4A 3K2UL 1EEZB 3PL6A 5GZNC 4XMKH 35C8L 3MYZA 5E00A 3J7HA 4HSQA 4PJFE 2IBBA 4RMTA 3UYPA 1DEDA 5IB3B 2GSIB 2C4XA 4ZS6D 3IFLL 2NY5H 2FYYA 4M7JL 2XWTA 3PABA 4J12A 5B22A 5B39B 5IUSA 5DD3L 2ZNXA 1Z0NA 4RMQA 4WO4C 4C59B 4BFGA 4YQXH 2R2HB 5H37G 2HT2C 5ADOL 4PGEA 1XGQA 5SX5H 3R8QA 4OB5L 4QNPE 3C2AL 1NUNB 4OI7A 2NTSP 2JJUA 5FB8B 3L3GA 2MJWA 1X5AA 3H3PL 1M4KA 1MJ8H 4HH8A 3RVVC 3CFCH 4ODUA 3JWOH 1OAZH 3RZCB 2H3NA 4GXVH 5DEGB 4Y5XC 1HKLH 5J89A 2FO1A 1JGVH 4HUWA 1DVFA 1E0OB 2A6KA 3KPMB 4OF6A 1Q0YH 1X5JA 2P7TA 1S7RB 5C0FB 5MENB 5IEKA 3NFNB 1IC4L 5J13B 2O5YL 1GAFL 1PJ9A 4XMPL 4HXAL 1J12A 3OKOB 1L6ZA 3FRUA 3QUZC 4OGXH 4TUKL 1S9YA 2G5RA 4IRJC 4UB0H 4Z7WE 2IPUK 2Y1VA 3I6KA 5E6IA 5DVMA 2FBOJ 2ZG1A 1J11A 4D2NA 5KJRL 3MBED 2ERJC 1CXLA 1L0XA 5FDYA 1CICC 5CZXD 5GIRA 3TZVC 3WFCL 3GMLA 3K4DA 3HAEB 5FEBA 3O3EA 1ADQH 5DZNA 4XB8A 2BC4B 1ES0A 2RQ8A 2VUYA 4LEOA 4RNRA 5A2LH 3SDCB 1PZ5B 2WUBL 1TZGL 4L9DA 3RKDD 3ULSB 4E5XA 1YPZE 4E41B 1G7PA 4ZPTB 4BH8A 5AG8A 4P57A 2G60H 4Y5VA 4XP1L 5DDHA 1IFHH 1YNKH 2EKJA 3ULVD 2Q1EA 5IBLD 3PV7A 4XCEB 4JY6B 3GSUA 4M9OA 3MSPA 5F7WC 2A0LD 2E9IA 4G8FA 1MUJB 4GOSA 5EFIA 2B2XL 3PQYE 3REVB 4I3SL 1NDMB 3QI9A 2RIKA 3T08A 4P2QB 5GGTL 1IAKA 4HHAA 2DJUA 3KWWA 4M7KL 1XIWA 2VO5A 2JCCE 5FK9B 2Z93A 4F8TA 1LE9A 3FJTA 1X9QA 3Q1SH 3MUZ1 4FZEH 5C07D 4MNGA 4PJGF 3NCYS 5E6IB 2BNRA 4I2XE 1LO4L 5IW1B 3QI9B 4HIIA 3U6RB 4CMHB 3VXQA 2R2BA 5JOPD 3KLSA 4YNYA 2WINB 4KDTA 1U8OA 4H8WL 4OZ4B 3IDYB 1ZLVK 4PJ7F 4UUJA 3I6LE 3DO7B 4YX2L 2VLMD 2NY5C 2EDLA 1ZGLB 4QXGH 3IU3A 3VWJB 3WCYA 2VZOA 3QIBD 5C07E 3CUPB 1BQHB 4HUVB 3PNWA 5I76B 4EEEA 5CEZD 1T66D 4LGRB 4W4NA 3BH8A 1KEMH 3ZT6A 1I7TB 4OLUH 5DA0B 4DGYL 5DD5L 3CSYB 5HVHC 3X14B 4NDMA 4H26A 5HGDB 3QG6A 2R2HA 4N5EC 4ZNEA 3DVGA 1GZPB 2GAZB 2YPLB 1WAAF 4MA1C 4YDIH 4HT1L 3WHXB 1AGBB 4M43H 1YY8A 5A16B 3EO1A 4JFPB 4B0MM 2C26A 3TCLB 5J13C 4QHNA 2R0ZH 4F3FB 1RK1B 5MEOB 3GSVB 5EOCL 1DE4A 4KXZI 4RSVA 5F7FA 3TYFB 3KPSE 5GS0H 1MFNA 1E4XI 2FD6L 3IFPB 1TCRA 3QCVL 4S11A 5HI4D 4BZ1L 2NQCA 2VDNH 4RWHA 2WW8A 3QXTA 5E2WH 1A7OL 3VD9A 5DWUH 5EC2B 1TETH 2ICWA 1UM5L 1JE6A 3V0WH 1GPOH 5J11B 4JO3L 1I9IL 1QR1B 3LAFA 3PIQA 3D18A 5DHYA 5EBMA 1CE1L 1QOKA 3NOIA 3E1F1 4LEXH 1CFSA 4DCQA 2FJGB 2PTUA 3QNXB 3GDBA 5ISZA 4GRWE 5BS0E 2YBRA 1JCKA 3TWCL 4U1HA 2A9ML 2VDOH 4W6XB 1Z0MA 4KQ4L 2RFXB 4WCYH 1JI2A 4P59L 2OK0L 3GJFB 4O9HL 5JMRA 5EBLB 3HPLB 1HXMB 2R4RH 5EU5A 5F7LB 2XA3A 1RJYB 1EFXB 1K2DA 2R56L 2HWZH 5H2BA 3W2DL 4N90E 3PWPE 1JNLL 4DVBB 4HC1H 1NC4D 4X7FC 3S6CA 3ROOA 1BOYA 3BQUC 1S7UB 3U0PB 3H3BC 4J23A 4P2OB 1KELL 2JLLA 4G3YH 4G6KL 5DMIH 5GRUL 3SKJH 1ZA3B 3MREB 4YDKH 4F37K 4QXUH 4XVUC 2GHWB 3TZVA 3MZTA 5IB1B 2C3GA 3RWCB 4OZHA 1B2WH 5TDPB 1RUQL 5CJQL 2HJFB 1UYWL 4OCXL 4NRXA 1I1YA 2YEZA 2JE8A 1U8JB 3V79C 1WT5A 2CUHA 4C57C 4DVBA 5GRJH 4ODSH 2GK2A 4CNIB 3MLSH 4EOWL 4ETYA 2ADJA 2EDEA 3ULVF 3LN5A 1P4LA 3ULUH 2DQDL 3EOBA 1ZLWH 4PRBB 5DRNA 3SDYL 3PHQB 3U79A 4AIZB 5B8CB 1S8DB 3QBTB 5IMLB 4J8RA 3D3VA 3G5YA 2B1AH 4N1CA 1G1YA 3EDKA 4JRYB 1IGFL 5CJOH 4F15C 4KJPD 1C5BL 2VKXA 4G6JL 2X4QA 2YSSB 4PRNA 1I8IA 3TN0A 1HSAA 1GC1L 5C8JB 4FQXD 4QF1A 4GAJH 3WD5H 5CEZH 3B6SB 1G7QA 4EDXA 4LGPB 4QWWD 4WNQA 5ALBL 5HYQB 1AHWC 5C71A 3MRNB 1KBGL 5I17B 3SE8H 1EGJH 3U6RA 4WO4B 4TOYH 4KI5E 5T3XD 4RQQB 3TESA 1E4KA 3EYVB 5CJ5A 1PYWB 4LFHG 3TBVA 1T0MA 5BV7C 4XC1L 4HFUH 4JFOA 1OLLA 4M1DH 2DN7A 2P47B 3PL6C 4P2RB 4X5XB 5L2KA 1CDHA 1IZKA 2HJLB 5C07A 1GZPA 2R23A 4ZUUA 4K94H 5IFAL 4IIQB 3D25A 5IVXE 1YEDA 4KJQC 4MAUL 3LRSB 2E27H 2QTEA 1I4FB 25C8H 2YRPA 1IC7L 3MV11 5IF0B 4Z7UB 3VFSB 5SWSE 2ED8A 3HPJB 3MCKA 4HKBB 1JWMB 2VLRD 1QNZH 1INDL 4F7MA 3P0YL 4G6FD 4ETQB 1ND0A 2W9EH 1CGSL 5FYJL 3VXOA 1M6OA 4HS8H 4HIHA 3VWKA 1MLBA 1SJXA 2HKHH 5KS9F 1QLFB 5HI5D 2JCCF 5DT1H 4BFIB 3S4SB 3MRBA 1KTDB 3WD5L 3OG6B 5TE7H 2XRAH 2AXFA 2AJYH 4OCSL 5I8KL 1A7PH 5B3NA 3TO2B 3ARFD 4OLXL 2PW1A 3JWDL 3DRTA 4PRIA 2ARJB 1FG2B 5J11C 4WI4A 5HYQA 4Y1AE 1LEGA 4FQ2H 1BGXL 5ELIA 2YD9A 4HIXL 3TBTB 5LAXB 4PTTA 3V2AR 2M26A 2NMSA 3L3HA 4NN5B 4FFYL 4XTRD 5AG9A 1GZQA 3I75B 2ITCA 1D5IH 4HEME 2VZTA 5H2BB 2XV6B 4PP2B 3GEWB 1T66C 1Q94B 1H5BC 5E7FA 1DDHB 2R1WB 4UI2A 5DD1H 5FO9A 3VXRB 5EZOH 1CICA 2I9LA 3I6KB 4UNUA 2DJ4A 2PCPB 1LE5A 1IGMH 5I1GH 5D5MB 4PJFA 3WN5B 5F9DC 4HZLB 4NQCB 3WSQH 2Y07H 3MRIB 3BP4B 1AQDB 2V5YA 2HFEB 4JM2A 3X13B 4JQVC 1Y6NR 3LCYA 2J6EA 2DIBA 5F8QC 1IJ9A 2DDQH 1BJ8A 4Y0GA 5E9DD 1E27B 3SE4C 3F12B 1A9BA 5D8JL 5IB1A 4E41A 4ODSL 5J12C 3SO3C 3TBWA 1KIQB 3HI6L 3V6FA 3AMLA 3MZGB 1BQSA 4Y19A 2LU3A 5HYJB 4CVZB 4OGAC 3K2MC 1FO0B 2BVEA 2EDRA 4QHNB 5DEFB 3NH7H 4AIZA 1WWCA 1IILE 1TVBB 3V7AE 1VGEL 4N5UA 5C0BA 3T77A 3FN0H 4HKJA 4QT5A 1ZA6A 4AENB 4GAFB 4L4JA 3MROB 1NSNH 1RZFL 4L8DB 4UTAH 5BRZD 5DUMH 2GFBA 4JQXC 2VXSH 2DAVA 4P48A 1JWUB 3UYRH 5HHOA 1N4XL 1WEJH 4LIQE 1ORSA 3NACL 4N0RA 3MUGA 1Q94A 3DHMA 2YMXH 3EW3B 1CFSB 2XT1B 3QXDA 4GG6A 4G43B 4P5KB 4U6XB 2AK1L 2ADGB 5TDOB 1F13A 3VFTA 3ULVH 4C56B 4ELME 3CZFA 4JY4B 3JV5A 1K9TA 4Y4KC 4CADB 4JRXE 5C0BD 1MOEA 4DKEL 3NIDF 5B3JF 3RY6A 1EFXA 3MV9D 2VDML 4AEHH 2Q8BL 2W1NA 4N0CC 3QUMB 4LSUL 4MZ3A 3QFJE 1F11B 4YGVB 1QRNA 3RL2A 5IB3A 2P42B 4OI9A 1R5VB 4JPVL 2W0FB 3KS0H 2AEPH 2DIJA 3MCKB 3T3MF 3MBEB 1VFOA 5DJ2A 3PDDA 2IAND 4PUBL 3LKNB 4YHZL 2W07A 1NFIA 4RAUA 1WCQA 2YEZB 1XH3B 4Z5RB 4ZUWA 4LHUD 2H6PA 4NNPL 5LJYH 2OZ4L 5C0IB 1FG2A 4LDLB 4U0RB 2AEQL 2F53E 5IJKA 3HUJB 1NJ9B 4KGJA 3TYFA 3UJJL 3EOAB 4PRPA 4RISL 1NMAL 2ED9A 4F33A 1P7HL 4HCRH 3WE6A 4N68A 3GI8H 1D6VL 1WITA 1PEZA 32C2B 1RU9H 4F7TB 1ORQA 1VFBB 2MOVA 3WS6A 4P9HH 3U30B 4Q9RL 1KB9K 4RX4A 1Q8MA 1MCIA 4TQEH 5DC9B 5HHNB 5DS8A 2EDJA 3BO8B 4JCLA 4PRDB 3B6SA 3RJQB 1YJDC 5IBTL 1NCDH 4EQ3A 3QI9C 1JPTH 4OF5A 1OTSC 5D1QD 3N1PC 2PXYA 5DJCB 5EUOE 3O9WA 3QDJE 4M7LT 5T5NF 2EECA 4K7PL 3ZDZE 3CSYA 3BQUA 4PJDF 1SVZA 2NY7L 1T5XB 2FH6A 2CKBB 3WEXA 1G9EA 2H9GB 4X5LA 3MRQB 2YC1B 1I8LC 2WUBH 5CZXC 5I8OL 5FYKD 4MAYC 4LAQL 2N1KA 1CS6A 2G5BB 3FCTA 2ATKB 3BP6A 1X4ZA 1I8KB 1MCKA 3R0NA 1F42A 4LFHD 1DVFD 4JZJC 1NFDB 4M00A 3RZWA 1IAOB 2PYFA 1NAML 3AMKA 1IGTB 1J0JA 2B4CH 2XQBH 3RWIA 1JYWA 4CVWA 3KYMA 2ATPB 4WWKB 2YUVA 1K8IA 3U2SB 4K7PH 4F33B 4HEPG 4XCFL 3JTTA 4HK0B 1NAMA 1TZGH 3MPCA 3LD8C 4JQVA 4S1SH 5JW3H 5MP6L 2BMKA 1LO0H 5E5MA 2QQNL 1WC7A 1OGAD 1CYGA 2MCG1 1LO2L 3PHQA 43CAA 4GXUM 4ZPVB 1CD0A 2CIIB 3BWAA 1I1AA 5BCAA 1NCUA 5BMFH 3RWGB 1XCQB 5E5UB 4JANA 4KK5D 3GUTB 2D0GA 5CSGA 3ZMRA 4GKOA 1R3KA 1U8OB 4MD5A 4WGVB 4IMLA 2GITB 1MHPL 4C56A 1CLYL 1NCWH 3F7RA 4K3EH 5JIHA 4Y2DD 3PWPA 4HPOL 1MNUL 5GGRB 4V2BA 1BLNB 2WANA 1TVDA 1H3TA 4XP4H 2OZ4A 2BXYA 4AQOA 5FDWB 3K7UA 1RULH 1FFNB 1N0XH 4KMTL 4NPYA 3VDBA 3MREA 1JGVL 3V4UH 3CH8A 3FQNA 5JHLH 1KJ3L 4MDJA 3ME0A 2XTLA 2AXJA 1KT2A 3F7YB 4AH2B 3TN0B 2CIKB 3CFCL 5CGMA 3NCJL 2J88L 3D39A 4KROD 3B2VL 3BDYH 1NBYA 3BP7B 4JDTH 2H41A 3QFJA 4Z0XB 3OHXA 5M95B 3DJ9A 1MVFA 3ZKNC 1FNAA 4X6CB 2VLKD 4XNYL 3DBXA 4JFPA 1N5AB 4X7SH 3OAUL 4XPTH 4ZO9A 1DCLA 3G6JA 1YMHB 5HHXH 3GIZH 3VWKC 3OL2A 2RR3A 3VXUA 4NNXB 4YHIB 4FNLH 4QTIH 2CR3A 4HWEH 2AK4E 1LHZA 4RDQF 5LCVH 1T1YA 3DVNB 5I1HH 1FFOA 1VEOA 3H9YA 2QQQA 5E8DH 2P46B 4MB5A 4QRPB 5J12B 5F1NB 1MJ7L 5J57B 4EXKA 4G9FB 1GJIA 3PGFH 1LNUA 5D2LE 1VGEH 4HWZA 2P44B 1YY9D 5J8OA 1B4JH 3S36L 1NBVL 3AAZB 4CVXB 4XT1C 1UC6A 4L3CB 5FYLH 3SDDA 1EJOL 5IVNA 1V3LA 1R5WB 3CVIL 1IMHC 4NUGL 4RMVA 4P4RB 3WYRA 4UUJB 1EIBA 1HHIA 4UT7L 2H1PH 4PG9A 4QGTA 2CJUH 3HNTL 1ACZA 4F58H 2EIZA 5IBTH 3DX6A 4FFZH 4LLMA 2HLAB 2BVOB 2ZUVA 1IQWL 4JVWA 4WW2F 4FQJH 1UKSA 2V2WA 1KENL 3LIZL 1FL3B 1WWAX 5E95B 1QKZH 2EC8A 4MJ6B 5ITFA 4X6CF 1D6VH 3QT2A 5GS1B 1MAKA 1VFMA 2VXUL 3KXFE 5IB4B 3MJ8A 3C6LD 5ENWB 3GKWH 1XCTB 3DLQR 3LN4A 3GSNA 1EO8H 3VWJC 4ZG1A 4BYHA 1TNMA 5I19H 5FO7B 5C0CB 5L8LB 3VRLE 5DTFA 4HUMB 1EXUB 2EO1A 3FAWA 1W0VA 1BFOB 3TCLA 3MJ9H 3P0VL 1Q1JH 5ICYB 1PKOA 3UZQA 4JRYE 4UQ3B 4KTEL 1MJJB 3KPQA 4XPAH 1K8IB 1GGUA 2ZSWA 1NANH 2DQHL 3QDAA 4WHYG 3RNKA 2X41A 4D3CH 5I1LB 4NKQB 1JPSH 2AJXL 1Y6KR 4I3RL 2Q86B 1RJCA 4G80A 1KXVC 5FYLD 2F54E 4HUUA 1HH9B 2NX5A 3L95B 1V5JA 3MV7B 1NL0H 4KUZH 5E1AB 4FFZL 5HSFA 2Y5EA 1GZQB 3JWOC 4U1KA 4GT7A 5T1LA 5F9JA 4LSDA 4RRPG 5BZDB 5D7IF 3QEGH 5HYJD 3MRLB 3C9NA 5B4MC 4XNMA 4EI5A 2CQVA 4HKXB 3EOTH 2WWKO 4BM7A 3WIIH 4WO4A 5KSAD 2BVTA 2WNGA 1GVIA 2HP4A 5F7EH 5F7MC 1HHKB 3PF2A 3D3VE 15C8L 3L95A 3U30C 3HE7D 5E2JA 2ZCKH 4N0FA 1OSZA 5ICXA 1BM3H 2VABA 1JF5A 5D6DC 4P2RA 2V7HB 4X5XA 5KW9L 1KULA 2LQRA 5DURB 3SO3B 4TNVF 1OAKL 4JPIA 4HGWB 2DI8A 4H1LB 3X3FL 2GT9B 3TA3A 4DQOH 3VW3L 1KJMB 3T8XB 1CWVA 1UWGL 1PDKA 1B9ZA 1GPOL 4KFZC 2EXWC 3GI9H 3I6GA 3LKPB 4M7LL 1EAPB 1S5IH 3ZDYE 4JKMA 4KVCL 1ED3B 5E2UH 4N90D 5FF6A 4QRQA 4ALAL 4C56D 1MI5E 1T2XA 1JTTA 5BXFB 2HH0H 4C54A 3IGAB 3DXAB 2OBGA 4LCCB 1I85C 1CLZL 5IB5B 1XF4B 4M1DL 2K7PA 1RHHA 3GK8H 4XNXH 1HH9A 2NR6C 1ZV5A 2Y23A 1I8MA 4Z7VB 2XZAH 3IDIA 1ZLUK 4NO2B 4Z5RA 5T1KB 2AXGA 4P46D 1AY1H 2FECI 2KQMA 5J56B 2X1OA 1KB5H 1NBVH 5E0QA 5EO1B 4MA1B 3EUUA 2NW2B 3IDGB 2ZPKL 3HZMA 5GS1C 4HPYH 1IEAB 5BVJA 4GW1A 1MFDL 3HNVH 1SYVB 4AM0B 5DQJB 1H15A 4NJ9H 1MWAL 3C5ZA 1RMFH 1QSED 5ACMA 4DN3H 3KDMB 4P0DA 3V5DB 4ZFFA 2QSCL 4UQ2A 1GCFA 3U82B 3WDIA 1HHGB 3SE9H 4JRXA 1OW0A 3GSNH 4HJGA 3BSZH 5HYSB 1PG7H 2DLTA 5EO1A 5HPMB 4YR6B 3V6OC 5DZOA 4Y5XB 4HMCA 5GSRB 4U1HB 2E7LA 1ZANL 4PJHF 1OQOA 2CLRA 1PZUB 3QJHB 4U3XA 2UZIL 1F45A 1UEMA 3LQAC 4FQ1L 5DF0A 3VI4E 4FQXC 4CKVX 1QFWM 4ODVH 1RZ8B 3I02B 3IFNH 3KYKL 4ENEC 1KCKA 4FG6D 2NX5D 4LP5A 2R29L 3AREB 3ARYA 4NJAH 4YR6A 4Z7VA 3MNWA 3O2DL 4CUCA 1B4RA 1K8DB 4R0LB 4GO6B 2UZYB 2BOCA 2NY1B 5E70A 1JPST 4LVEA 4PGEB 4LPTA 2IPTL 5SWZA 3LQZA 3L9RB 3PL6D 5DLMH 2ZUWA 2PYED 4PJDE 1UENA 4LCUB 5DYOB 3KYMB 4WWKA 1P4BL 5SWSD 4ZFOL 5KW9H 1NCNA 3OKKA 1U3HC 3F7VA 3GSRB 2VDNL 2EH7H 2F19H 5EIVA 5I1JL 1CL7L 4L4TE 2X5PA 3QG7L 1TQBC 5IFAH 3CPLA 3HAEG 5KTEH 5IHUL 4FQXA 5C0JB 2X89A 2YKLH 4ACPA 4MB3A 1OWRM 2Y6SC 1LQSR 2YC1A 1N6UA 4P4KA 1I7ZA 4FFVC 4XNUH 1DUZA 1ZVSB 1RD6A 1NEUA 1FRGL 2CLRB 3VH8B 3ALPA 1UVQB 3V6OE 3JTTB 4HK0A 3NFPB 3RAJH 3WFHA 2ZUQC 3TVMB 3GMOA 5I75C 4URTB 1QO3B 4Z78B 1KACB 3I2CL 5ILTH 4NN5C 3V5KB 2DQTH 3LZFL 5D4QA 5T33H 4M6ML 3T4YA 5IB2A 4F9LA 3BDYL 1DANT 4N0UB 3NA9H 3ZDXF 4QOKD 4Y5YB 5M94B 3WHXA 3K81A 3OJMB 4QHLA 4LASH 1AGDB 1F58H 2A83A 3QIUD 4R4FL 5C7XH 3GIZL 4I0CC 4O4YH 2XKUA 1MWAA 1W0YT 3G9VA 1QRKA 3MO1A 2VLRA 5MP6H 1G7HB 3UPAA 5KSAA 3H9HA 1RSFA 3S3JA 3CDFA 2I07A 4BQ6A 3DBXB 2VAAB 4ZYKB 3RPKA 3BMVA 4JFQB 3U0TB 5D7SH 1VENA 4HKBA 1NAKH 4I9WD 5TDNA 3LB6C 4OV5B 5HGHB 1X4YA 4R97C 4YHPA 4JJ5B 1G9NL 4NO5B 2W60B 5EIIB 4GW5A 5FAAA 5D1ZA 1MWAH 1SY6A 3MMEB 1YEHL 2F53B 3MLTB 4NYLA 3IJHA 2DLIA 4G80B 5GZOD 3WDJA 4Y8AA 4ONFL 4HPYL 1FLRH 3MJ6A 4NQDB 1T20A 1MIEL 5JW5B 3WKML 1BOGB 2WMPA 3STLB 4RMSA 3I3EA 4PB0L 4Q9BA 3VDAA 5C07B 4L8BB 4MYWB 2Z31A 3TNMA 2UWEF 1MCHA 4PJ7B 2XA8H 2F53A 3NA9L 1KN2L 4YHYC 2YK1L 2A74B 3K4AA 2X40A 5K9QI 5KSBF 1OSPL 2VE6B 1M71B 3O0RL 4OCRL 3D69B 4ODXA 4XTRC 2FJHA 1QVOB 5D1ZD 3LDBC 4NQEA 1VCAA 1DQML 3BN9C 1BX2A 1IM9D 3ZE1E 5IMOB 4XWOD 3MBEA 5DJ2B 4I18B 3KYKH 4P5MA 2DM7A 4U1MA 4PJEF 3MYJA 3SCMB 5I1EL 1J18A 4RAUB 4H1LH 3MCG1 1EFXD 2YWZA 4O2FA 4HS3B 5AD0B 3VGAB 4NUJA 5IVOA 4HCRA 3QWOB 2FX8L 4XPBL 4N8VA 4Q97A 5FGCB 5JO5B 4ISVA 2QADB 4QTHB 5I1JH 2YUXA 3BUYB 3R4DA 2Q3ZA 2BOCB 4GXVL 1YYLH 2OJZL 5DRZB 3IB4A 1AXSA 4OKVB 3FB7A 2H2SD 4U05A 5KJRH 1XZ0A 3CSGA 3VG9B 4KRPC 3LN4B 3BEWB 3TBWB 3AAZA 3LH2L 4QEGA 1VPOH 5E6IC 3TH4T 5SX4H 1G6VK 1UZ8A 4QWWC 4G9DB 4DGYH 5T3XH 1SJEA 3DURB 3OV6A 5J1AB 2OTPA 3TJEL 4S2SA 1FFPB 1P2CB 2EYSA 3U83A 1MCPL 2E9BA 2I24N 3NA4A 5L9DL 4KRLB 3QWRA 2Z31D 4AENA 1MRCL 5GS3A 2WQRA 3P4NB 4P2OD 2PTTB 5FGCE 3SJVA 5AZ2H 2QSCH 2KZ1B 1JWUA 4PD4K 4F7CA 5CHNB 4W81A 4PJIF 2BK8A 2HKFL 3HNVL 4NRYA 5EOQL 3BYYA 1QEWA 5H35A 1U91A 4U31A 4OF8A 3BZEB 4XAWH 4WFFE 1FYHB 4F37F 2B0SL 4LARL 4O51B 4XXDA 5I9QC 3OJVC 1P7QA 3EDDA 1MPAH 3OAYK 1F4XH 4XBGA 1EXUA 4YQXL 3LEYL 2V7HA 1OB1B 3BH9A 1ZT7B 2FO4A 2CDGA 4JO4L 1AHWB 5D2LB 1QFHA 2VITB 1KB5A 3C09C 1W72L 3CJJA 3QXAA 3JV6A 5EZJA 2KPNA 3QDJD 5HJ3A 4Z95H 4LCWD 1CLOH 4OTXL 3FN0L 3P9MB 3W11C 5EU7E 3FQXB 3JXAA 4I8DA 2XTJE 5KANI 3RPIA 5F9OL 2QHRH 5IVXF 5ISZE 2P48B 2A1WH 2VSCA 3S8WA 2H26A 4OM0H 4I48A 1D7FA 1FL5A 1DBAL 3DXAA 3BPCB 1MLCB 1GOGA 5F6IC 2KH2B 4XVSH 1NMCC 3B5GA 5FA4A 2HN7A 3OPZH 1RZKC 3VFUB 1WZ1H 1YEJL 1NPUA 2IQAB 4E9LA 2YKLL 3PJSA 4X9HA 1U8PA 2EZ0C 2NYYC 1S5HB 1NLDH 2OXGA 3WJLA 1HH6B 3FZUC 4NO3B 5ACZA 2BFVL 2NXYC 1TTGA 4ZO8A 1JF6A 5FKAB 1OAYH 3DMMB 5BVJB 1VKXB 4QO1A 3OR6B 1UKTA 2IH3B 3FFCD 3OWEA 5FV2A 4UINH 1NGQL 2X89D 4MD5B 5INCB 2XWJB 2BDNL 1NMAH 2UVEA 4RFOH 1ACYL 3VXQB 3P0YH 1P53A 3B3IA 3UTTD 3IGAA 3UJJH 3OGOE 1CG9B 2A6JA 4KZDL 3SDYH 4X6DF 1RURL 3HMWL 1AO7A 3RKDC 1QLEL 3S35H 3NH7L 1FCGA 3CLEH 4LMQI 5I19L 1JFQH 4MA8H 4PV9B 2EE9A 4JE4B 1U3HB 4NCC2 4U1NB 2FSEA 4RMUA 4HF5L 3RY6C 4CW1A 3E3QC 1AIFB 5HYEA 1U3HD 4PY7A 2QQLH 1U9KA 4OF0A 5C0CE 1YEEL 4OF7A 3T4AA 4WDIB 3O4LB 5TFSL 1IGYB 3GMNB 3SKNA 1AFVH 4KVCH 4UIMB 5IHZB 1MCOH 3FB5B 2AI0L 1T22A 3DVIA 4U6YB 1OP3K 5I73B 2X4UB 4UILH 4HPOH 5KSVB 5EWIL 4ZMAT 3ARQA 2IALA 2P4AB 2VLJD 5EC1A 2H2PC 1ZE3C 5JXEA 4FN0A 1CDYA 1EO8L 4F7PB 3AS0A 4JFQA 4BSJA 5IR1B 3O41A 1AIFA 4NWTH 3ESVF 3W2DH 3BX7C 2VIRA 1A6WL 4S1QH 3B43A 5F7HA 1OCWL 3QR2A 3KJ6H 2CDFB 4XPAL 2AK4D 5IBUB 5FCUH 4WCYL 5I16B 4MCYB 3PGFL 3JZ7A 4Y4KA 5E5MB 2FEEI 5LGHH 4S1SL 1MI5A 1VADB 3O9WC 3PWLB 4BK4A 5FYKU 5CEYB 1E6OH 4ZTOH 4DOHB 2V2TB 1C5CL 2Y06L 2HVKA 1F11A 3JV4B 3ZKQD 1B0GA 3CC5A 1A6TB 3EIFA 5E9DE 5EBLA 2YHGA 4WI2A 3H8NA 4D0DB 4E0RA 4MAUH 4PP1C 2FATL 5DTFB 4JM4L 1Q38A 1GH7A 1EGJA 3RZCC 5HJ3B 2G9HB 1CDIA 1A6UH 5HYJE 1UXWA 3O6FA 4EI5C 4XC1H 5ANMA 1CR9L 3MJ8B 4JO2L 5GISL 4ZFGH 1X5KA 3P0GB 4S1RH 5GGSY 3HI5H 3BPNC 5CUSH 1E4WH 3CVIH 1JPFA 2WAHA 5GZOC 3QPQC 1OQXA 4JM2B 3UBXB 3B9DA 5MHSD 5LBSL 2B0SH 3ARDD 5IV2B 3BE1L 1F8TL 4WUUB 2ZCHL 3W9DB 1XCQA 5I1DA 1Z5LA 4LF3B 4UOJA 5C6WH 3QIWB 3PJSB 1QFWL 2UZXB 1W72H 1W72B 1RIVH 1RU9L 3GBMH 4L8DA 1VFBA 4P2RD 4GMSH 3D87B 1KNOB 3MV9A 3DYOA 3DETC 2P8MB 5FYJE 4WHTB 1S7TB 5LGJA 5IVZB 5C08D 1PY4A 4PGBA 5JW4M 4MJ4A 1CBVL 4C56E 1SJEB 3DURA 4KKAC 2FD6H 4ELMB 1FVCB 5BRZB 1AE6H 3CGTA 4JDTL 4PGZA 1FGVL 4RWYH 3HE6B 3MACL 3QFJD 1TNNA 4BQBA 4OZHB 4CGTA 1SY6L 3BKCH 3ARFC 3JBG7 2E7HA 2EO9A 3L7EB 2XN9E 5FYLL 3QIWC 3EDEA 5HXMA 4KZEH 1JFQL 4HJ0D 3MRKA 4MA8L 4P2OA 3U0PA 3DI3B 5FYJD 2A6IB 4FHBD 5JZ7C 5ICZA 1GRWA 4JG0L 3WNNA 4YUEH 3ARUA 1UFUA 4Z7WB 4B41A 5C0AA 3MR9B 2IC2A 4XCCL 1UXSB 1I1FB 4MMZC 3S97C 1MCRA 1ROWA 5C0GB 1V7MH 4KHTH 4Z7QF 3L5XL 2VDPH 4XP6H 1CDCA 2Z8WC 1M7DA 3E0GA 4O2EB 3HR5B 3EGSA 3QDGA 4OZIF 1R0AL 3THML 5E2TL 4KK8C 1G0DA 4GRLA 5IM7A 3DX8B 5JQ6H 2GUOB 4BSVB 2GTZA 3UBXG 2V17H 2NW2A 4F9LC 1TZIA 1BBJA 4TPRH 2BVUA 1JVKA 2PW2A 1S7SA 4XPHL 3T77B 2JB6B 4NO2A 4F15B 1KBGH 3QRFM 1YNTA 2IGFH 5E2WL 3LKOB 4WHYH 1L0YA 1FE8H 2L7UA 1T83A 1JRHI 1BMGA 2NZIA 5C86A 4K3JL 5IIEA 2NR6D 3DUSB 1B0GB 4PLKD 5D2NA 2ZG3A 3OR7B 1X5ZA 2FIKB 4YUEL 3O9WB 1JYXA 2HFFA 4WI9A 3TBSA 2GSGB 3DHJA 4P46C 1JWMA 4P2CG 3PQYA 4LBEB 1WICA 3HMXL 5T5FH 4H5SB 1CFVH 4KMQA 4R4ND 1P1ZB 4PRDA 1AR1C 2QQKL 4FTVB 4GRLC 5D7KE 4YDLB 1NEZA 4NC0B 1A7OH 1S7QA 1QSEE 2HTLD 1LK2B 3CUPA 3FO2A 1G9MC 2C5DC 1JZ6A 1NCDL 3ZE0F 4PTTB 5L88H 3NBNA 1FFQA 1OTUC 1S7WB 3OXRA 5EPMB 3RY5A 1OSZB 3KPRD 3O3AB 1X6NA 3QIUB 3WSQL 4R4FH 5JZ7D 3SE9L 3ZSTA 4AEHL 4HW6A 5HGAB 4PY7B 1MELA 2VXQH 3OQ3B 1AR1D 3NZHH 3ULSA 2EDHA 2VXTH 1QSFE 4FOMA 5DMIL 3SKJL 5EU3B 3WXWL 3ZYIA 5IMLA 2ARJA 3K1KC 5I66A 3BWUC 3UCRA 1FN4B 2NY2C 1QBLH 2NY3D 2QADC 5HGBA 3WUWG 1BBDH 3QH3B 3RQ3A 3JUZA 5J06A 4G42A 4KDTC 1UWXK 5F7YC 4QOKA 3BZ4A 3MXVH 4LU5L 2P5WA 3DIFB 5I1LA 5FECB 4M7ZC 1J1OL 3HKFA 3HHRB 4ZAKD 2L4OA 1YQVH 1NMBH 1UGNA 5EU5B 2FJGA 3QNXA 5TPWH 4LP4A 2YA0A 2B2XH 1RJZB 5HHOE 3KXFA 5JLZB 3TIDB 1JK8B 4NHCL 5ICZB 5IHLB 5K59F 5GS1A 3IS1X 3BZFA 5JA9A 1VKXA 1OAUL 3VGFA 4M5ZH 4LLDA 4OUOA 1QPPA 5IMKB 4PRAA 5FUCE 1KTKE 2R9HC 2R23B 4JREC 4GRWF 1A9EB 1D5BB 3R06A 3PABB 1ORSB 4GXUN 3IDXH 1S7UA 5GHWL 3R8BB 2P5WD 3LKSA 1FAIH 4GQ9H 2AKRB 3GBNL 1ZLSH 3WFDH 2D03L 5F93C 2OTUB 2XA8L 3BOVA 2CLVB 3ZTJH 4PV9A 1YY9C 4NSKA 2NY7H 1A6WH 1IGIH 2ZJSL 1SEBA 4P2YA 1QBLL 3ARZA 2EC9U 3LSOB 4KUCD 5EOTA 5JR1L 3ARRA 5HHOD 3LQAL 3P9LB 1OTUD 4JDVA 4QHUB 2WUCH 1RZFH 1U8HB 4OB5H 3D0LA 3D48R 2P8LB 4Z7UF 5DEGA 2XZCH 2IMNA 3IXTB 2ZUXA 5TDOA 1J0HA 1NUFA 3RVWC 1K8DA 2K3TA 4TQEL 3RWHB 3F58L 3HG1E 3H9ZA 2OR9L 2OI9C 3L3IB 3VFRB 3CDGB 3D85A 3ULVE 3ZTJG 3HZYB 3QWQB 3GHBH 2IH1A 3GSQA 1S78D 4GG6B 4UOW0 1BQHA 1U41A 4AMKL 3QJHA 4UDTA 2D7OA 4OLWL 2O5YH 2A9NL 2GK0A 1TENA 2VR9A 5JIKA 3SDCC 5I0ZA 1G7IB 1QA9A 3LB6D 4K2UL 3W9EA 4XP9H 5F3BA 2C7UB 3RVWD 2DBJA 3X14A 1T7XA 4L1HA 1XF3B 4X8JA 4O5LL 4XBPA 1A9EA 1D5BA 5E8EB 1B90A 1GGBL 4TNVK 4FQLH 3H9SB 3UYRL 3DVGB 3AY4A 4U7MA 5FUCC 1BVZA 3BXNB 2JB5H 3GSQB 5GGUB 1LILA 4APQC 3BFOA 4IIQA 1AKJA 2NZ9D 4PUBH 1QVOA 1FG9C 4U1GC 2BX5A 1G6RL 1A22B 2VE6A 3FMGL 3UJIL 4ALAH 1S7XB 3U7WH 4LDEB 3QIUA 5B21A 4YHKH 3WN5C 4QXUL 3U7AA 2PO6B 1XR9A 3MOQA 5MI0C 1OP9A 1NDMA 2EXYC 1CXFA 3CFIC 4PGDA 1HZHL 3SKMA 1BQHG 2W59A 3BUYA 1IKFL 3SGDI 5J1TC 3C60A 5CZKA 3ARPA 4QRUB 4UAOC 3RWJA 3RVXD 2V17L 1MEXL 2Q20A 4OSUL 3CH1A 4OFYA 5F1IB 2C4FU 3AC0A 4Z7UE 4ELMF 5CAYB 3LEVH 1HWGB 1GHFL 1KXTB 4QRTB 3MJ7B 1B4JL 3WMSA 2ADFH 3VXSA 3C5ZC 1L0QA 3ULVC 3DYMA 4LKCA 2CH8A 5F7DB 3SN6N 1P4BH 3FRPA 1P6AB 3DGGB 3MV7E 4X7CC 3BT2H 4GW4A 1IBGL 2DWEB 1BF8A 4ZTOL 1I8KA 1OAKH 3QUKA 2QLVB 4WY7H 4TVPE 3TO2A 3NN8A 1CGXA 3I50H 3VWJA 1RUAH 1FIGL 3HB3D 2XYCA 1TLKA 3WL9A 1DUYA 4J4PD 4ERSL 2XFXA 3NFNA 4L1DA 1BD2A 3U0WL 2HKFH 2OXHA 3HNSL 3P4LA 3TF7C 1FYTA 3ARVA 1YPZF 5DVKA 4UU9A 3JWDH 2XXMB 3FT3B 1SVCP 4XVJH 4HWBA 4HX1A 1N26A 3BJ91 4XBEH 4G8EB 3AU1B 5L9DH 3CX5K 2X4NB 2FEEL 3SE4A 2QSTA 5D96B 5L6YL 1M7IA 5T3XL 1AXTL 1T7YA 2BNRE 1UG9A 4TTDD 1I1FA 2F54A 3S9DB 3QPXL 4HWBL 4LIQH 4HULB 4OQTL 4S1DC 2VOTA 1DQDH 3G5YB 2FLBT 1F3RB 3PV6A 3S3SA 4CRPA 2MNUA 5DMYA 4UV4L 1HCFX 4UU9B 5E94B 3X3GH 1KCSH 2CRMA 4HS6B 4NJ9L 2GJJA 1ZHNA 1WCBB 4JM2D 2ICEB 1JBJA 5DDHB 4ZUVB 1BFVL 3VG0L 1B0WA 2DB8A 5C0AB 1KFAH 4YIQA 3V95A 2IFFH 2H26B 2ENYA 4WW1A 4CDGC 4K2UH 1RVFL 2ARWA 3GSUB 2VZVA 1P7KA 5F96L 5JIIA 4OLWH 1WZ1L 1YEJH 1PLGL 2QKIA 1HOCB 3GSOB 4A2LA 4Z7QE 1BBJB 3CFBB 3GSWA 2BNRB 3GHBL 1D6EB 5BOZG 4ONOA 1OP5K 4P4KD 4TRPL 2H2SC 5JUEH 4N1EA 1FNFA 1V3JA 4TN9A 1C08B 1MCJA 1WUNT 1NMCB 4CVXA 5EH1A 4Y2DC 4HC1A 3NIGF 3V4VL 4XPFH 1WBYB 1NMBL 1NLDL 4J3XA 5C9JA 3GMQA 3QXVA 1NGWB 3TJHD 2ICES 1PKQA 4KPHH 1C5BH 4M43L 5EU7C 2W65B 3VH8G 5C08B 2A83B 4NWUH 5FUZL 1QNZL 5HHMD 2Y9RT 4LPUA 1H3VA 1H3PL 3DV6A 3RHWF 2D7NA 3MLXH 4YXHL 1HILB 4HIJB 5GGTA 4NHUB 5FIEA 4ZOEA 5DUBB 1LNUB 3VG0H 1AXSB 4NZTL 1FAKT 3NTCH 4U6TA 4M8QB 2DI7A 2DMBA 4PJ9C 3DVNA 4APQA 2BOBB 5SWZB 2FIRT 5I8EA 3GHEL 2DQEL 2UUDK 4RDQG 1DE4B 5E08H 3VD5A 3FB6B 5F1SA 3R1GH 3CFDA 4ZSOE 3TPUA 4JFDA 3JTSB 1YY8B 2A6DB 2VQUA 3EO1B 4KKCC 4YO0B 5ALBH 5A16A 1AFVL 4ZFZA 1R6VA 2PTTA 4PJAE 5E00B 4G3YL 4LSTH 4OKDA 1OPGL 4IRJD 4NQSA 1K5NB 4Y19B 5HYJA 1RUMH 3M07A 4MCYA 5CEZE 1DLHB 1BAFL 3ULUE 1F5WA 2WK2A 4MJID 4RMRA 5E6YA 1I7RB 1SEQL 1T80A 1EEZA 3PL6B 1LD9B 1KUMA 1QFUH 1YMMB 4PJDB 4O5LH 1EMTL 1CFTB 5JW4Q 5ADPH 1MCPH 3QXUA 4OQ1A 3BEWA 4XP5L 1T6VN 4PIRF 1RV6X 5JW3L 1A14L 1IM3B 3EOYG 3WXWH 1V8HA 2IAMC 3L1OL 4K3DL 4P99A 4YGAB 3HS0A 4IOIA 1N5YL 3M17A 1A0QL 1N2RB 4Q6IC 3LS5H 2BVYA 5DD0L 4O2CB 4JKPL 4PBVC 3CFJB 1KSRA 2WIIB 5F6HI 5JPMA 1B88A 3TBYB 3UTQA 3JWDC 5IFJB 1J87A 1D3CA 3QQ3B 4L8CB 1J9CT 5I8CA 1M05A 2EXYD 5DHVH 1XEDA 2NPLX 1SM3L 5D1QA 3WUZA 2FX9L 3MNVA 1EUUA 1LVEA 5DUPL 4HV8A 3ULUD 2EYTA 5GGSA 1RUKL 3DSNA 4U2ZA 4P9HC 1CGVA 1I8LA 2CMRH 5JIPA 2FWOB 4WJ5A 5IV2A 4N0CD 2VAAA 2UWEB 5AYUH 3OPZL 3QDMB 4LSRH 3VJ6B 3PDOA 5DVLA 1HZHH 2UY7A 3MRDA 4AEEA 1U95A 3LEXB 2HA1A 3H0TA 2P7TB 2VISA 4KHXH 1EEYA 1CE6A 3H2WA 4HKXA 4RA0C 1MCWW 4OZFA 4NZUH 3EYFA 5DQ9B 1JK8A 2Z8VC 4C4KO 4G6ML 1FQ9C 2HT4C 5SWSA 1N8ZB 1MF2H 2R0KH 1Z3GL 1MFBH 4ZS6C 3LKQB 4KKBD 3UTTA 3ULUC 1CI5A 3VRJB 2BVQA 3RVTC 4L29A 4EUPB 4AK1A 3LVEA 2NTFB 4XHJD 1G7PB 5JW5A 3KJ4C 1PEWA 1XGYH 4BSWB 1T7ZA 5DFVD 3DUUB 5CP7B 3IFNL 4L9LA 2BC4A 4NYLB 4NKMA 2J3SA 2W9DL 4MA3A 3OAUH 4OT1L 4XPTL 4L5FL 3OAZK 1HHKA 3A0OA 4JHAL 3OKEB 3RBSA 5MERA 2R1YA 3WNPA 5JHDB 1U3HA 2QR0B 4R3SB 4PJCA 2F5AL 3GO1H 1Q0YL 1X7QA 2AEQH 3EBAA 5ESQB 5F1KC 1PW3A 1BVKA 3R1GL 1O5DT 5AUMB 3G6AB 4NQEB 3VFWB 3FO0H 5IB5A 2C3VB 1R24A 1CIUA 2E6JA 12E8L 5L2KB 4I9WE 3IU3B 2VH5H 1TITA 3QXAB 3PG2A 3O11A 1T22B 4CU7A 2X7LA 2Z0BA 1HDMB 1T0MB 4ZNCD 4FTVD 2RBLA 2E7CA 4XNQB 4YPGA 5KG9A 2O5ZH 4LCWA 4JPVH 1MJJA 4XNZC 3I9GL 4ORZC 3HUJF 2A77L 1ONQA 3ZKXC 4BA8A 3SO5A 3CAFA 3INUL 4OD3L 3LKQA 2ZOLA 4LASL 2G60L 1XGQB 3OAZH 3AB0C 3WE6B 4GRWB 1QSEA 2D4DA 4K7FA 1INQA 3O2WH 3CCHA 3C60B 4QCIB 1QA9B 1F02I 3C87A 5D6CA 5F6HJ 3EGSB 3LS4L 4PJBA 3GM8A 1HHHB 5DJZA 5TDNB 3HZMB 3LRGA 4KRMB 4M93B 4MX7A 3ETBF 5CILL 5IROA 3UX9B 3UTZA 1FIGH 2XNAA 3NZ8B 5J1AA 4G9FD 2IH3A 4PJAA 4DZBB 4G8GE 2D7PA 3WKNA 2JB6A 4OFKA 3L5XH 4X0KB 4PRHA 1LDSA 4M7JH 4JGJA 1YA5A 2P45B 4V1DD 2H8PB 5IFHL 5DJZB 2DQGL 5CD5D 2R1XA 3VGBA 2WIIA 5JPMB 25C8L 1FO0H 2VLJA 3GSXB 1WBYA 3SGKA 4PGBB 5ANMB 15C8H 1NC4B 2ZUYA 4I5BA 4KK5C 2X9XA 3O6MH 5GJTH 1IM3A 1H0DA 5H37H 4HKZB 3WFEH 1UQSB 4XBGB 1RY7B 1CGTA 3O3DA 4NRYB 4NWUL 1L6XA 3FQWB 3IXAA 5ISZD 5AYUL 1DQDL 5IB4A 2L0DA 2QJDA 2CUIA 5ITFB 4I18A 4NN7C 3SGJA 4NHUA 1JHKL 4Z7WA 5EOTB 5BJTB 5D7KD 2H45A 4GQPH 3MRJB 1FZOA 4GMSL 2YPVH 5CJ8A 1FJ1A 5FM5M 5ISZB 2WSKA 4I4WA