4NBZB

Crystal structure of tcda-a1 bound to a26.8 vhh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
VKLEESGGGLVQAGGSLRLSCAASERTFSRYPVAWFRQAPGAEREFVAVISSTGTSTYYADSVKGRFTISRDNAKVTVYLQMNNLKREDTAVYFCAVNSQRTRLQDPNEYDYWGQGTQVTVSSGSEQKLISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Immune system
molecule keywords TcdA
total genus 32
structure length 132
sequence length 132
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nbzB00
1FNSH 3L3GA 3BN9D 5AZ2H 3UC0L 4UQ3B 4F7EA 4H20L 2C9AA 1I1FB 3NIDF 3E3QE 1IM3A 4PJGA 2DAVA 3RL1B 3ARDB 1MI5D 1FGNH 2H26A 3TJHD 4KKAD 1FGVH 3LZFL 1SBSL 2CGRH 4JVUA 4OGYL 1OGAB 4HIJB 2CJUH 5FYLD 4D9RD 3BP5B 3PHQB 3UO1H 2G9HB 2GCYB 4GKSA 4ODSL 3ZE0F 1YEGL 5HHVH 1OD7A 1MWAH 1VB9A 4GRLA 5EZOL 1U8QA 2NY2B 5BV7B 1E28A 5KANG 5D7SL 5JORA 1NCTA 5JQHC 3ROLA 1FCCA 1ZLUH 4RWYH 4WI6A 4WW1B 2FO4B 3BWAA 3CVIH 2H32H 5BOZG 4PD4K 1HHIA 4MB3A 1QG3A 2OJEB 4MQ7B 2EXWC 4DZBB 3ULVE 4WI9A 4NRXA 4X4XA 1LQSR 5T1KB 1D9KD 2OJZL 3MLVH 2WZPD 3WUWB 3ARRA 3ARVA 3KLAA 2CLRA 3L7FB 1J8HD 1P4BH 4G8FA 5EC1A 3SDAD 4ELKA 1SJXA 2IAND 3ARBD 5JHDA 1VFUA 4JHBA 1R3KA 1HILA 4WGVB 5BZDB 1N2RB 1NC4A 4MVBC 1DUYB 1A9BA 3L5XL 3N0PB 4NO2A 5J6HA 4X0KA 2ZNWA 3V4UL 3QJFA 3ZKSD 1BZ7A 2A74A 2HLAB 1AJ7L 3IDIA 5TPWL 3HZVA 1UKTA 4PJ7B 3UCRA 1RZ7L 3WDJA 1RPQA 1NEUA 2DI7A 3UTZA 2R56L 1NC2A 1DQQA 2F19H 4H25B 1N64L 4OAWB 6FABL 4LL9A 4NQTA 3D85D 4Q0XL 3HZKA 3UAJD 5F7DB 4NCDA 3FZUD 3M45A 4XWOD 4G43A 1YZZA 1RMFH 1KSRA 3GMOA 2IEPA 1JPGB 4NRXB 1FSKB 3IU3B 4A6YA 5E2VL 1MLCA 3V2AR 2UZIH 1QUNA 4G6FD 2X4TA 5DJZA 2ATPA 5C0FA 3AC0A 3N9GL 5DUBA 1WZKA 3DPBA 4JFDA 5CP3H 3SKJH 4NO0A 5GRVK 4XP1H 4XWGL 5GIRB 3F12A 4RZCB 1QLFA 3BESR 3DTXB 1G1YA 3OJ2C 3HE7D 4DJMA 3RTQB 2OR9L 2P49B 4Z77B 4GXVH 2CKBA 4O4YL 2AV1B 1Q1JL 1W0VA 3BP7B 1ETZB 4P59L 4HS3B 2Z91A 4X9FA 3LIZL 4PREA 5HHOE 5C2UB 3T4YA 2OBGA 2WBJB 4DTGL 4JANA 3N85L 3DYPA 3KPRA 5C8JB 4S2SB 3DV4A 1ZT7A 1W2KT 4XTRD 4D0CB 4R26H 3WKNA 5C3TA 4ZYKA 1CICD 4O51B 1TJHL 3N06B 5CBAB 5D70H 2H2PC 1IGCL 2CPCA 3QEUB 4RBPK 5BVPH 3CDGA 4NO0B 3F65A 4XHJD 4JEGB 4DUVA 2PETA 1AR1D 4OCXH 4OCNC 2B8OT 2C7UA 3L3HB 3TO2A 4QRRA 3MREB 3SO3B 1YEEL 4GS7B 3MFFB 3HS0B 3TJEL 3GMMB 5F6HJ 1HDMB 2YUZA 1WSST 1HXYA 3VFSB 2ITDA 4HS3A 4DW2H 4F9PC 2A77L 3MRRA 1RUML 2ITCA 4CN4A 5I15H 1PFCA 4P2OA 3O4LA 4HFUL 4X98A 3L3IB 5KG9A 1MHCA 4UV7H 1ULVA 4PJHF 5DVMA 5FO9B 1CVSC 2MSPA 3CPLB 1DBJL 3U0TB 4YHLL 5I75C 1JI1A 2R4SH 1B0GB 4I0KA 4DGYL 4M1DH 2B4CH 1U2HA 2YPLB 1FZJA 1NLDL 3CFJA 4U3HA 3SQOH 4XCEB 4HKZB 5TDPA 4GKSB 5GHWH 4EQ3A 1I4FB 2YZ8A 3PE9A 2EYTB 5HBBA 3IS1X 2YA2A 3NCFB 3CD4A 4Y4KD 2VLJB 1I1AD 3N1FC 4LEOB 4QCIA 1TIUA 2XFXA 1C5CH 4LCIL 2J3SA 3KYNB 2MWCA 3QDJE 2ADIA 3A6CH 3QAZB 2GFBA 1QP1A 3SDAC 3ZTNH 4WU7B 2E7MA 3K4DA 4KVNL 5FA3B 5EO0A 1LE5A 1N8ZB 3GRWL 1A2YA 1WBZB 1T1XA 1KGCD 3TEUA 4OI7A 3L3GB 1GJIA 2W1NA 2UY6A 5EZIH 1CIUA 1NGXA 1HIMH 2B5IB 1NCAL 3WUZA 1WZMA 5B38A 5DUMH 5AUMA 3TV3L 3BD4A 2ZKHL 1IM3B 5KSBA 2CMRH 12E8L 4PJFE 4C56A 3VFWB 3OGCA 5SX5H 3RVVC 1QOKA 3QUXD 4MD0B 5J6GA 5ISZE 2D4FA 4NOFA 2IAMC 2EEDA 2JJTC 4BUHA 3C9NB 3IGAA 1WFUA 2QSQA 4JRWA 2VB5A 4F37K 1XR8B 2J4WL 3NFNA 1T21B 5GPRA 3STLA 3GKWL 3EYUH 5FYKL 2E9IA 3G6JB 3G6DL 4M02A 4KROD 5F7EL 2BSRA 3MROA 4PJFB 4OGXH 2R1YA 5GJTH 1A21A 5C0CA 1JZ3A 3NA9L 2XQBH 1F4YH 2ARJA 3EW3B 4D8PA 5BZWA 1N6QH 4QRPA 2Z4QA 3NIFE 4PJ8A 4H1LG 1T1WB 4TNVK 3S88H 5LCVL 1NMAL 3MLUL 5DJCB 4X4YA 3BT2H 4AZ8A 4HF5H 3SKOA 1YNTA 3NMEA 2IANA 1Q0XH 4G8IA 1TJGL 2E9BA 1X5JA 5HYIA 4GG6B 3IGAB 5LJYH 4FQXA 2VRAA 1GOGA 4YE4H 3HRZB 5LWYL 1S7SB 3QWOA 5JXAH 1WZLA 4P57A 7FABH 3TESA 2P24A 4MXQD 3BKYH 3H9YA 1NFDB 2VXQH 1KJ2B 1D5XB 2R1YB 5EWIL 1IAOB 2FX9H 2EDHA 2V9TA 4G6AD 1ZS8B 3DI3B 4TUOA 4M6MH 3UP1A 1OSPL 2XACC 3TCXA 2A6JB 5IQ7H 1EBAA 3MLYH 5GGVL 5ICYA 4X6EB 1F6AA 4L8BB 3W81A 4JHWH 4XNQB 1C1EL 4G6KL 2YPLD 3WIFB 3WN5A 4TSBL 5K9OB 3PHOA 4CU6A 3O9WB 2RR3A 1UKSA 1QD0A 3GSWA 2VLLA 2F15A 2VL5B 2QQNL 1EFQA 1Q94A 1R3IL 1PD6A 2BERA 4MB4A 3RBSA 5BO1L 3TN0D 3TVMA 1CE1L 1QSFE 3GSUA 2CGRL 4V1DA 1A3RH 4S1SL 1WFOA 2X4TB 3ZKXB 3P77B 3ULUC 4RNRB 3GSQB 1MPAH 1MJ7H 2FSEB 1PKOA 4U1KB 4LKCA 3FFCA 4XZUA 5GGUA 1J88A 1A6ZA 1QLFB 3SHSA 4KTEL 3LKQB 3TPKA 1P2CA 3IF1A 2YC1B 4ZUUB 4HV8A 3KWWB 5CEZL 4PGZA 1UH3A 1QACA 4IMKC 2VDRL 3NZ8A 1UQSA 3T0ED 1L0QA 1CXEA 3GMNA 5KANI 3QUMH 3PQYA 3ZE1F 4NOBA 5IMMA 2V9RA 2R9HD 4I0PB 5L9DL 43CAA 1CU4H 1YEEH 2BVPB 3GI8H 3QO1B 4PTUA 4XCFH 4LBEB 4D0CA 1TVHB 4I1NB 5GRXG 5IVXB 4FQIH 5D7JD 5HDLA 3DIFB 1I4FA 3KYOA 1K8DA 5IUSA 1NGWB 1UWEH 2G75B 1PZUB 1RSFA 3E6HA 3RZCB 3ARDC 3MBXH 3O0RH 1YYMH 2AV7A 2FJGB 5C0IA 4TSAH 4Y19B 1IRAY 5D7IA 3WHXA 5FK9A 1AE6H 2CR3A 3L7EA 3O2WH 4P3DA 2HKFH 1UWXH 5I9QC 5E4IA 2EO9A 1QFWL 2GW5A 3I6LD 5TE7H 1DN2A 2DDQL 3UTSD 5TGBB 2BC4A 2A0LD 3QUZA 4LLQB 2DMBA 3BKCH 3P9MA 4J7RA 3MCKB 4KROC 5E00B 2B2XH 3PWLA 2CXGA 4NUGL 1YC8A 4KJWC 4HPOH 2AJUH 2R0WH 3UROR 4N5EC 4MD5B 2PW2A 2Y72A 2OJEA 4MQ7A 1DE4B 5D2LE 5F44A 4Z6AT 1X5FA 4J3XA 4GJTB 4UTAH 4GAJH 2GITB 4HUNB 1RZFL 3JTTB 2RCSH 4MNQE 1KGCE 3KLAB 3TA3C 5I2IA 5FGBA 1RZKL 5ISZA 1YQ2A 1NUGA 5I1EL 4WW2F 2HWZH 3UPRA 3KR3L 5LGJA 5I1KH 2HJFA 1RI8A 5HI3D 2DTSA 4GAYB 4HH8A 4A2MA 1T83A 1CLYL 3V4PL 2W92A 3X3FL 1U8MB 4LCCA 2P5WD 2HMIC 4PR5B 3G6JE 1UH4A 4JPKH 1B6DA 5CP3A 5DI8B 3KS0J 3W2DL 3VD7A 2G2RB 4OAWA 1S7QB 2VLKA 2A6IB 3QA3A 3FT3A 4K55A 3IAPA 2HJKA 4OI8A 5GS1B 4UTAL 1AKJA 1XIWC 4L4TE 3SQBA 1RK0A 4APQC 4JY6B 4QNPE 4N8CH 1SYSA 4GG6A 4E41E 1MCNA 3VRLF 3W9DA 4ETQB 3RDTA 3CUPB 4IRSC 3FL7A 2QADB 2BSSB 4I3RH 2IPTH 1PLGL 5EH1A 1BJ1H 4K8RD 3O3UN 3QDMB 3O4LE 5HY9A 3R4DA 4UV7L 2YD8A 1JI2A 3OKOA 4M9PA 4PS4H 4Y4FB 2FX8L 3ZYIA 4AMKH 3TYFB 4PG9B 1G9NL 2LQRA 4ZO8A 2F54D 3WKMH 2F5AL 3SDYH 1JBJA 3NTCH 1ZT1B 3QUXC 5DSCA 2X40A 3PWPA 4XC1H 1IC1A 2XQBL 1QHPA 2D7OA 2D3VA 3EOYG 2PUQT 2YUXA 3IDIB 4RAHA 1F11A 3KYMA 4FQIL 4G8GA 4WTZA 1CDYA 4PJHB 4MX7A 1OLLA 4L8SA 3UX9B 5DFTA 4DVRL 2IQ9H 4WO4D 2VTFA 5JORB 3NGBB 1QBML 2E7CA 3GIVA 4G80A 1FNFA 2ZOLB 2ID5A 4U7KA 4XPAL 3V0VB 5F9JA 3VJ6B 2LABA 4GUPB 4S1QL 4NKQB 1B4JL 2VDNH 3V6FB 3OAUH 1MEXH 4ODUB 4P49A 3DSFH 2OR9H 2GSGA 5D8JL 2ZCLH 3MRNB 5D1XC 1ZS8A 3DUUB 2AK4D 1MCKA 2VITA 1FVDB 4NWTL 1EO5A 2YD2A 2XZZA 1MJ7L 4KVNH 3BH9B 2MFNA 5IOPB 4Y8AA 3C5ZC 3RFZC 1QYGH 4V1DD 4AENA 4RMVA 5C08D 2AEQH 4IMKA 2GY5A 1QHOA 3F7VA 3O3EB 5LQBH 4ZXBC 2KQMA 4WHCA 3U4BL 2EYSA 4M7JL 2ZUVA 5I1HL 3BSZL 3LCYA 3KR3H 2BY3A 3IDJA 4PRPB 3BP6B 3M1BB 2OTPA 2HTKD 2RB8A 5D72L 4R9HA 5F89B 4O5LL 4G9DA 4MJ2A 4N0UB 4RNRA 3P0YL 2ADGB 2VXVL 3RWCA 4J8RB 1NBYA 4JREC 5ALBL 4Q0XH 5F71A 1JTPA 4Q9QH 5D8JH 4OV6F 1OT1A 1PYWB 4GMSL 5DZOA 2XN9E 2QEJA 4JQIH 1MCDA 2ZUTA 4X6CB 3MRCA 3HI1A 2AXJA 1YEJH 2GFBB 5DD5H 2I07A 3RU8L 1I1CA 2JB6B 4JFPA 2A77H 3OL2A 1F3DH 1ZLSH 3WS6C 2DTMH 3MRDA 5GIRA 3V5HA 4JFXB 2YHGA 1FLRH 4HS8H 1T83C 3LD8C 4IHOB 3QAZC 1N59B 1BJ1J 1N4XL 3PV6A 4O51A 4AL8L 3PGDB 4JZNA 4GSDH 4PJGE 1JHLH 5GS1C 4HC1L 3JTTA 2AXGA 4X98B 1YN7A 1EGJH 3SDCA 5F89A 3ULUH 5IBUB 1BZQK 3FQRB 3HE6B 1AQDA 3IJHB 4OCYH 3C9NA 5EU3B 4I2XA 4IJ3C 4JKKA 4Y4HD 1JRHH 5D72H 2V2TB 3NFNB 5KBNC 2IJ0C 3VD4A 4PJCE 4Y19A 5D7IB 2F5AH 3SDYL 4FZEH 4TVPE 1G0DA 4B53A 3KYKH 1RIVH 4QXUL 3CFBA 2VAAA 4P2OB 1B6UA 1SEQL 5L88L 3JV0A 2OL3H 1XGYH 4U6YB 4LSVL 2O5ZL 3MLRL 2DYPD 4OBSA 4XVUC 3D18A 3I2CH 4LVHC 2Z0BA 3HMXH 1KC5L 1IKFL 2QJDA 1P1ZB 1U8NA 4U1JB 5JXED 1AY1L 4LAQL 2YBRA 4D0DA 2P1YA 1CXHA 2YPLE 3KPSA 4NT6B 4KTDH 4F9PA 3PG2A 4W6XB 5GGQH 2VDQL 3HUJB 3VFRA 3QIBD 3THMH 2QHRH 1T3FB 2I27N 2DBLH 4YFLF 5E2JA 4GRLB 3ES6B 4JO4H 3WFHB 5I9QB 5DJ0A 1CFNB 4NPYA 1N64H 4G42B 1CFSB 3MV11 5IFAH 4XNZC 4PGEB 5GGTA 2Y6SD 4R2GB 4FABH 1GC1C 4PJ8D 4BQ9A 5DI8A 3JWDC 1VGKB 3MBXL 2I60H 4PGBB 3GMOB 5EULV 2DJSA 1H15B 3LQAL 5CGYD 3U30B 3KXFE 2X70A 3MGOB 4D0DB 5MERA 2B5IC 4R4FL 3JV6A 2HFFB 4BSWB 4X4XB 4K8RL 5LVEA 1NCCH 1BX2A 1JGDA 4S1DD 4F57H 4XCCL 1S9VA 3GHEH 4YGVB 1PX4A 5KSAC 1ONQA 1IC7H 4FFVC 1IAKB 4WY7L 3TIEB 3GSNB 3CDCA 1C5BL 3IYLW 1SJHA 4OI9A 1OY3B 5E8EB 1MQKL 3KWWA 3DVNB 5C9KA 1ORSB 1S7SA 2J12B 2AJXL 4TUJB 5IW1A 4R7DB 5DD1L 2JELH 2CLZB 2H9GB 5HDBF 3KPRB 1UM6H 5C8JA 5C0CD 3MRHA 3QXDB 4JFFB 3V7AG 1QR1A 1CT8A 1DZBA 3QCTL 1JRHL 3VWKD 1QRKA 5CFHA 4AG4H 4PJXE 1WC7A 2W07A 2X4PB 3EYUL 4KI1A 2X9YA 5FYKH 5IHUH 3X3FH 2EYSB 5GGSB 2OTUB 1KEMH 4F7CB 1KPRB 2AK1L 5CUSL 1OAYH 5GRJL 4HUMB 4UILL 3RX7A 5DJZB 1XCQB 3VFOA 4DWHA 5KSUA 3D39A 2FJFA 1NGWA 4PJ8B 1U8OA 2VN7A 1EXUA 4K2UL 5FDWA 1MFCH 4YHIA 2P8MA 3D25A 2YRLA 1Q94B 2NTFB 3BRGC 2X4OA 3I02A 3FQTA 3IRPX 3WFBH 3CMGA 4MDIA 1G9ML 3HC4L 1FNSL 3C09C 3ZSTA 5GJSH 5HSFA 2VDMH 3RUGE 4FQXC 2OZ4H 1LO5B 1WEJH 3VRJB 1JWSB 4NGHH 5FYLL 3IF1B 1OPGL 4TUKH 4GQ9L 2VXVH 3P0YH 3HG1A 3RWGB 3T1WA 5DK0B 4FMKA 3WMSA 4UILH 3C08H 2W9EL 4KMTH 3MA7B 3E6FA 3WS6A 3IJHA 1J10A 1MFEH 1U8KB 5E8PA 5JA8B 3SY0B 4GRLD 2M8XA 4P46B 3UDWA 1HYSC 3AVEA 2A83A 5GRJH 1ED3A 5D6CA 3S4SA 1KF9B 1MHEB 3S35L 3DETC 2FB4H 3GSNH 4GO6B 4TULH 3CZFA 4CVWA 3QT2A 4Z78A 3MJGX 3A6BH 4HCRH 1HDMA 1J0ZA 2VAAB 4GKOA 3DX7A 1YC7A 2AQ2A 3SE4A 5I1GL 2FX8H 5EU6A 3RKDC 3X3GH 3TBTA 4NQCB 5F7MC 4M5YH 1BQSA 4HWUA 4XMPH 2MPAH 2HTKC 2NY1B 4I0PA 2V6HA 1LEIB 3G6AA 3HNSH 3TJEH 4RFNB 1T7XA 4MXVF 3B9KA 3OX8B 2V9QA 3WIIH 4U1SA 4OZGE 5C71A 4KZDL 1XGTB 3L9RB 1WWAX 1FG2B 1ZLUK 1E6JL 4MCYB 1UYWH 1F3RB 1EEZB 3QO0B 2MQ3A 3TIDA 4JFEE 1OAUH 5EU3A 3Q3GB 5L2KA 5DMJB 3GSOA 5EUKB 1OP3K 3O45B 3K81A 3RA7L 3OKOB 5HHME 1MREH 1NANH 4G6FB 4PRNB 4ZAKC 3P4OB 5FO8B 3C8KB 4S1DC 2EEBA 4IOIB 3CLEL 3TYFA 4D8PB 2X42A 3SGJA 1WT5A 4TYUA 4PJXF 1TQCC 4P46D 3MREA 4OF5A 1SY6A 1LE5B 3GMMA 4JB9L 4P2RA 1U3YA 1OAZH 1Y6MR 4P59H 1QSEA 2XWBA 3CSPA 1RQ5A 3T77A 5KSAA 2X70B 1BF8A 2QHRL 1G7PB 4RFEB 4HEPG 4ZPTB 1JPTH 1PG7X 2DWDA 3MUJA 2ORBL 4JN1H 3MFGB 5K93A 4U7SA 1ZLVK 4HAFA 4DFIA 4Y5XC 3MV8B 2X1WL 5IW3A 1EEUA 1LDSA 4XNYH 4XI5D 5DJXB 5EU5B 3QEHB 4OFDA 3FFDA 1VFAA 1FFOB 1UZ8B 3UJTL 1BQHA 3ZO0A 1AXSB 1F3JA 4ONOA 1OF2B 1PG7L 5D7KE 3GB7B 4FQQB 1MHPL 1RJYB 4I0CC 3G9VA 2CLZA 2H9GA 1MFDL 1NC2D 5ADPH 5GXBB 2KPNA 4NZDA 3WKML 2R8SH 2DMCA 4K7PX 4L3EE 3A6OA 4FQJL 2XFXB 3STBA 4GKNA 1J11A 1G7JA 1KPVA 1VFBA 3JSSA 4E41D 4C58B 1R0AL 1QFWM 1X5ZA 3BXNA 4YFLI 3ZKMC 1L7TL 3W5NA 4MAYB 4WY7H 5D1ZA 1JZ6A 3PL6C 4M43H 4XNZB 4NZJA 2D4DA 4F7MA 1BEYL 1RZIA 3U7WL 3CFEB 5IQ9A 3T3ME 1W0YT 5E5UB 4YO0A 4ZUSB 2ESVA 2VLRE 3FQUA 4LSSH 3DMMB 2IH1A 4PP2A 5EOQL 1KCVH 2FEDC 1A6WL 4J3OC 1SVCP 2VN4A 2V7HB 1FFPA 1P7QA 4X5LA 4QT5B 3RDTB 1XR9A 4HFWB 3DVNA 5JR1H 1TVDA 2IBZX 4V2CB 3QULB 4TUJA 4N1CA 1NMCB 3C60B 2BNUB 5SWQB 1MIMH 4Z77A 3JV5A 3AREA 1NBVH 4TPRH 1A6VH 5D1ZB 5DHXB 1MLCB 1KFAH 5IVXA 1EJOH 4E41A 4MMXC 3MXVL 4JFDB 3NH7L 3X11B 1S78D 5IQ9B 2Y23A 4PJCF 1T7ZA 3TN0B 4LLWA 1T03L 4X7TA 1T2QL 3U7WH 4RZCA 1XGRB 4RISH 4RRPA 3BPOB 1WCBB 4KFZC 1MLBA 3WS3A 4QHMA 1O0VA 2B0SH 1PW3A 4P23D 5T33L 2DL9A 3OG4B 1KIQA 3I50L 1GVIA 1MCEA 3VFNA 1P84J 3B2VL 2B1HL 4P4KA 1NBZA 4RQQA 4UIMA 1YJDL 2WP3O 3WFBL 4PJIF 1MUJB 1G9EA 4L5FL 3RBGA 1J8HA 5CJOL 1PYWA 3SE3C 1IAOA 3VXSA 2W60A 3F7VB 1YEKL 2OX5A 4WHTB 3B3IB 3EOBB 2MCPL 3QHFH 3U4EB 3BIKA 4PRBA 2HWZL 4OLYH 4G3YH 4QF1B 3TP4A 1MSPA 4U3XA 5IHBA 2VITB 4X6DE 3RVWC 3PHOB 1CLOH 3MV7B 4LHUA 4WUUA 1AH1A 5L6YH 1PEWA 3PGDA 3WL9B 1RY7B 5DLMH 2QQQA 1BZ9A 1CD8A 1BM3H 3CVHA 5FO8A 1QVOA 2VL4A 1LO0L 3MRCB 4LCYA 4ZXBA 4XVTL 5L2KD 4JFFE 4EOWL 5C07B 4C4KT 1I8LC 5DQ9A 2CR6A 3V6OA 5EN2B 4NQCA 1WV7T 2F54B 2HFGH 4J8RA 3P9MB 4PRIE 2BOBB 3I3DA 1HQ4B 4JKPL 4N0CC 3T8XA 4AM0A 1VPOL 4KDVA 3EFDL 5FM8A 4M6NH 4GOSA 2ENSA 2GJ6D 3O2DL 3FT4A 5D2NA 4OD3L 2OYPA 1UEMA 4Z76B 2E8YA 2N56A 5A16A 4U1SB 3HNVL 2F53D 1RZKC 3MRIB 3U0WH 3MRMA 2XQYG 3H7BA 4LSUH 2EYRA 4MJIA 5MI0C 4DKAA 1FYTA 1V7NL 1IM9D 2FHBA 3R8BB 1NH6A 2WIIB 3MOAH 1CLOL 4JDZA 3VFWA 1F13A 4NDMA 4FFWC 3HC3H 5GSVA 3NPSC 2KKQA 5DK3A 3EUUA 4HUVB 3IKCA 5DUPH 5C92A 3P11L 1R3HB 2DM7A 4R6UA 4JHWL 3HZMB 1QLRB 2OMNA 3V5KA 4K3HA 4XBGA 2G5BA 3RHWF 2V5TA 5KS9B 4OF3A 5GRYA 4QOKB 3HC0A 3RZCC 1QNZH 4N0RA 4LDOB 4MWFA 3TLRA 3E2HB 1RZJL 3BHBB 4QRPE 4HDIA 1ZVYA 3T2QA 3O8XC 4GAGL 5IBUG 4AIZA 1D5BB 1VERA 4IBLT 3QQNA 4DFHA 1FLTX 2F8VA 4RA0C 4K71B 2LV4A 4ETQA 1A6AB 2DD8H 1FGNL 3SOBL 2APVA 4M7KH 4PJIB 2DQJH 5DQDH 4ODVL 1UGNA 4Q58C 1S9XA 1TJGH 5HVWA 4YDLB 1QKZL 5AYQA 4HX1A 1R24B 4Y4KC 5DJAA 3GBNH 5C0RH 5ENWA 3S3JA 5ERWA 2PKDA 2XXMB 3ZKNC 4DCQA 2BFVH 5J06A 5F9AC 4DGIH 4ODTL 2NZ9C 5DJ2B 1I1RA 3T0EA 3QPXL 1SEQH 3IU4L 5JUEH 3SCMC 3RY4A 1BFVL 4KQ4L 4H1LH 2OTWA 1QFUL 5BJTB 2X1PA 2ZG1A 3F58H 5DRXB 4O58L 1JWSA 1H5BA 1U2CA 2ZPKL 4HPYH 4LCWB 5T3XD 3S37L 3ZT5A 2GT9A 5LXGH 4CU7A 1NDGA 2UV3A 2D7TH 2A6KA 1ODAA 3G6JF 4I3SL 5D7JA 3RUGA 3BPOC 4MX7B 3VGFA 1C8PA 3PDOB 1NCUA 1KCVL 3M8OL 4PV8B 3DROA 4P2YA 3RVUC 3TNNB 4QRTB 5JXAL 4LVOC 1P7HL 3MXWH 3QWRA 4UOW0 5M94B 5F3BB 2DB8A 3V0WL 3VFUB 3LKRA 2A9ML 4FMFA 3JWOL 2W9LA 4P2QD 3O9WC 3BPLB 1T1WA 4JY6A 4DTGH 3MV01 2DIJA 3SJVA 2HVJA 4YUEL 3RU8H 1IEHA 3K8KA 1GH7A 2ZKHH 3QXTA 3L5IA 5D2LF 1A22B 4HGKC 1EHAA 5C0CE 3QRFM 5EZIL 4H8WC 3IDYB 1KELL 4TNWF 1LO3H 3O6KH 4P23A 3MNWA 4Z7UF 5JIPA 2GK2A 3CX5J 1ND0A 2HRPH 3OAYH 1KN2H 1MJ8H 4K23L 4QRPD 3MODH 2DYPB 3L5HA 3AXLB 5MHSD 5TE6H 1A3RL 3HR5A 3IFOB 3PWJB 3W0WB 4YBLC 3HC3L 3D6GA 2QKIA 1JNLH 1HKFA 3FOMA 4YIQB 4ZUVA 2NLJA 5DRNB 2APXA 2DQUL 4Z5RB 1IVLA 3H9SD 5DHVB 1EXUB 5FKAB 5E7FA 3RP1A 4Y16A 4ZG1A 1QYGL 4OB5H 3BZ4A 1QLEL 3CFIC 4BH7A 1QQDA 4PYHA 3VFPA 1XF2B 2OI9C 2FATH 5IJKC 3GSVA 4JFZL 2QADD 5E4EB 2PO6A 3B9KC 4GBXB 1Z2KA 1UQSB 4OIIL 3GSQA 5EN2A 2H2SD 4P9HL 1M7XA 4P4KB 2H2PD 4CW1B 4JO2L 1DCLA 1S78C 3EYFA 3UZQA 2C3GA 3RTQA 4ELMF 2X05A 4JFOB 3O6FA 2YK1H 3TBVB 4Y5VB 4PJXA 4L3AA 4OQTH 2NR6D 3MSPA 3PWJA 4P9MH 2BVEA 1MRFH 3OPZL 5DZNA 2WBWB 3T65B 2VWEE 1FVEB 1JGEA 1LO0H 5C1MB 2YZ1A 4JZNB 1Z5LA 2H6PA 4E42A 4LSQH 5E00A 1RJLA 5SX4I 3QG6A 4JR9L 2R2EB 2VR4A 4NQXB 5CJ8A 1YEHH 1BBJA 4F37F 5A3ID 1AQDB 2BCKA 2ZG2A 5DDHA 5KJRL 5BXFA 2AKRA 2VZVA 3MV7D 1RZJC 3O8XD 5E2TL 2GITA 4X4ZA 2IPUG 2W38A 1BQUA 4MNGB 1VDGA 1HEZA 4I4WB 4KMLB 4ODXB 3T2NL 2Q86B 1GIGL 4LMQE 3BPNB 1G6RH 4X7EC 4P46A 1HI6A 3LRSA 3WFCL 2P7TA 5GS0L 4NZRH 2EDDA 1MIEH 4LCCB 4Y4KA 4HIIB 2YD5A 2R0LL 3LS4L 3LRHA 1KLUA 1NCCL 4LSRL 5SWZB 5JQ6H 2MHAA 4K3DH 1LMKA 2JIXD 4AEHL 1VKXA 3V0WH 4PYGA 4L3CA 1T6VN 2JCCB 4XMKL 5IGXL 5KVEH 3U36A 4KKCD 3CFEA 4UINH 2AJSL 2D03L 4WFHD 3ZE2F 3F62A 5F7LB 4ISVA 3RX5A 5I8OH 4ZPTA 3VFTB 3ARDD 1MI5B 3HMXL 3QSKB 4F33A 1NSNL 4I9WD 4O2FB 2H26B 5DFVC 2GJ6E 4UTBH 3BAEL 4FQLH 3SGDH 1J5OL 1J1OL 4KUZH 2IBBA 2DM4A 4AQ1B 3BI9X 3MPCA 1JMXA 2O61A 1NC4B 2IBZY 2UZXB 3ZKQD 5C6WH 1MRDL 4KKLC 5JW3H 3BN9C 3EHBD 3TT3H 1BZ7B 5SWQA 4YDIL 1CGVA 2JCCF 3GB7A 1KEGL 1QKZH 4XPBH 4LIQL 3W5MA 3G08B 2VXQL 5HGBA 5D2LA 5J1AA 4XPFH 4UINL 1UKQA 5DHYB 1INEH 5I17B 1H0DA 3BEWA 4HCRA 2BRQA 4JDTH 3VFUA 4O2EB 3BKJL 1XT5A 5I66B 5D1QC 2I5YH 3PWNB 5IVXF 5EG6C 1KULA 2Y6SC 4DZ8B 3B6SA 3WIHL 1TZGL 1R3IH 3T77B 1NEZA 4M4RA 5E94A 1G7PA 1OAZL 5D7LD 1YDPA 3IVKB 4M6NL 1D6VL 5HVFB 4QTHA 4PJFF 2UVFA 3IS0X 3WNMA 4H88L 4XC1L 5CS7A 5TDNA 4XVTH 2VKXA 4RIRB 4Y5XA 5IBTL 1FAKT 1G7JB 1CN4A 2ZCLL 3AGVA 1FNLA 4MA3B 4YFDB 4OM1L 3CVHH 4PV9B 2YA1A 1LGVA 1S7WB 3SKNB 4TOYH 1WC7B 2X4PA 1I85A 1JPFB 2ZOLA 1PG7W 4Y4HA 4OCYL 1RHHA 1ZVSA 1RK1A 3PWPD 5J12C 3U4EA 5I1JH 2O5XL 1NGZB 1KTRL 3ILPB 5HDQL 4CMMB 3B6SB 4J2XA 2HT4C 1PZ5B 3U7YL 3ARYA 3QUYB 3MA9L 4KJQC 5FO7A 3PGCB 4JFYA 1TCRA 2AERT 2NYYC 5HPMA 1HNFA 2HG5A 3ABZA 3C87A 3B5TA 4PJBB 3WJLA 3MRNA 1MCSA 2J88L 1B0RA 4J3TA 1R5VA 1FVDA 5I74B 2YEZB 4PJHE 5IOPA 4HGMA 4A2LA 5DT1L 3VW3H 5I16A 4QHKI 4G7VH 1DBKH 1X7QB 1L6ZA 4KKNA 4AENB 3ARGB 4JQVC 5F7NC 4ZDHB 5E8DL 4IM8A 1CG9A 3BUYB 3X14A 3MRFA 3AAZA 1T0PB 4QTIL 4WO4C 3X11A 3C6SB 3PNWA 4MHHG 1QBAA 1M71B 4PRIA 3MA7A 1J5OH 7CGTA 2EYRB 3G5ZB 5D71H 5E5RB 2Z31C 3C5SB 1CI5A 3V6OC 1ZT7B 4MQXC 4F7CA 3RIAF 2VDKL 4YK4C 2RCSL 2NW3B 1SHMA 3P2TA 2R9HC 1TJIL 2Q87A 1OW0C 2XNAB 4JREB 4F7PA 4H8WH 5LBSL 2C4FU 1D6EB 4ORGA 3V95A 3N1MC 1JWUB 4QCIB 2W65A 4Z8FH 4QRRB 3FQTB 3NACH 1JYXA 3KYNA 4MMZC 3WS3B 3TBWA 4ZXBB 5DRWA 3EJJX 4S0TD 1MCLA 4WU7A 3AS3A 1CLYH 3KGRA 1RURH 3MV9A 3MRRB 4F57L 3T0AA 3L3OB 3ET9F 5C0DB 2Q76A 2JB6A 4WV1C 3K46A 3MV7A 4LHUB 4X6CF 3PXJA 4LASL 1MI5A 2Q20A 3RKDD 2PTUA 2PXYA 1NKOA 2H2SC 4LVEA 2CDGA 2OP4H 3DLQR 1GZQA 1TCMA 1TVHA 1ZMYA 5DVOA 2AJZB 4IMLA 1R0AH 3K2UL 1K8IA 4LVHB 5T5NG 4LLUB 5E8PB 4ODHL 1U93A 5INDA 3SDXA 2GYSA 4N0FA 4K3DL 3QNXA 1AGCA 2JELL 3S4SB 1CK0L 1FDLH 3MLSL 1E4XI 1BHGA 2J1KA 4RFOL 1KB5L 4C83B 1KPUB 1QPPA 3WD5L 2DWEB 4WWID 1EMTH 3FT2A 3QI9A 3T8XB 5HHVL 5FCUL 4YH6A 1HK6A 2KZWA 3ISWA 1RUPH 1U8LB 3H9HA 3CVHB 4RX4A 5EO1B 4ZUWA 5HHPA 5CD3A 4Q9QL 5D2NE 5D7JB 3MR9B 1X4XA 5B39A 3GJFK 1J0HA 3KPSB 4NT6A 2J8UF 3OKNB 2DKMA 1MCQA 4PGBA 3P40A 5DLML 4ZFFB 5JTWA 1MPAL 2A6DB 2GTZB 2BJML 4TTGA 1EEYA 4AJ0A 3IDNA 4NQVB 2YA0A 5EA0H 1DE4A 5TDOA 3FB5A 3DHJA 3RRQA 1CGUA 3O3BB 3TBSA 5D7LE 1TVBA 5D2NB 2YBRB 4YPJA 3BUTA 3WO3B 3OPZH 1KFAL 2VE6A 5IROA 5DJDA 3QFDB 5IFJA 4C83A 2VC2L 2WWKO 3IJYA 2D9CA 2JKXA 1NBVL 4TPRL 1FO0L 2W0KA 4OLUL 4IRJD 1FV1A 2R56H 3T0XA 4X5XA 4OCWL 1H3UA 1PGRB 3UTTE 3MJ7A 4K94H 3V6BR 2ICEB 3OKMA 5AD0B 4ZTOH 2MKLC 1ORSA 3UJTH 2ATKA 4TQEH 3VA6A 4MNQA 4PUBH 4DN3L 4R0LB 3VMPA 1UCTA 2J8HA 4MA1B 3WJLC 4M4PA 1RUAL 3QDGD 1ZA3B 1G7QB 5T3ZD 4KRPD 4YXHH 2P5ED 4GMTL 3FO9B 5DS8A 4F9LC 4XHQA 3V5KB 3U7AA 4XBPA 3RNQA 1S9VB 2OLDA 1JPSL 3SCMB 2VL5A 4HHAB 3DV6B 2VKWA 3QQ3B 2UZIL 2YPKA 3T0DA 1IEBB 4BA8A 1YNTB 2PTVA 5LAXA 3UTTA 3EDKA 4BFIA 5C0JB 2QL1A 1NAMB 2PW1A 5TE7L 5HYJB 4WW1A 3NACL 4U6TA 4PP1C 4XH2B 1L0XA 3G5YB 1NMBL 2NY6B 1FFNA 4KGJA 5J0BA 1GIGH 3I75A 4RWYL 2HRPL 3QUMB 1UACH 1IC4L 4CW1A 1MCPL 3HMWL 2IAMA 5DEGA 2XN9B 2AQ3A 2XYCA 5ALBH 2ED8A 1H3TA 4H26B 1BREA 1O7VA 3GDBA 2NY6C 4PRHD 4LNRB 5D1ZD 3FONA 4IRSD 2ZUYA 1KIUA 2BNQD 4HT1L 4HULB 1IGCH 5BVPL 2DBLL 4RMUA 5F9OH 3GRWA 4F2MB 4GW4A 1A7PL 3C08L 2VLJE 3V52H 3LKNB 4PTUB 5C0RL 5F9WC 3BVNA 3S8WA 5KAQF 3IU3A 5IHZB 1JPSH 2EDNA 5DURB 4NO3B 2VZUA 3DIFA 3ULVL 1A6UL 3RUGB 3GK8H 2OZ4L 3DROB 4I3SH 2GQHA 2Y5TA 3OR7B 1BVKB 3GSUB 1E4KA 1GOHA 4JO2H 3QNZB 1YNLL 1B0RB 1UWGH 2FL5B 4R97C 3C60C 1NAKL 3TWCL 2W0FB 5BW7A 1AD9A 5C0BA 1H3VA 4NFCA 1SM3H 2AK4B 4Z9KB 3KJ6L 5D7IE 1P7QB 4LDLB 3ARGA 5F7EH 2HP4A 2CH8A 1EPFA 4FN0A 1XF3A 3DVGB 3U2SB 4GKZA 2BNUA 4IIQB 5EOCL 2DQTH 1CDCA 3QUKB 3DARA 1WWWX 3FTGA 4JDZB 2EICA 3WUWG 3ESVF 1VEMA 4NRZB 4X9HA 3TFKD 3MLWH 2F53A 4FFYL 1E6JH 5J4MA 1KJVA 5I8EA 1OGAA 3QUZC 1DLHB 2P5EE 1FG2A 3IDUA 1BGXL 2H32A 4GT7A 3IDJB 4PRPA 1Q9OA 3S36X 2A1WH 3WN5C 3QDGA 1Q72L 1S9KC 4LAQH 5H94A 4LOUC 3U9PL 5FYJH 1X5LA 3UPRB 2EC9U 3KYOB 2FL5A 1EEQA 3HNSL 1PJ9A 4XCYA 3MFFA 4KRLB 4FTVD 1OWWA 4TRPL 4PRNA 1MF2L 1U8MA 3S34L 2W65B 4POYA 4DKEH 3CCHA 5FGCE 2IMMA 1TETH 1P4BL 4ZXBD 1E27B 3BQUC 3O2WL 5KOVC 2D0FA 2WANA 4JQIL 3UPCA 4KVCH 4OZFB 3T1FA 3I6KA 2R39A 3VXQA 4MCYA 4LHQB 4WO4B 5H8DA 2C7UB 3L3HA 3BZEA 5A16B 1Q8MA 4PJEF 1U92A 4HMEA 3ARSA 1S7XA 2AJYL 1T66D 5F8RC 3R0MA 4DVBA 5I66A 1AIFA 1DVFC 2BHZA 5D70L 4DZ8A 5DUML 2JB5L 3VFSA 1N4XH 1P7QD 3OX8A 5F88B 2P43B 4JRYB 1A7QH 4UIKH 1ORQB 1IZKA 4PJEB 2PYED 1A6TA 4YWGH 2FEEI 4HLZG 1MRCH 4A6YH 1JF1A 1N7MH 3KPRE 4JPVL 4ONFH 2Z92B 1UVQA 4P2RB 5F97E 5GSRB 1CGTA 2CIIA 1QLRA 3BYYA 2ZSWA 4DW2L 3TT1L 2WINB 2G5BB 3G6DH 4TRPH 4LCYB 3B2VH 5I1KL 3ALXA 3BZDA 2EZ0D 3FN3A 2P5WB 3H6JA 5I19L 1TJIH 4L29A 4TTDC 4NKDB 1FZKB 4MAYC 3ARFD 5EBMB 1MJJB 4CBPA 4HBCH 3PIQB 3S3SA 1KPVB 1VFBB 1CF8L 2X89A 4YX2L 1X6LA 3N1GC 2GTWA 2G2RA 2NY3B 2B4CL 4NQED 3VFTA 4XNXL 4UI2A 5ADOL 4FQ1L 5D4QA 3KYAA 2P46B 3P0VL 4Y2DB 5TQ0H 3VD9A 2XA8L 5ISZD 4HXAH 2JCCA 3N85H 1FYTB 3P30H 1OTSD 2O26U 4FRWA 1T5XA 2FD6L 5DHVH 1EZVX 3U36B 3L3JB 4DUXA 2YRPA 3IJYB 1MQ8A 1NGXB 1MRCL 4Q2ZA 3DMMA 2DQCL 5FV2A 2NNAB 3K2UH 1RIHL 1U91A 2FX9L 1BMGA 4EN3B 3ETBF 1RZIB 1JHKL 5EBLB 1WFTA 2IADA 4NO5A 4JDVA 3ARXA 3CMOL 4L1DA 4PD4J 2FIKA 4XPAH 5DD6B 4KRPB 3NA4A 4X6FB 3MGAA 4LSSL 1EO8L 1R6VA 3ZDZE 3S5LB 5CBAA 2BSRB 1S3KH 2NY0B 3MROB 1G6RA 5BVJB 1V3JA 1U8IA 2OJZH 2EDWA 3EO9H 4BSWA 4A6YB 4YQXL 1FFPB 5L0QC 3LN5A 3NFSL 5IBLD 3ILQC 1CLCA 2IQ9L 4G80B 2QSCH 3O4LD 4JCLA 5E70A 4ZFZB 4BH8A 5DMKB 1NGPH 4QRQB 4NHUA 4DEPC 4O2CA 2HVKB 1MVUA 1ZVHA 1DUZA 1JNHA 3MCLH 2VZ3A 4K94C 4UBDD 3NN8B 1D5XA 3RL2A 4X8JA 5CD5C 4KI5C 4NIKB 3LPFA 2ZUUA 2ICWJ 1U6AL 3AS1A 3RAJH 4OCLC 5FF6B 1QEWB 1W0VB 5ADPL 4ONHA 1NCBH 1TZHB 2BNRE 1G7IB 1NPUA 1EAPA 2IADB 1SJVA 1N2RA 3TGXA 1A9EA 3KPTA 3R06A 5EDXA 5IWLC 1A4KA 1FNEA 5BXFB 2W59A 4U1IB 1XGRA 1MWAA 2MCPH 3GSWB 1N59A 3QYCA 3ARGC 4XMLL 1ZGLA 3EOBA 3DV4B 3TZVC 3QEGL 1CU4L 4XPHL 1OAXL 4MNGE 4NN5B 4X9GA 4EUPG 2PF6A 4UT6H 4WJ5A 3W9EB 2X4SA 4N8CL 1UCBL 4JY4A 5DD5L 1OSPH 5ITFA 4FNLH 1Y0LA 2X1XR 1DVFD 3EO1B 1L0YA 4LLWB 4LP5A 1JZ5A 3IJSB 3LDBC 2VNCA 2ADJA 5I19H 1DL7L 3OZ9H 4EN3C 4BZ2H 3S9DB 3QIWD 1YNLH 4G9FB 4JFYB 3QIUC 5HYJE 5DVNA 4ONHB 1GGTA 2UWEE 4HJJH 4HC1A 3OJDB 2H3NA 1LO2L 5HGDA 4ZAKA 4AEEA 3ARBB 3M17B 1QFPA 3RGVC 2ADFL 1S5HB 5GGUB 2QQNH 2PXYD 3QQ9D 5D1XA 4XPTH 3R8QA 5D1QB 5B22A 5GZOD 5E6YA 3P3YA 1AHWB 1RZFH 5E8OB 3FO1B 1OTUC 2VMFA 1IGYB 2WP3T 4LNVA 2AXGB 4Z5RA 1WVZA 4D3CH 4G8GE 4LLDB 4QXGH 4KVCL 4WFED 3BP4A 2VXSL 5GSRA 3AS2A 1AQKH 3IFNH 1AR2A 4M1GH 3S36H 3FCTB 1IGML 5E08L 1KOAA 5DRWB 2V17L 3B83A 1Q9LA 4N0FB 3WFEH 4OZIE 5FFLA 4ZSOB 4U05A 4LFHG 5C0CB 2NW3A 1IC5H 2GJZB 3G5VA 3H9SE 4XT1C 5HHMD 2XNAA 3QIWA 5FUZL 3FT2B 3VG0H 4FZEL 2SEBB 4KHTH 3QWRD 3WNOA 1S5HA 3GSXA 1JNNL 4J4PA 4MJIB 1DLFL 4NQSA 3ARDA 3WHXB 4DGVH 1ZT4B 4NQEE 3GNMH 4IMLB 4EXKA 4OZHE 4N5UA 2IPUK 4PJ9B 4IOFD 1BVLB 5GS0C 1NFKA 3EYQC 4E5XA 5KG9B 4ERSL 5I1IL 3BEVA 1NAMA 2YPVH 3HG1D 3HZMA 4WU5A 2HN7A 2QV2A 5C0EB 2DQTL 3O6MH 1NQBA 1TPXC 2MCG1 2K1MA 4HWEH 3CK0H 5L2JA 3SDDA 4ZPVB 1U8QB 4C56D 4CMHC 1F4XL 4UB0L 3D69A 3LMJH 2CIIB 3BPLC 4XNMA 2YXFA 4FTVE 4JRYE 4PJDB 3QNYA 3RPIB 2WINA 1U8HA 3RA7H 3UTOA 5B39B 5SX5K 4JO4L 4FZ8L 4Y19D 4HUVA 4YDVB 3WDHA 3L1OL 4ZUTB 4PJIA 2R2BB 2DQGL 1A4JA 2QQLL 3D3VE 4C55A 1JYWA 1YEIL 1QLEH 4HJGA 3REVB 3D39D 5CZVL 5KS9A 3QIBC 1JHTA 2OZ4A 4WI5A 4CN1A 5FYKE 3LSOA 4KJPC 4PR5A 2ZJSH 3EDEA 1T1XB 1T03H 1FL6A 1VPOH 2VDOH 3QXVA 1QBMH 3UC0H 4G8IB 2XT1B 3QFDA 4FG6C 1CLZH 1UXSA 5EC1B 3IDGB 1TFHA 3OR7A 4LGSB 2R69L 5KSBB 3BO8A 4WFHE 4HKBB 4MNHA 2YN5A 4F33B 4HWZA 3VFMA 3O6FD 3EYSL 1NBQA 4FP8H 3UTTB 4BFIB 1OAKH 5EIQA 1KELH 4ZFOB 1KENL 4APQD 1U8HB 2F5BH 1EVUA 2Q7YB 4JN2B 4I48B 4P99A 4XH2A 4BSVA 1T20A 4PV9A 3VG9C 3I75B 1ZT1A 3GM0A 5IMOB 5DEFA 3FO9A 5FYJU 1CXFA 4QYOB 4NO5B 1NFDE 4KPHL 1YUHB 3DHMA 4K2UH 5KSVB 4H26A 4JFFA 4M1DL 5H35B 2X1OA 2NY2C 4NRZA 4JAMA 4Y2DC 4ZOEA 5D6DA 2YD6A 3TO4C 3QIUB 2DRUA 5GGSA 2GAZA 4K7PL 4UNVA 4X80H 1Q9OB 3UYRL 4MLIA 3OKDA 5I1JL 1NC2B 1MHEA 4H25A 1ZA3A 2XWJA 5C08B 3BJLA 2AV7B 2FJGA 3MYJB 4YXKL 5C0IB 4QRUA 1K6QL 2FNBA 2XRAH 1YYLH 4XWOC 5DJ8B 5E2UH 4UAOC 2MKWA 1MCCA 4QTHB 4DAGL 3OKKB 3FRUA 3HKFA 3CFCH 2DLTA 3IU4H 3HN3A 4GMSH 4YNYB 3ULVC 3HUJF 3CZJA 4NC2B 4CRPA 5DEFB 3MJ9L 2V2WA 3SDAA 3BMVA 5DRNA 3I9GH 5TE4H 4YBLB 1OP9A 5EBWA 1EH9A 4OT1L 1D9KB 5T1KD 4JCMA 1XGQB 5KZCD 4Y1AE 5EOCH 1KNOB 5GGRY 4XNYL 3MXVH 5BRZA 1ADQH 1I7RA 3V4VH 3VXTB 3C2AL 4S1RH 3VXMA 4BKLB 4JZJB 2NX5B 1Z5LB 2H6PB 4GQ9H 2FEDD 3VE0B 4ALAH 1A6VL 3NGBC 5BV7H 2FHFA 4IS6B 3FT3B 5ICYB 4OZIF 1C08B 2VERN 4WJ5B 4PREB 5ISZB 4NYLB 2XKUA 1U8KA 4FZ8H 4YEEA 2O5YH 2I9TB 2IG2L 4S2SA 3GGWB 4POUB 3LKNA 2D7QA 4NM4L 1KEGH 1JWUA 4OLVH 4I8DA 1V3KA 5FHBH 1ACZA 4ELMA 2ITDB 4ELKB 4Q9RL 5BMFH 2ITCB 2WUBL 2FSEA 1RJZA 1R3KB 4XP1L 4MD4B 4YEFA 1MUJA 4WW2B 1JZ4A 1PSKH 4F8TA 2HKFL 2BC4B 4NQXA 5T5NF 3BN3B 4M03A 3ZDXF 3EGSA 2Q76B 4U6HA 5EOCJ 4EDWL 1ZEAH 2FGWH 2JB5H 3STZB 1Q0XL 3V6ZB 5D1XB 3QCTH 3CUPA 3LEXA 4HIXH 3DXAE 3DGGA 3VXPB 3HFML 3MODL 4G43B 4NUJB 4RGOL 2QQKL 2DQEL 4ORZC 5I30H 3WLBB 4NCC1 4PJIE 4UMGA 4E42B 3QNXB 3JV4B 1DANU 1XH3A 4U4BA 4UV4L 3ZSSA 1BBJB 4AIXA 3LS4H 3EDDA 1QBLH 3CPLA 3I6GB 4LBEA 5C2BL 1VACA 5I1LA 3H3KA 2HFEB 1DSFH 1ZLVH 1M7IB 3OMZA 4MNGA 1ZLWH 3WD5H 5FDYA 5JO5A 4PFEA 2BVTA 4FTVA 1ZGLM 2AJVL 4EOWH 4GG8B 3VH8G 2O93L 4FNLL 4PJAE 5EUOB 2IFGA 4WWKB 4EKXA 1UB6A 1W8OA 4KZEH 5AZEL 1U8NB 4U1JA 1VA9A 5IM7A 3IDNB 4NKDA 4NHCH 2XTLA 5AG8A 3ZYOA 3BH9A 2J8OA 1HQRB 3VXPA 3EOTH 1RZ8A 3L3OA 2E9WA 2ICWB 1S7VA 4G5ZL 3TBSB 1IARB 5KVMC 4HS6B 3DRQB 4OF6A 2Z8SA 4BELD 1UVQB 3D18B 1QO3B 3VFMB 3EDJA 1K2DA 1S7TA 1Y18A 3IAQA 2XKSA 2FD6H 2F74A 1OARL 3QFJE 1NLBH 3NCEB 1MHHA 3KYKL 4NPYB 5EZOH 1HSAA 1T20B 1BD2A 3MJ9A 5DYOA 2ZCHH 4L29B 2LU4A 3T3MF 3KPLB 5A43C 2WBJD 1ORQA 3PP3H 4Q2ZB 4BQCA 5CBEB 4LLVA 5EOTA 1D5IL 4OF7A 1KXTB 2VLKD 3INUH 1S7UA 4KKAC 2IBGA 5DC0A 4M7LL 1QFOA 1Z0MA 4ZFOL 1F11B 3KYMB 4HDIB 4HJGB 5IROC 3QRGL 2GAZB 4MAUL 3L3IA 4OIAA 4HMDA 4TVPH 2VZTA 1QSED 2P5WA 3MOBL 5I8CB 1DFBL 1ZHBA 3RHWK 1GC1L 4EIZC 1A7OH 3L3KB 1HHIB 3TT1H 5LGHL 1AD9B 1H3PH 1SJEB 1WK0A 4NWUH 2AK4E 2F53E 1PQZB 3RAJL 4XP9L 4FQLL 1JGVL 3ULUF 2JTDA 1YQVH 2FX7L 2IFFH 4C57C 4JFPB 5FYLE 1NSNH 2A6JA 3EYOB 2AXFB 4F9LA 5KSBE 1NGZA 3MRDB 1JZ2A 1YMMB 3CH1A 4FFZL 5EO9A 1H5BB 2FGZA 2XKNB 1JHLL 3QUYA 2VLRD 4WHTA 3QP3A 5KSAD 1YUHA 2EXWD 3GHEL 1DLHA 4MNQB 1ZGLP 4OJFH 1D9KC 3O6FC 4OGZA 3PABA 4ZOCA 4LLYA 3MQIA 3QIUA 3SGKA 4GG6F 1H8NA 2V5SA 5KVGH 5AUMB 5JLZB 2BDNH 3MLZH 5F3BA 3X13B 3ILPA 5CZXD 4LDEB 1P84K 2YOCA 5D1ZC 4G9DB 3RNKB 5ETUB 4MD0A 4LIQH 3CXDL 2FJHA 5CEZH 1N5YL 3MLTA 5F1KC 3TBYB 5IEKA 1U41A 1MH5A 3C8DA 3OKLB 2W0FA 4ZDHA 4EI5D 3WLWC 1U36A 3TH4T 3A6BL 5F7HA 4OLUH 4Z7WA 1BIHA 4KRNA 5ACMA 2N7AA 5JOEA 4FQHA 1IEAA 1UZ6E 2HFTA 4C56E 4WV1B 2R69H 1SYVA 1MWAB 3B9KD 4OZGF 4J3VA 3O9WD 5ID1B 2QSTA 3HG1E 4Z76A 2FWOA 4WTZG 5GRVL 1QA9B 4M48L 3FONB 4LU5L 2UY7A 3E6FB 1NEZG 3MLPA 4QLRA 4P5TD 1CE6A 2WUBH 5DZLA 1WZ1L 1EDQA 4GW4B 4R90L 4PGDA 4UU9A 3RDTC 2CMRL 1I1AA 2WIIA 3VRJA 1Q9KB 3NABL 5DO2D 4XMKH 3HTLX 1J0YA 1A1OA 4E0RB 3MBEA 1CS6A 4S10A 1G9MH 3HC4H 1JTOA 5C07E 5CJXA 4HUKB 1QTYT 4RX4D 1CFSA 4GBXA 1T0NA 4ZD3L 3MO1A 5HHOA 3BKCL 1JNJA 2UWEA 2ED9A 5CSGA 4R96A 2HJLB 1IAKA 3TIEA 2XWTB 3FB6B 3MLVL 3IETA 4HG4J 1Q9LB 3CZFB 2I24N 4WTXA 3F7PC 1AGEB 1CDHA 2PW2B 1LP9F 1F58H 4YDJA 5D96C 3A67H 4N0YH 1IMHC 4HT1H 3BISA 1EGJL 3SE4C 4YHKL 5KJRH 1IFHL 4QRRE 3ZDYE 2R4SL 3M17A 3T4AB 2CK0H 4OLWH 4XP9H 2XG5A 4CUCA 3VXUD 3MRBB 2Q1EA 2R4RL 2MPAL 2ZUWA 1R3JA 1WWBX 3EOAB 4CKVX 1MHPH 3ES6A 5D7SH 5I1LB 3MO1B 3FQRA 4LLUA 4YHYC 4L8DA 5HYSB 1Z3GL 3UTPD 1QRND 5CBEA 4EZMA 4PGEA 2P7TB 4ZO7A 1FPTL 5I1CH 3MRGA 1AE6L 1GGCL 5L8JB 2ICEA 2DQJL 4N0UE 4UUJB 1E4WH 1NDGB 2EKJA 4RFEA 1I3RB 4PRPE 2BNQE 4L4TA 1M1SA 3TV3H 4NQEB 5FYJE 1OHQA 5CKAA 3TNNA 3DO7A 1F58L 2HMID 1J12A 4YHPA 4FS0A 1AGBA 3RZWA 5HDBE 3OKNA 1RZJH 3CSYA 5FKPA 2BY1A 3B9AA 5AWNH 1S7VB 3GM8A 4YHIB 1I85C 2V5RA 2BVQB 3IXTA 2J8UB 4CDHA 2F8XC 4MAYD 5IB2B 3DECA 1CQKA 2VLMD 4G6KH 4M5ZH 3KJ6H 5KW9L 1AKJB 4CADA 5DXWA 2ATKB 1Z9LA 2DIAA 5I73C 3DYOA 3QCUH 1CCZA 2VO5A 3WSQL 2BP3A 3H8NA 5CCKH 4X6BA 2R2BA 5C0ND 3O6LL 2OP4L 2KDGA 3RWDA 3MJ8B 2XN9A 5A2FA 2Y07H 5DJ0B 3WLWD 1RIUL 5A40E 4YLQT 3PWUB 1I7RB 4XX1E 4LLYB 5DTFB 5IMOA 2X4SB 2EC8A 4PRAB 4P4RB 4PBVC 4WFGD 4F7MB 5ACLA 5BVJA 1ZTXH 2EE6A 2D0GA 5AZ2L 1JK8B 3ZKND 5BQ7B 3GI9H 3OKYA 3KPOA 3NH7H 4QRTA 3JXAA 4YZFE 1F42A 1KB5A 1T7VA 3QUML 3D0LB 1UADC 3LPGA 2WBJC 4ZD3H 1MH5B 3OKLA 5DWUL 1KXVC 5I1GH 3WFDL 2HVKA 3QHZL 1NGYB 1MFBH 1G6VK 3QIBA 2GSGB 3TIDB 1QBLL 4BSVB 2E6JA 4Z7WB 4I2XE 2XWJB 1A8JH 1BLNA 4BYHA 3OAZH 1FL6B 3G5XA 5EUKA 5DD1H 5JPMA 1CGSH 1DDHA 2WBKA 5GGVY 5C0BE 5HVHB 2Y25A 4L9DA 4KWUA 4XXDA 3ULSA 1UWEL 3AM8C 2P48B 3F12B 5F1SA 1KJ2A 4KGLA 1K3IA 4UT9L 4R26L 2J8UE 3BSZH 1KJ3H 2IH1B 1S5IL 4N90D 5DJYA 3DGCR 1CIDA 1UM4L 1JFQL 2HYMA 1A7NH 5IMLB 3KNBB 3QHFL 4JLRB 4YFEA 4UQ2B 3FTGB 3LPWA 4M8QB 1KYOK 4D94A 2VXTH 2E6QA 4N0UA 3E1F1 3D0LA 4DZBA 4TSCL 1D5IH 5I74C 1SM3L 2DI8A 2RIKA 4OLXH 5SWSB 1NUNB 2GJJA 2GSIA 2VJXA 3C8KA 4Y19E 3O3EA 1OB1A 3CXDH 4EI5B 4G9FD 4HBQA 2Z8WC 3EFFA 5I75B 4MQXD 1BQHB 2V2WB 4TULL 1A9BB 2QTEA 4Y16D 1IBGH 4X6CE 2DJ4A 3TZVA 3ARBA 3MLXH 4OKDA 5DGRA 4Y1AB 4HV8B 5J12B 3D2UD 3FB7A 1BOGB 1T5WA 3B8SA 1VKXB 3OJMB 1BVLA 3T1FB 1D7FA 1MFNA 5TQ2H 3PNWB 3UTPE 3BPCB 1NLDH 4OSUH 4X9BA 3SQOL 3QDGE 3VFNB 1U92B 2APWA 2EDRA 4LLMA 4PJHA 4P4KC 4DVBB 4HUUB 2I9LA 1Q0YL 2JJWA 3DURA 3FB8A 1X5YA 5EU4B 3MUHL 3WIIL 2Z9TA 5T3XH 5K9KA 3LN4B 2ZOKB 1NCWL 3HZYB 3LH2L 3PJSA 4XAWH 3NCBB 5E95B 4GRWH 5T1LA 3CC5B 1F2QA 1OB1B 4JE4B 1FE8L 1XIWA 3B9EA 3ZTNL 2OL3L 4ZSOA 5C07A 5AEAA 3QDGB 2NR6C 1D6EA 1FSKC 2YWYA 5CMAB 3S36L 1A6UH 1CYGA 1HSBB 3I6GA 3MLZL 1IILE 4ZNEE 6CGTA 2HJLA 2EYTA 4Z78B 4UOJA 3UTSB 1GAFL 3MZGB 4QRSA 3LDBB 3WEXB 4WHYG 4G7YL 3FQXA 4PBXA 35C8L 1G7HA 4RAUA 3EOTL 3BPCA 2BRRH 5TGBA 1SBBA 1IQDA 1NUFA 3RTQC 3ZLQC 4LCUA 1U3HD 3UJIH 3HE7A 2A38A 5L6YL 3AU1A 4X99B 2DLEA 3PWLB 1IL1B 4J6RH 4Y7MA 4NN5C 3RY6A 4LOUD 5IR1B 2F54A 1MY7A 3QDJB 2ZUQB 4R4NC 1QZ1A 2Q6WA 2BOBA 5DJXA 2C1OA 2D31A 4HK0A 2OQJB 4K07A 3OV6A 1DQLH 1Z9OA 1PQZA 4PRHB 1IGYA 2Q7NA 1AO7A 2RAMA 4C56B 1UXWB 3D39E 4GRWF 1GHFH 5LKNA 4L4VD 3SBWC 5CJQH 3RVVD 2VDML 4PB0L 4TVSa 3PQYE 5FYKD 4IRZL 4ZTPH 5J9PA 3GMPA 4WFEE 4QHKJ 1AC6A 1I9RL 5DQJA 1WISA 4I18C 4HCRL 3NFPA 1M4KA 4M7LH 5T5FH 1H15A 3PWUA 4Y5YA 1FO0B 3QRGH 1KTDA 1X6NA 4UT6L 1FN4B 3WDIA 2VDKH 3JV6B 1KCSL 2GEEA 3HE6C 4AYFA 3A0OA 4JDVB 2DQGH 2APTA 1JGDB 2NX5D 3BDXA 3W0WE 4AEFA 3N9GH 2A6DA 3REWB 3AS0A 4NRYB 3LN9A 4GRWB 4HFUH 4O2EA 1VGKA 4EQ2A 4MA8L 2X09A 4XC3L 5HHOD 5FCSH 1OM3H 4KRPC 5IM7B 3O3BA 3RZCD 3C5ZA 1SJHB 4L3EB 2P44B 3O8XA 3QR2A 2V2TA 1GL4B 4QRQA 1DQML 2V7HA 1RUQH 5HI4C 4HUXB 4TTDD 1KB9K 5JW4M 1UZ8A 1T89A 4AIOA 4FG6D 2JJTA 4YGVA 3WCYA 5AG9A 4MXQC 3VXMB 4BKLA 1G6RB 4JKLA 4YXLH 5HHMB 4U6YA 5J7CC 4HKJB 4MS8C 3IT8D 4NSKA 1FLRL 2JCCE 4HS8L 3KLDA 4V1DE 5EBLA 1A14H 1E0OB 4XBPB 5MP6L 2E7HA 4NHUB 5C7XH 2FIKB 4J3SA 5DD6A 1KYOJ 1FCGA 5F9WB 3BWUC 1I9JH 2W0LA 4U0QB 3NPSB 4G8GD 2DS4A 5HI3C 4F7PB 3DXAA 4QWWD 1RUQL 2R4RH 1FORH 2X41A 1RJZB 1FQ9C 1LK2A 4X5WB 1ZHKA 3C6LA 3WFDH 2QR0A 4CL7A 3LN5B 1KIQB 2XRAL 5FGCB 1RU9L 4PY7B 4YXKH 3BGAA 4LKCB 1J8HB 4M61A 3VWJD 3V6ZA 3OAZK 2G9HA 2DLIA 2JK5A 4NKOA 5FUOH 4XCFL 1FZOB 2MTPA 1AP2A 1CG9B 3BUYA 1EHLH 4Z7OF 5EIIA 4ZUVB 3VE0A 5C09D 5DJCA 1E28B 5DHVA 3MJ9H 3X12A 1YMMA 3KPQA 4OZ4A 4X7CC 3O6LH 5K9KB 1C12B 2N1KA 4D0BA 1RIHH 2BVPA 3Q5YA 5ELIA 4OFIA 1FZMA 3I50H 2LU3A 1Q9KA 1YEDA 3GEWB 5ID0B 3VGGA 1B0WA 5HYEA 3CSBA 1R24A 3Q6GL 3RWCB 1NFDA 2F8OA 3D9AL 3EYFB 3BKML 4KU1A 4W4OA 4LVNB 4XB8A 3GHBL 3C5ZD 2R0KL 4EI6A 4LPYA 1U8LA 2DM3A 3H9HB 5ETUA 2Q3AA 1QSEE 4G8FB 4KK9D 5IT2H 5C86A 1TZIB 3MUGB 1IQDB 1KV3A 5JW4R 3PQYD 1KIPA 4YHKH 3LS5H 3HE7B 2QADC 4NJAL 1IM9A 1KCRH 4FQHB 4LPXA 4TSBH 1NCBL 3WLBA 5HGHB 5IGXH 2HT3D 4LEXH 5SWZD 5TPWH 5CJ5A 5F1OB 2ZPKH 1HHKA 3RL1A 1KENH 2OSLB 4KJWD 3OF6A 3UZEA 1Q38A 3DYMA 3HE7C 1AJ7H 4IIQC 3VG0L 4HKZA 5JR1L 2Z31A 4MQTB 1DEDA 1IZJA 1EFXA 1C16B 5DRXA 3I02B 4Z7QE 1TTUA 4PGJA 3UYPA 1AGFA 4ZODA 3MLSH 1A14L 5F93C 3GSOB 4TVPL 1ZT4A 3NABH 2W91A 2QHLA 3QXAA 3FRPG 3O2VH 3P0GB 3MXWL 2M2DA 4XTRC 5GZOC 5I18L 4LPVA 3DX6A 3QIWB 3BZEB 3IFLH 3EO0B 4OTXL 2KL6A 2J2ZA 2NY7H 3HLAA 4PJ5D 1HHKB 5D5MF 3F6LA 2FX7H 3H9SB 2HJKB 2ADFH 2EH7H 1I3GL 1HZHH 3GBMH 4ZTOL 4JO3L 2PNDA 4PJDA 4U6XB 4CJ1A 1T7YA 1HWHB 4EEEA 1F8TH 3MX0A 1R3LA 2BK8A 1BD2B 4L4VB 3UO1L 5A2KH 2BY2A 4ZS6C 4PJBE 4N90E 1F00I 1MWAL 2NY1C 4KDTC 1NCDH 3GBNL 2HN7B 1CDBA 2CRYA 5EIVA 3GMPB 4JFEB 2IPTL 2BY0A 1EAJA 2NZIA 5I8KL 4HXBL 3PV7A 1WJ3A 4JFZH 2WSKA 3G08A 3P73A 5BV7L 5FM5O 4KXZH 5DMGC 2BDNL 3IKCB 4GG8A 3T09A 2DI9A 3NIFF 4PJGB 4KKBC 4XRCA 1CE1H 2O61B 3U0PB 4OQTA 3S4SG 4QOKA 4XMLH 4EIGB 5HHNB 1CFVL 4P2RD 4ZO6A 1MAKA 5HDQH 4X4YB 4FXLA 2J7LA 1IC5L 5JW3L 1ZE3C 1RUMH 4CADB 5CJBA 2GSIB 3K7UA 4BFEA 3P4NB 2YPVL 4GRMA 3U0TA 4CVZA 2VQUA 5LAXB 4OCRH 4ZS7H 3GIZH 3VW3L 4O58H 4Y5XB 5JDSB 3EKCA 3GNML 2X5PA 1RJCA 4OM0L 3V4UH 1LP9B 1P7KB 2AJXH 4OIBA 2LTQC 1YN6B 5IFHL 4IRJA 1LDPL 4K7PH 4JHAL 1FVEA 1KN4L 4FQCL 4P4RA 5GGRA 1AY1H 1K4CA 2OTWB 4XBEL 4Z95L 1JK8A 2LVEA 2KUTA 1JFQH 5D2NC 5J3HC 5BW7C 4Z7NE 1EUUA 3T4YB 4X6FA 1M05A 3HPJB 4X0KB 5DFWH 4M5YL 1L7TH 1R5IA 2HLFD 3LIZH 1KPRA 3DRTA 1A3LL 5JOFA 3VFVA 3CVHL 1YEDB 3KLHC 3B9DA 1CL7I 2I25N 4UIMB 3V79C 3U46B 5DK2B 4RGNE 3BX7C 4M1CD 1WAAF 3S98A 2APBA 1DUZB 1NGQH 1RFDH 1OOAA 2VC2H 3RIFF 4MA8H 3KLSA 4YDJB 4HIHB 2VDOL 5ID1A 2NX5A 2D0HA 4WW2A 3THML 4PJXB 1C5DB 3SPVB 3BIKB 1XF1A 4G5ZH 3FAXA 3GMNB 4BK4A 4M3JA 5F7DA 3ILQD 2W9EH 1RURL 3DMMD 3EIFA 3INUL 5E2WL 4K8RH 1D5ZA 1GGBL 4XP4H 1I75A 5CEYA 3Q6GH 5EBWB 2AV1A 3QG6B 3KPQB 4OZ4B 4X83A 2NY5C 1UG9A 2BOCA 5BMFL 3VXSB 4XGZB 4HGWA 4NNPL 3BEWB 3C60D 4NKMA 5SWSE 1I8MA 2EH8H 2Q8AL 1LNUB 1LE9A 3B3IA 4PJEA 1MNUH 4LHJB 2PR4L 4IS6A 1U58B 4YC2C 5BS0A 3TT3L 4PBWD 4FQXD 3FQUB 1DVFA 3G9AB 4G6AC 1YPZA 4R90H 3C2SA 2EDTA 4FQ2H 3UYRH 2ERJB 32C2A 4JFDD 5C7XL 1OD9A 3QISA 3BP7A 2UUDH 1ACYL 5JDJA 2P42B 5D5MA 1N0XL 3SKJL 4XAKD 3L5WA 3T2NH 4WFGE 4YR6B 1HILB 3QULA 3ZHDA 1C5DA 1KB9J 3UJIL 3MOQA 1PAMA 1YEFH 4GRLC 1ZANH 3U83A 4OT1H 3SKMB 5CEZE 4KDTA 3FFCE 1NAML 5HD8D 5L2KE 2CUMA 4ZYKB 4OFPA 4RA3A 1DQQB 4PJAB 4RAUB 3ULUD 2BMKA 1UA6H 3BDYL 4DGYH 3VGAC 1F5WA 1W72L 2FZ3B 3VXOA 4X8XA 5C0GB 4NDMB 1F6AB 1AHWA 5T1LB 4MDJB 1J9CT 4YAQB 1P1ZA 3SEPA 3D5OF 1U8PA 4JPIA 3BMWA 4IRZH 4XVJH 4FQ2L 2OS7A 4LARL 1ZSDA 2A0LC 2HKHH 1GHFL 2GCYA 3MRMB 2FHCA 1TQBC 4P2RE 4L8DB 5EORH 5H2BB 4ZMAT 4HK0B 1A6TB 3MJ8A 2V17H 1ADQA 3GI9L 4K7PY 4TVPD 2Y06H 1JMZA 3WFZA 4LSPL 4OLVL 3O45A 1QFWH 1HXMA 4U31A 1AO7B 2CO7B 3D0VB 3WEXA 2PXYB 1JGUL 1AQKL 3IFNL 5CIPA 1A3QA 4KRMB 3WBDA 1VACB 2GJ6B 4XCNA 5FUCE 4BJLA 1T1YB 2UYLB 3SDXB 1CL7L 4NQDE 4P3CL 4F7TB 4GW5A 2K9UA 3VA2C 1M6OA 4J4PD 5E03A 5MEQA 1X5HA 1ZANL 2VQTA 4PJ8C 1HYSD 4XBGB 1NCDL 2C4XA 1FN4A 4AL8H 2DQCH 5TDOB 1F4YL 5ECJE 3IAGC 2C3VA 3MGOA 3ARTA 4KQ4H 4WUUB 5LGHH 3LHPH 5MHSE 1HZHL 3GBML 4JVPA 3LB6C 2JJSA 3P0VH 4LGPB 1R3LB 1RZ7H 1IL1A 2HLFC 2L7UA 4XP6H 1FFOA 5IIEA 5DMYA 3VXUE 5T33H 4J1UB 4PJ5E 3RWDB 1M7DA 4BUGA 3ARPA 1V7NH 1P5VA 1FIGL 4QRRD 2E7BA 5F7UA 2EDEA 1SBSH 1WQVT 2VH5H 1II4E 1RZGA 3BZFB 3TJHC 1XR8A 2JIXA 5E4EC 1KCLA 3UPAA 1M6OB 1B9ZA 1A7BA 4K8RC 4XRCB 1KACB 4IRJC 2AI0L 2C3HA 3I9GL 5TE4L 4JKMA 1A7PH 4L9LA 4MAYA 1EK3A 1XGUA 5FOBB 1U3HA 4XNUH 4AK1A 4AG4L 1KIRB 5D7KD 1UEYA 5SWZE 1EGJA 2DLFH 2IALA 5ANMB 1AXTL 3MLTB 1R5VB 2DL2A 4GUPA 4PJFA 2RFXB 5DURD 1NEZB 5EU7C 4ODWB 1Q0YH 1JVKA 4R2GC 3OB0H 2EDQA 2EXYC 3BIAX 4JN2A 2WMPA 4KK8D 1IGJA 4ODTH 3VD5A 4MJID 1NJ9A 3PGFH 5ACZA 2YD3A 4GW1A 1BIIB 3HNTL 3PABB 1VFMA 1UH2A 2OR8A 2P8LA 4NBYB 2AABH 2J5LB 5DJYB 2VR5A 1LO4L 3N1PC 4M93C 4Y4FD 1IM9B 2FGWL 1KN4H 4YBQD 5F96L 5EU4A 3QUMA 3P9LA 4POZC 1I9IL 3QPQC 4DOHB 1S7WA 3SKNA 5KOMC 2R29H 3HG1B 4L4VE 2GUOA 2HKHL 1YY9D 1RHHB 1ZVSB 3D85A 3VI4E 1MF2H 3BP6A 4LVOB 2X6MA 5FGBC 4JZOA 4QHNA 5FYJL 3IDYC 1BVKA 4P9HH 4M7ZC 1YPZB 1MFDH 2RFXA 4AT6A 4D0BB 3HS0A 1EX0A 2K7PA 1NGYA 3BVNB 3MNZA 2X44D 1F90L 3FHQA 4EVNA 4X6CA 3WO4C 2NXZD 1DANT 5IG7A 4NC0B 3LS5L 1MCWM 4E9LA 2NY0C 4PPTA 2ZG3A 3MLXL 4IIQA 5AWNL 3OKMB 5AD0A 3ECBB 3GSRB 1AD0B 3ULSB 4J3WA 5HGDB 4LKXA 4PY7A 2VLRA 4I3GA 3BFOA 1I1YB 3MBEB 1RU9H 1CICB 1TTGA 4U0RC 2AK4A 3TBVA 3TWCH 1J0KA 3LQMA 3SKUD 3CFJB 3BGMB 1C08A 1QNZL 4J4PC 4JM2B 2DQDL 1JIBA 4Y2OA 5D96B 3VDBA 2IANB 1XGTA 2DQIH 4Z7WE 2C5DC 3FN9A 1FRGL 1MCRA 7FABL 1JP5A 1P9MC 3LKQA 2VLJA 5JOPD 3D0VA 3VXSE 4Y5VC 4A6YL 2M1KA 4JFHD 2VISA 4LSTL 2X9XA 4NM8H 1W72B 4Y4KB 5HGAA 3FCTA 4EVNB 2VOTA 4XVSH 1OWRM 2VABA 1JJUA 1EHLL 1ES0B 1IGFH 4K7FA 2A9NH 3HB3D 3VWJA 1G7QA 3IFLL 4TUOB 2CDEB 3ULUL 1LD9A 5EZLB 4LASH 5MEOB 1MFAH 1MELA 3SCMA 3EZ8A 4ISVB 1RFDL 1UM5H 4GSDL 1A47A 3STZA 5BV7C 4XNQA 3WN5B 1NANI 5CWSB 2FIRT 4OFYA 1JF6A 1RK0B 4QGTA 3ROOB 5D6CB 3TCLA 1KIPB 3E6HB 1UACL 3IDGA 1UXWA 1YMMD 4HUXA 5GJTL 4WENB 5GISH 1UFUA 4DK6A 1CDGA 3T4AA 1DFBH 4U7MA 4L5FH 2PYEA 4ODSH 1GZQB 3QG7L 1FV1B 2HFEA 4H8WL 3EZJB 1R3JB 2VABB 1LO4H 1CFQA 1JZ7A 3MRLB 4NQEA 5M95B 5KZCB 1AXSA 1FYTD 1KTDB 3VWJB 5DR5H 3PHQA 1BWWA 5CMAA 1TMCB 5BZWB 1RAMA 4WNQA 1MJJA 2IGFL 5IB4B 5C70A 2CUIA 4M6AA 1ZHLA 5D71L 3NZ8B 2NZ9D 4HW6A 3MRGB 2J8UA 4HKXB 5T1DL 5TQ2L 4W4NA 5AAWA 4TQEL 3L1OH 1PKQB 2L0DA 3E8UH 3RNQB 4NO3A 3SDXE 1QSFD 3BD5A 1OAKL 2PCPA 3WJJC 4Y4FC 1N3NB 5JOFB 4KUCD 3BWAB 2J6EA 4POZD 2OXGA 1OAQH 4DGIL 1U6AH 1OARH 3QDJA 5KVDH 1UXSB 4HLJA 5CGTA 4Y5YC 5DK2A 3MRQB 3V0VA 1OQXA 2OQJA 4OGAD 1HH6A 3MLYL 1I7TB 4PRHA 3LQZA 3GSNA 5T1KA 3TVMC 3WUWA 5F7WC 3Q1SL 2VAJA 2P8LB 3AB0C 4APQB 3TF7C 3F7RA 4XPHH 1FNAA 4QO1A 4S1QH 1XR9B 4HFWA 3U0PA 3P4MB 1E27A 4Y5YB 2FECL 5JMRA 4LSPH 1Z9MA 5DD0H 5GGRB 3OAYK 4JPWL 2OL3A 3CFKB 3D85B 1WBZA 1U8IB 1MOEA 4WO4A 1Z3GH 2HH0H 1CGSL 4MD5A 3DUSB 4QXUH 4R8WH 3CFDA 1SEBA 1DBKL 4G7VL 5B3NA 5K9JH 1IC4H 5SWSA 3PL6A 4OFKA 3RJQB 3ARUA 1N6QL 1HE7A 5HHNA 1LO3L 5C6TL 4WHYH 3QB7C 1E6OL 3MRPB 1MFAL 2W9DL 3S97C 1YA5A 4PY8I 3DXAD 3JTSB 3RPKA 1UM5L 1EZVY 1JF1B 3B4NA 1JRHI 3QDHA 4LF3B 2F9BT 2NY2D 1B2WL 3P4NA 3TN0C 3PWPB 2D9QB 2IWGA 3G5XB 4JZJC 4LKXB 1VADB 5A2LH 5D7LB 3G04A 2D7MA 1PX3A 1EO8H 3W11D 5IESH 5AYUL 1DP0A 3SOBH 2NX5E 3W0WD 3V5HB 4WUUE 1A02N 3WE6A 4WEBH 5EBMA 2WIMA 5CJOH 1KUMA 5FHBL 3OHXA 3NCMA 5E8NA 2PR4H 3CXHK 4KMQA 5E9DD 1SQ2N 4OM1H 1EFXB 3QH3B 2X4UA 3D87B 3VWJC 2Y1VA 2CIKB 3HHRB 3MNVB 3SDCC 3LH2H 1M71A 4PRIB 5E7BA 5CP7B 4FABL 5H94B 4D3CL 1YDPB 3IVKA 4K94L 2FATL 5F3HB 2HAZA 3VD3A 1VEOA 1H8OA 5TQ0L 5MENB 3DX7B 4IEFB 2ENYA 5DO2C 2Y5TB 1YEFL 4PLJD 1MAMH 4PJGF 1T1YA 5ALCH 5FAAA 5I1DB 2DICA 4I5BA 3TO4B 4KMTL 3CFBB 3EO0A 1BFTA 4NNXB 1DQDL 4JG1H 4Q6YA 4FQ1H 1LWRA 3MV7E 3IJSA 1XZ0A 3WE6B 1OQOA 3RWJA 4GAJL 2ZWLT 4WFFE 1QA9A 4G9FA 2EO1A 5DT1H 1L7IL 2E5EA 5EB9A 1UB5A 1GPOH 4K9EC 4P2CG 4BZ2L 2O5ZH 3MLRH 3PDGA 5CEXB 1JGVH 4P9HC 5BS0B 4N68A 3WXWL 3I2CL 1KJMB 4N8VA 2Z31B 1I9JL 4QOKE 3TNMB 5HYQA 1RUPL 1N26A 1F4XH 1I8IB 4UB0H 3S34H 5EORL 3GK8L 1HSAB 4NZRL 3VJ6A 4JGUA 4YHOH 5F9JB 2FRGP 5D1QA 3O3AB 4YWGL 5FDWB 4WNQB 4HK3N 3V6FA 1XIWB 1KLGB 1ZHLB 2X4OB 3KXFD 3GSXB 5CIPB 1Q9WA 2BHUA 4OCSL 1X3DA 4HJ0C 1TZIA 4LPCA 2ZNXA 3WNLA 1G7IA 3NCYP 1LO5A 3NCYS 1BBDH 5IEHA 4MWFB 4FP8L 4I18B 3F7YB 4LGRB 3UBXA 3VRIB 2MOVA 4LMQI 3D2UB 3TCLB 3B9VA 4NKIH 3VXSD 1FNHA 1J1OH 4KUZL 5FM5M 4KHXL 2PN5A 1FL5A 1W0WA 4ZPVA 4YJZL 3FHAA 4UTBL 1MCJA 5IB3B 4Y4FA 1OT2A 1K8DB 1I3VA 4NM4H 3EO1A 1IAIH 4XCCH 1U8PB 4HQQH 5JIIA 1CDIA 4OB5L 4RGNC 1B4RA 4NBZB 4S1SH 3GMQB 5JPNA 3BD3A 4HXBH 5DS8B 3UYOD 5F1NA 2E8ZA 5HHQB 3D3VA 1GGCH 4Z7VF 5ESAA 1EUTA 3DV6A 4Z7NF 1ZGLB 4HWNA 1NFIB 4L4TB 1X5XA 4G42A 1RD6A 2NY1D 2AGJH 1I7UB 2FBJL 5ESVA 5FO9A 5E2VH 1UJ3A 1XGYL 3FO0H 2DM2A 3LMJL 4RMSA 1P4IH 2OTUA 5DVLA 5E8DH 1G9NC 1NGQL 4HJJL 4GW5B 2NW2B 4QTIH 3U46A 1A64A 5E5MB 5INCB 2JJUA 3LEVL 3PL6B 4OLZH 5B4MD 3C6LD 1LVEA 3L6FB 1K8IB 2F19L 3CNKA 2IAMB 1K6QH 1MVUB 3DO3A 3NAAH 5E6ID 4FXGA 3VRLE 4KY1L 5HHXH 1IEAB 2NXYD 4QNPF 3BKYL 2PW1B 1J0JA 5F96H 5JPNB 2NYYD 2EDBA 1I8KA 3D3VB 4P23B 1PLGH 5ESAB 2N4IA 4N1EA 2XOTA 4JGJA 5FHAH 2HFFA 3LOWA 3ARBC 2DYPA 1JYVA 5EU7E 3K8LA 1RUAH 3V7AE 1LK2B 3MGTA 3IFOA 3OKDB 2FYYA 4OD1L 4S11A 5E5MA 5INCA 2DDQH 1RULH 4PTTA 3L6FA 1SYSB 4OUOA 4Z0BH 3NBNA 4JGMA 1GGIH 2BNRB 2O5YL 2DBJA 3DVFA 1A5FH 1MCBA 3S5LG 4L4TD 3HCVB 5IFJB 5IFAL 1P6FA 4R7DA 3LKOB 4ZFGL 1RUKH 3UXFA 1J05B 4UT7H 3JTSA 1NAMH 4I5BB 3QEHA 3S35H 2YD1A 2VLME 5BZDA 3ALWA 2BFVL 4GKZB 2CKNA 2ZUSA 3FFCB 3CGTA 2GT9B 4HC1H 5IT2L 1PSKL 3MNZB 1P7KA 5ESQB 3BKJH 1AGEA 5CHNB 4NZUH 1D5ZB 1BAFH 4ODWA 1WBXA 2CD0A 3PDOA 2Z4QB 5CZXC 5EUOE 2Y36L 4QY8A 3PP4H 3UJJH 5C0BB 5I1AB 4U1MA 1N0LA 1T2JA 1K4CB 1B90A 3FRUB 4OZGB 4P23C 1XF5B 3WIHA 1EAPB 3J7HA 3IXAB 1GZPB 2KBGA 3U79A 3QXUA 2OK0H 1JGEB 2XN9D 2YD9A 3QDMD 5C0EA 4GQPH 2CRZA 2WV3A 1T1ZA 2LTQB 1JPGA 5LBSH 4PRID 3U82B 4RCAA 3L5JA 5D1XD 3VFGL 1EBPA 4Z7QF 5L8KB 3ZZ1A 5KVDL 3Q3GA 5FXCH 1WIOA 3ULVH 4YUEH 1OP5H 4LCIH 5C9JB 4ELMB 1TNNA 1XFPA 2F53B 1I9IH 2FR4B 5DUPL 3T08A 5SV4A 1MFCL 1YEGH 4YDVA 4JVWA 1EHNA 4M7JH 4X6DA 5EC2A 4M6OL 3RKPA 3RX8A 2O5XH 1HI6B 4R7NB 4H1LA 3SO3C 1V3MA 2D03H 3WNPA 3ZE1E 2DD8L 2P45B 2VDQH 3HR5B 4XP5H 1V8HA 5TE6L 1CGXA 1DEEA 2HT4D 4HPOL 3PP3K 5AZEH 4K23H 4HWBL 4MQSB 3IXAA 1WBYA 4QYOA 3F6IA 2C4FT 1G9NH 3OBAA 1C16A 4RGNB 2FLBT 3EYSH 4PLJC 3Q6FA 2AAVA 1XAUA 1KJMA 4P5TA 3VFOB 5IK3B 5JHDD 25C8L 2XZCH 1WTGT 4KUCF 2ERJC 5HYQB 1J1PH 2HFGL 2X4NB 5E8OA 3NOIA 3WFEL 4WCYL 5HTSA 4X80L 2DLGA 1KB5H 5JXEC 3LKSB 1DQJA 4Z95H 3EJZD 5E6ZA 4KPHH 2UYLA 4OTXH 3DX6B 3TYGH 2E7LC 3G6AB 1OGTB 1KLGA 4GXUM 4L4JA 4F7TA 2DQEH 5GS2H 3KPPA 3LQAH 4ZUTA 4ZQKA 4GBXC 5E6IC 5CEZD 5I73B 5EUOF 4HIXL 4P5MA 2UUDK 4OD2B 4B5EA 3I85A 4F8QA 3QEQE 1VHPA 3REVA 4IDLA 3W2DH 1IGTB 1WWCA 3RWGA 1BFOA 2CXKA 3HAEB 4Z0BL 3NCCB 5SWSD 2OR7A 3VI3F 2VZ1A 2IALB 4IHOA 5CZKA 4WUUD 1DBBL 3E3QC 3P11H 3DVIA 3KDMB 5SV3A 4HWEL 3UDWC 1FL3B 1BF2A 5F6IB 3EAKA 2F74B 5HVGB 1A7OL 4HG4K 4JM2D 4U3CA 1G0XA 5IIEB 5E94B 4MB5A 4M62L 3VXUA 5DYOB 3CX2A 1J8KA 3K80A 2XTJE 4P5KB 4XWGH 1LK3L 3MACH 4X7SH 1N5AA 1CFTB 3PP4L 3UJJL 3SDDB 4KZEL 1WUNT 3JUZA 1IKNC 1OGAD 1DJSA 3JWOC 1KLUB 1QFWI 5LWYH 2BSTB 2DQUH 1S7UB 3U7YH 1FNGA 1TQBB 2FECI 3GJFH 4LHUG 1MHHB 3FQWB 3KS0H 5T5FL