4NBZB

Crystal structure of tcda-a1 bound to a26.8 vhh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
VKLEESGGGLVQAGGSLRLSCAASERTFSRYPVAWFRQAPGAEREFVAVISSTGTSTYYADSVKGRFTISRDNAKVTVYLQMNNLKREDTAVYFCAVNSQRTRLQDPNEYDYWGQGTQVTVSSGSEQKLISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Immune system
molecule keywords TcdA
total genus 32
structure length 132
sequence length 132
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nbzB00
5IGXL 3OKEB 3CX5K 4H26B 3S98A 2ID5A 2H2PC 2R0LL 4HEPG 5F3HB 5HGAA 3WD5H 4BSVA 5CGYD 1C12A 3KGRA 5IWLA 1RIVL 4HPYH 1TJIH 3FT3A 1FFRA 1NMBH 4WUUA 1NCCL 1LK2B 1WF5A 1ITBB 2OX5A 2JCCE 3LRSA 1QLFB 4I9WD 3ZDYE 2W9DL 2NXZC 1FC1A 1FG9C 5F89A 3MLVL 1NCAH 2VQUA 5D9SA 2DQCH 5D1ZB 3WIIH 5HVHC 1WZ1L 4KKNA 3NA9H 1Q9KA 2WBKA 3GSNA 4HUWB 3HCVA 3IJHB 5D6CB 4RAUA 5KANG 3TH3T 4DEPC 3ARXA 4WI5A 4Q6IA 2ZUWA 4GW5B 1KCLA 2G5RA 2V17L 2D0FA 3C5SB 5EO9A 3HC3H 5DVLA 3L7EA 3CC5B 4KTEH 3T0EB 1IGJB 1I9RH 2IALA 5L6YH 3TZVC 1CDJA 1YDPB 3VGEA 4PJXE 1A4JB 4HEME 5GGSY 3MNWB 3X12A 3QCVL 4L4VE 4DGVL 1U3ZA 4JG1L 3JV0A 4X4ZA 2VR4A 3QUYB 3MRMB 3UYPA 1Z3GL 4X6CE 3VWJB 5D2NC 1AQDA 4POYA 1AO7B 5EZLA 3FFCD 3BP5B 1UC6A 3NOIA 2HLFC 4D9LL 3V79C 4ZNEE 3ZE1E 1YUHB 1U91B 1CR9L 1H8NA 3ARBB 3UTPD 3OR6B 1OOAA 3QG7H 5CUSH 3RL2A 1QRND 1QRNA 3HAEH 3IJSA 4EBQH 5C0CD 4LCCC 2XWJA 3RDTC 1M7IB 4FFZH 3G04A 4ZUUA 1S7TB 4JO3L 5J9PB 2E7CA 4IOFD 3MRMA 3TO4C 1DDHB 4IRZL 1EFQA 2VUOA 1TQCB 3RVUD 4OLYH 1CWVA 1IZJA 5BRZE 4LVEA 4U05A 5ACZA 1OGAE 4KGLA 4OZFH 2XFXA 5DD3L 2GSGA 4WY7H 1NMAL 3MGTA 5AYUH 5EB9A 5CGYC 2GJ6E 5GRYA 5DS8A 5FM5O 4H20L 4IDJL 4HKZA 1FVCA 4EDXB 2DQDL 3CDGA 3QAZB 2XZAH 3SE3A 3DIFB 4W81A 1WIOA 2BVPA 1KENH 1BD2D 2DBJA 5D1QB 4UILL 5SWZE 5ENWB 5IW1A 4WWKC 3OAYK 4FZ8H 4YR6B 5FUZL 1N8ZB 2YXMA 3MNVB 3I02A 3FMGL 5FHBH 3TN0A 4OLZL 4OSUL 2FX8H 4ZDHB 1A1OB 1N3NA 2NY0B 1FGNL 3O9WB 2VLKD 1NAMA 2MNUA 5CGTA 4Q7DA 1YEJL 5C0BD 1QLFA 2HT3C 4WUKL 5HHNA 4YFLF 4Z78B 2X44D 1N2RB 1R6VA 1WWWX 4Y4FD 1HH9B 4O2CB 4LIQH 3GO1L 3TIEA 1DSFH 4HIEA 4GQ9H 2BJMH 1W0VA 1WCBB 5H37G 5GIRB 5IR1B 4CVWA 1T3FA 1D5ZA 1P7QA 1U2CA 2A1WL 2VH5L 1U8NA 2BDNL 2ICCA 5EC2B 1KIPB 2ARJQ 2PUQT 5IVXB 2IBZX 1IC7L 2D3VA 1MFNA 4QTHB 4LDOB 5I8EB 1BD2E 1K8DB 3GSXB 1OAXH 1OP3H 2YRZA 1F5WA 4TRPL 3VFNA 1MUJA 4F33A 3F7VB 3WHE1 4MXQD 3FRUB 1IEHA 4NC1C 1MIML 5D1QC 2R4SH 4RGMB 2X1OA 2O61A 1CTOA 3UTZB 3JWDC 3RWGB 2BNRD 3L5WB 1N7ML 5BZWA 3FO1B 4TVPL 3L5JA 3HPLA 4O5LL 3TT3L 1T2XA 2DMKA 3QWOB 1FO0B 3MLTB 1CGWA 4QHUA 3VI3E 4MB5A 4X4YB 2GAZA 3RIAK 1ZHKB 4BKLA 5I73B 3DJ9A 2CIIB 3GB7B 3OR6A 4E41D 3TO2A 4DK3A 1A3QA 4X4XB 4UTAL 3SJVE 4MX7B 3ECBA 3GIZL 1MRDH 4UT7H 1A7NL 5J13C 5E4IA 5JOFB 25C8L 3D85A 1XF1A 4X99B 1P84K 3TIDB 4GBXB 1KG0A 4K8RD 3BO8B 5IW6B 3I6GA 1BFVH 1KT2B 3NA4A 3ZE2F 1DBKL 4H88H 2AJYH 5A2LH 3UTQB 4PPTA 3TJEL 2GTWB 1G0XA 4FABL 2FWOB 2BRQA 2WMPA 1NJ9A 4G80A 2F53B 3MNZB 4PBXA 2AJSL 5AZEL 2YHGA 3O3EA 1IEAB 3UJTH 4FQQA 1A6WH 3QULA 2BVUA 2R1WA 3BDBA 1H5BA 2X9YA 3DV6B 4P3CH 4R90H 5GS0D 3ARPA 4NQUA 4OZFB 3KVQA 5CSBA 4PG9A 5IK3A 2VLLB 5F1OB 1JHTB 4H5SB 1BP3B 5D1ZA 3BW9B 3IDYB 1B4JL 3HUJE 2GSIB 4D9RD 2J5LC 4DKAA 1HHIA 3QRFM 3BPOB 4OBRA 2HT4C 4K7PX 3LRSB 4X7FC 4Y2DC 3G5XB 4J6RH 5IT2L 3LCYA 2EDXA 3QUKA 1YJDC 4XC3H 3SDXB 5HGBA 4LP4A 3GM0A 1BQSA 2FZ3B 4RFEB 1DBAL 4YE4L 5DC9B 1NDGB 2QHRH 4LSTL 2H3NA 4Z9KB 2FR4A 4R97C 2XT1B 1FFOA 5HGAB 2FD6L 4XCFL 2HH0H 5CJ5A 4DUXA 2B0SH 2ZG3A 5I1EH 3IS1X 1RI8A 1CGYA 2J7LA 4BZ1L 2DBLH 5GRUL 3MLRH 3LMJL 3H9ZA 3UTOA 4B41A 1XGQA 2WIIB 2VDRH 1UM6L 4JHAH 3G5VB 2IANB 2VAJA 4ISVA 4CBPA 3EBAA 4NRYB 4OCWH 5MEND 2EDTA 4ZAKB 5FUCE 1QEWB 3TO4B 4ELMF 2EDKA 3CDYA 3V6FB 5ILTL 1KJ2L 5EU6B 1OM3H 4AH2B 1IMHC 1LO5A 4FTVB 4MA8L 4ONGH 3DURB 3EDFA 1P6AB 4GAYA 3VFWA 5CEZD 1RZIA 4NT6A 3TA3C 1W8NA 5KANI 4P2QE 4A2MA 5DD0L 4JREB 5JORA 2P5WE 4CVZB 5GGUB 3D85B 2OK0H 1VGKA 5D7IE 4Q6YA 5D72H 5A2IH 4TNWK 3WS6A 3BT2L 4M1GH 4YGAB 4Q9QH 4JKPL 3RWEB 1TMCB 4TSAH 3UCRA 3VDBA 2QADB 4P59L 4L3ED 1QRKA 1E6JH 4OI9A 5LAXA 4ZS7L 5I71B 4JM4L 1A6VL 3GI9L 3K81A 4JFDE 3MRIB 4HXAL 3KXFA 1MQKH 5KW9L 2CDFB 1U8KA 2AW2A 1JNNH 4U2ZA 2FBOJ 5B39B 1YY9C 4RA3A 5GQBA 4IS6B 4GS7B 1DQJA 2B0SL 4KQ4H 2AJZA 4KH2A 1FZOA 5I18H 5GS0C 3TYGH 3UAJC 2G2RA 5IB5B 4LLWB 5L8LB 4HUXA 4A6YH 4Q9CA 5CEZE 4S1SL 3V7AG 3L9RA 3HNTL 1D6EB 2IPTH 4RBPK 3GJFH 5CZVH 4K55A 5F21B 5FYKL 1XF5B 2DAVA 1MCJA 5CHNA 3V6OA 2QQNH 3NCBB 4NQDB 3RDTA 3FQRB 3VFVB 4PYGA 4YZFF 1BOGB 5C0AE 4JLRB 1HNFA 1OSPH 1KEGL 1HDMB 4KDTC 2G5BB 4KJWC 2PXYB 3HNTH 4YXHL 1FZKA 4W6WB 1F4WH 3P11L 3IDIA 2DBLL 4TYUA 4ZFGH 3DARA 3VXRE 1I9JH 2C26A 4LSRH 1HKLL 4UTAH 3IFLL 4NKOA 1MRFH 2JELH 1BIIB 2J6EA 5K9KA 5K9QG 4FG6D 3MYJB 2HVJB 4WJ5A 3EJZD 4P2RD 3QSKB 4U1MA 4PJ8A 4I3SH 2ZJSH 4YHZL 2W38A 4LVHC 3LH2H 1TZIA 5CEYA 3PL6A 4I0CC 4Y5VA 4NBYB 2VN7A 4G8FA 2J88L 5LQBH 1QFWM 1F6FB 3BKCL 3VXRB 2A6DA 2Y9RT 5ACZB 1GZPB 1ZHNA 2WBJB 5JHDA 2MCG1 2DJUA 1CFVH 2FJHB 1YEDA 2QKIB 4P99A 5D96C 1KPVB 5SX5H 1J0ZA 3HMWH 2X9XA 3W9DA 4GO6B 5BXFB 4UINL 3W2DL 8FABB 3TWCH 4LSPH 3VFNB 1AXIB 1RJZB 1MEXH 1S7SB 3PWVA 2NYYC 3BGMB 4P2RA 4R96B 3ZL4L 4ODVH 3HE7D 1EA9C 3TJEH 1XMWA 3MLRL 3G6JE 2A6IA 3F12A 1V7NL 1ZGLM 2JJVA 4JN1L 2X09A 1ROWA 3U79A 1MQ8A 4L1HA 1I7TA 1AXTL 3QNZA 4MNQA 5EBMA 32C2B 4G9FA 5I76A 4OLXH 1G7JA 4OAWA 5F9WC 4LPCA 1VKXB 3FQTB 3VDAA 4OM1H 3NH7L 1F2QA 2KKQA 1U8HA 3FQXA 3TN0B 1FYTE 3GHBL 1KXTB 5M95B 4P9HL 5HYEA 1VFMA 1NBVL 2OSLB 2NY7H 4OF7A 2NY5H 3RNQA 4IOIB 4PD4J 5IVXF 1MHCB 5IP4A 4L1DA 3ZKNC 4F7MA 3PWJA 1A1MB 2DI9A 4V2BA 1UB6A 3GNML 4K3JL 4HDIB 2XRAL 1MAKA 1FH5L 2VB5A 5F88B 1OW0C 5FYJL 2CDGB 1M05B 3BQUA 1P4LB 5C0CA 3H42L 4KUCD 3X3FL 2J4WH 4JO3H 1UZ6F 3O8XA 3VFSB 4J3XA 5D71L 1MCBA 3KDMA 4P9ML 4FABH 4MLSA 2A9ML 1F4YH 3OAYH 1CD1A 5K93A 1IM3A 2VLRE 5JOPE 1QHOA 5F71A 3NPSB 4R26H 5DUPL 4YHNB 4HBCH 3TVMB 3UJTL 25C8H 1QNZH 3TBSA 4I5BA 3HRZA 4M6NL 5ITFB 1MLCB 2NY3B 3NTCH 3C87A 3QDGB 2UYLA 3K4DA 2ADIB 2VLLA 1F4YL 3E8UH 2W65B 2ERJB 4JRYB 5HHMB 3UXFA 1WK0A 1YPZA 3B2UD 4NN5B 4GKNA 1HHJB 1WCQA 3MJ8B 3IDMA 4K94H 3NAAL 4Y16B 2ZUTA 4Q58C 3B9VA 4EI6A 1FGNH 4WHCA 4CGTA 2CK0H 4ZQKB 1I1FA 4U4BA 4DN3L 1CLOH 4WTZA 4MA3A 4TTDC 4Z7VF 1LP9B 4YK4B 5HYJE 5C6PB 4QRRE 4MQTB 3BSZL 1CU4H 4JFQB 3HZVB 4ODTH 4P5KB 4WUUE 5IKCB 2J8UF 5LWYH 2CGRH 3MUGB 1VDGA 1FFOB 4KK8C 2BDNH 1N4XH 3MACL 2O5XH 3HRPA 4HWEL 5I9QB 1YEGH 5TFSH 1KIUA 4S2SA 4MZ3A 5EIQA 2Z8VC 5J6HB 1KIRA 3O9WC 4PJHF 1YQVL 3EDJA 4XI5C 4BH7A 5JXAH 1MY5A 3CZFA 5DUPH 3F7PC 3GSUA 3SQOL 4H0HB 1UJ3A 2NX5B 3HUJF 3UTTD 4D9QE 4Z7UB 5CD3B 1Y0LB 2DB8A 2F9BT 2DWEB 5HDBF 1JE6A 4QXTB 3GSWA 1HDMA 1OSPL 5EC1B 3EDKA 3N1FC 1LHZA 3X3FH 5ALCL 1AI1L 3L5WA 5JZ7D 1K4DA 5CILL 4F33B 3KLHD 2C3VA 3PP4H 4K8RC 4PJFA 3KLDA 5E94B 4JFDB 5E00A 1IM9B 1H3GA 3VGAB 4YQXL 3U4EB 4C55A 5ICZB 3QWRA 4I0PC 5IB2A 4LCWE 1F45A 1J8HE 5DUBA 4U0RC 1H9VA 4QTIH 2DKUA 1QSEE 1L6XA 1DQJB 1B2WH 4HKXA 1KOAA 1N4XL 1D5ZB 2N7AA 2V9TA 1QSFB 3RTQA 1JFQH 4F7CA 5F6HJ 3VGFA 5J1AA 1CICB 2ZUQB 2VDMH 1RJLA 3QUMH 5EG6C 4QXTA 4UV4H 3DUSA 2R8SL 4Z18A 1K5NA 4K94C 4NKMB 3IXTB 1ZGLB 4P2QB 3ARED 2ARJA 3AREA 2AK4E 2EIZB 2XA3A 5I1IL 3MRPB 3A6CH 1LEKB 3S34L 5D7IF 4YIQB 1Q1JH 4YFLI 3GMNB 4LMQE 4X80L 3C8DA 5F1SA 3CVHB 1ZKAA 1F3JA 4J2XA 4U6YA 4P9MH 2E9WA 5DWUL 5SX5K 3PHSA 1YEKL 2ZCKH 1RIVH 2EE9A 1S9XB 1TZHB 1UWEH 4YDJA 3BDYH 1N6QL 5A16A 5GPRA 5A43C 3OG6B 3DRTA 2C3VB 2CQVA 5JOPD 4KK6D 5JXAL 5GS3A 1KLUA 1Z9MA 3BAEL 1YC8A 5HI5D 3BUTA 1XCQA 2J6EL 3ROOA 4EI6B 4BZYA 1N5YL 2R2EB 3N1GC 3RWFB 1XF2B 5DA0B 4JHWL 3AMKA 5DD5L 5HHXH 4WI6A 1OF2A 5FM4A 2VDNL 3CZFB 2YN3A 2FECI 5JZ7C 5C0EB 4ZFOL 1DZBA 5F7KC 5I1LA 4HJ0D 5BRZA 2IF7A 2DQUH 3D1MC 3BPNB 3TNNA 3LKOB 3B6SA 3QUYD 2C4FT 2YD2A 4YBLB 4FQXA 2NY2D 2R69L 1RVFH 3MGOA 1IGYB 3JBG7 5C8JA 2G75A 4HS6B 1FVCB 5I15L 1S9YA 4WFEE 2NXYC 1CFNA 3GBMH 1NL0L 3U6RA 3FFCB 1WT5A 3RWDB 1K2DA 3T0AA 3UP1A 1MHHA 4XBEL 4L8CB 4FQ1L 5EZOL 3NCMA 5C0CB 3IF1A 4Y8DC 5JA9A 5E2TL 3WFDH 4AEHH 4HBCL 3C5SA 1I7RB 4WCYL 1MIEL 1L7IL 1GVIA 3O6FC 1B6DA 3ZKXC 3NFPB 2AP2A 3CNKA 1N5AA 3QIUD 3HRZB 4L8CA 1LO4L 1G7HA 1IKNA 3EZ8A 4WTZG 4IIQC 1ZLWK 1LEGB 5B8CC 2AKRB 4OFVA 1S9YB 4HGWA 1BD2B 2W91A 3W5MA 1GGBL 2AI0L 3G6JF 3UMTA 4NO5B 1R3LB 3ULVH 4GXVH 1RPQA 4KVNH 1HSBB 4TUOB 3NFSL 3V4VL 3K80A 2ILLA 3P30H 3T0EA 4OZHB 4UQ2B 4QT5B 1TJHL 5HDQH 5IBLD 1R24B 1FC2D 3BXNA 5T33H 4NQVA 3RJDA 2Y25A 4LLQA 5IFHL 3KJ6L 4ETQB 5DJAB 1OAKH 4HLZG 4CVUA 1IRAY 1Q9WA 3O11A 5MHSE 3SY0A 3QEUB 3MPCA 3QZWG 3PWPB 4XCCL 5GISH 4PBVC 1DLFH 5D72L 3T09A 2CRMA 1DJSA 5E2JA 3VWKC 2PYEA 1W72H 3PABB 5EO0B 1LO0H 1B6UA 4HJGA 5SWZD 2Y06H 4AZ8A 1KV3A 4Y5VB 2FLRT 1OAUL 2NXYD 4PJDF 3MRLA 4XP4L 5E2WL 1HZHL 3BP6B 5DMYA 4Z7VA 5BS0B 4NHUB 4ODSH 2CDEA 2VDLL 2GKIA 3EGSB 5B8CA 1T2JA 3RVXC 2R0KH 4QRQB 3WEXB 5I0ZA 2BVPB 5J57B 1AQKL 3F65A 4RCAA 2FX7H 1N7MH 1XGRB 1OD9A 2LV4A 1IGFL 4BKLB 5GRJL 4QNPE 3B9KB 3P4MA 1I3GH 2OJEB 3T0BA 1UM4L 4QXUL 5E8PA 3UBXG 1MCQA 3ARGA 5FOBA 5JIPA 3FO1A 4XCNB 3T0XA 4J3VA 4U1IB 3DXAD 3SDDD 5IROA 5IQ7L 5JPMA 5CINH 1UJTA 3JWDH 4MDIA 5I17B 4GKNB 2V5YA 4K9EC 1D7FA 3E1F1 5T3XD 1I8IB 4XP6L 2CJUH 1P53A 1I9IL 4JGUA 2P46B 4DKEH 1NCNA 4DAGH 5DRWB 2AQ2A 2E27H 2WUBH 5DJXB 1AGFB 2W60B 4MDJB 4JVUA 2F15A 1AO7A 5T3ZD 3DYPA 4G8GE 2IMMA 2UZIH 1YEJH 1BQHG 4P2YA 3KYMB 2D31B 4WFHE 1G7LB 2AXHA 4J3UA 4ODUA 3WFDL 4AEHL 1OAKL 4WFED 2YA2A 2PO6D 1LO2L 2PW1A 3OF6A 3V6OE 3MA9L 3IXTA 4BQ6A 4PJEE 4TPRL 4NOBA 1BOGA 3INUH 5JR1H 1T1XB 5ERWA 3ULUC 2DM7A 1CK0L 1EFXD 3QQ4B 2E8YA 4JGJA 1CL7L 4JFXB 3LV3B 4NJAL 4W68A 2FYYB 2VDPL 3CVHH 4LDLB 4PB9H 1LK3H 1T1ZA 3TBTA 3WCYA 5ICXB 1FL6B 3QCTH 2E3VA 5EBLA 1IJ9A 4JAMA 3KXFE 5GGRY 3STZB 3TPUB 5DO2D 2FGWH 1A5FH 3ZDYF 3S36H 1T5XB 1IM9A 5EU6D 4RMSA 5DR5L 4FTVD 5BO1H 3ZE0F 3O6ML 2FIKA 1E28A 1DEDA 3P0VH 5GGVY 4CJ1A 4KZDL 2W07A 1FNFA 3HAEA 3VWJD 5E8NB 1LDPL 3CSYB 4ZUWB 5E2TH 3F58H 3RIFK 1MAML 1C5BH 3LQZB 4LLYB 3O6LH 1U91A 1TJGL 5HDBE 4PJIF 1CF8L 4G5ZL 1DFBH 3BN3B 3SCMB 4HG4K 4B5EA 1VFUA 5C0AA 3QUZA 3TT3H 2AEQH 3E6FA 2AXGB 4Y16C 3QDJB 3PV6A 4MXWH 4FTVA 5I1JH 4HWBH 1UG9A 2RGSA 4Q0XL 4ESKA 3V0AC 4L3AA 3WE6A 3U0WL 3HR5A 3F58L 4OFDA 4OZ4B 1BGXL 5DLML 1NCWL 5F70A 5HGHA 3OB0H 3LHPH 2ESVE 4ZSOE 4LLAA 4X8JA 1A1NA 4WEMB 3VFUB 5EH1A 3UTTA 4PJHA 4XT1C 3QFJD 5DQ9B 5F6HI 4YHYB 1CFSA 1SMAA 2BXYA 4Y19A 5KVFL 1XCTA 4IRSD 4UILH 4JVPA 5LXGH 4C83B 2G75B 3BKMH 4JFOB 4W4OA 1H3UA 3NFNB 3WFEH 1UCTA 5FV1L 1B4RA 5JQ6L 3GSVB 3VWKB 3RWIB 4KTEL 1KT2A 4L9DA 2XKNA 1OLZA 3FN0L 1CDIA 1JPGA 1ZSDA 4O02H 1PKQE 5C0AB 2DLIA 4LSDA 3LKOA 2GIYA 1A2YA 1SY6L 3RHWK 2R0ZH 5GS0H 2R29H 1L7IH 4OD3H 5CP7A 3D0LA 2BVYA 2W9EL 1M4KA 5D5MF 4MCYB 4OI7A 3WNKA 2UWEA 3L5IA 2A6JB 2DLHA 5GZOD 2LU3A 2UZXB 2QR0A 3VMPA 1EAJA 3CXHJ 3N1PC 3O3AB 5F3HA 3T4YB 4U1LA 3KYNA 4W4NA 4M7LH 3RDTB 2VLJB 4G43A 1NCTA 5K9OA 3O45B 3CK0H 4M93C 2E7LA 1L4IA 4D3CL 5KSBB 4YHIB 1FSKB 2I9TB 2QL1A 4XCFH 2XTJE 1H3VA 4OFPA 5HY9B 1UH2A 2P8MB 3I9GH 4OZ4A 2GTWA 1UVQA 3GSOB 3OG4B 3IAGC 4HIXL 3X14A 3A6OA 4F7TB 1OQXA 4TUKL 3P4LA 1X4XA 2VLME 2DLGA 5CBEB 2BFVH 3WFCL 4JZNA 4M3JA 3AGVA 1U8KB 3QAZC 2QQKL 3RVWC 5AEAA 1RUML 5IB1B 3NGBC 2ARJB 4PRPA 3CXDH 2EDDA 4JPIB 2GK2A 2VLKA 4ZS7H 1BFSA 2R56H 2GITB 1N0XL 1N64L 5IFAL 1CL7H 1MRFL 2JELL 3IRZA 2I5YH 4DZ8B 4CN4A 3CFDA 3ZKQD 5E8DL 4TSCL 5T1DH 1YY8B 4ZPVA 1KSRA 1UZ8B 1UYWL 2ADFL 5CBEA 2VISA 2J1KA 2ZKHL 1R3JA 1INEL 3QH3B 2OZ4L 4KRNA 1CLZH 3RPIB 1YEEH 3N85L 2CJUL 1F4XL 4AEIH 5IB1A 4LSQL 5DHYB 3CD4A 3SEPA 4G6KH 4YHLH 2RCSL 2XXCB 3P2TA 2DQIL 4LIQL 5E8OB 2EXWC 4QHKJ 1G7IB 3WO4C 5KVGH 1KN4L 5JPNB 1NGYA 3B9DA 3OKKA 3WFBL 4YEEA 5DUBB 1IEBB 2V9QA 1SYSA 5FDWA 4RQQB 3T8XA 4XZUB 3REWB 1JZ8A 1BWWA 4QHNA 3S4SA 3DETD 5CSGA 3R0MA 5GRJH 1HH9A 4O2CA 3HUJB 5K9OB 5I1GL 4PRIA 1XF4A 3AU1B 1EJOL 3O3AA 5L6YL 2R23A 3NIFF 4XC3L 4OGAD 1V7MH 1AD9B 4ZDHA 2BY1A 4G8GD 1P4BL 3G6DH 2C9AA 3HG1D 3D0LB 3WLBB 4ODHH 5DD3H 3QCUH 3LD8C 4NJAH 4ORGB 1QR4A 5MI0C 4U1JB 2IPKB 4FZEH 1KXVC 5DEGB 4F8TA 5ITBL 4YDVA 5DD1L 5D7LA 3BT2H 3QG6A 4XXCA 3NA9L 4QRTB 5SWQA 4HWNA 3GHBH 3FB6B 3L3HA 1I7ZA 4Z8FH 3VD4A 2E27L 2XZZA 2NY0D 1XFPA 1MSPA 1E4XH 1EHNA 4X9BA 4KRPC 5HHVL 5E9DA 1U8PA 5E6ZA 1NEZB 2XXMB 1NCCH 1JRHI 2BXZA 3AAZA 3I50L 5F7MC 3L3JA 1KNOB 2N7BA 1ZEAH 1J5OL 1UQSB 3RJQB 1UKSA 4U1SA 4CADB 2JIXA 2YUZA 1A6UH 3UPAA 2MHAA 3KPMB 4FG6C 1BAFL 2XWJB 1YYLL 1PBYA 3SCMA 4RAVA 4PJ5D 1D5BA 2X4PB 4ODVL 1M6OB 1J05A 4P4RA 1MLCA 2WP3T 1HHJA 3RU8L 1CS6A 4NZUL 2IQAA 4HF5L 4APQD 1MCKA 3I50H 2W65A 3RTQD 3HMWL 1A7BA 1F8TL 4XNUL 3ZDZE 4NQCA 2VDKL 4TUOA 5C07A 5ITFA 1DL7L 2BNRB 2IG2H 4P23A 1AD0B 4LLMB 3IVKA 1IAIH 4K8RL 1AGDA 1NGZB 4PGEB 4Z7WE 2P5WD 4KVNL 3MZTA 2QV2A 3VXMB 3LKRB 2CDGA 4I18A 5E1AA 1S7VA 4WI3A 2QHRL 4LSTH 4LHQB 3WYRA 4MLIA 3HI5H 4YDKH 4IIQA 4WCYH 4RFOL 1MHPL 2QEJA 4P23C 4DVBA 1KB5B 1WEJL 4HKBA 4OGAC 1I4FA 1J88A 5KOVC 1GHFH 1TETH 3O6LL 4PJEF 5HSFA 2YC1B 2VR9A 4I3GA 4P46B 1S7XB 1RZKH 1IKFH 2V5TA 4HZLA 2HVKB 4JB9L 3MNZA 4HIIB 3MRCB 3O6MH 5INDB 1XH3B 2C3GA 2MQ0A 3SCMC 1AD0A 1BZ9B 5TDNB 2Q6WA 1GJIA 1FE8H 4UINH 4B7IA 3RWDA 1FO0L 2X4SA 2LABA 3TJHD 3ARFC 3V6ZA 1Z5LB 2GJ6A 4NFBA 4L4TE 2CR3A 3RQ3A 3BPLC 3WKML 1G84A 1P9MC 4AIZA 4GMTL 4KTDL 2UVFA 1TITA 3ZKND 3UJIL 5BRZD 4ZUSB 4MJ6B 4YBQC 5INCB 2W59A 3LEYH 4JE4B 5DUMH 5EUOE 4F7PA 3IDYC 5HHOE 5JXEA 2HWZL 3IDIB 4RAVB 4X5XA 1RQ5A 5DRWA 2VLRA 3OZ9H 4L3EE 4Y8AA 1DN2A 2PXYC 1YNLL 1BFOB 4NM4L 4POUB 2FB4H 3MR9B 3L7FB 1OAQL 4WFGE 1BJ1J 3EYSL 1PX4A 4MHHI 5IIEA 5CWSB 3FQUB 1JNHB 2EH8H 2VLMD 3FFDA 5C08D 2Y7QA 2Z31D 3OGCA 4CU7A 1IGCL 5A16B 1RU9H 4R7NB 3OKOA 4Z7QE 3I6LD 4ZAKD 5D5ME 5I8KH 5TE7H 4BQCA 4ERSH 3LB6D 3ARFB 4XB8A 3WDJA 3N0PB 3WUWG 3G5ZB 4L3CB 2P24B 1ZA6A 4UT7L 1VGEL 4KU1A 3MX0A 1XEDA 1FL3B 4HIHB 5C0BE 4JFFD 5ILTH 2EH8L 5E4EC 1OM3L 5E9DE 2Y72A 1QYGH 1LQSR 4Z77B 2HT4D 4TUJB 35C8L 5HYSG 3QQNA 3BWUC 3J7HA 4F9LA 5FKAA 3ORJA 2PW2A 5MERA 3KR3L 5LBSL 3GUTA 1RD6A 4XPFH 3T1FA 4ZXBB 4MJ5A 7CGTA 3OMZA 3JZ7A 4P0DA 3OXSB 4JPIA 2EXYC 2PXYA 4OB5L 2H2SD 3T8XB 4U1HB 2NX5E 1J1XL 4P46C 5I1KL 5KSBF 2HRPL 3CDGB 1JPFA 1XZ0B 1ORQB 4F7TA 2CMRH 4RFNB 4PRBA 4HCRL 5F7EH 1G7IA 4UNUA 4MQSB 3P9WB 4GS7C 1Z9LA 3B9KA 1HH6A 4JQIL 4ZUVA 3CMOH 3O2WH 1B4JH 4IRJA 4ZUSA 3GK8H 3BEVB 3KPSE 4HWZA 3CSGA 4YIQA 3VXMA 3PWLA 1FZOB 2GFBB 1SHMA 3BH8A 2IANE 4JJHA 3LKPB 3W11D 3T65A 3OPZH 2N1KA 3KPQA 3KLHC 4Z0BH 2VXTL 2XWBA 3K2MC 4K7FA 4O2FB 5GGQL 1X5YA 4BQBA 2PXYD 4PJIE 5FAAA 5MEQA 2B2XH 5INDA 4OUOA 4BH8B 5IFJA 1YNTA 3X13B 1MCEA 3WNOA 1S7UA 1MRCH 3LKSA 4UIKL 2XY2A 4ZFFB 3U0TA 3BYTA 4K71B 3TV3H 4BSJA 3QRGL 2ATPA 2PYEE 4PJ7B 5FFLA 3IDGA 5FYJU 3L6FB 1U95B 5DDHA 5E5UB 1F11B 4YZFE 3U9UA 2X4OB 4KHXH 2YSSA 4N0YH 4U6HA 3QULB 2A9NL 1RUQH 2YOCA 1T03H 4PS4H 1MREL 3O41A 2EEDA 4XPGH 4E42A 1T4KB 2SEBB 3NPSC 1UB5A 1FJ1B 3BQUC 3MV7D 3OKMA 1FL5A 4JKPH 3U9PL 3BZFA 4UT6L 4NO5A 3MRKA 3JV4B 2NY1B 5IW6A 5T3ZL 2D2OA 1CG9A 3S5LG 1UA6L 2AXGA 4X99A 1B0RA 2YEZA 1IVLA 4LSUL 4UAOC 4WTWA 1RURH 1BIHA 2Y36L 3PDOB 1PLGL 1EO5A 3TO2B 4XPHH 2P44B 1DEEB 2GTZB 1WV7T 5IF0A 4O2FA 1WC7B 4WUUD 1CE1H 2VZVA 5FHBL 4LF3A 3MA9H 1HHIB 4X6BA 1NFIB 5C9JB 1IGMH 2X2YA 4M7JL 1MVFA 3NPZB 5DJ2B 2VXUH 4DK6A 5SWSA 1S5IH 4YPGB 5IHZB 4J4PC 3KDMB 4OKVA 1C8PA 1TZGL 3MRDA 1OB1B 3BPNC 3NIGF 2JJTA 2FO4A 3PIQA 4O00A 5GGRA 3BQUB 2EO1A 1F3JB 1VPOH 2JLLA 5L8JB 4QF1A 5I1DB 3MRHA 2E5EA 4UDTA 1FNLA 5HHQA 2IADA 1JFQL 1CD0A 3ROLA 1JTPA 1MCOL 3LN9A 1B9ZA 1PX3A 4MVBC 3VXQA 3RX7A 4ZPTA 5HPOA 5C7XL 3PQYD 4LLUA 2LVCA 3QQ3A 1A7OL 3OQ3B 5DK2B 1JJUA 4JFZL 3DUUA 4GBXA 3TBSB 1UZ8A 2IJ0C 3HE7C 3FQWB 1UWXH 3DOSA 1QFWL 5IEHA 2H41A 2Q8BH 4WHYG 5HHNB 4PIRF 2A0LC 1P5UA 3AREB 4U1GC 1WQVT 4YDLB 3PL6C 1CIDA 2L0DA 3D69B 1G7JB 5EU7E 1PD6A 1NFDB 2JCCF 3UBXB 3PHQB 4LLVB 4QRRD 4PGDB 1XCQB 1MELA 6FABL 5JW5B 2VLJD 4G6MH 2AEQL 3T77B 4CU6A 5T1LA 3QUZD 4X7EC 4GAJH 5DTFA 4CDHA 5I16B 4MDJA 4LSQH 3I3DA 2VXQL 3WIFA 4EUPA 4PYHA 3HG1A 2ATKA 1UFUA 1RHHB 3M1BB 3G08B 5HHMD 1KCRH 4R0LC 1YN6A 3C08L 2VXTH 1JK8A 2VO5A 4M6OL 3SKNB 1MWAB 2A77H 2AV1B 2X4UA 1DQLH 1NC2A 2Y06L 4N0FA 4PGDA 1IQDB 1U6AL 5KSBA 3GUTB 2OL3B 2QHLA 3MV9D 4L9LA 1U9KA 1BOYA 4KKBD 5F1KC 5B4MC 1QBAA 5E2VL 3BYYA 3SBWC 3H42H 1PG7H 4MMXC 2FRGP 4XNMA 3PL6B 3RL2B 1LK3L 1JF1B 3D2UD 1PZ5B 1ZT1A 1Y0LA 5E6ID 3UO1H 4G6JL 4MJ6A 2HA1A 3QPQC 5DMKB 3FB7A 5IG7A 5DZNA 4F15B 4HUVA 1J8KA 1TENA 3ROLB 1WBXB 1F4WL 3GFUA 4P9HH 4WHTA 1C5CH 3CH1A 3MV9A 4BK4A 4PJ9A 4Y19E 4X98A 1KEML 1QSEA 2X4SB 3GBNL 2I24N 3RX8A 2D03L 4CRPA 2DDQL 4WNQA 4JQVA 2NX5D 5KAQF 5ICYB 1S78D 3B2UC 2BMKB 5IKCA 5EOQL 4HKZB 1YEDB 2H8PA 5KOMC 3FT2A 1KC5H 4WFFD 3GSNL 5EDXA 3O2DH 3DTXB 3DMMA 1MJ8H 1JNHA 4P23D 5E24E 4ELME 1PVHA 5CHNB 4M48L 1BZQK 2AK4A 4H8WC 3UTSD 1BF2A 1EMTL 1AR1C 1T21A 4ERSL 2UWEB 2WUBL 1RK1A 4OIIL 4ZFOB 4MQ7A 4O2EA 5ADOL 3CPLA 4G8GB 2ED9A 1DR9A 5JIHA 2IH1B 1S7UB 1ZANH 3QDMB 1S7WB 4K3JH 4OUUA 2WLZA 4BM7A 1VACA 1GH7A 3IFPA 1NC4B 2NTFA 4LQ1A 1ZS8B 2A6KB 1UCBL 4AQOA 4HG4J 4H1LG 3NABL 1AFVL 5GGVL 2AEWA 2F58L 4XI5D 3P30L 2XTJC 3MC0A 2AJ3A 1XT5A 3DVGA 1SEQL 2J8OA 1SM3L 4K8RH 5DQ9A 4JFYA 5IVXE 4TOYL 4UOW0 4YBQD 4G8IB 1I1YB 3V8CA 3VFVA 4MJIE 3JWOC 1JGUL 5I19H 5J8OA 1AKJB 5LCVL 4GMTH 1OAZH 4KTDH 2ED7A 2VLKE 5LGHH 4LQFL 3HCVB 3IJHA 4V1DA 1KFAH 3THML 4B53A 4C59B 2KZWA 1KYOK 4MMZC 1RUKH 3C2AH 4IIQB 4OFYA 5I6XC 4Z95H 4PLKC 4M03A 1V7NH 5T1MB 5E99H 3T3ME 1SJHA 4XMPH 1DQMH 2XZCH 3HI1B 4M1DL 5B38G 4KTYA 1IKFL 1JN6A 1NGQH 3ZE2E 3CFJB 3IVKB 1MIEH 1U8HB 1JV5A 3RWHA 5KSVB 5KG9B 1EDQA 4LHUA 1YEHH 4F15C 5IJVB 1SBBA 5J6GB 1RUKL 3O4OB 3DI3B 5C07B 3LS5H 3SGJC 2EKJA 3QEGL 4O9HH 4ZO8A 3SDDA 4JHAL 3ISWA 3CUPA 2P48B 1BEYL 3EZJB 4PJCF 5JO5A 2FZ3A 3C5ZC 2EYSB 4URTB 2OR9H 2NY5L 2YRLA 4KI1A 4G9DB 2H32H 2EE3A 1NSNH 3GHEH 4O51A 3BISA 4KY1L 3BFOA 3D39B 3PWNB 5DK0A 2QSTA 3LV3A 2CSPA 5EPMA 1HQRA 2XKUA 1NDMA 4CMMB 3IDXH 3MO1B 2R2EA 3QDGE 3DHJA 1WIUA 5IK3B 2JK5B 4CN1A 4Y2DA 2CXGA 1MCRA 2YXFA 4FRWA 2M26A 2Y07H 1T1YB 1KLUB 3AB0B 3GHEL 1T0NB 3DX7A 4J7RA 3MROB 5DYOA 3OF6D 3T4AA 1FVEA 3KLSA 4NC0B 5ACMA 2YBRA 2RR3A 4U7MA 3IKKA 3QYCA 3CSBA 4JKKA 2ESVA 5I8KL 4K2UL 4I1NB 5FA4A 2NTFB 4JDTH 1CXLA 3LY6A 4U7KA 3GMNA 5JHDD 1T0PB 4MD5A 4JQIH 4F3FB 1JWUB 3MBEB 5HGDB 2ICEB 1NBYB 4O2EB 3MROA 3UROR 1TCRA 4ELMB 1BZ9A 4AY0A 2OL3A 4IRSC 1A0QH 5BQ7B 4OZGF 1T21B 3HNSL 3WSQH 2A38A 3P0YL 4WDIA 2R69H 3VG9B 2HVKA 3P77B 3D6GA 1XGPB 3SDCB 4PJGB 5IMKB 1GZPA 4JM2B 3CFIC 4FZEL 4XVUD 5E2UH 3U7YH 4HK0A 4LNRA 3L9RB 1NKOA 1U93B 1QFHA 3PWPA 2AI0H 1BX2B 4NCC2 5LKNA 1HHGB 3UX9B 2VDQL 4F9LC 3EJJX 1NCBL 1FRGL 1MCOH 4P2OB 3VH8A 1MUJB 5DHYA 4LLQB 3BPCA 4X98B 1QD0A 5I1GH 5I1AA 3WEXA 3EO0B 4YWGL 4U1MB 4YHKL 1ORSA 1AIFB 4X6EA 3LKRA 1DE4B 3WL9B 5IG7B 1OHQA 3HKFA 4G43B 1WBZB 2OI9C 4PJ5B 2B1AL 4LCWA 4WFGD 3O6FB 5C2BH 4KKLC 2ESVB 4RWYH 3WJLA 3QIBA 2ITCB 3WN5C 2EYTB 4GKOA 4NN6B 1AI1H 4KJYB 3UJJL 2JKXA 2BERA 2DL9A 1QKZL 5ESQB 5HJ3B 3QDJE 1PQZA 5AD0B 3FOMA 4Q2ZB 1G6VK 3O2VL 4W6YB 1A6AA 4EI5B 3ME0A 2HRLA 2R29L 3V5KB 4M6NH 2BC4B 5L2KA 1GOGA 3RVWD 4GAGL 2P8MA 3KWWB 4TSCH 5T1DL 1X5GA 5IBLC 2VIRA 1JNLH 5I1HH 3DIFA 1MCFA 2P5EA 4QRSA 1OGAD 3NCCB 3L3GB 1TTFA 2MTPA 1QA9A 4C4KO 2C3XA 2XPGA 5DHVB 5FUZH 2VDQH 5JQ6H 2VRAA 3QEHB 4MNQD 2LTQB 1KEMH 3VFTB 5C08A 5J89A 1XGQB 2WIIA 3DXAB 2XTLA 1SJEB 5SV4A 2VABA 4HF5H 3J8F7 3VWKD 4XH2A 4QKXB 4XPAL 4HS6A 3QNYB 3PDOA 3S9DB 5IBTL 5A3IC 2VWEC 1YMMB 4NN6C 4DOHE 2H32A 3HNVH 4NN7B 5LGKA 5FYKE 4NO0D 1IT9H 2Q20A 4GKSA 4M5YH 5IHUH 1LO3L 3VFGL 1A7RL 2L7JA 1M6OA 3BVNA 3BN9C 5TF1H 4FOMA 4PRIE 4TVPD 1R3IL 3B83A 3V0WH 4LGSB 3SPVB 4E0RB 3QG7L 4M1DH 4PFEA 4BFGA 3V95A 4H5SA 5DGRA 4YPJA 1V3KA 1IEAA 2BSSB 5DRNA 1RZGA 2EICA 4YH6A 3BZFB 2GSGB 4JRXB 1LO3H 3VFGH 1C1EL 1ZAGA 1FNSH 3WJJA 5IJKC 3STLA 2IALB 3JTTB 4Y4FA 1D5XA 5IHZA 2DWDA 3QUML 4PJ7A 5C0RL 5EOTA 3IDMB 5EU3B 5JIIA 1H3XA 2MJWA 4KUZL 4HUVB 1JGLL 4U0RB 3UC0L 1YJDL 5GZND 5JHLH 1FH5H 3P9MB 3LQAL 3WLBA 3R8QA 1B88A 2VISB 1IE5A 1KG0B 4WEUD 1AGEB 2L7UA 5I8OH 3BRDA 2ZCLL 4UQ3A 2IPUG 7FABH 5IOPA 5I8CA 3RGVD 3D39E 4WUUB 5DJZA 4R9HA 3ROOB 1NC2B 1H8OA 4DN4L 4M8VA 3VRJA 2PO6C 1NUNB 3I84A 2FLBT 4JAMB 1SYSB 1FJ1A 4EBQL 4YBLC 3SE4C 4HFUL 4H26A 1EGJH 3QEQB 2APVA 5KS9F 1TJIL 3L7EB 4S0TD 2P4AB 1GC1L 4G3YL 3ZE0E 3DX9A 3ULUD 4JDTL 3MMEA 1UADC 5FKPB 1VFAA 4Q9RH 1U8NB 3U4BL 2DQFA 3HNVL 1S78C 3BH9A 5E5MB 1EPFA 1VEPA 5AAMA 4UTBH 1RJYA 3S35H 3AXLA 4I9WE 2EDNA 4LEOB 4QXGL 2PTTB 3ES6B 4EQ3A 1G9MC 4MB3A 3P9LA 4FQHA 2CK2A 2XN9B 4M00A 1FYTD 3R0NA 3CFDB 2WIMA 5EIVA 4KK9C 4LAQL 1W0VB 1RUPH 3WXVL 3S5LB 4ODTL 2DLFH 5IQ7H 1JPTH 2OJEA 4U49A 4HK3N 5E9DD 1BZ7A 2V5MA 3S35L 4RGNE 4L4VD 5E08H 2W0LA 3PP3H 4I2XA 5EUOF 3V8OA 1CDYA 1BQUA 1XF3A 3BIKB 5J56B 2IPUK 1IQDA 3U48A 4MD5B 3UYOD 3BDYL 1CK0H 1N6QH 4RMTA 1ZK9A 4X6DA 3WFEL 4K3HA 4R7DA 2JJSC 4GG6F 2OCFD 1MQKL 3FFDB 5E7BA 5T1KD 5I1CL 8FABA 4JCMA 5C08E 3ZKMC 1INDL 3QB7C 1NGPL 1FV1B 1T1WB 4G9FE 3H7BA 1AC0A 5FGCE 1CYGA 4MZ2A 2B2XL 2OL3L 1ODAA 1NCDL 3QEQA 1MPAL 3O0RH 4LSSL 5FGRA 4PJGA 3KYNB 1RZ8A 4DGYH 5HYIA 4FA8A 3SY0B 4XAKD 3DX6A 3MLZL 5E8PB 2EYRB 3IJSB 1Y6MR 2EDJA 5EA0L 2GTZA 1F58L 4JY5H 5BQ7A 2CRYA 2UZYB 5IMMA 3BZ4A 2B5IC 5CEYB 4HULB 1DQQB 1A6TB 4QCIA 5J9PA 4F2MB 1MJJB 4XTRC 4DUWA 4LVHB 5I66B 2LTQC 1RK0B 3LKQA 4HWBA 5T5FH 2NY4C 5EOCJ 3I2CH 4Q9BA 2X4QA 5JUEH 4X5XB 3X3GH 4OZGE 4ZS6C 2RB8A 2DTML 3LSOB 4Y4KC 3EYSH 2VDPH 3CVHL 1OAYL 1PY9A 1A21A 3VG9C 4IJ3B 1ERNA 3VA2C 5DMGD 1E6OL 5J12C 5CSZB 1T20A 3P4OA 1MFEL 4YXLL 1F3DH 1NGWA 1KJVB 4PG2C 3HNSH 1QP1A 1QSZA 3OGOE 2X4RB 4XNMB 4UNVA 5GGSB 5IVZA 1NANH 4GLRI 4RGNB 1X4YA 3SDXF 3PGCA 4LMQI 2FEDD 4GJTB 1S7QB 5FF6A 3MGAA 1AGCB 35C8H 1LO2H 3B9KC 3SKMB 3WN5A 3E8UL 4PRHA 2GHWB 3ARUA 3CJJA 3KPSD 3SN6N 3CC5A 4ONOA 5T1MA 3WXWL 3BGFB 1U0QA 1P7HL 3AXLB 3KXFD 3QXAA 4JO2H 2J8UB 1XIWC 3SE9H 4RZCB 3MRQA 1MHCA 3MV01 4XP4H 4DOHB 2HP4A 1HZHH 3VXOB 1TQBB 2X4NB 1FP5A 4PLJD 4JQXA 2VXUL 5DVNA 1SY6A 4IMLB 3KYOA 3WHXB 2ITDA 3AS0A 4G8IA 3VXUD 3HZKA 1KPUB 4LSPL 3DECA 3HAEB 5FYLD 4PJHE 1OW0A 1BD2A 1RMFL 3O2WL 1HEZA 1CD1B 3O81A 4LGRB 1HCVA 1KTDB 3EFDL 4NC1E 1YEIH 4KUCF 2DYPD 3NMEA 4Z0XA 4DFHA 1T5XA 5IFHH 1GIGH 3N1MC 5BRZB 3LZFL 4KK5C 3U46B 3BKCH 3OZ9L 4X0KA 3H9SA 3NIFE 2R4RH 2J8UE 1OTUC 2NY7L 4ZUVB 5ICXA 3O41B 1TFHA 3VXUA 3I3EA 3MRQB 5L88H 1K6QL 2ARWA 1EV2E 2VIRB 3IT8D 1I7RA 1I75A 2P45B 3ILPA 4QO1A 4PJAA 4PS4L 4OLVL 4X7TB 4DKFH 4UV7H 3WDIA 4KAQH 1L9MA 5E2WH 5ID0A 1JPST 1MCLA 1FNAA 1I9JL 4PJCB 5D1ZC 3OBAA 1TVBB 4NQEA 4FQJL 4XBPB 5B39G 4MA1B 3VGGA 2BSSA 5DRNB 2W92A 3B9AA 1HI6A 1PGRB 1KEGH 4JY6B 4GG6E 2IFGA 2FR4B 3TNNB 4R2GB 1NFIA 2AJUH 4NCDA 2YD3A 3S37H 1GCFA 5C8JB 2CH8A 1C16A 1MY7A 1YEKH 5DJ0A 5TF1L 3EUUA 4ZFZA 1AC6A 3WS3B 5BVPL 3BPLB 3MLXH 4MJ4A 5I66A 2ENYA 5TQ2L 1D3CA 1SYVB 2JJWA 3FO2B 2E7HA 2ZNXA 4JZOB 2CIIA 3GB7A 4B50A 1JHTA 1I1CA 2B1HL 1I1AA 1SM3H 3C6LC 2ZWLT 4XZUA 4POZD 4WO4C 4CADA 2FJHA 1ZMYA 4XP1H 5DJYA 4JFFA 3SGEH 1XR8A 3LEYL 4J3OC 5KVDH 1OTTD 3AY4C 1K9TA 1PG7W 1CCZA 5DJDA 4MHHG 4G8EA 3UDWC 1XGYH 1BQHB 5F96L 1T2QH 2VN4A 3Q48A 3FB5A 2H9GA 5C09A 2P42B 2C7UB 2UZIL 1D9KA 1PEZA 2PN5A 5DJCA 4PJ9B 3SJVD 5HGDA 5JMRA 1AJ7H 3MV7E 4I18C 3PGFH 2B4CH 3MUY1 4TUJA 3U82B 1NQBA 2BVEA 1NGQL 2FDBP 2DJ4A 1KJMA 1XF3B 1MFDL 5HYJB 4BZ2L 1AY1H 3IDNA 3U30C 4MX7A 4ONGL 1MJ8L 3DX8B 5IM7A 4WENB 3HC4L 4JG0H 2VAAB 1F02I 4PP2B 4PRAA 5DT1L 3ULUL 5E56A 1HYRC 3GMOA 4DKFL 1R3KB 5AAWA 2APTA 5CJOH 1RULH 3QI9C 4P2QA 4OIIH 2PYEB 2OTPA 4D0DB 2Z35B 3DSFH 1QLRB 3QA3B 1Q0YL 1T1YA 3VFPB 3MUHL 5KAQG 3QO1A 2GITA 3JXAA 4BZ2H 3VXPB 3IKCB 3BH8B 5H2BA 1KBGL 1QSFA 1UVQB 3GSOA 3VXQB 5CMAA 3F62A 4M7KL 3GSNH 1KTLB 3ARGD 1G0DA 2HKHH 4OZFG 3FONA 5GISL 1EBPA 2XG5A 1H0DA 3SO3C 3MOQA 4DWHA 1HNGA 1YEGL 3TZVD 3QHZH 4UT6H 3B3IA 2A0LD 4ZOAA 4PGEA 1AKJD 4HQQH 1HKLH 4KMTH 4Z8FL 5J11C 5C0ND 3I6KA 1NUGA 3F7QA 3HG1E 4M6AA 1HSAA 4XNZC 3VFRB 2IAMD 4TULH 1MCNA 2JJUA 4MJ5B 4R90L 5GZNC 5DJ8B 3UO1L 2RIKA 3H3PH 1MCSA 2Y4SA 4NRXB 4OD1H 1DCLA 3VA6A 5B3NA 5C0JB 5IUSA 1E4WH 2FBJL 1JN6B 4RGMC 1SBSH 1S8DB 5F3BB 1IGTB 3F7YB 4I77H 5FO8B 3RZCC 5C0EA 2YD7A 4CDGC 1BBJB 1T89A 2DQIH 3GMLB 3MFFA 3PP4L 3VI4E 4KHTH 4QRPD 4QRPA 1F97A 5HYQA 4HUNB 1MHPH 5EZOH 5ISZB 1INDH 1T80A 3KPRA 2DDQH 3V5HB 4JANA 4Z7QF 5IVNA 4EDXA 3RWFA 3QO0B 1XCTB 2AEIT 5CD5D 1U8PB 3MXVH 4E5XA 1U58A 3DXAA 3G6JA 5E6IA 3C5JA 1IC4L 2HH0L 2XQBH 1FYHB 4CJ0A 5D7JD 5C71A 1CGSL 2YD6A 3BWAB 3HZVA 1FVDB 1FDLL 1E6OH 4XWGH 1RUAH 3FB6A 3L3HB 3MCLL 4KPHL 3WO4B 1IFHL 3FN0H 5D2LA 2ICWB 4NQSA 1I1RA 1QOKA 3TESA 2ZSVB 3ZDXE 3RUGB 4L8DB 5CSZA 5SWSD 3KJ4C 4KUZH 2XN9E 4MCYA 5FO8A 1YMME 4NBXB 12E8L 1OGTB 2HTLD 2HMID 3RY5A 3SBWA 4E0RA 3L95A 3WJLC 4F7PB 3QWRD 3LB6C 2Q7YB 4M48H 1I1AC 3UPRB 3LPGA 1F3RB 3MRBA 4FQLL 1BEYH 2KDGA 1RHFA 1LK2A 2DQEH 1RSFA 1OP5K 2VABB 5C0JA 1H5BC 3GZKA 2I9LB 3FOLB 2JIXB 1X5JA 4LAQH 3FL7A 3QEHA 3VFRA 4ZSOB 3O3DA 4Q97A 4MNGE 2YPKA 4NQCE 5F88A 1T1ZB 1CF8H 3K74B 4FMFA 4HIIA 3HI1A 1CT8A 3VG0L 1JGEA 1AGBA 2R1XA 2F5BH 1JGDA 3MJ6A 1IC4H 3PWVB 1IC1A 3T2NH 3STZA 3TPUA 5IWLC 4X6CA 3VH8B 3RNQB 4XVSL 4XXCC 4Z95L 4P46A 4OSUH 4A6YB 4TNWF 2Z91A 2DQGH 3TCLB 3VXRD 5IMLB 3BESR 4PRBB 3EYVB 1Q9KB 4HDIA 3O4LB 1L7TH 4NJ9H 4QRTA 5SWQB 1N64H 2L4OA 1UWGH 3W0WB 3FQXB 4MS8D 1GXEA 2NQCA 1A47A 1PQZB 2OP4H 4Y7MA 1B90A 1YPZE 2DI8A 5KVFH 4GRWB 4I18B 3M8OL 3RZCA 1NEZG 2DWEA 1RUQL 1P7KB 5GSVA 3HE7B 3M07A 1SJVA 1WUNT 3D0VB 1OGAA 2ICEA 4GH7B 3QIUA 3EO1B 1U8QB 2XOTA 4JHZA 2YRPA 3NZ8A 5CKAA 3QFJE 3PQYE 1HXMA 3B2VH 4RGOL 5I75B 3FO9A 3BPCB 1BMGA 5JUEL 3F6LA 2C3WA 1Z9OA 1ZT4B 4W4OC 1FL6A 1HH6B 5GRZA 5ICZA 2BFVL 4L4TA 1HHKA 3OAUL 4CW1A 4MDIB 5I1AB 1VFBA 2A74A 2HKHL 2KQNA 4LNRB 4JFXA 3ARBC 4PB0H 3TN0D 3OHXB 4RISH 4WI2A 3HC4H 2YA1A 3AC0A 4IM8A 3VD5A 3Q3GA 2FH6A 1Z0NA 5KSAD 3L3IB 5IW3A 2YUXA 4N0UB 1QVOB 4K94L 4GRLA 1T1XA 3DV4B 1IBGH 4OM0H 3TIEB 4OCMC 1H15A 1DFBL 2ZSWB 4HC1A 4XCCH 1MJ7L 2PW1B 4DZ8A 3O9WA 3BQUD 4JDZB 1EVTC 3QCTL 3MODH 5DZLA 2ADIA 3Q6GH 1QSEB 4L8SC 4H1LH 4AENA 4EQ2A 4PRPD 2CMRL 3JWNC 1HWGB 2IC2A 4H8WL 2AV7B 4R4FH 5JO5B 4UNTA 1NC4D 1IARB 3BIKA 4M7ZC 4F57H 3AFLA 3LDBB 1TJHH 5FO9A 2FHCA 5HDQL 4GOSA 5BO1L 1BVKA 3F8UB 3PQYB 5ID1A 3IFNH 2QSVA 3NN8B 2H6PB 3ULVC 1GYAA 2A83B 1U3HB 4FQ2L 2FJFA 1T04B 1WFNA 2P8PB 5EU4A 3MODL 1IZKA 2EE2A 4BFBD 3O9WD 1REIA 4KK5D 5HY9A 4LCCA 4ONHA 4ZO6A 1AQKH 2OP4L 4NQDA 2E6QA 3HUJA 1SJHB 1W8OA 4XAWH 4AEEA 3MBEC 1A9EA 4XWGL 1KULA 3K4ZA 2BP3A 1TQBC 3MJ7B 1CGVA 4LKCA 1IEBA 5A2KH 3OHXA 1A3LH 3TH2T 4GRWE 2QSCH 4LDEB 2AEPH 3MO1A 1TLKA 4E9LA 5BV7H 3JWOH 4AG4H 5B39A 4APQA 2WNGA 3IYLW 1HIMH 5AG9A 3CSYA 5D1ZD 3T77A 2Y07L 4LBEA 1K4CA 3BE1L 5C07D 1FRGH 3ZT5A 3CMOL 5L0QC 3GGWA 1U3HC 1J8HA 1EO8H 1KXQE 5AYUL 3QUXB 1I7TB 3DMMD 4MAYC 2BVOA 3OXRB 3T3PF 1RIHH 1CXIA 4PJGE 3UAJD 2GK0A 3WNNA 1IGJA 1EEYB 3ALPA 4OV5B 5DXWA 1J1PH 3D2UB 1W2KT 3JVGA 4OF6A 5KSVA 3TWCL 1S5HA 3HI6L 2PO6A 4YHZH 4C58B 2QQKH 2YPVL 3UJIH 1I4FB 3QUZC 3C6LD 1MHEB 1NUDA 2F54B 3C6LA 1ZHLB 5F9WB 4E41E 4PG9B 1ZWIA 5DD5H 3QO1B 3QEQD 4FQIL 5D9SB 1KLFA 5EIIB 3BP4B 1OTTC 5EO1B 3GMMB 1FE8L 5TE4L 2XYCA 3VFMA 3ZHKA 3K2UH 1A3RH 1J87A 4KJYA 1R3KA 4KZDH 4P5MB 5SWSE 5TJWK 1HSBA 3ULVD 2AJ3B 3PF2A 4ONHB 3FO0L 4X6DE 2HAZA 1HYSC 4ZUWA 1W72L 3I85A 2LQRA 3KPRB 5C9JA 2FGWL 2FX9H 4RMUA 1VFOA 2GJ6D 3EJZC 4EUPG 1GPOH 1ORSB 2W0KA 1CICD 2XY1A 2C1OA 2GSIA 4JR9H 3QBTB 1I8IA 1QPXA 5E6IC 3MLUH 2HG5A 5JXED 5BJTA 3QPQD 4ZD3H 1Q1JL 3G5XA 3NVQA 3QP3A 4N5UA 5IBUB 3RVTD 3W9DB 5BXFA 1UA6H 3GRWL 1XZ0A 3V4VH 4ACPA 5I1EL 1HHHA 3AUVA 1MJJA 1IGIL 4HJ0C 3PNWA 3STBA 3NH7H 4N8PA 5F7YC 1NCBH 1BECA 4NNPL 4HQQL 4KMTL 4XNQB 4H8WH 1LVEA 1A6VH 5EU5B 4NC2B 5FB8A 2NXZD 4IJ3C 4Y4HB 2O5ZL 3BMVA 5C0BB 4OCXL 1JP5A 2ZPKH 4JZOA 4X7SH 3G6JB 1FLTX 3ULSA 5JDJA 4GG8A 4WW1A 4Y5YB 4WNQB 4D0BB 5DD0H 2MKWA 3DVIA 3RWJB 1KB9K 2FCBA 3QUXC 4NWTH 4PREA 5BV7B 1BZ7B 5GRXG 3HZYB 2R1YB 4GMSL 3RI5K 5KJRH 2A1WH 4P5TC 2WQRA 4Z78A 5DT1H 4JKMA 2KUTA 4XRCA 5ADPH 1L6ZA 3VXSD 2RCSH 4YFDB 3GJFK 2P5WA 3S88L 5TDPA 1IBGL 2DRUA 2QADD 4L3EB 4YDIH 1Q9OB 2BNQA 4HS8H 1MWAA 1RJYB 2AV1A 2XTJD 4N0FB 1Q9WB 2I25N 3O11B 1S3KL 5DF0A 1I3GL 2NY2B 1ZHBB 3DGCR 1QZ1A 4Z7VE 5BZDB 1VADB 4JFDA 2HLAB 4MQXC 4G9DA 2R15A 4UDUB 1E4XL 4O5LH 3QWQB 3JUYA 5IB2B 5D7JC 2VDLH 3S96A 2Y5TA 1DQDH 1CT8B 1IAII 2A2QT 3KXFB 4OJFL 1L9NA 4U1HA 2B39A 4PLKD 1VEOA 1X44A 5H2BB 1HEZB 3ZSTA 2VSDA 2FX7L 3AS1A 4Z7UA 2EIZA 4XMPL 3TBWA 1P7KA 4P5TB 5GSVB 5C86A 1A6ZA 2F58H 1GRWA 2OYPA 4AL8L 2H3NB 5HYSB 4RFNC 2X4TB 5D7SL 2HTLC 3GMOB 1PYWA 1N2RA 3P9MA 4NSKA 4N0UE 3QIWD 2VXQH 4D3CH 3D3VB 1MAJA 4WWKD 5IB4A 2WZPD 3H3BC 3CAFA 3CLFL 3BEWA 4BH7B 2NMSA 3EJYD 5HHVH 1RZJH 1TCMA 4P5KA 1NLDH 2H26A 5DEFA 2MCPL 4KJPD 1IL1B 4NO2B 1L0QA 2YBRB 3DRQB 4U1KB 5DJAA 2LFGA 2V9RA 4GSDH 2HT3D 4HH9B 3O0RL 1FL5B 1XGUA 1WISA 2Q87A 4PJCA 1R24A 3MJ9H 4XP9L 3K8MA 1CIUA 4G6AC 4UB0L 3QIBD 2A73B 1T2QL 4Y2DB 5EO9B 5GGTH 1V5JA 1Z6JT 5MEPB 5FA3A 3VFUA 3SDCD 5IT2H 1P4BH 2FO1A 2HYMA 4XRCB 5CJ8A 3P3YA 3SE8H 5DK0B 3V7AE 5GJTH 2IAMB 3B5HA 2VERN 2VQ1B 1V3MA 1L0YA 4MXQC 4XMKH 1XGRA 4F57L 5JIKA 3FB8B 3FZUD 3B9EA 3N1QC 4F8QA 2EZ0D 5C0GA 2D7NA 2EDYA 5DQDH 2NR6C 2PR4H 4M1CD 1I3RA 1IC7H 5DVKA 3O4LE 3WLWC 5BS0D 3MRKB 2Y23A 1T5WA 4PJDE 3ZE1F 5EZIL 3KPMA 5ADOH 5T5FL 1JPSL 1LP9E 3JWOL 4AG4L 5JTWA 3QPXH 3SGKA 4JM2F 1RUAL 1X5ZA 1K3ZA 2BVQA 3IU4L 4PJHB 4NYLB 1OP9A 4WW2A 5D7JB 2VKXA 5ICYA 2DM2A 4JO2L 3SGKC 1CFTA 3F7VA 1G0YR 1H3WM 4BSWB 2VMFA 4Y4KD 3RHWF 4BJLA 4JRYE 3MJ9A 4HKJA 4TVPE 3WUWA 2YWYA 5FDYA 1RZKC 2XWTB 5IEKB 1Q0XH 1LEIA 1ZHLA 3SGDH 2D4FA 4K3EH 1V8HA 4ZFFA 1E27B 3OB0K 3QCVH 4QRUB 2IGFH 5IB4B 5ESQA 1DSFL 5T3XL 3L6FA 3FJTA 5DDHB 4LPXA 4LLYA 4V1DE 3WHE0 1WJ3A 2X4TA 1ZVSB 2YPLD 5DSCA 4MNQB 4QHMB 3H3PL 3ZTNH 1CLOL 2BVOB 3OXRA 4C4KT 1AP2A 4ENED 1ACZA 5DLMH 2ITCA 1NAMH 4Z7WB 3RWCB 4ODWA 1PG7L 1XIWD 2CIKB 3QNXA 1KN4H 5T3XH 3EO0A 3DX8A 3MNVA 4J3WA 1YMMD 3VXNA 2IH3A 2X05A 1PG7X 5E5MA 5LJYH 3QPXL 4PD4K 1CD8A 1WITA 4RMVA 1QKZH 3TBTB 4LASL 4F2MA 1D5IL 1DQLL 4HUMB 5AUMB 1C5BL 2QKIA 1ZWIB 3K8KA 5DJCB 4R7NA 5HVGB 4R8WL 1MFBH 2NY3C 1A3LL 2XFXB 2A6DB 2B4CC 3QQ4A 1HQ4B 2YUWA 1ZLVK 1WTLA 4Q0XH 5IESH 4X5WB 2Z93A 1SVCP 3LN5B 1A6AB 4EI5A 3SKMA 3GJEA 2B8OT 3CLFH 4WFHD 4XCEB 4D0DA 4DGVH 2EC9T 4PY8I 1XR9B 5DJYB 2EDWA 4UIKH 3S36L 3WKNA 5DFVC 2YD8A 1CE6A 4XP5H 1IC5H 4G8FB 2BX5A 3U6RB 2B7DT 2DLTA 4WGWB 2AXFB 5DK2A 5INCA 1FSKC 2I07A 5D7LB 1ZA6B 2ZG2A 1QR1B 4XP9H 1ES0B 3IETA 4FXGA 4GFTB 5D2NB 5IFAH 2AS5M 4PJCE 4QY8A 4YUEL 2Q3AA 1E4XI 2V7HA 1V3LA 1D9KC 3QCUL 3FFCE 4YHKH 2R2BA 2DWDB 1I3UA 1GOHA 1UXSA 2LE9A 3VJ6B 4K3GA 1GGYA 4JZJA 1OY3B 3EYQC 4LRNH 4ZYKA 4J3TA 4KZEH 3BN9D 4OJFH 2X89A 2FO4B 3PIQB 3SKJL 1MI5E 5I1JL 4MNQE 1R3IH 3CFKA 5E00B 5KSUA 4G7YH 5IMMB 1OWWA 1RZGB 1RAMA 4YUEH 5E95B 4XVTL 3BIAX 2Y7QB 3OGCB 3LS4H 5HHOB 4LKXA 4YQXH 1QQDB 3QJFA 1Z0MA 1DLHA 4L29A 1C1EH 4S1RH 4XCYB 3UEZA 4HXBL 3KHQA 4IMKA 2FJFB 4HUWA 2ZOKA 3GSNB 2VITA 3LVEA 3PG2A 2HN7A 5D6CA 1KCSL 3VGHA 4AK1A 4L5FL 4S1QL 2O93L 5EN2B 4JFFE 3PQYA 1URLA 4PJ8B 5D2NA 1S5HB 2BOBB 4U6YB 3VXUB 1KJ3L 4FFYL 1QSED 3NCYS 4XVJL 2AV7A 4WO4D 5F93C 1JRHL 1JHLL 2E7BA 1MI5B 5I2IB 1SVZA 1E4WL 4J3SA 4MAYB 3O3BA 1FAKT 4LLMA 1JYNA 1W72B 4UT9L 1TNNA 3DVNA 3MRPA 5CEZL 4Z0XB 3FAWA 3OKMB 3MRNB 3OKLB 5F7LB 4UIMA 1FNEB 2ZCLH 4N8VG 3RRQA 2GUOA 3T4AB 1R5IB 1CICC 5JW4N 3MACH 1QVOA 3MV8A 3ARVA 1IAOA 2O26U 3KLAB 1PJ9A 1OAQH 4MA3B 4AIXA 3PDDA 5DA4A 5IV2A 5TQ0H 4XPGL 3UTPE 4HZAA 5KZCB 4LKCB 3VXTA 2G9HA 2ICWJ 1EXUB 3JVGC 4D9LH 5CCKH 1LO5B 4PV9A 3PUCA 1Z9SA 1EVUA 2R1XB 1OSZB 1MVUA 4LRIA 3DWTA 4WV1A 1IQWH 1FBIL 2HFGH 2ZJSL 4EDWH 4PJBE 3TVMA 4PRID 4JZJC 4CU8A 3SPVA 1T66C 3FOLA 1J7VR 2QTEA 3R4DA 3VRJB 1SBSL 4AT6A 3T0VA 3MGOB 5DEZA 3PV7A 3TZVA 3BIBX 3P4OB 4M4PA 1LEGA 3QUXD 2DQEL 3B6SB 2DM3A 5IQ9A 1NDGA 3NCJL 2IPKA 3OPZL 1CFVL 4GKZA 4YHOH 4EIGB 1YNLH 5I1KH 5GRUH 4KQ4L 2X4NA 1ORQA 2IAMA 3EYVA 4GBXC 4JPVL 5C0NC 3CVIH 2LVEA 3DURA 4IEFB 2QADC 1IGFH 5DHVH 4PGZA 5HHPA 3HB3D 2GCYA 4EI5C 2F54D 4YGVA 2IBZY 5I6XB 4KMQA 5FYKH 2AGJH 3ARDC 5DQDL 1IFHH 1J86A 4RX4A 1HINH 2VDOL 3DV6A 5L88L 5ESAA 4XBGB 1KNOA 3UTTB 3MLYL 15C8L 1NPUA 43CAA 1CDHA 3NGBB 3DVGB 5GJTL 2VZ1A 1U3HA 3NFSH 4FQCH 1JWUA 4ZOCA 2DQJH 3BX7C 5D8JL 5K59F 3TIDA 2O5YH 3JTSB 4KDTA 4OM1L 4RMQA 2A6KA 2YKLH 1I9IH 4JR9L 1HINL 2WV3A 3U83A 4X83A 5JLZB 2EDFA 3Q0HA 5FYLL 4JM4H 4YHYC 5CJOL 1WAAA 3I2CL 3QIUB 5GS1B 2PYFA 2V7NB 2MFNA 5MEQB 5CINL 5KJRL 5J13B 4L9LB 5DMGC 5E8NA 2PYED 3FQUA 1O7VA 5HHME 4D8PA 3WDHA 1KELH 3MLTA 1UZ6E 4S1QH 3QIWC 3L3IA 1QPPA 2YMXH 5JPMB 1KCVL 1JK8B 1KFAL 4RDQG 3BZDA 5D2NE 1I8KB 2H8PB 1JUFB 3ARGB 3ARRA 3QQ9D 2AGJL 1T66D 4HUKB 4OCYH 5C6TH 5CAYB 4N1EA 2ENSA 4DCQB 2I27N 4OZGB 2EIDA 1G9MH 4KRMB 4YDKL 5I15H 4IHOA 3BEWB 4OQTA 4MNGA 4K7PL 2E6PA 3T0EE 3U0PB 4ZNEA 2OMBA 4K9EH 4NNXA 2OQJA 5EUOA 3TYGL 3OL2A 5J3HD 1WFTA 5T1LB 1JF6A 5DUML 4G6JH 2BY2A 4L3EA 5GS1C 2ZZUT 4TTGA 4HPOH 4U3HA 1A1OA 3DUHA 4XNUH 3PHQA 4LLVA 4UT9H 2PW2B 4PUBL 3A67H 4NKDA 4OF0A 4WHYH 5HI4D 1EJOH 4L8BA 5I8CB 2ZCKL 3RTQB 4GRLC 2C5DC 4WWID 2D7MA 2M2DA 1KIQB 1MCDA 1NFDF 2JCCB 3VRLE 5KVEH 1HIML 3SO3B 3TNMB 4HX1A 2XTJB 5F9DC 1KELL 3EW3B 3I75B 4A6YL 1DQML 4R3SB 4PJXF 4EDWL 4BQ8A 2WP3O 4J23A 2DQJL 5D8JH 5CZXD 2G60H 3U2SB 3IXAB 5AYQA 3H2WA 4NZJA 1S7SA 1K8DA 3GSXA 4OBSA 1PY4A 1U42A 1JRHH 1G9NH 3FRPA 4JFQA 3X14B 4FFVC 1PEWA 3E0GA 1KPVA 3O3DB 3CDCA 2MMXA 3O3UN 1U8LA 1Z2KA 4OLVH 4X6BB 3U36B 5EBWB 3U7YL 4YC2C 5HHPB 5D93C 2ZCHH 4MWFB 4HHAB 1P4IL 4KZEL 3X11A 3PJSB 3LMJH 5SWSB 4PP1D 1ZE3C 3D69A 1CGUA 4UAOB 3S3PA 4OZIB 3GSUB 3X17A 1YYLH 1JIBA 1RFDL 5JW4R 3VWJA 4Y19D 1LD9B 4DGIH 3CUPB 4NP4L 3M17A 5HBBA 3QIWB 5GGUA 3FRPG 3EAKA 4J6RL 4JFEA 3HZMA 2NZ9C 3NZHH 4G42A 1Z5LA 2GJ6B 4XGZB 3DBXA 3VXSA 3MTRA 4ALAH 5EU6A 4AH2A 3VH8G 2MKLC 3MGTB 1C5CL 4MCZA 3U7AA 1K3IA 4PY8J 5EBLB 3WFZA 4C83A 1UB5B 4S1RL 3RBSA 3TCXA 4Y1AA 1YQVH 3BD4A 1A7QH 4LP5A 3GI8L 4WVRA 4GQPH 2HJFA 2XNAA 3UPCA 2FHBA 1T6VN 3N50A 3IDXL 4HAGA 4ZUTB 3FO0H 2NXZB 2C1OB 4H88L 1T83A 4BH8A 4PJFF 1S9KC 2AK4D 2NLJA 5HJ3A 3ARSA 4IDLA 3HE6B 1XF4B 1FFNA 2HJLB 3CLEH 3Q6FA 3MRIA 2GI7A 2OJZL 2ZOLB 4MWFA 4MJIB 3VFTA 5EZJB 1Q8MA 1QFWI 2R1WB 1CDCA 4JY4A 5D1XA 1QG3A 1NGXB 1KJMB 3PDGA 1U36A 4V2CB 1B2WL 1U2HA 4OQTH 4YLQT 1DBKH 5EN2A 3KYOB 3WHXA 5BVJB 6FABH 4PRDB 3JV5A 4F9PC 1Q72L 4F37F 3QUYC 1J8HD 1EMTH 4LIQE 5E99L 4H0IA 4R26L 1B0GA 2WBJC 4Q6IB 3WUZA 3RAJL 2X6MA 5IEKA 5KVGL 3QXAB 3GIVA 3C09C 5C3TA 3WV0A 1MCPL 3H9HA 4NUJA 4Z7UF 3VFPA 4JO4L 3P40A 4WWKA 2P5WB 1LEKA 1KB5L 2P49B 1XGPA 5TDOB 4L4TD 4WW2B 5JHDE 1CLZL 4X4XA 1YEEL 3N85H 3FQWA 1C08A 2WAHA 1CE1L 2WLYA 3TBYA 3SGEI 32C2A 1LDSA 3VE0B 3O6FA 1TZIB 4PRPB 5C6WH 3QUMA 5IHLB 4YBHA 5J4MA 3WMSA 1EHLL 5FKAB 5D1QA 5B8CB 2HFEA 5DJ6A 3MYJA 1RZJC 4HUUB 2Z4QB 1CTNA 4EKXA 1INQB 5HGBB 3VU2A 2AVGA 1PZ5A 3T1WA 3P0YH 4ODBD 2F8XC 5T3ZH 1Y6NR 5ECJE 4GG6A 4Z7VB 5BS0A 1JPSH 2FL5B 2ZCHL 4GT7A 4JDZA 1CLYL 1P4IH 4G8GA 3QDHA 1WT5C 2GY5A 5GJSH 3ARDA 4S0SD 4QXGH 4U31A 3SGDI 3BZ4B 1H15B 5DJDB 3BKYH 3MOBL 4HJGB 1MF2H 1T0NA 2PKDA 2UVEA 3ESVF 4WY7L 3FQRA 5I17A 3C60D 2LAGB 3MR9A 3C08H 3GMRA 2BNQB 4GAGH 5EU4B 1MJUH 3HMXH 1KJ2B 1WWCA 5JHLL 4KV5E 3RKDD 1CZ8H 3IJYA 5IGXH 5CP7B 2VZUA 1D5MB 1VSCA 4HWBL 1KB5H 3TA3D 2K1MA 1VEMA 2Z92B 1T7VA 3ALWA 3ZT7A 2M1KA 4ZFZB 3WS3A 3U2SA 1DBML 1B0RB 2GQHA 3Q5YA 1CBVL 4NO2A 4GMSH 4PGJA 3O4LD 3H9SB 5A40E 4XHJD 2CDEB 3BI9X 3DSNA 1I7UA 4PRHD 5D7LD 3TNMA 5JDSB 1O5DT 4JJ5A 4NP4H 1RURL 2NY1D 4ODXB 4OCSH 1PKOA 2KL6A 3PGFL 3B5TA 2BSRA 4DVRL 3IJYB 3V6ZB 1TVBA 4NQEB 2AAVA 3SQBA 4BA8A 1EERB 4WU5A 3VGBA 1EHAA 4FZ8L 4X4YA 1ED3B 5DD6B 4EVNA 2XACC 3RKPA 3V5DB 1JV5B 3RWHB 4KAQL 4PRPE 1D6VL 1EIBA 4X8JB 2YSSB 5MENE 3LN4B 4YHML 5F7UA 3AROA 1XF5A 3RVXD 2RAMA 2UWEF 4Z5RA 2BZDA 3H7BB 5C3LD 4Y5XA 4TQEL 4BUHA 4WW2C 1IILE 4HPYL 4OZHF 3SHSA 4EN3A 5L7XL 4OZIE 4ONFH 3GKZA 5IB3A 3W39B 4N8CL 3MRJB 5F9OL 3MRDB 1AHWB 3U4EA 1KBGH 4CNIA 5FCUL 4X6DB 2EC9U 4XB7A 2NW2A 3SCMD 1QSFE 3EYFA 4OD2B 1I8KA 2X41A 3QDME 1NCAL 1RZKL 1NBZB 3HC0B 4KJWD 1UWGL 3CU7A 4OZHA 4UQ2A 2X4RA 4NHCH 2OZ4A 1FFQA 1A7RH 1MI5D 3SKUD 3EYUL 1JTTA 4BELD 4D0CA 2IQ9L 5KG9A 1I3RB 3BPOC 3QFJB 4G7VH 2ITDB 5B4MD 3LKNA 4OT1H 4X5LA 1WWBX 3JSSA 2ICES 1LMKA 3A6BL 4X8XA 1R5WB 3QHTC 1D5BB 3QHFH 4M43L 3CFBA 2DD8H 3R1GH 4Z7UE 2OMNA 1ZGLP 3RKDC 3EIFA 3UJJH 3INUL 4JKLA 1MLBA 3RA7H 3VMOA 4GW5A 2O5ZH 1QEWA 5IBUG 5CZVL 1AGCA 2DQHL 4XHJC 5C07E 2C3HA 2Z31C 4Y4HD 1WAAF 3T08A 3MV8B 3HHRB 3E6HB 4ZAKC 1FORH 1X6LA 1JZ3A 3RGHA 2EEBA 1OVZA 5KSAC 4GSDL 1P5VA 2H6PA 4ZOEA 4U6XA 1QLEL 5EU7C 2QQLL 3EJYC 5F8RC 3MREB 4X9GA 5J11B 4TRPH 5LVEA 5E7FA 5JDSA 3VDCA 3QRGH 3AREC 2C4FU 4KXZI 4U1GB 3MXWL 3CH1B 3MV9B 1TVDA 4NQCB 5DI8B 3ZTJH 4Z7NF 5J3HC 2V5RA 1YEHL 5DJXA 4ZNCD 4XP1L 2Z92A 1GZQB 2IQAB 4APQB 3BUYB 1G6RA 4TVSa 4ZO9A 2DYPA 3MXVL 4B0MM 1JF1A 4Z0BL 3RX5A 3PGDA 3GBML 3A6BH 3H9YA 4NCC1 5MEPA 3MLZH 1JI1A 4JREC 1IGCH 4NO3B 3TFKC 4XP6H 5L2KD 4PR5B 3EOAA 2A9MH 2VL5A 2VLRD 1CXFA 3U9PH 3O8XB 1MF2L 1AO7E 5FECB 1JGVH 3LEXA 5LGJA 1S9XA 1TZHA 4WU7A 3MLWH 1SQ2N 2GJZB 4N8VB 4ZTOL 2R39A 1M05A 1EBAA 4XXDB 4ZG1A 5HPMB 5BV7C 2EZ0C 3LS5L 4LRNL 3RL1B 3RPKA 5E4EB 4WGVB 2X4OA 4N0YL 4QLRA 5HYQB 4S10A 2Z31A 5CEXB 3V4UH 1R3JB 4YXLH 4MA7H 1HXYA 4QEGA 1U8QA 2HWZH 2BC4A 4KFZC 4K7PH 1EHXA 3DPBA 2AJXH 1LWRA 1LGVA 2OR9L 1N6UA 4ORGA 3BKJH 1A6WL 5AD0A 1YEIL 1XGTA 1MFCH 1MCCA 1EEYA 1MCHA 5C0IB 3X13A 1KTRL 1AD9A 2FJGB 2NY2C 4PJ8D 1M7DB 2R2HB 2V2XA 4OLXL 1ACYH 4MAUL 5I76B 1T7WA 1XR9A 1HN1A 2NY6B 4WWKB 1CDBA 4WO4B 1F4HA 1U8OA 1MJ7H 1J10A 3DMMC 4MAYD 1I85A 4DCQA 1EEZB 4R0LA 1AIFA 4X6EB 4DTGH 1KB5A 1J18A 2R0WH 1JUFA 1JZ4A 2JB5L 1DVFC 4NO0A 4DGYL 3EYUH 1JMZA 3LS4L 2JJSA 3HG1B 4M93B 4JO1H 4MD4B 5LGHL 4QF1B 3THMH 5DRZB 2VDOH 3JTTA 4Y4FB 3CX2A 4PJIA 1NGXA 4XCYA 4Y2DD 3ET9F 5LGJB 4N90D 4LVNC 1F4XH 1U8OB 4ENEC 3QIUC 2EEAA 2I9LA 2JCCA 1KCSH 1R3LA 2DQTH 4LSVH 5F97E 1LO4H 2MQCA 4YXKL 3WFCH 5IMOB 2R4RL 1GOFA 1YY8A 3WIHL 5FK9A 3MSPA 4QXUH 1B3JA 1Q9OA 1A2YB 1J1OH 1OT2A 5DVOA 1ZLWH 4NKIH 4D2NA 4Z7NE 3GRWA 2VE6A 4LOUD 3PP3K 2ADJA 3BGAA 4LL9A 1FNGB 3WXVH 3QQ3B 3NN8A 3GSRB 2F19L 4Y5YA 4F3FA 3BP5A 4I5BB 5EUOB 2DS4A 1S9WB 4OIBA 1DANU 4UMGA 4JPWH 4PREB 3RL1A 4QWWD 4M9PA 2VUYA 3EHBC 4ZFGL 3VFOA 4L4VA 5JXEC 3T0ED 1JYWA 1X3DA 1SJEA 4Y1AB 1BAFH 4M3KB 3GSVA 5IJKA 1L7TL 4NJ9L 1UKTA 3NIDE 3U7WH 2D7PA 4ISVB 5D7JA 3GKWH 4B7LA 4NDMB 5HGHB 3S7GA 3ILQD 1A4KB 3WFBH 3F6IA 4AM0B 2ADGB 3EOBB 4LASH 1P1ZB 1S7TA 2DICA 1J0YA 3VXUE 1R5VA 3SJVA 4DZBA 5LCVH 1XIWA 4NQDE 3H6JA 2HFGL 2CGRL 4RFEA 4JFEB 2XQYG 4QOKE 4PJAF 3MUJA 3VXMD 1NCUA 1UGNA 1LE5B 1HHKB 2ZUUA 1IAIL 3ARTA 5L2JB 2HJKB 5JW3L 3M45A 5BJTB 3QI9A 4FQ2H 4HS3B 2IH3B 4FQIH 1ZSDB 1OQOA 1CG9B 4TQEH 3V6OC 1JNNL 5F9JA 3E2HB 4RMWA 5EORL 2WINA 1UT9A 5HI3D 3PJSA 5KN5B 5EBMB 1OAYH 3QXTA 3KPQB 4P5TD 2F8OA 1WSST 4BFIA 4JHBA 4HCRA 4YAQB 5H8DA 5D2LB 2CR6A 1CDUA 3F12B 1KTKE 5ID0B 4NUGH 1ZVSA 5HYFA 5L2JA 1QA9B 2XG4A 3WNPA 2R9HC 3EYFB 5C1MB 3GI8H 3FCTA 1EHLH 2J3SA 3GMQA 4S11A 2FWOA 5IESL 5DRXB 4E5XB 4OCRH 5EIIA 4DQOH 5LG1A 3NCFB 2HJFB 2XNAB 5CJBA 1U95A 3ULUE 2H26B 3KJ4B 4PGCB 1A1MA 3K46A 4NUGL 4HK0B 3FOMB 4Q2ZA 2PCPB 3IF1B 5K9JH 4G7YL 4RNRA 1TTGA 4DEPB 1KLGB 1FNEA 1DN0A 2DM4A 2JE8A 3D3VA 1A02N 4YHPA 1DUZB 1BFVL 1JGEB 1ZGLA 2OZ4H 2LU4A 3SDAB 3UC0H 4QWWC 1FFPB 3KYMA 3B2VL 4RGOH 4OF8A 4OV6F 5J1AB 3T0EC 4NQXA 1A6ZB 1T0MB 3VRLF 4KKCC 3D5OF 5C09E 2R0ZL 1RFDH 4YDVB 1TPXB 1NMAH 1T5WB 5I8OL 3UTZA 2HVJA 1FNSL 4G9FB 1M71B 4AQ1B 1S7WA 4XPAH 4Z76A 4KQ3H 2EKSA 1FGVL 4PJ7E 3T3MF 4KJQC 3SE8L 1VERA 2IMNA 3RA7L 3B43A 3QJFB 4CKVX 5ALCH 4LU5H 4LRIC 1ADQA 4OFKA 1RK1B 2IFFH 2K3TA 3C9NB 1LE5A 2FYYA 4KKAC 3BGFC 1KTLA 4LPTA 4NKIL 1ZHNB 2WBJA 4U1IA 1U8MA 3OWEA 3S4SB 1P7QB 5E03A 4JFFB 5EBWA 1Q94A 1I1YA 3U4AA 1G7PA 3L3OB 3DO7A 2DTMH 4YDIL 5ERWB 4HIEB 1ULVA 4YO0B 2F5BL 1JWMB 4TPRH 4U6VH 4UBDC 3QIBC 4L4TB 2NX5A 4H0GA 1BVKB 2FIRT 2P7TB 4Y4KB 3ZMRA 4JFHE 2WSKA 1F58H 4JY5L 3E2HC 1KIRB 4GBXD 1HILA 1G9NL 1VACB 2R1YA 1AXTH 3BHBA 3QH3A 2EO9A 3SO5A 3V5HA 4PUBH 5JA8B 5HYJA 1T03L 3CLEL 4WJ5B 4A2LA 3L3KA 5HTSA 5E08L 3FT4B 4U1NA 4YEFA 3BZEB 4LFHD 4TULL 4LHJB 1ZHKA 4MSWA 1Y6KR 2ZP0T 4NHUA 1T83C 5DYOB 5MHSD 1CFSB 1D9KB 2DQTL 4ELKA 3UZEA 4RIRB 5IIEB 5J06A 4TVPH 4FQPA 1KF9B 4UOW1 5BZWB 1VHPA 4I77L 4G8EB 2EDLA 3DTXA 4OKDA 1WAAE 5D7SH 4YO0A 4NNXB 1JHKL 3HR5B 2PTTA 4PJAB 2VZTA 3BOVA 4CW1B 4JLRA 1HQ4A 1MAMH 5DMIL 3PWNA 3D39A 3OTTA 3QUZB 2DQFB 4KKCD 2VXSH 4HLZH 3CH8A 1F6AB 1OPGL 4MA7L 3NAAH 1GC1C 5AUMA 4WHTB 4G3YH 4Y5VC 1INQA 5D5MB 1BJ1H 3U1SH 4KRPB 4TSBH 3PXHA 4KJQD 4K3EL 1MRCL 3T4YA 4NO3A 4JM2D 3BD5A 2HKFL 3MJ9L 1E28B 4HC1H 5TE6H 5K9QI 4NHCL 1A7QL 1VGEH 3GO1H 1JWSB 1KPRB 5B22A 1KPUA 2W9EH 1NBZA 3HC0A 3VFSA 1DVFB 3T2NL 3K1KC 3QQ9C 1LE9B 2YZ8A 1AY1L 3KPLB 4M4RA 1MVUB 4NQED 1AGEA 1E27A 3QUKB 2XN9A 4CNIB 3OJDA 4Y88A 2BHZA 2JTDA 2BCKB 3L3DB 4OLUL 3MJGX 1MNUH 2Z93B 4ALAL 1S7XA 5FGBA 4I48A 3GMMA 3WIHH 4LVNB 4ZFOA 1GAFH 2B5IB 4XPFL 2DKMA 1B0GB 3MREA 1FZMB 2ZPKL 4YDLC 3A67L 3JTSA 3QHZL 4MJID 4L8DA 3W0WA 3G08A 1MHEA 2X4PA 5GGQH 3NACL 3KJ6H 1GGBH 4N5ED 5FHAH 1YYMH 1K6QH 2YD5A 4PJ7F 1UQSA 4K23H 1AXSA 1S7VB 4MA1C 3KPPB 3O3EB