4NBZB

Crystal structure of tcda-a1 bound to a26.8 vhh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
b'VKLEESGGGLVQAGGSLRLSCAASERTFSRYPVAWFRQAPGAEREFVAVISSTGTSTYYADSVKGRFTISRDNAKVTVYLQMNNLKREDTAVYFCAVNSQRTRLQDPNEYDYWGQGTQVTVSSGSEQKLISE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TcdA
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Immune system
total genus 32
structure length 132
sequence length 132
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nbzB00
3CFDA 5J6HB 4XVJH 1SJEA 4R2GB 1RI8A 2V6HA 1RZFL 4ZUUB 3EJYD 5DT1L 1GGBH 4M6NL 1RUKH 2R56L 1D5MB 1PDKA 3F7PC 4KPHH 3VMPA 3MRJB 4JPIA 3NTCL 2XQBH 5L88L 3BD3A 1RJLA 3G08B 2R0LL 3CK0L 3EO9H 3GRWL 5TQ0H 2MPAH 2IH3A 1T7WA 5DUBA 5EO0B 4BK5A 1NKOA 1V8HA 4FXGB 4YGVA 4EUPA 2MTPA 4U6VH 4MJIB 4XHJD 4XP1H 4MB4A 4LLDA 4XRCB 2Z35A 3QXVA 3KPPA 1KV3A 2ED8A 1T0MB 4PJ7B 3P73A 3PWPE 5BV7L 4PRNB 3F6LA 3MRCB 1IC4H 2DF3A 4ZFGL 4F9PA 4HUWB 4IOFC 2CLZA 5EOTA 4WFHE 5BQ7B 1FG2B 2YPLD 4F9PC 3AC0A 3CVHB 1QSZA 3SE9L 3VFWB 1P84J 4BH7B 1J8HA 2H26A 2AJVL 4I3SL 2EDJA 3QQ9C 4LSTL 1KFAL 3PABB 5C0RH 3HI5H 3IXTB 4KKCD 4E41A 3DLQR 5JOPD 1JP5A 1FFPB 3DROB 3QXUA 4U1SA 1FNEA 2CKBH 1S5HB 1QZ1A 3BISA 1ZSDB 4ODWB 2BY3A 2H32B 5B21A 3MRGB 4ODSH 3KPLA 1HSAB 4X6CE 2O61B 5F9JA 3GSRB 1MLBB 2O5ZH 2XXCB 2YK1H 2ESVD 1DR9A 4HKJA 4PJGF 3TJEL 4WI4A 1U8OB 2XRAL 3VRLF 2DMCA 4YIQA 3OKMB 3ULUL 3CU1A 1X6NA 1DQML 1CL7H 1JHTA 3HE6B 3CLEH 4MAYA 4HS6B 2EH8L 1RJZA 1DJSA 4LF3A 4W6WB 3DMMB 4NCC2 1EEYB 1RUPL 4EI6B 5L2KE 2Q87A 2EYRB 4X8JA 4FZ8L 5FF6B 4MAYC 3EYQD 2FJHA 3MLVL 5DA0B 5DJDB 3VXQA 1WT5A 3VXRB 5EZIL 3FOMA 1WAAE 4TPRL 4XNXH 5GRZA 4G7VH 4HXAH 4LCWB 1WCQA 1R3LB 4M61A 5HY9A 2YRLA 3M17A 2DQCH 3BKML 2ARWA 1KEGH 2EECA 4OIIH 2YA1A 3KPNA 5IGXH 1DVFD 1T1WB 4KVNH 5E9DD 3ET9F 2VLJD 3FO1A 1P4IL 2C1PA 1MCNA 4PLKD 3C08H 1BQLL 4N90E 5D70L 3W39B 4OIBA 1FYHB 2RIKA 1DLHA 1N0LA 3H6JA 4O9HH 2H9GB 4TTGA 5C07E 5JHLL 4CVZA 4RIRA 3QIWA 1WIPA 5J12B 5FM5M 4X8XA 5CEXB 4NFBA 1T6VN 1K3IA 3QIWC 1A6TB 1X3DA 4NQXB 1AQKH 2AJZB 4JN1L 1KT2A 5IKCA 2K3TA 5CINH 3HC4H 3WJLA 4P5MA 1UCBH 4HS8L 4HKXB 5C0BD 1ZLSL 1A4KA 5BJTA 3OKNA 5C6TL 3SDCA 5HGGS 5F44A 4PJIF 3WJLC 2BOCA 2V5YA 5T5NG 3B2UC 4WI2A 4X98B 4WEUD 4Z0XA 4HHAB 1MF2L 4ZUWB 4DN4L 2FX7L 4B7LA 3FT2B 4P99A 5I2IB 2HT4C 5F72S 2XT1B 1NCCH 4BFGA 4NQCB 1Q0YH 2AP2A 1FC1A 3EGSB 4K2UH 3WFEL 1ULVA 2ADFL 4ELMF 3GSXB 5C0AE 2BNQB 4OD3H 5KTEL 2ZSVA 3KYOA 4QTHB 2EKJA 3WIIH 1N26A 4P23A 2BNRD 3P0GB 2IFFL 5IMOB 5IUSA 5KSAB 2R8SL 5AYQA 4M5ZH 4U1LA 1TCMA 3S96A 5JOFA 2P24A 4P23C 2RCSL 3THMH 4LL9A 1OAUL 3L5HA 1OAXL 3F7VB 4KHTL 1I1FB 1GJIA 4YHZH 3STZB 4AH2A 1N6VA 3GSQB 2EDBA 1OARH 4N9GA 1FSKC 5ESQA 3BSZH 1A64A 2KL6A 3K46A 2BRQA 2PCPB 1DUYA 4MAUL 4NZUH 2J4WH 2UUDK 1CFVL 4ZNCD 5HYJD 5EUKB 1NPUA 1P1ZB 1KCRH 4LNRA 5I18L 1LO3L 3S9DB 2DWEA 1MCEA 3OJMB 3TZVD 4JFPB 3MLTA 1TZIA 4XBGA 4WHYH 1MCBA 3BEWA 1F3DH 5D7SH 5GISL 4CKVX 2VXQH 1HKLH 2R23B 2QQNL 5B22A 3ZHKA 2BFVH 3P40A 1I9RH 3WNMA 1RZ8A 3FQXB 4Y5YB 3G6DL 2WLYA 1IC7H 3QG7L 1FAIH 4GT7A 2PO6B 5T3XD 3MBXL 1NCWH 2F53B 1JHLL 4WI6A 5GZOC 1VPOL 3OR6A 3W82A 1J0HA 1QHPA 3WXVL 5FAAA 1WIOA 1FO0L 1CFSA 1TIUA 3MRHB 4PP2B 3JSSA 2FLRT 5F96H 4WUKH 3G6JF 3DXAE 2G5BA 3MXVH 2XKSA 1H8OA 2OTUB 1YQ2A 3BKYH 1KELH 3EOAA 1OAQL 4DQOL 3GBLA 1JI1A 3C09B 2BOBA 4G8FB 4KDTA 3BP6B 1F90H 3JVGC 3L5XH 1NGQH 2VLKA 3S36L 5F21B 5FYLH 4R2GD 1B2WH 2OCFD 4TVPE 2XWJA 2UYLA 1CFBA 3EYSH 2QR0B 1IBGL 5HHMB 4FN0A 2WINA 2FDBP 3O6FB 1R0AL 4TOYL 3NCYP 5E7BA 1LEKA 4Z7OE 4Y2DA 2WP3T 3PWPA 4NKQB 5KVGL 3EDJA 3ARGA 4HDIB 4LLUB 3QQ3B 3KLHC 2ZCKH 1A14H 4AIZA 4Y2DC 4AENA 1PBYA 4AY0A 4KTEL 1N59A 2P8MA 2N7AA 1ZANH 1T22A 1DUZA 3ARGC 3NZ8B 3RIFF 4JLRA 3IU4L 4BZ1H 4J8RA 1YUHB 4CADB 3UTTE 1UZ6E 1TZGL 4MJID 4GUPA 3MO1A 3WL9B 3C6SA 1ZGLA 2HFFB 3LOWA 4M43L 1VFAA 4R97B 4UTBH 4JG1L 4CRPA 1OW0A 3GSVB 1K4DA 1CVRA 3MRRA 1R3HA 4RNRB 1MI5D 1OW0C 3LQZB 3H3PH 5T3ZL 1MFBH 3WLWD 4A6YA 1NSNH 1AGCB 3H9YA 3ROLA 3MV7E 4ZUSB 5IR1A 3F62A 5H94B 1KEMH 3NIGE 4RAVB 4JFEA 4QCIA 4RA3A 2ADGA 1NDGA 15C8H 1J9CT 4QYOA 5EN2B 4MYWB 5EU5A 1JBJA 4I1NB 5E24E 3D6GA 1ORSA 2JCCB 4NO2A 4PJEE 1NAKH 3AB0B 4YO0B 5F1IB 4LRIA 1CG9A 3LKSB 1CK0H 5T5FH 3TBWA 1CD9B 1NUNB 4S11A 1MJ8L 3DRQA 5L2KA 4KY1H 5T1DL 1T5XA 5EO1B 3BO8B 4LRIC 5IB1B 2FIRT 1ITCA 1VKXB 3KLSA 5JXAL 4JY5L 5C3LD 5CZVL 2J88H 2E7MA 3LQAC 5I8KL 1RK0A 3CVHH 3D18B 3LDBC 4JO3H 4QRQB 3T0BA 1AI1H 2R0ZH 5BZWA 1A6ZA 3C2SA 3NACL 1KPVA 5D72L 2ZPKL 4GS7C 3HE6D 1UJTA 1KG0B 3HB3C 1MCQA 1XGYL 1AXTH 2W0FB 2GIYA 5CJXA 3DMMD 4G6KL 2GFBB 1UM5H 2A1WL 4MA1C 5E8NA 1NGWB 5JHDA 4PJBB 5JLZA 4OGZA 1G7JB 4U33A 4HWUA 4LLVB 3ARXA 2D7TH 1QSEB 5CJXC 3RVXC 2H32H 1FYTB 4OZIB 3VXRD 3MRLA 3LB6D 4NT6B 4XVJL 4LCCA 4LCWD 5FUCC 4WU7A 1FFOA 2YR3A 3QFDB 4G6MH 4UAOC 4LCCC 5DI8A 1GGBL 2A6JA 3LPWA 4NN6C 4OZHF 3ROOB 3MJ9H 1RIHH 4XZUB 3IKCB 3S6CA 4APQB 1P7HL 4KPHL 1T21A 3V7AE 2FJFA 2XQBL 2PR4H 2DM4A 3MRQA 3EO9L 1DL7H 5TQ0L 3MOAH 3KPSA 1FV1B 3MV8E 1DBMH 4M5YH 5HYSG 3IJYB 2BNUA 3KJ6H 3KG5A 2H2PC 5JIHA 5K9KB 4XP1L 3AY4A 1E4WH 4N5UA 1P4LA 1ZA6B 1UXSA 1ZHKA 5DTFB 4F7PB 2Y25A 1ACYH 1XGPA 3KYKH 5D7IB 4Z5RA 3AY4C 1IC4L 2DLGA 4KI1A 2R1YB 5MI0B 4L4VD 4HIJB 2PTVA 5FOBA 3ZDXF 1F5WA 4PJCE 1T2QH 2AVGA 1BBJA 4XP4H 1ND0B 2ZZUT 1QPXA 3CMOL 3OHXB 3LN4A 3U4BH 2FEDC 3HE7D 1FFNB 2FIKB 2BXYA 4QNPF 3LZFH 5IBUB 2WZPD 5IB4A 4WUUD 3L3HB 5F7FA 4F7CB 4I2XB 3LN5B 5D71H 2CKBL 1TZHA 4JN2B 4J3XA 4H1LB 4XPTH 2DKUA 4ODSL 1JCKA 4X99A 2CGRH 3O9WD 3LQAH 1FZJA 5GRUH 2CRYA 2O5ZL 2YK1L 2D7MA 2EE2A 4UTAH 3O4OC 1P7KA 1YMME 1FVCB 4GLRI 2MCG1 1IAIL 2OM5A 3HC3H 1MQ8A 2F74A 2FH6A 3QDAA 2I9LA 1CL7L 3CLEL 5MEQB 3V6FB 3QUXB 4QWWD 2YXFA 3BRGC 5SX4I 2DBJA 3BIBX 4LHUG 4ZFOB 1GC1C 5HGAA 1FZOA 3ALPA 4W4OC 5I30L 2UWEE 5I66B 4Y19E 3BQUB 3R0MA 3OAZH 5FHAH 3RY6A 1XCTA 5BRZD 3FN0H 2ATKA 4YBLB 4G7VL 2E6JA 2FBOJ 2A6DB 2OXGA 4R97C 1AGDB 3QO0A 3GSUB 1KEGL 1BLNA 5MERB 3RPIB 5IBUG 3KXFB 2PO6D 5IGXL 5EZLB 2HFGH 1R3IH 1Q9LA 2AXGA 4KVNL 5A16B 4WU5B 4H1LG 1OF2A 3LSOB 5GS1B 4XWOD 2DD8H 2L0DA 1I1RA 2GTWA 1AGBA 3RWGB 5GS0C 3LKQA 2F5BH 3WXWH 4LCUB 5B8CA 5DHYB 3WHE1 2AK1L 2I25N 3S35H 4ZDHB 4O9HL 5K33A 4IDJH 5B8CC 5C0GB 2X2YA 1A1MA 1UA6L 3HPJA 5I1JL 5C70A 4V2CB 3O6LL 2HT2D 4GKOA 3EHBC 3R4DA 1LP9B 4X6EA 2X4SA 3AB0C 1YYMH 5GSRB 1NANH 2AGJL 3MJ7B 4PJ9C 4JJHA 3PV7A 5ACLA 1AQKL 5DQ9A 4FQXB 2HG5A 4Z7WB 5HYSA 5HHMD 2Z31B 3HC4L 4NDMB 3O6FD 4IEFB 2EICA 1UCBL 2PW2A 4JVUA 4LLAA 3BPOB 2H2SD 4JREC 4M4RA 5JXED 4DN3H 3SE3A 2CKNA 2CDEA 4RMTA 1U58A 5JUEL 1DQLH 5E1HB 3ARPA 5GS3A 5MHSE 4LPWA 2D4FA 2OP4H 5EC1A 3SE3C 2IQAB 4QRRA 5CJQL 3L9RB 3MV7A 1NBQA 1X7QB 4OGXH 1OGAB 4K2UL 3E2HC 3RWHB 2HTLC 4S2SB 1OGTA 3HZMB 2QADB 4OD3L 3AMLA 3RUGA 3I02B 3QWRD 2VYRE 3WIIL 4K3JH 3SDYH 1PG7H 5SWSA 3QFJD 1GGUA 4QRUB 4LCIH 4M5ZL 1FC2D 5CZXC 4PJEA 3THML 1SEBA 1R24A 4HPOH 3OXRA 3QUYA 5FO8B 4YHZL 1JYXA 5BS0B 3VFGH 1OARL 2W60A 1I8MA 3BSZL 1RZKH 3QUYC 1S7QB 4NZUL 2J4WL 3QDMB 4XGZA 8FABB 2HRPL 1KCRL 3L7EB 4OI8A 5C09D 2ATPB 2VQ1A 4L29A 5HHPB 2FHBA 3IB4A 3TCLB 3HG1D 4YHLH 3DRTB 2F8XC 3RX5A 4LLMB 5D7SL 1AR1C 4YWGH 3ZKXB 2VXQL 1HKLL 1BGXL 1CGYA 1N3NA 3HLAB 2BFVL 1I9RL 4NNYA 1NAMA 4MNQD 1IC7L 4LHUA 1UZ8A 4JM2F 1FAIL 1A7BA 1G7HA 4XMPH 2ORBH 5HGDA 4OF3A 1P5VA 4JZNB 5DRXB 4P59H 2YD8A 5IW6A 2GKIA 1MVUB 4XB7A 5I6XC 4X6FA 3O2DA 4DKEH 5F96L 5IOPA 3TFKD 4WUKL 3FRPG 4Y88A 1KELL 4GRLB 2V5RA 4NC2B 3SGEI 5F3BB 1MAMH 5MENE 2X9WA 1UJ3A 3P0VL 3J8F7 3D39E 4K7FB 3S3SA 4L3EE 5IQ7H 1A1NA 3ZYOA 4R4ND 1NCAH 3GMLB 1NGQL 1UJ3C 3NIDE 5F8QC 5FYLL 3P2TA 1G7PA 1B2WL 3ALXA 3AS0A 3KGRA 3EYSL 5ACMA 2F15A 4YXKH 4EI5B 3GMQB 1XGUB 2M2DA 1F6AA 4F8QA 3TA3A 3RGVA 3KPRB 4PRDA 4R7DB 4K8RD 1X5YA 1GZQB 3UZEA 5F9OH 2YPVL 2VE6A 1A7NL 3WFZA 3GB7B 1D6EA 1MLCA 2ZCKL 1A14L 3RGVC 3B3IA 3TA3C 5I0DA 2EZ0D 1ZANL 1F4WH 4OV6F 4ZYKA 3I6GA 5ID0A 5HHQB 1QRKA 1PG7X 4BZ1L 5IQ9A 1IGJA 1EGJA 2Y7QB 1G0XA 1D5BB 2YBRB 2HVJA 4H5SA 1CFTA 2DTSA 3BQUC 4UTBL 3KLDA 5EU6B 5E8EB 5EIQA 1LK2A 4YBLC 3VG0H 5DFVC 4O51B 5E5UB 3DIFA 4LKCA 1NLBH 5CSZB 2B0SL 3H3PL 1MFBL 4FMKA 2Q3ZA 1NSNL 1D9KD 3DUSA 1WEJH 2OBGA 1UB6B 5GS1C 1KEML 2E6QA 1BIIB 5KZCD 1YMMA 5TDPB 1C12B 2FH8A 3D0VA 3TBSA 3X12A 5IG7A 15C8L 2FBJH 4XWGH 4F2MA 1KNOA 4LOUC 5DURD 3GMMB 1NAKL 1S3KH 3FRUB 3K7UA 2XACC 3U4EA 4BM7A 3UYOD 3IFOA 3SO3C 1X4ZA 1CK0L 2XTJE 1F3RB 1HQ4B 4KY1L 3DNKA 3NIGF 1QFPA 1C1EH 4JCLA 4X4XB 4ZXBA 4AG4H 2R0WH 4HMCA 2X4TB 3RRQA 2XI9A 5IHLB 3CVHL 2DYPB 4P4RA 3H9SD 1CGTA 1AI1L 2R0ZL 3BP4A 4ZXBC 3MV01 2QEJA 2R29H 3UX9B 4IS6A 3O2DH 1AXTL 3QUXD 1VGKA 2R15A 3B9AA 5IMLA 1UM5L 1WIUA 1YC8A 3WS6A 2QSCH 1H8NA 2BK8A 2D7TL 1KCKA 3VRIA 4H1LH 5C0FB 3JV6A 4D0CA 4L8SB 3WS6C 3IU3A 1V3MA 1JV5A 4X5LA 4JFDE 3RVTD 2P5EA 2LV4A 4DEPB 4LFHG 2MSPA 4HS3B 5CIPB 2QADC 4KHXH 5GZND 3UBXA 1KTKE 3R06A 4ODVH 4P2OA 5ECJE 4G6ML 3D2UB 3RAJH 4O2CB 4YXLL 3MJ9L 4PJIB 1RIHL 1VA9A 2AABH 2YD2A 1CE1L 1PYWB 2WIIA 4P2OC 5C92A 4M48H 3ILQC 4PV8A 4U1HA 3QB7C 1VB9A 2NY6C 2Y36L 3U0TB 3GIZH 5EUOF 1N6UA 1QFOA 5C08E 5J89A 1RJLB 2PR4L 2BVPA 3EYFB 3MOAL 4YGVB 4M5YL 2APWA 4RMWA 3KJ6L 1EGJH 4L8BB 4HWEH 4P2YA 1E4WL 1T04A 2VDMH 5D6CA 5SWZE 5I8CA 2BDNH 3CFEB 2X10A 4Y16B 4NC1C 3UBXI 3MUY1 1ACYL 3FT4B 3KYKL 1Z9SA 2VITB 3EFDH 1JPSH 1U8HA 5DHVA 3CSYB 1ORQA 5AWNL 4RGOH 1QPPA 3GEWB 1UM6H 4P9MH 4FQXD 4KJYA 4S1RL 5J1TC 3LKNB 2PNDA 1T2QL 1HHHA 1KB5A 2W59A 3FONA 3RQ3A 4CMHC 2EXWD 4DWHA 1MH5B 4BSWB 4NPYB 5HHOB 2VL5B 1MCOH 1XGTA 1T2JA 1L9NA 5TQ2H 2NXYC 1Q1JH 3U4BL 3IDNA 1CDCA 4E41B 1AGEA 2V2TA 3NA9H 2NY3D 2X4QB 1QFWH 2ZOLB 4Z78B 4YLQT 3OKEA 4U1SB 1NGPH 3HC0A 4PJCF 4G6AC 4RA0C 1OGAD 4Z7VF 4MNGB 1UVQA 5J4MA 4XPTL 4KJPD 4UIMA 2EDOA 2CGRL 1NFDB 3O45B 3O3DA 1YN6A 3G6AB 2Z92B 3TVMD 4HH9A 4UTAL 3EOTH 1IAOB 4MQ7B 4CVWA 2R4RL 3MFGB 4CVUA 5CD5D 3HC3L 2EIZB 5BS0D 2VH5H 5AYUH 4JRXB 3VWKA 4OD2A 3H0TA 1MFDL 1F00I 4EZMA 3RTQA 1U93B 4CDHA 5ITFA 4LVNB 2PYFA 4P48A 4TUKH 4V1DA 2DQIH 2HTKC 4OAWB 3VXQB 3VFVA 3RTQC 5FHAL 1PJ9A 4GAFB 1FDLH 5JO5A 3FN0L 2GJ6D 5HVHC 4PJGA 3V8CA 2NPLX 2C3XA 3VD5A 3GSOA 3QQ4B 4WWKB 4GRMB 1F11A 4WJ5A 3STLB 3FT3A 3ULVE 2HN7A 4GRWE 5MENA 4J4PA 1M6OA 3VDCA 3D39A 3OB8A 2HFGL 3CH1A 4IHOA 3TIEB 3GSNB 4XX1G 4F3FB 1R3IL 4S1DC 4J4PC 2DD8L 3OL2A 1ZVSA 4NN7B 1CCZA 3I3EA 3WD5H 3WXWL 4PUBH 4MX7A 1GVIA 3S35L 5D7LE 5F1KC 4MHHG 2NY5C 4GRLD 4HFWB 1NGXA 3W0WA 3ARSA 2YWZA 4JZOB 4LGSB 1OLZA 2EC9T 2HKHH 4QXUH 4Y4KB 2P8PA 3QDJE 1QFUH 3UTSB 4N1CA 3P4NA 3E6HA 2NY0C 3BZFA 4EI5D 3TBTB 1KB5H 5ID1B 3RNKA 2ZUVA 3KPRD 2ZG1A 4Q9RH 1JZ7A 3IAGC 4PJDF 2H6PB 1PFCA 4DN3L 2PN5A 3ARBB 1QQDA 4H88H 1DQLL 4XMLH 5EB9A 4EN3B 2NYYC 2OP4L 1G6RB 3JTSA 4YZFF 4L1DA 1MFCH 3L3OA 4OGXL 4PJFF 2ZSVB 4P2RA 4R26H 9CGTA 3RY5A 5EU6D 4Z77A 4K3JL 3SDYL 4YFLF 1PG7L 3HS0A 4Y5XA 3QPQD 1MAKA 1WZ1H 2I27N 4U1LB 4LCIL 3DTXA 2BVTA 2OR9H 1JNHB 5F7DA 4HPOL 4PRPA 3TH3T 1U3JA 1U8NB 4O5LL 4Y5XC 4Y8AA 3P9LB 5JW4N 3VFGL 3QG6A 1QVOB 4TSBL 3VCLA 1FQ9C 1URLA 1RZKL 3EO0B 2YD1A 4ODXB 1E4KA 3U9UB 4ELMA 1UQSB 4M8QB 4NQSA 3CFCH 1CGVA 3SE4A 3DSFH 1BOGB 2FD6L 4XBEH 4WTZG 5A2LH 1E4KC 3MLTB 1TZIB 5HI5D 1O7SA 4M1CD 4X7CC 3WV0A 3TPUA 3SE4C 4YHLL 3MCKA 2YD4A 3BEWB 3PWVB 4WHDA 4YWGL 2OK0H 1RZ8B 4FQHB 2LU7A 5DMGC 2D31B 3F7RA 4TUJB 4E42B 4NQDB 2A6KB 4GXUN 1O7VA 2ORBL 3D9AH 4DUWA 2WBJA 4OLXL 4S0SD 4G42A 5DGQA 2DYPD 1H5BB 4P57B 5FKAA 3OJDA 4P59L 3TN0A 1CDHA 4O4YL 5ISZE 1SJXA 1RMFH 2CIIA 2WBJC 5GGUB 5LWYH 1CFSB 2QJDA 3UMTA 4KAQH 4DKEL 4IMLA 3VI3F 1YNTA 2VOTA 3OXSB 2HJLA 4QHMB 1MFAH 3C5ZD 4NQEA 3FAWA 2G9HA 3UPRB 4QKXB 1NJ9B 4PJHE 5L6YL 5J1AB 2BOBB 4NJAL 5C08A 4MA3B 2J7LA 1A6VH 1NCAL 3RBSA 1W2KT 4R0LB 1IARB 4WW2B 5EZOH 1DQQA 1MFEH 2XWJB 4X4MA 4NRXA 4ONOA 3FB7B 4GKNA 2KQMA 4YXKL 3D2UD 4IMKA 3MNWB 5SWZA 4KWUA 1TVBA 4YHIA 3DO7A 3PWPB 2O26U 4POUB 5HI3C 3G6JA 4IMKC 2X70B 2OL3B 3NN8B 1UH3A 5LBSL 1N59B 3TWCH 3NIDF 1PEZA 1T22B 5L2JA 1T2XA 4C83B 1F4WL 2FJGA 1KTLB 2DL2A 4XP6H 1DBJH 1EAPA 5DC9B 5T1KA 4JPVH 1VFAB 1Q72H 2NY7H 3BIKB 4EQ3A 4Y16D 3VFUA 4IOFD 3VG0L 2NTSP 4LDLB 4HIEA 1KJVA 3VMNA 5B38B 2BY2A 4LPYA 3SDAB 5DVLA 1KB9J 2MJWA 3UAJD 1MRCH 5I0ZA 4JHAH 5K9OB 2Z91A 4URTB 1HYSD 4YEFA 3QQ9D 1WEJL 2DWDB 2Z8SA 2A38A 4X6CB 5IR1B 1E27A 1JK8B 1U8QB 5HHOD 4D2NA 1P9MA 1BD2E 4Q97A 2NCMA 2QSVA 4XCFH 4OQTH 5I17B 1ZMYA 4E41D 4IRJA 43CAA 2LU3A 2FBJL 1I7UA 4XWGL 1HH9A 1N4XH 5JW3H 4JDVA 1WK0A 1S3KL 4IRJC 5J6GB 4MDJA 5IIEB 4MA8H 2OR7A 3O41A 3TBWB 4ZAKA 5IESH 4HUVB 3VD4A 3ARFA 2ENSA 1C1EL 3BPLC 4GQ9H 1LNUB 3RWJA 4AG4L 2R0WL 5IHUH 4FP8H 4UINH 4ZAKC 3QISA 5FK9B 5GSVA 5DJ2A 2X7LB 3DX6A 5BZWB 1H15B 3GI9H 3NCBB 4WDIA 1MELA 2B7DT 3WFHB 1RZGA 1I9IH 2ZCHH 4P46C 4DW2H 2R29L 4MAYD 3MRKA 3QAZC 2XZQH 2UY6A 4XVUC 3PP3H 4J23A 3ARBC 3U0PA 4C56A 2QSCL 4WI9A 1A3RH 1TNNA 4PJAE 4Q9QH 3C5SB 1IEBA 5DEZA 3WHXA 3IFPB 1CIDA 4HUKB 1EMTH 3SY0A 4KHXL 4WWKD 4KTDH 5J8OA 2IANE 2E7LC 5C07B 4ODVL 1QRNE 3QEQE 1YEDB 3OAZK 3SEPA 4CMMA 3RAJL 4EIZC 1HOCA 1VHPA 1CDGA 2AABL 4M48L 5CWSB 3MMEA 2IG2H 2FJFB 3CXHJ 3GIZL 5I75B 1OCWH 1TVHA 4X6BB 2NLJB 5JQHC 4ZFOL 4DFHA 4QRTA 3QDHA 4M7KH 3P4OA 3B8YA 4PFEA 3WS3A 5DQJB 4JY4B 4Z7UE 5EBMA 3QIWD 5I16B 2VDML 1L0XA 2BDNL 1UM4H 5TH2B 2A83A 3EFDL 1JPSL 4Y4KD 4TNWK 3D3VE 4RGOL 4KKLD 4TVSa 3PJSA 5FOBB 3GSNH 4P9ML 4KDVA 5DZNA 1IKNA 5C0AB 4RZCA 3DBXA 1BBJB 1HQRA 1HHIB 2ADIA 5DMYA 1YN7B 5T1MA 2C3HA 5L0QC 5EA0H 4JKPH 3SDCD 5I73B 5C0JB 5KSBE 1MCOL 5TQ2L 1RY7B 1AGFB 1YEHH 1Q1JL 2VSCA 1VCAA 4QHKI 2ZOKA 3MOBL 3X14A 4YNYB 4F37K 3L6FB 4EN3D 3RI5F 5C0DB 1J1OH 5IVZB 1IGYB 3MV9E 4GW1B 3MLSH 1NGPL 5E2UH 3QQNA 4KRLB 3ULUF 4HG4K 3MRMB 4P23D 2N4IA 2UY7A 3R0NA 2ESVE 1ODAA 4CU7A 4I9WD 3K0WA 5EU7E 4MXQD 4M3JA 4QRSB 3NIFE 4R0LC 1L0YA 4U0RC 3EOTL 2VXUH 1KJMB 3B5TA 4W6XB 4O2FA 4OIAA 1E6JH 1SQ2N 1W72B 4UB0H 2HFEB 4QHKJ 3D25A 3HNVH 2AKRA 1T4KA 2I9LB 1WC7A 5AYUL 4KZDH 3K2UH 1ONQB 5T1LB 5IF0A 3TIDA 4Y1AA 1U3HA 1G6RH 2F5AH 5EO9B 1KBGH 1FZOB 3V4UH 2DQIL 5I74B 3BYTA 3E6FB 4PJXF 5E2WH 1VGEH 2J8UE 3UTOA 1XCTB 1LO2H 2AJYH 3BPCB 3VXUE 2HYMA 1T83C 4M02A 4PP1D 3DXAB 4ELKB 3VW3H 1QNZH 4P5KB 5FYJE 1IGIH 5JIKA 3RZCA 1MHEA 2YKLH 3AGVA 1T89A 4XNZB 5BZDA 5GZOD 1B90A 3H7BA 2DQTH 1ZWIA 3O3BA 3QUMA 3SGDH 4LMQE 3W5NA 4YE4H 3RIAF 2VDLL 3RZCC 3FFCE 5J13B 2KH2B 1T89C 1CQKA 1TFHA 5E8OB 1WCBA 1DDHA 2GTWB 1AGBB 4YHKH 4RMSA 2IALB 4OCYL 3O6KH 1JWUA 3T4YA 4FABH 4N8VA 3WD5L 2A73B 2X9YA 5A2KH 3W9EB 4QO1A 4HIHA 4HH8A 4W81A 4NQVA 2C4XA 5GRYA 2JB5L 5D6DA 3FAXA 4ZS6C 3P77B 5CEZD 3LVEA 2GTZB 3TNNA 2AEPH 3U0WL 2VLKD 2HKHL 4QXUL 5JR1H 1QFUL 1TJHH 4RGNC 1OAZL 1UEYA 5IEHA 3UTTB 4UU9A 1BFOB 2WP3O 1MJJA 1TJIH 1Y6NR 5TDOB 1YMHB 5ITBH 4Y2DD 5CKGA 2D9QB 1I75A 3PWPD 3QDGB 4BELD 3K80A 5IW1A 4Q9RL 1L6ZA 4KQ4H 4H88L 1N64L 2HRLA 4XMLL 3DV4B 2YD6A 2IAMB 1M7IB 5EC1B 2BY0A 1A7QH 2I24N 2DQHH 4NNXB 1B4RA 1Z2KA 3MV7B 1MFCL 2QSQA 1OGTB 3BDXA 1HN1A 1BD2A 4BFIA 3VI4F 3MREA 1IL1B 5AZ2H 4NUJA 3RWEB 4HWBH 1V05A 1WZ1L 5KANI 2OR9L 1RJYB 4DVRH 4PJEB 3SDAD 1K5NB 2EDHA 4OKVB 3RNQA 1UWGH 2X4NA 4JGUA 4WY7H 4M03A 4CU8A 1BVKA 2OL3H 3LPGA 1JMZA 5HYJE 1G7LA 3TP4A 3IFLH 4I48B 1QBMH 1AKJB 4XGZB 3VE0A 3T0XA 3T77B 4JFED 3UCRA 3Q0HA 5I75C 5D2LE 2VXSH 3CFCL 4K3GA 1VACB 3T3ME 3MRBA 2RFXB 3LKOA 3F7YA 4XBEL 2W65A 2XG4A 3WUZA 2HP4A 4L29B 3N1MC 5B3JE 3NFSH 4EDXB 2VUOA 3BX7C 2OK0L 5L2KD 3MGOB 5DHXB 4WVRA 3QHZH 1OOAA 5T3XE 4FTVA 3MRIB 1UZ8B 4KUZH 4PJAA 4ZOAA 4AT6A 4MS8D 5DEFA 1KCUH 3GMNB 3NPSB 4L8DA 5K59F 3D9AL 4DZ8B 5MEPB 3QZWA 5IMMA 2Q86A 3S97C 3CFJB 3JWNC 1ZK9A 1RMFL 2IANA 3UJJH 1CICB 1HXMA 4MJ5B 4N0CC 4DOHE 5LWYL 1QRNA 3QEQA 3BXNB 4KAQL 3VXTA 4M1GH 3RVXD 4R3SB 5FUOH 3B5GA 1MFAL 1PZ5B 1EO5A 4BQ9A 1NBYB 5GGRA 3AVEA 3REVB 3P30H 2QQLL 4YHNB 2FWOA 2CIKA 3L3JA 1A6VL 4ZFFA 2GCYA 4BUGA 5EWIL 1DN0A 3MV8B 5EZOL 4A2MA 4JM2C 3MV11 1MFEL 2B1AH 1JHKL 2FYYA 5BVPH 4IIQA 4Z76B 1AHWA 2J2ZA 1DTUA 1CXIA 3ARDA 3DVNB 1UWXH 3TPKA 4PJHF 2VE6B 2W0KA 4IIQC 4I0PA 5L8KB 1AHWC 3GMPB 5FA3A 4JGMA 3PHOA 3HRZA 3ARDC 4KFZC 3PQYA 3SQOH 2BJMH 4F7MA 3TWCL 2C1OB 2BHYA 1HCVA 4PJCB 1KXVC 3UP1A 3KPSD 4UILH 3I6GB 5IB3A 3UC0H 1S9YB 3OKYA 5E99L 1JZ2A 1JRHI 4X5WA 1X5IA 1DBJL 4NWUH 4PLOB 4HUUB 3MNZB 2XWBB 4JPVL 1Q72L 2NY7L 4W6YB 1Y6MR 2MOVA 1NBVH 1MI5E 1IGCH 4H26B 1F42A 4ZUVA 3DIFB 1SJHA 4CN1A 1MRCL 3FB6A 4ONHA 3EYVB 5C0AD 3ZSSA 1ADQH 3HI1A 43C9A 2P43B 4F33B 5J13C 2V9QA 2OJEB 3Q2CA 4ZPVA 4HV8A 1QFHA 1KSRA 3RVUD 4XCFL 1JL8A 3WIHH 4OQTL 1YMMB 2W92A 3D0VB 3MROA 3X12B 2CRIA 2XV6B 4HW6A 4D9RD 3O4LE 1KNOB 5HD8D 5JW3L 3JV4B 3U4EB 5CJBA 2XN9E 2E9BA 4HPYH 4PGCA 2E8YA 1T0NA 4MA8L 3TM6A 3T09A 1H3TA 5IESL 5JNYA 1V3LA 5KS9E 2UWEB 2VZSA 4Y19B 4JPWH 4HUXB 3O3EA 4GQ9L 1SYVB 5IHUL 5ADOH 4UINL 2J8UA 1JF5A 1P4BL 2P4AB 4OF8A 3BW9A 2B4CC 4JZJA 4P4RB 1V3JA 4KXZI 3GI9L 4Y4FA 1XF3A 3CDGA 1I9IL 2ZCHL 2JE8A 2PTTB 4DW2L 1EEQA 4JZJC 4CJ0A 3QCUH 3GHBH 2X89D 2XZQL 5IMLB 1YEEH 3RJDA 1CIUA 5EFIB 2VAAA 4XB8A 1WTGT 3FFCA 3AXLA 1A3RL 4Y5VA 3HCVA 1MJ7H 3Q6FB 4D0CB 4OCLC 3IU3B 4KU1A 3V79C 1KLFA 3LV3A 4MCYB 5HVGB 3A0OA 4Y5VC 3QNYA 1EMTL 3BRFA 3BJLA 1BBDH 3QHFH 4KRPB 1R5WB 5DJAA 3BZEA 1W72H 1ZHNB 5GS0D 5DEGA 4JHWH 1GIGH 3JWDH 3X3FH 1D5IH 4KMTH 3EFFA 3BGMB 5FEBA 1HKFA 5E94B 2IG2L 2XZZA 4TVPD 3WNPA 5JPMA 4XAKE 4LMQI 4PD4K 4D94A 2R1WA 3DYOA 2K7PA 3BGFB 1MWAB 2XOTA 3QI9A 3SDXE 3PNWB 3ILPB 1G7MA 4FZEH 4JFZH 3OMZA 1CDUA 4ZFZA 3W9DB 3LEYH 3CUPB 1UM4L 2DLEA 3QNXB 5TDNA 1CWVA 4PRBB 1CDBA 4Q9CA 2QQKH 4KH2A 4MDIB 4P0DA 2ITDA 4ZS7H 3KJ4B 2Q6WA 1HH6A 3GSNL 4NUGL 1IC1A 1MQKH 3BUTA 1Z5LB 1G9NC 5KVEH 3T65A 4HKBB 3NPSC 4OZGE 2A9NH 3A67L 5FGBA 2LU4A 4Z7UF 3TBVA 5EA0L 4JKPL 1XGTB 3VGGA 1ACZA 5B4MD 1CICC 1T5WA 4WUUE 3VFPB 1AGEB 4LP4A 3ORJA 2IAMD 4BQ6A 2EDRA 3BUYB 4QRRD 1J1OL 2QLVB 3MV7D 2ICEA 2WWKT 3HC0B 3MLSL 4HK0A 4J3OC 5E2UL 1S8DA 4B41A 1DBBH 1A4JA 2XWTB 5KSVB 1CYGA 4CN4A 2IPKA 3IVKB 2H8PA 3I50H 4GG6F 3LRGA 3WKNA 4I18B 1GRWA 1QO3A 1T7XA 1YN6B 3O3DB 2B4CH 4YDIL 4HH9B 4NN5B 4HGKC 4P4KB 3PHQB 1C5DB 4AL8H 3QUYD 1JWSA 1TDQA 4UB0L 5LG1A 3UJTH 6CGTA 4XAWH 3HNVL 1KLGA 4NCDA 3VWKB 1IAKA 2R2HA 2XTLA 1Q9OA 3K2UL 5CSBA 3Q1SL 4PTTA 4Z7VA 1FPTL 1G6RL 2F5AL 4X7SH 1EHLH 1KBGL 3V4UL 2GT9B 4NC0B 4CVXA 3CU7A 2K7QA 5J0BA 5E2WL 1JGDB 1VGEL 4JFQA 4D9QE 1MUJA 1OL0A 1LO2L 2AJYL 3SJVA 1PY9A 4HWZB 1DEDA 1BF2A 3GSOB 4MLSA 3VW3L 1PQZA 1EUUA 4CN6A 1QNZL 1IGIL 4K3DH 1AO7E 2IQ9L 2HN7B 2YKLL 3S34H 4NKMB 5MENB 4G80A 4NZTH 1LEGA 3IXAA 1J5OH 4NSKA 3D39B 4L3EB 4YE4L 2BHZA 4RRPG 3QPXH 1ZVSB 4YHKL 3PP4H 1UEMA 3O6KL 1FZMB 5FYKE 1JPFB 3MZGB 3PE9A 3T4AB 3VU2A 1MCJA 1RUMH 1DN2A 4YHPB 2VB5A 5DD6B 1L9MA 3GGWB 1T20B 2C3VA 5HHXL 3ZE1E 2W38A 1E6OH 4G8GA 4R4FH 1B0GA 2AEPL 1II4E 2ICWB 4PRAA 4JFXA 4U05A 1JVKA 5JR1L 2P8PB 1TJHL 3ZMRA 3CC5A 5AUMB 2AK4E 3I84A 2GITB 1OVZA 3RGVD 3VFNB 5ITBL 3WEXB 4GKSB 4Q6IB 4YXHH 1ZOXA 1GGCH 3PDOA 5ENWB 2M1KA 4KQ4L 4PRHB 4XI5D 3OR7B 3MCLH 3Q3GB 1I8IA 1Z3GH 1FL6A 3U7YH 3BN3B 3JTSB 1A7QL 2DQHL 4X6DF 1T1YA 1GPOH 4LAJH 3OV6A 3L3OB 2H3NB 4OGYH 4PG2A 4P3CL 1UCTA 2CUMA 1IMHC 2JJSA 3OAYH 1L7TH 5FIEA 3VWJA 4Z77B 3OX8A 4PG2C 1UXWA 3HS0B 3HR6A 1XF2B 3O4LA 2IC2A 5AD0B 4HWBL 2JJSC 1KOAA 2HVKA 3VWJC 4PJDA 4CNIA 5F7DB 1WLHA 5ABDE 2YUZA 2XN9A 3GSWA 5IBTH 3OTTA 1UWGL 1CXEA 2YSSB 5ACZA 2XTJB 4WY7L 2OL3L 1EZVY 1M7DB 3QG6B 2E9IA 5KS9A 4PREA 3IFLL 1GOFA 4I3GA 5EPMA 1KTDA 3VXPA 5C09E 4PJFA 1F6LL 3MGAA 4NQSB 1INEH 2KPNA 2VXSL 2YN5A 3MODH 3FQTB 1YMMD 2Z93B 3V4PH 1I85C 1MCIA 3VGFA 3N0PB 5D93C 1AD0A 2OTPA 3HG1E 3IFNH 1FLTX 4G8IA 4JM4L 3L7FA 1ETZB 5C0NC 3TPUB 2YD9A 3NFSL 3MCKB 3BH8B 3M45A 4P2QB 4QHUA 3C60C 4MNQE 1HHKB 2ZWLT 3WFDH 1IT9H 3S5LA 5IT2L 1JZ3A 5H37G 3QHZL 3IJHA 1FIGH 4KUZL 4Y19D 4OFYA 5D2LF 4ZXBD 1KCUL 4F7EA 2CLVB 3MUZ1 1OT1A 3BHBA 4JFDB 3GJFH 4PY7A 5FKAB 3D1MC 3WHE0 3MACH 4MXVE 5IEKB 4OD1H 3QUZA 2XKUA 3UJJL 3GJEA 1CFNB 3S3JA 3IDGB 1CLYH 3EO1A 5FDYA 4M1GL 3QUZC 4YDVB 5FUOL 4LAQL 3JWOC 4QRPE 5IP4A 3CZJA 1CD1A 4KK8D 4PB0H 5KVMC 1XZ0B 2DLFH 3P30L 4OGAC 2V7NB 4M9OA 5C08B 4RRPA 1I3UA 1XGQA 2P5ED 1N2RA 4QOKA 5D5MF 4L8CA 4LVEA 3QEUA 2VRAA 4PBWD 2V5SA 4P2OD 4I18C 3ILQD 1HWHB 3RDTC 4KRPD 5BVPL 4IRSB 5E5MB 2EH7L 1JZ5A 2J12B 5SWZB 5JDSB 1TLKA 5JORA 2EC8A 1XIWA 3QJFB 1JPGA 4RCAA 1DCLA 1F4AA 2BJML 3S4SA 4PRIE 4MWFA 4KI5E 1XIWC 1KJ3H 1JYNA 3UXFA 4UILL 3SDDB 4OZGA 3UC0L 4FQ2H 3L95A 2E7HA 4NWUL 1QR1B 3GUTB 4MJ6B 3RWIB 4WI3A 4RAUA 3VFUB 5MHSD 4ENEC 5IK3B 2VIRA 1IGCL 3QEGH 5B3NA 3KYAA 4B53A 3V0VA 2JK5A 4B0MM 1GOGA 3VRJA 4PJ7F 3SBWA 5CBEA 1ADQL 2D2OA 2FZ3B 5IB5B 1KIQA 1A02N 1ZXQA 1CXFA 5D96B 1Y0LA 3NFNA 4L5FH 1I1AB 1FJ1B 1MWAH 4UOW0 3SBWC 1SVZA 1G9EA 5SV3A 3WIHL 4HX1A 2BC4B 2NX5A 1HH9B 3BEVA 5JPNA 2B5IC 1HINH 2IWGA 2CUHA 2VWEC 3CSPA 4ZTPL 1TPXC 4OFKA 3O41B 4I77H 3ARFB 1RZIA 3CDYA 5DJYB 4CBPA 4JPWL 2NY4C 4N1HB 5DC4B 3H9SE 5ADOL 2X4RA 5DJ2B 4P4KD 1F8TH 3DX6B 4YK4C 3MA7A 4GXVH 4ZNEE 4NKOA 2ZNWA 1C08B 1AO7A 1NGZB 3VWKD 4BK4A 3QH3B 4GRWB 3JWOH 5HYFA 3MRKB 4OZFA 3QCUL 3GHBL 1YEEL 1Y6KR 5FO9A 4V1DD 1KCVH 3TYGH 2ZUXA 3H9HB 5IVXE 4OM0H 1A9BA 2V2XB 3O3AB 4GBXC 3SY0B 2BSRA 3MYJA 4H25B 5DD0H 5D7LB 2A74A 5CBAA 3F5WA 1BBDL 2XYCA 2DQUH 3QHFL 3ESUF 5MEND 1NKRA 3G5YB 1NH6A 3RP1A 3D39D 1W72L 5LGKA 3C5JB 4L3ED 2R2BB 3JWDL 1WJ3A 3X3FL 1D5IL 4KMTL 5I1HL 2XIDA 4KK5D 1J1PH 4HEME 5C9JA 3QDJB 2PETA 4U1GB 5F93C 5HDBF 1BQHB 2Q7NA 1CZ8L 4BH8B 1S9VA 2AK4A 3G5XA 4QRTB 2H45A 5IV2B 1QLRA 3P4OB 5FV1L 1XR9B 3W81A 5EBWA 1MIEH 4RDQG 3WS3B 2APVA 4LLYA 4JFZL 1FZKB 3AREA 3VFRA 3W0WD 1B0RB 4KTYA 3LEYL 3GRWA 2P5WE 3ES6B 5D7JA 2NY0D 2F54A 4MQXC 3HUJE 3AREC 2GSGB 3FQWB 4J3VA 3V0AC 4Z7NE 2QQKL 4U6HB 5I9QC 2NY1C 3VXNA 2AXJA 5HHNA 4JFOA 4ZS7L 3DVFA 5D7JC 5A3ID 1HE7A 2NMSA 1BZQK 3KAAA 3DBXB 5KVEL 3P4MA 2ZUYA 3CD4A 3G5ZA 2A9NL 4TVPL 5AEAA 3DETD 3MNVB 4ONFL 3KPTA 3L3KB 2R2EA 1T66C 1N7MH 3KR3H 4OT1H 5HGHB 4U1IA 1O5DT 2M26A 5E7FA 4NYLB 1MRFH 5TE7H 3PUCA 2W0LA 2A0LC 1DBKH 2YC1B 2AJXH 4X7TB 2VR5A 2CLRA 1DBBL 4P2RD 4JKWA 1BQHG 1XR8B 4LSDA 4PGZA 4XPHH 4OV5B 3I50L 5DMJB 3VD7A 5TJWK 5T3ZE 1WBYA 4M8VA 3VGAC 2J5LB 1B4JH 4L3CB 4O2FB 3VFTB 1WWWX 4PRPD 4AL8L 4IRSC 4L3AA 5DJ8B 5E8PA 5F9WC 3MJ8B 1SEQL 2XTJD 3MA9H 4N0FA 4JKLA 1HSBB 4XAWL 3T0EE 1U8KA 3OKLA 1LK3H 1IQDA 2DTMH 5H37H 3R1GH 4X7SL 3P9MA 3BH9A 1EHLL 3ELAT 5ISZB 2DIAA 1I3RA 4DUXA 2GJ6E 3FCTA 4RFEA 3AAZA 3SCMA 3ULUC 4KJWC 1BWMA 2EDNA 4JVWA 3BGAA 1VFBB 1JGEB 1MOEA 4PYHA 1EERB 4DGYH 3LKRA 1XGRB 1JUFB 2CR3A 5C0IA 4G9FA 4QRPA 4TSCL 3S34L 1MCDA 2XKNA 4NZTL 4PJHB 3MLZL 1J5OL 3O3BB 3QUMB 5D1ZA 4TNWF 4DZBB 4JFDD 1JF1B 5FCUH 1RZFH 1BJMA 1HWGB 4AQOA 2OSLB 1VEMA 3TN0D 2WW8A 3QPXL 4BKLA 1K9TA 3MLWL 3QUKB 3WN5A 4N8VB 5DUMH 5D96C 4JQXC 1RUML 1DEEA 5D2NE 1X5ZA 4G43B 3CCHB 4D3CL 1FN4B 1AC6A 3C8KB 3ISWA 4TNVK 1QR4A 2ICES 1KJ2H 4F37F 1E6OL 3GRWH 4R4FL 5C08D 3AS2A 4M62H 3TNNB 2YPKB 2Z0BA 3MRNB 1J18A 2BMKA 4R7NB 3JBG7 5C2BH 4PGEB 3UEZA 5FECA 2WBWB 5HDQL 2GI7A 4GW5A 2EKSA 3NGBC 2UZYB 3OKKB 4GAGL 4OLVH 2DM7A 3U36B 5SWZD 4V2BA 5F1NA 3KPOB 4CUCA 4E9LA 4ZFGH 1WBZA 4YXHL 2XPGB 1XF5A 3N1PC 3EOBA 2AJUH 1OQOA 4C4KT 5E2VH 1GGCL 5HSFA 1Q94B 3CFBB 2Y5TB 2NW3B 3MCLL 1Z3GL 1FIEA 1S7XA 2X4PB 3U7YL 5GS2H 1UWXK 5GGVY 1GPOL 1SY6L 3QIBA 5CHNA 4OGYL 2X09A 4ZD3H 1KFAH 2DN7A 5T1KD 1J0KA 3ZE2F 1RK1B 1S7WB 2EIEA 2PW1B 1BD2B 1GYAA 3VXSA 3FTGA 1L7TL 3QXWA 1S7SB 3QCTH 2DIJA 3QIBC 3EZJB 4F15B 3E8UH 3IETB 1P2CA 5DFTA 5FDWA 4R4BB 1R5IB 5D1XC 1MHHA 2R1XA 3FQUA 4M7ZB 1ZHBA 2KZ1B 3TNMA 1BVKB 3BPNB 4HLZG 1DE4B 1I1AD 1DP0A 1U8MA 4ORGA 1RVFH 1NEZG 3TV3H 5I76B 1INEL 3ULUH 3MODL 5DRNB 1S9XA 4IRJD 1DQMH 3F7YB 1RHHA 2XA8H 2W65B 5FOJA 3KVQA 4Y4HA 3IFNL 1NDMB 1TCRB 3B9KA 5DRWA 4KKAC 4NKIH 1RUPH 1RZ7L 2LTQC 3SGKA 4Y4HC 3B6SA 1R5VA 3FO2B 3WFDL 1IT9L 4M93C 4Z95H 3ARFD 1I7TA 3SGKC 1BZ9B 1FFRA 4JANA 3T3PF 1ZS8B 3OBAA 3F8UB 4AK1A 5DEFB 3V6BR 1MRDH 1HDMA 1LE5A 3C9NA 3VXMA 3UZQA 5AZEH 5IMMB 4HK3N 1EH9A 3MACL 4XVUD 4OD1L 2IANB 2BERA 3ULSA 4XCNA 4MQTB 3B9EA 3ULVD 1QRNB 3QEQB 1BHGA 4QHNB 1I4FB 1M05A 1P6AB 3DX9A 1FCGA 3HTLX 1YEJH 1CLYL 2DJSA 5DJ6A 2JB6B 4EBQH 1G7IA 2XFXB 3D85A 3K81A 2I9TB 4OCXL 1FO0A 5I1DB 4PTUB 4FQQB 3C6LA 3FQNB 1VADB 4MSWB 2MKWA 5I71B 4NRZB 4HIIA 2PYEE 2PXYA 1EEZB 1QEWA 3KNBB 3ARRA 4U1NA 2VR9A 2J6EH 5D7LD 3ZKMC 1TMCB 2AQ1A 2CXGA 2GSIA 4U1KA 2FYYB 1DBAH 3MBEA 4PJBF 2PXYC 4Z7UB 3UTZA 2RB8A 4AEEA 3FFDA 1LO5A 1V3KA 2AXFA 5ICXA 2X4UB 3NPZB 2XNAB 2FRGP 5GXBB 3MBEC 1CGUA 4GKZB 5IFJB 3HUJA 2ZG3A 4GRWH 5FA3B 3QDJD 3PHOB 4KDWA 3D3VB 3HRZB 1NGYB 5E6IB 2YEZB 5DJCA 1ZLSH 2VLRA 1CE6A 1KJ3L 1MHCA 4LBEB 3OQ3B 1CQYA 4U7SA 3WLBA 3V6ZB 5LVEA 3L3DB 4FQ2L 4GG6B 1W0VB 3PL6A 5KSBB 4QT5B 1MCFA 4DN4H 3D69A 2FX7H 3GMRA 5HJ3A 5BW7C 4FFWC 3C8HA 3LS4H 5I1EH 4ZPTB 1DQDH 4RQQA 3PL6C 2HFTA 2MHAB 3QEGL 4X9GA 3F12A 1YNLH 3MV9B 4U6XA 3WDJA 3SHSA 3UROR 2Z4QA 3FB6B 4XBPA 5J3HC 1S7VA 1MCKA 1KIUA 4PG9B 2EEDA 3HI1B 43C9B 1J8HE 4TTDC 5D1QA 2V2WA 2ESVB 5ETUB 5D7IF 4HV8B 4L5FL 2BX5A 3I6KA 1MWAL 2Q76A 4JFFE 2ZUQB 3QIUC 3PWJA 3HHRB 4PV9B 2IMMA 5EBLA 5DD5H 4X7EC 1XFPA 1FL5A 1CFVH 4HKZA 3T0EA 4BSVA 1Z0NA 2DQFA 5I18H 4MCZB 1T0NB 2P49B 3EIFA 4P5TA 3FHQA 4I77L 3KDMB 3LY6A 4I3RH 4XCEA 2ERJB 2J8UB 5GISH 4P5TC 1I9JH 1F8TL 3MGTA 4K3EH 4GXVL 3VXUB 3CSBA 4HIXH 4JAMA 5DMKA 3U48A 3UTQB 4Y4FB 2NW2B 1CN4A 3ZDZE 3JWOL 2D9CA 4LCYB 4G8EB 5A2FA 1U3HD 1ZVHA 1VPOH 5T33H 3FFCB 3PV6A 1KCVL 1X6LA 3TYGL 5B39B 3I9GH 4OM0L 1YPZE 3RVVD 3QWOA 4HBQA 4F57H 4I5BA 4XH2A 5DD0L 2VR4A 3PWLA 1FG9C 5D2NA 3VFOB 2BSTB 1T03H 3PIQB 2VABB 4MGXA 1LWRA 3QXDA 4HC1H 4X0KB 5DLMH 4NP4L 3QO1A 1IM9A 4OZ4A 3IAQA 5BXFB 1GAFH 2NXZC 4PJ8C 1J1PL 2WWMC 1FVEA 1AY1H 5JPMB 2GW5A 4D8PB 1JTPA 3LEXB 1K2DB 1RIVH 5IMKA 3U46B 2EO1A 2VDOL 4LEXH 2C4FU 3ETBF 1NUDA 4ZS6D 1D5ZB 5M7QA 1MIEL 1QLFA 1G7MB 2BVQB 1NMBH 3ZYZA 1NFIA 4RGND 5ICZA 4FFVD 5K9QI 5EULV 3IU4H 4D0DB 4XXDB 4NO0A 2FLBT 1F2XK 3SKOA 1AH1A 1J0JA 3BP7B 1AFVH 3HZYB 2NNAA 4LEOB 5B39G 3KHOA 5KSUA 1BECA 4DCQB 3DUUB 4PGBA 5FB8B 1LP9F 2LVCA 3EJYC 2OTWB 3KR3L 2I60H 1F4HA 3TO4A 4OT1L 1U91B 2DB8A 1C16B 4ETQB 2DQEH 4F9LC 4KGJA 4EIGB 2HJFA 3ZKQD 3C8DA 3PGCA 1KGCD 4Z7WF 5TE7L 1MRFL 1U8IA 5ANMA 5F89A 3TO4C 1DBKL 3OKDB 5HYJB 2AJXL 2BCKA 4Q6YA 1KCSH 3EJJX 3AMKA 4HLZH 1BD2D 2H8PB 4XPHL 5CD3A 1P7QA 3FZUD 5D2LB 1YC7A 1LHZA 3CGTA 5EORH 1QSFA 1PVHA 3TZVB 3L5WA 5INDB 2CKBA 3ZYIA 3AFLA 5DD1H 5GIRA 1T80A 5CMAB 2D0HA 2FSEA 5INCB 3MA9L 4NNPH 2IBGA 5IM7A 3TEUA 1ZT4A 4NHUA 5CZVH 2YPLA 5HI4D 1LK3L 3DGGB 2FECI 2DTML 2WQRA 4PTTB 1HHJB 3R1GL 1V5JA 5DD3L 5EDXA 4HUNB 5D72H 2ZPKH 2V5MA 3WE6A 1K8IA 5GGSY 4N8PA 3VGDA 5HPMA 5IBLD 4DOHB 5DRZB 2DIBA 4PYGA 5C0CA 5EU4A 1BPVA 3L3IA 4KKCC 2I07A 3U2SA 3PGDA 1UYWL 1FNGB 1SYSA 4FTVD 5DZOA 5IFAH 3INUH 4NSKB 5TF0A 1U95A 3GO1H 4MNHB 4WO4A 5EC2A 5EOCH 3KS0H 4N0CD 3ZDYE 4FXKA 5FCUL 2PYEA 5KW9H 4N1EA 4WO4C 2IAND 3K74B 1QRND 1NC2B 3QEQD 2EYTB 4F7TB 2FO4A 4XCYA 5DUML 3QXAA 3BZDA 3HFMH 2QKIB 3RWFB 3GJFK 1OB1B 2HLAB 1EXUB 4PGJA 5CEZE 4L9LB 1NCDH 3IDMA 1KJ2L 2VLKE 3X13A 1B0GB 4M62L 4P3DB 3ZT7A 5DVNA 4L1HA 3UYRH 1CD0A 4UIKH 5CGYC 1H3PH 5C2BL 4LVOC 3CC5B 3EYQC 4OCWH 1T1XB 5LGJB 1KUMA 2D7OA 4QHLB 1U8JA 1MCHA 5KN5A 1KPRA 4OLVL 1Y18B 4YR6A 3BN9D 1MAJA 1PGRB 1E28A 2PUQT 3CAFA 2Q7YB 4CW1A 1DVFA 2B20A 1MI5B 1EFXA 4I0PD 2YRZA 3D3VD 5E6ID 5IHZA 2AJUL 2VLJA 5E2VL 2HT3D 4NKDB 1DVFC 5C6PB 4M9PA 3VH8B 1LO0H 3CMOH 3L1OL 4OCRH 3GK8H 3M1BA 2CDGB 1UKTA 3F58H 4ZD3L 5IROC 3VMOA 2IH1A 4QXTA 4JFFA 4MZ2A 1KN4H 3QCTL 4ZUTA 3E8UL 4M00A 4YDLC 1VERA 3QNZA 4TRPH 3NH7H 1HZHH 3MV9D 4RWHA 1IEHA 4X5XA 2XN9B 1N8ZB 1YEGH 1S7UA 1FP5A 4KKBD 5F3HB 4S1QL 4QEGA 5KS9B 4PREB 1X4XA 4JFEE 2Y9RT 1VFUA 5C0BA 3VXPB 2N1KA 1RVFL 3TV3L 1IAIH 5BVJA 3BVNA 3VA6A 4R96A 4BA8A 4UMGA 2XA8L 4KROC 5L8LB 4ZO8A 1MCLA 4HJGA 2LFGA 4NKIL 4Z9KB 1S78D 4X9BA 3OG6B 5I30H 1W8OA 4QGYA 4JO1H 4Z95L 5MEOA 2W91A 3DYMA 1H3UA 1KENH 2GJJA 5ICYA 2AV7A 5H2BB 2BNRA 5CEYA 1YPZA 1MRDL 3BHBB 4RBPH 5FA4B 3RKDD 4UI2A 2YZ8A 5AZEL 3O8XA 4XNMB 3VXUD 4PJ5E 4Z7QF 4RFOH 1ZT7B 2FL5A 4Y4FD 5EU3A 5FYJD 1Q9WB 4D9LH 4RGMC 1WBXA 4FMFA 2N56A 1I1YA 4PR5B 5JHDE 3O8XC 4GW4B 4PY8I 1SJVA 4NQCE 5IB2A 1AIFB 1YEJL 1IJ9A 2DOCA 3BT2H 4EBQL 5E4EB 4IDLA 3AU1B 1ZHLA 3FFCD 5DJXA 2Q20A 1MJUH 4OBSA 5FUCE 1CD1B 1UH2A 4XMKH 3W11C 1K4CA 1AXSB 2AK1H 4YHYB 3L3GB 1K8DA 1N2RB 2W9DH 2AJ3B 2J6EL 4IJ3C 3SDXB 1UA6H 2GK2A 5I1JH 3TZVC 1DBAL 3O6LH 3IJSA 4U6TA 5JA8B 1J8KA 1YNKH 4AIOA 4OUUA 5EIIB 1KTRL 2NY2D 3ZTNH 2AGJH 1M71B 4PY8J 1V7NH 4FNLH 1QLEH 4L4VB 4OQ1A 3ULVL 2APBA 1UGNA 4PGDA 5I8OH 2BSSB 3KPSE 4IM8A 1U3YA 1A9EA 1KC5H 3WO4C 5H35A 4LDOB 2EYSA 5D5MA 3KHQA 3QI9D 1U42A 4N0UE 4OZGB 1I1CA 4IOIA 3OAUL 3TBYB 3HE7B 5JUEH 4HGWB 5J11C 1XH3A 2R0KH 3MUGB 1F3DJ 3LS4L 4OKDA 5I1EL 4RAUB 4U1MA 5CJQH 1DQDL 4WUUB 2BP3A 2CPCA 4MD4B 1ZKAA 1M7XA 3CPLB 4G9DB 3RBGA 2VLLA 1YNLL 5J6HA 5SX5H 3U30B 5DS8B 3O9WB 3IGAB 4ZUUA 1IM3B 3VRJB 2DM3A 4EEEA 1Z9OA 4N68A 4R2GC 3CH8A 1D5MA 3FJTA 4MVBD 4D9RE 5DSCB 3HNSH 3ZE0F 3MRJA 1EZVX 3S37H 5DD5L 3BYYA 2WWKO 2DAVA 3G08A 3OKOB 4FQIH 1G7QA 3NCYS 5E6YA 5EO0A 1JJUA 4OFIA 2HRPH 4FXGA 1ZLWH 4DKAA 5DDHA 1OTTC 3KLAB 5DYOB 5CJ5A 3T0WA 4XRCA 1KCLA 5E2TH 3MR9A 2P7TB 4PJ7A 4MJ2A 5BRZB 2OZ4H 4I3RL 5FGCE 3HPLB 3MRCA 4KQ3H 1I9JL 1BGXH 3FB8B 2QL1A 3QEHA 1HXYA 4K3EL 4HUWA 5GRWA 4HIXL 3RWCB 1AO7B 4W68A 1NFDF 2M8XA 3OWEA 4YBHA 3CVHA 3GIVB 3OSKA 3RL2A 3VFWA 2AS5M 4XPFH 4BH7A 5T33L 1ZT1B 3PABA 4HAFA 1V7MH 3IXTA 5E08H 3I9GL 5LAXB 4F57L 3SJVD 4RMUA 3SOBH 2Y07H 3DOSA 4RX4A 1FFPA 1S5HA 2OQJA 3JVGA 1ZSDA 4ODWA 4XP5H 2H32A 3P0VH 3WBDA 3MRGA 2A77H 4XC3H 1QBAA 5JW4M 1T03L 1HSAA 4HC1L 1KF9B 2O61A 2CRZA 5DLML 3GSRA 4FFZH 1MLBA 1HI6B 1GAFL 4LSUH 5T3XH 2CRMA 2B1HH 3X11B 1INDH 1U8OA 1AY1L 1GHFH 3QSKB 2SEBB 3MJ9A 3OKMA 2EDFA 1RIVL 4GSDH 1NC2D 4QY8B 2JCCE 4LEXL 4OLZH 2YPVH 3HE6A 1A7NH 3EYOA 4JE4B 2Y72A 3RJQB 4X4YB 1EEYA 2QV2A 1IFHH 1NMBL 4EI6A 3HE6C 2EYRA 2P1YA 4JR9H 5FF6A 4AMKH 5DJDA 2VKXA 4WFED 3DMMC 1H9VA 2Z9TA 4JFHE 3VXRA 2B2XH 4RFNB 1AFVL 4JDTH 1R3LA 5BV7B 4ODHL 3LB6C 35C8L 3G5ZB 3QFJB 3S37X 4UQ2A 1T1WA 1Q9KB 3NCMA 2B0SH 1D6VH 1KPUB 2KUTA 2X1XR 2I60L 3DJ9A 4YDJA 5F7LB 4U1IB 4QRRE 3HKFA 4XNQB 2DQEL 5E4IA 3U79A 4Z6AT 5CJOH 5TGBB 4TQEH 3BMVA 3EAKA 3WKMH 3HA0A 3RUGE 3W39A 2Q8BH 3OGCB 1KCSL 2H9GA 3PXJA 5C09B 5GGQH 5SWSE 3VWJD 1KYOK 1JZ4A 5F9DC 5EORL 1YY8B 4OLYH 3LEVH 3O4LD 2FR4B 3HG1B 2G2RA 2ARJQ 5CEXA 1S9WB 2CSPA 5DD1L 3MLUL 1A6TA 2OX5A 4L4TE 5E2JA 4NQXA 2XN9D 5J12C 4MNQB 4XTRD 2VDNH 2FEEL 4NNPL 4HKXA 3W2DH 1WFUA 3BH9B 1X4YA 2YUVA 3CXDH 3O2VL 1N6QL 4X98A 4PJ5A 5DJ0A 4HHAA 4U6YB 3RI5K 2V7HB 1ZA3A 4ZUWA 3AAZB 3DV6B 4WV1B 3FT2A 4R8WH 5I2IA 2E27H 5DXWA 4NQCA 1KIPB 5I1LB 4Q2ZB 1AE6H 3EGSA 1MREH 2VZ1A 3GSXA 3REWB 5C0IB 2BNQA 4QRPB 4OSUH 1JNNH 4QTHA 5IFAL 3INUL 3GO1L 3G5VA 3MLXH 3W5MA 5EOCL 5IMOA 5KSAA 1BZ7A 3F6IA 5KW9L 2DBLL 1JTOA 3QUZD 3F7VA 1I1FA 3WN5B 5KSAC 4YXLH 3VJ6B 2XXMB 3GSQA 4I13B 1CE1H 1R3JB 3HFML 2Y36H 3PWNB 1BREA 4PLJC 1KXTB 5EUKA 1P1ZA 2VZOA 5DFWH 1NCDL 5C0EB 3EZ8A 4XAKD 4PRIB 4JFPA 3UYRL 4UIKL 3MRPB 1H3PL 4F58H 4X80H 1YY9C 4N0UA 4OCWL 5GHWL 2R23A 2J8OA 3IDIB 4MB3A 4WGVB 5FYJU 3FQXA 1EHAA 1JWMB 4FQJL 3RIAK 5AWNH 3VFSB 1XIWD 3T1FB 4Y5YC 2F53A 4S1RH 4WW2F 2ZKHL 5KOVC 1D9KB 2PO6C 4QXWA 3SKMA 1LO0L 1MEXH 2D4DA 3BP5B 2VZTA 4XWOC 4OCRL 3GK8L 3I3BA 4PP2A 3F58L 5KZCB 4OF6A 2ZJSH 4BSJA 2LQRA 1MNUH 2OTUA 1FNHA 3FTGB 3MRFB 2GUOA 3T08A 1KN4L 1MCCA 1HEZA 5DURB 4G8FA 5I15L 3BP6A 4JY6B 3M8OH 1YDPB 4TRPL 1FGVH 3NH7L 1HZHL 1NANI 3C09C 3I2CH 1MY5A 2R1XB 1RUAH 1QSVA 5DO2C 1NMAH 1ZHBB 1YEGL 2QR0A 1MIML 4POYA 4LLQB 5LQBH 3O6FA 1U8LB 5GGSB 2OS7A 4DVBB 1NBZB 3H9SB 4LNVA 4HDIA 2R4RH 5JXEA 4LLUA 3O6FC 1S9XB 3QQ3A 4WHTA 3CZFB 5J56B 1LD9B 3ZYJA 2NX5D 2H2SC 1F4YH 3O11A 1JN6B 3C87A 1MFDH 4MA7L 4W4OA 3B83A 2GQHA 1J12A 1INQB 5JXEC 3MC0A 4X6CF 1YUHA 1RZKC 4CADA 4WENB 4POZD 1A5FH 4TNVF 4GAJH 3WL9A 4JO1L 2HFFA 4YEEA 1CTOA 1KENL 1CI5A 5IVXB 3GSVA 4D9QD 3VGHA 4WFFD 4KJQD 3C9NB 5FUZH 3UDWA 4RNRA 5ESVB 4E0RA 3LQZA 1DZBA 4RFOL 3MUHL 3IDYB 4M6OH 4D9LL 1AO7D 3UDWC 3BWUC 4QXGH 1AGCA 4OJFL 4HG4J 2AV1B 4ODUB 3S98A 1MY7A 1ZGLM 4JO2H 3BT2L 3HAEB 2J8HA 3BZ4B 5H94A 5GRXG 2BVOB 1WAAF 4RAVA 4JFYB 1MJUL 3FOLA 5F7EH 1TQCB 4XMKL 2P5EE 2R4SH 1T7YA 5EN2A 4GG8B 3KYNB 5FYKD 2W07A 2W9DL 2JCCA 1JGUL 1NEUA 2DMBA 5D4QA 4YO0A 5F1IA 2GSIB 1X5HA 1ERNA 3LKSA 4PJ9A 5D8JH 1P5UA 2OJZH 4X7DC 4AYFA 2P5WB 1YNKL 2AXFB 3ZTNL 3GKWH 5EO1A 3BO8A 4HUMB 5IB1A 1VKXA 1V7NL 3EW3B 4FNLL 1QLEL 4LPVA 2O5XL 1ZTXH 4KKNA 3NCCB 4HZLB 3D18A 1TQBB 5I8OL 1MPAH 3GMOB 4E5XA 5JA9A 2O5YH 2AK4D 2E6PA 1MFNA 1KC5L 4NC1E 1UKQA 1H3XA 2W0FA 3OB0H 2ARJB 2GFBA 3OG4B 32C2B 2R0KL 4PJBA 3LCYA 1FVDB 1G7JA 4I8DA 4LLVA 2NY3B 4WV1C 1QSEA 5D7JD 1FYTA 2F54D 4OZIA 1KXQE 4NT6A 2ITCB 4MMXC 4U6XB 2FX8L 1T66D 2DQGH 3QFDA 5D1QB 3TVMB 2V2WB 4J1UA 4XZUA 3IKCA 4APQA 4QF1B 3HRPA 1BVLA 4LSVH 4O5LH 4GAYB 3LN9A 3RVWC 2R2CA 3HNSL 3WCYA 1R3KA 4OFPA 1LDSA 4L4TA 3S37L 3TJHD 4APQC 5KG9B 4TSBH 1QA9B 4HKZB 2X1PA 3T0EB 3OGOE 4FQIL 1FV1A 1QOKA 4KRNA 3IJYA 1U92B 2FD6H 3NFPB 2EZ0C 2A6IB 5K9KA 5E2TL 5FKPB 2W9LA 1ZA6A 3ME0A 5TF1H 3VXOA 5DTFA 4H0HB 2OZ4L 4F7PA 5F6HI 2GJ6B 2UZXB 4KQ3L 1OSZB 3MGTB 3WUWB 3GBNH 2R1YA 3ZKSD 3QA3A 4JAMB 4HIJA 3HZKB 3VDAA 4UV7H 4OCMC 1RIUH 4X83A 5BO1H 4GH7B 2WM0A 2APTA 3WDIA 3U1SH 4HLJA 5MI0C 1TVDA 3JTTA 4OLXH 1ND0A 5FO7B 4ZQKB 4V1DE 3DX7B 4KJWD 3OHXA 4O4YH 4XPFL 1D9KC 4MD5B 1FFNA 2FIKA 1V7ML 1GH7A 1KLUB 3VG9B 4PJGE 1AD9B 3SCMD 5E08L 3VRLE 5ERWA 1QBBA 3SOBL 5F6HJ 2HJKB 2Y07L 3L3HA 4F7CA 4UDTB 4I2XA 3LN5A 2YD7A 5D2NB 5L6YH 3BESR 4XP5L 4H1LA 5CLWA 4QRPD 4NJAH 1UT9A 2A77L 4XC3L 5DVKA 2XQYK 4C59B 5D1ZD 4FFZL 4OZ4B 1N0XH 1D3CA 4HJ0D 4LSUL 5T3XL 5IWLC 4BZ2H 4YGAB 5HVWA 2B1HL 1INDL 1WF5A 3HMXH 1FVCA 1YEKH 1W0WA 3RX7A 1GHFL 4GSDL 5HYQB 5DWUH 1EIBA 4OLZL 1XCQB 5MEQA 2GYSA 3V6FA 3W0WE 5F7HA 1QLFB 5LBSH 1B0WA 1BX2B 1IFHL 4ZFOA 3DVGB 1CFQB 5ICZB 4JR9L 3K2MC 3QUXC 4AMKL 4H8WH 4PRID 3BQUA 4KI5D 4UUJB 4WW1B 4M7LT 3V5KB 1D5XA 2B2XL 1JZ8A 4Z7OF 4JDTL 2A6DA 2NNAB 2Q8AH 1A21A 4NZRH 1AGDA 2YOCA 1NCBH 5ALCH 1RPQA 5KSUB 3RVTC 2W0PA 3RPIA 3KXFA 2OI9B 4C4KO 3LHPL 5CCKH 5EZLA 3TYFB 1D6VL 4K8RH 4WU5A 1AQDB 5GS1A 1NMCB 4K71B 5TE4H 5I19H 2L7JA 1UZ6F 3RWGA 2HJFB 4AJ0A 3PGCB 5JW5B 2OLDA 1JGLH 5CJOL 3N1QC 3NZHL 2G75B 4JVPA 4TQEL 4LCUA 4N5ED 3WKML 5DHYA 4P2RE 3RHWK 3CLFH 5GQBA 2Q8BL 3V7MA 3VXSD 1P7QB 5GGQL 3BWAB 5C0GA 2YUXA 4OLYL 5DR5H 1HHGB 3LEVL 3HZVB 5KAQF 4D0BB 3QJHB 4PRPE 4NO5B 5GIRB 5GSRA 5C9KA 1I8KB 3MJ7A 3SO5A 3D0LB 2CDFB 3MRDB 1VENA 5I1IH 2VDNL 4FQXA 3RUGF 3DPBA 4Z7WA 3SGJA 3NCJH 4HFUH 2Z31A 2ZG2A 4NDMA 5FM5O 4ELME 4MLIA 3T8XB 1E0OB 3CMGA 3ECBB 4FQXC 5GGTH 3W2DL 3SGJC 5E1AB 2ZSWA 5MP6H 2Z31C 5ADPH 4KKAD 4PJEF 3CXDL 3BPOC 4EVNB 4Y4HD 3WIFA 2F19H 3ARZA 3B9KD 5HPMB 4R8WL 4UBDC 3V6OC 2HAZA 2IQAA 1QFWI 3KWWB 2C4FT 1HNFA 2E27L 3C5ZB 3L9RA 2NTFB 1AE6L 1X7QA 2I07B 2VZ3A 1MREL 3RWHA 4DGIH 5I1AB 1Z0MA 2NY3C 3HZMA 4OSUL 1JNNL 3I02A 5CP7A 4YPGB 1FBIH 2XY2A 3CFDB 3FO9A 3MLXL 1SJEB 4JRWA 1G0YR 5I1CH 1DSFH 2N7BA 3VXMD 4KJPC 5A2JH 4QRUA 1LEIA 2PYEB 1C5BL 1QTYT 1EFQA 3CFIC 5TFSH 2PKDA 3FRPA 4Y89A 2VERN 3BRDA 5FO8A 4BQBA 2FO4B 4NQEE 4RBPK 5JZ7D 4DAGH 1S7QA 4JPIB 3QDMA 4RMVA 5C8JA 5CD5C 1L6XA 3ZKND 3L7EA 2IH3B 5DUBB 2ATPA 3C6LD 4EUPB 4LQ1A 4X4ME 3A6OA 2X5PA 2PXYD 1QP1A 3TCLA 4EDWH 4F58L 5C1MB 4X80L 4LLDB 2Z35B 3KPPB 3N85H 4LLMA 2F58H 3MBED 2X05A 1GSMA 3P73B 1JYWA 4HAGA 4KK6C 3FQRA 3G6JE 2P5WD 4GO6B 3ZKXC 8CGTA 1HK6A 1EFXB 2VC2H 2X1WL 2DDQH 1HIMH 2CLZB 1B6UA 5EOTB 1NL0H 4JZNA 4WTWA 5DRXA 4ZODA 3UJIH 2DLTA 2NZIA 2VUYA 1U2HA 1MEXL 1MVUA 2BXZA 5FYKU 4LIQE 4FFWD 4C54A 1J8HB 2H26B 3M1BB 2R9HD 3G9VA 3LD8B 2ZJSL 1MNUL 3MOBH 4JFFB 3Q5TA 5F3BA 4ZUTB 2VL4A 4O58L 4K7FA 4B50A 1FNEB 4U2YA 1T6WA 4GRLC 5J9PA 1CDIA 3M8OL 3GMLA 4PD4J 1FGVL 4TTDD 2K9UA 3KPLB 2FX9H 3SKNA 3I2CL 4YAQA 1RUAL 5F9JB 1NMAL 4EUPG 5D1QD 4K23H 3GMQA 1XGUA 5LQBL 1JMXA 5A1AA 4HKJB 5T3ZD 1WV7T 5SX5K 4YIQB 2DICA 1TNMA 2I5YH 4EI5C 3GB7A 3BAEH 1IRAY 3H3BC 1JHTB 1XMWA 1F4YL 4MAYB 1RJZB 5DVOA 4LF3B 3T0ED 4YJZL 3K4ZA 3UPAA 5HHQA 4X8JB 2EDTA 1CXHA 2Y7QA 1A5FL 2Y5EA 2FJHB 4GAJL 1D5BA 3P0YH 1PKOA 3FOMB 5EU6A 5E8EA 2MNUA 1I8LA 1YPZB 4M61B 5HY9B 3M17B 4O51A 5FUZL 1ZLWK 4Z0BH 4NBYB 1J0IA 1WSST 5CSZA 1BQSA 1I8LC 2FL5B 4DJMA 5F88A 4M6OL 3KPNB 1WBXB 3QPQC 1YYLH 2CMRH 3MJ6A 4QXGL 3H42L 2VDLH 2UWEF 4HZAA 4C56E 5IB2B 4DFIA 1UB6A 4JO2L 3FO1B 3MTRA 5CP3A 5DJXB 2C1PB 2RAMA 1LQSR 1BIIA 4OCYH 3BIAX 2WV3A 5F7EL 5TDPA 1C12A 2ENYA 2R4SL 3DX8A 3MLRH 1DLHB 2WQ8A 3T0DA 2XICA 4HCRH 3GMMA 4XT1C 5JW4R 4CVZB 2JB5H 4RIRB 3QIWB 2NXZD 5HI5C 5D8JL 4LPXA 1HQ4A 2OJZL 3U0WH 2IBZY 1BOYA 3GKWL 4OTXL 1OAZH 1YEIL 4G6JH 4LPCA 2X4TA 1QFWM 4DTGH 1ZTXL 1KT2B 5IKCB 5EIVA 1MPAL 4P5MB 2O5YL 1A9EB 1IGTA 1A4KB 2Y6SD 1Z9MA 5BJTB 3OKNB 4ALAH 3SDCB 3MLYL 1OWRM 2BOCB 3TC9A 1OWWA 4XPBH 1A0QH 4OZHE 4Z0XB 1N64H 3QRGH 3QXTA 1A6UH 2W1NA 2YMXH 5C0FA 5JMRA 4L8SA 2KZWA 1YQVL 2QBWA 4HS3A 5CIPA 3KYOB 2XA3A 1K85A 4L8SC 3ARQA 4P23B 3A6BL 2DQGL 3ARWA 1QUNA 4DEPC 3D2UA 3S96B 4O2CA 5JOFB 2P24B 1SM3L 4LQFH 1FSKB 4PJIA 1JZ6A 1PYWA 4ERSH 4NHCH 4U3CA 4LSVL 4M7JH 1WQVT 3TO4D 5SWQA 4AH2B 2EIDA 5GPRA 1C5CH 3U0TA 1SMAA 4N9GB 5ESQB 3TT1L 2RQ8A 1WWBX 1DUYB 3B2VH 2MFNA 3ZDXE 1G7QB 3EYFA 3RGHA 4OQTA 4LNRB 5DDHB 1E4XH 1P7QD 1OAKH 4L8BA 2DWEB 1GZPA 3MR9B 1QSFD 1RULL 2LE9A 4XBGB 5TF1L 3CFEA 4Y16A 3GZKA 3WJJA 2VITA 3FT4A 3CSYA 2D7NA 4QNPE 2NR6D 2HMID 3GBNL 3QEHB 2E7BA 1A6AA 1HXYB 4OBRA 4Y16C 4CAGA 4EJ1C 3T2NH 1IKFL 3WJJC 4UV7L 3KPMA 3IYLW 3LKNA 5LCVL 1RIUL 4Y1AE 3UYPA 5BO1L 5TE6H 3U1SL 3GKZA 3BMWA 3UAJC 3PF2A 4Y8DC 1MH5A 2WLZA 3RL2B 3K4DA 4BSWA 4NPYA 5HHOA 2VL5A 5KJRH 3OR6B 5CP3H 1HYSC 4L4JA 3WNNA 3DVIA 4XVTH 1N5YH 2X4QA 2ZOLA 2EC9U 5L7XH 3LD8C 2BRRL 2G5BB 5C0CD 4Z78A 5BOPA 3SPVA 1XT5A 3EOAB 1IZJA 1CXLA 2OQJB 1FLRH 4MNGA 3I6LE 2QQLH 25C8H 3CX5K 3K3QA 1NFDA 4GMSL 3O45A 4WO4D 2VLKB 5D9SA 5EWIH 5CGTA 3G6AA 2Z92A 1N0XL 2PYED 2UYLB 4BZ2L 1MVFA 1JHKH 3HMXL 1IAOA 2X1QA 4MQ7A 3RWDA 1YEKL 2WINB 4J3UA 5A40E 1LEKB 2XZAH 4KZEH 4Y2DB 2VAJA 2EIZA 2UZIH 5DWUL 4JRXA 3WYRA 3ARGB 3EYOB 1F45A 4AIZB 4AENB 4RGNE 1U93A 2P8MB 4A2LA 2VKWA 5CGYD 1DUZB 4OUOA 4Q0XH 4JLRB 4OAWA 3LS5H 4H8WL 4J8RB 5E99H 4Q58C 4UDUA 3V8OA 4GUPB 3MO1B 4H0IA 4LVNC 3C6SB 1ZGLB 5CIPH 3QQ4A 1WT5C 2Q8AL 2CH8A 4WWKA 3MFFA 4GRMA 4NZRL 1K4DB 3R8BB 1NCBL 5ALCL 3STLA 4Z8FH 3MRRB 1R3HB 2DQJH 4U3XA 4MHHI 1IGMH 4WWKC 4UQ2B 5CCKL 1EFXD 1OSPH 3TIEA 2C5DC 3GSNA 4Y0GA 4F3FA 4K8RL 4A6YB 4YDJB 1KGCE 4XXCA 5TE4L 5I19L 2FGWH 3ROLB 4DGVH 1JGLL 3S3PA 4XXCC 1J8HD 3CLFL 4JFEB 4QCIB 4EUPH 4NN7C 2ADGB 1CXKA 1NDGB 4JFFD 4QYOB 5EU5B 1MCRA 4HFWA 1ORSB 4NO2B 4JZOA 5DR5L 2G2RB 4KUCD 3S7GA 2AEWA 1CG9B 4Y4KA 3UTSA 3DRQB 5L2KB 3ZHLA 1OM3H 5HTSA 1T5XB 5I1IL 3LDBB 3Q6GH 1UG9A 3NCJL 4LVHB 4HFUL 3TBTA 4Y4KC 1J86A 4WTZA 1P4BH 4KKLC 3NBNA 4GS7B 1RK0B 5ID1A 4P46A 2QTEA 4KROD 4UT9H 3E3QC 5GGTL 1A6ZB 5MP6L 5ADPL 1KPVB 2H6PA 2GK0A 4MA1B 3ARBA 5DJ0B 4PJ5B 2X6MA 3K4AA 1ZA3B 2F19L 3SDCC 4LSSH 4EN3A 5B38G 1G6RA 5JHDB 2VQTA 3QWQB 5E8NB 5JLZB 1CLOH 4N0RA 4I0KA 4FTVE 4DGIL 4EN3C 5DZLA 2E7LA 3MRLB 1FBIL 1S7RA 4UAOB 3G5VB 4LCCB 4YC2B 4NN6B 5I1CL 1DSFL 2DS4A 1J1XH 2YA0A 5BMFH 1BZ7B 3O8XD 4WU7B 5TFSL 1FFOB 5DI8B 1JNHA 2A6JB 1U8NA 4MXQC 3N9GH 3T2PA 1PD6A 3P9LA 1OTSC 5LKNA 3GDBA 1QVOA 1LE9A 3W11D 4DAGL 1T21B 2HH0H 3EO0A 4ODXA 3U83A 3U9UA 4GOSA 2RJMA 1UQSA 4M8QA 4BQ8A 4FOMA 3MRQB 4W70A 1BOGA 1I7ZA 3KPSB 3V5DA 4LPTA 4P9HL 2BNUB 1WFTA 4EDWL 4N0UB 1OPGH 3PWVA 3N85L 1P4LB 2F58L 1YJDC 1UXSB 1EO8H 1ZHKB 4OZHA 4FQHA 1XGPB 2ILLA 1NUFA 2D31A 4Z5RB 4E42A 4TUJA 5FYLD 4NQDA 2VXTL 4PP1C 2A6KA 3SGDI 3PQYE 2CK0H 4NFCA 2VC2L 4NUGH 2DDQL 2HWZH 2X1OA 1HIML 1H5BA 4P57A 1NL0L 3UJIL 3B2UD 2MCPH 3DSNA 3SKMB 3A67H 1DLFL 5GGUA 5FHBL 1H5BC 1P69B 3S88L 3LN4B 4CGTA 2HT4D 4ZO7A 4NZJA 2YD5A 3OXSA 4QHMA 5F7YC 4EKXA 2GUOB 3UPRA 1NJ9A 5IB4B 1HEZB 5J1AA 2AI0H 3AS1A 1OT2A 4MA3A 4NIKB 1TZHB 3OB0K 1I7RA 1QACA 4R0LA 4WW2A 4X99B 2FX9L 3O4OB 4KDTC 4YBQC 1UADC 1DFBH 1FZJB 3TLRA 1EEUA 3FB7A 4YDIH 4HWBA 4K23L 4F8TA 4WW2C 3MNWA 3RPKA 1P7KB 2VISA 5FGCB 4Q7DA 2I5YL 4UQ3A 4WHTB 3BAEL 2F74B 2X70A 1NLDH 2OL3A 3NN8A 3UTPE 5HYIA 3IAPA 1OTTD 3O11B 2Q1EA 1FGNH 3Q1SH 4C83A 5FV2A 1FPTH 1KTLA 5HGAB 1YZZA 1F58H 4NM8H 1T83A 4UT6H 3P0YL 3BIKA 3VGEA 2ATKB 3QDGE 1X5XA 3VFMA 3BE1H 2DQDH 4Z0BL 3QO0B 5B38A 2IQ9H 3SDAA 4E0RB 1BLNB 1QG3A 4ZO6A 2CQVA 1FORH 5K9OA 3LQMA 4LASH 1YYLL 2CMRL 1Q9LB 2AXGB 2DWDA 3SDAC 4X6CA 1OF2B 4XPGH 4OLUL 1JK8A 1U8QA 5DJZA 5L9DH 3LKQB 3FOLB 1YECL 1X5LA 5L8JB 4RDQF 5I17A 4ZMAT 3BD4A 5B8CB 4YHML 4NFDA 5GRJL 3MLRL 3IDJA 4RX4D 3ULVF 1YJDH 4GRWF 4HCRL 4OI7A 4FHBD 4H0GA 4QTIH 1CGSL 5J6GA 1A1MB 5HHXH 3HPJB 1UWEH 3PDGA 4PJ9B 5IIEA 4X6EB 4HUVA 2X4SB 4BUHA 4HK3J 3V52H 1LNUA 4G6JL 2X44D 5DQ9B 5FK9A 4DTGL 2HG5B 1WAAA 5HYSB 2X7LA 4JREB 4E5XB 4LVHC 2PW2B 4MS8C 1H15A 3KLHD 3WFHA 4I4WA 4M1DH 1MCPH 3ARGD 4ALAL 2VO5A 2V17H 2CDEB 5K9JH 1U58B 4JG0H 1IQWH 1A0QL 4XPBL 4ODTL 2EIBA 3QRGL 5I1GH 1RZJL 4HSQA 1A6UL 1PX3A 3E2HB 1ZEAH 4OCSH 4QRRB 3C5SA 2YMXL 3RU8L 5CEZH 4XP9L 5EUOE 4N9OB 4P3CH 3IFPA 1FH5H 3NA4A 1PZUB 1LO4H 3RUGB 1PX4A 5C07A 1EBPA 4JCMA 5SWSB 4YC2C 1YEDA 4J1UB 5E8DH 4LQFL 1SEBB 1BVLB 1R24B 1RUKL 1UC6A 4ERSL 5F6IB 3OXRB 4NHCL 2E8ZA 2JELH 2AEQH