4NBZB

Crystal structure of tcda-a1 bound to a26.8 vhh
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
132
structure length
132
Chain Sequence
VKLEESGGGLVQAGGSLRLSCAASERTFSRYPVAWFRQAPGAEREFVAVISSTGTSTYYADSVKGRFTISRDNAKVTVYLQMNNLKREDTAVYFCAVNSQRTRLQDPNEYDYWGQGTQVTVSSGSEQKLISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TcdA
publication title Structural Basis for Antibody Recognition in the Receptor-binding Domains of Toxins A and B from Clostridium difficile.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Immune system
total genus 32
structure length 132
sequence length 132
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nbzB00
2R2CA 1JHLL 1I1AB 2XWJB 3E6HA 5I2IB 1CE1H 5IROC 5GRWA 3B3IA 4X6CB 2MJWA 3DXAE 2B1AL 3T2PA 2AXHA 2APTA 3ARFB 5C2UB 5CEXA 4H20L 1H3VA 4PJAA 1FDLH 2F19L 4GMSL 1AHWA 1EHNA 4NC0B 1EXUA 4WFHE 3MUJA 4UU9B 4FP8H 4JRXA 4RA3A 1A4KB 1RHHB 1MNUL 3J7HA 2AEQH 3A6OA 3UTPE 1QQDA 3DX8A 3ZTJH 3BZFB 4OCRH 1J88A 1CFVL 3HAEB 4Z0BH 1F4HA 5IJVB 3QEQA 4JZOA 3IJYA 4D0BB 2O5YL 4JPVH 5TDNB 1YPZB 3VD3A 2PTUA 4DUVA 3WLWD 5JIIA 4YDIL 1VFBB 2XZQH 5EU7E 4PJGA 2JJVA 3REVA 4L3CB 3BW9A 1UWEL 2FZ3A 3MLZH 3QDJB 1OGAD 4UUJB 1I8KB 5DVNA 1CFTB 2QKIA 3CMGA 4OF5A 4Y4FA 1K5NA 5JXAH 1R5VA 2XA3A 4LKXA 1JYWA 4K3JH 4WUUA 1LDSA 2DQIH 1HH9B 1RZKC 3ZKND 6FABH 1H3TA 4FFWD 1OD9A 2M8XA 4HS6B 3T3ME 1HK6A 1EGJH 4ZFGH 4X98A 3VGHA 2BNQB 1S5IL 1XGPA 4HGWB 1RZIA 2R56L 5FYJH 5EZJB 1H5BB 3T0EE 5L6YH 3G5YB 1JPFB 1NUGA 5ESQA 1MAMH 4JJHA 3UJJH 4X6DA 2C7UB 2E7CA 2AEWA 4Y16A 4XCYB 2QL1A 4OLVL 3LN5B 1F8TH 2I26N 3MODH 1NSNH 4LCWE 4DTGL 2KBGA 3O8XA 2JIXA 2NLJB 3RQ3A 3DVGB 2FGZA 4ELMB 3L7FB 1MCLA 4RZCA 3S5LA 1YEEH 3OB0K 3RWFB 1PYWB 4X6EA 2DBLL 1IC4H 1H8SA 3O6FC 4ZNEA 3ZE1F 4R9HA 1XIWC 5C0BB 3CVHL 4PFEA 3ZL4H 3L1OL 4JJ5B 1QBLL 3GO1L 4R0LC 4X9HA 3KPRA 2CRYA 3OPZH 3VXRB 5BRZD 1W72L 4YPGA 4KRNA 2IANB 2VLRE 2OI9B 4Y4HA 2GT9B 4U6HB 4M6AA 2QLVB 2Z91A 4L3EA 1CVRA 3K4AA 3VDCA 1WSST 3BXNA 4MA7L 4R4FL 3ZYJA 2R1YA 3QCUL 4PJBA 5CZXD 2A83B 4JQXA 4P57A 4MQXD 2R1XB 2ADGB 4L8DB 3DO3A 3LMJL 4TSBL 5E08H 1GPOL 5EO0B 1A1MB 1TQCC 5BOZG 1CGYA 3QO0B 1F4XH 3UO1H 4PJHF 5CD5D 3AS0A 4G8GE 4FQXB 3EDDA 1ACZA 3RVXC 2HRPL 4JO3L 4EKXA 5F7KC 1P7KB 1XR9B 3QI9B 2G75A 4J3OC 3MRCA 3U36B 2JB5L 2IAMB 1BWMA 5BJTA 4ZUUB 4YXLL 3FFDA 1MCWM 3LSOA 4K3EH 5DEFA 3O6LL 3CSYB 4MXQC 1KJVA 3B2UC 3GSNL 3VG9C 1DCLA 3VDAA 3NFSH 3O4LE 3AC0A 3X13A 3LH2L 4JHWL 3V5HB 3A67L 2L7UA 3V0WL 2A9ML 4YBLB 3MCLH 4WI3A 1N5YL 2A38A 1UJ3C 3QIWD 4GG6A 5HGBA 1F6AA 2GJ6D 3CH8A 5L8JB 3H7LA 2A77H 4JQVC 4W4OC 3QPXL 3WCYA 3PXJA 4JAMB 1H15B 1T22A 1RJLA 1CFSB 3BI9X 1C7TA 1KCKA 4NO2A 3VDBA 2DWDA 3BH9A 2H8PA 1OF2B 4Q9QH 5L88H 5A2JH 4WEBH 5J1TC 4AEIL 1H3WM 2LVEA 5ICYB 4O2EA 2ADFH 4NT6A 4FXLA 4HH9B 3FONB 2R69L 4NUGL 3M8OL 1IGCL 2D2OA 3E6FB 4L8SA 1S7XB 2DQCL 3KDMA 5IBUG 1JWUB 1K3ZA 3LKQA 2Q20A 3C5ZB 5BV7H 4XMPL 5IEKA 3NCJH 4U1SA 4YFDB 1YN6B 4Z18A 1DBJH 3L5WB 4R8WH 4YHZH 3QUZA 4P46D 3ZHDA 5KSBB 3LIZH 1JPGA 2K3TA 5BV7B 3BPLC 5E0QA 3PWPB 5I71B 4GW5A 4HZLB 2EDWA 2PTTB 4UNTA 1DP0A 3ARRA 5D7KE 2VXVL 3KPSE 5C0JA 5D1QA 3JWNC 5CLTA 1DANU 3FFCE 3RVWD 4RDQF 5C07B 4ZAKD 2VDMH 4OD1L 1AXSB 1G1CA 1HIML 1T03H 4MXWL 2X4NA 4MA8L 5EU7C 2AEIT 1J1OH 3SOBH 2FO4A 3T0DA 3QEGH 3TN0D 2GQHA 3DRQA 1NBVL 5K59F 1BQHG 3E2HC 4PJIF 2R8SH 1MFBL 4QOKB 3WNNA 1OP5K 3SKMB 5DS8A 3JV6B 3MYJA 3BKCL 1BQLL 1I1FA 5C09D 4FNLH 5GS0H 5HGAB 4KRPD 4MNQD 3LKRB 4C83A 3NZHL 2VXQL 3WEXA 5E2TH 2VDKL 3LN4A 3VMOA 1DVFD 1GC1C 2FATH 2BNRA 4KK6C 5GGUB 4I13B 2MQ0A 5JXEA 4WY7L 5TQ2L 2FX9L 2VAAA 3VW3H 1FV1A 1T5XB 4X7TB 1M6OB 1UWXK 4JREC 4ZUWB 2FL5B 3OKLB 3HRZA 3DBXB 4M7LT 1G0DA 1WTLA 2DIBA 3HZVB 2NY5H 4RCAA 3MXWH 3T0EC 2ZSWA 3EYSL 3G5ZA 2OMBA 1SBSL 5DZLA 4JKPL 3RY4A 4P5TC 5KN5A 4WO4D 5EOCJ 1P6FA 5IHUH 1QRND 3LEYH 3HE6C 2VIRB 3CC5A 3HPJA 4NZTL 2LU4A 4Z7OE 5T3ZE 1VEOA 4R90L 3TO2A 1KG0A 4I4WA 1BZ7B 3ZLQC 5BMFH 4PJHE 4EOWL 2DLIA 2Y06L 2VWEE 4BELD 2ITDB 1YEDA 5H37G 3O6ML 2H3NB 3MRNB 4POUB 4WW2A 1BJMA 4N1EA 3JWDC 3L3DA 2D9CA 4ONHB 4LLWB 1IKFH 5DRXA 1OAUL 2VZUA 3F12A 2D31A 4MDIB 4F7EB 5GPRA 3M1BB 4S1QH 3DVIA 3SE4C 2AERT 1BFSA 1CD0A 2M1KA 2HYMA 2NR6C 5HYSA 3CSBA 1A5FL 3IXAB 1EMTH 4YHPA 5L2KE 4XHQA 3FB6A 4LSQL 3VD9A 3D2UA 3IGAA 1MFAH 1MRFL 2NY6C 3C08L 1Z9LA 1U93A 4ZD3H 5ACZA 4ZFFA 2XNAB 5D7IF 4NWTL 4Y5VA 1KOAA 1J0IA 1DQQA 4R4BB 3SE9H 1U2HA 1WGOA 2F5AL 2J8UB 3QJFB 4K7PX 4HSQA 4CBPA 5CGYC 5F9OL 2QTEA 1NDMA 1RJZA 1T0NA 1JWMB 3L95A 5JW5A 5KVMC 4KK9C 3TH2T 3O45A 3CZJA 2IADB 5J6HA 3SDAA 1IAOA 1JF1B 4P3CH 4Z77B 1TETH 3W0WB 3X11B 2ADJA 1MCWW 5A1AA 4XNMA 2AVGA 2FHCA 4XPFL 3HNVL 2VITA 1U8QA 3OXSA 5F3HB 3QWOA 4G6JL 2A9NL 3LHPL 3C6LD 4NQEA 5FECA 3SKUD 3FHAA 4NJ9H 5EUOB 1AH1A 5KAQF 4JHAH 2LTQC 2CJUL 2X4QB 3CFCL 5DEZA 4Y88A 3WJJA 1G7IB 2R1WA 4FTVE 5IEHA 3LRSA 5K9KA 3EOYG 4J12A 3J8F7 2IMMA 4APQD 2MNUA 2C4FT 5AYUH 3MJ9L 2DD8H 2FGWH 1JE6A 5FK9A 3S5LG 4N68A 2EO9A 5D71L 3B9AA 4M1CD 4HEPG 1GGTA 1HWHB 3OJDA 4LLUB 3MMEA 1JYXA 1II4E 1T04A 5C9JA 2EDKA 3VFMA 4ALAH 3VRJA 2X70B 4G80B 1RIHL 1E6JH 5J13C 4BKLA 4UB0H 3LKPB 3UPRA 1TZHA 2XPGA 4CVXA 4O2CA 3VXQA 3IFLL 4TULL 3NPZB 4TNVF 3IAQA 4DKAA 3GSOA 3VXTA 2P5WB 5J11C 3DURA 2PW1A 3HI1A 3S36L 3K7UA 4PGBA 5KSAD 5FYLH 3BGFC 1G0YR 3CMOH 4WI2A 1IL1B 4KWUA 1V8HA 4YGVA 1DE4A 2VLMD 1MFDH 5E00A 1LNUA 4AEHL 1J0KA 3DROB 2JKXA 4Z78B 3IDNB 3M17B 3NACL 5DJYA 1CL7L 3EFDH 1N59A 3ROOB 1G7JA 3LCYA 1FYTE 1SJHA 1N6VA 2MKLC 1T21A 2NY4B 2OTWB 2X9YA 3CFBA 3CFDB 4B7LA 4F7CB 5ALBL 1ZLVK 3P40A 3GJFK 4Q9CA 3WSQH 1DQJA 1WIUA 3VGAB 2P8LB 1LO5B 1QNZH 5EOTB 4GBXA 4GKNA 4RMSA 4KK8C 4NKQB 3O0RH 4MAYC 2OYPA 3EOTL 5EOCH 3K3QA 2YA0A 4U3CA 3BJ91 1YMMD 5CJXA 4LVHC 2ZUSA 2HJFB 4MAUL 5FGSA 3MV7A 5D1ZA 1C08A 5F6IC 2XY2A 5IK3B 4UT6L 2FWOB 5DGQA 5F70A 4MGXA 1R3IL 4IRJC 1DDHB 1NEZA 1RSFA 4NCC2 4DEPB 5L8LB 3QP3A 1S7WB 2CMRL 2XQBH 1A7PL 3BYYA 5BS0A 1ZE3C 3T77A 4QHMB 3S88L 2EIZA 2X2YA 3R06B 5DRZA 5I8CB 2M26A 3DSFL 3WKMH 5D2LB 5T3XE 2Y7QA 3ILPB 1ERNA 4PV9A 2O61B 1CGVA 2VAJA 3MLXH 1QBAA 1UVQB 3D39B 3CFEB 5CJQL 2ZNWA 3V5KB 2WBJC 1NLDL 2LABA 2W38A 3EAKA 2R29L 3IJSA 1PKQA 1ZHBA 1I1AD 2BDNL 3S34L 3I6KB 3SQBA 4FZ8L 5DTFB 3KPLB 1IC7L 4DKEL 2HN7B 2XFXA 4MB4A 3ARFD 4HBCH 2XG5A 3OKKB 3CPLB 3DMMA 3BKYL 5M94B 1X5AA 3P4LA 1ZTXL 3OGOE 2Q7YB 3P3YA 2ED8A 4HJJH 3ZSSA 4P0DA 3VH8B 5AAWA 3FN0L 1U2CA 1FG9C 5DJXB 1TZIA 1JGLH 2X05A 1IC5H 3MRDA 4RWYL 4IS6B 2ADIA 2EXYC 2IQ9H 2P47B 4MD0A 3G6AA 3JV5A 1CBVL 4M9PA 4NOFA 3WFBL 5DD6A 4RFEA 4IRSC 3WHXA 4UV4L 2PCPA 1F00I 4JFXB 2R0ZH 3KHOA 3EYQD 3BPOC 5I0DA 4MS8D 5IVXF 5I1CH 4JRXE 4NZDA 3RKDC 1GL4B 3HUJB 1CGTA 1K8DA 3MBEC 2V7NB 2AJ3A 5D72L 1UYWH 1MLCA 3ARQA 4HPYL 2ATKB 4IDJH 1CDIA 1EFXD 3QDJD 4NQCB 1EEYA 3OR6A 3QEQE 2Y72A 3BKJH 1S7RB 4QT5B 4PD4K 2HJLB 3RGVC 4FHBD 4ODTH 4YHOL 3MRIB 4P2YA 5TPWL 2DM7A 2D7TH 1MIML 1OTTC 1VFAA 3MXVH 4HQQH 4LFHD 3L5XH 4NNXA 3C60C 3RPIB 1JMZA 3N9GH 4PJGE 3IRZA 3HRPA 1JF5A 2R2EB 5DYOA 2CDFA 5ILTH 3G5VA 3RDTA 4Q6IC 1MCJA 4O9HL 5F6HI 5DUPL 1OCWH 3QFDA 3WJLA 1JPSH 1LEIB 4EN3A 1E4KA 2CO7B 2BNQD 2P8PB 4R97C 3VGDA 3MOBL 4FA8A 4B7IA 2VDOH 4J3TA 5KG9A 4ETQA 4KJQC 4Q7DA 4WUUE 3HZMB 4OUUB 3CCHA 4L4VA 1HQ4B 5EU3B 3VFTA 4L8BA 3P0GB 3SJVB 4NC1E 1RZKH 1PX3A 1MCOL 2AJSL 3BX7C 1U58A 5LXGH 3QIUA 3F8UB 1QHPA 5FYJD 1JI2A 3RIFF 1N64H 1W72A 1KLUA 4UTBH 4K23H 5DJZB 4M9OA 4JKWA 4TTDC 3VFWA 2FJFB 2BC4A 3WFCH 3KLAA 1KJ3L 3UJIL 4LAJH 2EE2A 5C0BD 5B4MC 3BGMA 2A6KB 1VKXA 5E9DA 5DMKA 4FABH 2CR6A 4HHAA 3K46A 3VXRD 3WIIH 5HYSG 4WHYH 3QHZH 1A64A 3X17A 1JPTH 3LKSA 2IAND 4FG6C 3IS1X 3GB7B 2B4CL 5HHVH 1YDPB 1U92B 5KJRH 3WNKA 1P7QA 4NO0B 2XY1A 2F53B 4PJXF 4ZNEE 4CMMA 3MLTB 1YNKL 1X5HA 2CIKB 1PY4A 4JDTH 4QXUH 3L3HA 1D6VH 4KZEH 2EYSA 1XT5A 3TH4T 2VKWA 4ZPVB 4G5ZL 1C16B 1BIIA 4KDVA 2GKIA 4PIRF 4KZDH 1Y0LB 1ONQB 4QHKI 4KI5E 4FQXD 3GHBL 1I7ZB 4O51B 4OFDA 3I02A 1U8LA 5ACLA 1N26A 4L3EE 3SN6N 3GRWH 3QI9D 3O6FB 4CGTA 3T0WA 2IAMD 4KUZH 4Y0GA 5EO9B 5FM8A 1G7MB 3EFFB 3MRGB 1YNTB 2IH3A 4LBEA 1CI5A 4R0LB 1KGCE 3EO0A 5HGHA 5AZEL 5AD0B 3HR5A 3BP7B 4LNRA 4LSUL 2BK8A 1FG2A 1NLBH 5EORH 5GS2H 5IR1A 4F37F 4LCUB 1G9EA 5J57B 3ARGC 4RGMC 3NH7L 1BVLA 5FA3B 2FIRT 4M02A 3H9SB 7CGTA 5IB3A 3ARXA 4AIXA 1CDUA 3NAAH 2DQJH 4NFCA 4P23C 4E0RB 5J9PB 2XZCH 2C3VB 4EDXB 5B21A 3MRJA 3DO7A 1CL7I 1XCQB 3FOMB 2BCKA 1DSFL 1GAFL 1MSPA 3VRIB 1UXSA 3MA7B 3U48A 1JGVL 1BAFL 2XTJC 1MCPL 3BWUC 5D5MF 1BOGA 3DOSA 4LSTL 1C1EH 4GG6E 1JHKL 5EU4B 4HUUA 1WF5A 2I5YH 5TGBB 4OQTL 3R8BB 5JLZB 3BZ4B 2HT2D 1U8JB 5FOBA 3ZE0E 1CE1L 1X3DA 2BZDA 4J4PD 4QYOB 3EZJB 4PJCB 3RVUD 5DFVC 3MRQB 2IG2H 5CSZB 2LAAA 4JHBA 1FDLL 2ZCKH 1U8IB 1NUNB 2GITB 4NQDA 3TT3H 4HIEA 1UJ3B 4FP8L 2DOCA 2AEQL 3SHSA 4YBQD 5I66B 3NIFE 2FR4A 2DYPB 4GT7A 5JQ6H 4DCQB 2K1MA 3O2VH 1X5XA 4OCRL 5E2WH 2E7HA 2OTUA 2UZIH 3PWPD 3EDFA 1E28A 5BXFB 2N7AA 3FT4B 4JFPB 5IW1B 3VGBA 5DZOA 4UTAH 1GOHA 4JPVL 2UYLB 4I1NB 2VH5H 3RA7H 4QRTB 5C07D 1YC7A 4TUOA 3SGDH 1AGFB 2XZQL 1FFNA 3BWAA 1IGJB 4JR9L 3P4MB 2EYRA 4BJLA 1CCZA 1U8PA 4D9RD 2MSPA 3TYFB 1S5HB 1A7NH 3V6ZA 1CFQA 1JVKA 5DK2A 1BVKB 3LD8C 1V3JA 1NGZA 3F7RA 3H42H 1CWVA 1A6AA 5JXAL 2PXYD 2VLJA 3CJJA 4QOKD 1HI6B 1KNOA 3ZSTA 1WLHA 1X5YA 4K3JL 3GSRA 4G8IB 2DQIL 2QSQA 1NEZG 1KJ2L 4JFEB 4PLKC 1Q8MA 2O5ZH 3WN5C 3B9KC 6FABL 5FA4A 4OCSH 3WDJA 3VCLB 3BPLB 1EGJL 1KIRB 4ZFGL 4ZUSA 5FYJL 5BRZA 4U1LB 1MAML 5GS0D 4I3SH 5E8PA 4KQ4H 2XACC 1YC8A 5E8DH 2XKUA 2GI7A 4NZUH 3N1FC 1F8TL 4QHNA 3MODL 1NSNL 2BNRE 1M7IB 2P48B 4LIQH 3TNMB 5DDHB 5LBSH 3RL2A 3E2HB 4OZFH 4M6MH 2ZG1A 1YEEL 1XR8A 1DQTA 5GGRB 1BFTA 3BIKB 1IC4L 3L6FB 1IGMH 2P5ED 3OJ2C 5E4EC 4XCCH 1SYVB 4K3GA 1NC2B 3ZL4L 3DUHA 2WQ8A 1FZOB 1T1ZB 3T2QA 4JVWA 3OPZL 4JN2A 4MXVF 4MJ6B 5HHMB 3PWNB 5CEZL 4OZFB 5FO8A 4XPBH 1ND0A 3G6JF 2OX5A 1QACA 4YFEA 4XC3H 4JREB 4URTB 1GGUA 4AT6A 1ES0A 4M3JA 2ZG2A 1YQVH 2VQ1A 2WUBH 4W81A 4LGSB 2COQA 5EBMB 4WJ5B 2GFBA 4P5TB 3JVGC 1QSFB 2YC1B 1BLNB 4KY1L 1I9JH 3DX7A 2APBA 4MLIA 3WIHA 5B39A 2GJ6A 1F4XL 3UO1L 4P48A 2IQAB 1JNHB 3HE6B 3JV0A 4NHUB 4NBXB 4PJDF 1TZGH 5IB5B 4TUKH 4FQHA 1GIGH 3GHEH 2K9UA 2FH8A 3PQYD 3ULVL 1XF3B 1CQKA 4KJWD 2NXYB 3TCLB 4ERSL 4YX2H 3GBML 5L2JB 2JB6A 4K3EL 4X6FA 5EU6B 3W0WD 2OXGA 1D9KC 2WIIA 25C8H 5CJOH 3R1GH 3W9DB 1ORSB 3BPCB 4RMUA 3QFJE 1K8IA 3NFSL 2WWMC 3LVEA 3MJ9A 1FZKB 1ZHLA 4OV5B 2V2TB 5FO9A 3MNWA 2BSRA 4MVBD 3WS6C 1FL6A 2AV1B 4NJAL 5SX5K 2OSLA 4IEFB 3UYOD 1I3UA 4RFOL 1VGKA 4RQQB 3EO1B 2A77L 3AXLA 1JV5A 4YWGH 3W81A 1L4IA 4C56B 2HWZH 2G2RA 3MGTB 4P46A 3C5JB 2Q76A 2YKLL 2P7TB 4Z7WF 5L88L 4M7KH 1AGCA 1CK0L 1NGXA 4WEBL 3CSPA 3QEHB 1N6UA 1R5IA 4HLZH 2R0KL 2J6EA 3GSXA 1UKQA 4YH6A 3P4NA 3WO4C 1XZ0A 5I17A 1ZLUH 4HLJA 2AXFB 1KF9B 3IB4A 2VABB 5BV7L 5E5MB 1S78C 3TN0A 5JPNB 4X9BA 4C57C 3FQNA 1NAKH 3RWJA 2LTQB 2P5WD 3KPQA 3LEXA 4MNGA 3DRTB 3NCJL 4DKFH 3KYMB 1KJMA 5I8EA 1WWAX 3S35H 4JPKH 2YS4A 4R8WL 4YHZL 2W92A 5FHBH 5C09A 3P4OA 2C3XA 4KGJA 3UPAA 3LIZL 4MNQA 4U6VH 5I15H 1DVFA 4U1NB 4N0FA 1X4ZA 4OUOA 3DV4B 1XGTB 2OCFD 2NY4D 1VPOL 4I3GA 4X7DC 5FYLD 4DW2H 5I76A 1XH3A 2VDML 4WGVB 3UBXB 3PGCB 4G8EA 1T03L 1A4JA 1MCEA 4X6BA 1J1OL 1DQDH 1V3LA 3QEGL 3V6OA 5J13B 4U1MB 1B6UA 1T5WB 3GZKA 3RVTD 1INEH 2OL3A 5F71A 5FYKE 3SY0A 1UFUA 3HNTH 4NKMA 4WO4A 3FTGB 1QRNA 2P8MB 4JFHD 4HC1A 1FO0H 3DETC 4NDMB 5J11B 3GJEB 4FNLL 5IG7B 2VZOA 3FJTA 3IDIA 5HDOA 5GS0L 3BGFB 1HH6B 1BBJB 3OAZH 4GG8A 5E2TL 2ATPB 1DFBL 3CFKA 5H2BB 3LRHA 3QWQB 3F65A 1SEQH 4NCDA 3VW3L 3MJ6A 1FO0B 4HKXB 5FKPB 2UUDK 3D39D 3MV7E 3VE0B 2NY5L 2IFGA 2VR9A 1UB5B 4CADA 4XAWH 4OKDA 1JRHH 4M62H 5BS0E 4LLQB 5IHUL 3LEYL 3IDMA 2VOTA 4MAYB 3P73A 5IMOB 3KLHC 2ESVE 3EJZC 5TE4H 3ZYIA 5BMFL 1TXKA 4LVHB 3TCXA 3OJMB 4NBZB 4Z7UF 5F6IB 2R23A 2JJTA 4XVJL 4IRJB 1P4LA 2E7LA 1PKQE 1IKFL 3GJFA 3RWCA 4Q74A 3ZYOA 1FFOB 3REWA 4S1QL 1BM3L 2BY2A 3GIVB 1I75A 1LE9A 2J88H 3ARYA 4Z9KB 1BWWA 4Y7MA 7FABH 1N4XH 3PWVA 3BSZH 3JUZA 2D7NA 3VFNB 4JO2H 4LDOB 3C6LA 1MFAL 3RZCC 5D1XC 1HXMB 1A1NB 3LY6A 3VXSB 3C5SB 4U6YB 2WBJB 4ZD3L 3X3FH 1G6RA 1PKOA 4NQCD 4ZODA 5SWZB 4G6MH 2V9TA 3SE9L 2PO6C 3RKPA 4APQA 5FCSH 1IGFL 1CFNA 3CLEH 4IM8A 3FCTB 3JTTA 1HILA 4XP1H 1HHIB 2Z8RA 1I4FA 3EIFA 3JWOH 1MJ7H 3O3EA 4QRPB 4BQCA 3WV0A 1KPUB 5C1MB 4H8WL 4CL7A 4Y8DC 4RFNC 3B5HA 4LEOA 4HDIB 3BE1H 2EDEA 2IWGA 3HMXA 4O5LH 4IRSB 4HW6A 4F9PA 4NJ9L 3U79A 1NBZA 2P42B 5ITFB 4XVTH 1AD9B 1BF2A 1AGEA 1JBJA 4JZNA 4YIQB 1WWCA 1F58H 1NJ9A 1ZA3B 3MBEB 3RL1B 1WC7B 1D6EA 4LSPH 3SJVD 4GKSB 4N8VA 4HAGA 5KSAA 1KYOK 1ETZA 4ODXA 5AYUL 2FGWL 3D1MC 3V0VB 4JKMA 2BVTA 1VADA 2IF7A 3NCMA 3C60B 2H9GB 4L4VE 1G9NC 4ALAL 1C5CH 5GGVH 4NNPL 4Q6IB 5C9KA 3KR3H 3MTRA 5HDBF 4Z7QE 1NFDA 5GGTA 2FJHA 4XNYH 3SE8H 2W0FA 43C9B 2DTSA 4R97B 5T1KB 2P4AB 3OKNB 2SEBA 2CLZA 5FV2A 3QNZA 3U9UB 5MEQB 4NO0D 2F53D 3RUGE 1YMMA 5FYLL 3CH1B 2I27N 1B9ZA 2HFEB 3CMOL 1I7RA 5E9DE 5F89B 1QLFB 3LQAC 5B39G 1FCGA 1MFDL 2YD6A 4MDJA 32C2A 3FQRB 5DHVA 1I8MB 1OSZB 4HUVA 3BZEB 1S9WB 3OX8B 1BFOA 5E1AA 4L9LA 1B2WH 1NCCH 2X4SA 5F7FA 1YEHH 3CDGB 3O6FD 3HPLA 4OI7A 3ARBC 5CSGA 3WSQL 3V4PL 3GMNB 3M45A 3RNQB 4AQ1B 5EZOH 1QNZL 3U82B 1LK3H 4JG0H 3O0RL 5EU5B 3MLVH 2XWJA 5EOCL 5CINL 5I2IA 4ORZC 4KC3B 3SBWA 3MLRH 1OAYL 4X6CA 2EDLA 1BFVH 4C55A 3ARFA 4QKXB 4PJEF 3WLBB 1GGIL 4PJIB 4N8CH 5JQHC 2XQBL 4UU9A 3VXMB 1A4KA 1RHHA 3B8YA 4OIBA 4OSUH 4PRNB 4XVSH 3PG2A 3BZFA 1YMHB 4TVSa 5GS2D 3UXFA 3WKML 1CZ8H 3HAEA 5IJVA 2YBRB 1DEEB 3LAFA 3FB5B 3MLXL 4XPHH 3RVXD 4D0BA 1WCBB 5TDNA 1YPZA 4JGMA 1KPRB 4LPWA 5B8CC 1D5MB 1VFBA 1X5JA 3U0PB 5FV1L 4HS8H 1BQUA 4MXQD 4L3CA 2EDFA 4B0MM 3B2UD 3H7BB 1QHOA 1U42A 2EH7H 3QDJA 4HBCL 3IXTB 1I8KA 4MNHB 1CFTA 4NCC1 1VA9A 1PLGH 3OMZA 4PP1C 3TPUB 5E56A 3ARGB 4RGMB 3OKOB 1SJXA 5FM4A 2YPLB 4YXKL 1UZ8B 1V7NH 4HWEL 1VEMA 4I2XB 4RIRB 3UAJC 3MRMB 4OT1H 1JGLL 4P23B 1HH9A 1IC5L 4GFTB 5F96H 5MEPB 1ZXQA 1WWBX 4LCYB 2IQ9L 4BSWB 5DA0B 4FFYH 4HFWB 5ESVA 2E9BA 4AY0A 4HS6A 4X8XA 2OP4H 1OGAE 2BVPB 2R0ZL 5EG6C 2A6JB 3FZUC 1UCBH 2D7OA 2XTJB 2UWEF 1WT5A 1BVZA 4C59B 1PG7X 4HGWA 4DOHB 5I1CL 2BOBB 5EZJA 1H5BA 1JPFA 4NBYB 1UYWL 2Z9TA 3KYOB 1MLBB 4IDJL 1IZJA 2C7UA 1EHLH 4MJ4A 4X80H 4JFOB 4TVPL 3BKJL 3E8UH 5TE6L 3LN5A 3SKJL 4ODTL 2KQNA 3CZFB 4G6FB 2D7TL 3OKDB 4WI9A 5D7IB 2NLJA 1CN4A 4HQQL 3QQ4B 3PNWB 3DVGA 3L5XL 1HZHH 4LLAA 3BN3B 4ELMA 4M61B 3L7FA 4PRAB 3SGKA 1J8HB 1E4XH 4JFED 1FCCA 3VXOB 1AGBB 5HY9B 3RWFA 1INQB 2OBGA 4LLYB 4UMGA 3PV7A 4KDTC 4PJ7F 5C0BA 2CRIA 3JTSA 4JJ5A 1YUHB 3MBXH 5J6GA 1MHPH 1WJ3A 1JYVA 3VXRA 3K2MC 1T7ZA 1LE5B 2MMXA 4WUKH 5CD3B 2IANA 4OLWL 3U4BH 5IFHH 3C09C 3BEWB 2GT9A 2VUOA 1ZSDB 4JM2A 2PW2A 4U6HA 3QCTH 2UZYB 1RD6A 1RZKL 4CNIB 4POYA 5LXGL 2GTWB 1CFBA 4JO4L 3IJHB 2A83A 4IIQB 1FJ1B 1MAJA 4UTBL 2R1XA 3LD8B 4YNYB 5BRZE 1J05B 5EO0A 1HNFA 3WFCL 4FZEH 5AUMB 1NC2D 1LEGA 3WN5B 1P7KA 1XR9A 3B9KB 4OV6F 4FABL 3QI9A 3GI9H 3T0AA 3U36A 5HHMD 3QHZL 1JPTL 4MX7A 5HHVL 3D0VB 1UEYA 2W1NA 5KJRL 2ZNXA 1CICA 4NGHH 4PJAF 3V5HA 1ZHKB 4QXUL 3CLFH 4RMTA 1AXTL 1CGSH 1D6VL 2XKSA 4OCXH 4AIOA 4P5TD 1QSFD 3I6LD 2YD4A 1UADC 3HE6D 4JAMA 1A47A 1H15A 4KZDL 2P43B 2R15A 1CFSA 2YSSB 1U6AH 4ETYA 5GRYA 4BH8B 3STZA 1AFVL 3GRWL 3VXUB 2NXYD 4OM1H 5E4EB 4JPWH 5DF0A 2XQYG 1DZBA 5EU6D 4R26H 1EBAA 5IMLA 4X99B 5AEAA 3SDYH 1ZT7A 5ICYA 4ZO6A 4HH9A 2GJ6E 3FONA 5IW3A 4X8JB 2VERN 2NR6D 3UROR 1S7XA 2AK1H 4JN1H 5GS3A 5IB2B 1NLBL 1JWUA 5EORL 2LE9A 3MNVB 5C2BL 4J4PA 2D7PA 3C5ZA 4R96B 1A7QH 3KYKH 4X7CC 4U1IB 1J18A 3OR7A 3OB8A 2BSED 4QEGA 3O6KH 2DQJL 4NRYB 5EA0H 2I07B 5IVOA 4R6UA 3ROLB 4C56D 1P7HL 2Y25A 2ENYA 2XZZA 3L5WA 4XVUC 4HMEA 4NQSB 5KSBA 1GGYA 3GIZH 3PWPA 2DDQL 4GRLC 5CGYD 4HZLA 4KK9D 2PTTA 1WWWX 1AKJB 1C1EL 3C8HA 4U6XA 3T2NH 1A7BA 3RWEB 1JZ4A 4X6DF 3VJ6B 2I5YL 1BEYL 2F74A 1HQRB 1IEAB 2G5BB 4MYWB 4U49A 1ADQH 1D9KB 3SPVB 1AXSA 2EE9A 4WHCA 4RWHA 3MCKB 3CXDH 4FS0A 5DJ8B 1BMGA 1VDGA 2ERJC 3C9NB 2OJEB 2KQMA 2IG2L 3DSNA 3TT3L 5JOFB 1TPXC 2PETA 4LAQH 2BJMH 2X4UB 5KW9H 1T20B 4QOKA 1RK1B 4TNWK 3SKMA 3JV6A 4BFBD 1DN2A 1TCMA 5JQ6L 5ANMB 3O2VL 1KEML 5E2WL 1E6OH 3LKRA 4U6TA 3VD7A 2NPLX 4NQXB 1SY6H 3NA4A 1AE6H 2VH5L 4ZOCA 3RA7L 1A2YA 5GGUA 5BZWB 4MNGE 5EUKB 1A02N 3D9AH 1T5XA 3HHRB 1M6OA 4ZUWA 2FL5A 3DBXA 4PJBF 3HZVA 5C09E 3UTTB 5GZOD 3WO4B 1RURH 1KT2B 1A7NL 1DBBL 5I19H 4MNQE 4GRWF 5IVXB 3TNNB 3KHQA 4I0PC 2YRPA 3H42L 3IDYC 4KKLD 1D5BB 3MLUH 3VFOB 4CVWA 2VIRA 5CEYB 3IETB 4FFWC 4RMVA 5M7QA 1JMXA 2F8VA 2VMFA 3FQTB 2VDQH 3T4AA 2O5ZL 3TBWB 1O5DT 4HMCA 4HIIB 2H3NA 4OCSL 3MRNA 4L9DA 3V6OE 3K80A 5AAMA 3VFPB 3O3DB 4ONHA 4LLWA 2DLEA 3OHXB 4DK6A 3BQUC 3HAEG 3LS4H 3M1BA 1QRNE 1TVBB 3GKZA 3HFMH 4I3SL 5IKCB 4EIGB 4KQ4L 3IXAA 4N1HB 3T3PF 3BUYB 2JELH 5E8DL 4R3SB 1Q9KB 3QAZC 4YXHH 5DJ2A 4NZUL 1URLA 3ZDXE 1S8DB 4YAQA 5D7JC 3A6CL 3N1MC 4V2CB 3RIAF 4LIQL 4KK8D 5FHAH 4U7KA 3F5WB 4TUJB 4ZPTA 4MAYD 2R2HA 5ID0B 1Q72H 5FGCE 1U36A 2EDNA 4U1JB 4KVNH 1IQWL 4PB0H 2D7MA 4RMRA 4R4BA 2ARJB 3SDDC 2DQHL 2ZWLT 2J8UA 2CPCA 3QJFA 1IGML 4XCCL 5EOQH 5I16A 3P77B 1JTPA 4LFHG 4OGZA 1P69B 4DUWA 1EEQA 4IRJD 1JWMA 4P2RB 4CRPA 2ZOKB 1GGCH 4C4KO 2IADA 4YR6A 4BYHA 4J8RB 4MA3B 4Z77A 4XPBL 1MH5B 4YDJB 3W0WA 3X11A 4YZFF 2X42A 1P2CB 4LK4A 3CX5K 2RHEA 1Q0YL 2HKFH 5CZXC 4XC3L 5EIVA 4D0DB 5EUOA 3WNPA 1NBYB 2WUBL 3VXSD 2WBJD 3NFPB 1G7IA 4UOW0 3RJQB 1UM4L 5FXCH 1I9JL 1CLCA 5SWZD 4FMKA 3HG1B 5EBLB 4PJXB 5DMIH 4UIKL 2XN9B 4TUKL 3PWJA 3GHEL 3GKWH 2RCSH 3ALPA 4JY5H 4EQ2A 1D3CA 4QRPD 5TDPB 4YX2L 3EGSB 4XNXH 5HVFB 2XA8H 4LOUC 4BUGA 4LLUA 3CFJA 25C8L 4N90D 1QFHA 3G04B 2EXYD 3QIWC 4IRZH 2E27H 2X70A 2HFFB 4IRSD 4G80A 1TTGA 1TENA 4Z6AT 3LKPA 3VD5A 4FQCH 1ZA6B 3RKDD 3RZCB 5D1XB 1FNLA 3MBED 3T2OA 2P5WA 2IGFH 1MJJA 4YWGL 1A9BA 2YXFA 3FAXA 3FN3A 5HGDB 2X41A 4K7FB 3MV9B 5ICZB 4P9MH 2F54B 3PGFH 2W91A 5JA8B 1LK2B 4WGWB 1P9MA 4M7KL 1OTTD 3DROA 4Z78A 4K7PY 3IDNA 5F7DB 3M17A 4EIZC 5J3HC 3C60D 1ULVA 4Q97A 3ROOA 3NZ8B 2OTWA 3CFDA 1FNFA 4F7CA 5D6DC 2HLFD 4RFNB 1L7TH 3DV6B 2LU3A 3L3OB 3QSKB 5D5MB 5EZLB 3TBYB 2EEBA 3QB7C 2P8LA 1LO5A 2VLME 5EOTA 5T1KD 4OF0A 2X4TB 1NAKL 4DKFL 1YEJL 1T89A 1CLOH 4KJQD 5EFIA 1YEKH 3S35L 4ZS7L 2HJFA 4JPKL 4NRZB 4WW2F 1NGPH 2X4OB 2ZCLH 1JZ6A 5FHBL 5IK3A 4MQ7B 4WI8A 1G9NH 4HWBL 3RVWC 5HJ3B 4LKCB 1NFDE 4V1DB 1CVSC 4U6VL 4ZAKC 5C3LD 1S7WA 5I15L 3KJ6H 2ZP0T 4BFIB 4QHMA 4HXBL 4TTDD 5DQJA 1S9VA 4ZFOB 2IBGA 4JDZB 3ILQC 3ZDZF 5I8CA 4DW2L 5D2LA 3ILPA 2Y5TB 5B4MD 3CVIH 1YMME 2O61A 3BN9C 1UVQA 3D39A 4XZUA 3NIDF 2IPUK 1DQDL 2B39A 3CFEA 1TVHB 5FUCE 1FC2D 3V5KA 1UXWB 3LQAH 4HUXB 1INEL 2I9TB 1JF6A 4FG6D 3HNTL 4O4YH 5DI8B 5A2KH 1WUNT 2D7QA 1RK0A 5F88B 3WUWG 5FUZH 5DTFA 1FO0L 1EZVX 3KPLA 2XV6B 3IVKB 4PUBH 4CU6A 2HN7A 3D6GA 1PZ5B 3OKKA 1WV7T 5HI5D 4WNQB 5LQBH 4QF1B 1SJEB 2E8ZA 2Q7YA 3VXMD 1NUDA 3VH8A 5BZDB 3MUY1 3WL9B 1M05B 5DJXA 1SEQL 4WWKC 4IS6A 4GJTB 4MLSA 4X6CE 3SGDI 3ULVF 1NEUA 5D70L 4JFXA 3A6BH 4AH2B 2YD3A 3EDEA 2CDGB 1HSAB 4BK4A 4KJYB 5CUSH 4XAWL 1VERA 1WQVT 3JSSA 2X44D 5HHQA 3HUJA 2YZ8A 4M62L 3IFPB 4EXPX 1RQ5A 2V7NA 3OG6B 3V4VH 2ED7A 2ATKA 2AQ1A 5TE4L 1P4BH 1JNNH 5IROA 1S7RA 4QT5A 5I18H 3FB7B 4M43H 5J7CC 3ARGD 3MRIA 1YPZE 2AJYH 2Q1EA 2YPLD 5LGKA 2EICA 2ZKHH 4PRHB 3RPIA 1KCVH 4P23D 5DJAB 3D69B 5CILL 2F5BH 1KB9K 3QDJE 7FABL 2K7QA 2AW2A 2JJSC 3LPFA 2XYCA 1N4XL 2XTJD 3BSZL 3QXAB 4XCFH 3BKMH 3ULUL 4LU5H 4XP5H 3C8DA 2P8PA 4JO2L 1J1XH 35C8H 2UVEA 4PTTB 1M1SA 3X3FL 5B8CB 1RUPL 2DWEB 1ROWA 3HZMA 3G6JB 4OUUA 3MOQA 1U8NB 4H20H 4G6ML 1HQ4A 1R3JB 1RIVH 2F19H 4DVRH 3SJVA 5CAYB 5IBTH 1VSCA 5DJ6B 1A3LH 4G6FD 5DFVD 3CLEL 4OFIA 2EIBA 4JVPA 4XP1L 2FHBA 4GO6B 2BNQE 3JWOL 5HHPB 5DJZA 1J8HD 4XBPB 2C3WA 2DJUA 2PF6A 4PJDB 1FC1A 2O5YH 4M6OH 4MD5A 3BE1L 3H3BC 3MACH 4ZYKA 4XPAL 2A6KA 4O5LL 1FNGB 4Z5RB 3EDKA 3NIGF 5FYJE 1YN7B 3RP1A 3T08A 2VQUA 1VB9A 4ELME 3GB7A 4RX4D 1F90H 1HKFA 1F58L 3FO9B 2AJUH 3PDOB 4LSPL 5DHYB 1FORL 4NO0A 2VLKB 2F53A 2W9EL 3MLTA 5C0BE 4XBEH 1Z0NA 2CIKA 4YHIB 5E8EB 1L9MA 4ZUVA 2IBZX 4ZPVA 5F8QC 2H41A 5D2NC 3VXRE 4LVOC 1AY1H 2IANE 3UTQB 1Y0LA 1CDYA 1ONQA 9CGTA 3GUTA 1I7ZA 4PLKD 3HZKB 1N5AB 5GGVL 1U95A 2DKMA 3B9KD 4Z7WB 2EXWD 3QRGL 4U0RC 3L3JB 5I1JH 3O6FA 3KR3L 5E2UL 1XIWA 3BP4B 1Y6MR 3V95A 5EO9A 1VCAA 1G7MA 3EFFA 4PRPB 3SE8L 1YNTA 1UJTA 4R0LA 4FFZL 5AD0A 3BP7A 4OLVH 2X7LA 5KVEH 4JFYB 1YEIH 3I2CH 4Y5XC 2IPTH 1QOKA 3C09B 4U7MA 3SO3C 2B4CC 4LCUA 5CZVH 1F2XK 3BAEH 4OBRA 3K8LA 5FA3A 1OD7A 3H9SA 4G9FB 4HG4J 2DBLH 3WNMA 1QPPA 4OD2B 4E0RA 5J9PA 2C3VA 4EDXA 3FQUB 1B2WL 2Z4QB 3FOMA 1QBLH 5EBWB 1NCCL 4GH7B 3NBNA 3VXUD 3TP4A 1YEHL 3VRIA 3MA7A 1RUQH 5HYQB 3D3VB 4UILH 5F9AC 2ZZUT 1WAAF 3O3BA 3LDBC 5EZOL 4WTWA 1IJ9A 1T1WB 3KPNB 4Y5YC 4XB7A 4JG0L 5TGBA 1HDMB 1P84J 3CVHB 5JLZA 3MLVL 5FUCC 3EJYD 2E3VA 4Q6YA 5JIHA 4FQ1H 4NZJA 4QYOA 5JA9A 4PJCA 1BFVL 5BW7C 1CD9B 4TSBH 4I48B 3MRQA 4BK5A 5CSZA 3UBXI 2QSVA 1U8IA 3VA2C 4N8CL 3RWGB 2XWTB 1UJ3A 3NVQA 2DLHA 5GSVB 3ZDYE 4OSUL 4JHZA 1FN4B 5I66A 2EDOA 4JQVA 2DYPA 4DCQA 1OM3L 1CZ8L 3K81A 1MHHB 5BXFA 4KKBC 2I9LA 3FT4A 4NO5B 4UZGA 4YDVB 5IW1A 1IM9B 4XPHL 1I1AC 1D5ZB 1AKJD 1S7TB 5GGSB 2UYLA 1FVCA 2FBOJ 4EJ1C 1OWWA 3ZKQD 3S96B 4CVZB 4QRTA 5DJCB 3MRHB 4G7YL 3LH2H 1D9KD 3V0WH 1IGJA 3P4MA 3O11B 4HT1H 4CN4A 2RJMA 5CBEB 1WFOA 2EH7L 2WWMD 3TYFA 5KSBE 1S5HA 4L1HA 4PGZA 3PWPE 4TN9A 1SQ2N 1PLGL 4HIJA 1T4KB 1BVKA 3QUZC 2Z8VC 3GSNB 1UH2A 4UINL 2KH2B 1CD1B 2VRAA 1L6XA 4KROC 3FB8B 3S37L 1HI6A 4Y19B 1V7NL 3HZYB 4HMDA 3DXAA 5C07E 3W11C 1EPFA 4G8IA 4OT1L 5TDOB 3EYQC 1OARL 2NX5D 4JFEA 5CIPB 5F96L 5D1QC 4TNVK 4FFYL 4Z7UB 4D9RE 4AEIH 1SEBB 2BX5A 2OP4L 3PL6C 5IFJA 5JHLH 3VCLA 1UCBL 1KIRA 3M8OH 4GRLB 1IGCH 5C6TH 5JR1H 4QOKE 4PTUB 4U1LA 5FOJA 1MI5B 3S3JA 2AJZB 3UTTD 4K55A 2G9HB 1EHLL 4X80L 2W9LA 2ERJB 1S78D 2A74B 4PJFF 2YN3A 4XGZB 2FH6A 3TNMA 5DDHA 4FXKB 4JFZH 4ZOEA 1E0OB 4P3DB 4PBXA 1HZHL 2ZSVB 1TPXB 1F45A 4D8PB 1E4XL 5J4MA 2VXSL 2XI9A 3MUGA 5GGRA 3TYGH 3MV8B 3BIKA 3FT2B 3GM0A 3L6FA 3LPWA 2NQCA 1SYVA 1NC2A 3ZKMC 4U1KA 1S7VB 3GMOA 1H3GA 1HCFX 3MBXL 4OBSA 1FZOA 1MHPL 1T1ZA 3V6FB 3PWNA 4FQ2H 3HE7C 1FFPA 4WUKL 1NAMH 3U4EB 1I85C 1X4YA 1BHGA 3HC0B 3C87A 5IFHL 2VO5A 4GMTH 4ORGB 4IOFC 1S7SA 1NBVH 3QCTL 3U7YH 4JM4L 1F6FB 3T0EA 4GAYB 1JPST 4KPHH 4N0UB 1UZ6F 5T3ZH 4F7MB 5ISZB 1JWSB 1FSKC 4WJ5A 4I0PB 1FQ9C 4P5TA 1NAMB 2YC1A 1BLNA 3IDYB 5KVFH 1OPGL 3NZHH 3PHQB 4XP9H 3UPCA 2IQAA 1JNHA 2KZWA 3HE6A 4NHUA 3DETD 5IB5A 1A3QA 5KZCB 2YRLA 4KGLA 3LV3B 1TCRB 4WY7H 5C0IA 4P2RD 1NCWH 2FX9H 1XF3A 3GI9L 3TCLA 4BQ9A 4JRYB 4OJFL 1OP3H 5EU6A 4HFUL 4G8FB 3BQUB 1CXIA 2YD5A 3EYSH 3HS0B 3NOIA 3SE4A 1ORSA 3BPCA 1SBSH 1S7QB 5GRUL 2J8UE 5EIIA 4NGHL 1FZKA 5I74C 3THML 4OV5A 3GBLA 2CDEB 3CLFL 2Q8AH 5DD3H 4OCXL 4K8RH 3QAZB 2AV1A 1QP1A 4R2GB 4FQXC 5D7JB 3HG1D 1KBGH 3FMGH 4RQQA 3EO1A 3VGFA 4ACPA 4EVNB 3W0WE 1UCTA 1DUZB 2XN9D 2IAMC 4C56A 3EJZD 1U6AL 1EHAA 4RAUA 2C4XA 5E6ZA 1IVLA 3SDDB 2D3VA 1LO4H 3C5JA 3Q0HA 2P7TA 2DL9A 4OM1L 5EUOE 1TITA 1QLEH 4OI9A 4JPWL 3PE9A 3GSWA 5IFAH 4R26L 1V3MA 3QEHA 3OKMB 3ULVC 3HR6A 3WBDA 2NZ9C 4RISH 2AK1L 4JN1L 1JZ8A 4XP6H 1AJ7L 1X5IA 2AXFA 3BJLA 2VABA 3F7VB 3KYKL 1A7QL 2AGJH 3VWKC 5E5MA 4HXAH 1CDHA 4NWTH 5F7WC 5JPNA 1NCDL 5D1XD 4P9HC 2IH1A 1JNJA 4LCIH 3LEVH 3DRTA 3O6KL 1MY7A 4W68A 5EA0L 4HK0B 1N6QL 1XAUA 2NZIA 4GW4B 4K7PH 3PABB 5F9OH 3MV9D 1SJVA 2BMKB 4BZYA 2F54D 3W2DL 1KPVB 1QPXA 2NW3B 4PJEB 3IDUA 3ES6B 4K3DH 3GIZL 4YDLC 2B1HH 2HT2C 1PEWA 3ZYZA 4U1NA 3T2NL 3MJGX 4CU8A 3W39B 3WHE0 1QTYT 3DV4A 1XGTA 3I84A 2UY7A 3RIFK 2P5WE 4G6JH 3RVUC 2X10A 4GXUM 3BO8B 1ADQL 3PGCA 2DQEH 2YA2A 3CFCH 2YWYA 3CXDL 3HC3H 5IM7A 5IW6B 1CS6A 4U1MA 2BSTB 1T5WA 2BNUA 4U33A 1OL0A 4LAQL 2BJML 3FTGA 5KW9L 1FFRA 2FX8H 2P8MA 2ITCB 1FZMB 3U1SH 1MY5A 3WIFA 1UT9A 1NGYB 4NDMA 5FYLE 3GJEA 5D71H 1E6OL 4H1LB 4WI6A 3MQIA 5AG9A 1HH6A 1BBJA 1MCKA 1T7XA 1SY6L 2I24N 2Y23A 3MZTA 1AE6L 5CKGA 4OZIF 3B2VH 5H2BA 3EBAA 3MUHL 4XHJC 1A6TB 3D9AL 3EJJX 1FO0A 3MYZA 1NGWB 3PIQA 1X9QA 1TJHH 1VHPA 5FKPA 4JFHE 5FIEA 3AGVA 1REIA 3SKOA 3VE0A 2YXMA 1CR9H 2PXYC 1QO3B 3MZGB 2UWEB 3IU4H 5I19L 4F8QA 5K9QG 1A3RH 1UB5A 5D1ZC 1W0WB 3S36H 1M4KA 1HHHB 1CGUA 4MAYA 3H3PL 5IMOA 4GS7C 5D2LE 2VDQL 1Z2KA 1E4WH 1O7VA 1MFEH 3NACH 3D39E 1CL7H 1PEZA 4LCCC 4IRJA 4HD9A 2R4SH 3AS3A 5A2FA 5ESAA 1FFOA 1PY9A 3B5GA 3LS4L 3EYFA 1XCTB 3TIEB 1FLRH 3GIVA 4JPIB 4PJ7B 5CHNA 3HFML 2OR7A 3CX2A 3I85A 2BP3A 2JELL 5K93A 2V5MA 4YXHL 4KKAC 3VFNA 2FEDD 2Q86A 4G9DB 4HWNA 4NKOB 1HXMA 2HRLA 1A1NA 1BQHB 3VXSA 3C5SA 4PREB 2WBJA 4U6YA 1QSVA 1GRWA 5FHAL 1L7IH 3K8KA 1Q72L 4KVNL 4LGRB 4PB0L 3EHBD 4IOSD 1I8IA 3MROB 3VI3F 1E4XI 5TF1H 2QV2A 5EOQL 3S88H 3CD4A 3FCTA 3TH3T 1XF4B 2QBWA 1FAIH 1WCQA 1HHIA 4PRHD 1GGCL 3DSFH 3HUJE 4PJ9C 4LPYA 5HI3C 4N1CA 4QRPA 4PJHA 5JNYB 5DUMH 3EKCA 4RGNB 2EH8H 1QSEB 1ITCA 2AKRB 3H6JA 5CJQH 4WWKB 4NQCE 1RVFL 2HKFL 4RMQA 3N85H 5KOVC 1NH6A 4IRSA 1T6WA 1WBZB 3OF6A 5ITFA 1AD9A 4ODSH 5FDWB 4YIQA 3FRUB 4UT7H 1A6VH 5HD8C 1ZA3A 1LGVA 2C9AA 3MBEA 5F9WC 5ADOH 1WC7A 4GKZB 1MREH 4PJAB 5DMIL 1AHWB 4GKSA 1DANT 2DIJA 2V7HB 4ZO7A 3RY5A 3GKWL 4NNYB 1WBXB 3RDTC 1QQDB 4PP1D 3RGVA 3B83A 3V0VA 4RWYH 1CBVH 8FABB 3IJYB 2DQDL 2XA8L 4UV4H 5AZ2H 3C60A 3UAJD 2H9GA 4PRIB 1JHTA 4Q9BA 4IRZL 3SJVE 2E27L 5DMJB 4Q6IA 4H8WC 5IB4B 4WI7A 4KTEL 3O2WH 4FQCL 2JCCF 3FZUD 3TJEH 1D5IH 1YYML 43C9A 4WCYH 3HLAB 2Z31D 5T1KA 2FLRT 3OKNA 2KUTA 3EO9L 1SYSB 2QKIB 5MEQA 3U9UA 2IGFL 3QNXB 2VLKD 3T09A 2L0DA 3R4DA 3TWCL 1K5NB 4N5EC 4X4ZA 3CH1A 2XICA 1ACYH 2HFEA 4N0CC 4P9ML 4UDTB 5DRNB 3PGFL 1C12A 5F89A 2R2BB 1N0LA 1QLFA 1KXVC 1WK0A 3F6IA 5CJBA 3MLPA 1UACH 4FTVA 1T3FB 2R0WH 3KYAA 5B38B 3FQRA 1I8MA 1OSZA 3BZEA 3HB3C 1LVEA 1ZVSA 4WU7B 3DHJA 1I3RB 2F53E 3CDGA 3F6LA 4LHJB 1L7TL 3T04D 1Q38A 1HEZB 5TE7H 3GMNA 4PRPD 4L29B 1QR4A 1GZPB 3RNQA 4X6DB 4DGYH 5C6PB 3OAYH 1BZQK 4F15C 4OZ4B 3TBVB 5EU5A 2Z92B 3DHMA 3W82A 4DZBB 3O3AB 4MCYB 1YEKL 3AROA 4NOBA 3O8XB 4LSDA 4KFZC 2GJZB 5LGJB 1NGPL 5JUEL 3IDGA 4RZCB 1G9NL 4G9FD 5JO5A 3WLBA 3HMWL 2F8XC 3NMEA 2B0SH 2MCPH 4R4NC 3KJ6L 3VXMA 2E8YA 5D2NB 4PRNA 4MJIB 5F9JA 4LVOB 4KDWA 1YMHA 1RAMA 1ZWIB 3KPRB 1Q9LB 1DEEA 2A73B 1K2DA 3RVTC 3D3VD 3FB5A 1X7QB 4K94C 4GRWH 4YPGB 5DK0B 2E5EA 3H9SE 1OT1A 4WTZA 4FN0A 2LV4A 4NKDA 2PR4H 1KPRA 1FYTA 1D5MA 4HK3N 3U0PA 2JLLA 1IC1A 3PP3H 4O4YL 5KVGH 2CLVB 4OD3H 4DEPC 4PJBB 2M2DA 2MTPA 3I50L 4G5ZH 4Y5XB 5DRWB 4GRWB 2QQKH 2IC2A 5C0FB 4MNHA 4NYLB 5LQBL 3TPUA 4JQIH 3ARGA 3OKOA 3QNYB 2WLZA 2YPLA 1UZ8A 4I2XA 4RIRA 5FO7B 3MRMA 4P23A 4LCYA 1ZMYA 1I9IH 4BSWA 5J1SC 1UM6H 3G08B 3FFDB 1IM9D 4HFWA 4PJCE 3LSOB 2BVPA 4ZDHB 4BUHA 4X4XB 5CUSL 3LDBB 1LWRA 2XZAH 2A6DB 3GBNL 4Y5YB 3V4VL 3KYOA 2EDQA 4YDKL 1AD0B 4M4PA 1MLBA 4NHCL 2HH0L 4OF6A 3K4DA 1P4BL 4JFOA 1JNNL 2AK4B 1S9KC 4M43L 1J8KA 3CZFA 4WFFD 2KPNA 3OKDA 4Y19D 5D7IA 3QQ4A 3D5OF 1KCVL 1DSFH 3AS2A 1J8HA 2DS4A 2H8PB 4TOYH 3VXOA 1AGBA 4QGYA 5HY9A 1BAFH 1INQA 4LLYA 2F5BL 4XVUD 4JGJA 4ODVH 3ULSB 4W6YB 1BP3B 4CN1A 2YOCA 4OQTH 1PAMA 1SBBA 4GRLD 1YUHA 4XCFL 1ZAGA 3OZ9H 5L0QC 3BKML 4LU5L 4XP5L 3DTXB 1J1XL 35C8L 4L8SB 2X4PB 5A40E 2EECA 1LE5A 1KSRA 5KANI 1MI5D 5CD3A 4Y1AB 4F2MB 1DLHA 4YHKH 3BEWA 1ZSDA 4PLJC 2VYRE 4JFEE 4Z7VF 3RRQA 4DVRL 1RIVL 4BFGA 3BEVB 4NRXA 4CNIA 5IBTL 2Z35B 1A3LL 2GTWA 1T1YA 2YWZA 4ZS6C 3IJHA 1VESA 5E03A 3QUZB 4YNYA 1Q0XH 5GISH 5LWYH 4HUWB 1R3KA 1J05A 1JPGB 4KROB 3MV8D 4XTRC 2HVJA 5CJ5A 1FZJA 4M6OL 5I9QC 1K4DA 5AUMA 2EDYA 1S9XB 4XP4H 3MACL 5D1QB 2ICEA 3WN5A 3B9KA 3U46B 1G7QA 4H88H 3PL6B 4AG4H 4JR9H 5IV2A 3RWIB 2J12B 1EFXB 1F90L 4S11A 3BRDA 2YD2A 2AJUL 4R7DB 5I1EL 4HKZA 1ZHNA 1FGVH 4XBEL 1L0QA 1ZHKA 2FNBA 5ISZD 1L0YA 5F8RC 4I0PD 1WISA 4LIQE 1KJ2H 2Y6SC 4XT1C 5HHME 1F4YH 2P45B 4IDLA 5JDJA 1AY1L 4MMZC 3BD5A 2CRZA 1ZLWH 1A1OB 3WEXB 1RUAH 5KZCD 1RPQA 2YSSA 5DEGB 4ODWB 1E27B 4AM0B 4BH8A 4L8CB 1H3PH 1Z9MA 3VXUA 2B7DT 5I1JL 2IPUG 4JRYD 4U1GC 1KJ2B 2HP4A 4ONGL 3RFZC 4S2SA 2W0KA 1U3JA 3BQUD 5ECJE 3ALWA 4IHOB 1QSFE 1OAQH 2ZSWB 3I6LE 4X8JA 5KVEL 1YEIL 3HE7B 4QWWC 3I2CL 5IB2A 2IPTL 5MENB 5ALCL 3RTQC 1QR1A 2J2ZA 3MNVA 5CZVL 2EIDA 3BAEL 4U1IA 4R2GD 4UDUB 5D7JD 2D03H 1VFUA 4I4WB 5LG1A 5L2KD 2C5DC 1DUYB 3MUZ1 4D9LL 5EU6E 5IMMB 3KYNB 1FSKB 2AV7B 1R24B 2I07A 5AG8A 2Q6WB 3X3GH 2LQRA 3ROLA 3JVGA 4WW2B 3L3DB 3QXTA 5FGBC 3SDDD 4NQSA 4PBWD 2WBWB 5DRXB 2D31B 1EK3A 2BVOA 1N8ZB 1RUQL 5CEZH 4UILL 2V17L 1MEXL 1AKJA 1X5GA 3KS0J 3FO2B 1LMKA 3RWEA 4X9IA 3VJ6A 6CGTA 1HQRA 1IEAA 1MWAA 2G5BA 5HSFA 4S1SH 2DMCA 3KNBB 4HAFA 1D9KA 4PPTA 4AEFA 4C56E 2HT4C 1J1PH 4FQ1L 5D4QA 1OGTB 1U93B 3MCKA 4J23A 4Z7NF 5DJ8A 5ACZB 1V5JA 3ULUF 1IGTB 3IS0X 3Q6FB 4FXGB 2OJEA 4KY1H 5CMAB 5I74B 1OAZH 2VR5A 4U3XA 3PV6B 3WS6A 5JOFA 4YHNB 4LF3B 2X4UA 4L4TB 2J5LB 2C1OB 2P24B 3V2AR 1ADQA 3IFOB 1KTLB 3ULVH 5FGRA 5JW4M 1PG7W 4ERSH 5FAAA 1IAOB 3KXFB 2VDLH 5JW4N 4NQXA 3GBMH 3F7YB 2VZ3A 4XC1H 5DMYA 5GHWL 1JCKA 5E7FA 4DUXA 1RHFA 4JZJC 4JM2F 5BZWA 5IVZB 2YMXH 1CTNA 2GAZB 3FT3B 5EUKA 4LOUD 1ORQA 4K71C 4NQEB 4P9HH 5J06A 3VG0L 3IT8D 2DM2A 4HT1L 2HFTA 2IBBA 4NJAH 3UTTA 4RDQG 3GMRA 1U8MB 1AQKH 1SY6A 3Q3GB 4RFOH 5IVXA 3TNNA 5ERWA 5T1DL 3VWKB 2CH8A 1TVDA 3D25A 2OMNA 2UV3A 3MR9B 1D5BA 4AK1A 3VFOA 3PHSA 4F7TB 5CEYA 5F3BB 3IETA 4YQXL 2YKLH 5HYFA 3FQTA 3TBWA 1CK0H 1OLLA 2DF3A 4HIIA 5DT1H 5JHLL 3VFPA 4YFLF 2R0KH 3O3DA 5BOPA 5C6TL 4YDLB 3OHXA 1IT9H 3QWRA 1F97A 5J3HD 4CJ1A 5JR1L 2QSCL 3LB6D 1TVBA 1NPUA 4AQOA 4QRRB 1WFNA 4DFHA 5GS1C 4O2CB 2C3HA 4WTZG 5IKCA 1RZJC 3BUYA 3QUMH 3BMVA 1Q9KA 4R3SA 4JFFB 3UTSB 3GSOB 4AJ0A 1S8DA 1LQSR 4N0RA 2MPAH 3LPGA 2E9IA 3F5WA 2NMSA 4JFZL 4TUJA 2DTMH 5ID0A 1EVTC 4U1JA 1DBML 5E00B 2ARJA 1LNUB 3TYGL 4XNUH 2X6MA 3QUMB 1YECH 1OTUD 2AP2A 3P77A 1NC4B 4G7VH 3SE3C 1G7JB 1SJHB 2XRAH 1VPOH 1T21B 1KEGH 3CFBB 3ZHKA 2FYYB 5BVJB 2UVFA 4X5XB 4J8RA 4MA3A 4ZFZB 5CCKH 2BY1A 4I8DA 4FQ2L 1NAML 2W0PA 2FJGB 4YDJA 3ILQD 4ZG1A 1P2CA 3FOLB 2G60H 3BPNC 4GMTL 2DM3A 4OCLC 4PGCB 3O81A 4J3UA 3U7YL 3BN9D 4W4NA 2H32H 4JFDB 4D0DA 4KRLB 4P2QB 5SWQB 2PXYB 1NBYA 2FECL 4ZQKB 3Q48A 4C4KT 4TTGA 4KPHL 3GGWB 5T3ZL 3NFPA 1ZOXA 5D1ZB 3HG1A 2YHGA 5KVFL 4PJXA 1K3IA 4XP9L 3VFUA 1PBYA 5FCUH 3ZE1E 2E7LC 3RAJH 1DFBH 2XN9A 3TGXA 3TV3H 4GS7B 2H32B 3T77B 1NCWL 3TVMC 2NY2C 4MMXC 5ICXB 5AWNH 4KV5F 1GZQB 4LCCB 4WU5B 3VXSE 5TDPA 1EEZA 5I75B 4PV9B 5CP3A 4RGND 1QSED 3KS0H 2XXCB 4WWKD 1A9EB 3G04A 5SWZE 1EDQA 1H0DB 2Y36H 4QO1A 3T4YB 5I1AB 4JANB 1FPTH 2HFFA 3G9VA 4DJMA 4MHHI 4WW1B 2PNDA 2Q8AL 4ODBD 5DD3L 1ZA6A 4K8RL 5T33H 3LKNB 4ENED 4IMKC 3RZCA 5D1XA 4QRPE 4YEEA 1KBGL 4HJGB 3FMGL 5KAQG 1BD2B 2NXYC 5I1IH 2P5EB 4N90E 3D0LB 3VXNB 4K7FA 1LP9F 1NMAH 3MV9A 4RBPH 4OB5H 4XVJH 5ICZA 2F54A 4K07A 3RU8H 1LO4L 5E8NA 1LK2A 2PO6A 1TZIB 3B6SA 3BHBB 1BM3H 3PWUB 3MRDB 1QLEL 2MOVA 4WV1C 5F7DA 5IFAL 2GSGA 4RFEB 4HKJB 1JN6B 2PCPB 1UH3A 4PJ9B 3NZ8A 4PRID 2PKDA 3MRRB 4RISL 2JK5B 2NNAA 3IKKA 2NY0C 4XP6L 5F1NA 1K8DB 3DV6A 1QZ1A 5D5MA 2AJ3B 5CSBA 5EZLA 3TBYA 3BVNB 2AGJL 3L3KB 4LMQI 4HXAL 4HS3B 3KJ4C 3QFJA 4LCIL 3LEVL 4MCZB 5FM5O 1I9RL 4LVEA 4U31A 1IGFH 4K7PL 4Q9RH 1FP5A 3G5XB 1OTSC 4NRZA 5F9WB 3PQYB 2X4OA 4KI1A 4K3DL 5DMGC 5HJ3A 2EEDA 2B1HL 4UQ3B 4V1DA 4H8WH 4LLDB 3RI5F 5TH2B 3RDTB 3UTZB 4BFIA 2BOCA 3S97C 1MVFA 1B0WA 4ZFOA 2O26U 4JDZA 1Q9WB 1LO0H 4LQFH 4EUPA 3EYOB 2HTKC 2DQEL 5KSUB 2C1PB 3HC3L 4HKBB 1MOEA 5KG9B 3I75B 1TVHA 5FFLA 3QT2A 2GY7B 3CNKA 5F7NC 3AVEA 3EYVB 4HUXA 4L8BB 2I9TA 3W9EA 5IHBA 1T7YA 3BRFA 1MPAH 1DR9A 2FX8L 3O8XD 5F88A 5KS9F 3U1SL 5DQ9A 1U91B 5DC4B 3H2WA 1IGIH 3IVKA 1PZ5A 4PYHA 5KTEH 5I30H 4WNQA 4PJ5B 4QF1A 4A6YA 4U2ZA 1SJEA 3KLAB 4ODHH 3EDJA 3AAZB 4MJID 3B2VL 5GZOC 3WL9A 4S0TD 4NNPH 2VDPL 1JIBA 3ZE2F 3KPRD 1LEKB 4YHMH 4OCWH 2DBJA 5E2VH 1TJHL 1NFKA 3VRLF 1IE5A 1X5KA 2B5IC 3LKSB 4KKLC 1CR9L 4AH2A 4Y4HD 5I1LB 5K59E 3IU4L 2CDGA 1HSAA 1TDQA 4PJIE 4KJYA 3ARBA 1A3RL 3WFEH 3VXME 1PSKL 4ZNCD 3IFPA 4F15B 4Q2ZB 2ZUUA 3QXVA 4OZHF 4OIAA 1JK8B 1QVOB 1E4WL 2FLBT 1LO2L 1MFEL 3FB7A 4PJFB 4K94H 2ZUQB 2HAZA 4MQTB 2E7MA 2R4SL 1U8LB 4PRHA 2DN7A 4KV5E 3UDWC 5DJAA 5B3JF 1DLFH 1TFHA 4K2UH 1FLRL 3D69A 3OB0H 3V4PH 1SM3L 2DKUA 5HGHB 2Y07H 5C0CB 4XMKH 4NN7B 1U3ZA 2XWBB 2ZJSH 1KLGA 5CINH 3RX8A 4PTTA 1MJ8L 2YPLE 3H9HB 1OAYH 4KMQA 4ZMAT 1L7IL 4I2XE 5B8CA 2DWEA 5GRVK 1U8NA 1EFQA 5IB3B 1GGIH 1R3JA 2AK4D 3B5TA 5I8OL 1QFWL 5DJ6A 5TF1L 4PY7B 1EZVY 4EXKA 2XTJE 2K7PA 5KSVB 1QEWA 1FAIL 2AEPH 5HHPA 4DOHE 2ESVA 4U2YA 1MRDH 4P99A 4XBPA 5DUML 4PJDA 4QNPF 5ETUB 2CK0H 2EH8L 2XQYK 4WVRA 4QXTA 2BRQA 4LNVA 4KKBD 3N85L 1FNGA 1CDCA 4Z5RA 4JLRB 3SO5A 4P49A 5MHSD 1JUFB 5D7IE 3RBSA 1YN7A 1U3HC 4ODSL 2MQCA 5D7SH 3SCMC 4Y1AD 2OQJB 2NY1B 5F97E 1FVDB 3P30H 2FECI 1J8HE 4UT7L 1A6VL 3ULUC 3BDBA 1CLZH 4KJPC 5ADOL 4CMHB 1MREL 1X5FA 5DHYA 3OQ3B 4O58H 2WBKA 4NQDB 4HIEB 4X5WB 5IF0B 2I60H 4YHIA 4YXKH 5E8EA 3ZKXC 2DL2A 4XCNB 4I18C 4HWEH 2FR4B 3QUZD 1H8OA 4PG9B 3RWDA 4KROD 5L9DH 1A7RH 4K3HA 5AZ2L 1HXYB 3UTQA 3I6GB 4JB9H 3W11D 3KPMB 3JWOC 5D1QD 3HZKA 1N5AA 1BIHA 4IMLB 4PBVC 4KDTA 4OZGF 4Z7WA 4TUOB 3L3JA 3I9GH 4JM2C 1PG7H 3BP4A 3PL6D 4M7ZC 3O2WL 4WWID 5BCAA 3TJEL 4PRPA 1D5IL 2LAGB 5L0QB 2YUWA 2EDTA 5JHDB 3V0AC 4WCYL 3AREA 2VNCA 3EYUH 3FRPA 3TEUA 4TVPH 3SKJH 5TE6H 1FYHB 3OAUL 2VLJB 1ACYL 2KKQA 3UP1A 4RSVA 5T5FH 1E4JA 3DVNB 1K4CB 3C8KB 1UACL 4DGIH 4G9FA 2R0WL 4EBQH 3V8OA 4OD2A 2HLFC 4RRPA 3PGDA 3FQUA 2Z4QA 3BD4A 1F5WA 3CAFA 5EBWA 5JXED 1WZMA 5DQDH 2QQNH 5C0NC 4JCLA 5GGQH 3GMMB 5I9QB 5HYQA 1DN0B 3ZKMD 2F9BT 5TE7L 4OLWH 3VFVB 1CICC 4DGYL 4JY6B 1VACB 2XG4A 3KPNA 3QQ3B 4GSDH 1HDMA 2D4DA 3CVHA 3HE7D 1W0YT 3UYPA 5C0AB 5MEND 3DX9B 4IOFD 4JO4H 2Y1VA 4H5SB 3BIBX 2N7BA 1W0VB 3VXUE 4I48A 4J6RH 2CQVA 1RIUH 2NY7H 2CD0A 4FQPA 2B0SL 2MCPL 3RWGA 1TLKA 2XWTA 3RUGA 3D85B 5GSVA 3QEUB 1FN4A 1LILA 2IBZY 2J7LA 1OP5H 4XBGB 1MHHA 4ODUB 3SDXF 4NO5A 4YDVA 3HI5H 5TQ0H 3FN9A 5HHNA 5GGSA 1S7TA 4ZUTB 3WIHH 4OZIB 1NCBH 4FQQB 3IDXH 1R3LB 5F93C 4B53A 2PR4L 3S96A 4CVZA 4U1GB 5DJCA 1RV6X 3MRHA 3RX5A 1ES0B 5KVGL 3BMWA 4OD3L 4DFIA 5HI5C 3TBTB 4JGUA 1AXTH 3O11A 1UWXH 1HHKB 5CBEA 5CEZD 1IAIM 2VSDA 3TZVC 2GFBB 2QQKL 4PG2C 5INCB 4AIZB 4DN4L 5B39B 3RTQB 3BOVA 1T4KA 4JQIL 2CUHA 3GSNA 4ONOA 3LN9A 1CD1A 3FB8A 4L4TD 4C54A 4U0QB 2B8OT 5INDB 4WFGD 3OKYA 3AS1A 1AFVH 5I1KH 5TDOA 1O7SA 4GOSA 5CIPA 4Y2DC 4HUKB 4LQ1A 3WFZA 3KXFD 1I9IL 3WUZA 1UM6L 4Z7UA 1NGQL 3GSQB 3UMTA 1SEBA 3G6DL 3VI4F 3SKNB 4GRLA 4EUPG 4P4RB 3OGCA 4AYFA 4NQED 1KUMA 1ZHLB 2XZAL 3ULVD 1LD9A 3OL2A 5FO9B 4PTUA 4XH2B 5C2BH 3ARTA 1MI5A 4EI6A 2NZ9D 2AJZA 2G9HA 1NKOA 5ANME 4U4BA 4J1UB 4CN6A 3QJHB 5H35B 4JE4B 3MRFB 3VWKD 4H26B 2J6EH 2A74A 1QRKA 4UI2A 2HT3D 4XGZA 5C70A 2W07A 1F11B 3X14B 4FXKA 2G2RB 4P3DA 2ZSVA 5ID1A 4HX1B 2OTPA 4D8PA 4TOYL 2DDQH 4C58B 4ODVL 3FT2A 2CUIA 4G43A 1NGXB 1Z0MA 4LPCA 2MHAB 3UTTE 1T6VN 4HCRH 3H9ZA 1BEYH 1NL0L 5HYEA 1S7VA 5IVXE 5ABDE 3OZ9L 4YE4H 4JG1H 5DD0H 1KC5H 1SMOA 3V6FA 3U4EA 4NKIH 4JZJB 4QRRD 3P9LB 5C0RH 3HC0A 4YHKL 4CW1A 4ORGA 1N7ML 1OGAA 4K71B 3K1DA 3PDDA 5IOPB 1TJIH 4JFFD 3UTSD 1YJDC 1NCNA 3PJSA 1IZKA 4GAYA 3MSPA 4N0UA 5ISZA 4PB9L 1JWSA 1QFWI 3LS5H 4XXCC 4I0PA 4XPGH 4I3RH 1KEMH 1NAMA 1Q0XL 5GISL 5LWYL 2X1OA 4H0IA 4KU1A 4PD4J 4PYGA 1NC4D 3RHWK 1ZVYA 1TCRA 2OL3H 4XP4L 3WO3B 3ABZA 2X4RB 1RZJH 1JZ3A 3DWTA 1MCBA 4JRYA 4H88L 4HC1H 4AG4L 1KIQB 3L9RB 4L4JA 4XHJD 4G8EB 3STLA 5I8KL 2ICCA 4UV7H 4G8FA 3QG6A 3QDHA 1DBBH 3GSUB 4X5LA 1DQML 4IIQC 5CP7A 1RZGB 4X83A 5GS1B 4JFDD 3DLQR 4P2QD 1EO5A 1FGVL 2JCCB 2CDEA 4P2RE 3MRBB 3MV7D 1V05A 1GSMA 5D1ZD 2DQFB 2EDXA 5D7JA 4XX1G 1F4YL 1R5WB 2FIKB 4FOMA 4EVNA 2EXWC 1DUZA 1RUAL 1WBYA 1JI1A 1ZS8B 1ZKAA 1CXFA 3SDDA 3AY4A 1H3PL 3H9YA 1IRAY 2DIAA 4F9LA 1KV3A 2IALB 3EOBB 4Y8AA 3OTTA 1WZLA 1F3JB 2R9HC 1I3VA 3OKMA 1OAQL 4E9LA 3Q6GH 1N2RA 3HG1E 4OIIH 4PJXE 2DMKA 2BVEA 5B3NA 2XN9E 4OGXH 3A6CH 2GK2A 3BPNB 1ZLVH 1C5BH 4HBQA 3F7VA 4KKAD 1KIPB 4QRUA 1IQWH 2D03L 4Z8FH 5C0GA 1QBML 2DQHH 3QQ9C 1BD2D 2HFGH 3CXHJ 3X3GL 1TIUA 2QHRH 4GW4A 2BMKA 1KULA 5HYJB 1KPVA 3LKOB 5IJKC 2NW3A 4NSKB 3ES6A 4OLYH 5CWSB 3BISA 3EJYC 3L7EB 3TVMB 2NY2B 2J8OA 1L9NA 1MFNA 4PJ9D 3W39A 1Q0YH 5HI3D 1IEBB 5IESH 5T1MB 4MWFB 3PWVB 3HKFA 4S1SL 3BO8A 2ZOLB 2EIEA 3MV9E 1J1PL 2VL5B 1HOCB 2F54E 3QIWA 2GSIB 4WFED 2HG5A 3FRPG 3V8CA 5IW6A 1UM4H 2BSTA 2H2SC 3TO4C 1OAZL 4UIKH 5FF6B 1NCAL 1FFQA 5C3TA 1RUKH 3HMXH 5HD8D 5JMOC 2ITCA 1FZMA 4MB3A 1NGYA 4ELKB 1I4FB 4H1LA 3BIAX 5LCVL 3O3EB 2VDLL 5D5ME 2GUOB 1FLTX 5F7MC 4RRPG 3MA9H 3RDTD 1U9KA 4XC1L 4P5KB 2WINB 3IYLW 4WV1B 4LEOB 2YMXL 1A6TA 3T3MF 4P9HL 4YC2C 3UZQA 4X4YA 2RQ8A 1T89C 3M07A 2NY0B 1QO3A 2IFFH 5D6DA 3QBTB 2UWEA 1AQKL 4LL9A 1J11A 4V1DE 4YK4C 1D6EB 2F58H 1RMFH 1W0WA 3S3SA 1MUJB 5DVOA 2PYEB 1HHHA 3KJ4B 4ODXB 1ZT4B 4U05A 5GGTH 2YR3A 2BRRH 4N5ED 3MGOB 4PJ5D 4N0CD 3NCYS 5LJYH 5LKNA 5DT1L 2Y9RT 3DPBA 4Z0XB 1IT9L 3KLDA 4ZAKA 5HPMB 1XCTA 3TIEA 4PJ7A 3HB3D 4PV8B 3W5NA 2ID5A 1B4JH 3MOAH 3HC4H 3EOAB 1WFUA 1CF8H 3QUML 5FYKL 5JIKA 2VSCA 1YEJH 3U0TB 4XXDA 2EZ0D 4NKOA 5T5NF 1BQHA 4ZS7H 2MPAL 3S6CA 1F3RB 2EDJA 4PREA 3P9MB 5IQ9B 2DTML 4Z7VB 3L3IB 2CKBH 4HWBH 2NW2B 32C2B 4XNUL 1DEDA 1X6LA 3AUVA 1YECL 1J0HA 2DQGH 3U6RA 1U8KB 4G7VL 4HXBH 5E1AB 3DUUB 4L9LB 2V2XB 4LSSH 4P4KC 2A1WH 2XRAL 1KEGL 4CVUA 4R4ND 5CCKL 2VDNH 5JNYA 4G6AD 4KK5C 3ARSA 1XMWA 1QSEA 2CKBB 2AKRA 4WTXA 1OP9A 1DBKH 5J8OA 4WWKA 2G60L 4PRBB 1EHXA 4TQEH 5C7XH 1JTTA 1H9VA 5C0CD 4GUPB 2X40A 4QRQB 1K9TA 2B5IB 2Z8SA 4D2NA 1WBZA 1RUMH 4M7JL 1QA9B 1D5XB 1A0QL 4YLQT 2C3GA 2EDRA 3HAEH 1MQKH 4PRHE 3QXDA 5FDWA 2CLRB 3FRUA 1RJCA 4D0CA 4LRIC 1JL8A 2LVCA 3DI2B 4GKZA 5FCUL 1A21A 5E2JA 3FO0L 3RAJL 3FQXB 5IBLC 2V7HA 3TV3L 1DQLH 1KELH 4NNYA 1WBXA 4MXVE 3L5JA 5AWNL 3CDFA 4GXVH 2UY6A 8FABA 2YPVH 2GEEA 4LPXA 5D70H 3G6JE 5F1IB 1P5UA 3OWEA 2J4WH 2VC2L 2Y36L 4PRIA 1WFTA 1FPTL 4M8QB 4XX1E 3QDMB 3GEWB 4N8PA 3GK8H 5IB4A 5F44A 2JJSA 4PLOB 4PR5B 4BZ1H 1B0RB 5T33L 2NY1D 4NFDA 3HLAA 5DWUL 2H26A 3ECBB 4LSVL 4E5XB 3BP6A 4PJDE 1SYSA 2YD8A 3QNXA 1ZVHA 4NQDD 5I1IL 3F7QA 5EULV 3MFFB 1CG9B 1NMAL 3V5DB 1J10A 4OB5L 3RY6C 4BH7A 4UDTA 5DRNA 3DGGB 1KTDB 2HVKB 3RU8L 2R2BA 3QO1B 4YBHA 1OW0C 2VISB 1YEGL 1T3FA 1KENL 5CILH 5B38A 2HTLD 2Y4SA 2DB8A 5ESVB 1IAKB 4NN5C 2H6PA 4LRNH 3TBSB 1CLYH 3ULUH 4WU7A 3E3QC 2VLKE 1EA9C 1I3RA 3HCVA 5CGMA 5HVHC 1MVUB 4MSWB 4K9EC 1Q9OA 1HEZA 4L29A 1RUPH 1GZPA 5JHDD 5IMKA 4OZ4A 3TBVA 4S1DD 2HJKB 4PJ8C 5DUBB 2Z92A 1U3HB 2Q8BH 4DZBA 3SCMB 3SEPA 3O3AA 4MCYA 1T80A 4PLJD 4P5MB 1BGXH 4Q9RL 2VLJD 4B41A 2GJZA 5LGJA 3QZWB 1I8LC 3MLSH 4Z7WE 3VU2A 4LDEB 4Z76B 4QCIB 5F21B 4ZS6D 4QHLB 3MNZB 2V5RA 4PRPE 3ZKXB 4CUCA 4I18B 5C0EA 4TVPD 2RGSA 4OGYH 5D2NA 2GK0B 4MJIA 3JTSB 4XPAH 4V2BA 3KG5A 4XTRD 5I1HH 1LO0L 4LQFL 1MIEH 5EO1B 3UZVB 5J6GB 1ZWIA 3D18B 1Q9LA 2A73A 5JMRA 2IJ0C 1X7QA 5FB8B 5DK0A 4FQJL 3BZDA 2VZTA 4E42B 3QUXC 1IMHC 4JM2B 4G9FE 2OS7A 2PW2B 4M7ZB 3O4OC 3UC0H 1EV2E 2FB4L 1FORH 5C0AD 2W9EH 2V5SA 2CLVA 3O3UN 1MPAL 4LMQE 1XGUB 1IGIL 5DRWA 4Y5XA 4OTXH 1X5LA 2X1XR 5KTEL 4Z7OF 1J12A 2OR9H 5C0FA 5I30L 4NYLA 1CQYA 3D3VE 3STBA 1T7WA 4ODHL 5DSCB 3D85D 3HI6L 3QNYA 2Y6SD 2PUQT 4M00A 1HCVA 2V9QA 1IKNC 1J5OH 1LEGB 5IP4A 5FKAB 5FO7A 3QRGH 5E2UH 4F80A 4YHML 4OCWL 5E2VL 3G08A 4MX7B 4FFZH 4X7EC 4ZDHA 4X4XA 4F7PA 3WFEL 3DX6B 1VEPA 4IBLT 1CICB 3QIBC 5JOPD 2A6DA 4O2FB 4Y5YA 1F02I 4QWWD 1AD0A 1ODAA 2JF1A 4XPTH 3S7GA 1ZK9A 3QULB 4LDLB 2AK4A 3RTQD 3NN8B 3B8SA 1EH9A 3BGAA 3QUYC 3WHE1 3HTLX 5BW7A 4K94L 1KIUA 1YY9C 2VJXA 2YD1A 5L7XH 1INDH 3STZB 2WWKO 4H1LG 1DLFL 4K2UL 2YEZA 3Q5YA 4OLXH 4BQBA 2FEDC 1T83C 2N4IA 1U8OB 3ULSA 5IMLB 4I9WD 1ZT7B 2WNGA 2Y07L 4PS4L 4XMKL 4XWGH 1XF5B 5HXMA 2ZJSL 3DTXA 1I1AA 4OGAD 4WFFE 2X4PA 3EHBC 2N56A 3N06B 4Y19E 4LPVA 4MQSB 4Y1AA 4RAVB 4F2MA 3WUWB 5GRJH 3O9WC 4OLUH 4OCNC 5IHZB 3OR7B 2HT4D 4Z7UE 4ZXBC 3BEVA 2FBJH 4XWOC 1WZKA 4OQTA 3K2UL 4EI5C 2Z35A 2X1WL 1FL5B 3TZVB 1WIOA 4AENB 3WFHB 2H2PC 2AEPL 4KMTL 4WI5A 1OM3H 4HUWA 5E6IC 1MRDL 1X6NA 1W2KT 2CK0L 1MI5E 3ESUF 2GYSA 2NYYC 4U6XB 4N9GB 3NCYP 4Y2DB 1S9XA 4BZ2H 4IOIB 5DJDB 5I73C 3N50A 2F74B 1JNLL 4G7YH 3U46A 5CZKA 1XGRB 3PL6A 3RWIA 5GSRB 5D7SL 2DM4A 1EFXA 3P30L 4UUJA 1CLZL 2X1PA 3LZFH 3MV8E 4R7DA 5EC1B 4O58L 4UINH 2CR3A 3UEZA 2I60L 1AR1C 1CT8B 3S37H 5LVEA 5E8OB 2DI9A 2AQ2A 2VZSA 1OARH 1R3HB 1YNLH 4WEUD 3FAWA 5L9DL 1IAIH 4GAJH 1A7RL 5SX5H 1HYSC 3T1FB 1A1OA 4UIMB 4JB9L 3TPKA 1LP9B 4D9QD 5DEGA 1FRGH 4ODWA 4DN3L 1A2YB 2ZUXA 5DVMA 1E27A 4AM0A 3NFNB 4L8CA 2BNQA 4HV8B 2Z31C 2D0GA 2VXUH 1RULL 1UH4A 3I9GL 3G5YA 1PG7L 3L3GB 4DZ8B 1YJDH 4N0UE 3GMQB 5ISZE 1KJ2A 2DQTH 1O0VA 4MA1C 4KMLB 1OOAA 4IHOA 5TJWK 3EYUL 4XCYA 4J3SA 3HE7A 1I85A 3ALXA 5MENA 1EGJA 2JJUA 5GGRY 4MD4B 1T2XA 4KUCF 3Q2CA 5T5FL 4UDUA 5C8JB 4JRYE 4DGIL 2VXSH 3TA3C 1PYWA 4EBQL 3T4AB 2ARWA 3MLWH 2GHWB 1DUYA 3IDJB 5IMMA 3KYNA 2AV7A 1R24A 3AU1B 4NN6C 2Q6WA 2A0LC 2ZG3A 1KYOJ 5DQDL 5EPMB 2QQNL 5GGQL 5HDBE 4R7NB 1BREA 1N8ZA 5DC0A 4EDWH 4NO3B 1KCUH 1UQSB 2W65B 3FO2A 2EC9U 4DGVH 4GSDL 4LGPB 5DJ2B 4JM4H 2DMBA 3KNBA 4PGJA 4YAQB 5K9JH 5MP6H 1OGTA 4Z95H 4KHXH 4UAOC 1IGTA 4ZPTB 3Q6FA 4FXGA 2R2HB 2ADGA 4L8DA 4J6RL 5CMAA 1A1MA 1RIUL 3QO0A 1OPGH 2NY7L 3PV6A 4YHNA 4LF3A 1G7PB 3C2SA 5KS9B 4M1GL 2NTFB 4FQXA 4L4TA 3SGJC 5I16B 2C1OA 2P24A 3JXAA 5HYJD 3IFOA 1KTLA 4LLMB 4QY8B 4JKKA 4YR6B 4OJFH 2IAMA 5B38G 4ZUUA 3KXFA 4P3WA 4E41B 2RAMA 3HI5L 3F7YA 4HFUH 1NANH 4NQVB 5TQ0L 4LARH 3TVMD 15C8H 1AO7B 2NY2D 3WIHL 1NCBL 3CSYA 3IDXL 3GM8A 3WYRA 1OAKH 4W6XB 2H1PH 3L5IA 5GRUH 5IVZA 3U9PL 2GAZA 3FT3A 2RFXB 3Q5OA 3THMH 3QDAA 1EAPB 3UYRL 2ZUTA 3S4SB 4Y4KC