1E5BA

Internal xylan binding domain from c. fimi xyn10a, r262g mutant
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
87
structure length
87
Chain Sequence
TGCSVTATRAEEWSDGFNVTYSVSGSSAWTVNLALNGSQTIQASWNANVTGSGSTRTVTPNGSGNTFGVTVMKNGSSTTPAATCAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLANASE D
publication title The Structural Basis for the Ligand Specificity of Family 2 Carbohydrate Binding Nodules
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 8
structure length 87
sequence length 87
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e5bA00
3NDYE 2CWRA 3NDZE 1EXHA 1EXGA 1QBAA 1HEHC 1E5BA 1HEJC 2RTTA 5DHEA 1XBDA 2XBDA 1QBBA 1C7SA 2CZNA 1C7TA 1E5CA 5DHDA
chains in the Genus database with same CATH superfamily
2XC8A 4WIQA 4KXDA 4N5EC 1OAYH 4F58H 1KFAL 1FVDA 3NIFF 5EDXA 3TO4C 4Z7QE 1I7UA 2YPLA 2JF1A 4ODBD 3T0EA 1N6QL 3QW9A 1EMTL 1I9RH 3IBOA 4HWEL 5DHXB 3FF8A 1U3ZA 4FQLL 1P4IH 4L05A 4ONFL 3QWRD 3BWZA 3QH3A 4HFUL 2F53D 1KN2L 5F93C 4GG6E 3T9WA 4WI0B 2FH6A 4ATTA 1NGZA 4PUBH 3EG9A 2P8MA 3L1GA 1S9KC 3NCFB 1HQRA 1K3IA 1PY0A 3BZFB 1GS7A 5H94A 4UNTA 4GAGH 1LNUA 2IAAC 5HVWA 3QPQC 2OR7A 1IGFL 1I1AB 2G2RB 3PHSA 3GZOA 1PKOA 3QUMH 5DJZA 2DQHH 2R69L 5H37H 3RUGB 4AK1A 1XWVA 3BAIA 1OTTC 3ZKNC 2VO8A 5F89B 2F68X 2HVJA 3AWGA 3GMOA 4JM2F 4QXWA 4IU3B 4X6DB 4D9QE 2COQA 5ADOH 3NK4A 3SGJA 4NQVA 5D1ZA 1N6UA 2EH7H 1W16A 1HKFA 3FTXA 2Y2TA 3GSUB 4YL9A 3D3VD 4NO0B 3L4WA 1DEDA 2DWDB 5C2UB 3N1FC 3HZ3A 4NGHL 4DGYH 4WEEA 3BP4B 3Q8CA 3CFQA 5TQ2L 3ZTNH 3PF2A 4XI5D 4XZ4A 5DMGD 5DU7A 1SVBA 4R26H 2Y7MA 3UP6A 2FJGB 4CJ1A 2WQXA 2H4EA 4UDTA 4AIEA 3MJ6A 3QEGH 2ZCKL 5FDYA 3SDDC 1KB5B 2JKJA 5B1CA 5E8EB 2NLJA 3W9DA 3QDGB 5D7JB 1DDTA 5DQDH 4WI5A 3SYAA 3TN0A 1YDPB 4ODSL 5F7WC 4HIIB 4TL5A 2N3JA 2NR6A 5I1GL 1DEEA 2ZP8A 3QR2A 2IGTA 2DLEA 3GRWH 3H9SE 4AGMA 5HDOA 3L4CA 2H0PA 4Y9GA 4YOKA 3I6KB 5LJYH 4QI3A 3U30B 3ZR6A 3L5JA 2YAHA 3QZBA 4LK4A 1J1OH 2ITCB 2IFGA 3HKZA 4LCIH 1E7VA 1WC7B 5DT1H 4J5VA 1JV2A 3BWAB 4LSDA 1DUYA 5JIIA 1A66A 3NUKA 2DQUL 1KJ2B 5KS9B 1MHCB 1Q4NX 2OTWA 5L4JA 1MWAA 3AQZA 2YXFA 2ERJB 4NHUA 5FO7A 3IJHA 4K07A 4ODXA 3KDMB 3KG5A 1J5IA 1B4LA 2I07A 1HHIB 4OLYH 1W6LA 2X6CA 4Y2DA 5M95B 1B0GB 5TDOA 2HTKC 3TPKA 1KGCE 1UB5A 2FLRT 3ARDD 3MRBB 3TU6A 1AKPA 3OXRA 4I5BA 4RQQB 4BD4A 2GPZA 2WXMA 4XX1E 1SN5A 1NMAH 3GMQB 3TBBA 5C1MB 3MRHA 4PJ5D 3MLYL 4X5WA 5LGJB 1BQUA 4PI2A 5AVUB 5GJTH 1Z9LA 4LSUL 5J12C 4GG8B 4KK6D 2AGJH 3VFUA 5FF6B 1RVFL 4YDKL 3LV3B 4JFYA 1HN1A 4S1RH 3SYCA 1W0VB 1CC3A 3C75A 3MLZL 4L29B 5D2LB 1DQDH 1GVIA 3NFPB 1EZLA 2XJKA 4YFDB 4KTEL 4FEIA 3SGEH 3RIFK 4O51A 4PP2A 4DGIL 4OM0L 5E56A 4ZYKA 4TTGA 1CFNB 4HJJH 5LCVL 4GINA 3QRGH 4P23D 1KT2B 1TEYA 1J18A 3F5WA 4NN7C 1NGQL 3QG6B 3HC4H 2YMXL 2NLJB 5T1JA 1NM4A 3KBEA 4LO9A 4PJHB 1F00I 2BERA 3LZLA 3BEWA 2OP4L 2CBOA 5GZOC 1JZ6A 3AQYA 3ZY7A 1YC7A 5IMLB 4ELMB 5DUJA 4XOEA 1A5FH 5C3TA 5IBUG 1U2CA 4JQIA 1EPFA 5KVEH 2P28B 1U2YA 1X5GA 3T0BA 2WNWA 1YY9D 5EN2B 4GBXC 2HA1A 5F7AA 4TL4A 4N2HA 1A64A 1JV2B 3RDTC 1PG7X 3GC3A 2V2XA 1UEYA 2VB5A 2IALA 2CJUL 5F3FA 3M7OA 3SODB 3UBXB 2WAQA 3TA3A 1C8PA 1UXWB 2AXWA 3QUHA 4Y5YC 2JCCA 2WWMD 3MROB 4NLHA 1WAPA 1DJIA 1CD0A 2EIJB 1F18A 1FFOB 2CKBH 1JS4A 4FFZL 3OVUB 2DKMA 2VXTH 5EU3B 3RNQB 2ENYA 3ARBB 5G2NA 3RWHB 2QLYA 4KVCH 3GSRB 2QVFB 1AYRA 1U92A 3L95B 2EJ1A 2A9AA 1CQYA 1QOKA 3QI9B 3VXSD 4U3SB 3FTWA 3S3JA 2CA4A 3QO1B 2WO3B 1UVQA 4M3HA 4H1LG 4HGWA 5K39A 3TH2T 3KLAB 3IB4A 4KKLD 4PJIE 4ODHL 4M6MH 3GEWB 3E8UL 4WKXA 4IDJL 4WY7L 1BLIA 4LVNB 3WOVA 3MV7D 1U8MB 4ACPA 1FIGH 1JHTB 4HULB 3IJ9A 1SXCA 3VD1A 3M1OA 1CTMA 3GSVB 3EGDA 4NFBA 4HFWA 3NFNB 5EFIB 1DUZB 2O6EA 4PJ7E 3L45A 4RA3A 4R90L 3SOTA 2LT9A 2BMKA 1B2WL 5I8OH 4F8LA 1JOIA 3GZKA 3EH5B 2XPGA 3T3PB 4IIQC 4A7TA 2D2CC 4YGVA 1GTNA 1U95A 4MJIB 1CJYA 3PYCA 4B9IA 3OWEA 2FO4A 1NLDL 2EILB 2R23A 2LAAA 5CZXC 1XGZA 1OAUL 1K8IA 1B0IA 1LILA 3MQIA 4OFKA 3DX1A 2GIYA 4DH2A 1E8WA 1ZHNA 4BKSC 3U1SH 2FEEL 4Z7OB 3BZEA 2NNRA 4X6FA 3PNWB 5I23A 3LXBA 3OHXA 4OQTL 3VD5A 3KPLA 2CLVB 3U9UA 1JF1B 3N41F 5KBLA 2BNQA 2EP6A 1CGTA 1HCFX 1X9QA 2K7PA 5CGTA 5ETUA 1B9KA 5T5FL 3AITA 4ORGB 4MXQC 5GZNA 5F21B 4AENA 4NUPA 1NGXB 3FQXA 4K3DH 4HH9A 3IRCA 3P4OB 3NPZB 4J3OD 3VD4A 4HLEA 1QASA 5J6GB 4EXPX 2W0FA 3WHXB 2QPEB 1WZAA 4DVBA 2QQNL 4XNXH 4UYQA 2VXQL 2H2PC 5GS0L 5I30H 3F62A 3DGDA 3HZMB 4M6NH 5EZLA 3BE1H 3VWJC 1MHEB 1QHPA 3F7LA 3IFPA 5BVPH 1YJDH 1S8DB 4MAZA 3WNOA 5J1TC 2OS7A 5CBAA 3A22A 1GYAA 1MCIA 3VVWA 4F3FB 3RWGB 5A2CA 3O6FD 4PG2C 2LLLA 3QUXC 2GJ6E 2VDRB 3F64A 5C09D 3QJOA 4PI0A 5TDNB 3ESMA 4JE4B 3KBFA 3NYKA 4MS8D 2JQMA 1PQZB 4DQAA 5AYUL 1HEJC 5T33L 1QVOB 3RPIB 3ZIMA 2YXWA 3P3SA 5EZOH 5FUCC 3US9A 2YN3A 4AJ0A 3DX7B 1U8OA 1M56B 1XQ4A 4N0YL 1I8KB 1MZYA 4NHCH 4IKLA 3TZVA 3EYUL 4GRLA 1Z5YD 4B9YA 4L37B 2MMXA 1K5WA 4LLUB 2AC0A 3JWDL 1WSST 4JM2A 4YFLF 4YGVB 5C08E 3SO3B 2DBLH 1JYNA 3FHQA 1JSYA 4PJXB 1OE1A 4H8WH 3WNKA 2F15A 5TE4H 1S7UA 4AQAA 4N2OA 1OP5K 3K91A 4E41B 1K2DA 3C5XA 3U9UB 3B9KC 4XP4L 1Q0EA 5FA4A 3VGBA 4BDVB 3B7SA 1MREH 2X89A 2ZOKA 2R0ZH 1YQVL 3DETD 1XT5A 1NLBL 4G6FB 1QZ1A 3L2LA 4KJPD 4CC0A 4ZFZA 1TEFA 2IXQB 4LT7A 3B2UC 4OGXH 2VN6A 3FQXB 4DGUA 3QCVL 5AOMA 4PRAA 4H2AA 2NXZB 3M1CA 1F02I 4YHNB 2FHCA 3RIAF 4Y9FA 3MXWH 4HJ0D 4HZLB 4HUMB 2X0WA 3R8QA 1WFTA 2O5NA 3UGXA 3CZFA 4IRJD 2VAAA 2VN7A 4GW5B 4MQSB 3S5ZA 5I9QB 1M2VA 1B4RA 5EDSA 5E95B 5I75B 3K8MA 4TVPE 4GW1A 1FPTL 2BNRA 2JKNA 4YSSA 3L3GB 1XCQB 5EOCH 3MAWA 3FUNA 3Q1EA 3WN5C 4QRPA 3QUYC 1TUPA 5I17B 3T2QA 5MI0B 1IV8A 1CD1B 3AQDA 1WT5C 2HKHL 1KCWA 1IEAB 4NUMA 5AWNL 4Z7WF 1L5GB 1GGUA 3IGAB 4X83A 2A3TA 5AOZA 1QP1A 4NKIL 3I6LD 5DTFA 1VFOA 4ELKB 2CDEA 4ZQTA 5AW8B 3TESA 3L3DA 4YE4L 3TZVB 5FGBA 2HUEA 2J6EL 1R0AL 1KNOA 4YNYB 3PJLA 3RKDC 4JM2B 1E7UA 3JV6B 1W9XA 4OAWB 4DEPB 2N7SA 2OMXA 3FUIA 1FLRH 4YMPA 1IKOP 2WBJB 3IEAA 4HUVB 3MV9D 2G75A 3UC2A 5IIEA 2AV1A 3CHQA 3II3A 3O9WB 1VGKB 2C9SA 5C2BH 4M7KL 4GRWH 1HKLL 2MQCA 3U9WA 4NPKA 4O2FB 2ZXDA 4R3SB 3QNXA 4ERSH 3X14A 3EO1A 2ZXEB 3ZIYA 1MSPA 3ALXA 1H8OA 2MQ0A 3L48A 3R1GH 2X41A 1DVZA 1ETA1 2VLJB 1KCVL 3BIAX 1T5KA 4Q9RL 4XCFL 3MJ9H 1U3HA 1BZDA 2C34A 3DO4A 1TKWB 3FO0L 4Z7VF 4W6XB 5B3NA 4A2HA 5SWSE 2FT8A 5D96B 4E2OA 3O6MH 4A63A 3WE6A 5AL8A 1X5IA 1Z3GL 4BSJA 3VWKD 4MNQE 5I1EH 1MRFL 2ZCHL 4Z6AT 2DL9A 4KTDH 1OAXH 1KDIA 3ZGIA 4GKNB 4DW2H 4Q89A 3ZE0F 4XRCB 3DX3A 1TVBA 5EU6B 3OSVA 3VDCA 1MAML 1H6FA 5CUSL 4H13C 4YS4A 3QEQE 1XGUB 5EG6C 3SE4C 1JWUB 2EDKA 4GP8B 3VACA 4IRSD 2B59A 4FZ8H 4YR6B 2DPKA 5E8NB 3W11C 3IAPA 4X7SL 2B8OT 5IOKA 3AU0A 5IMKB 3B8SA 2YQBA 1EAPA 4HUXB 1S7SB 3UJJL 1JXDA 3LIUA 4WTXA 4AIZB 4GKSA 5DDHB 5BZDA 3K0YA 1FYTB 2B0SH 3CFJA 3LQAC 4MJ6A 5LNEA 4WHYG 3D69A 3V4PH 1TSHA 3LOWA 3RUGE 1V05A 4NZDA 2AS5M 4LSQH 1S4IA 1YSOA 2CBTA 2GJRA 1EHAA 1AZVA 1JHLH 4F7MB 3EYOA 4X6BA 3U6XS 3UO1L 3GT6A 4X6DE 1U8JB 3OJDA 1F90L 5JW4M 1Z5HA 3HB3C 3FOLA 1URZA 3U4EB 1Y07A 1A65A 2J7LA 4L5FE 1F3JA 1JYWA 3EYFA 4XXCA 1CFVH 2W81C 1WZLA 3RTQB 5HHXH 2A38A 3EFFA 1UH3A 3M1BA 3L5XL 1PLGH 5CZRA 1I82A 3LS5L 1A4JA 2NZIA 3EOBB 5C0FB 2ESVE 3C08H 4D3CH 2BWIA 3OPUA 3HZYB 4YHIA 2Y06H 2ED8A 1U3HB 3MGOA 2B1OA 1NMCB 3HC3L 2NY5H 1A4AA 4A2EA 3BPCA 3EGXA 4MB3A 1ZKAA 2C3HA 3LD8B 5DMIH 4PGEA 3HI1B 3NSDA 2XWEA 1S7TB 1NJ9B 4UANA 1GYVA 3ZPDA 2FSDA 5CP3H 1KV3A 3D2UB 1GW0A 3I3DA 2QSVA 3DTDA 4JGMA 5AW4B 1W0WB 3C09B 1HDMA 1CZ8L 1D5MA 1THCA 4AZ8A 2I26N 2VN3A 3BAKA 1BQ5A 3BH4A 1WHOA 3VJ6A 1KBBA 4YC2B 1NCUA 2XN9E 1MDAA 4BWUA 1EERB 1JCKA 3O4LE 5KS9E 4KJYB 3MLWL 3QC5X 3KLLA 4FXTA 5EEUA 4LKXA 3OAZK 3FFCB 5IB4B 3B9DA 1SY6L 5MP6H 4M8UA 4JFFA 4YSAA 4MQ7B 2DM2A 1KENL 2ZUUA 3DTXB 3P9WB 4LSTH 3NQKA 2BVQA 4HUCA 4XN1A 3FCSB 2VW6A 2JNZA 2W9DH 1D5XA 1LLAA 1R3HA 1WITA 5DJYA 3KPSD 5FB8A 3QXWA 3QFJE 5L2KE 5T1KA 1G7LA 2G60H 4RGNB 4FA8A 4RWYH 2FECI 5FOBB 4EO5A 1DANU 5DUPL 1NCNA 1ZLEA 4MHHG 5IJCC 4KQ4H 3QJHA 3VFSB 2EABA 1HEZB 5FUZL 3RIKA 1G7PA 3HOGA 2B5IC 3MBEA 5D2LE 2DTSA 1QRKA 5BS0A 4HEME 1AO7B 3NG5A 3RIFF 2IV8A 5JZ7D 4FFVC 4MX7B 4MAYD 3MRCB 4OFDA 3SKOA 4QT5A 1S3RA 3KYNA 4PJ8C 5HY9B 2FT6A 5B1AB 2X0UA 1OGAA 1N64L 3HUJB 3RGVB 5FUOL 3OAWA 1IC1A 4URKA 2XN2A 3N1GC 3ETTA 4MB1A 4YHIB 3RWIA 5MEND 5HJ3A 3GRWL 1RZJL 5BOZG 4PJHE 1L7TH 3N41B 5ESAA 1YEIH 3CLWA 5GJSH 4MCMA 1L7IH 1RZQA 3HAEG 3NA4A 5GGTL 3FMGL 2QADC 1FF5A 1RLBA 1X9RA 4B7IA 3D85A 1BP3B 4DOHE 4IDLA 1V3MA 2HWZH 4F5CE 2F1BA 1YEEH 5D6CA 1O9WA 1HSAA 2VDQH 1A7RL 4RRPM 5EOQL 2VR8A 1EGJH 1GGIH 3TBYB 1NGYB 4WWOA 5AYTA 1F5WA 5GGRA 1HE7A 3VB8A 3ELAT 3KNBB 4BH8B 2HJFA 2FAUA 3TV3L 2VJXA 4LPWA 3U79A 1D5IH 1J7VR 1G7JB 1NAML 5HDQH 3DYOA 3FQ1A 4Q9BA 2DQMA 1IFHH 2QSCH 1W2KT 4R7NA 5E4OA 1BZ7A 2NY7L 1Z66A 2Z4QB 4TPRL 1P7KB 2YLHA 3KD4A 4JFFB 2XETA 3WFHA 2O1AA 2BFVL 2BVQB 2VUYA 5HYSA 4G3YL 5DJYB 3AXHA 4JRYD 1ZLWH 1T83C 4X8JA 5FB8B 3VI4B 3CN3A 4NUGL 2ZG3A 1MCPH 5E00A 2DW5A 2XQYA 2V9RA 4Y5XC 1A7NH 5D7KE 2JKTM 4JZJA 5JPMA 4U4BA 3ARPA 5DVNA 5E5UB 1N4XL 1B6DA 3I6SA 4FF9A 4EDWH 3MUZ1 1QFPA 5DURD 2YEZB 2X2JA 2VXVL 2YGOA 3JTSA 4HLZH 4CNIB 2VZ1A 2BIOA 3C60A 4DERA 3D25B 3D2TA 3V6OC 2IDQA 4WNQA 3GYRA 5IQ7H 5EUOB 4RMBA 1XGRA 4Q2ZA 4PVNA 1PKQA 2XY2A 1IGML 2WP3T 2ICWI 3M8OH 3MJ7A 4LEXL 3BIKB 3C2SA 3Q06A 1OGAB 3KAAA 2Q3ZA 1ZGLB 2J2ZB 1BVZA 1DQMH 1DHKA 1NDMB 1D5RA 1TQUA 3K71B 2VABA 1LE5B 2NRDA 1A1OB 2NX5B 3CMOL 3MNWA 3OAZH 4Y16A 4Z7OE 5C0BA 2V33A 3PE9A 3VNYA 4G7VL 1P6AB 2MPAH 2B14A 2Q0ZX 5IGXH 1YNKH 3QUMB 1VPOH 5G55A 5IF0B 5DF0A 4I0CC 5E7FA 5DJ2A 3GMRA 5EU7E 3QUZA 3UEZA 4M02A 4TQPA 5H2BA 4XI5C 5DMGC 2UYLA 3FTZA 4GAJH 4FG0A 3SE3C 4NXKA 4Z7VA 3QHTC 5A7EA 4QRSA 4AJYV 4LRNL 1FWXA 4OSUH 4NENA 2AKRA 1FORH 2VAJA 2WNKA 3GEFA 4R7NB 2HFEB 3GS7A 2V7NB 4IKIA 4X8GA 5GISH 1IBGH 1ZK9A 3THML 3LVTA 4ZUSA 3UP1A 2H6OA 2IBGA 4JBSA 5I71C 2YEVB 2ZPKL 3DHMA 3BD5A 3N42F 4O2EA 3KVQA 1WFMA 3X1FA 1RSFA 4F2MA 2L7EA 1DJWA 3F7PC 3ESNA 3UFIA 3HZVB 1IT9L 4BRVA 1YEGH 3L9RA 1FNAA 5LVEA 5KVDL 1AXTL 2OYPA 2VMCA 5DS2A 3C6SA 1RURH 5I8OL 1HSBA 4ZXBA 1UD6A 2Y23A 3EYVB 1MXDA 4PRHB 1CFTA 1X44A 2HXAA 4NQDD 2E27H 3DO7A 1T21A 4LCWA 3GMLA 1DVQA 3ARDC 4F7CA 8FABB 1T0MB 2GBTA 5LO7A 2EEFA 4OM1L 4LLDB 3WMPA 4U0QB 4WGWB 4QOKD 5AW0B 5JOPD 2CKBA 4Q6IC 3DVFA 4P3CH 3LHAA 1G7MA 4U1IB 3FUDA 1M6OA 4KK6C 4NDMA 1GAFH 5TDPA 2G2NA 5LNGA 5I8KL 3JVFC 3AG3B 4E41E 4TVSa 5CJOH 3CFBA 2CIKA 2V9TA 1DBAH 1ACZA 2YRLA 4RFEB 5DJ2B 1G0DA 4W70A 3H7LA 5JQ6H 1MOEA 4XPAL 2OCJA 2C26A 4L8SB 1MHHA 5GGVH 3RL2A 1IM9B 2QDWA 2WLMA 1TFPA 4P23C 4JJ5A 5I30L 2FX9H 3OGCB 4LEOB 1FZJA 4JG9A 4L1BA 2V9UA 4B7LA 3MREB 3EIFA 3M86A 4YBLC 1N5YL 5D4HA 2CO2A 4IBZA 5INCB 4NENB 4N8UA 5I1JH 1U2HA 4OFQA 1L9PA 4HUNB 2D9CA 1T1XB 2EYRB 3WU1A 1A1NA 3HNSH 2AJZA 4EN3D 1KBVA 4A1RA 1GPOH 1GS6X 5I24A 1J5OL 4ZJ9A 2FJSA 2F7OA 3BFQG 3VXUB 4BYHA 4DN3H 4HHWA 5JIQA 2VQ4A 3FU7B 3TEUA 2VZVA 1YY9C 3KYOB 4TXVB 5C0EA 5ITBL 4PREB 2W9EH 1J86A 1XV8A 4AYFB 1WDAA 4HIEB 2C9VA 3P3RA 4AVHA 2R7EA 3B5HA 5EZOL 1FVCB 3WY3A 1YYCA 3L9RB 2ZWYA 4NS0A 3CVDA 2HAZA 3N6YA 4OI7A 2VZTA 4UYPA 4W9CC 4M7JH 4JZOB 4PGDB 2WWMC 1RMFH 4N2LA 1QRNA 2BH0A 1V7NL 1PX3A 1PZUB 4BQ8A 4U6YB 4GXVL 4D94A 1ETZA 1A7BA 3KWWA 3BRFA 4D9QD 2ZXWB 1UZ8A 3PWJA 2BHUA 3VM7A 4AM0A 4F7PA 3V4UH 4W4OC 2XZAL 4HS6A 3FO9B 4KKLC 4C4KT 4R4BA 2Y9RT 3BP7B 3ZE1B 2CH8A 4WU5B 3JZYA 3QEHA 3TVMD 1M6OB 2WLKA 2R0ZL 4I3SL 2A83A 4RDBA 3ZL4H 5C92A 2JTDA 2CLRA 3NSXA 1I75A 3SDXB 2VRKA 2WXGA 2AVGA 2BW4A 3KCPB 4IM8A 5ADPL 4NNYB 3P4MB 5IJBC 2FBJL 5ELIA 3HNVH 3ULVD 3DX2A 2PLTA 5CGMA 1XF3A 3ZR5A 3ZDYB 5FDWA 4FTVA 4B95C 4M5TA 1FVEA 4XC1L 5LGHH 2UWEB 2EUWA 3H9SD 4RIRA 5GRVL 5AVRB 5F7KC 3G6JF 2CHXA 2VLJE 3ARFB 2IOMA 3AMKA 3FTSA 5JNYA 1PMYA 1ZVSA 2FWLB 1ZXQA 1SQ2N 2JKLA 4FXGB 1D9KA 4WZ9A 5CM1A 4I3RH 1E9QB 2B9AA 2CKNA 2BOCB 4GXFA 3U36A 4AQZA 4RBPK 4XBEL 2XTSA 3HG4A 3V0WH 2YSTA 1AFVL 3SDCA 1UWEL 5KVFL 4XGZB 1VB9A 1OGTA 4F91B 4LLVA 1TG8A 5C0EB 3MJWA 1LDPH 4KITB 1JCVA 4LHUB 2ZZUT 4LEBA 5DEFA 3DVNB 1JFQL 1Y6NR 1NFIA 3BD4A 4JQXA 3TIDB 43CAA 3PFUA 4J3OC 3A6BL 4ADIA 4L1LA 4K55A 4XNMB 5F1IB 1J10A 3BSGA 2IBZY 3H0TA 3VYNA 3V9EA 1ETZB 1Q90A 5D6DC 3G9AB 1FN4A 2A4CA 1TJHL 1FYTE 3CAFA 3V95A 5HI4D 5C07D 2CUIA 2YIHA 2F19H 2XIBA 3SCMA 4HS6B 1VKXA 1U3JA 3FK3A 3TJHD 1QTPA 2C1PB 3O6FC 5E6IA 3CPLA 4XVOA 3T6QC 4WTQA 2X38A 2B16A 3WTSA 3QEHB 1ZSDA 2NY0B 1N7ML 2DM7A 3RGHA 3DXAD 3NZHH 4ALAL 4MS8C 3ME0A 2A83B 1AD9B 4JFEE 3D0VB 4JO3H 1QW8A 2BHYA 4ICXA 3N44F 3GSQA 1CU4H 4OF0A 2TRHA 1KIUB 3W2DL 4OLWH 1I9EA 1L3NA 3V6FB 4YSQA 1UD4A 4CILA 2EDDA 4B27A 2DY2A 4RIRB 3FT4B 5M7QA 3TF4A 3GI9H 4AIOA 4ESKA 1L4IA 3SN6N 3O45A 3QQ9D 2IPKA 4BINA 2W5PA 3A24A 4RDQF 3DVIA 3IDYB 4Z7UF 1F97A 1T89A 3QXAB 1E3ZA 3OKOB 4M93C 3QQ4A 1YPZF 4QRUB 1OY3B 1R4XA 3S0PA 4DP4X 2J20A 3NESA 1WZMA 4WUUD 2R0KH 2Q10A 1P5UB 4WHDA 4HPOL 2PR9A 3LRHA 3DETC 3ETSA 3L3OA 2CO7B 4FG4A 5IBTL 4PVBA 4LLVB 4KJPC 3FRUA 1A3LL 3ZMRA 1G5AA 3DO3A 4F9LC 3O0LA 3H4HA 1NFIB 4NSKB 4GIPD 4LZKA 5GRUL 5F9OL 5K59F 2FJFB 4XAWL 2X6VA 4G8IA 3ARXA 2NTFA 2WTPA 1LDSA 3ECUA 5B39A 4YHMH 4HJ0C 3RFZA 1JK8A 4A04A 3LQAH 5FLUA 4K5PA 3FFCE 4IRJC 1ODUA 2B1HL 3GXTA 4PB9L 2F1EA 2G9KA 4Y4FB 2XG4A 3O41B 1AQHA 2WOBA 3AREB 2O5ZL 5CFAA 4FNUA 1N12A 1Q0YH 3MJ9A 2DZEA 2V3FA 4G8FB 2X6MA 5D1QA 5C0CD 1UEMA 3F7YA 4QXUH 2B3RA 4RGNE 3DJRA 5DQJB 4BE5A 4JE0A 5E2UH 3REWA 3CZJA 2I85A 4DPRA 1CURA 5F9JA 1GMEA 4RBPH 3KLKA 3HFFA 2HVBA 1JRHI 4ZBJA 1UD3A 3F05A 1X7TA 3QO0B 4L0PB 4HDIA 3AY4A 3D8MA 3I50H 4C8XA 4PY7B 4IIZA 5KBMA 1JMZA 4O02L 3NZSA 1U58A 1V10A 2BJML 2GAZB 1KCSL 3T6XA 4AYMC 4N25A 2IWGA 3TO2B 1DQLH 1OCWH 4KRPB 4ZMYA 3GSNH 1HINH 5KBDA 1BD2D 1FLTX 3O45B 1UADC 3FQWB 1UA6H 1BZ9B 1N5AB 3OG6B 1U8LB 3VCLA 1FDLL 3P30H 3QQ4B 4WEUD 3VG9B 5IR1B 3V4PA 4X9BA 5HDBB 2VXSH 2YAMA 3S37X 1ROCA 4HZAA 4R0LB 5HJBA 2AHIA 1UKSA 3WFBL 1Q1JL 4Q6KA 1ED3A 2PMZA 2PXYB 3REVA 2AP2A 3MV8B 4GEIA 2W60A 5F1SA 1QEWA 4XODA 2XZZA 3D39E 2Y5QA 3EJYD 5C8JA 2GSGA 3PHQA 3WKNA 1G84A 5JO5A 3V0HA 1GH7A 1QO3B 5DJ6A 4PJ9D 3WKML 4GRWB 4XP9H 3MLRH 2BIMA 1RSYA 3C6LB 2FX7H 5MEOA 2WINB 3QRBA 4Z18A 5JIDA 3GSWB 5J6HB 3ARVA 1GCFA 4IQHA 3HE7D 43C9A 2IOOA 3SDAB 1SHSA 3G04A 3VWKC 2P26A 4M5YH 4P5TA 4U6HA 4EUPH 3SE9L 3JT2A 1CDCA 4NJ9L 2O5YH 3VI4E 3VMOA 4DQOL 1OF0A 5CLTA 3F7YB 4L1HA 1LD9A 5HBBA 2YR3A 2BOLA 2UXGA 1RUPL 3TO4A 3NZ8B 1DSYA 5I6PA 4IRSC 5CP3A 3VRJA 1JGIA 1KEML 2EECA 2VDKH 4H5SA 5ID1A 5EUOE 3VSUA 1GGBL 5J56B 2OXHA 2YJQA 1BQKA 3T09A 3CVBA 3O2VL 2IH9A 3FQNB 3DJZA 4UU9A 2ZXQA 4WW2B 3ZHNA 1U58B 4XVSH 1GYUA 3BUBA 4ZX6A 5ID0B 1XF5A 4FJYA 4PG9B 2PTTA 4FQCH 3F04A 3K6NA 3Q9PA 3EDEA 1G9EA 1ZT7A 1RXLA 4M00A 5CLYA 3JZ7A 1UYWL 2MPVA 3L3JA 3HW7A 2WLLB 1E27A 1U8HA 3DYPA 2EC8A 3IMSA 2OZNA 5CBEA 3W0WA 4ETYA 3IF1B 4HUUB 5DD6B 1A6WH 2ICEC 5L9DL 1XTLA 2P80A 3UTPE 3L7FA 2MH4A 2YAEA 2APXA 3VXRA 2VLKD 4GMTL 4BFNA 3E6HB 3B43A 4OV6F 3TYGL 3G6JA 3CDFA 4G7RB 1TZGH 3QDHA 1KG0A 3ILQD 3IK2A 2K45A 2VDML 3HPLA 4NQCA 2JB5L 4O2CB 2ZXCA 4TVPD 3DPDA 1QYGL 5DJ6B 2PWHA 4HCFA 3BFWA 32C2A 3EFDL 5JUEH 5C9JB 1E9PA 2V6HA 3ZSSA 4XPGH 1H6EA 5MHSD 3SDDA 3DTUB 3QJXA 1QA9A 1NUNB 5DK2A 3NH7H 5I1KL 3DOHA 3VFVA 2OULB 4BFOA 5DJXB 1C16B 2E76C 2BSSA 2P42B 4QKTA 1MJJB 4P59H 4KZ0A 5E2VH 1RZIB 3J8F7 3KPOA 4PVMA 4PGBB 1RIUL 2WO4A 3ATEA 1H3XA 1RJLA 5ABDE 4N24A 1LMKA 3EGSA 3K72A 1QFUH 4Y5VC 4O02B 2KLRA 3E9UA 4TULL 2GI7A 4NJAL 1M1XB 3DGCR 3PWVB 5EF3A 4KKBD 3OLDA 4AXWA 1T1YA 1ZAGA 4OZGF 2O93L 3GHBL 4P2RA 1HX0A 2EVJA 4ZTOH 3VQ2C 4C56D 4MZ2A 1IM3D 3A6OA 1EGJA 4JG0H 1WFOA 4K3EH 3HC2A 1MCOL 1ZHLA 3QUKB 1K6QL 4HJSA 2H41A 4U1MB 4ZFGH 5G5DB 1TPXB 2AK1H 1NCCH 4MWFB 2ZUTA 4LGPB 3V0DA 4Y2LA 1E27B 1U8HB 3BT0A 4FQXB 3BP6A 3G5VA 4L3CB 3ZYIA 4BZYA 1S9WB 4WO0A 4CSPA 1OAZL 3MRRB 5MEPB 3F6LA 2Z1KA 4R7XA 2H9GA 5I15H 3PWPA 1C7SA 1ZHBA 3TPUA 5JZ7C 5B21A 3OR7B 2PR4H 1QW9A 4MAYC 1E43A 2DIAA 3GO1H 3H7BA 4FZEH 3PL6D 4XMPH 3GI8H 3KPRE 3MACL 4K94C 4Z7UA 1MIML 1R9FA 2IPTH 1EVTC 3ARSA 1LK2B 1YPZA 4F8OA 3G6DH 1RPQA 4W68A 3LEXB 4JHWL 3SJVB 1T0NB 3IBEA 1T3FB 2E9JA 4GO8A 4Y4KB 1H5BC 5EU5A 5SWZB 1JNNL 3ZE2B 4OFYD 2VLRB 2OYKA 4KOBA 1OAQH 4EZJA 1OM9A 4KX7A 5EWIL 2IMNA 1CLOL 2PYEB 2Z7ZA 3NJFA 3TJEL 5GZOA 4HJ1A 2CMRH 4XH2A 3UROR 1AIZA 3FTGB 1UWGH 4CSZA 3BI9X 3OKKB 3QWOB 4EXKA 4ODVL 1ACCA 1NOFA 3CV5A 2EE3A 3B1TA 4GBXA 4AXWB 3GXFA 5FS5A 3FHAA 4JB9H 3HN8A 3RDTA 1RZKH 5CS7A 5HHQA 3ZSTA 5JPNB 4X5RA 3LH2L 4P2RB 5DFVD 5H35B 4XWOD 4DPBX 4XTRD 4Y5YA 2E8ZA 2F74A 4KQ3L 4X9FA 3VRLF 5K9OA 3VYPA 5DI8A 4IS6A 2DMBA 4KH9A 3MA9L 4NO0D 1R3KB 2EDRA 3KM1A 1UKTA 4W9KC 1XTMA 3ZE1E 4OLEA 4YUEL 4U3XA 5D93B 5IHHA 1RD6A 2B08A 3N44B 4AT6B 2Q76A 1AMXA 4FKHA 3D12B 4ILDA 4ZAKB 5JQ6L 1KCUH 1XHHA 4MBOA 3SDXE 4N2EA 1BFOB 1RK0B 1S9VA 2H9GB 5ACLA 3QDGD 4LLYB 5D7JD 3VAEA 3GIVA 1X7QA 1F6AA 3INUH 2IGFL 2NYYC 2MNWA 3PAVA 1B90A 5I1AA 5JQIB 1SXNA 5F9WB 2LQRA 2UWEE 1JV5B 1R47A 4I4WB 4XE5B 3U2JA 2A0LD 1V3LA 4UINL 4GQPH 2K78A 1BFVL 4IIQA 5JXEA 1PD1A 2DL2A 5KVDE 1OLLA 5I8EB 3QGVA 4GY4A 4DN3L 1OIOA 3QJTB 1SDDB 1AXSB 3O4LD 3SPVA 4M7ZC 1QAWA 2R2EA 4G80A 3JWNC 5AVWB 3BWUC 3S36L 4RMSA 3F00A 3U0WH 2LLGA 3FAXA 1J1PH 2NT0A 4POZD 1FG2B 2CO6A 2G30A 4IEFB 3HG1A 1KTLB 2Y7LA 1X6NA 2HT4D 4GSDH 2V7HB 5F7EH 1A7QH 1AZUA 3I9GL 1X4XA 5BMFH 4TMPA 2HRPL 3T5WA 5F97E 1XF1A 2APTA 1YECH 4LRIC 1UOLA 4F57L 1RZFL 1JWMA 3ABZA 2KL6A 4UQ3A 2YKKA 3L6FB 3V79C 1G1OA 4YDJA 3NA9L 3A47A 5GIRA 4RRPA 3KGRA 4FNSA 1KPUA 1FL6A 3MRNB 1UWXH 2ICWB 4NZRL 2CK2A 4BZ2H 1D7FA 4D0BA 5JA8B 3OPZL 5DSCB 4MDIA 1G6RL 1CGXA 5DVMA 5E70A 2W0KA 4QMEA 5H4YA 1BF8A 5HSFA 2QHRL 4NQXA 1NC4D 2J8UF 4DP1X 2NTSP 4RLDA 4KHTL 4PG2A 5T3XH 1WZKA 3QUXA 4I8DA 5D1XB 2GHZA 5ABZA 2ZKWA 3NQIA 4DIXA 2H0JA 4FG6D 3V0AC 4I0PB 4HIHA 4BZ1L 4GKLA 4WFEE 1EEUA 5BJTA 3L8QA 3EBHA 3S5LA 2DJUA 3H3PH 3P77A 4TNVK 4L9LC 4Q0XH 4TQEL 1IL1A 2ZSVA 1CF8L 2WQRA 2FYVA 5FV1L 3TBSA 4N85A 3G7TA 4Z0BH 4E68A 4FS0A 1MZZA 2NY1D 3BMWA 4MGXA 4FL4B 4HWNA 5AW1B 3IETA 3FYEB 2W1NA 1BM7A 4X42A 1NANI 1E4WL 4Y8AA 4YXHL 1IARB 2XQBL 1LO5B 3QDMA 3QFDA 3S34L 4HQQH 4O00A 2BP0A 1LDPL 5ESQA 3CBJB 4P9ML 1HI6B 4G80B 1QSEB 3D18B 5CJQH 4CGTA 1P1ZA 4FQIL 4BFEA 1BXAA 3T3MF 3AG4B 4AY0A 1NGWA 1WZ1H 3B9KA 3GB7B 3SE8H 4FNLH 4PJAF 3ARBD 5L6YH 4Y1AB 3X12B 2GTQA 3MJGX 4RNRA 3BVDB 3QI9D 1OAJA 4TLTA 2R1XA 5DJAA 3IFLL 3KGSA 2NT1A 3WIIL 1GZPA 1MW1A 3MRQA 3O6KH 3SPJA 4XMLH 4NT6B 3MLTB 5D7KD 3U0PB 5IB3B 4JFDE 3BWSA 3CX2A 4EN3C 2WV3A 3L3KB 3VE0B 3L1OH 1UJTA 3Q2NA 1DLFH 1JGUH 5DZLA 1EXUB 5AAWC 3VWJB 4AVKA 1XCTB 4JFVA 1BZOA 3GBMH 1A3RH 4C83A 4O58L 4QCIB 3BGMB 1AGBA 4OZGA 3VGFA 3C12A 2KI6A 2AJXL 3WN5A 3UTTB 3NIDF 1A21A 3OQ3B 3QUXB 1T4KB 4MJID 3QXTA 3MXVH 5IB5A 1WT5A 5HP5A 4U6VL 5ICZA 1OLZA 3QEUA 1UFGA 1I3GL 3TL5A 4A2FA 4Q8BA 2E9WA 4XOAA 5KVFE 4PJEE 1KLGB 4X4XB 5JIMA 2K9UA 4ZW7A 2MFNA 5F3BA 1ZCRA 3MC0A 4NZTH 3RA7H 3EDJA 2VZSA 4NWTL 3LQMA 1PF3A 4NI6A 3MLUL 5CHNA 1FZOA 1BOYA 3T65A 5CD5D 4JHVA 3TVMC 1AC0A 2F7PA 5D7SL 4XP6L 4XOBA 4JO8A 3IVKA 2BP0B 3ALPA 5AAPA 4TUUA 4KDWA 2FIKA 3MO1B 5ESQB 5DFTA 5HDBE 3WE1A 4XT1C 1YNTB 5F7NC 3ZKMD 1P1ZB 2OSLB 4G7SB 3QQXA 4IBSA 3ULVC 1QTYT 4XPHH 1MI5B 1QQDB 4J6RH 4OD3L 5FKAA 2P5EB 3CCHA 4BSVA 3K6DA 2P7TA 4W93A 3BDXA 4QNPF 4N3TA 5SV3A 3CK0H 5DJAB 3IMVA 1QBMH 1G6RB 1XGPA 2ARJA 4UQDA 1MAKA 5KVGL 2X1QA 3H53A 2Z34A 4DAGH 2D4DA 1HXYA 1SFDA 2CHZA 4BUQA 3RDJA 3G6AA 4YO0B 4OZHB 5F0LB 2V2WA 5HYSG 4KO6A 5CN1A 2WKGA 4QYAA 5GPRA 5E2UL 5IFJB 1ORQB 4PGJA 1SM3H 2IANB 4H8VA 4FQQB 3L4ZA 5J57B 4D7BA 2VDNL 4CVXB 5GGRY 3T04D 2XQYG 3IU3B 2GIXA 2DBJA 1BJ8A 4JN2B 4MZ3A 4ES8A 3AB0C 2DQTL 1XMEB 2YXMA 4JY4A 2O61B 4A2DA 4RMRA 1BZQK 1Y6KR 4ABVA 3QUYB 3VG0H 4RX4D 3R8BB 1PG7L 4PGCB 1GGCL 3QNYA 5D70H 1E42A 2ZX8A 3P11L 1NCBH 3RVXD 3SE4A 5ICZB 3UABA 3FUEA 1JDDA 2XCMC 4WSKA 2WVSA 2ROYA 2MHAB 4WQOA 3L2MA 5HI4C 4AM0Q 4AUYA 4GUCA 4IGBB 4E41D 3S8GB 1E8YA 3IGKA 1SN0A 1SYSA 4P04A 3TJHC 5EA0L 3TCXA 5EBLA 5IJDC 5JDSB 5E6UB 4CBZA 2DWEA 4G8GB 3UCQA 2VJ0A 4G6FD 3QRFM 1SVZA 2W9LA 1FNEA 3Q01A 3RY4A 3EDDA 2X1PA 3D09A 1HQ4B 5EUKB 3MNZA 5E4AA 2D03L 2YPVH 1F4YL 2PTUA 3ASNB 1FE8L 3US0A 3HI6H 5EO1B 1JRHL 1FBIL 2NXZD 1Z9OA 4MNGA 1IE5A 2VE6A 4DVRL 3HMXA 4KRMB 4MCZA 2X4NA 3P0YH 2QR0B 5JXAH 2GITA 5CSZA 2TSBA 3PDGA 1AGFA 2G5BA 2PUQT 2JELH 2H32H 4AOFA 4JZNB 2ALWA 4K0OA 5DGRA 1FFNB 3T8XA 3TEXA 3QQ9C 5FYKU 1IGJA 3B7UX 1LEKB 1QKZH 3O3DA 4ZX4A 4MYWB 1B9ZA 5E94A 2DYSB 4KKPA 1G1CA 3RGBA 1CE6A 5CMAB 5KBNC 4ATWA 5DEZA 4CADB 3ZO9A 4G5ZH 1JPGB 5KUKA 1NWPA 3DWTA 5TF1H 1RZ7H 4AYGA 3VXMB 5I1LB 1ACXA 3O3UN 4RCAA 3VXNA 1ZT4A 2Q2LA 4D9LL 1ZMYA 3MCKB 4OGZA 1TTFA 5DK3A 2O6PA 4UQCA 1GY2A 1UOVA 4AGQA 4MA3A 4TOYH 2MJWA 4XN8A 2YC1A 2P5PA 2YXVA 3FONA 3MGTA 4NCDA 2Y07L 1VRSA 1ILSA 3JV0A 2WBJD 2WVVB 3KW7A 3O9WD 1FNHA 3HNTH 3VI3B 5DWUH 2WUBL 5E08L 5DR5L 4KDTC 3ZT6A 2J8UA 1IKFH 4LMQE 4DN4H 1YEKH 1MH5B 1KC5H 4Z7NF 1YC8A 3W5NA 2DWEB 3KXFB 3PG2A 4E9RA 5HHOB 2IADA 3KBPA 5E2TH 2EKSA 1LJMA 2R0WH 4RFOH 1H3TA 3HN3A 3OKMB 4M4RB 3GMNB 5ENWB 2I5YL 4NBXB 3GBNH 2VLJD 2YA0A 4EUPA 3WTVA 4C55A 1PD0A 2J1ZA 2X2UA 5HYJA 4MZRA 3CN1A 1J05A 2J8OA 2IC2A 5GGQL 3KHOA 4H25A 4H20H 1KELL 4B0MM 1Q94A 3L3HB 3GLZA 4P57B 4BHUA 2AQPA 1AGFB 2J88L 4P5SA 2ADJB 4K71C 5KYYB 1HFUA 4OZ4B 1CL7I 5PAZA 4JKPH 1OQOA 4TYUA 3PGCA 1NIFA 1U4EA 4PJ8A 4WJ5B 2P5WA 3QHZH 1IQWL 2F6AA 2GT9B 4E36A 3F58H 2OTPA 5EU6D 4HKZB 4EMZA 4XO4A 1Q0XH 2F54A 4P8QA 1NCGA 4FOMA 1UENA 3WLBA 5JHDB 2VLRE 5CEZH 4ZZFA 4V33A 3VTMA 1MHPH 4PJAA 1LP9B 2EE0A 2BO0A 3IJEB 3KM2A 1XD0A 2NMSA 4G1EA 5D8JL 3GSNB 4TTDD 4MCNA 3HVDA 3D30A 3O2WH 4I48B 3EJYC 3TCTA 2OX5A 1AQMA 4F80A 4BWWA 15C8H 2AF2A 4ZFOB 4MMXB 1FYTD 3LHPH 3L9YA 4XPTH 5D9SB 5FM5M 4PJ9C 1AY1H 4NQSB 4LSVL 4PCYA 3ASOB 3NAAL 1XGYL 5T1MA 5TE7H 4NPJA 1W8EA 3CMGA 3LKOA 1DBBH 4NZ8A 4Y4HB 1CL7H 3KCWA 2DKUA 4ZG1A 1H3VA 2ZUQB 4KJQD 3RVVD 5E8DH 4KFMA 3HE7C 5E24E 4R4FL 5KSUB 4F15B 2EDLA 4X6CB 3LAFA 1OZUA 4HMEA 4J3OF 4JFED 5HHVL 1EFXA 4XMTA 1BVLA 2CIIA 3MRLB 1JWSB 1OSPH 1S7WA 1YMMB 1CK0H 2CUHA 3FU8A 1CG9B 3IDMA 4JFZL 2BVOB 5GQBA 3UTSA 3RTQD 5GS2D 2VH5L 1OK0A 2FH8A 2YPLE 3QJUB 1CTNA 3T0EE 1T83A 3FZUD 1QNZL 2G0KA 2HJLB 4JL2A 3RVUD 2HH0H 4GQ9L 2BDNL 2FVNA 4XC3H 4FQPA 3I9PA 4Y5XA 2YPKA 4WTZA 3ZL1A 1LK3H 4WWKB 1HH6A 2GABA 2OMYB 3QWRA 5GXBB 1TJIL 2F53A 1HEHC 1MJ8H 1EO8L 1CYGA 4K94H 3TBTA 1JD7A 1NKOA 5I2IB 2V5RA 3V6OA 4YSRA 2QVTA 2IDUA 2UZIL 1QLEL 1U8NB 2XWXA 4J4PD 4BBWA 2R39A 4YXKL 2P8LA 2YKLH 4N0UA 3D2UD 1Z5LB 3VH8B 1BYOA 1JHKL 5EZIH 2OMWB 4XXWC 1HS6A 2AQRA 2DIEA 3APFA 5I1DB 1TJGH 2GUOA 1VGEH 2YFNA 2Z0BA 5D72L 1KPRB 4XNZC 1J8KA 5GGSA 2QGEA 3ABMB 4OLVH 5IY5B 2VC2H 4N86A 3AS0A 5FYLL 3CBKB 4FLSA 4PW9A 5BVJA 4OUUA 3FFCD 2OTUA 4A7VA 1QFWM 2IQAA 3D3VA 4FQHA 1OSZB 2WN2A 3NEXA 3ILQC 5KYUA 4AEIL 4JLRA 1HL4A 4ZODA 1X5JA 2GC7C 3UJIH 1JGLH 1INEH 2ICCA 3T1WA 4FMVA 3V5HB 2FX8L 3EYSL 3NJJA 1V54B 3NIGB 4P4RB 4EPSA 4UTAH 1AS7A 1P5VB 5B7MA 3SE3A 4K7PH 5E99L 3O11A 3QAQA 3WFEH 4JFXB 4RGND 3NRFA 5IVXB 4QRBA 5LXGH 5TE6H 9CGTA 4Y9CA 2EC9T 3HKFA 3EOTL 3HIZA 2QT6A 4ZFFA 1QHOA 3RPKA 4YK4B 2A6DA 5K9JH 3FXIC 1S7WB 3U4AA 4EI6B 4OZIF 1IBDA 5FWQA 4JDVA 2J4WL 4QRQB 1AO7D 4Q74A 1I1FB 1I9JL 4KKBC 1M6UA 3DUUB 2XWCA 3HMWH 4LVOB 3FYIB 5EBMA 3T2PA 2QPFA 4RMUA 4U1NB 1FI8C 3MCLH 3RGVD 4K23H 1B4JH 3QDAA 2IBBA 1XF2A 4WNSA 5AOKA 4PJGF 4NZJA 3VFTB 1TTRA 3X1NA 2VDLH 5F6HI 1SMAA 3R4DA 1MEXH 2X4QA 4PWIA 1VLXA 4TNVF 3IRPX 5AW2B 2QQLL 2YMOA 1Q9KA 1OPGL 2Y7QB 4OLUH 5HGBB 4WHTA 2AAVA 3WY1A 4CSTA 4ZMNA 4JO1L 3ZDZB 4LL9A 5I1IL 5IP4A 2PWGA 3SOBH 3ARDA 3Q6GH 2J5WA 3B9VA 1A4KA 2X87A 4QY8B 3ILPA 3CXDL 4G2AA 4NP4H 3UPRA 3JWNH 4U3CA 1IKNC 4H4NA 3D9AH 1M05B 2DQEL 4PJ5A 5CO1A 5F44A 1WFJA 2D31A 5FFOA 3ZQWA 5BUGA 5GGSB 4Q6IA 5FO8B 4U1JA 4GLRI 2X44D 4XO5A 3M6DA 2VZUA 3RWJB 1QPXA 1GTFA 4HIJA 4AG4H 5LB1A 5FIEA 3BW9A 1J0HA 3PL6C 4BUHA 2J72A 5D2NB 5DC9B 4CU7A 5EOTA 4WDIB 3CNKA 3RNKB 3H42H 4UIKL 4ZOAA 3PPEA 4DPCX 4ZTEA 5B39G 1BYNA 1ET8A 2Z92B 1K4DB 4P23A 4YHZH 5EC2B 5AW9B 4S1QL 2EIZB 4H2CA 4HC1A 1ZVHA 4W6WB 4AYEC 2DTMH 3O3AB 3QZPA 5DD1L 3MBWA 3OXSB 4R6UA 5HYIA 1EV2E 2A6IA 2VXUH 3GJFK 5HJGA 5CFHA 4I2XA 4GLRH 3ZDXF 1QLEB 2VYRE 1S78D 4W9ZA 3BXNA 1DSFL 2Z8VC 4JW3A 4OCRH 1E40A 2R2BB 3L1EA 4OCWL 4S0TD 3UTTE 5KEZA 3WN6A 1QWHA 5DC4B 1E4JA 1F6FB 3BPLB 1A6AB 2FZ3A 5DFVC 4NUJB 4XWOC 3QJFB 2NX5D 2X4QB 2CK0L 4XTRC 5DFWH 3QNZA 3EXLA 4OCMC 1A6TB 2AEPH 3C5JA 4YWGH 4DUXA 1NMBH 2GJJA 2C9AA 3BAEH 1OOWA 1Q9KB 3DX6A 4YEEA 2P24B 1NCTA 4JKMA 5HGDB 3UTPD 2FO1A 4B9CA 2PO6B 1M9WA 3VXSA 1BM3H 1W72L 3ULAB 2R1WA 2V5YA 3IJYB 4Y1TA 1A4KB 3N43B 2EAEA 4W4OA 1DFXA 3ILPB 2ZYHA 1UXSB 2APWA 3VFMB 4OJEH 5DRNB 1MFVA 2J44A 4M43L 3QIBD 4UMSA 1ZEAL 2MCMA 5CP7B 3T77B 3V4VL 1EHXA 1TU2A 2GTZB 3DX8B 2E3VA 1KTRL 1LO4H 4BZ2A 3D06A 3MV7A 5I66B 4URTB 5D7JC 3EJUA 1N19A 1MI5E 2P5EE 1T1WA 5J7CC 3BVTA 4YE0A 1L6ZA 3FDWA 1N0LB 4N8CH 2ADIA 3NSFA 4OBSA 4KK8D 1R5IB 2A0LC 1HJBC 3U30C 4HKXA 3N1MC 1P2CA 2WLHA 4U6XA 1BX2B 4G8AC 2K0RA 4P23B 3FH5A 4OJFL 1Z9PA 4R96A 3ZZ1A 3PWNA 2DIBA 2VWEC 2I24N 4OZHE 3JTTA 3O8XD 4DEUA 4MD5A 4ZUTA 1G9MC 1ULVA 1YEDB 5DEGA 3VGAB 2ERJC 1BQLH 3LIZH 4POZC 25C8L 2IANE 1SYVA 4PRHD 2BS9A 4YHYB 3NBNA 2G5UA 2XVLA 3F3HA 2I69A 2VOTA 1JPTL 2HT4C 1YEHH 1AC6A 3BSHA 4U1GB 1PX4A 1XB3A 4YSEA 3FQ2A 4E9SA 2HN7B 2KYIA 3FN0H 4JM4H 4XMZA 3X3GL 1KTJA 1AI1H 2ZKMX 2XBZA 2RBLA 2VO5A 4WU7B 5DS8A 4TNWK 4LQ1A 3MSPA 5D7HA 1CFQB 1MW2A 3WENA 3ETBF 3SKUD 5HGAB 4LLQB 3O6LH 1QBLL 5KOVC 3LKNA 5AD0A 2DS4A 3NIFE 4FP8H 5D6DA 4KXAA 3HI5L 3I9IA 1G7QA 3NCEB 3I6GB 4KXZI 1ORSB 3FC8A 3KYMB 2VERN 1J48A 4HS8L 5GRXG 4NKDB 4XAKE 2EKJA 4OD1H 4TUJB 5DHVH 2QVMA 5DZPA 2NUPA 3WTXA 3O6FA 3TGXA 1IM9D 2QQKH 4KMTL 3NJHA 3QCTH 1S2EA 3E6FA 2R56H 4QRTB 5C09A 2VQ1B 1MLBB 1WAAE 3D1MC 4FG6C 4K7FB 2HKFL 4Y19B 2Q5BA 4DESA 4BM7A 2Q9OA 2NZ1A 3DGGB 1JNHB 2OJZL 3FB6A 3BVXA 4NQQA 1VIWA 4G72B 5LAXB 5CGBA 1RU9L 3QVAA 3UYPA 2ADIB 4F1ZA 3V9FA 3VXUD 3MRKA 5C70A 5FK9A 1DQKA 2NY1C 4U6XB 2Z65C 3DBXB 4B96A 5I6OA 2O6DA 4RZCB 3L08A 4GP4B 4LL4A 5DJDB 5BO1H 3OKDA 4UB0L 1C5CH 5J11B 4KXZH 1DJGA 1YYLH 5J9PA 1WPCA 2H2SD 3F12A 4L3AA 5B1BB 3G5XB 1GL4B 3CVHH 3MRIA 3ATFA 1KCKA 4WLCA 2ED9A 5TQ0H 1I4FA 5F1KC 4W9EC 4X99B 4LCUB 1OCCB 1ACYH 3ARBC 2NY6B 3JBG7 3MODH 3VXME 1CIDA 3MR9B 5D70L 3QI9C 3TF7C 1R75A 1W72B 2R4RH 3CDCA 3S35H 5I8CB 3RJDA 4F9LA 2AMGA 1N67A 1ZANL 2W91A 4HX1B 2ZNXA 4NQEB 4M03A 3FN9A 3V5KA 1BBDH 4LU5L 3LNIA 4UNIA 2EDEA 4OZIA 3UADA 1M3JA 3AG1B 3V4VB 4N3UA 4PW3A 1HXMA 2HFGH 4LVNC 4L2YA 8CGTA 4M6OH 1K8DB 2WCSA 4IRJA 2GVYA 2Y36L 4XN7A 3VI3E 5AD0B 1A6UL 2ZP9A 1HT6A 1IAOB 2AK4B 1J1XH 3MRGA 2BNRE 2NNXA 5CGYD 1MJUH 4B9JA 3DSFL 2FQDA 1GJUA 2MNUA 5JMOC 1KXTA 5JW4N 3FS9A 4QRPE 3ILDA 4KO7A 5ERWB 1I7ZB 1S3KH 4PJGA 4JO4H 5E2WL 5HHOE 2P44B 2WXQA 3DX9A 3TFBA 5KVGE 2BINA 2ZWLT 5BV7H 4IRZH 4LPVA 2WNXA 1KGJA 2WXNA 3UERA 3HRZB 3OX8B 2QFRA 3ARFD 4X4KA 1GW6A 5T1LB 2P8PB 3W82A 4UT6H 2XQ0A 4B6ZA 3KL3A 2QSQA 4HKBB 3EXJA 2EUZA 1H15B 3A67H 1T2QH 1DCEA 1NH6A 1QBAA 3L5WB 1YG9A 1PVHA 4RDQG 2FO8A 3KPMA 2Z8WC 3HS0C 5BRPA 3TA4D 4PRNA 1F2XK 2RMNA 4KU1A 1EZSA 3ARWA 4HP5A 2ZOTA 4D7PA 5CD5C 5LQBH 3SQOL 2WD0A 4JM0A 2BX5A 3T1FA 4LHUD 4JPKL 4NKOA 1DQVA 1KYFA 4G43B 2XT1B 4K3GA 2IGLA 1AGCB 4J28A 1ASQA 5JHDE 4Z3FA 5LGKA 4YQXH 1OL0A 3NDYE 1RZ7L 5KSBF 3Q1SL 3WBDA 2VW4A 2WGXA 1J9QA 1TQBB 3MV9A 3BEVB 2ZKYA 1SOQA 4H8QA 2E7CA 3ZKMC 2AQ2A 4ETQA 2M26A 1E6OH 4QXGL 1XXFC 3CLFL 1FO0H 3T4AB 4XVTH 1MFAH 3CSYA 4U6TA 2WO2B 4ANKA 5IQOA 5AKVA 4OJAA 4P2QE 3AAZB 4UIMA 5EO0B 3Q05A 1L9TA 4PV8B 2E47A 3MYJB 1Y0LA 1YUKB 4G9DA 3F7VB 3TBCA 1AHMA 5E23A 3SKMA 3GLAA 1UB6B 3BWUF 1BHGA 4A7QA 4O4YL 4XO3A 1DBML 1KTCA 1UD2A 2BHFA 5E8PA 2YK1H 1WGOA 1CIUA 4NC2B 3PS6A 4Y1SA 2XV2A 2M2DA 2NY0D 3NABL 1ZHKB 4HAGA 5I6XB 3WXVL 2H32A 3BVUA 4Y89A 4IRJB 4ZS7H 1N26A 4JDEB 5K9QI 1YMME 4HXAH 3C2AL 1JN6A 1D7DA 4MNHB 3WJMA 3GIZL 2WB1A 3B2VL 4WFED 3VWKA 4M8VA 1RUML 3UJTL 1ZA6B 1ZTMA 1SJHB 2A74B 2WSKA 3GGWA 3BKYL 2R0LH 2XHNA 3K8LA 2Y1ZA 3PNRB 5DUML 3QZLA 5DVPA 3OKLA 4S0HA 5AB0A 2HJKB 4H20L 1WUNT 3UTQB 4IBTA 1VJSA 1NIBA 3O0RH 5KANI 2QEJA 3RVXC 1Z32X 5KW9L 1FC2D 4I13B 1AOZA 4PSRA 3U7WL 4IRSA 4EZMA 4OT1H 2A5UA 1CR9L 3LZFH 2CXKA 3NTCL 4Y88A 5I6KA 2MOGA 5IKCA 1C8QA 1UFUA 3LRGA 3OMIB 1IGCH 3LY6A 3KHQA 4YJZL 3CG8A 3O2DH 4ZPTA 2ZOOA 2XN0A 4GT7A 4B97A 4RA0C 5J06A 2WJ7A 4DKDC 4LBEA 1GC1C 2FL5A 1SBSH 4D0DA 4HAFA 1FFPA 2GY5A 3QHFH 4FQ1H 3QIUD 2CPCA 3V0VA 1WE5A 1SJVA 5DD3H 2NXZC 3NCBB 3FU5A 3G5ZB 3MNMA 3FB5A 4TUKH 1WS7A 4QHUB 4NZUH 3RQ3A 3LHPL 3VXOB 1EUTA 3HFMH 1L9OA 2ICEA 4PYGA 1NAKH 1QSFB 3CSYB 2ENQA 4Y4FD 1VACA 3EUDA 5I75C 5MEQA 2IQ9H 2XWTB 3ARED 1ZV5A 4H0GA 2C7FA 5I19L 1IB5A 3NIGE 4BK4A 3B3IA 5JW3L 1KJVB 4UOW1 1BOGB 3UPCA 3L16A 4HHGA 1X9LA 2NQCA 3QBTB 1SMOA 2N59A 1Z6JT 2FBRA 2VQUA 4GIAA 2OQJB 4QTHB 1QR1A 5IOPB 4TUOB 4RRPG 3SZKC 4M8QA 2MKWA 2G3XA 4JHBA 2NCMA 4RVBA 1P4LB 1TVHA 1U91A 3HE6B 4LLWB 4AV0A 3VQ1C 1UD5A 3DHJA 4Q4EA 5L7XL 1FIEA 2NY3B 4MYPA 1XAUA 4QLWA 1TETH 4UAHA 4F92B 4OUOA 4AQ1B 5JOFB 2YA2A 4H0LC 1BEYH 4Y5VA 2C7UB 4JDZA 4PS7A 4H8HA 2F58L 1DBJH 3DI3B 1FJ1A 1CLVA 4KRPD 4OIIL 1QMUA 4WJKB 1R3JB 4DEPC 4U1LA 4K9EC 1CPUA 4IRSB 2V2TB 1JZIA 2IEPA 2WBJC 2SEBA 5I74B 3S5LG 5L88H 1XGQB 3O9WC 1MFDH 4BFJA 2WQWA 1RUKL 4P5MA 4UT7H 4LARH 5DRXB 3WL9B 5I1CL 2WBWB 4YX2L 3K46A 4A66A 1JGDB 3U0TB 1CGYA 3ZDZE 4AZUA 2ZXAA 3LRSB 5BXFA 4DJMA 5IEHA 2PXYD 4U1SA 3CVIH 3MV8D 4HIXH 2OL3A 3ARGB 2HRLA 2FL5B 3C5ZB 3ECWA 3KPSA 3LH8A 3MLPA 2KERA 1PFOA 3TCLA 5H4ZA 4YDIH 4TSAL 4AH2A 3Q6FA 4UM9B 2BZCA 2I60L 3IMRA 2QV2A 5CLXA 4WEBH 4WW1B 2F08A 3C6LD 4KV5F 4RISL 4TVPH 1U8CA 5BS0E 5CZVH 2XIDA 4PMFA 5D96C 2QVKA 4GSUA 1AR2A 5IROD 2YSSB 1DN2A 3SDAD 4KH2A 4FADA 2OZ4L 2ILLA 3IDJA 4HBCH 5DJCB 5TFSL 3WXWL 4NAJA 5C0IB 5I16A 4MAYA 3NJIA 2EVGA 5IVOA 1NOAA 3BO8B 3VFNA 3OB8A 1XB8A 2DQFB 5IM7B 3UO8B 1AZBA 3VFRB 5KJRH 3ULVF 4RAVA 5MENA 3VW3H 1ROWA 1VCAA 1P4BH 1P69B 2X4SA 5TH2B 4PP1D 1BVKA 4N87A 3CDZA 1H5BA 2OXGB 1BJ1H 1T5XA 3HMWL 1AQKH 4HS3A 1C1EH 4TTDC 2BSTA 3IYLW 3QORB 3WGVB 1S9XB 3S2CA 1AZZC 1IC5H 3FFDA 5FKPA 3BHBB 1I8UA 2PCFA 5CAYB 3B2MA 3ECBB 4G1MB 4EQ2A 4YFEA 4ABWA 5TPWL 3TNNA 1NEZA 3I2CH 1M7UA 3D07A 1T20A 1SJMA 1FJ1B 4AEHL 2AEOA 4KJQC 2QKIB 3RVVC 5HGHA 4IBVA 2KLSA 4GP5B 2MTPA 4S0SD 5EPMA 4XCYA 5CD3B 4XCNB 1GOGA 5CCKL 1VFAA 1TLKA 5FYLE 3SKNA 4QF1A 2PP9A 3NFSL 1T22A 1KGUA 3FO2B 3SEPA 1FZKA 4DFHA 3RTQC 3B4NA 2DEWX 2ZP0T 4AE1A 4JRYA 3FZUC 4LVHB 4Z7WE 2XV6B 1OB1A 3IFOB 2MKLC 3RVUC 1QLFA 6PAZA 2CDFB 1Q9LB 1TZHB 1NMCC 2BRQA 3IDGA 1TYRA 4ZTPH 1QUNB 2LE9A 4D9RE 3UC0L 3VA2C 3TBWB 3FSWA 4N2KA 4J4PC 5L0QB 1G7HA 1ZIBA 3CUPA 3MMEA 4B9FA 4UV7H 3QQ3B 4X98B 4OV5B 3LRLA 1S9YB 4Z95H 4M61B 1E28A 3PP3K 3C09C 4YGAB 4K8RL 5KSBA 3HBZA 2CDGA 4KY1H 3NJLA 4BFIA 3B7TA 2JKXA 3BVNB 4QHNA 1JYVA 2X7LA 4IU2A 1A6ZA 1IGYB 4OCXL 3A6CL 4YC2C 5A7BA 1F4WL 4JKWA 3EKCA 3E38A 4PIBA 2VIRA 4CN6A 4UQ2A 4RMVA 2BP8B 5DYOB 4HWZB 1OM3L 5ICYB 2EADA 5I5IA 2HVKA 2AVFA 3NRQA 1ZWIB 1C08B 1AMYA 1NEUA 3FRPB 3FTUA 3S37L 1D5ZB 2A9CA 4J3VA 1Y7VA 4S2SA 3Q3GB 4P2OB 4XPFL 3LMJH 1RJYB 1XF4B 4WCYL 5EEXA 2VC2B 5E1IA 3UZVA 4PJBB 4TNWF 4DGWC 2TSAA 3MLSH 4YWGL 1R5VA 3X3FL 4G6JH 1J5CA 2RTTA 4L5FH 4B9KC 3ZL2A 4I0KA 4RGNC 2QHLA 3IU4H 2VISA 3UIZA 5EC1A 4LRIA 2ZWKA 5CCHE 3CZLA 5DA4A 2BCKB 4FQXD 1HIML 1BGXL 4IMLA 4OIAA 3NCJL 1M3IA 5EF2A 5D71H 3P0GB 5C6TH 4KTGA 3RKPA 5HHPA 3AS2A 2EICA 1F4XH 4M48L 2YWZA 4PJIF 3UZQA 1EX0A 4A39A 1OPOA 3TYFB 3QG7L 2OMBA 3DV6A 4X4YA 5B3JF 1LO4L 1NFDF 1JZ2A 3N0PB 3RGVC 3CLEH 4PEEA 1EJOL 4W9GC 1INQB 1NDGA 3FHEA 5DMKB 5T1DL 1A9BA 2C9UA 3OG4B 4PJ7F 3W56A 3WHE0 3KBHE 4Y19E 4JAMA 3LEVL 2XACC 3SJVD 1IQDA 1EFQA 5F0MB 1LQBC 4Y4KD 3QPXH 4LCWE 5SWZD 4NQDA 3HEIB 2ZKXA 5IHZA 2XA8H 3D4YA 2PW1A 4NM8H 5K1JA 1RZGB 2VLRD 4JFTA 3ZHDA 12E8H 5ISZB 3MMEB 1CDBA 4G6MH 4RAUA 1XH3B 2PYED 2YAOA 2AXGA 4L9LA 3G5YA 1E28B 2J3SA 5IEKA 5LG1A 1KJ2H 2VDLB 35C8L 5FM5O 1G9MH 1IC4L 4XBGB 4X4MA 5CIPH 1MCFA 2NZ9D 2X4RB 4QOKA 3FSVA 2XZQH 2WQUA 4QHNB 3BD3A 5AB1A 3G08B 4CVUA 4F93B 4I85A 3TBVA 2CA3A 1RJZA 2VIRB 3DRQA 3W38A 5ANHA 2DQIL 3BT2H 1YCSA 3GDCA 3OKNB 4HCGA 1FNSL 3B6SA 3CX5K 3BN9D 4OF8A 1ZS8B 3OKYA 1E9OB 3DURA 4M7ZB 5E4EB 3U4BH 5D7LB 4PBXA 4CSSA 2YQ3A 4S2SB 3DOSA 2JLPA 1R5WA 4GAYB 2EXTA 2CLZA 5KSAB 4XNYH 3EO9H 2X4PB 1C5DB 5FO9A 2DWYA 3SB3A 1JXFA 1NBVL 4MJ5A 4OLZH 4NQEE 1Z0NA 4XO8A 4YDMA 3QZWB 2VISB 4GW4A 2A9MH 2ZOWA 4PD4K 4PRPB 3ENEA 4ZAKD 4CC4C 1ZOXA 3K2UL 2UY7B 3UBXI 4GAFB 3MA7B 2LHAA 1U36A 2AK4E 4EN3A 4YXLL 1KFAH 1S46A 2H8PB 5F3HB 1S78C 2DMCA 4KGJA 1QLRA 4O5LH 3SGKC 1N6QH 3LKSB 3IMUA 3PP3H 1KIQB 1EMTH 2XXFA 1TTUA 2I7SA 4HWEH 4FQLH 4E42B 5AAWA 4PRIB 4JFWA 1ZT1A 3M17A 1OXYA 4ONFH 4WRLA 1KN2H 1XD1A 3OR6A 4EUPG 4AJWA 3LIZA 4F7TB 2EDMA 2FE0A 4CMHB 2WLIB 3IXAB 2KKQA 4M1DL 2EUVA 1PY4A 1CQKA 1U6AL 2YMTA 4HSCX 4QO1B 2XFXA 5KYXA 3GJEB 4FE9A 3IMWA 1IGFH 5EU4B 2QELA 4WHCA 1B2YA 2CNYA 3OMNB 4P46D 3QJVB 2R69H 4XZUB 4P3WA 4RAUB 2DJSA 5ESVB 1ES0B 2X1XR 1GZQA 3G5WA 3K6FA 2KQNA 3VNZA 2AXGB 2YD7A 4ABUA 2LTQB 2EDJA 2R2HA 2WXKA 1DE4B 3E8VA 3QIBC 1DLHA 3TVMA 1MQKL 2Z0UA 4YH6A 4BWTA 2X88A 4NGHH 4OF6A 4MKTA 5DHVA 3FTYA 2ODHA 3HHSA 5TQ2H 2F5BL 4PD4J 3SBPA 3JXAA 2X12A 2Z9TA 1ODAA 4KK8C 3PWLB 3DOSB 2ZCKH 4YIQA 4NAQA 4OGQC 5LBSA 4HK3J 1TVDA 3H9SA 2MTAA 3NP4A 4BKLB 3GJFA 1NFAA 3QQNA 5E5RB 5HPMA 2X4OA 1P4UA 2VT0A 4ODSH 5F88B 3O8XC 3U6RA 5I1GH 1R34A 2V5MA 4Z7QB 1TSRA 1RZJC 1CFSB 5D1XD 2HPOA 2XVGA 2X70A 4I0PD 1KJMB 1L6XA 2RAMA 4ANVA 4GG6B 3QISA 4ZDHA 1JBJA 1LEIB 3T08A 3PXLA 5HYEA 3A4DA 2AQTA 3H2PA 4KDVA 5ALCL 2JMRA 2DQUH 3CVHA 2R29L 1HNGA 3KPPB 4X9GA 4WTZG 3TM6A 4K3HA 3ZX1A 1Q9OB 2YUWA 4EIZC 4LDCA 3N2JA 4PU2A 4WENB 3DDGA 1G1YA 3FPYA 4NNPL 2ADGB 4RFNC 1JGEA 2XFXB 5KYXB 2KPNA 3BYTA 3K4AA 1TO5A 3PQYB 4MXWL 1A25A 1LO2L 1IGIL 1QSED 2WANA 4PCSA 5EV7A 5C07A 3B34A 4WO4B 4Q58C 4A7UA 5K1NA 1ND0B 4Z5RA 3MLYH 4G6KL 3VFOB 2K7QA 1N9PA 4L8SC 2WW8A 4Y7OC 2JKRM 4LSUH 4Y1AD 3PREA 1HJCA 1RVFH 4YDKH 3PHOB 1U3YA 1XX9C 2LU3A 3STLA 3MLZH 4HKJB 4ZMLA 2PWEA 1HHJA 4KTEH 4NO5A 3NEOA 3B7RL 2GY7B 5CN2A 1BG1A 4UWQB 2WBXA 4DGIH 3ZDWA 4HETA 4OM0H 5LCVH 1BJMA 4IRZA 4DEWA 1CXEA 4XMUA 3U2SB 1NGQH 3EOAA 2YMXH 5DHMC 1VHPA 4ONOA 5CILL 3P9MB 4HWBA 2XY1A 3H9SB 4UT6A 2F18A 5AW5B 5GGSY 4LBAA 3HS8A 3VWJD 4Z8FL 4F7EA 3GUTB 2H2SC 5HPMB 3O4OB 1A7OL 1M9SA 1Q38A 1KCBA 1KEGL 1GKOA 3UTTD 2K6YA 2JJWA 1P84J 3ISWA 5F96L 5FYKL 3ET9F 4GS7B 1N8ZB 1XH1A 1NCIA 2XICA 4WUKL 1MLCA 1SDYA 1FL3A 3SY0A 4JHAL 4WUUA 3CSGA 4AITA 2JB6A 1TQWA 3DECA 4MMZB 4LIQL 2MWCA 2OLDA 4R8WL 3DSNB 4JFQA 2CJUH 2MQGA 3MX0A 4GH7B 4BH7B 3FB7A 3ZLQC 1FCCA 1UC6A 2AI0L 4KRNA 4PJDB 2V17L 3CFIC 3L9BA 1FO0A 1TYJA 2VLLA 4FFZH 4A2MA 3BUDA 4UOW0 1OGPA 2FRGP 4DP8X 1OB0A 3MI6A 2ADYA 4PJIA 2ZOLB 3HMXL 2H1LM 4BSWB 3CXHK 4XE0A 3RUGF 4I87A 1TITA 3QFGA 1NFDA 3LQZB 5CGYC 3WIFB 1R19A 4X9HA 4J23A 2FEEI 2XG5B 4ODHH 2JK5B 5D1QE 3WJLC 2VSMB 2W65A 1MI5D 4KDTA 3E8UH 4X6DF 2HFFB 2P5ED 4IDJH 2UUDK 4PJ7A 3HFML 4M56A 4WY7H 5C0CA 3QWQB 5A2AA 4M5ZL 3ARFC 1G7IB 4LCVA 2WTOA 4FXGC 3V0FA 1U8PB 2WTRA 5FYJU 1Z9NA 1AGDA 1WBYB 4MLSA 4R90H 2I9LB 5H8DA 3LKRB 1B2WH 2ENPA 4X8CA 4NBYB 2A6KB 4JHUA 3Q2LA 2V4LA 1CFMA 5BV7B 4J8QA 3EH1A 3GQFA 3PXJA 1NLDH 2IAND 3DA0A 2AV7A 1OAUH 4K5NA 2ZG2A 4OZFB 1LL1A 3MFFA 2DQDL 3MOBL 4OW6A 3UG4A 1LWRA 5DD5L 3WO3B 1BD2A 2OMZA 2KMWA 4OQTH 1J8HB 2O5XL 3QUYD 5CINL 2OYLA 3O2DA 4NX0A 4ODWB 4YSOA 3CC1A 1M71B 5E6ZA 2JJSC 2H26B 5T5FH 1GCYA 4ES9A 4J1UA 3BAWA 3FUKA 4UTCA 3CXHJ 5KS9F 2DQJL 3QCUL 4IGBD 1S7RA 1BXXA 5E1GA 5A2FA 4EVNA 1UQSA 2QQNH 3S6CA 3NK3A 4KK9D 1S7XA 2I7OA 2VXQH 4IJTA 4PJ9A 5GS0H 4G8GD 4KZEL 4XAKD 2NY0C 4HOWA 4LOUD 4KNSA 1A7PL 1CT8B 3L5HA 5IMOA 5C0ND 3DBSA 5ITFA 4L9DA 3AGVA 1YAZA 2DYPB 2EQDA 4GRMB 3HE7A 4H26B 3DIDA 2MRYA 1E6JL 2X2HA 3HPJB 3ZJAA 4NNXA 4Y8DC 2IBZX 5E1QA 4L4TB 3FO1A 2WQVA 3CD4A 2Q8AL 1JNJA 1BAFL 3CGTA 4JG1L 4CMMA 2W07A 3HN5A 4PJ7B 4APXB 1UWFA 1QPKA 1E4XL 2HX9A 3BYYA 5FCUL 2C3VA 5AZEL 5D2LF 3RG1C 5AYUH 5T33H 4PJCB 4TLSA 5F7DB 2J1XA 2WTRB 1NCWL 2CE6A 3BZDA 3AU1B 1WEJL 3FAWA 3IDYC 2Z91A 4N0YH 4Z77B 5BW7C 2YOAA 1B0WA 4NRZB 2PW2A 3GMMA 3EYUH 5DVLA 4MRBA 4KROB 2X9WA 1UM4L 3JWDH 1QFOA 1P5UC 3CFKB 3QP3A 1ZA3B 4BELD 4J2XA 1U42A 1MRCL 2A77L 3CH1A 2YBGA 1WD8A 4PJHF 1SXSA 2IPUK 2A7BA 4GUQA 3QIUC 4XNUL 1JZDC 3VXMD 3X11B 4XNQA 4IBWA 2J57A 3FCUB 4ELMF 1TZIB 1AD0B 4XXWA 4C57C 4XP4H 2NSQA 3LB6D 3ES6A 2JI1A 5CNHA 1KB9K 1YQVH 3VXRE 1ZRUA 3C87A 1NLBH 3L4VA 4JPIB 4N0RA 3U2IA 3LPPA 2VLKA 2X3CA 1TNMA 1WTGT 4Y4FC 5ACZA 3S4SB 2AEWA 2ZG1A 3AREC 1WTLA 3QCVH 3MJ8A 1VEMA 3Q2WA 4NRXA 2Z6FA 2UUDH 4TKWA 1OZTG 1PYWB 2X4UA 3DUSA 4J3OG 5TGBB 1MDTA 1M7IB 2RH0A 2ZSWB 3LJ3A 3VVVA 3CFNA 2R9HD 3KXFD 4PPTA 1S7VB 2DI8A 5IHLB 1JPFA 5HHOD 1AS6A 5GS2H 2AW2A 1JTPA 3WEXA 2GJ6B 2IWKA 5B4MD 1NBZB 3HE7B 1FPTH 1KLUB 1H6TA 4QRRB 4WK4B 1ZGLM 4ENED 2WMPA 5IB2B 3IXTB 3APCA 5IV2A 4TRPL 3MRPA 3S96A 5DK0A 4IOIB 1PIGA 2YGQA 2EYTB 1ZDQA 2HKHH 3QXUA 4J3WA 4JGJA 3IGFA 4OB5H 2WZPD 3ROLB 1MCQA 2FWOA 5AWNH 4KRPC 4NKIH 5INDA 2AFNA 2D7OA 2EO1A 4FFYA 4OU3A 5C08B 2W8CA 1WH0A 2Z91B 1XH0A 1JG9A 2GSMB 4ONGL 4YE4H 3HTLX 1R0AH 2J6EH 3T3PF 4OH2A 5JHDD 4C56A 3B37A 1IM3A 1KY6A 5MERB 5IW6B 1B88A 1SJEB 1KB9J 3T0VA 4ZRGA 2KT6A 4PBVC 4R0LC 3RBSA 5L8KB 2PXYC 4X50A 4GB9A 4E9LA 2D2OA 5SV4A 4Z7OF 5E1AB 4GUPB 1MUJA 2NW3B 3FCTA 1JGVL 4EOWL 2YLKA 3LZQA 4HUWA 4M7KH 1FNGA 3WO4C 1HKLH 2EC9U 3OZLA 2JTYA 1IKNA 3C6LC 3ES6B 4Y4HD 5CEXB 2H1PL 4EE2A 3PWPE 3QNFA 2FHFA 3KPNB 1WBZB 4MTMA 1BSIA 4N1CA 5HYQB 1U8QB 5C0GA 5D7LE 5IROC 3SDAC 4YVUA 3MNVA 4XR8C 2P52A 4N8VB 2AERT 2J1YA 1KCVH 1YMMD 4EI0A 4Q9RH 4XCFH 3PL6A 3GSXB 3II2A 2GJZA 4NN6B 1RHHA 3JWOL 3FO0H 2VRAA 1LVEA 3T0WA 3QJRB 4AW7A 3X17A 4KOCA 1CN4A 1IJ9A 1TXKA 3RZCB 1OP9A 4BQCA 3WFCL 4PRPE 2PCPB 4PP1C 1HZHL 1Z3GH 1U93B 1MRFH 2DLGA 2HKAA 1AOHA 2EIBA 2ZCHH 3B7YA 1MCDA 3IAQA 4WWKD 4OFYA 4BQ9A 3RYMA 2YO3A 4U31A 3OV6A 1MCCA 2HRHA 5IV2B 5J5EA 1IEBB 4WI0A 1MAMH 4H1LH 4U7KA 1D6VL 5CUSH 3D7PA 3QE5A 2ZICA 3LEYL 4WW2C 3BZFA 3U48A 3AC0A 4M1GL 4KUZL 4QEGA 4X7SH 1OWRM 4MXVF 1G5GA 1DR9A 2G2RA 3UAEA 2WP3O 2DB8A 4WI7A 3RUGA 4AYBA 2WWOA 2GUYA 1BCIA 3UJJH 4X7FC 5EIVA 5F89A 1WD9A 4IU3A 1SN2A 4X6DA 3UXFA 2RHEA 1PU0A 4ZX3A 4PJXF 3Q2CA 3GSUA 2CR0A 3LH9A 2AXJA 4NO0A 5FA3B 5HHNB 1RERA 3UO1H 1AJ7H 1F90H 2DN7A 4WAFA 5C97A 1MNUL 4PRDB 4YHKH 3B2XA 4HC1L 2FJGA 4R7VA 4AWJC 1YLBB 3L5XH 2Q3XA 1IC7L 2D7TL 1KB5A 3DVGB 4NFDA 5C0GB 1KZYA 1Y6MR 3LS5H 3C8KB 5LN8A 3QDGA 5D7JA 4AYSA 5DJ0B 1YDPA 5SWSB 3SO5A 4MKMA 4HIIA 4MQXD 2H45A 2Y5TB 5EBWB 1CGVA 2NY5C 1RHHB 3B8YA 3HC3H 4MNQB 3I6KA 4XN9A 3H9ZA 4KI5D 5KVMC 2GBAA 5DZ9A 4AGLA 2E7MA 3APDA 4N8PA 1N0XL 1EJ8A 3UTZB 2ITCA 3EADA 4NAMA 1WC7A 4O5LL 4PS4L 7FABL 5HVHB 3BWAA 3HC0B 5DYFA 4RGOL 3QEQB 4HAKA 2VKWA 2ZCLL 1KJ2A 2WUCL 3O4LA 1MHCA 5KS9A 1CZ8H 3D0LB 3WIHA 3KDMA 3HG1E 3DRTB 1FYHB 1HHIA 2Y24A 3RP1A 3V9CA 3KPQB 5AZ2L 1JF5A 3MLWH 1B0GA 3B1UA 4FI6A 4P3DB 1TPXC 3MRBA 1SY6H 4JANB 4RQQA 1MFCL 4FI7A 2VCOA 1GZHC 1TQCB 3WYRA 5ECGA 1KENH 5ALBL 3GMQA 1NM9A 4FQXC 4UILL 3FBQA 1RHFA 1CCZA 4WI3A 2BSDA 1TNNA 1FAIH 5LGJA 1SZNA 1JTOA 3PQYE 3WMQA 1MFEL 4GG8A 5FF6A 4RAHA 3LV3A 3UL4A 1W0VA 5D2LA 4L29A 1W91A 4X6EB 3CFCL 5DUPH 2JH2A 4CC1A 2OYMA 1ADQL 3NFPA 4JEGB 4P48A 5FUZH 4AE0A 1OW0C 1QI3A 2DRUA 2YD6A 1RI8A 1NC4A 4K73A 1MPAL 1CFNA 2ESVB 4FABL 1PZ5B 3TEZA 2A1WL 1KT2A 2VR7A 4YN3A 1M53A 2LW3A 5IB1B 5J1AB 4Y4KC 3QG6A 4IBUA 2F5AL 2Q8BL 3ORJA 4JR9L 4PJHA 2Z93B 2ORBL 1N64H 4U0RB 5IW1B 5FUOH 2Y4SA 5JHLL 5A6LA 1VFBB 5IMLA 3QQDB 4I18B 1NKRA 4JKLA 4ORZC 3Q9QA 4ELMA 1RZJH 3GBLA 2NZ9C 3IJSA 4KKQA 4IKKA 4JPWL 4AVIA 4F5CA 4KZCA 5GGTH 4RMQA 3FMGH 5EN2A 4A6YL 4BV1A 2R8SL 3BDYL 1NPJA 2R69A 4CVWA 5FGCE 1BQHG 1JI2A 5JPNC 2XN9B 1A3QA 1KGWA 5BZWB 3BGFB 3WUWB 3ABKB 3BN9C 3UBXA 3O4LB 2JKIS 1JD9A 1A7RH 1UXWA 2D73A 3LS4L 1RZ8B 2GYSA 5CIPB 5EOQH 1PZBA 4KC3B 2ZF8A 3MROA 4NQUA 4YBQD 1Y1UA 4LKCB 1WP6A 4XVJL 5FYLD 5T5NG 1D5BB 2VN5A 3L3IB 2J12B 1FFOA 5EU3A 4FNPA 3RNQA 3RWHA 2OK0L 2Y0SA 3ARBA 3TV3H 3FF7A 3K2MC 1NAMH 2PO6D 3GSRA 4PJDE 4ZPVB 3D34A 3L95A 3CHSA 3QI9A 4U3SA 2BWDA 3U25A 3QO1A 2NY7H 4TPRH 5D93C 5DEJA 4DKEL 3KLAA 3OLEA 2BFVH 3QFJB 1NSNL 4MAUL 1RIHL 4WWID 5L2KB 2OAAA 4ZAKC 4G3YH 5C7XL 4C4KO 1UCBL 3RX7A 1H9VA 3I3EA 1E5YA 2X53A 1UKQA 1U8MA 4NUGH 1JHTA 2CUAA 1QWNA 4PN6A 2K3TA 1TIUA 4WSJA 3GSVA 3NFNA 5EFIA 1DO5A 2C4XA 1N4XH 1J9RA 1DUZA 3NSYA 3KL5A 5F9WC 1IEHA 4IBYA 3S7GA 2C1OB 1Z0MA 2VXVH 1XIWB 4Z9KB 5AALA 1NC4B 5CCJA 1X6LA 1BA9A 3IWUA 2UX6A 3F8UB 2P45B 4MJIA 3VU1A 3V8CA 1EHLL 3KEHA 3LSOB 4JFOB 2A2QT 4DSYA 1IGMH 4AV5A 5DLMH 2ATKB 1IAII 4LEXH 1CDGA 3VA6A 4Z1PA 1N8OE 2CR6A 4P46C 4CN1A 1DQQB 2Y72A 2XPZA 1P7BA 1WHPA 3PNWA 4PV1C 1ETB1 3HRPA 1HAWA 2CLVA 2XWZA 2D3LA 1JF1A 1JZJA 1UACL 3VD7A 3HS0A 1VF5C 3CMOH 4DOHB 1AKJB 1X5XA 3IJSB 5E03A 5FV2A 1Q72L 2NY1B 3LRKA 4G7VH 4JVPA 3P2BA 4ORGA 1J8HE 1X4ZA 3CZEA 1NGXA 2VL5B 3P4OA 4YHOL 4ANUA 1TLMA 4CN4A 5J6GA 2ATPB 3WHXA 1F58L 2FLMA 4FQ2L 1EZUA 1JZ8A 3TURA 4UOJA 2Q6WB 1C5BL 3ABLB 3BQUB 1NEZG 2A6JB 2FQGA 4LRNH 3HZMA 4EEEA 4PV9B 2X3BA 1D2OA 1MHEA 4FLQA 3H54A 2N7AA 1S8DA 3E2HC 1FZMB 3THMH 1ZE3C 3GSOB 4F3FA 3RWGA 4L23A 3LN9A 1PJ9A 5LCVA 4AVJA 1PAZA 5D1XC 1ZK5A 2ZPKH 1J88A 5TDNA 3K6SB 3QWNA 4I0PC 4HH8A 4JO2L 4Y19D 4L4TE 1PQZA 4WHYH 5GRVK 1QVOA 1IT9H 1PL3A 3RPIA 1BZEA 1NCAL 2LV4A 4HV8B 2CNZA 3DX7A 5KVDH 1AXTH 3QARA 1CVSC 1I8KA 1I8LC 4OGYL 2WXRA 2E7LC 3B56A 2DM4A 1MCLA 2WQAA 4L37A 4LLUA 3AS1A 3NN8B 2K6WA 4PJCE 4FL4C 3S3PA 3VRLE 5KAQG 4CDGC