1E5BA

Internal xylan binding domain from c. fimi xyn10a, r262g mutant
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
87
structure length
87
Chain Sequence
TGCSVTATRAEEWSDGFNVTYSVSGSSAWTVNLALNGSQTIQASWNANVTGSGSTRTVTPNGSGNTFGVTVMKNGSSTTPAATCAGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords XYLANASE D
publication title The Structural Basis for the Ligand Specificity of Family 2 Carbohydrate Binding Nodules
pubmed doi rcsb
source organism Cellulomonas fimi
total genus 8
structure length 87
sequence length 87
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e5bA00
1E5CA 5DHEA 1EXGA 3NDYE 2RTTA 1QBBA 2CZNA 1QBAA 1E5BA 2XBDA 1HEHC 5DHDA 1EXHA 3NDZE 1C7SA 2CWRA 1XBDA 1C7TA 1HEJC
chains in the Genus database with same CATH superfamily
1MJ8L 3WTSA 1S5HB 5C2UB 1W0WA 3UTZA 3OSKA 25C8L 4DIXA 2Q5BA 2R9HD 3V8OA 1N4XH 4MX7B 4XMWA 1EBAA 4CVWA 5HGHB 4XXCC 4TVPE 2B15A 5EPMB 5CAYB 1SJMA 3NTCL 1OAUH 2EC9T 1TUPA 4UT9A 5AWNL 1AIFB 3WTUA 2BFVH 2RB8A 2EYRB 1IVLA 5DO2C 1I9JH 2WQVA 3HKZA 2OBGA 4POYA 3C09C 4QWWC 2HFEA 3FFDA 3MRQB 5JXEC 4ENED 3AQXA 1MCHA 4RSYA 4LSTH 3D39D 3T6ZA 2WP3T 3WNOA 4XXDB 5E6SB 3FB7A 2ATPB 2WYHA 4YIQB 4BHUI 5HYSB 5CKAA 3V4VL 4L37A 3O9WB 3RJOA 3PIQB 4YDJB 3S3CB 2H3NB 1ZLUH 2F53B 2KLRA 4HZLB 5DJAB 2I9TB 4DTGH 4O02A 3AACA 1PFCA 1IL1B 2X1PA 4GRMA 1YEFH 3MREA 5AL0A 3AS1A 1PW3A 3KLQA 2D9CA 1KTDB 4H1LG 3RGHA 1FVCB 1D5BA 1RZGA 1BREA 2ICWJ 3GK8H 4G42B 3VXSE 5CEXA 4JO5A 2DPKA 4JFQA 3U9PL 1E9OB 3P11H 4ODSL 4JZJB 3VXME 2G3ZA 2OK0H 3VWJC 3V95A 1AZVA 1YYMH 3MRDA 3ULVC 2WO4A 3CVIH 1O7DE 5T1KD 3CV5A 2C3VA 1NIDA 5IKCA 1K5NA 3H7LA 4PTTB 1KIRB 4G8FA 4HCGA 4RGMC 3RB7A 3VFWB 4WVRA 3IXAB 2F0CA 5AG8A 2WWMC 2NY4B 2CO6B 3KNBA 4JHAH 4NRYB 3WUWG 5TH2A 4EZKA 5EO0A 4AT6A 4PB0L 1WS8A 2NX5A 4WK0B 3II2A 4J3OC 4B97A 3VD4A 4ODHL 3RE0A 3PJNA 2K7QA 2J1XA 2R59A 4JFEE 1B6UA 2XV6B 4LVHB 4Y4KD 3OKYA 4IIQA 5ALBH 1FL3A 4NKDA 3S4SG 4G8AC 3EJZD 4MYWB 4JFFB 3RWGA 5HHVL 4F9LA 3C5ZD 5DJZA 3MROB 2MCMA 5IFAL 3HZVB 3V0WL 2ESVE 4Z3TA 2BVPB 5EZLB 4RMRA 2V2TA 3L17A 4H8WC 3WHXA 1NCAH 5MERA 2WGNB 4YHPA 1A9EB 1KXHA 3T2OA 5E6ID 5BV7H 3WTTA 4XT1C 4Y4KA 3VRJA 3HG5A 5BRPA 2R83A 4G5ZL 4XI5C 2BSRA 3CC5A 2Q1EA 1XGYL 3MCLH 2G0KA 4OFVA 1HFUA 5HGBB 4XZ4A 4TL4A 2EDTA 3L3JB 9CGTA 2VDRH 5HVFB 4PRAB 4XODA 2WQ8A 4QHNB 4WJG3 2BCKB 1I7TA 2YC1B 1H3WM 2R69H 1OGTA 1UADC 5F7LB 4RIRA 4LLVB 3PHQA 2H1LM 2CDGA 5EF2A 1KLFA 4AMXA 1JDDA 1TEFA 3PWNB 3MV8E 2X2JA 3APDA 3GBNL 1JCKA 4R5TA 1NC4B 2NDGA 4X7CC 3V4VH 4PJHA 4ZAKB 1FGNL 2VUKA 3UDWA 5J12C 1HXKA 1J1PH 1G5AA 1SOSA 3ARDC 5EEYA 1BEYL 2FJFB 1EUUA 4HWBL 5JIIA 2G9KA 3H3PH 2IAND 3V5DA 1J1OL 3EG9B 5D7JA 2E9JA 3O3AB 5ESVA 2P43B 1YYLL 4MD4A 3FJTA 3ZT6A 2PUQT 4PRIA 4GKSB 3HUJF 1SN2A 1CE6B 4EI5B 4PJ5E 1IARB 3U1PA 3ZTDC 2V2WA 4HUXB 5DMYA 1XGRA 3FW6A 4ODWB 3QXAA 5IT2H 2DN7A 4AGPA 4EUPH 3M8OL 5E1HB 2IANA 3VI4F 3OPZH 1A4KA 1YSOA 4N8VA 3N6YA 1P53A 3LJ3A 3IGUA 3PGDA 4IBTA 4TULH 3DNKA 4ODSH 2Z6FA 1DQQA 3QCVL 4ODTL 5D4IA 5ERWB 4JFXB 5IQMA 3HZYB 1C16A 1ORQA 3GRWL 3NESA 3LS4L 1U6AH 3VFTB 2R29A 3P40A 2OXHA 1LEGA 1MJ7L 3MBXL 3B2DC 1HI6B 3UJIL 1ACZA 1MNNA 2VKWA 4JG1L 5LAXB 4PRNA 3B37A 2F7PA 1HC1A 1JDCA 5KYUB 3W9EB 5IBLC 4XP6L 4YZWA 1F18A 1R5VA 2E9WA 2X4SA 5EOQL 1T4KB 5CN3A 5CLTA 2JJUA 5AD0B 5IEKA 2IWFA 3BPOB 1QFOA 3EXJA 2BNQB 1A65A 2E27H 3ZE2B 4G8EB 1AXSB 1T21B 3FAXA 3I2CH 4OAWA 5ADPL 3RWFA 4NSKB 5D2NA 4Y9GA 3MFFB 3S35H 2XWZA 2JQAA 3WEBA 1OW0C 4P49A 2Q3ZA 1BVKB 1M7XA 1ZHNA 1JYWA 3HBQA 5FXCH 4Z7QB 2R2BB 4DK3A 7FABH 3LMJH 1P9MC 4HFWB 1OF2A 2ORBL 4ZOAA 1B0IA 3NABL 4LE8A 5DC9B 3MI6A 1FNLA 2ZOWA 2QSTA 2VLME 4IBQA 5EF3A 4ANUA 3GMLB 2J5LC 3ZL2A 3MRIA 4JKKA 3GI9L 1ZS8B 1HYSC 5D7IF 3CTTA 4WU7B 4Z77B 4B6ZA 4FYQA 4MJ4A 2BZ7A 3QIBD 4XCCH 3ZMEA 1HILA 1E5UI 4BWWA 4XTRD 3T3ME 3D0AA 4LEXL 3T0VA 1T1WA 1FN4B 2BRRL 3EDEA 1T5XB 1ZLWH 3HC4L 1A2YA 1CK0H 2YXWA 3KBPA 1RVFL 4RFOL 5I30H 4K9JA 3QPQD 4QRUA 3T4AC 3FB5A 1U8CA 5ELIA 1EVTC 2EABA 4Z8FL 1U8LA 1NCWL 2WCSA 3QIBA 1YN7B 1RU9H 1G7HA 2DJMA 3AFLA 3IPEA 1LWJA 2MWCA 1M2VA 1ACYH 4J28A 4FFZH 2QHRH 1E8YA 4PJDB 2VIRB 4JMNA 2BJML 1P6FA 4XR8C 3F7LA 3SIKA 2DDQL 2CHWA 3HFML 4CVXA 4JB9H 3M8OH 2Z8SA 5FO8B 3I6LE 1NFDB 3HG0A 2CKBH 3S97C 4I2XE 1AHMA 3B9DA 1HOEA 1XF3A 4G43B 5D5MB 4QF1A 4HPYH 2WTRA 4PRHE 5FUOL 4WIQA 1W8NA 5GJSL 3LN4B 5JO5B 2C9QA 1T7WA 5DUBB 3UTTB 1TQSA 2Z65C 3LS4H 5IR1B 1WGVA 5C0NC 3LH2H 4MA7L 5IQLA 2EEDA 3D85D 3SDDC 1U8MB 2GJ6E 3UBGA 3UJIH 3QRLA 2BDNL 1U30A 4XPGL 1K8DA 4ZTEA 3RWIA 1O9ZA 1I3GH 1JWUB 3OMAB 2W88A 1FC2D 4XP6H 2Q87A 4JPQA 4NB7A 5EOQH 2BH0A 2SODB 4DETA 4EMZA 3L3DB 3QR0A 4O5LL 1TZOA 4IGBA 4WTXA 4P3WA 1G1CA 1HYRC 3MO1B 4GEJA 5CBAA 3QDMB 5JZ7C 5LG6A 4LOEA 3UGXA 1X5YA 1MIEH 4EIZC 2XNAA 1WWAX 3VH8B 4QCIA 3WS3A 3UZEA 4AQAB 3ARRA 1NKRA 3NP3A 1JGEB 4LGRB 3L3OA 3LYRA 3BN3B 3V0VA 4IRZA 5F7DA 2NY5L 1GGIH 5DLLA 5ILTL 3GGWB 4XN4A 4PVLA 4RZCA 2IWGA 2BY1A 1IM3D 1WA2X 3CMGA 2XTSA 1PY9A 4EXKA 2BSDA 3IJYA 1W9XA 5DC0A 5T1DL 3WEMA 1FFOA 1NGWB 2E9IA 1AQHA 4RMWA 3HVDA 1MIML 3QJQB 4RAUA 3I50L 5E9AA 2H32A 1IM3A 4K5LA 4CSPA 3KGSA 3QIUB 5IBUG 4LPXA 2Q8AH 5IW6A 3LKOA 2MJWA 1YJDC 3CFDA 2CLRB 5BQ7B 4DOHB 2YD2A 5B8CB 4MLSA 1JRHI 2P5PA 1F45A 3TO2A 3T6XA 3HC2A 2WOBA 2W0FA 3SE3C 4ZYKB 3U9WA 3VE0A 4HU8A 1WZLA 2ALAA 5CLWA 2YPVA 3IXTB 2EKSA 4GBXD 4WDIA 4YDLC 1I1FB 1MW2A 4IU2A 2OMUA 4KZEH 5JLZB 1SYSA 1AYRA 2OMWA 3G6AB 3VTMA 1BF8A 3IVKB 4TUJB 4NO3B 3OR6B 2JKWA 3KYMB 3DVNB 5DWPA 5HDLA 1T7ZA 3VFGH 4P2YA 1INQA 4B5EA 4JFVA 3ZYZA 4X9YA 3DRQA 1NLDL 5DQJB 1PAMA 3M1CA 3P69A 2XIIA 5EIIA 1HX0A 3W1ZA 3DSFH 2VJ0A 1XCTB 1W15A 2HRPL 3OGOE 4KROC 5F0LB 2EICA 4U0RC 5KOVC 43CAA 1QLEL 3B2XA 2GC7C 2X1WL 2FGZA 4TNGA 3TBTA 5F88B 4JW3A 2JMRA 1ZRUA 2AXFA 4KGLA 4HXAL 2FJHB 4NC1E 4NKIH 5I6XB 3WGVB 3EYFA 2FBRA 1AI1L 2VDML 2XRAL 5CD3A 2HLAA 2J6EA 1KZQA 2W95A 1IO4C 3V6OC 1C08A 5D7EA 1MDAA 2H0PA 1HWGB 5KSAD 1WC7B 3TBWB 2ZXQA 5CP3H 1WBXA 3RL1B 3GJFB 3RY4A 1U42A 4FQIL 4I9WE 1QFUL 1YDPB 4XVUC 3LNGA 5F9DC 1JI1A 3EHBC 4AMKL 1EA9C 1QO3B 3REWB 4ZMZA 4UT9L 4MJ6A 1ROCA 4X4MA 1J11A 2AJSH 2HN7A 1I9RL 2MHAA 3ESOA 4N2OA 4EKXA 4P59H 4ACTA 1SEBB 2ZTBA 3GXPA 2VSMB 1LO0L 2AANA 5C0AE 5ILTH 4Q9CA 3JXAA 4C57C 3UCRA 3BUYA 5B1CA 1I75A 1V55B 5EU5A 5DJ6B 1X3DA 1PZDA 4FQCL 1TKWA 4FTDA 2BNRD 4URTB 2GBAA 2DQDL 2ZUWA 1U33A 3CBKB 4OGYL 4P23B 3TBSB 1BD2E 4RQQB 4XE5B 3EJYD 4O02L 3DX9A 2G60L 5KJ4A 4QHLB 3E8UL 5DHDA 3FT3A 4AZ8A 4XH2B 5DSCA 2JJTC 4RDQG 3ZDZF 2WIMA 5HI4C 1JFQH 1GL4B 2YAPA 1CXFA 3BO8B 4R7NA 1DP0A 1JPSL 2EVFA 3BP5B 4NUMA 1WBZA 2JJSC 4B9KC 1OGAE 4KRPD 2L0DA 4B53A 2OW6A 3CSYB 3QI9C 5TE6L 1BYOA 2K4AA 3ARED 5AAPA 4I1NB 3BH9B 4Q0XH 3NEEA 4F57L 4XBEL 3V0HA 3RBGA 1I7RB 5H94A 1W8EA 1E6OL 1DL7H 1HHKA 4Y4HB 2XFGB 3U36A 4KHTL 3FRPA 4IOSD 4TL5A 5HI3D 5A2AA 2GBUA 4FA7B 2D3LA 2WNKA 3OKMA 3QUGA 1GJIA 1MCIA 1T0NA 4H20L 3COOA 3KPMA 3MJ8B 3MUJA 3PL6C 4QRAA 4A2DA 4YAQB 1M53A 2A1WH 4JRXE 3RVXD 3CU7A 1KY6A 4AENB 1EDYA 4GAYB 2DRUA 3N2JA 4HKZB 2HRPH 3A23A 4QHKJ 5I16B 1K4DB 2H6UA 2P8PA 2ZWYA 5L9DH 3V0GA 1JGLL 4ZFFA 4UNUA 4NO0D 3VXNA 1F4WL 3NGBC 5DZVA 3EDDA 3K46A 4OZGA 4Y4FB 4Z3GA 3KLLA 5J9PA 5EN3A 5JQ6L 4HXAH 3FHQA 2VAAB 3H0TA 3OR7A 5I0ZA 2BOCB 4AE0A 4JJ5B 1AI1H 3FOMB 3GTNA 3SSGA 4ZXBA 5F3HA 1IAKA 1D5MB 1T66D 4LCVA 3UBXI 2BM3A 1QSEE 4F2ME 3M17A 5D7LD 4NO0A 5IROD 4FKEA 1JZ8A 3ZRCC 1RZKH 3FB8A 1QFUH 1DLHA 4Y9EA 4WI6A 2G2NA 1DANU 3UAJC 5DK2B 4GXUM 3ABLB 2O72A 5BOZG 1NLBL 4UT9H 4JRYE 4CADB 2NCEA 1CBVH 3G7TA 2J71A 2XPGA 4E2OA 3U83A 1OCWL 4KGJA 2XT1B 4NM4H 1S78D 1T83A 1RUKL 2MRYA 5CHNA 5C0GB 4RMQA 3OAWA 4YN3A 5FWQA 3IJ7A 4J12A 3L3IA 2J57A 3S37L 3FUKA 2VDNL 5GRZA 2CPUA 1CPUA 4FJ6A 2FWUA 3HBPA 4M1GL 1J48A 3S8WA 4DN4L 4I4WB 1FFTB 4Y19D 5AW2B 4PJ9A 2DQDH 5GRVK 1NGPL 2X4PA 5D2LA 4QHKI 1QHQA 4MNHA 5C09B 3STLB 1IU1A 3UJTH 1QR1A 4J3TA 1ZXKA 4KX8A 1H3UA 3TJEL 5K9OA 1AS6A 1N2RA 4X5WA 1QX1A 1F3DJ 4FQXA 4P2RD 3WO4B 5DJDA 4WNQA 1ZVYA 1D5ZB 1E67A 1T7YA 2K0RA 3HUJB 3MNWA 5DI8A 3U48A 4CL7A 1MH5B 1BFVH 2D73A 3ZUNC 1N64H 1PX4A 3EO0B 2OZ4A 1RERA 5AVRB 3SOBL 1JPSH 1K8IA 3GRGA 1ESOA 1BPLB 1TFPA 3K4DA 3L9YA 3OZ9L 2CGRL 3F65A 1B0GA 5E5MB 4P2RA 3HS9A 3ECBA 1RLWA 1QMUA 3DSNB 4L8SA 4CDGC 1I8MB 1FJ1A 3HB3D 5EBGA 4RGND 4P57A 2HT4D 1LHZA 2DBJA 1LYQA 1GZHC 2R29L 2E8ZA 4MXVE 2FEDD 4QTHA 4LAQH 5EF0A 5F7HA 1HK6A 4KHTH 3UROR 4U1GB 4FI6A 5LDSA 2NNRA 5F1OB 4MMXC 1B0WA 4LKCA 3ZSTA 3AY4A 1PYWA 2R4SL 1D5IL 1CN4A 2CNYA 4IRJC 5BPPA 3VDBA 4JY6A 1MFBL 2OM5A 3CHSA 1X4XA 4J6RH 5J6GA 1FO0A 1M71A 4LLQA 3TA3B 4TN9A 4DK6A 2D31A 4YFEA 4X0KB 3KLSA 4XB7A 3T0EC 1UXLA 4P9HC 4WW2C 4K7PH 3FYIB 4AK2A 1TJGL 1OOAA 3KPLA 5D1ZI 5JQ6H 3KWWA 1B0RB 1NL0L 3FK3A 3IFLL 4HLZG 4QTIL 1VENA 2VXSL 4Y1AE 1UM5L 3E9TA 3DKHA 1SVCP 1ID5I 3APMA 1TOXA 2K4WA 4ZTPL 4ES8A 2BWIA 2DWXA 3H9HA 1CBJA 3FZUD 3MYZA 3WJMA 5EEZA 4NIKB 3MLRL 4AYBA 3LKQA 1M4KA 2XN9B 4XNYH 2K3HA 2DMHA 3PV6B 4O2FA 1YPZA 5GZNA 2DJ4A 4ZNCD 1U21A 2WXLA 3OJVC 3K2UH 3D25B 3BD3A 4J3XA 5DMKB 4WFHE 4APQC 2P45B 1USQA 9PCYA 1BM3H 3U9UB 1KENL 1PJ9A 4GS7C 1UG9A 5E8OA 4KZ0A 5D7IB 1UACL 4RFEA 1ILUA 5F3BB 2A4EA 1U92B 3FQ4A 3P30L 4MMZA 1ZIAA 2X89A 3QQ4A 3MXVL 3HZMA 2X6BA 5DZLA 4LOFA 3KM2A 1MREH 4UV7L 2VL5B 4K15A 5IFHL 4HLEA 1JWSB 1JRHH 2R1XA 3HMXH 3PREA 4NZUL 1ZOXA 2Y7OA 3L9RB 3TM6A 3WGUB 2CLVA 2A2QT 4Z7OF 2B20A 4YSSA 1JHKL 3CPLB 3ES6A 4NQDE 3O4LD 4YSRA 3KM1A 2EEXA 4LLUB 3P3UA 3JWDC 1TVBA 1TO4A 4PP1C 4Q9BA 3ZOAA 1J0KA 4PRPA 1TCMA 1KTRL 3OZ9H 4KI5D 4U7SA 4S1SH 4ADGA 4EI6B 3UBXB 2YQ3A 2X4OA 1R47A 3BZDA 3KWXA 4H8QA 3QDJA 3LZFL 5I1IL 3NSCA 1JV5A 4G6FB 4A37A 5JW5B 3O4LA 1F41A 2J2ZB 4ESKA 3ECQA 3UZVB 2CZNA 4Z95L 2G4GA 1MHEB 1KCUL 1OP4A 4I89A 2R29H 1WZ1L 3HR5B 3IRCA 3D09A 4F7PB 5IMMA 1A22B 1T6VN 1EFXB 4IU3B 3GSNB 4JY4B 1KFAH 5A2LH 3RVTD 2LTQC 2BLFA 1IC4H 4IRSD 4ZBJA 1T5WB 1QLFA 4JFTA 3TURA 1NANI 2YMXL 3T09A 2QQQA 1MFBH 3TCTA 5DQDL 4HA1A 1EJ6A 1QHPA 1CG9A 2K6YA 2EAEA 4N90D 3ZW3A 4JFOB 3OKNA 5L2JB 5E8NB 3MBWA 2CBMA 1M05B 5GS0C 5SWQA 4YWGL 1RJCA 1H0DB 2BXYA 5CFAA 4CSZA 2D7MA 4UILL 2XG4B 3MRBA 3VGDA 1G9NL 2GT9B 3IFLH 3K6DA 4GB9A 4HJTA 5IWLA 2P8MB 2DBLH 3IDGA 3QORC 4G5AA 4JQXC 1U2YA 1PKQA 1HCVA 1PNCA 4IRZL 3NG5A 2UY6A 3PWLB 2CDEB 2NOYA 2W59A 5ICYA 5KAQG 1IIIA 1DVFD 4HOZA 1CE1L 4MDJB 4MAYB 5CSZB 4AM0B 4L5FL 4X98A 4EKJA 4Y89A 3L48A 1I9IL 3PXLA 4YPJA 5TGBB 2EIBA 5HYFA 4I18A 3ARVA 3V0IA 3HN3A 1XGTA 5BS0B 3G5YA 3UL4A 4JFHD 4QOKE 4GAFB 4X6DA 1KBKA 1KENH 2X6CA 3IRPX 3BP4B 4NQED 5DURD 1YEHL 1JXGA 2CBQA 4NM8H 3ZTEA 1LK3H 3U0PA 3BEWB 2ZSVB 3TYFB 1GCYA 1TVHA 4OD2A 1SBSL 1AD0A 1DJZA 4BJLA 2H6PA 1NCDL 2VDLB 3L13A 3ZTJH 2B4CH 1M1XA 2YPVL 3IDYC 4XPAL 3ZLQC 5IFHH 2WV3A 5BRZE 1QBMH 2GY5A 4U4BA 4IK7A 1JV2B 1J0JA 4FFVD 1OWWA 4YSOA 4ZW6A 1ITCA 1QNIA 2ITDA 4KXZH 1JD9A 1DCEA 3QO1B 4DEWA 4TLSA 3NCJH 2XPZA 5D1ZB 3QDGE 4HV8B 1W72A 5FYLD 5EUOF 1EEYA 1SJEA 3BPLB 1S5IL 1T0MA 4BFOA 5C0EA 2OPCA 3V9EA 5A3ID 3S0PA 4KK8C 3ZO0A 1M6UA 3CVHH 3LNEA 4I48A 3LKPA 3DDGA 3TEXA 2H8PB 4LOVA 1JVKA 3UG3A 3MLSH 4YZFE 4ZPVA 5CCJA 3FQNA 1HEZA 2PXYC 4OUUB 4M5ZH 3SBRA 2OMYB 3LY6A 1VGEL 4GW4B 4LK4A 5CSGA 2JKJA 3DVGB 2FHBA 2P80D 4MJID 4Q6YA 4A6YB 1RJLA 3GPEA 2QJDA 4XB3A 5IB4A 3QUKA 3P4MA 3WMSA 3MBEB 3RQ3A 4BQCA 5C7ZA 5DJ0A 3AQYA 2Y6SD 4TVUA 1BQ5A 2J6EL 4U2ZA 2Y7NA 2DD8L 5C0IB 3ZE2E 2JELL 3SPCA 1I8LC 2C5DC 2DQEL 2OTUA 2LR4A 2UYLA 4JM2D 3UYRH 5I9QC 1ZPLA 4GRLC 3BAEL 3FQRA 4ZUVB 5IW1B 1UWXK 2OYPA 5ICXB 3LXUX 1XH3B 3SD2A 1G9NH 3A4DA 4HWUA 1WAAA 4PRBB 2X70B 4Z7QE 3FBQA 5K5YA 3FMGL 1HT6A 3I3DA 2BY2A 3ZL1A 2YUVA 3JZYA 1LO4L 1VIWA 4PJ8A 4RESB 2MH4A 2DWEB 1GAFH 3T1FB 3DX7B 2HKAA 2J73A 3PQYB 4PJBA 3FB6A 4AYID 3LXCA 2N4IA 4JPKH 1JJUA 2NXYD 3ASNB 2UZYA 3K8LA 2B1HL 5DWUH 3SGEI 1YEIL 3FO1B 3ASOB 4JFDD 2H32H 4U3HA 3KWUA 4EN3C 3RVVC 3B9KD 3SY0B 3GMMB 1HQ4A 3WHE0 3ZDZB 1PLGH 2ZKMX 1VFBA 3MJ7A 3UG4A 4MDIA 4NNXB 4FNTA 1G7JB 3W11D 2FUTA 4F8PA 4BM7A 5FR3A 3VRLF 2AK1H 1JOIA 3UG5A 7TAAA 1YEKL 1KCWA 3TOPA 3NCWA 5L8KB 1PY4A 2YPVH 3FQWA 3P0YH 5BO0D 2YWYA 3W39A 2VOTA 3V79C 1ZLDA 4Y16B 4XOBA 5C9JB 1MW3A 3KGUA 3CX2A 4Q2ZA 5INDA 1FNAA 1CTOA 1IGIH 3KL5A 4P3DB 4AKQA 4ALAC 3WNKA 3MOAH 5FLUA 2NY0D 1EZVX 2EUWA 1CS6A 1S7QB 1URLA 3OZKA 4JHUA 5ABZA 2IADA 3ZX1A 4DKAA 1T89A 1FL5A 1NFDE 1BEXA 3OKOB 1AE6H 2QGDA 1T1YA 4WUUB 2DAVA 3QG6A 3QEQB 4LCCC 3RJQB 5AKSA 4X9IA 5CEYB 3GHPA 2Y7QA 2ZT9C 1U8OA 2ZOLA 1F6LL 1F56A 3VXTA 4OLUL 2Y25A 1S7VA 2GW5A 4NT6A 2VLRA 3SBPA 3CQFA 2EDOA 2XZCH 2OP4H 1ZGLP 2IBGA 5AQ0A 1OSPH 5I76B 4ZFOB 3V6BR 1JK8A 1FRGL 3KPPB 4DO4A 5GGUB 5L2KD 1A1NB 1HKLH 1MKFA 2EP6A 3F7YA 1DQTA 4FD0A 3ZDYF 4OLWL 5G55A 2DD8H 1F3DH 1FGVH 5AYTA 1ED3B 3BDBA 1OOWA 1TEGA 5G5DA 2GJZA 3RI5K 5EZPA 3GXTA 2WXOA 5DYOB 4BV1A 2BWDA 2FZ3B 5L2KA 5CEZE 3D07A 4QLWA 4MNQA 3TZVB 3CFKB 3FFCB 3HS0B 3HNTH 3TONA 1TNMA 5ID0B 3R06A 4WI5A 1BVLA 1VF5C 5MEQA 1U0QA 1NUGA 4U3SA 1E90A 2HFTA 5KSUB 1L3NA 4YBLC 4FAAB 1SM3L 1WCBB 3KJ6L 2BMKA 3MRLB 3RWHA 3HMWL 5BVPH 4AEIH 2WY3B 3VVWA 4DEPC 3P4LA 4PI0A 3W0WE 2DQCL 5I1KL 4PGCB 5F0MB 1TU2B 1U95A 3C6LC 2ZCZA 3LH9A 1KLUB 4X9HA 1GIGL 1PLBA 4GKOA 1OCCB 3LKSB 3ZKNC 3ZKQD 5C08B 3CXFA 1DLFL 5J0BA 4MJHA 1KACB 2EH7H 2UWEB 1ZIBA 3A6BH 3DXAB 3IJ8A 1JWMA 3C2AL 3K4ZA 3LB6D 2X2IA 2OZ4L 1BP3B 3O6FB 1KIQA 3ETTA 1E9QB 2JCCA 3P4OB 4ZD3L 2PLTA 1AJ7H 1HCZA 5F70A 1VACA 5E00B 2BCMA 2B1AH 5EZJA 1WK0A 1RLBA 1T22B 4L1HA 3EYSH 4ZMVA 5DS2A 5GGQL 1QSZA 4E9RA 5JYMA 1VLXA 5HDBE 4QXGL 1SQMA 1ZCRA 5JHDE 3VQLA 4KY1H 4XXWA 4KFZC 4LCIH 5HPMB 2WSKA 5LGKA 1WG3A 3H2PA 4NWUL 5DD1H 3O9WC 5IB1B 5EU6A 3QUYD 5IHHA 4IBSA 2DQFB 4HSCX 3T77B 1UA7A 3BUTA 3LEVH 5IJCC 3D0VA 2QPFA 3ABZA 4MJ2A 5AAMA 5I17B 5IMKB 1PPIA 2YA1A 1FO0L 3FTZA 1KXTA 1KDIA 5EBWA 5HYQA 4GRWF 3K1DA 1F2XK 3P77A 4GSDL 3DBSA 1AFVL 4Y7MA 1TJIH 2FSEB 2VNCA 1D9KD 2LAAA 1VCBC 3QUYA 5I6LA 1F4XH 5KS9F 4DPCX 4R0LB 3BT2L 4LPTA 1IJNA 2YGVA 3NCXA 1IZKA 2IC2A 1MCEA 2JI2A 4IBZA 5DHYA 3D39E 5HJGA 2BSSA 4JZJC 4MAUL 4IOIA 3L95A 3KYKL 1QUPA 4HALA 4PS4L 5KW9L 1DQKA 5TE4L 5GJTH 3GSQA 3GUTB 4FCAA 5DEFA 3CK0H 3QQ3B 3DMMA 1D9KA 1YY9D 3QJUB 4XE0A 4H88L 1J8KA 1J5DA 1KBVA 1RZIB 1ZTXL 3V0DA 1U93A 4PCSA 1BZ8A 3ESVF 3QYCA 1WDAA 3MLYL 1PZ5B 5B3JE 1EEZA 2NY4C 2AV1A 3BVTA 4N2KA 5E9DE 1XF2B 2ZF9A 3PWJA 1V7NL 4H40A 4H8HA 4Y9BA 1IQWH 3P3SA 4AQ1B 1QRKA 1F4YL 3OKLB 3DPBB 3QIWD 3AQDA 3GXIA 2NY6B 3LZOA 3HI5L 4P48A 4LVHC 3OGCA 1NPJA 1BQHA 1U8NB 3SKMB 5I1KH 5EB9A 3X1GA 5I1GH 2UY7B 2ZUUA 2A83B 4ZUSA 2CIKA 1P7KB 1T1XA 2WBWB 2OCCB 3B2UD 3D50A 1HINL 3ARFB 1GIGH 1S7RB 5DRXB 3I6GB 1NOFA 3D3VB 3VD5A 4N5ED 3U4BL 5SWZB 2GUOB 3OB0K 3GMQA 4Z7OB 1YQ2A 2ZP8A 3Q2VA 1WD9A 4M43H 3TF7C 1KGWA 3VVVA 5JW4M 2HAZA 3A0OA 1PVHA 2B8OT 1LD9A 4LNVA 2AAVA 1TMCB 3EOAB 4X5XB 1YNTA 1CU4L 2WKOF 1IKFH 3MGTB 3MU3A 1OTTD 4ZSOA 2VWEE 4NKMB 4O9HH 3FNKA 1G7LA 3QJFB 3VSVA 1E28B 1LK2B 2I7OA 3NSFA 2VJ8A 1XHHA 4UDUB 2NMSA 2CIIA 4LRIC 1T2QL 2ZJSH 5DJYA 5C7XL 5FYJL 5C0CB 2X6AA 4PVNA 4PG2C 3WFDL 2EADA 2LVEA 4HS6A 1MXDA 2KLSA 2B59B 1P5UB 3BAJA 4F3FB 4QJ4B 1M57B 2N7BA 4U6VL 4XNAA 4ZAKC 1I7ZA 4X9BA 4FZEL 4FNLL 4KI1A 4P2OD 3NRFA 1HS6A 2DWDA 4KMLB 1RZFL 4QXTA 1KDJA 4BK8A 5K9KB 3JV4A 4HMCA 5DR5L 2YKLH 4OZIA 3DTXA 1WBYB 3WY3A 3CZFA 4ZPTB 4PLJD 2DQHL 4NNPH 4QJ3B 4EI5C 5CM1A 5JYLA 3VXQB 2F5BL 3P4NB 1U8QA 3R18A 3UBXG 1RZ8A 4P4KD 4GSDH 2F15A 3MOBL 5GSRA 3SGDH 3H1ZA 4NQSB 4F37K 5L7XL 3VA2C 1LEIB 1JPTL 1S9YA 4WTZA 3BT2H 2LU7A 5AW5B 4NFCA 2WVVB 1UKQA 2AJZA 2AXGA 2JKSA 4CSSA 2X3AA 1NKOA 4HJJH 1GS8A 5E4AA 3V4VB 3NBNA 2DL9A 5I2IB 5TE4H 2EECA 4A7TA 1GZPB 5AUMA 3V6FA 3FT2B 5C86A 1TENA 2BVOA 4FHJA 4Q6IA 1L7TL 2FHCA 2OQJA 3VSTA 2AZAA 4O2CA 3NPZB 1CL7L 1UJTA 3RGVA 4BE6A 4C56E 4EZLA 3MLYH 3BAIA 5GS1B 2IGFL 4JVPA 2EE9A 3LKRA 4AYMC 1G7IA 3HC3H 2YGQA 3WTXA 1KCRL 1V7NH 4OFYA 1NGYB 3CN1A 2FWLB 1XZ0B 3LQAH 1PKOA 3ESNA 4YX2L 3U46A 5I1EH 5EC1A 5FFGA 5JOPE 3MACH 4Y0GA 2QTEA 3BPOC 3NJFA 4GXVH 2K45A 3WFCL 5C09E 4OM0H 5I71B 1EXGA 1CR9L 2EDHA 4TXVB 4L1TA 1BWWA 3QQDB 2YSSB 3TWCL 4C4BA 2EVGA 5A16A 2H2PC 3HUJE 5FB8A 5C0JA 5DXWA 4WFFD 4JVWA 2DTSA 5CIPB 3VI4E 5CINL 3QG7L 4X8XA 1L9SA 4U0QB 3HG1D 5HHOA 5IVXB 3HPLA 3QCTL 3L3HA 4G7YL 4P5SA 5KBDA 1W72L 5EUOB 2XWBB 3S2CA 1WEJL 1UB5B 1SGKA 2IH3A 3EYUH 3WEXB 2Q8BH 1DJGA 2OMXA 2ZYRA 4YDMA 4KPHL 1FUNA 3IMRA 4L9LB 3IS1X 4XVOA 3RTLA 1Z9OA 4MCZA 4ANVA 6FABH 1LE5A 3KCPB 3HLKA 2ADJB 5KVDL 4RA0C 2YD3A 1RZJH 2WXMA 1YNKH 1XCQB 1CFTB 1NDGA 3QXVA 4OFDA 5FYLL 3SB3A 1CFNB 2P7TA 3L5IA 4IBLT 1R24A 3JUYA 3SDAB 4GIOA 2P24A 4R5VA 3MRCA 2I27N 4FZEH 5MEOB 4M6ML 4W6WB 1RZFH 2VR6A 3WDHA 2F1EA 3ARGA 1UWEL 2DI9A 4GKZA 2WLNA 2IPTL 3SGKA 4HFUL 1IILE 5DR5H 1ID2A 5DT1L 4NAQA 1R5WA 1HE8A 3LS5L 3FTXA 1OM3H 2VZVA 4ABWA 3LD8B 4OD3L 1INEL 3V4PA 1UWGL 1OSEA 2DQGL 4LOUC 1JZ4A 2Z92B 2IIJA 5DMJB 2HTKD 2DYPB 4YHIA 5I19L 4BE5A 32C2A 1QUNB 4OF5A 1K2DA 4XHJD 2RCSL 4PJ7E 3V52H 4TUOB 4YGVB 1JPGB 4ELMF 3KE0A 1ZA6B 2XQYK 1HHIA 4PJHF 2PCFA 2PWEA 4K71B 3GT6A 1LO5A 5D70H 4K3DL 4UQDA 1BBJA 4K55A 3AS3A 3N04A 2J4WH 4DF9A 3UOAB 4YDIL 4CUCA 1OT1A 5E1QA 4ZK8A 2L7EA 5D7IE 4M4RA 3CZKA 4DJMA 2WXNA 3QYNA 1OL0A 3MCKA 5DUMH 2FATL 3F7VB 1CURA 1KCSL 1RURH 1IGFH 2YAHA 4WCYL 3S5LA 2ENPA 2FIKA 4J39A 1X9QA 2HG0A 3GLEA 5H4YA 3TU6A 2FYYB 4DUXA 4KTDH 4ODVL 4LBEB 5ACZB 2OR9L 1IGTB 4S1QL 3ULUC 5AW1B 4V1DD 3X12A 3PAVA 4HHGA 4UIKH 1CFBA 2C34A 1DHKA 4AV0A 1KXVA 3QUXB 3VG0L 2OMZA 1MAJA 4TSAL 3NUKA 5DZJA 1N5YH 1Q72L 3HI1A 5A6IA 3PNWB 3TCXA 4RX4A 1CFSB 2UZPA 2Z31A 3ARQA 1KT2A 3DX0A 4L4VD 1A4JB 1IKNA 4W4OA 1AOHA 5C1MB 5B3SB 1XGUA 1U8PB 1W2KT 1ZLEA 3ZYIA 4FQ2H 3MGOA 5E2WL 5LGJA 2NW2B 4G7YH 1A6VH 1W72H 4P46B 1L0PA 3Q5YA 2ZUQB 5G4OA 2K8QA 3G9VA 3QO0B 5C0BB 4B96A 1WFUA 4XWGL 4G9FA 4LU5H 1NAKL 2Z35B 2W91A 3QIUC 4BDVB 4P5TD 3DVFA 5ITFB 5B8CC 4UBDC 3C6EA 2I7SA 3DGGA 1O5PA 5HJ3B 3WHE1 2D7NA 5FM8A 3LN5A 4LRNL 4MD0A 1J5OL 2HUHA 4OCSL 1EK3A 3WJLC 4K5PA 4ENZA 1SF3A 4R84A 2KMWA 4Z3FA 1ACXA 4HFUH 1JE6A 4P2AA 3DRTB 4R90H 1J5CA 3L4CA 4XCEB 1P1VA 2FJUB 2XKSA 4POZD 5I6MA 1UWGH 2HB0A 1DUZB 5FYKD 3GMOB 3QC6X 1A8JH 3CBJB 4IKKA 5CGYD 3BP6A 1ANUA 3GB7B 3KZ8A 2K70A 3FL7A 2GITA 2N01B 4PWIA 3GXFA 4D0DA 3RNKA 3VD3A 5GGVY 1TTCA 4JAMB 2UZIH 1DANT 1XV8A 1A8ZA 5CCKL 3CZNA 3LQMA 2MCPH 3O0RH 3GYRA 1QEXA 1VHPA 4J8RA 5DRZA 4ZQTA 2G2PA 2VDKH 3DX6A 4OM1H 3VUAA 3BWAB 3UAEA 3QW9A 4V2CB 3FQ1A 4A67A 3G04B 5CLXA 4MD5A 2CK0H 1BAFL 2R4RL 3ZKXB 5I6XC 1TJXA 3IKCB 4IEFA 5F96L 1N3NA 1SYVB 2H3XC 3CDZA 5I1LB 1K4CA 2EE0A 1RJZB 3B9EA 5BXFB 2ZICA 4GO8A 1XSJA 3UTSB 4FTVD 2VSDA 1Q0XH 2G75A 1DDHB 1LO3H 1SN5A 5IVZA 4CMMA 5FYJU 1EJOL 4KVCH 2OR9H 2HRGA 4S1QH 3V7AG 3KDMA 4N2HA 3H9SB 1IE4A 4N2FA 3H7BB 1ZT4A 1LJMA 3MV7D 3OHXA 1J8HA 3KLAB 1MRFL 2DQTL 4PS8A 3WE6A 4LDEB 2NY1B 5IHWA 1Q72H 3RTQB 3ATDA 3GSUA 3HJ0A 4XOAA 3L7EA 2PO6A 3QJHA 4MA1B 3BQUD 4HKBA 1QRNB 3P9MA 4UQ9A 1AHWB 2BSED 3WNLA 4TQEL 2G9HB 1T4WA 3EOTL 2EDBA 5EOCL 1DE4B 3M1BA 4AYEC 2IALA 2YLHA 3T3PF 3MUUA 5E2WH 1DBML 1D2OA 3MV7A 2ICEA 4DAGL 1M6OB 3D69B 1BIIB 1UXWB 4LGPB 4NI3A 1AQKL 4P23C 4LPWA 1VKXB 5DQ9A 4FQLL 2UXVA 2P28B 4LCWB 3G5VB 3HG2A 2BHZA 1W0VB 4QO1A 3FCUB 4HQQL 4Q74A 2QKIB 1YO4A 4QEGA 1VADB 4JN2B 4MCYA 2OA9A 3JWOL 4WLCA 3WLWD 3QNXB 5ICZB 5KS9B 1XGQB 3LZPA 2NY3D 3CZJA 4TNWK 5FGSA 1GVIA 3VFVB 2BVEA 2WTOA 4X4XA 4OCSH 4XP9H 3EGDB 4YSEA 3PE9A 1XVSA 2ATKB 1IBZA 1RZ7L 4J4PC 5J1AA 4G6JL 3L4VA 2BNRE 3AGWA 4DUWA 3NOIA 1B4RA 4Y4HC 1EMTL 4BZ2L 1IM9A 1ZLVH 1NH6A 1DO5A 1FC1A 2F54A 1E0OB 2XXMB 5BVJA 3VB9A 4FEMA 3D2UB 1JZIA 4UDTB 4TQHA 2GTZB 4Y5YB 5BRQA 4R7DA 2H26A 3DYMA 4I3RL 1QBLH 5I1CH 1PDKA 1PL3A 4KZDL 3QFJD 4BKSC 3FU0A 1B88A 3IDXH 1PAZA 1YMMB 1S7UA 1TIUA 2CUMA 3BGMB 3PWPA 4EO5A 4W68A 3VXUB 2JB5H 1HXYB 4D9QD 4P2QB 1NQBA 4ES9A 4Y4FC 2OTWB 3CXDH 5TFSL 3ZKMC 3DX1A 4GQQA 1WFTA 2FJSA 3C5JB 1D6EB 1DCLA 4LIQE 1TJMA 3DUSA 4IMLB 4WWOA 4G7SB 5F97E 4TQIA 1MEXH 1JNHA 1URIA 1Q1PA 2YAQA 3MZTA 4M7JL 5D7KD 4LHQB 4ZOBA 3X11B 1DBKL 2CALA 1T2XA 4X6FA 5LBGA 4K3GA 3PV7A 4QJ5B 1FL6B 2IO5A 3NFSH 1QLEB 4FP8L 1X5ZA 1A9EA 4XO8A 4XPTL 1HL4A 3GBDA 3JWNH 3J7HA 3LXAA 1LWHA 2EIJB 5F7MC 1KGUA 4LCUB 1FG2A 1FNSL 1G6RA 1CYGA 2GB2A 5DHVH 4A2EA 1RAMA 2W9DL 1CFQA 3BUQA 3QEQE 3QJSB 4KK6C 4ONGL 4TQEH 2VDMB 1NAMA 3S9DB 4Q9QL 1W0WB 2R0WL 4JG5A 4Q97A 5DD5H 3UTZB 1G7MA 3PFQA 5LHDA 4G7RB 4GMTL 4DAGH 4LLVA 4LVNB 5D7LE 3GI8L 2H0JA 1AD9A 4B9YA 2OYMA 2MFNA 2J1ZA 3WO4C 4I1RA 3QYMA 3PWNA 3HPJA 2CGYA 4HQQH 2PCXA 1WO2A 4RMBA 3UABA 3MRKA 5LQBH 2Q10A 3O3DA 4ACPA 4FL4B 4EE2A 3KPSD 1E3XA 5GRUH 5D7SH 2HFEB 3FFDB 3I02A 3JWOH 4PLKD 4UOJA 4HAKA 1JD7A 2KZ1B 2EXYC 4ZX5A 1AO7D 3FB7B 5CD5D 4PWKA 4DP0X 1L0YA 4FMKA 4MKMA 4L37B 4Y19E 1EV2E 5AAWC 4EJ1C 1PSKL 5I8OL 1NMCB 3WL9A 2AF2A 5T3ZD 1EMTH 1XAUA 3FFCE 4O02B 5LJYH 2DQJL 1FA4A 2AJ3A 2H0FA 4GRMB 4U1GC 3U7YL 4X6CA 5KBPA 5BQDA 1WP6A 2Y72A 2VZ1A 1U3ZA 3NCEB 4BK5C 2NYYC 3MREB 2VDOL 5J11B 1CDYA 2O6PA 4BCZA 2F8OA 4YHOL 1D5BB 3FOLA 3WMQA 1RZGB 3DI2B 3PNRB 1JPST 1E4KA 1A02N 5DO2D 2XA8L 2VW4A 1X7QA 4HUKB 3TA3C 5CEXB 4JFQB 4XNUL 1P0SE 5JXED 3D30A 2IAMA 2IH1A 2MOGA 2R23A 3MRDB 5TFSH 3AY2A 4PGBA 2OULB 1GOGA 2VW7A 1RY7B 4NS0A 4RRPA 4N2CA 2C3VB 4CAGA 3DO7A 1XL6A 1CD9B 3KR3H 5IKCB 1K5NB 2ZAHA 3FQTA 3DXAE 2BS9A 3NEXA 4G8FB 3T8XA 3JTTA 4J3WA 4L3FA 3MRJA 4GYBA 4DQOH 1GXEA 4D0CA 3KNBB 1R4XA 3O81A 4KKCC 5FFOA 5TH2B 2Q2LA 3MLXH 3RVUC 1HEJC 5EO0B 4AT6B 4TSCL 2DEXX 2QVTA 2NX5B 3GBLA 5FW6A 3F8UB 4MCNA 4PY7A 3RX5A 4ZMQA 5EORL 3GSWA 3O2VL 3VFUA 1THAA 1RZPA 4FP8H 2DLHA 4IIQB 1XF5A 1FL3B 4NKDB 4HBCL 1MCWW 5TJWK 3PF2A 3RWGB 5DJZB 4YO0A 5DMIH 4WWPA 3TVMD 4HGWA 3PU7A 2V2TB 3VU2A 3VWJD 2V6HA 3EAKA 4ONGH 4YHPB 5MERB 4XMUA 3RIFK 3WHXB 43C9A 2Y7LA 3ULVD 4Q9QH 5F6HJ 1ZGLA 1JNJA 4Y4KB 2R0WH 1PLCA 3L4TA 3VRJB 1MZYA 4DVRL 4FEIA 4N2BA 2VLLA 2XSKA 3FXIC 4N1HB 2BSRB 2V2XA 4HXBL 3P73A 2IOOA 3LZNA 3KLHC 2C3GA 3TVMA 1IFGA 1PIGA 2WWMD 3N1GC 1E4WL 3RX9A 1QTYT 5EZOL 3V4PL 1D6VL 1UB6A 1DQJA 1A6AA 2P8LB 1V3MA 1AXTH 1I7TB 1K6QL 1OT4A 1OGTB 1IBBA 4J3OD 3N9GL 4RWYH 4RIRB 5IGXH 3PHQB 3NIGF 3RWDA 4M7ZB 5CR8A 4N28A 1OE3A 1SXZA 12E8L 5CJ5A 3RYMA 2CDGB 3S88L 1KLFB 5GZOA 2VDNB 3IMSA 4F27A 3R1GH 1KTJA 3IT8D 4JGMA 4E9QA 1JZ7A 2C1PA 2HMIC 3N85L 4I9XA 5MHSD 2MIZA 2J72A 2XU9A 5KVFL 5D2LF 3ZMRA 1XEDA 5KYXA 2DZEA 5SV4A 3WKNA 1CLZL 4JHWL 3VD7A 3V5DB 2WZ6A 2DI8A 1OSZA 3N55A 2CO3A 5D7JB 2EIDA 5ESVB 4MD4B 4XI5D 1R75A 4PRIB 3U7YH 2LU5A 5HYJD 3HEIB 4KOBA 1ADQA 3WY1A 2P5ED 1E8ZA 3MODL 1AAJA 1P4IL 2V2WB 4RFNB 1BGXH 1NC2A 2E0PA 1T03L 1XGRB 1AGEA 3S3JA 3QXAB 2Q9OA 3G6JA 2IANB 5IR1A 1A4KB 4Q9RL 4N8VB 4R2GD 3PGDB 4EOWL 2B08A 3MLZL 1DQQB 4CDHA 3EYOA 4DZ8A 5JW4Q 4R97B 3VQ1C 2VDPH 5SWZE 4Z7OE 1C16B 1YNLH 1ORQB 3D34A 5E1GA 3O11A 3O3EA 1KYAA 2XWEA 2E7DA 4LLAA 3RJDA 1FIGH 3DECA 5D1XA 1DBBH 1YUHA 2L4OA 4UANA 2OXHB 1J10A 1LEGB 2F18A 1IGCL 2WSDA 3ARDD 4HJ0C 5IB2A 3E6FA 4JG0L 5TF0A 4F24A 3RVWC 1GW6A 4PRNB 4MAYC 4W70A 2JLLA 1BMGA 3EGSA 3QRFM 3QEGH 3NJHA 3VH8A 2UUDH 1KXQA 1R5VB 1F8TL 2VRAA 2X4SB 4UI2A 4F9PC 1NICA 1OTUC 3IKKA 3O2VH 3B56A 3WYRA 1QPXA 5IEKB 2O5ZH 4N5UA 4J23A 1BFOA 2QGCA 2J8HA 4QY8A 4N90E 3S48A 1UXSA 4OVUA 4DPRA 3K81A 3QUZA 2HH0H 3QHTC 3RWFB 2HLFC 5HHMB 3SYQA 3KXFD 5EUKA 2VLJD 4F1SA 3LRKA 5T1JA 5JHMA 4LQFL 4KITB 3BKCL 4JGJA 2W92A 1ZHNB 1IC7H 3VGHA 5D71H 3V2AR 5HVHB 5IB3A 5CS7A 4M1DH 4MA8L 1KTLA 4N0YL 3AGVA 3VGFA 4UAOB 1OF2B 1OCOB 1E4WH 3KXFA 1R3KA 1YPZF 2FX9L 4KUCD 5I8EA 5I1DA 3U2JA 2FT6A 5EZOH 4ZX3A 5GGTA 1VA9A 2LVCA 1SXAA 4YK4B 3E38A 4RVBA 4AL8L 5IBLD 5D1ZC 1J88A 1U9KA 4WV1A 3MRIB 1FBIL 4X7SH 4CVZA 1NBYA 4NQCD 3BPLC 4M6NH 2MCG1 4NQEE 3IPFA 3S36L 3G5XA 3CMOH 4K9EC 1GYUA 1HILB 4CN6A 1NCBL 1CUOA 2QVIA 3BZ4A 4YL9A 2ADGA 3ZQXA 1T1WB 2D3VA 4HIJA 2GYSA 1GYWA 1A2YB 2LT9A 1MW1A 4QYAA 2HZHA 3MV01 4H8PA 3SGJA 1CLZH 4QRUB 3W38A 3FB5B 3EF4A 1U8CB 2GSGA 3N91A 3P2DA 1U8LB 4YVNA 3QIBB 8CGTA 2VLKD 4OLEA 3MBEC 4EBQL 1G7HB 2P5WA 3BAYA 1M2VB 5K33A 3SOTA 1CLYL 4YSCA 3MA7A 1T5KA 2JI3A 3D4YA 4IOFC 4X5QA 5EZIL 4CVXB 4F8QA 3RIFF 3KJ4B 1U2CA 2BFGA 1YC7A 4F80A 1MRCL 4QRQA 2J5WA 5C3LD 1XF3B 1HYSD 2CAKA 3BGAA 3OB0H 4UTAA 3SCMA 3NQKA 4QF1B 2ZKHH 2A6JA 4OSUH 3L5HA 4K94L 2WTRB 2X2HA 3PLYA 3GRBA 5JUEL 2A3TA 4IMKA 4NHCH 4PB9L 4IKNA 4G6KL 1JF1A 2MPAL 2Z8VC 3H4FA 3SE9L 3WIHA 1J8RA 3RWIB 1K8DB 2R0LH 1MI5D 5LDUA 2QGEA 4ZNEA 4I0CC 4KNUA 2WZPA 4IGBB 4A68A 2VXUL 4O51A 5CZRA 2A9CA 5CBAB 5DO8A 4Y2DA 2XNAB 4QCIB 3WS3B 3ZT5A 4OLYH 3N1QC 3L3OB 3ATEA 5L4IA 5CU9A 5KYYA 3S3DB 3V0VB 4QRPE 4M4PA 1EGJA 3MA9H 4RGOH 5F7DB 3KPRD 4JFPA 3BKCH 2A77H 4RZCB 4MRCA 2XY1A 4UINH 5JHBA 1JYNA 4MHHI 4Y16C 3SDDD 1TCRA 3IJYB 3LIUA 4R7LA 1FFOB 1JAEA 1H6UA 4M6AA 3KPRA 4OBRA 3VDCA 5TPWL 4KKPA 2XUWA 4RAUB 4XVJL 4R4BA 2H32B 1IM3B 2YD0A 4X6DF 4TUKL 2DQIL 2IQ9H 2VN6A 3LRHA 2R15A 2BHFA 1FYTA 3FHAA 4HEPA 5AKTA 2YMTA 3LKOB 3H53A 5TE7H 5IW6B 3CFDB 2A0LC 4G8IA 4ZDHA 2XXGA 4CILA 2P52A 2QPDB 3TO2B 5KG9A 2W0FB 1A6TB 4HJSA 2EIKB 5FYKH 3VE0B 4ZFGH 5DHMC 4F7MA 3L08A 2DMBA 5M7QA 2OAAA 2EKSB 3HE7A 4WDIB 4DKDC 5J5EA 1UURA 4UV4H 2OSYA 1J9QA 4IU2B 2OMUB 1KWKA 1SYSB 2OMWB 5I0DA 3F12A 3GO1L 1U2HA 4XMLL 2V9TA 2GABA 4JHVA 3FUHA 3SBWA 5AOZA 3UYPA 1N68A 1W16A 2YN3A 1FE8H 1INQB 3P3TA 4FG6C 1WIOA 2PABA 3VRLE 4U3XA 5T3XL 3B34A 3A24A 3DRQB 5ITBL 1I9EA 3JVGA 3QQ9C 3R4RA 1AIZA 3RZCD 3DOIA 4JPWL 3HI6L 1C7TA 4U1KA 4MSWA 5EIIB 2ZUTA 1RZQA 3UYOD 5KVGH 43CAB 4E41E 2WQWA 1NIAA 2AQNA 4K94H 3TZVC 1INDL 3HS0C 1H3VA 1FLRH 2FX7L 2Z4TA 4PY8J 4D7PA 3TBTB 3RZCA 1GC1L 1Q90A 4G6KH 1UZ8A 2MPAH 5F21B 1HL8A 2AXFB 4TVPD 1G6RL 1CMOA 3EYFB 5I5RA 2F8VA 4LVEA 1CFMA 1NAML 4BELD 5CD3B 2HLAB 3IWUA 2Z1PA 1C08B 4LMQI 2YZ8A 3OD3A 3E3QE 5AOJA 3RU8H 5SX4I 4HS8L 1WBXB 5C6TL 3LDBB 5IV2A 1A7PH 3EJRA 2Q86A 4RAHA 5DFTA 1X5HA 1KNOA 4L18A 1LO2H 4AGNA 5IJDC 4FDWA 4UM9A 1EFQA 4GKNA 4MJ6B 4ELKA 4XP1H 4OLXL 1G43A 3CLWA 2HN7B 1H6EA 2MHAB 4R8WL 3O6FC 4KROD 4OY9A 35C8L 1XT5A 4PW3A 1NBVL 1QNZH 1TF4A 3ZDYE 1F42A 4YC2B 1ROWA 4RMSA 3BUYB 1JXKA 1TMQA 5EU5B 3LH8A 3S35X 4NHUA 4HMEA 3EO1A 3FT1A 5ES4B 5GHWL 2OXGA 3QQXA 1XF1A 1TKWB 2UXFA 3HCVA 3IJ9A 3O45A 4P07A 3UAAA 1AZZC 3ARYA 4OLVH 1RH8A 4NQQA 3GBML 4HWNA 4UNIA 2WXPA 2QEJA 3VXSD 3DX9B 4PY8I 4AZ8B 3FT3B 3O3BA 1SNRA 2FX8H 5DSCB 2Y1ZA 1CLCA 2ENYA 3VXMD 4JBSA 2FNBA 3LEXA 4XVUD 1E2ZA 4R7NB 2RBLA 3O6KH 3PG2A 4LSUH 3EHBD 5IHBA 3BZEA 3KEDA 4KTYA 1BQRA 1JL8A 4YE4L 1WBZB 5JXAH 1EHLL 3W57A 3VXMA 2VMEA 4NUGL 1KPVA 5JW4R 4MASA 1N6VA 5KANI 4K23L 4XPHL 1VZGA 1YEEL 3FH5A 1ECYA 4R0LC 5H94B 3F64A 5B1JC 4ADJA 4YDNA 1JG9A 3IU4L 1QSFA 1HHKB 3HNVH 1QABA 1Q8MA 2W0KA 4JFED 3U36B 1Z9NA 3FRPB 1TYRA 4OZFH 4LPVA 2DQMA 4J3VA 3OKMB 2AEOA 3DROB 3POHA 1T0NB 3GTVA 3C2SA 3KPMB 4NRZA 4AXWA 3N06B 5A43C 2GAZA 3H9SE 1XB3A 1G1YA 3KPQA 4YUEL 2E7MA 3C08H 2ESVD 2VQUA 2CQVA 3MLWL 5I6OA 2WXGA 5B39A 4JPVL 2NUTA 4LSSL 2P8PB 4QLRA 5C3TA 4ZFFB 5HHQA 2VC2H 5E08H 4AQ1C 1BWMA 3VXNB 2X88A 1HDMA 4OZGB 2NY6C 5J9PB 4D8PA 2ESVA 1G6RH 3QI9D 1U8KA 2XN9A 4P9ML 3H0TB 4HF5H 4W6XB 4WUKL 3PGFH 3RAJL 4ZXBB 2ICCA 5F3HB 5ADOL 1NTDA 5DFAA 4QRBA 3ZE0B 3KG5A 1EHKB 4GY4A 1BV8A 1IBGH 1MFDH 1RSFA 3ARFC 3M17B 1C12A 4HS8H 2WNXA 4NO0B 4D3CH 5C6TH 1CF1A 2LLNA 2I9LA 3FB8B 4G6ML 4GRWE 2KBGA 2B14A 4C54A 2CD0A 4XBMA 1DLHB 2JIXD 3K2IA 5A2FA 3MV8D 2ARJA 1PJWA 3HAEA 1MRDH 3IJSA 5DTFA 5F7EL 1EAPA 4FC3E 3FSAA 2XPGB 2J8UF 1ZEAH 1GMEA 5CHNB 1AOZA 3QZWA 4ZMPA 3OV6A 1II4E 5H2BA 3L3IB 3SE4C 3OLEA 5A2IH 2JF1A 3CUPA 1G9ML 5GHWH 3CSFA 4PJ5D 5AZUA 4KNTA 4PJ9B 3F05A 2PP9A 2X4PB 5D2LB 3IDMA 4MNHB 5FKPA 1JZFA 3U0TA 1QR1B 4FFWD 4TSBL 5K9OB 1P5UC 1N2RB 4X5WB 2KLTA 4HCFA 5FUZH 4FQXB 1TQTA 5DJDB 4WNQB 5EN2A 3MNWB 5DI8B 1ADQL 4PJ5A 3CIQA 1ZK9A 1WSST 1YMME 3QPKA 3OKDA 3CFMA 2QHLA 2ZWLT 3VXUE 5JPMA 1K8IB 1VZHA 2FTAA 1WRFA 2H9GA 3CE1A 5T3ZH 2JCCF 3DK2A 1J12A 1B0GB 4Z7IA 4P2RB 3ECBB 4NUGH 3WOVA 2BIPA 2EDDA 4L8SB 4X99A 5IHZA 1FJ1B 5LVEA 3VQMA 1J5IA 4MDRA 4YBQC 3EOBA 4P57B 5ESAA 4DPBX 2X9XA 3IU4H 4LLWB 4QTHB 5C9KA 2XACC 4XP4H 3STBA 3MV9E 3O6ML 4X5RA 4JQVC 3WD5L 2YD8A 4FQHA 1N6QH 2GIYA 4U6XA 4OFPA 2KL6A 2ZONA 1X7SA 4Z23A 5L2JA 2X28A 4LASL 4LKCB 1UEYA 4DKFL 4YUEH 5F7AA 1PYWB 3EGXA 3MJ9A 3ZZQA 3TH4T 4GAJH 4KX7A 2I5YL 2XG4A 4JY6B 4PJEE 5GS1C 3NZHL 5J6GB 3BH8A 4KK5C 1FO0B 1M71B 4JPVH 4LLQB 4R3SA 2D31B 3L1FA 4HCRH 4LNRA 1NPUA 3CFEA 1G84A 3LZLA 1V3KA 4N8VG 3F04A 4IKJA 3VW3H 3KPLB 4PBXA 4P9MH 3KWWB 1Z5HA 5I71C 3L5WA 2EDWA 2VLMD 1I85A 1OAZH 1QQDA 3N41F 3NAAL 2YBRA 3IMTA 4U49A 1KPUA 4X50A 4OCWL 4DNLA 1PZAA 4LDLB 3H9HB 2IBZY 3WJMB 4WW2F 1BXVA 4G1EA 1KGYE 4H1LA 4BEIA 3QDHA 2KH2B 1FH2A 2BP3A 4W9JC 4O2FB 1YPZB 4NRXA 2YXMA 5B22A 3ULVH 5GGTL 5G2NA 1WICA 1BMWA 5MP6L 1P1ZA 5F7UA 1ZD6A 5KVMC 4IDJL 5E8OB 5LB1A 3L1OL 5GGSA 5C07A 2APFA 3T0ED 3GZKA 4FYRA 4RFEB 4YFLI 3F01A 3ARBA 4AYGA 4MMZB 3SJVE 4L9LC 3NJJA 4KVNH 1QACA 3QQ4B 3CVDA 1WFMA 3HZMB 4J3OH 5AVUB 2OX5A 4ZODA 2DKSA 3Q8BA 1JZ6A 3AU1A 4UT6H 1J0IA 2I60H 2CJSA 2R1XB 3SDAC 4PJGA 3I6LD 5FIEA 3F6LA 2CLVB 3UIYA 5I15H 4ELDA 3ES6B 3O41A 1FPTL 4LSPL 1M3JA 2WVSA 1U8IA 1YC8A 2HKFH 3CHXA 1I31A 4PRHD 4XX1G 1OZUA 1YCSA 4H8WH 1YNTF 3MHZA 4JDVA 4W9FC 4W9EC 4WWKD 2D7TL 3HG1E 1TVBB 2X42A 2ROXA 1PFOA 4PRPB 1OALA 3LD8C 2OL3H 1XX9C 4A6YA 4MXWL 3C8KA 4APQD 1E30A 1RUQH 4I2XA 3PAYA 2G5UA 2X4OB 5I18H 3QDJB 2GJ6D 1JV5B 2XZAL 4AIXA 3CLEL 2NT1A 3O4LB 4UTAL 1L9TA 3GHBL 1GPOH 4PRHA 1XIWD 4WWKA 1QSVA 3AG4B 3HTLX 1O9VA 3WFBL 4H7VA 4Z3IA 2JJVA 3HVNA 4J3BA 2WLJA 3EBGA 5IMMB 1E7UA 5A1AA 3WIHL 3BN9D 4J1UA 4K71C 5IB5A 5E8EA 4GLRI 2WAHA 1SRDA 4DKFH 2QMJA 4LKXA 1XIWA 1QLFB 4AGMA 3D48R 3WFHA 1F11A 2FO8A 4Z7UF 3NZHH 2OI9C 1AQDA 4OCRH 2YEQA 1CG9B 5A7EA 1UD5A 1TQCB 3OKNB 4PP1D 2X9YA 5F71A 3MBWB 1E7VA 1L7IH 2BIHA 5SWQB 1RULH 3SPVA 1QPPA 5SX4H 1JHLH 3TWYA 3PQYA 5EEUA 4WEUD 5KBKA 3MRBB 3NT0A 5CNHA 2DOCA 2PKDA 3K71A 3IDGB 5K9JH 2FT7A 1MLCA 4L0YA 1PKQB 5E5RB 1EGJL 3FU3A 2UY6B 3K72A 3KLKA 3EIFA 1V7ML 4B3EA 2V8LA 5ICYB 1ZSDA 2YAOA 3OAUL 1A1MA 4JN1H 3QUXC 1BHGA 3S34H 4X98B 5CWSA 3ILQC 2QV4A 3VTAA 2J88H 4I18B 3U79A 4HOMA 1B2WL 2KZKA 1XGTB 3H2QA 5DLMH 3CBRA 3G5YB 2HFGH 4OCMC 4XOEA 1J9CT 4X6DB 2XQYG 1V3JA 1NBQA 4P46C 4IDJH 4ELME 2ZUQC 1R6VA 1GGTA 3B7UX 4PJHE 2YIHA 3GIZL 5B1BB 3N0PB 3U0PB 2W65A 1TVHB 1S9XA 4OD2B 3ZL4L 5GS0D 3E3QC 2J55A 2OFQA 3S5ZA 1AD0B 1X4YA 1F58H 2EDRA 2H6PB 2VXQA 1AG6A 1WYJA 2OCJA 4S10A 1FH5H 1M1XB 2XFXA 2DYRB 3QORD 4PRIE 4YDKL 2E7LC 1D7DA 3GUFA 2AEQL 2W5PA 3ETBF 4AQ8A 4WUUA 1PBYA 1ZV2A 4KX9A 5HDQL 2VXTL 4MBOA 5H37G 5CILL 5EOCJ 2NUPA 1LNUA 1X5JA 5GRWA 4JFZL 3T0BA 2ITDB 2ODHA 2AGJL 4NNYA 3ZT7A 2YPLA 5FDWB 2WIIA 3Q43A 1N7MH 1W72B 4LEOA 2VZTA 3MCYA 4GFXA 1EEYB 1SJEB 3AAZA 1T0MB 1G9EA 5C0EB 1YHPA 2Q3AA 5AW7B 4B50A 3D1MC 4PMFA 4URKA 4I48B 4F7TA 1CVSC 3LKPB 3TH2T 4YLQT 4KMTL 1EO8H 5DK0A 1JCVA 3GZPA 4D9LL 4PGJA 2A9ML 3GHBH 1AC0A 4GOSA 4H0IA 4ZPVB 5C92A 1A6UH 2WW8A 1HEZB 3FQNB 3WFBH 4N8CL 4XWOC 4CU6A 2A6IA 4L4JA 1A5FL 3QCUH 4I9WD 1RJLB 1KJMA 3GHEL 3ABMB 4OH2A 5IB4B 3QUKB 3ME0A 3P4MB 3VGAB 1P6WA 2XBDA 3PPSA 3BWSA 5I1JH 1RUAL 4HCIA 2WBJA 5KTEH 5CJXA 3T0WA 3E1F1 4JKWA 1YRKA 5TQ0H 3GMNA 1XZWA 2CPCA 3ZKXC 2OTUB 3NCCB 1EUTA 2UYLB 5C0AD 3G6DL 5D2NE 1UENA 3QHZL 2EEAA 2J1KA 3M86A 3FQRB 3A6CL 3TLRA 1YECL 5AW4B 4I77L 1SLXA 3P0VL 4UM8A 4KK8D 3EDJA 2OSLA 5GPRA 2ZKYA 5JW3L 2QVKA 1CI5A 3UEZA 2GBTA 4K7PX 2R0ZL 5FHBH 4BH8A 2QFPA 3BFOA 3APFA 3WNMA 1SHSA 2XWRA 5C0AA 4AW4A 2PXYD 1HXMA 1AY1L 4JHZA 4PJ8B 3IF1A 1R33A 3LIZA 3VRIA 4NYLA 4YSQA 4PJBB 4XX1E 4N0UB 3FB6B 2NY1C 1WA0X 3RTQC 4OLZH 4MA1C 1TTFA 3TTSA 1BD2A 3RNQB 2UZYB 1AHWC 2ENSA 4H8VA 2YGPA 4KO7A 1N26A 1OGAD 2CCLA 4IBUA 2X4QA 4L8BA 5KVGE 1S9WA 2XX1A 3CFIC 1HQ4B 1KCLA 3IGAA 4JO3H 3T6WA 1VFBB 2DWYA 4MDIB 4GRLD 4CKQA 4NPYA 4ZJ9A 4AVJA 2R0KH 3B2VL 3BGFB 2CUIA 4G71B 3UZQA 1BX2A 1V10A 4FTVE 1Q9KA 3Q8EA 4G72B 3FCTA 4GQ9L 1P2CB 4K3EH 2QKIC 3FQWB 1J9SA 3QRGL 4FQQA 2AEQH 2WNGA 4XNDA 4CRPA 3GNML 2O6CA 4Q2ZB 5INDB 4JRXD 4MQ7A 2NY5C 2IXQA 2A73B 3U25A 1GYCA 3N1PC 1EO7A 2BY0A 2IADB 4L3ED 1FL5B 4UB0H 3UBFA 4PJFA 3ZO9A 4DKEL 1T1YB 1UEMA 4OGAC 5TF1L 2R2EA 3QG6B 1BQLL 5DJ8A 4JRXA 1WHPA 4KJWC 5D1QA 5DVNA 1PU0A 5TDOA 1I8IA 4NOFA 2Y7QB 4KMTH 1U8OB 2VH5L 4WKZA 2ZOLB 4Y5YC 5F9WB 2A9MH 1G0DA 3VXTB 1RV6X 1S7VB 4X7DC 4KKLD 4N8CH 2L04A 3GUTA 2VLRB 5EBMA 2K8MA 3EO9H 3T3PE 4HJGA 4OT1H 4DESA 3KS0J 1JK8B 1ZGLM 2K7PA 2ZWZA 4N8PA 1MHPH 1YJDH 3T2PA 5I26A 2IPKA 3F7YB 5JIPA 2FD6L 1ULVA 4E9TA 4EN2A 3FRPG 1QSEA 4MCMA 2HP4A 4BUGA 5JR1H 5G5DB 2GJZB 4APXA 1JGDA 2VMDA 4TVPH 2QQKH 3FF7A 4UT7L 4JO1L 3W9DA 5L2KB 1YECH 5IVNA 3P0VH 4MNQB 5ABAA 1UWFA 4JRYA 1AVAA 3SKMA 3VX0A 4HEME 4I0PD 4PJIE 4MHHG 5T33L 3R06B 1AXIB 1BVLB 5MEQB 4U3SB 1XTLA 2CXGA 4O2EA 4NGHH 2BMKB 1X9LA 3BYTA 1GGYA 3NSJA 5D9SA 3RWHB 2TRYA 4PV8A 4F5CA 1SLWA 4BBWA 2YD5A 3GS0A 4NJ9L 4Q4EA 5LWYL 4KJPC 2PYEE 1F4AA 1O6VA 3NPSB 4I0PA 2AK4A 1U95B 4D9QE 3U82B 3LX9A 5SWSA 3PP3K 4PHZA 3AADB 2WUBL 3EJSA 3VXRD 3OKEA 1YG9A 5EA0H 2VDQH 5HPOA 4UF7C 4AYSA 1DJSA 2L7UA 1U36A 2ADFH 1G4RA 3P2TA 3GSXA 4E5XA 4LVNC 4X4KA 5EU7E 5I8KL 3TO4A 1JWMB 3QNYA 4F2FA 1CFVL 2WMPA 5KUKA 1KIQB 4ZI8A 2RIKA 2BIIA 2JCCB 1LTXA 3KAAA 4N86A 1VACB 5EZJB 1HSAA 3FUMA 4ZFZA 2VR7A 3K6IA 4FL4C 4PPTA 1KV7A 1LDSA 2WGXA 5D6DA 3FSWA 3WKMH 1TQBB 1QI4A 2FH6A 5I0VA 1KULA 1Q9WA 1NUNB 1I1AD 1A7RL 3C6LD 4PRDA 5L88H 3QXTA 3ZR6A 2X1XR 1GKEA 4HBQA 1GA2A 3EH3B 4A7SA 2R69A 3CWGA 5EU6B 1BQLH 1NMCC 3AJ7A 4K2UL 1LQSR 5I5IA 3MJGX 1GGBL 1LP9E 5GISL 1I3RA 3MJ9L 1N5AA 3D0VB 3Q6GL 2EACA 1CD8A 3TEZA 1I1AA 1KXTB 5EBWB 5HYQB 4F7CA 1L0QA 5E6UB 5J11C 1KGCE 3BEVA 4LLDA 3CH1A 3CJJA 3P77B 4ONOA 2IDQA 4I5BA 2WZAA 4B0MM 3QUYB 3QNZA 5FCUL 4YXKL 5DCCA 2X87A 5J6SA 2XJLA 2ZCLL 3QR1A 5DHYB 3MLUL 1TLKA 4Y1AA 1AQ8A 2BSSB 1ZS2A 1QAWA 2ZXBA 1AO7E 2HX9A 3H3BC 3L95B 4IOIB 4OD1H 4Q6KA 4WFHD 1F3RB 1VFAA 2MNWA 3GSQB 4AYDC 6CGTA 1SXCA 3DMMB 1D9KB 1FCCA 2YD4A 2EO9A 3X3FL 1U93B 4FZ8L 4AOFA 4XBGA 5J4MA 4NZTL 4EUPA 2CU9A 1G7QA 3O9WD 3OF6D 4UT7H 3TN0A 3TIEA 1V05A 2F53D 3VXOA 1EEZB 2AV1B 1N8ZA 3KEHA 2WHVA 3EZJB 4N6RB 3PWJB 3AQZA 4OGXH 5MI0B 5T33H 3G3LA 2N7AA 1BJ1H 3CXHK 5FKAA 4OZHA 4LL4A 2HWZL 1BG9A 1E43A 3HN5A 2X05A 3ULAB 4IIQC 5TD4A 1AKPA 1JERA 1BQHB 2O26U 4F8TA 1PD1A 4F9LC 3OMNB 4JRFA 1OP3K 3NA9H 3WIIL 4ZUSB 5AB2A 2CIKB 4FHKA 1T1XB 4X7EC 5LN4A 4J5VA 1TO5A 3TT3H 3I9GH 4XCEA 3LHPL 5F9JA 1V54B 4NENA 4Y4KC 3GMQB 3TASA 1OARL 5AYUH 2YZ1A 4FLSA 1DVSA 4NQDA 3EJZC 1DFBL 2JQZA 3RFZA 1LD9B 5KANG 1YNTB 1CFVH 4FFYH 1VRSA 2NY4D 4ZSOB 3A4EA 4GP4B 1Z5LA 2M83A 3FO0L 1A7QL 4Q89A 1ML0A 1USZA 3W81A 1G7LB 5F3FA 4A6YL 3J8F7 2DLFH 5DFVD 5ALCH 4WI4A 3U30B 2LQRA 2ZUSA 4JZOA 2Z1KA 3N44F 2CIIB 2X4UB 5EU3A 5DJYB 4M7ZC 1D5RA 3T2LA 1A6ZA 4ERSH 2D7PA 1Q0YL 4HOWA 1E4XI 4JFFD 5C3IA 4HS6B 5DUPL 2JV6A 2WK2A 4XCFL 3U6XA 1KCVL 3QFGA 1A7RH 4DCQA 1KSRA 3IRZA 3MSPA 1I7ZB 3UDWC 3N42F 5HHNA 2DWDB 8PAZA 1P4UA 3JV4B 1ZHKA 1CDHA 3EJUA 4OZIB 3DTXB 2Q7YA 3MJ9H 5D7JC 5HJDA 3OKKA 4YOKA 3C75A 3CZFB 2PP8A 2BP0A 1H8NA 4X4YA 4RFNC 1U8QB 1IFHH 1RZ8B 1SEQL 5GSRB 3MN8A 3TH3T 3O8XD 4GAGL 4YXKH 4JR9L 3BAKA 2YGOA 4ABQA 5C6WH 1S9YB 2E6PA 5KZCD 1TYJA 5FO9A 2AJZB 2AXGB 1CB4A 2ZCLH 3L45A 3MLUH 4M56A 3BFQG 1F5WA 4JRLA 4UYPA 1AKJA 4QGTA 4QOKD 3FCSA 4NZJA 4K5NA 4R97C 4YHYC 4U7MA 5AUMB 4FFZA 3O8XA 3V6FB 2D2CC 3X13A 1NC4D 4H1LH 2BVOB 4FZ8H 4LARL 3BCFA 4Q6IB 3MQIA 2XTJB 2OQJB 4O2CB 3RGVB 3NIGE 2CKBA 4X6CF 4RISL 4P5KA 3LKRB 5HYJE 1RK1A 4QOKA 1G7IB 2VDOB 2EUZA 2P5EE 3ATFA 2PR4H 3U46B 1J8SA 5EC1B 2BSTA 2A5UA 4B27A 4EI5D 1OXYA 3MLVL 3QH3A 5BRZD 4LPUA 3WSQH 5K9QG 1KFGA 1MCDA 1MNUL 3BISA 2DS4A 4KC3B 2K6ZA 3JYCA 4L4TE 2A7BA 5D2LE 2R8SL 4JKNA 4P05A 5E2VH 5I82A 4DO5A 2AI0H 2UXGA 2VXQL 3ALXA 2ZUYA 5J13B 5D2NC 4I3SL 5A16B 1AYOA 5BRZA 3LEYH 4QHUA 1YZZA 5FB8B 3BHBA 5C0JB 4YHNA 4P9HH 3IFNL 2NYKA 4FABH 3Q6FA 1OARH 3GDCA 3NIFF 4YEFA 1MSPA 4HP5A 1FZMA 1KV3A 4BFBD 5AL8A 5HVHC 3WG7B 4Z7NF 3THMH 2YKKA 4LMQE 3QDGA 5HHOB 3HPLB 3L3HB 4UAOC 1UUSA 2IH3B 3WN5A 3CDCA 4DGIL 4JDTH 1S7WA 1SXBA 4AX3A 2IFFL 2OMXB 3TESA 1RPKA 4YK4C 4DH2A 4YSUA 4MCZB 3UACA 1PF3A 1WFNA 1LE5B 5D72L 2FYVA 2AABL 5F7BA 4EAEA 3FQ2A 4XZUA 2BVTA 1NDGB 1UM4L 7CGTA 5EO9A 2I26N 2XC8A 5CZVH 3UGEA 2P7TB 3WO3B 1R24B 2P24B 3A3YB 3DYPA 3SYAA 2H2PD 3MRCB 5HYIA 1CICA 1N67A 3FN0L 3ZRSA 3ARGB 1IAIL 4GKZB 5C97A 1TZAA 3AUVA 1UOWA 1R5WB 3D08A 3QIBC 1HIMH 2BW4A 3V4PB 3NZUA 4NC0B 4XTRC 1RI8A 2YRLA 4OIBA 3GPSA 4CU7A 3GJFK 2EDEA 4OF8A 2GSIA 3QPQC 4YHIB 3KJ4C 3VGGA 1BBDL 32C2B 1AR2A 1E3FA 1C1EH 1V27A 4BFIA 1K2DB 3FFOA 4X7TA 2JK5A 1ZTXE 1CLOL 1MG3C 2HVKA 4OBSA 2WXQA 1REIA 3JWDH 1HHIB 2UV3A 1AMYA 3AXIA 3PYCA 2PCFB 2X3CA 3LIZL 1LO5B 1IKOP 4YXLH 3CHPA 1BBJB 4O4YL 4XP5L 1HNYA 4LARH 2F58L 3T2QA 4AIZA 4H5SA 4AGOA 3ZYOA 3AITA 3HNSL 1HTYA 3BAWA 4JO2L 4RISH 4M4RB 2ZX6A 2Q0ZX 1XXFC 3CDFA 4K73A 3MCKB 2IH9A 4B3VA 4QRRA 5KBLA 5D5MF 5F7WC 2JKIS 4P8QA 1XH0A 3S5LB 1E2VA 3G6JF 5CU5A 1OAQH 2FIKB 4H0LC 3QPXH 4L23A 4IGBC 4LOUD 2CO4A 3OLDA 1Y1UA 3VA6A 5JQIB 1SF5A 1VGKA 5HI5C 2X0VA 5IM7A 3OJDB 3RA7L 2Z8RA 3D87B 5E0FA 3ILPA 3X12B 1SOQA 3UZEC 3EJJX 1NWPA 2MSPA 2VZSA 3KS0H 5ICUA 4WK2B 1G9NC 3FT9A 4I3SH 2E86A 3L3OC 1IE5A 1TZHA 2OMZB 1UXWA 2J20A 5J1TC 3HI1B 3DO3A 5CP3A 1N4XL 1L5GA 4NXSA 2Z31B 5GS0H 1KT2B 2N1TE 4WF7A 4HUVA 3DIFA 4PRPE 4F92B 1XGUB 4V1DB 1D5XA 1OAUL 2ZOUA 3J27A 3MGOB 5LGJB 2ICWA 1MI5E 2BFVL 2ICES 2FE0A 4C4KO 4D94A 4OFKA 1HAUA 5FYJE 5E99H 1CDUA 4G9FB 2V9RA 4U4IA 4LSTL 1CGYA 2GHZA 1PQZA 1ET5A 1UKSA 2Y4SA 4AEFA 3PDDA 2BHUA 4F91B 4PGEA 1FCGA 3QDMD 1EH9A 3NN8A 4AJWA 3DGGB 4PW4A 3VI3E 3ULUD 3EFDH 1WHOA 4YSDA 4DTGL 2NLJA 3LN5B 5EU7C 3GQFA 4U2YA 2HKHH 4MD0B 4YHLH 1NEZA 2FL5A 5EHFA 5CEZD 4U1LA 3BFWA 4FLQA 3DOHA 4U1JA 3D4CA 4ZQKA 1Y18A 4B9PA 2CJ3A 4LHUA 2XN2A 4P3CL 2IG2H 3LSOA 3GK8L 3BP6B 3RWEA 2RACA 3ZE1B 1P7QD 5E4EB 5CN2A 3W0WD 5GS2H 2GITB 5JTWA 4ATTA 4G1MA 4D0DB 1JXJA 3RNKB 3B7TA 4FNUA 2GHWB 1YYML 2OTPA 3CVIL 4XMPH 3QIUD 3X14A 4PWEA 5BO1H 2FQDA 3BPNB 1JUFA 4UBDD 4ZW3A 2ZCKH 2H1PH 4J8RB 2PCPA 5DRZB 1Z0MA 1P7QA 3W0WA 2KDYA 3DX6B 3TPKA 2EJ1A 1NGXB 3KYNA 5DRNA 1MFNA 2NY7L 5F8RC 1HH9A 5CJBA 4X6DE 3ROLA 3NIDE 1MCKA 3SYPA 4MD5B 3QDAA 4HOXA 1H3GA 4AMWA 4XGZA 1R1CA 4IEFB 4M5TA 3EBHA 4FKHA 1N3NB 3CDZB 1HHJA 1K4CB 4A2GA 5ALBL 2JVUA 2CHXA 1U3HA 2E47A 4G7VH 2IGTA 1VESA 2CO1A 3P3RA 3LDBC 3VFMA 4MS6A 4XNXH 4AITA 1SVBA 2CG9X 4QPEA 2VN7A 2G75B 4CMMB 5IVZB 1XO8A 3RA7H 1E6JL 2AVFA 5JHDD 5KWYC 1NCAL 3KDMB 1UOVA 1ES0A 5BV7L 1ZT4B 3OHXB 1J8HB 3FQXA 3WE6B 2RA1A 5CJQH 3GSUB 2VGLM 3ALPA 3HE6D 3MRHA 3L7EB 2PO6B 3QJHB 4YC2C 4ZW5A 3MCLL 4DWHA 4HKBB 3P9MB 1Y1DA 5JHDA 1UH3A 2JQMA 2RJMA 3CXHJ 3M1BB 4B9IA 2IALB 2VDRL 2ODIA 3MV7B 2ICEB 4NBXB 2R69L 4R96A 2EIZA 5T5FH 5KVDE 4G3YH 4F15B 5DQ9B 1DYZA 1E4XH 3HE6A 5JORA 2MTPA 3I75A 5ANME 4DN3H 4QYOA 1T7XA 1N6UA 2BZDA 4DT2A 4QO1B 3T1WA 5DEZA 2DM2A 4N2MA 5GGRA 2H4EA 3JZ7A 3QZLA 2LV4A 5FDYA 5L8LB 1TZ8A 1F1DA 2SEBA 1J1PL 1Y7VA 4MCYB 1OAYH 2VITA 3VMNA 1N0LA 3DLQR 3H3PL 2WVTA 4FGMA 4X4XB 3Q2WA 1BYPA 3D39A 4HJUA 2H5UA 4Q58C 5E9DD 3WS6A 4H4NA 1Z9SA 1Z9PA 5J1AB 1UOKA 1U3YA 4QXUH 2NT0A 3QAZB 2P26A 3QS3A 4P3CH 5IT2L 1IM9B 2EEBA 1WA1X 2F54B 5BVJB 1Q38A 3TJPA 3OPZL 3V6OE 4P23D 1RIUH 4TULL 2YWZA 5E9DA 4R7DB 2H26B 1ETZA 1PDKB 2E3VA 2WWNA 4K5OA 3GF8A 1O7SA 1TETL 4OJFL 4EZMA 1KIPA 1U6AL 1S7UB 3PWPB 3TBYA 1HZHH 4FQJH 3O2WH 1J7VR 2YD7A 2IWEA 4JPIA 2LLGA 3CFJA 3T65A 4FYSA 2NY7H 3UCQA 3OG6B 3BVVA 3ZHLA 5T1KA 1WWWX 2FECL 2BIQA 4J4PD 4ZXBC 3DUSB 3IE9A 3LNHA 4QKTA 1MCPH 4XAWH 3SE8H 2EDYA 1JNHB 4Y4HD 2E27L 2A6DA 3APNA 3I2CL 1O0VA 4X6FB 3X1BA 2A9NL 1NJ9A 3QGVA 1FAIH 1E6JH 5EIVA 3VCLA 3S35L 3L5XH 3F84A 4G8GE 2GPZA 3N44B 3PAUA 4WHYG 4XC3H 4M5YH 1T83C 4OIIL 3IAGC 4GSXA 1BQHG 3TP4A 5HBBA 3C5ZA 3WKPA 7FABL 3U4EA 2RAMA 1FG2B 1G6RB 3LMJL 4LSRH 1CWVA 4Z0XA 1CFQB 1W6WA 3GBEA 1NAMB 3QRBA 4KJQC 5IHUH 3VYNA 5E6IA 4PJ9C 1JN6A 1G7MB 2P8LA 3N42B 1EJFA 1RCYA 4TS6A 4JFWA 4MNGE 3LNDA 1AD9B 1QFWL 2PYFA 4GFTB 2Y1YA 3CN0A 2X1OA 4FQXC 4YJZL 2LW3A 3TNNA 2VLRE 4OV5A 3A4FA 3HPJB 4Z1PA 4XCCL 4CC4A 1J1XH 3MRKB 2IDFA 3O3DB 2FGWH 3AB0B 5KOMC 3T71A 3ZTNL 1BZ7A 1H8LA 3I02B 1CK0L 1M9WA 5I30L 5BW7A 1VSCA 2XPYA 4KU1A 3GMPA 4AYFA 4C56D 3HMXA 4A2LA 4HPOH 4OF6A 2C9PA 1JF6A 2D7OA 5I24A 1RU9L 4L8SC 1AGCA 1ACYL 3AUWB 5B7FA 4FFZL 1PCXA 2OLDA 2QHRL 4KK6D 2IDUA 4PIBA 1NUDA 4MNQE 3WL9B 5JOPD 4YPGA 5DEGA 4G70B 4JB9L 5D7HA 4C56A 2AJ3B 2J8UE 1CGTA 3K1KC 2EE6A 4NO5A 3WIAA 1M42A 4X6CB 5C09D 2CKBL 3BKJH 4WFEE 4AEHH 1NDMA 2OSWA 5BOPA 2Y07H 3WY4A 4KQ3L 5TK4A 4FKKA 4DW2H 1RP9A 2K78A 3AY4C 4HPYL 1A3LH 1TETH 4OJFH 3FOLB 4K3JH 2FAUA 2OJ1A 4EXPX 1X7QB 2V7HA 3LH2L 5EG6C 4WTZG 2WTPA 2HJLA 2YXFA 1FFPB 3RRQA 1S7SA 2IAMB 2IH1B 3PHOA 4PUBH 2R23B 3C12A 4UYQA 4PGBB 3UX9B 2EXYD 1UA3A 1I3GL 3MRGA 4OJAA 2ZWSA 1FNFA 2H0EA 5I28A 4QAMB 3SKNA 4S0HA 3DO7B 3FQTB 4NO2A 3T8XB 3JTTB 4M7LL 3MRJB 3T0AA 2E74C 3NIFB 4AY0A 2JCCE 4D0CB 3GLDA 1R46A 3VI4A 2W07A 4Z7NB 2ZE0A 3NK3A 1MIEL 2DLGA 2EINB 3F3HA 2A9NH 4D8OA 4JFUA 5GZNC 2PW2A 4PY7B 2GKIA 3KDPB 4TM9A 4P99A 2LAGB 4FXLA 3GSWB 3QXWA 5LXGH 3VFUB 4I0KA 1F90L 3EW3B 1XF5B 1GGIL 1MCLA 1TVDA 2OMTA 2PTTA 2XVGA 4OIIH 2NW3A 4DFIA 1XEUA 4YO0B 3TA3D 1QFHA 3UMTA 1AGFA 4HGWB 3TFKC 3VM5A 4A66A 43C9B 4MMZC 5EU6E 3P0GB 3BP7A 3SQOH 1MCSA 1ZGLB 4RBPK 3WKQA 4EIBA 4JJHA 1IAIM 2EDMA 4EVNA 2VLLB 5AVVB 4OKVA 1CGWA 3MKGA 4HDIA 5EDSA 4Q14A 2V2XB 5JOFA 3P73B 4H8UA 2Q8AL 1QFWH 3TTYA 3Q8FA 3TVMB 5DGQA 1Y6KR 2YMOA 1EDHA 2BRQA 2D4FA 2E59A 2EYTB 4KKCD 3VFNA 3RVUD 1UB6B 1DQJB 5KYWA 1A6AB 3OAYH 2MTAA 2OMVA 3I84A 4N0CD 3IBOA 3ZTNH 4HGMA 1QKZH