1E5BA

Internal xylan binding domain from c. fimi xyn10a, r262g mutant
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
87
structure length
87
Chain Sequence
b'TGCSVTATRAEEWSDGFNVTYSVSGSSAWTVNLALNGSQTIQASWNANVTGSGSTRTVTPNGSGNTFGVTVMKNGSSTTPAATCAGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords XYLANASE D
publication title The Structural Basis for the Ligand Specificity of Family 2 Carbohydrate Binding Nodules
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 8
structure length 87
sequence length 87
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1e5bA00
1C7TA 2CWRA 2CZNA 3NDYE 1EXGA 2RTTA 5DHEA 1E5CA 2XBDA 1QBBA 1HEHC 1XBDA 1C7SA 1HEJC 5DHDA 1QBAA 1EXHA 1E5BA 3NDZE
chains in the Genus database with same CATH superfamily
2LVEA 4LSDA 1J9CT 1NC4D 5IEKB 5ADPH 2MHAA 3QUKA 3MLPA 2ICWB 1Z0NA 3BO8B 3CCHA 4PJAA 3BDXA 5DJXA 1SY6H 3MZGB 4OLYL 1BBDL 3NG5A 4G80B 5G4NA 2XV2A 4N1HB 3CHPA 3QUHA 3FHEA 3VWKC 2UY7A 3ROOA 2D03L 2VXUH 5B7EA 5HDQH 5HDOA 4NSKB 1M05A 5C0BA 1SF3A 1B88A 2A6DA 4WV1B 2BDNH 3MLXH 3BPNB 3KGTA 4A2HA 2HH0H 3TNMA 2AQ2A 4DNLA 1EEZA 1MJUH 5I18L 3N43B 3AG1B 4LLYA 4MNGB 1JHLL 1U58B 1XGUB 2FX9H 2NYYC 3MJ9L 3QQ3B 4KK9C 4LCVA 4YEFA 4K5PA 4Y1AA 4ZUSB 3U6XS 4FABH 2PNDA 2RIKA 4NKIL 5DZLA 1W72L 3QI9C 3T0VA 3H3PL 4QLRA 1OL0A 2D7OA 5L4FA 5I76A 5TE7H 2JQAA 4FTVD 1NLBH 4MNHB 1CFMA 3HMXH 1PSKH 1MDAA 2H1XA 3V6OA 3K5SA 2X3BA 3L9BA 3NFSH 4KTEH 4BH7A 5IMMB 1EV2E 3C6LB 3RBSA 3TYGH 3W56A 3ZXAC 3SDXF 1N0LA 3MV9D 3PQYB 3FO9B 3FRPA 3NDYE 7FABH 1IARB 2WWMD 3GWJA 3VB9A 4Y5VB 1E65A 1T2QH 2FTAA 4CJ0A 1JZ4A 4NOFA 3F83A 4P5TB 4E2OA 5GJTL 3TC9A 5KVEE 3FQRA 5L2JA 1UKTA 4RSVA 3VXPA 4A67A 1Y1UA 4OD2A 4E5XB 4F7MB 1U8JB 3TBBA 3NCJH 2Q8AH 1UASA 3ZSTA 4OJCA 1MFVA 5C0DA 4JGJA 4PGEA 2EIZA 3SZKC 4L9LC 3PGCA 3QJFB 5FKPA 3CDZB 2VDLH 2V5TA 3IN0A 3QHZL 4M29A 1XCQB 3QZLA 5JYMA 2CKBA 3ZGHA 1YEWA 4KQ4H 1HSAB 2DD8L 4MCZB 2BIOA 3ETSA 5F7AA 1H3PL 3TIDB 3VXTB 1AZZC 2NX5E 4ZNCD 1J5OL 4PGCA 1NIEA 3B37A 3O4LD 1BPLB 4WJG3 3HS9A 3BIAX 4QRUA 3G08A 1JN6A 5T5FH 2I9TA 2WQSA 5IK3B 4FAAB 3P0YL 3JUZA 1HH6A 4YSEA 2RALA 3VD3A 3PFQA 1BF5A 1G7LA 4YE4H 3WFHA 4Z77A 5JHDB 3QXDA 3VQ1C 1FVCB 9PCYA 3OB0H 3QEUB 4AQ1A 1K5WA 3VGFA 3UYRL 5C7ZA 3HG0A 1CFTA 5DRZA 5JIKA 3LKOB 5CR1A 3FTYA 4TXVB 4QAWA 1O7DE 4AQAA 4JPQA 1TT6A 4B53A 2JJSC 1OK8A 4I0PD 3D39E 5INDB 5ESQA 5FM5M 3TO4C 1OE2A 3HUJE 1E2WA 1AQMA 5IBLC 1V55B 3AMKA 3BEWB 2IOMA 1P6WA 1WFOA 3U2IA 4TNVF 4PGJA 5EORL 3OVUB 3UG3A 5HP5A 1Q1JH 2F7IA 2HFGL 3EDEA 4LDCA 3IXAA 1QZNA 4HWBH 4P5SA 4OKDA 4R7DB 5A3IC 1FLRH 1NCTA 2KYIA 3SJVE 4X42A 4XNYL 5KBNC 1NCHA 1EX0A 2VW6A 2YC1B 3P30H 1D7BA 4P57B 5DWUL 3RWEA 5IQ7H 1AHWC 2OMTB 5SX4H 4G9FE 4M7JH 5DJ8A 2I69A 1N7MH 4HHWA 2QQNH 4YH6A 4MD4A 1AMYA 2D3VA 3O3DA 1RPKA 4RA0C 3ZKND 4LNRB 4UTBL 1B3IA 4RIRA 2D7NA 2I07A 2VR3A 1L0XA 4CMMB 4XPGH 5GS0L 1T0NA 1MWAB 25C8H 4PJ8D 5TQ0H 1Y6KR 4DP7X 3B7UX 4YDJB 5IEKA 1CICB 1UM4L 2DF3A 4M7LH 1MCCA 2ICWA 2GBAA 3BO8A 4F24A 4FHJA 3VFSB 2YAQA 3EOAA 1YMHB 4G80A 4XAKD 3MOBH 2NNXA 4IHOB 1DJHA 3NCYP 3ECBB 3LOWA 3OJVC 2L04A 2W0FB 3QJTB 4HJUA 4TNFA 4ZUUB 4KFZC 1EAJA 2OJZH 4NSKA 5DJ0A 2EIJB 1CLCA 1QQDB 1CDGA 1PG7X 4WV1A 2YMOA 3KW7A 4Z7AA 5I82A 1ZE3C 5DFWH 1DUZB 1QSEB 4G7YL 5F71A 1AGEB 1FE8H 5EEVA 1N68A 4GRLC 2EIEA 5I1JL 2O72A 5FA3B 4MNGA 1XGUA 1U58A 2IH9A 3QQ3A 4YWGL 4LPCA 3U4BH 1TLKA 1L6XA 4ZUSA 1BEXA 4P2RE 2ZOOA 3BJLA 1XF3B 4ZO6A 5IGXH 2LV4A 3UGXA 3WO4B 4ZSOE 1IBGH 4EI5D 1U8KB 4XAWH 3TA4D 5BRZD 2XWXA 2WUCH 1CFBA 4P4KC 5F6HJ 3RIFK 3V6BR 4F8QA 4L3FA 4FG4A 5HGBB 4DN4H 1R34A 4F2MB 1QFUH 3RVXC 4MNHA 3BD3A 5D70H 1LDSA 1FAIL 2K78A 3ESMA 2J2ZB 2MTAA 1T5KA 3ESUF 4NO0B 4KK9D 2KZBA 3B9KA 3C6LA 4YOKA 3UAFA 1TNMA 4DETA 1A6WL 1EVTC 1N26A 2CUIA 2JV6A 2Q2LA 3DBSA 2D7TH 3FO9A 3MRBA 3KJ6H 1YAZA 3PQYA 4RDQF 5JXEA 5KSAC 5E2UL 2XN9B 2WBJB 4JREC 4Y5VA 2Z8WC 1YMME 2YMXH 3P0VH 4K5MA 2FQGA 4NWUL 4P5TA 4PJHB 43C9B 2YD6A 3UBFA 3T1FB 3K4AA 3RU8H 3ZZQA 2Q3ZA 3CVHB 3O2VH 4DN3L 2W0PA 4E5XA 4F7MA 1U8JA 4X98B 3T6VA 2KH2B 3FNKA 3BKYL 3CSGA 3AJ7A 4LEOB 4H13C 1ADQH 4HD9A 2QR0B 3QJFA 3U9WA 1DVQA 3CDZA 4JW3A 5F7LB 1NM9A 5J56B 1LO2H 5EC1B 3BE1H 4YFLI 1P1ZA 1XCQA 2CU9A 2GI0A 4BZYA 3H4HA 3F04A 3MRGB 1HSAA 4JL1A 4MCZA 4FDWA 3VXTA 3AU0A 3TIDA 2O61B 1CGWA 3U1SL 3SSGA 3ARWA 3NRPA 4P8QA 4APQD 1RFDL 1RJCA 2M2DA 4JFOA 5KVDL 3NH7L 4MMXB 3UTSB 3DXAA 2Y7LA 3ETBJ 3LB6D 4PHZA 5DYFA 5IK3A 2V2TB 3SGJA 1MCQA 1QASA 5JHDA 1FZKB 1OAQL 1RKRA 5E6SB 1FVCA 1KBKA 5LUMA 4K2UH 1F4HA 4XBMA 3VGGA 3QEUA 5HYJD 1NJ9B 4RETB 3T0ED 3LKOA 3VU2A 3SBRA 4OCYL 4EDXB 2GY5A 3SE3C 5C2BH 5DI8B 2KLSA 4I77H 5INDA 1F6AB 1YC7A 3DBXB 1QHQA 1I8KB 4FQIH 3BEWA 5HJGA 1ML0A 2VC2L 3QGVA 3II3A 4F92B 5LGHL 1HS6A 4G8GE 4R7DA 3ECUA 3HI5H 5L2KD 2YD3A 3MV7D 4NX0A 3CZJA 4X50A 1RUAH 4W70A 5ICXB 5A2JH 4P57A 2YC1A 3AY4A 5ITBL 5GZOC 2AQNA 2BS8A 2OMTA 3PL6B 4BQCA 4YLCA 1C7SA 2Q7YB 3TGXA 1F8TH 4ORZC 1LVEA 5KVGE 4Y4KB 5B21A 3GUFA 3LKPB 3KWTA 3WNMA 3VWJD 3ETBF 5JR1H 4RISH 2ZSVB 1QW8A 3AAZB 4LNRA 1I7RA 4HXAL 3VYOA 3BT2L 5L0QB 3EJCA 4N2LA 5FYKL 3B8SA 2DH3A 4CMMA 1UT2A 1BW8A 5F7EH 5DURB 4LSSH 3CDYA 2Q76B 2YPLD 1MWAA 1OAUH 4ALAC 3WFBH 2FX7L 1GS8A 1T66C 4YDJA 3QK0A 4DUXA 1CICA 1Q94B 1P4LB 1OGAD 3SE4C 5C09B 1K4DB 5IMOB 4O5LH 3VFSA 1ZANL 3F6JA 1YMHA 1RURL 1PLGH 4M7KL 3CLFH 4FQXC 4IHOA 3GMOB 3ECBA 2W0FA 4DPBX 4FMVA 4ZUUA 2Q8BL 4UF7C 2OR9H 2YK1H 2X3AA 4Z8FL 3SN6N 2EIMB 1CTNA 1QQDA 4D8OA 2C4FU 3X3GH 1U33A 1NUGA 3BKMH 1JZGA 3RGVA 1DUZA 1QSEA 5T5NG 3SE9L 1AZRA 1AGEA 5J13C 4N1EA 4OJDH 3LHPL 1U8MB 2FD6H 2F1BA 5FA3A 5C71A 2NCEA 2XFXB 3O9WC 4I2XE 2H32B 4MAUH 3EOTH 5GSRB 5LBGA 5MI0C 2OXGB 5F7BA 1XF3A 4HUUB 5JA8B 1BZQK 4AL8L 1S7QB 1U8KA 3IDUA 2FO4B 4B97A 1ZJBA 2AXHA 4O02H 5E2TH 1BQ5A 4Q56A 4F2MA 3D6GA 4LOVA 4Y7OC 5C9JB 5J12B 1XVSA 4GRLD 2J2ZA 2V7NB 4E9QA 4NO0A 5DUBB 4AGQA 3CX5J 2XG4A 2F5AH 1T4WA 1TJIL 2X6AA 2MPAH 2I60H 4TUOB 4UV4L 4KMTL 4AKQA 2VDQH 2X4PB 3DRQB 2XN9A 2WBJA 4L3ED 1EHNA 4K8RD 5LO7A 4P4KD 2NY2B 1U8LB 2WXKA 1SYSB 4PJHA 8FABB 43C9A 4KY1L 3T1FA 4NFBA 3JV4B 1KPVB 1NH6A 1PQZB 1H8LA 1UACL 2YEQA 3CVHA 3FQ1A 3UH8A 2IOOA 4X98A 5I6LA 1ZIAA 3QUZB 4L29B 2EO1A 4LEOA 2H3XC 3BIBX 4GSDL 4F9PA 1IC4H 1KY7A 2QR0A 1ES0B 1XAUA 3VDBA 4XTRC 3D39B 1JWMB 4M03A 1FL3B 5EC1A 4XMPH 2WXIA 1T1XA 3LRMA 3NCBB 2F54D 3MRGA 2ZOTA 4J12A 4A38A 1D9KC 3X1GA 4KO7A 1BAFH 2O61A 1OTSC 1U3HC 4JGUA 5CEYB 3BW9B 1G7QB 4KJPC 3EGXB 4M43H 2VO8A 3IDMB 1HZHH 1ZMYA 1JPEA 2DQGL 1DN0B 1GC1L 3CMGA 4Y5YB 1BXXA 4G9FB 4MMXA 3UTSA 4FKKA 4I1NB 4MQXD 4CVXB 5KS9F 1BECA 3D52A 1WA0X 1QHOA 1BLNB 1P7BA 5FA4B 2OK0L 4OLUL 4I1PA 4UNTA 5I5MA 5AL0A 1FZKA 1A7RH 1C5CL 4OLXL 5HHNB 1NBYB 1GYVA 2BIPA 3MI6A 3ZQXA 3NCXA 3TL5A 4JVPA 3GD1C 1IFGA 1NJ9A 1FFQA 2UZYB 1R5IB 1E9QB 3CXDL 4EDXA 3ZGIA 5HI3C 2MQGA 5DI8A 5CZXC 1X3DA 1F6AA 4HWUA 3DBXA 1FFPB 1I8KA 2JNZA 1HHHB 4WWKC 2J21A 2XZCH 5DMJB 4ADGA 1JFHA 8PAZA 5I1EH 2GG1A 3K2IA 3S88H 3S35L 2GTZB 4XCYB 1J05B 5CJOH 1U93B 3WNNA 1TCRA 4Y2DD 2A5UA 2VR4A 2WWKO 3DMMD 4I18C 5ICXA 3IT8D 2V9QA 2XTJB 1YNLL 2JKNA 2QGDA 5AW0B 2QADB 3G6DL 4NM8L 3PL6A 2E6JA 1Z9MA 3O3UN 4GXUN 2Q7YA 3P3TA 3VYPA 1HWGB 3QUXD 4LCUB 4Y4KA 3LKPA 5JOPE 4J3TA 4FTDA 4NKMA 3SKJL 3AAZA 1VLXA 2WSDA 2P5WB 4NERA 2Y5TB 4OF7A 1JNNH 3LAFA 1UT9A 2KQMA 4JDVB 3RWCB 1J11A 5DWPA 2JB6B 2Q76A 2WZAA 4F37F 2QMJA 4HYTB 2ROXA 3GYRA 1Q94A 1P4LA 3P1VA 5C09A 1K4DA 2VRAA 1B0RB 5IMOA 5E70A 4LEEA 3ZDZF 1ICTA 5MHSD 3LS5H 4ZS7L 1A7QH 1Q0XL 4GAGL 1G43A 3HAEH 3GMOA 3ZT5A 5KS9E 4PAZA 3TP4A 1TPXC 4AM0Q 3BQUD 3KLAB 4PSRA 3HFFA 4C54A 2V6HA 1NCUA 1UJTA 4A37A 1TEFA 1OIOA 1JZ6A 4K7PH 3BN9C 4LCCB 3IGKA 2X1WL 4GT7A 4G6KL 1N12A 1AHMA 1HKFA 4K3JL 5E4EC 5EUOF 2XX1A 2Y25A 4OM1L 3ZT6A 4R2GB 1U8MA 2NUTB 2XFXA 4PJ9C 4ELDA 2H32A 2J6EL 2ZQKA 4HU8A 3QQXA 5GSRA 1UD4A 5C07B 2OXGA 4N0UB 2VLME 4HUUA 3V0AC 4UB0H 2NY1B 4NCDA 1S7QA 2FO4A 1PAMA 3ZKXB 4BFJA 3ZIYA 4HISA 2CWRA 1QACA 1S9XB 3D5OF 3WAJA 3Q6FB 2UUDK 3ZE2F 3Q5TA 2BSTB 4O9HL 1BEYL 3FUKA 5B1JA 3E9TA 3KHQA 4MJ4A 5C9JA 4FP8H 1A7PL 1OXYA 1U92B 2V7NA 1OZTG 4MJHA 5KSVB 4MA3B 2A9DA 3L3IB 3D4YA 3ILDA 5DUBA 3D2UD 2PYFB 5FV1L 5C0CE 4ISVB 4PQXA 4TUOA 4Z3TA 3CN3A 1TSHA 1PZDA 4JY4B 2XZQL 3WIIH 4ODWB 2N01B 4TSAH 2X4PA 3W0WD 4KAQL 4G6MH 1JZIA 5DLLA 4GBXC 3FYEB 4LZKA 4Q6YA 5JW4Q 1U8LA 2XQ0A 1SYSA 8FABA 2R2EB 3LEYH 2YQGA 2WLYA 5E6IB 4UBDD 4B9PA 3QPXL 3JV4A 5DZ9A 1QBMH 1KPVA 4S1QL 1PQZA 5FV2A 4UANA 3VTAA 1IKFL 2IANB 4F3FB 2EUXA 1CLOL 3QUZA 4GW5B 3BAKA 4L29A 4FRWA 4UIKH 5F1NB 4NZRH 2DQDL 1ES0A 5AAMC 2EDHA 4KKZA 3V2AR 1J1OL 3D39A 1JWMA 5DRWB 1FL3A 2BRRL 3ERXA 5INCB 1IM9B 2Y36L 1SOXA 2Y07H 5FS5A 4P9ML 2XWEA 5HSFA 1YEFL 3OKOB 5FHBL 1G0YR 3IGFA 5E1HB 1TQBC 5JIHA 5CEYA 3BW9A 1G7QA 3EGXA 3IDMA 3CXHK 1HT6A 4ZMWA 2HRPL 1WIUA 1DN0A 4PJAF 3VI3E 4Y5YA 3SKOB 3W37A 4G9FA 3VXRD 3EYQC 3MJWA 5D72L 4G43B 2P24B 3BUDA 3TV3L 2WAHA 4CVXA 4NP4L 1X7QB 5AW3B 3PJLA 1BLNA 5KVDE 2DQHL 5FA4A 2DLEA 2C7UB 1CBVH 1WV7T 3ML9A 2ZX7A 5HHNA 1NBYA 3HCVB 1NUFA 1N4XH 5AKSA 4YHML 3OGOE 4XCFH 2UZYA 3ZE2E 1R5IA 1ET8A 1E9QA 3EZJB 2GC4C 1KBWA 3IRZA 3VD2A 1MCRA 1CZ8L 5AOJA 1FFPA 3K3QA 4DP1X 4TPRH 1HHHA 3C60D 3FUMA 1P4IH 4TULL 1NMCB 3A4AA 3GRGA 2Y5QA 5A16B 3P2DA 2OMYB 2GTZA 2IWFA 4XCYA 4NZDA 5SX4I 1TYEB 1J05A 3GI9H 1U93A 4R4NC 1SGKA 1UA7A 4C4BA 3I75B 1S2EA 3AT0A 3L13A 4GP8B 2BFVH 1ZIBA 1WEJL 5EU7E 5JHBA 3NIGB 5AB0A 2F0CA 5FYLH 5HI3D 3T2NH 2FBJH 5EO0B 4IRSB 4LCUA 4BCZA 3WO3B 1OVZA 3OMAB 1FNLA 2X44D 3DK2A 1OAYH 1SXZA 4YHPB 3WS3B 2EDFA 2P5WA 2Y5TA 2IPUK 2Z64C 4MAYC 1MWAL 1ECYA 2DJUA 1JSYA 2A1WL 1ZT4B 3MN8A 4JDVA 1N5AB 4P2QE 4Y16C 5F0PB 3RWCA 2JB6A 3D85D 1VRSA 5EF2A 4PW4A 5E8NA 1AKJD 4TQEH 5FYKE 2OL3L 4AUYA 1B0RA 1HYRC 2WVSA 2VR6A 3QO0B 4PS4L 1HE8A 1HDMB 5SWSE 1EHKB 3KYMB 3QQDB 3CVBA 5ABZA 3KLAA 3QPQC 3Q06A 3IMTA 3TCXA 5DD3H 1K3ZA 3DPDA 4QRBA 1BD2E 1CPUA 3QDMB 4LCCA 4AK1A 1R5VB 5I0XA 1QNIA 4D0DB 4TNWF 3ESOA 2RHEA 1IT9L 1YEKL 3FPYA 5H37H 5JXAH 1KIRB 4YXHH 2WSPA 3OKKB 1S3KH 2NUTA 3TF7C 2QSVA 1E2ZA 3KH3A 1IFHL 4C47A 5CCJA 5C07A 4YZFE 4DP9X 2E9IA 4PD4K 4N0UA 2WINB 3PLYA 1WG3A 2HN7B 3L48A 4FFTA 3TJPA 1FH5L 4U7MA 1OPOA 4KJWC 3ZHFA 5EU5B 3BN9D 4PRDB 4EUPB 3LX9A 4EI0A 1S9XA 1TMQA 3SDYL 3Q6FA 3MLZL 5EO9B 5K1VA 2BSTA 4YDKH 3BEVB 2PWEA 2H0JA 1VFAB 2DBLH 4HK3N 3GDBA 1KN4L 5FDYA 1PLBA 4XNMB 4XP9L 5JIIA 1U92A 4QRRE 2ZXDA 5F96H 4YR6B 4XMVA 5KSVA 4MA3A 3H56A 3L3IA 3EAKA 2PYFA 5CN2A 2YFNA 4KGLA 3BVNA 4ISVA 1UADC 3VFUB 4QHUB 3C87A 5I6KA 4M7ZB 4ODWA 2ZT9C 4M62L 4BGDA 1QR1B 1D3CA 3H6AA 3QUYB 4H20H 2HT2C 5T3XL 4W9ZA 3TN0C 2X53A 2ZCLH 4F91B 3ECWA 1NEZB 2R2EA 5E6IA 1U6AH 3WTXA 2C3XA 2VMEA 1XMWA 2IANA 4F3FA 4GW5A 3IBEA 1GA2A 3O41B 5E0QA 4KZDL 5F1NA 4MTMA 5I1GH 2MEJB 4N8CL 2GTWB 2NZIA 4BYHA 4M5YL 5HY9B 1INDL 2PYEB 5DRWA 4A2DA 4Y9BA 3PAVA 5INCA 1QPXA 3BWUC 1IM9A 5GGTA 5CD3B 3HG1E 3GHPA 3HNSL 2VR9A 1MUJB 1CGSH 3CFDB 1DL7L 2C34A 4TF4A 3OKOA 1Z9SB 1AR1D 5I8OH 5DK3A 3RDTC 4OF8A 3UBXI 4KI1A 2C3HA 1JZ7A 5HVWA 3FN9A 1ZA3B 3OAUL 2NYZA 3Q6GH 2HTKD 3HR6A 4A7SA 3NJFA 4ECNA 4WWOA 1TQCB 3SKOA 3PU7A 1Q9WB 4KVNH 4PJCF 1THCA 4G43A 1NICA 2P24A 1X7QA 4QOKB 1S7RB 2X6CA 2PWHA 2ICES 2A6KB 1MI5B 1XF4B 2IDCA 4XXWC 5ACLA 2H0FA 3HCVA 5BUPA 2XLLA 4WU7B 1GGUA 5GGQL 1IGIH 4H1LG 3QULB 3ZN6A 1UJ3C 2BWIA 4GIPD 4F8PA 1JXGA 1UWYA 3QFJB 5FW6A 3L3HB 1I85C 4FMKA 1CN4A 4M4PA 1FFOB 3I2CL 1IO4C 3T2PA 5D71H 3RKPA 5A16A 2B1HL 1MREL 2OMYA 2VXTL 3E8VA 4FLQA 2IEPA 3VD4A 1AQHA 4LL1A 5I23A 2NY5L 4YXLH 2K3TA 2Q7AA 3A6BL 3QDJB 5AVRB 5DEGB 1CGVA 1Z5YD 3I75A 1NCAL 2R0KH 3T6XA 5CEZL 1OB0A 5EO0A 3LH8A 4IRSA 1MFDL 2OMNA 1GSKA 4O58H 4RGMC 4JHWH 4XOAA 4Y0GA 1NSNH 2O5XH 1YEIH 2O5YH 4YHPA 35C8H 5JPMC 3TA3C 4KK6C 3T77B 3T5WA 1ZT4A 1N5AA 4R4ND 1BF2A 4H8VA 4PJGB 4JFXB 1PIFA 4XR8C 4D3CH 3UGUA 1VJSA 4TL5A 2YUXA 4FQPA 4F58L 1W80A 4H26B 1GAFH 5AVXB 1KB5H 4JKMA 2PPEA 1MFBL 3DYMA 3NK3A 3QDGB 3QO0A 4JFHD 1HDMA 2CR0A 2C1PB 2B2XH 2HRLA 4N90E 4PJCE 1KACB 4WUKH 4XB3A 3ZDYF 2AEOA 2J72A 2VN6A 2Z31D 3KYMA 3LIZA 4FQQB 4CUCA 5IMLB 3QQDA 3E3QE 4TLKA 2XV3A 1KJ2L 3II1A 4XO5A 1I7UB 3FFCE 3QDMA 4PJDB 1R5VA 4LGSB 5F9AC 1X4XA 4D0DA 1I31A 1S9VB 1EZVX 5JW3H 2VISB 2QKIC 4IOIB 3TZVD 4EMZA 1DBBH 3RWJB 1KIRA 3OKKA 4MS6A 5I6PA 1CDBA 2JCCB 1BWMA 5H4YA 1Q72L 2ZKHL 2XBTA 1FGNH 1P6AB 2WINA 1VB9A 2HN7A 2QZ5A 3GJFH 3QPQD 4L4VE 4KVCL 1LWRA 4X8XA 3F01A 5EU5A 2DQJH 4PRPB 3W11C 5D2NC 2R8SH 4PRDA 3OL2A 4EUPA 5EOQH 5EO9A 3CFCL 3CDCA 3H6JA 3BEVA 3Q1EA 1VFAA 3LKNB 4UYQA 3T3PE 3VD1A 4QTHB 4XNMA 3VVWA 4YR6A 4AUJA 1BXAA 4GQ9L 2OZNA 1ZSDB 4E9SA 3UFIA 1BQHG 5G55A 4RFNC 3VFUA 1EJOL 4QHUA 3C5ZC 4JG5A 1QR1A 2IBGA 3GFUA 4BRJA 3QUYA 1DLHB 3FO1B 1OSYA 1TZGH 2J8HA 4PJBB 5ERWB 1NEZA 4WK4B 2ZAHA 1A4JB 2IAMD 3MJGX 3DGGB 3CZNA 4U0RB 3CN2A 3VA6A 1NAKL 3CBJB 3KL5A 2LQRA 2J55A 1JV5B 3OAYH 4XN1A 3O41A 2HG5B 3FRUB 2GTWA 4FFZL 1BDYA 3ZDYE 2PYEA 3F6LA 2X10A 4Z7NB 1CDIA 3N1QC 2VL4A 4J5VA 4MGXA 4AJWA 5JPNC 2IDTA 1UKQA 4KUZL 2AQ1A 3CAFA 1NCWH 5CD3A 1OPGL 1R3JB 3L3OC 2JF1A 1MUJA 3QAZB 1C08B 3CFDA 1AKPA 1OT1A 3KPRB 3OGCB 1L9SA 3H42L 2BOLA 3E8UH 3TBSB 5TE4L 5F21B 3F6IA 3PXLA 4L8CB 1QPKA 1ZA3A 2LVCA 4N0YH 2BNQD 1GOHA 4GMTL 1BYPA 1I53A 3HS0C 2OTUB 1Q9WA 4TRPL 1G9NC 4HUVB 4QOKA 1S7RA 5IVZB 2YARA 5F9OH 2CQVA 1TZIB 3MQIA 3V8OA 3ZL4L 2A6KA 1L0YA 1NDMB 2DKSA 1MI5A 1XF4A 2C5DC 1KCBA 2YA1A 3MCKB 4H8QA 4KNUA 3NZUA 4WU7A 2DWYA 1RZKL 4XCCL 3WXVH 1MRDL 2EEXA 3KPSD 3QULA 2AXGB 3EJSA 1BYOA 4MRBA 4F80A 1I1RA 1SUJA 5IHZB 2CBTA 3QFJA 2YLKA 3L3HA 3NA4A 2ZXAA 4L0ZA 3AXLB 1CLYH 3WXWL 2VM3A 1FFOA 5I9QC 2CIKB 4B9KC 3GKWH 1YA5A 4F7EB 2V2WB 2GB2A 3U7WL 3L4CA 3QDJA 4IM8A 4LQFL 4N0RA 5DEGA 2J57A 4FI7A 1XV8A 3TPUB 1TITA 1PNDA 3L4YA 4YQXH 4XBGB 2FHBA 2XXFA 3C08H 1BQLH 2VDNB 4UOQA 2P8LB 2VMDA 3A24A 3PYCA 5EULV 4WTQA 2TRHA 1DQLH 1M1SA 2BO0A 5HHMB 3RHWK 3NPSB 1IE4A 1U3JA 5GS1B 1IEBB 1H19A 4GW1B 3TIEB 3T77A 2O5ZL 3VSUA 1R3KB 1AI1H 2BY1A 1TR7A 3CE1A 4PJGA 4JFXA 3UO1L 4MVBD 3FFDB 3IDNB 3TOPA 4FYSA 4HOZA 1CE6B 3LJ3A 5D1XD 3B34A 4H26A 2F18A 3FHAA 5HJBA 1A47A 4FFYL 1AXTH 3ZRSA 5SWZE 1NAMB 4PWEA 3JWOC 1YNKL 2CO2A 3QDGA 1CLZH 1QZ1A 5EZIL 5KVGH 4HJJH 2C1PA 5E8DH 2H4EA 5KN5B 3FT1A 4OW6A 4R96B 5IMLA 4FQQA 3RKDD 4FFVD 1RUMH 3TA3D 5D7SL 3SPJA 1KB3A 1I7UA 4TUKL 4Z3JA 1AO7B 3SDAC 4JM2C 3FDWA 2EE3A 4PJDA 1EAQA 1MCKA 1S9VA 1KFGA 3WNLA 3RZCD 4M1GH 2VISA 5EC2B 4IOIA 3DGDA 3RWJA 4YK4C 3LMJL 3N55A 5FWRA 3FH5A 4ODTL 2JCCA 2DLIA 4ONGL 2IH3B 3S37X 1X9UA 4MA1B 4RMSA 4YC2B 1OT2A 2UZIH 1YEJL 3EHBB 5JW4N 3ARUA 1I1CA 4YDNA 4OLYH 3TNNB 3KBFA 2KDYA 4HPHA 3TT1H 4ZJ9A 3QQ4B 3L2LA 4PRPA 1DO6A 1RERA 3H8NA 5FLUA 2B4CL 1CI5A 2D03H 1L6ZA 2HXAA 3BLKA 4UMSA 1XF5B 4HWEL 3NTCL 1RQ5A 3EJTA 3LKNA 3U46B 1FG2B 5DT1L 4QTHA 3PGDB 4WY7L 3PHSA 1KV3A 1RXLA 3ZLQC 1RIHL 4KWUA 1ZSDA 1J86A 3ELQA 4NBZB 5D2LF 1T0PB 2PPCA 2QBWA 5I18H 4I3SL 2JH2A 4WKZB 1JHLH 4YBHA 2V5MA 4WTWA 5C9KA 3T3MF 1XT5A 4F57L 1DLHA 3FO1A 3W11D 3EO1B 4PJBA 5ERWA 4ZO7A 4NKIH 2FQFA 1A4JA 3N50A 3NEEA 4HCIA 4K0OA 3SBQA 3DGGA 2YGVA 3P4NB 5T3XE 4RAUB 3RTQB 1A5FL 1WAAE 5BZWB 4BXSV 2GK0B 5LBSA 1JV5A 2XWJB 3DUUB 4KDTA 4PRID 4N26A 5AVYB 5J1AB 5MENE 2HG5A 3FRUA 1RLWA 4H0IA 3BKCL 4M02A 5B1CA 2WCGA 2H0EA 2KLRA 5LQBL 2XYBA 3UDWC 1C08A 2JJTA 3KPRA 3GRWA 3OGCA 2PP7A 3AC0A 4Y8DC 4XO3A 3TBSA 4LASL 4DCQB 1FC2D 4L8CA 1MN4A 3PRZA 4RBPH 5TK4A 1BM7A 3WUWG 1MG3C 4OLEA 5F0JB 3VFMB 3V79C 5GJTH 1ZK9A 4RZCB 2R0WL 2OTUA 4GEJA 4H4NA 4HUVA 3CTTA 4W6YB 3JQOB 4JHUA 3QNXB 5IVZA 4IJ3C 4AMWA 1TZIA 3KNBB 4HAKA 1NDMA 2BP0B 5DD6A 3MCKA 3LKQB 4ANXA 4XXCC 3SY0B 2EADA 5FM5O 3QAQA 4MJ5B 4QDGA 2AXGA 3A3YB 4P2QA 3TBTB 1HL9A 3CUPB 5JNYB 2VYRE 2X6UA 2DD8H 3D7PA 5IHZA 1Z1WA 1G0DA 3VXSE 5K9OB 5KYWB 1H3PH 4QGYA 5DZNA 3C5XA 1U8HB 5D2LE 4AKOA 2FWUA 1UT1A 2CIKA 2DQEL 3VFOB 2Z93B 2G4EA 4YIQB 1IAIM 2HLFD 2AZUA 3JV5A 3T3ME 2V2WA 4F7EA 2BIMA 1NQBA 5ES4B 4ZW5A 1RY7B 5M7QA 3DYOA 3TPUA 4HFUL 2YXWA 5B8CA 4OGZA 1NFDF 2W59A 4KHXL 5DMKB 2GSGB 4XBGA 3LXUX 1INEL 4GRWB 3A6OA 4OT1L 2P8LA 4L4TB 3UYRH 3G7TA 5ANHA 1FYTD 4BH8B 5CEZE 2WBXA 1HHJB 4FXKB 4UYPA 4YSQA 3UP6A 1ZV2A 3L6FB 5C0GB 1BVNT 5TPWL 4MJIE 1ORQB 1UZ8B 2G5UA 2VLRB 4X9BA 5GS1A 1IEBA 1OY3B 4XPTL 4GW1A 3TIEA 4ZD3H 2QLVB 4P04A 4OIAA 2APVA 2VQ1B 1R3KA 4L4VB 1S7TB 3FFDA 3IDNA 4NNYB 4WHYH 4YSDA 5EORH 3QS3A 1CE6A 2HFGH 2WKGA 5AW5B 2WXHA 1EJFA 1CFQB 3D0VB 4FZ8L 4YGVB 5B4MD 3T09A 4OGQC 1NAMA 4PWGA 5DWUH 3ABMB 4J6RL 1AGBB 1LK3H 2E27H 5KN5A 5F3HB 5DLML 3RIKA 4R96A 4AQ8C 5EEYA 1OAZL 3POCA 2HX8A 1ZLSH 4HG4J 2OKMA 6FABL 3D08A 3T4AA 4OJAA 1AO7A 5IQMA 1CURA 3VFPB 3UPRB 4UTBH 3K2UH 3CSTA 1F4WL 3BLPX 5HDRA 5EC2A 5HGDB 2CNYA 4G82A 3WFCH 2WOYA 5GS0H 5DHVH 3HBZA 4I13B 1TNNA 2IH3A 2OULB 2ADFL 1OM9A 1UM4H 3APDA 2QKSA 4OVVA 2KLTA 4XVOA 3SDCB 3BQVA 1E6OL 2HVKB 4IGBB 3TNNA 1U3NA 3WUZA 4YHLL 3QQ4A 4RX4D 1UYWL 2J88L 1G1OA 1XF5A 1NFDE 1QRND 3U46A 3G6AB 1FG2A 4DUVA 3PGDA 3QC6X 1HL8A 2VM9A 3H7LA 2EABA 1MVUB 2HT3C 4J8QA 2HJFA 4G7YH 4UM9D 3PWPB 5ALBL 1SXBA 4WKZA 2V9TA 1MHCB 2ZUXA 4RMWA 1IC7L 4R26L 3TEUA 4TQHA 2ZKMX 3EO1A 1OWWA 4PRHD 2NXYC 4JANB 1UB6B 5HHOD 3R1GL 3ARGD 3P4NA 1KYFA 1CFNB 2OSWA 1O7DC 4TSCL 3RTQA 5KSBB 4PWHA 1KCVL 5BZWA 2GK0A 1IGCL 2XWJA 3DUUA 1M53A 2Y7NA 5J1AA 3WN5B 5J1TC 2DLFL 2FATL 3C09B 2EACA 2W95A 2PO6B 3UTTD 4X9GA 5I8CB 4I5BB 4FNUA 4HEPA 4N2BA 4JFEE 4PP1D 3L5JA 2G60L 5AFAA 5CILL 1EDHA 2ENQA 3MACL 1C16B 1USZA 1P5VB 4OCWL 2Y1YA 2WLLB 2YGNA 4JEGB 4RWHA 5FYLD 3RGBA 2PW1A 4KKAC 3VFMA 5I5RA 4P06A 4YSOA 2PR9A 4DN3H 1AR2A 2JIXB 3LY6A 4WRLA 3QNXA 4A1RA 3NUKA 4UQ9A 1OW0A 2A2QT 2XKSA 2VDKB 3KNBA 4RGND 4WTZA 3ZE1B 2BP0A 3D1MC 1AG0A 1KBGL 3ZYIA 4ZO8A 2M83A 3LKQA 5ICYB 2RH0A 1ZLEA 3SY0A 2FJUB 4CU8A 5I26A 4MJ5A 5ADOL 3TBTA 3CUPA 3E2HC 4OFKA 4P2AA 1HIML 2PPFA 5JNYA 1JXJA 2AEWA 1TYJA 5KYWA 4YE0A 5I5IA 5K9OA 3JV6B 1U8HA 1SN2A 2IVFC 4FEMA 4TVPL 4F7KA 4KX9A 2EEDA 1LILA 1E4WL 3GSRB 4PG9B 3U1SH 1M7IB 1RFDH 4HS6B 1H8OA 5E99H 2WLIB 3VFOA 4JFDB 1KEML 2Z93A 3NH7H 4YIQA 3H7BB 1IC1A 2G3NA 1KENL 3GXMA 3V4VB 5EBGA 2XVBA 2YXMA 4M8QB 3L7FB 2F08A 3F7PC 1H9DA 1FORL 2NY0C 5DMKA 2GSGA 4LAQH 4ONHB 4Q58C 3RY6A 4X5QA 3BAJA 2WP3T 1VFUA 3MRNB 1T83C 1CFSB 1G7JB 2DAVA 3BUTA 4L4TA 4X7FC 4YL4A 4BH8A 3DWTA 1HHJA 2Y7QB 4FXKA 1YN6B 2XJKA 4NQDE 2Y22A 4U2YA 3ZHDA 4OCYH 3L6FA 3EGSB 2IGFH 3QA3B 5C0GA 4D9QE 4EN2A 1ORQA 2VLRA 43CAB 1F11B 3UZQB 2APFA 2WANA 2XBDA 2FECI 3ARDB 3N85L 1IQWL 2VQ1A 7CGTA 5HHVL 4L4VA 4DK6A 4P9HH 1S7TA 1MFEL 1IGFL 2VERN 4FNLL 4NNYA 5LGHH 1CFQA 3D0VA 2OI9C 4YGVA 4QY8B 3BT0A 3OF6D 2N0MA 5FEBA 2P80A 1AGBA 5ITBH 5F3HA 1TTCA 4KXCA 4OTXL 4N2HA 3P4LA 1LO5B 5C0JB 2LFEA 2UVEA 3AUVA 5TFSL 2CD0A 4EZJA 2YAMA 1HXMB 2QZQA 5ENWB 1LO0L 2ENYA 4M6ML 5D8JL 3VFPA 3UPRA 2NT1A 4HXAH 2IQ9H 2CBQA 3ZMEA 4B9YA 5FGRA 5C0AB 5FYKH 5HGDA 1X4YA 5IW3A 1J18A 2HJLB 3TJEL 3WHXB 5A2FA 2FX7H 4XC1L 5LG6A 4NDMB 1V3MA 1IJ9A 4LHUD 5SX5K 2F1AA 2P8MB 3SDCA 2EKSB 1ZANH 4FX5A 2HVKA 2P47B 4IGBA 1WHPA 2O6CA 1RURH 4M7KH 5E24E 5K9QG 5KYUB 2FWSA 2F8VA 3KXFE 2Q8BH 5KAQF 4N2EA 4W9IC 4P07A 1UH4A 3G6AA 3BVVA 1KXQE 4Z8FH 5DR5L 5PAZA 1MVUA 4FQJL 1TO5A 2WHVA 3SE9H 1S7WB 3PWPA 4N28A 2WN3A 1M3IA 2XT1B 3LHPH 3TBWB 5CU9A 2P1YA 4G70B 4RRPA 1SJVA 4ZOAA 4YS4A 1KIUB 5F72S 3IU4L 2P5ED 4XX1E 3OKEB 4JANA 1YUHB 2XZAL 1UB6A 1WF5A 1I9IL 2NX5D 2YXFA 3BAXA 3J07A 3JSSA 4MKTA 4AL8H 3F7LA 2BRQA 3AY2A 5KSBA 2FVNA 4PJXB 5I0VA 3NIGF 5GZNC 3G5WA 3WN5A 3LHAA 4ONOA 4QRAA 5J89A 4KV5F 2PO6A 3GRWL 1F41A 5KUMA 5CJ5A 5I8CA 3EYOB 2YAOA 5D7EA 3RFRA 1TJIH 5EBLB 5F6IC 4UV4H 4KMTH 3C6SB 3FQWB 2NXYD 4WWNA 4Y4FD 3SEPA 1C16A 1BOGB 1P5VA 3L3KB 5MERB 2WLLA 1P7HL 3QZBA 4RNRB 1J1XL 4KY1H 2EVFA 4QYOB 2BVEA 1UACH 3S96B 4LLDB 2ZUTA 4LPWA 4WW2B 4AXWB 2JIXA 1W15A 5MP6L 3S3DB 1YYMH 3FBKA 2QQLH 4HC1L 1EANA 1EFXD 1NBZB 4GSDH 4PUBL 2BIIA 1IX2A 1PZSA 2V8MA 2Y3AA 4AGNA 1R47A 3SJVD 5ICYA 3HMWL 3OR6B 5F7FA 5BZDB 5K5YA 3UROR 1Z6JT 3QORA 3B9EA 5DRXB 1YZZA 3L81A 5C6TL 3VXQB 3APCA 1LJMA 2Y7SA 4BK8A 4KKAD 3JV6A 5LNEA 1J87A 2E3VA 1UEMA 5GGUB 3GSRA 4PG9A 2NW2B 1G7PB 3UZEA 2WKOA 1M7IA 4HS6A 4UQ3B 3T2LA 1P69B 2DQGH 2WLIA 4CW1B 4URKA 4JFDA 1GC1H 4KKPA 4XPFL 3H7BA 2J71A 4GXUM 3V4VA 4W4OA 3I85A 4M8QA 1OTTC 3L7FA 3UG4A 1ULVA 2PCYA 4YSSA 2OK0H 4OLUH 4OJYA 3CU1A 4XMKL 4GXVL 5IP4A 1C5CH 4MYPA 4ONHA 4FCHA 4HJGB 4OLXH 1B4JL 4FERA 3MRNA 1XGRB 1CFSA 4PBDA 1G7JA 4JX0A 3GS0A 1X5XA 2Y7QA 1TJMA 1YN6A 2G0LA 1LTXA 4U0QB 1SFHA 3EGSA 3QA3A 2AJUL 2VZ3A 4G6AC 1YRKA 4KV5E 4S1SH 43CAA 1F11A 1KJ3L 1R3HB 3UZQA 5C0FB 3ARDA 2EVHA 3EBHA 3WIHA 2BOBB 3IS1X 4KITB 4MDJB 4NUQA 2BNUB 3S35H 1G7MB 3ZZ1A 4V33A 5EZOL 5C08B 4XMUA 4QY8A 4HH8A 2VDPL 2E47A 1YNLH 1ZD6A 3NYKA 4R97B 3G6DH 1AQDB 1Q0YL 4NM8H 2CGYA 2YSTA 5F6HI 1SXNA 4P2RD 1LO5A 5C0JA 1HNYA 4R0LB 3QNYB 1ZK5A 1PZ5B 5BOZG 4UUJB 5I30H 2K4WA 4DQAA 5ENWA 1HXMA 4FKHA 3SKJH 2W8CA 2DQCL 1OP3K 1KDJA 4HZAA 1HCVA 5C0AA 4P99A 3MLWL 2XZZA 3PAYA 2HJLA 5HVHB 3BISA 1WHOA 3WHXA 4B41A 4OFDA 2R39A 1HWWA 2ZWZA 3OKDB 4NDMA 5GRVL 1T7ZA 4WGKA 2P8MA 1H8SA 1T0MB 1XTMA 3HC4L 3KPOB 2EKSA 4JZOB 3MSPA 2XXCB 5I6OA 5CP3A 1ZVNA 4X80L 3RFZC 5FW7A 1O6TA 4ZS7H 1NM4A 1HEHC 2IADB 4GAGH 4M6NH 3IDGB 4KDWA 4QHKI 1KLFB 1YMMD 2AVFA 2FWOB 2IAAC 5CXPA 2IOIA 4L1SA 5AVZB 5KYUA 1P84J 2OJ1A 5ANMB 2ZG1A 3UAJD 3U6XA 4FYQA 3HE7C 3VJ6B 2LTQB 3VU1A 4JFEB 1VSCA 4R90L 2BJML 1EBPA 1OOAA 4OFPA 2AW2A 3QCTL 4N0CD 2HB0A 1BQSA 4JCMA 1S7WA 4OM1H 2HMIC 3WKYA 3TBWA 1JERA 2K4AA 5E7BA 3UCQA 3WTWA 2VUYA 3ELAT 2J6EH 3SKMB 2HJKB 2XQYK 3WIAA 1KIUA 1FG9C 4Q2ZB 5CGBA 1D5IL 4LPYA 3OKEA 1YUHA 3MR9B 1H6TA 1EAPB 2BNRE 2COQA 1EZVY 3GXPA 2XQYG 4PJXA 5E5RB 2HT4C 5IWLA 1RHHB 1TCMA 1KXVA 2JKLA 4O9HH 1BEYH 1FNSL 4Z95L 5LLIC 2CXGA 2J8UB 5FK9B 1J0ZA 1QSFB 1HSBB 2CCWA 1T3FB 2Y06H 1PD6A 1XIWD 3ARXA 4QJ5B 3EYOA 5IFHL 5EBLA 1PZAA 2Y2TA 3C6SA 1CD8A 1CYGA 1GKOA 3FQWA 1JDCA 2BXYA 2XZQH 3MAWA 4HMCA 4XCEB 3DO7B 4ODXB 2B77A 1BOGA 3GPSA 3L3KA 5MERA 4J3XA 2WVUA 1I1YB 5CINL 4RNRA 1YVLA 4UNUA 1ZXQA 4URTB 1IKOP 3QPXH 3T9WA 4QYOA 4S1QH 5GRUL 3S96A 1CDUA 1IV8A 4LLDA 4WW2A 4AXWA 4R84A 4JE0A 1IKFH 2KL6A 3LD8B 4KI5F 4X5XB 1NBZA 4YSCA 3FQ4A 4W9DC 4G8GD 1FL6B 1Q9LB 2DQDH 3HZMB 4YLBA 1TEGA 3IXTB 1ANUA 1J1OH 3MCG1 3OR6A 5H8DA 5BZDA 2DWEB 4PJDF 2X89D 3OPZL 3D34A 2Y36H 1MRCL 1HFUA 5DRXA 1WT5A 4P9MH 5EG6C 3VXQA 5GS0C 1YEFH 5GRJL 1G7HB 2IWEA 1WK0A 5FHBH 5GGUA 1CQYA 3I74A 1J0KA 2JCCF 2GJ6E 1Z0MA 1G7PA 2NW2A 4ZI8A 2KZKA 2DN7A 4UQ3A 2HRPH 4Z3HA 3VGHA 4CW1A 1ROWA 4U6HB 5ESAB 3HLKA 3VFVB 2VTFA 2BVPB 3DX1A 4TVPE 5D72H 2QQQA 3MRQB 1I9JL 3TV3H 3K71B 4NP4H 2QPDB 1X5ZA 1EEQA 3RZWA 3ZUCA 2B15A 2ZNWA 2Z65C 2D31B 4MX7B 2XPYA 4N86A 3FSVA 4DGWC 5IQOA 4HJGA 3FKUS 1XGRA 4J4PA 3X3FL 1AQ8A 4YHMH 2AJZB 3HB3C 1CGUA 2EUVA 5E1QA 1ZHBB 3WTYA 4WO4D 3QG7L 3WV0A 4J6IA 4PMFA 2WBWB 1CZ8H 1BJ8A 5DVNA 1D7FA 1R3HA 5C0FA 5F1OB 3WU1A 4HGWB 4UM8B 4XH2B 3FUIA 4XODA 2BOBA 3CK0H 3CBRA 2R7EB 3ML8A 1DE4B 4MDJA 3DDGA 5KYXB 4PJBF 1LM8V 1AZUA 2BNUA 3SBWA 1G7MA 2YEZA 4Z7UB 5C08A 2DEWX 4AK2A 3HNTL 4WEBL 3S9DB 4BZ2A 1AQDA 3B83A 4MWFB 1WEJH 4RMVA 4WGVB 3U30B 2HCZX 1L4IA 3D05A 3OM3B 3QUML 4ZZKA 2RCSL 4R0LA 3QNYA 1PZ5A 1DQDL 4U4BA 4UUJA 4PJIF 3B1TA 3X14B 1SNRA 1TMCB 3FQYA 1S46A 1MWAH 2A1WH 2D0HA 4J3BA 3JVGA 2WIIB 5BQ7B 4YXKL 4NM4L 3OKDA 4E9RA 4XPHL 2OL3H 4GG8B 2W9EL 3NMEA 1T0MA 3KPOA 3KBHE 4JZOA 1LO4L 2WXJA 4PS4H 3UYPB 5IJDC 2W5PA 3NACL 1T6BX 2IADA 3WFEL 4HEMA 1JPFB 3IDGA 2A3TA 2FWOA 1KLFA 3KPLB 1UWXH 4TQIA 2ED6A 2XA8L 4P2OD 5LXVA 2J5LC 5ANMA 3VJ6A 3O8XD 4XXDA 1E50A 3WEBA 4JFEA 2DIEA 2CMRL 1BLIA 4X8JB 1N6VA 3LNHA 3RNKB 3NIDB 4K9EC 3S5LB 3QJUB 1YEKH 1NLDH 4G7VL 2ZUSA 1RZPA 3I50L 4LK4A 3IGUA 1CR9L 1JCVA 1IFHH 3ZYOA 3LXCA 3SKMA 2HJKA 4ALAL 1IKNA 3P4MB 4LCYB 5IVXB 4HS8L 2EVJA 2I24N 2XYCA 1RIUL 4JGMA 4XI5C 2F53B 4NZUL 1ZLUH 1FH5H 2GKIA 3MR9A 3BD4A 2I7SA 4KHTH 2D7QA 1EAPA 3FU7B 3NRQA 3O0RL 3QCVL 1MKFA 3QIUB 5I1CL 2WYTA 1RHHA 4OKVB 3TH2T 2WZPD 3H2QA 2VT0A 1UH2A 1KN4H 4KUCF 4XP9H 2J8UA 4L9DA 5FK9A 3ZTJG 3MBXH 1QSFA 1HSBA 2YPKB 1T3FA 2ZYIA 4OQTA 1IRAY 2FX8H 4KZCA 4PJIE 3TVMC 1J5IA 4HX1B 3CDFA 3DROA 2EIBA 4P9HC 4A6YB 4UZUA 3D8MA 5BRZE 4HU2A 3DO7A 4XCEA 2B59B 4M62H 3KW8A 4ODXA 3V9EA 1G6RL 3QIWB 1I1YA 4HIEB 3IMWA 5FUCC 2KC0A 5CJXC 2OZ4L 3FL7A 4A04A 3GMPB 4K3HA 5KOVC 4LEXL 3QZWB 1ZTXL 4UOW0 1URIA 4X5XA 4IOSD 3MRLB 2YHGA 1FO0B 5LHDA 4KZDH 1FL6A 1Q9LA 3HZMA 4M5YH 3JTSB 1INDH 3IXTA 4UILH 5KVFL 1KIPB 2DWEA 5BUGA 2ZYSA 4MZIA 2IFFH 3HNSH 3KM2A 3QPKA 1QATA 2GUYA 3LN5B 1DL7H 1FVEB 1NDGB 2E8YA 2OM5A 3NSXA 1SOKA 1WAPA 2C3WA 3QO1B 5H94B 5JOPD 2VXVH 3OAUH 1MHPL 5LCVA 2H8PB 3SPIA 3WJLA 4PCSA 4E9LA 2VR5A 4U6HA 5ESAA 2AJYL 3VFVA 2BVPA 1HHIB 1WZ1L 3LN4B 5E9DE 2E75C 5FIEA 4KNTA 5D7LB 3K71A 2GIYA 1CGXA 4Y4HD 4MX7A 3TH3T 4JPWL 4X6DB 2Y1VA 1ET7A 5GS0D 3H53A 1ZTMA 1V05A 2AJZA 4CVWA 4KC3B 1ZHBA 4JRWA 1AP2B 5D7IF 1LDPL 5DA0B 3E9UA 3O3EB 4HGWA 4UM8A 5C3LD 4XH2A 1F42A 3HRPA 4L0YA 4UDTB 2X05A 3V0HA 3I2CH 2R7EA 2VLLB 1U2HA 2HUEA 1DE4A 2XN1A 5KYXA 2B1HH 1MREH 1JRHL 2VXTH 3A6CL 3S36H 4AL8C 4Z7UA 1SY6L 3INUL 2NY5H 3N44B 3O6FD 1JYNA 3A6BH 1GPOH 4PW9A 3LPPA 5MEPB 4WIQA 5IHUL 2CIIB 3V6OC 1A4BA 1NCAH 4MWFA 4WLCA 5CEZH 1NC4B 4HP5A 2VXUL 3UBHA 3TTYA 4L8SB 1EA9C 2EO7A 4K71B 4BSWB 1BAGA 2VLMD 3CD4A 5HI5C 1OSEA 5JIMA 1NCCH 2B14A 1SMDA 3H2WA 3HZYB 2Z0UA 4JFTA 3X14A 3HBGA 1U8NB 4K4KA 5T5NF 4Z7WE 2I27N 2WP3O 3SQOH 3CN4A 2WIIA 5BQ7A 4NGHL 1NOFA 3ZUNC 2NMSA 4F58H 3ZU8A 2LOEA 1G9HA 1OGTB 3QRLA 4KRMB 3FSAA 4GG8A 4UT9L 5EOCL 3H9SB 5C0CD 4GS7B 3NGBB 1F6FB 4UWQB 2JKTM 3UYPA 3O2DL 4LBEB 5DQDL 2Z91B 3CHXA 4BE5A 2VERA 1JPFA 1KPRB 3KPLA 1PFOA 2VNCA 3VFRA 1OF0A 2DL9A 1N18A 3OR7B 2BP5M 3ZKSD 3NFSL 2APWA 3Q7JA 4X8JA 1XL6A 3QEQE 3RNKA 2OX5B 4FTVB 1SDYA 5DU7A 4HOWA 4UQBA 5JQIB 3S5LA 2O1AA 3I3EA 3RYMA 2F2HA 5BS0E 4HXBH 1PCXA 5D7IE 3SB3A 3EUUA 4KKCC 3AFLA 2JE8A 2QL1A 3DHMA 1Q72H 1NWPA 2ZKHH 5LDSA 2A0LC 4LCYA 3P4MA 4JFFE 1WJ3A 5IVXA 2EXYC 4AKPA 1MEXL 2F53A 2WQUA 3O81A 2Y1ZA 3MV9B 4KVCH 3FU7A 1W16A 1QAWA 3QIUA 2OSYA 4OKVA 2K8MA 1TIUA 2BK8A 5LAPA 4O2CB 4JQXA 1WDAA 2EZ0D 5D93B 5AEAA 1TQSA 3MXVL 5IY5B 5JIPA 5EF1A 2YPKA 3PV7A 4GQ9H 1X7SA 3ARFD 3NK4A 4PLKC 1C5BL 2FNBA 1EXHA 4A7TA 2RAMA 4KK8C 2EH8L 4HX1A 3WDHA 4A6YA 1F3DJ 4QXTA 1EJOH 4MHHI 1DVYA 4KRPC 4F15B 2B59A 3MO1B 3JWDC 3D48R 1PIGA 2RQEA 3QIWA 5EN3A 5ECJE 4HIEA 1IFRA 3BWZA 3A67H 2O6DA 4DZBB 3BGAA 3GMPA 4FN0A 4PRAB 3QZWA 1NAKH 1M71B 4GMSL 2JQZA 2PLTA 1L0QA 3O4LB 3ZTDC 2WXRA 3MRLA 1FO0A 2W07B 3TVMD 4XOEA 1G87A 4FFZH 4MJ2A 4DSYA 3JTSA 1CBJA 1KIPA 3WLWD 5FGCE 3NQIA 4KUZH 1P1VA 2R4SL 1H3XA 5D93C 3ZIMA 3S4SG 3WELA 4D7BA 1F2XK 3LN5A 4PGZA 2Z34A 3KLQA 1FVEA 3T6WA 1HQ4B 3AXHA 1MY5A 4B27A 1GGTA 3GHBL 1NDGA 3H42H 1MHEB 1PAZA 3GSVB 5TE4H 5H94A 3VO0A 3QO1A 4TS6A 1ZOXA 4NFDA 1QLEB 4GQZA 5ELIA 2H8PA 3L1OH 2IDUA 4Z9KB 3FBQA 2RB8A 5CGYC 2BFGA 4I0PB 1HHIA 3LN4A 5TD4A 4TRPH 5LNGA 1EHLL 5IQ7L 2IV9A 5D7LA 2ARJQ 1SXCA 3ARZA 3MBEC 2GABA 5DD6B 5C6WH 4LHQB 4WV1C 4DEUA 3QCUH 3FU9A 5FYKD 4X6DA 1N7ML 1S3RA 2QQNL 5D5MB 5GGVY 4FZEL 1RZKH 1VGKB 3V4PL 1A9EB 1MRDH 2WGXA 4OM0L 5SWSD 4YPGB 1DJYA 1AP2A 3NCCB 4LL9A 2PXYD 4I4WB 3O3EA 3KYAA 4ELKB 25C8L 3BESR 5TQ0L 4QKXB 4UDTA 2A6IB 2XPGB 2VLLA 4UU9B 1BD2D 3QNZB 3F7KA 1P5UB 4XNQB 5H2BB 3U7WH 4V1DE 4GP4B 2WUBL 4LQFH 5MEPA 3K4DA 4NHUB 1Y07A 2CIIA 4PJ8B 3WJMB 1G6VK 4QRSB 1NC4A 1JGDB 2D7MA 2WVTA 4NQEE 4QAMB 1T1YB 3C6LC 4L8SA 4BSWA 1HTYA 1O9ZA 4WI3A 1L3WA 3HZYA 3BCFA 5JXEC 1U8NA 4Y5VC 5CJBA 1CD1B 3FRPG 4P5TC 1Z5LB 2EAEA 5JW4M 2AP2A 3PREA 3SKNB 2K7QA 2O5ZH 4E9XA 3UO1H 2YJLA 4QRRD 3JXAA 3GIVB 4QXUL 1HU8A 4PBXA 2JXMB 3V6ZB 3U4BL 3TM6A 3GSOB 5KUKA 2HVBA 1OGTA 2YRPA 5IGXL 2EDQA 2Y7OA 4K94C 1FNAA 3OMIB 1IBGL 2Z8RA 4XAWL 5A2KH 3GUTB 3SE6A 1YNKH 2B9BA 5EZIH 3W81A 4LBEA 2Z91A 3ZE1F 4JBSA 1KPRA 3U1QA 4AWJC 1SXAA 3EYSH 1FN4B 4YL9A 2OV0A 1U0QA 2JKRM 4JL2A 1IAIH 3OG4B 3OR7A 4XWOC 4EI5B 5BRZB 4JHBA 2WTOA 1AC6A 3ZDXF 5F7DB 4NN6B 2OX5A 4FTVA 1Y0LB 4KO9A 2ZCZA 5L8LB 5C0IA 1MFAL 3EBGA 3LMJH 2WKOF 3WY2A 1PX4A 4JPSA 4NZTL 4G1MB 4GUQA 1XCXA 4ODTH 2BERA 4ONGH 3SGJC 2KBGA 3HG1D 1U8OB 5DMYA 1E9OB 1KUMA 4EN3D 3RU8L 2E7MA 2WXOA 3O2VL 3U9UB 3MV9A 5LWYL 1XSJA 2NSMA 4BQ8A 3H54A 3VFTB 3DX6B 3QWNA 1F2QA 2B4CH 5E5MB 1ZVYA 2DRUA 3WJJA 4EIZC 4O2CA 1LO2L 2VDOB 4Q0XL 1IGYB 4ZTPH 1Q1PA 3EYUH 5DT1H 1AACA 2X1OA 4NIYE 1B2WH 4WY7H 5ICZB 1DQQB 3LQAC 4BFFA 1RIHH 4LP5A 2AK4E 3LPGA 5EOCJ 3ZBMA 5GS2H 1OTUC 4I3SH 1VFMA 2MQ3A 1DJIA 2Q2EB 3W9EB 1NPNA 2D8KA 3AY4C 3MO1A 4B3VA 3DI3B 3KLLA 2PPAA 5B38B 5KZCD 1DVFD 1O6SB 5I1AB 4DZBA 3LVEA 1G5AA 3PXHA 5FO8B 4PRAA 3VRJB 5F9WB 4BZ1A 3TEZA 3FH8A 1KT2B 2MOVA 1M71A 1P4BL 4APQB 1A5FH 3ULUC 3O4LA 4Q9BA 3CJJA 5CLYA 2W07A 5JDJA 3AGVA 2Y6TE 1W91A 4MASA 3AABA 4L9LB 1ZTXE 4OVUA 5EH1A 4BFEA 1YCSA 1RP9A 2Q20A 3WDJA 4BK5A 4U49A 1T5WB 1U2YA 2ICEB 2IF7A 1NPJA 2W81C 1WPCA 5F7WC 4IDJH 4H40A 5KVFE 2FEDC 2YD8A 1HQ4A 1XEDA 3ZDXE 2X6VA 4OZFH 2VN7A 2LR4A 5HYJB 1MHEA 3B2UC 2MFNA 1HQRB 3GSVA 5FW8A 4LOUC 2VH5L 4LASH 3T0EB 1FRGL 4ILDA 1R0AL 1FLTX 1ECZA 4L1LA 3HI5L 1WIPA 1CYWA 1TJHH 4I0PA 4O4YL 4P5MB 3HA0A 4IHBA 5EEUA 2F9BT 5AOKA 5CIPA 5LAXB 2JTYA 2Q3XA 2UY6B 1FQ9C 2MNJB 5EBMB 5FGBC 1TZOA 5EPMB 1YPZB 1QUPA 1PPIA 2NZ9C 3MV7B 5L2KB 3IJ9A 5D5MA 5F88B 5JR1L 2R2HA 3MV8E 1EQWA 1VGKA 1A9EA 3NJHA 2VAJA 5T1KD 1TVBA 3UEQA 1JK9B 4YPGA 3ISYA 3EYVB 4N90D 3SIKA 1UURA 3RX7A 4LKCB 4I4WA 2FLBT 5F7EL 3A21A 3SGDH 4LSSL 4ELKA 2XIDA 3BX7C 4HZLB 3WO4C 3VWJB 2HSIA 2XPGA 1RK7A 2WWNA 3FFCD 1QHPA 3EIFA 3MBED 3OTTA 4PD4J 3QNZA 4UU9A 3CFJB 2VDMB 5GQBA 1P5UA 4XNQA 1EHXA 5H2BA 4NHUA 2YPLB 3ASOB 2E0PA 2DLHA 4LVOC 4PJ8A 3WJMA 4HFUH 1MHHB 4QRSA 4KHXH 2BPBA 1JGDA 1INEH 1T1YA 1MCHA 1OGAB 4WI6A 1DN2A 4C4KT 2EJ1A 2HAZA 3PS6A 4OT1H 3U4AA 1DFBL 3X3GL 2WBJC 4OZHB 1CD1A 3ISRA 3KYOB 4PJ5E 3NA9L 4OGAD 1Z5LA 5HXMA 3SKNA 2BSDA 5FGSA 3BH9B 4PIBA 3EOTL 3GIVA 4FMFA 4QT5B 2JXMA 3V6ZA 3PPEA 3GSOA 1MCLA 1NCOA 2R23B 5D1QB 3GT6A 4FZ8H 4F9PC 4Z7QB 4WW2F 3MJ6A 3GUTA 3IRCA 4PGBB 4J6RH 5J3HD 1FDLL 3ARBB 5AYQA 5DLMH 4JO1H 1OAZH 3WS6A 6FABH 1FN4A 4WNSA 1K85A 4OAWB 2GAZB 3D18A 4EI5A 3HS8A 5BRZA 3JBG7 4B9JA 1XWVA 3CV5A 1MLCB 2ERJB 5F7DA 3MLYH 1Y0LA 1F4WH 1LGVA 2V5RA 3NJJA 2I60L 3SOBH 3FFOA 4MMXC 1ACYL 2C1OB 5LG1A 5IW1B 4G1MA 2WGNB 4GRLB 2ADFH 2QVKA 5IJKA 1U8OA 3LNFA 3AG2B 1ZLWH 1S8DB 4JJOA 2WC7A 3ZQ9A 4DKFH 1E6OH 2GHZA 1M4KA 2N3JA 1KTRL 3U9UA 4N0FB 3UJIL 1XEUA 1HAUA 1JMXA 3VFTA 2Q1EA 4DW2L 1UYWH 3DX6A 4XVTH 4L3EB 5FGCB 4P4KB 5E5MA 1IC4L 2GW5A 4FQLH 2DIBA 5DFVD 1IGYA 1U8QB 5DO8A 1E9PB 3CQQA 5ICZA 1DQQA 4ABVA 4BKSC 4ZX5A 3GXNA 5ALBH 1H3TA 1B6UA 4CSSA 4BFOA 3MJ8B 2X38A 3W9EA 1NIBA 4R26H 5HYQB 1UCBL 2VSKB 5HVGB 5B38A 2NY5C 4IK7A 2F54B 4E9VA 3PL6C 1RUKL 4XN9A 5IJVB 1DUYA 3V8CA 1O6SA 5I1AA 3EUDA 5FO8A 3VRJA 4Y4KC 4OFQA 1KT2A 2WO3B 1IIIA 4TSCH 4APQA 3TWYA 4ANUA 1KCVH 4JQIA 5E2VL 3RI5K 4KROD 1WFMA 3T2QA 3TEWA 3VMPA 5E2WH 5IROC 5L0QC 4WF7A 4L9LA 2FATH 5ILTL 2GTQA 1I1AD 1PX8A 2K9FB 1SMAA 4X2UA 3V0WL 1T1WB 1T5WA 2ICEA 3F7YB 3WE1A 4DKTA 1NINA 4NWTL 4P0DA 2R9HD 1CF1A 1TTAA 2G60H 5HYJA 1ZRUA 5CILH 1HQRA 3X1FA 4R5TA 1UXLA 1JZ2A 2X4OB 12E8L 3T0EA 2OLDA 2XZCL 4L8BB 4OCWH 5EZJB 3S8WA 2C9VA 3S88L 3VW3H 3OJDB 5DF0A 4OI8A 2Z0BA 5CJOL 4H8WL 4P5MA 4XPBH 4XT1C 5EN2B 2K6WA 3EO9L 1NBQA 5LAXA 5CWSB 2UY6A 5EBMA 2F8XC 3U0TB 3JZYA 4WAFA 5EPMA 1YPZA 4L3AA 4N2DA 4U6TA 3JYBA 3T8MA 5L2KA 3MV7A 1HJBC 5F88A 1J8SA 5SWZD 4JMNA 1X9LA 4Y2DB 3DMMB 4XNXL 1XO8A 3IF1B 4XVJL 5AOMA 5ADOH 5T33L 1JK9A 4LAJH 3EYVA 1HIMH 4LDOB 1ZVHA 2HG0A 4YSAA 3DX9B 3D33A 4HJIA 2BY0A 4LKCA 2UWEF 4JG1H 2ATKB 3QUXB 4TVPH 3KL0A 1E4WH 4HZLA 3VRLF 5BVPL 3WL9B 3VWJA 4B95C 4N2NA 3CFJA 2X9XA 3CU7A 1KENH 4OB5H 5E8OB 3RVTC 4HJ0C 3TYFB 5F0LB 1A7QL 2YPLA 1G9NL 2FB4L 1FORH 4DP6X 2BSBA 1MHHA 2ZUQC 3CVIL 1CVSC 2NY6C 3CNKA 4WENB 3L5XH 2WWOA 1OGAA 3R4DA 2F19H 1YYLL 2XWZA 3LZLA 2J8UF 3S6CA 4OLZH 1YSOA 1KTLB 3N42B 2C8NA 3FSWA 3EJZD 1I7ZB 4OZHA 3SQRA 4CKQA 2NY2C 3KYOA 3BQUB 4TYUA 4ZFOB 1FL5B 3N85H 1WBXB 1CO1A 1FH2A 1IQWH 1YEEL 3LIUA 3QWRD 3TBVB 3BH9A 4BBWA 1XQ4A 1HILB 4DF9A 1MFEH 1IGFH 4KH9A 3NCYS 4QT5A 4UT6L 1NANH 2VW7A 2E7HA 3QUZC 4D9RE 5IW6B 2R23A 5JORB 3LH2L 2ZWNA 4F9LA 1CC3A 3TCTA 1AZNA 4M48L 4AY0A 4PGBA 4TN9A 2MNUA 1KYAA 1AH1A 2G75B 1CMOA 5CJ8A 4OTXH 4XO8A 4FP8L 4IKLA 2XVLA 3K6DA 2GAZA 5TFSH 1ZXKA 1RZ8B 5T3XD 1LO0H 4M6MH 5D8JH 1MLCA 5AALA 3MLTB 3VG9B 5I15L 1PG7H 5BV7B 5G4MA 5IHHA 2R29A 4KRNA 4PI2A 4Y5YC 1MCOH 5MEND 4MQ7B 4JFHE 3IDYC 4KBPA 2C1OA 1L3NA 2UWEE 4GRLA 4K5OA 4AC4A 3ATFA 1THAA 5B1KA 3LEYL 3D2UB 1S8DA 4ZDHB 4WSGA 3RUGE 5DJCB 1G84A 4ZS6D 6PCYA 4N0FA 3FUDA 1GYUA 2ZAGA 3AREC 3N1MC 3NFNB 3W0WB 3JWOL 4L3EA 1T6WA 4P4KA 5A2LH 1RZKC 1MAKA 3CN0A 3FS9A 2RACA 1W0WB 1U8QA 1M7XA 1E9PA 3GI8H 5A7EA 3EJUA 1X5JA 5DR5H 3FZUD 3GSNB 4FXGC 1CG9B 4OIIL 1Y1DA 4FQJH 1PMYA 4TM9A 3BWUF 4XNUH 4JR9L 1GYAA 1B4TA 4XB7A 3FF8A 3LNGA 3MJ8A 2EP6A 5HYQA 2XTJC 4LQ1A 2F54A 5GGVL 3QJZA 3H3KA 4BHUA 5IJVA 3IU4H 3VXSD 2CRIA 3NJVA 2XZAH 4WSJA 3ZKMD 2LU7A 1GKEA 1IE5A 1CBVL 4ZG1A 4U3HA 4ZAKB 4PLNC 1N4XL 4LCWE 4TUUA 3VXRB 4AUUA 4WHTB 1IGMH 2LU3A 3FTXA 5M94B 3GRWH 1T1WA 2EDTA 3A5VA 3F7YA 3QG6B 4XVSL 2EDYA 1UCTA 4QEGA 2XY1A 3AM8A 1J0HA 1MW1A 1KF9B 4PWJA 1KCWA 4KTYA 4BRVA 3SCMD 1K6QH 1KYUA 1OZUA 1P4IL 1CI3M 2X4OA 5CEZD 5DJDB 1NTDA 4L8BA 5EZJA 4AZ8B 5KEZA 3S3PA 1OM3H 3BSZA 5KANI 3OJDA 3BPOB 1OT4A 1S7SB 3NP3A 4MJID 2EYSB 1J1XH 2N1KA 1ACXA 4Q4EA 3RX8A 5EN2A 5IROD 3K6IA 3C60B 5MP6H 1N64H 4LHUG 5CWSA 4HC1H 5TK2A 4EE2A 3U0TA 4PUBH 4ZOBA 3T2NL 1IM3D 1EUTA 3WAKA 4Y2DA 3NBNA 3DMMA 5DC9B 4R2GC 4LLVB 3IF1A 1OAYL 4Y2NA 3NIDF 3EH2A 1DFXA 3VFGL 1A7BA 3DX9A 4G1EB 5C6TH 3HG4A 4XMZA 1RJLB 2ATKA 4A7VA 3QUXA 5DD0H 2NY7L 3WL9A 3RHWF 2ITEA 3ZKXC 3ILEA 5IVXF 4XPFH 1JIBA 1PY4A 4IOFD 4NLAA 3AS0A 5E8OA 5HPOA 2X9ZA 3BPLB 2NR6D 2PTTB 2J6WA 2B4CC 3QR0A 1UWFA 2KHAA 3ALXA 3D85B 3MPCA 3F7VB 4GXVH 1AKJB 4JY6B 4HLJA 3ECQA 3QEGH 4BQ9A 1KGIA 1B4JH 1LP9F 2ENSA 2YD4A 5DD3L 4AV5A 4PP2B 3QJXA 1XGTB 3KHOA 1JCKA 2APTA 4XP6L 1KTLA 1N10A 1KB9K 2ZXWB 1I7ZA 5I19L 2AJUH 4IS6B 5DVPA 1KXTB 3KGUA 3APMA 3BQUA 2O4EA 1FL5A 1KJ3H 3DVGA 3NABL 1WBXA 2WLMA 2XIBA 2CDEA 3D4ZA 3TBVA 4QRFA 1KTJA 1HILA 1E5CA 2BSCA 2BVTA 1YEHH 3ZE0B 1BSIA 5IW6A 4FNRA 3M8OL 1SQ2N 5EZOH 2NY6D 5JORA 2D7PA 3SE4A 1U8PA 1X6NA 1J8HE 2ALWA 3U36B 3GBML 1Q0YH 2L3BA 2G75A 2YPVL 5C0RL 4CGTA 1IAII 4Z23A 4P46D 1ONQB 4YDKL 1T03L 2VDLB 4HIPA 3T0XA 3B3IB 2DBLL 3PNRB 4MXQD 3X13B 3QZOA 5F96L 1U8IB 1F56A 1KLGB 1RZ8A 2XWDA 3K91A 4DKDC 2DQCH 2MQ0A 3MLTA 4XHJD 2IIJA 1GYWA 3BVWA 1GS7A 2R69L 4MQ7A 5E4EB 1FCGA 4DWHA 4JVWA 2BHFA 5GSVB 2NPLX 2H9GB 4H20L 4AJYV 3CGTA 4WDIB 1EGJL 3D2UA 3HC4H 4ZDHA 3LYRA 4F1SA 5DJCA 5HGHB 5L4JA 3PAUA 2DY2A 1XGZA 4X80H 3QZMA 4RESB 1PU0A 3NFNA 1BZEA 2FBOJ 3W0WA 4X6DF 2AJVL 4FJZA 4GI6A 4BUHA 3TFKD 1QTYT 3GEFA 1OP5K 3RQ3A 1SLVA 1XCWA 4J1UB 5LDUA 1W0WA 2H0PA 1LP9E 3P3YA 2VZ1A 4JG9A 4YDLB 4R90H 5IUCA 2BJMH 3GSNA 2GI7A 1CG9A 1NMCC 1KY6A 2FJHB 2Y69B 3MV11 3QCTH 2PF6A 2I26N 5I8KL 4B50A 3OBAA 3OSVA 3B8YA 4PJ7B 4U1NB 2AC0A 3E0GA 5GGRB 2AQ3A 3Q6GL 3F2LA 4XNZB 3S48A 3ARED 2DJMA 1QA9A 3ZZLA 4NOBA 3TASA 3I02B 1JS4A 1WFNA 4IRSC 1AR1B 5E4OA 5A6IA 5F9JB 5D7JD 2J43A 1E8WA 1K4CB 1T22B 4GLRH 1PLAA 3DX3A 4Z95H 1WE5A 3AQYA 2E9WA 4TNVK 3VXRA 5IOKA 1JBJA 2BSED 4WHTA 3QQ9D 1EAOA 4OZIE 1BFSA 5D1ZC 4K3DL 3FCBA 3QG6A 2XTJD 5D2NE 1UZGA 2C9UA 1JG9A 3NVQA 1HCYA 5IFHH 3PF2A 1HCFX 2E5EA 2VXSH 4HCGA 3R4RA 1DLFL 5D71L 5DJDA 4AZ8A 4NQDD 5CINH 1A7OL 3WNKA 1S7SA 4D9QD 3L08A 5BNXD 2EYSA 3U2SB 5TH2B 4LFHG 5GRUH 2OR8A 3CVDA 3C60A 2VN5A 2DYPD 1UD3A 4Z7IA 3EW3B 4XP4L 1IZKA 3UABA 1IEAA 5DS2A 3HKZA 3A23A 3BRGC 4O58L 3BUPA 4X6FB 3OPZH 3QIBD 4LLVA 2AK1L 4MXVE 4ZXBD 5HDBB 1EWHA 4P48A 3SGDI 1MW0A 1FSKB 3IPFA 4ZW3A 5ISZE 3CZGA 3HFML 2TAAA 3LSOB 4G1EA 3N1PC 4JZNB 1RJLA 2E9BA 5AZEL 4LVEA 1F86A 2DLTA 4CC1A 5IHBA 4WW1B 2QLYA 2WYHA 2FIRT 1CTMA 4G6JL 4MD5B 3MTRA 5J6GB 3UX9B 1RZIB 4JS7A 1J5CA 1BXUA 4WNQB 1KB5L 2F58H 4AMXA 4F7TB 2HZHA 2PTTA 4TL4A 4QNPF 5G5DB 5HGAB 3IJSB 3ULVH 3D85A 4WUKL 2ADJB 2AJXH 3K72B 4JY6A 1AKJA 3BVUA 2WTRB 1IAMA 1UUSA 2FZ3B 2VDRB 3HMXA 3KCWA 3X3FH 2IQAB 4PP2A 5D1ZI 1GTFA 1JGIA 1XGTA 3SO3B 3QG7H 4HS3B 4M7ZC 3RVUC 1A66A 2XOTA 2CDFB 2FQEA 3QUYC 3DV4B 3QFDB 2Z31B 4IS6A 1KXTA 3KD4A 1WD9A 2Y24A 4KX7A 4R4FH 3KXFD 4JM2F 4QXWA 4PTTB 3RUGB 3S0PA 2AERT 2VE6B 2VR7A 3UYOD 2NY3D 2ODHA 1XFPA 1N9PA 3BGMB 4M8UA 3FU3A 2CPCA 4FF9A 3TZVB 3TS8A 1KCSL 1JGVH 1BF8A 3HNTH 1KGWA 2EEBA 4PJFF 4MA8L 1YYCA 1WGOA 1SFDA 1E67A 2H1PL 3U36A 1GTNA 3ZRCC 3G6JB 4PV1C 3QUMH 1ONQA 1MPAL 4PWKA 1UQSB 2RCSH 4P3CL 4OY9A 4QPEA 3B3IA 1TOXA 1DQDH 2WB1A 4IRJD 5CSGA 1FZJB 4K07A 3X13A 2ED8A 1U8IA 1KLGA 1FIGL 1MCDA 2WPGA 1WS8A 1IBYA 4M3HA 4AEFA 3WSQL 5KTEH 3V4UL 1QBLH 2HKAA 1ZEAL 4L1HA 4LLYB 5GSVA 4YXKH 2H9GA 3MBWB 3DYPA 4NM4H 1P9MA 1NGYB 2K7PA 4XPHH 4OSUH 1E0OB 4WDIA 5FC9A 3D3VE 5T5FA 4N3TA 1F3DH 5HGHA 3IDIB 2NXZC 1OP9A 2AV1B 3NACH 1M9WA 3WFEH 1RSYA 3TCLB 2QGCA 5T1LD 1B4LA 2A9MH 2G9KA 3EJRA 4L8DB 2RA1A 1FC1A 3IEAA 1WUNT 4J1UA 2IAMB 3BOVA 4MMYB 2H7WA 3KEHA 1CDJA 5EUKB 2JMRA 1DVZA 2FJHA 3EXLA 2ZAIA 4LT7A 4X9YA 4PJ7A 4G7VH 4U1NA 1ETB1 5GGRA 2EVIA 4N0YL 3I50H 1CR9H 1D2PA 4ALAH 1QWHA 4HS8H 3I02A 2JCWA 1V3JA 4JKNA 5JQ6L 2P48B 2FRGP 5F9OL 3QCVH 5F9JA 3MRFB 5I1CH 1K4CA 2BNQB 1T22A 2X3CA 4PJFE 1FHNA 4W93A 2E46A 2Z3FA 4MS8D 3FHQA 5AAMA 3IJ7A 2E9JA 4AW7A 4GG6E 2OR7A 1GZHA 1P53A 2WWKT 1AFVL 3CH1B 3DVIA 3KBEA 5DEJA 1KC5H 4JK0D 5TE6L 3WTUA 1CLYL 3H9HB 4JDZB 3LEXB 3KPSB 4RH4A 5DK2B 1G6RH 5A6MA 3GKWL 2GVYA 4OCLC 1O7SA 4XMTA 4OZ4B 4KI5C 3U2SA 1FFNB 5TH2A 2EKJA 3ASNB 4LEXH 1A1OB 4V11A 5HHPB 4Z77B 1JZJA 3WCYA 1ZTXH 3NIFE 2CSPA 5D1ZD 1TU2B 5HYIA 3WEMA 1BQLL 2H2SC 4A2GA 5J0BA 5F89B 3VXUD 1AGFB 5KVFH 3MXWH 1OANA 4X6FA 1DQLL 1ACZA 4OD3H 2ARJB 5FYLE 2UUDH 4AQAB 3OC8A 2OW6A 4KKQA 5FECB 4FXLA 4ODSL 3LSOA 5ESQB 4LPVA 3OKLB 4R83A 3UIZA 4JZNA 3UPAA 1BGXH 2YD5A 1AI1L 1PNCA 4WW1A 3K0YA 4IMKA 1DVTA 2E9GA 2X6BA 3MA9L 4MD5A 5J6GA 1RZIA 3WDIA 4M9OA 2ZIDA 2AJYH 4WNQA 1PZBA 4IRZA 1CE1L 4F7TA 3PWJB 3F7RA 4EUPG 5G5DA 5HGAA 2XY2A 4HJJL 4O02B 3IJSA 4O51B 1JGLL 2ZKWA 3KZ8A 4KGJA 2W92A 3V0IA 2ADJA 3B2VL 5IBTL 3K72A 2FAUA 4GO9A 2XIIA 2J44A 4JPWH 4XE5B 3KG5A 4S11A 4WI4A 5D1XB 5KBLA 1RUML 2WTRA 2LLNA 2FZ3A 3Q8FA 4HCRL 1IZJA 1N6QL 2IQAA 1Z9PA 1SHWA 4ZFOL 4HS3A 3CZUB 2N59A 2CDFA 1YHPA 5TDOB 2R83A 3DV4A 3QFDA 2Z31A 4M1GL 4NJAL 1LDPH 4DERA 1NANI 4I88A 3TA3B 2VDQB 4PBVC 4PTTA 3RUGA 1CL7I 4JFPA 3CFBB 4U0RC 2F74B 4TNEA 1NEZG 3UP1A 2VE6A 3JUYA 2LU4A 1F1AA 5DVOA 3MV01 2WO2B 1JRHH 3A6CH 2UZIL 3RX5A 2C7FA 4UNIA 4KDTC 4LLUB 3RZCB 4H8PA 3INUH 2CBMA 3EOAB 3BGMA 1PFCA 2YWZA 3TZVA 3TT1L 5IHUH 1MCPL 1UWGL 3I6LE 3UMNA 4JM4H 5T1MB 4K73A 1ADQA 1JZ3A 3G6JA 3RVUD 3VXMD 4W9GC 2BMKB 1UQSA 3C9NB 1KBBA 5DJ0B 3KLHC 3N1GC 1FZJA 4GRMB 3NESA 1ZA6B 2BNRD 2FSEB 1RU9L 5EU4B 3ET9F 3M07A 1GGCH 4NZJA 5FCSH 3L5HA 4KKBC 4B9GA 5JOEA 3MLUL 5CAYB 4NGHH 3MBWA 2UZPA 3RIAK 4NCC2 1NGYA 3UBXA 5CP3H 4UT9H 5EOCH 3KPNB 4XN4A 4YVNA 3IDIA 1GR7A 3O2DH 4ES8A 2AV1A 5DQDH 2OS7A 4I89A 4MDIB 3VGAB 1ODUA 5FM8A 3D4CA 3TCLA 2F7PA 1UOVA 4L8DA 2WKLA 1UWEL 4W9CC 2IAMA 4MMYA 3QW9A 3HE6D 2Q87A 3MC0A 4NENB 4C58B 3CX5K 4TSBH 5EUKA 2Y6SD 4MBRA 4ZX4A 1J0IA 3FUFA 3B9KB 4FGMA 3ARVA 4PRIB 1JPSL 4Q14A 4IBYA 4LSTL 1VHPA 3DJTA 4AC2A 3MRBB 5TDNB 2WLHA 2QMKA 2NXZD 3EH3B 3MLRL 1AC0A 4CILA 1PKQE 1SJHB 4ZNEE 5DJ2B 1MEXH 2V37A 4NB7A 2GJ6D 4C8XA 2DDQL 3MRFA 3IBOA 2BNQA 3NPSC 2F5BH 2PWFA 5L9DH 4TVPD 3P54A 2HTLC 2FL5B 1Y6MR 1P1ZB 1BQUA 1H9VA 2X40A 3MXVH 5DEFB 5GHWL 3U0WL 2DQUL 4F7CB 1HYSC 4H5SA 3JV0A 5FYJL 1ZHLB 1A3RL 2DQMA 4BUGA 2NQDA 5AQ0A 1C5BH 3CH1A 2P5EE 1EMTL 2EH8H 4Z7VF 3H9HA 3BP4B 4JDZA 4NC2B 3LEXA 3PAZA 3KPSA 4JFOB 5I1HL 1J10A 5DK2A 5EHFA 1FNFA 1G7IB 3T8XB 3DXAB 4OZ4A 2BWDA 5JIQA 2H2PC 1FFNA 5J4MA 2UV3A 3B2PA 2BOCB 1D6VL 1A1OA 2M26A 3HAEB 3Q5YA 5HHPA 4GMSH 4LHJB 5EF3A 5JUEL 1TU2A 1AQKL 4F37K 4OLWL 4BWTA 3RA7L 2C26A 5F89A 3RVVC 1AGFA 4IBWA 3BWAB 3WY3A 2R4SH 2ARJA 1F1DA 5FECA 4MA1C 1H3VA 3OKLA 1E4XH 4ZD3L 3GHBH 4Q9QH 4YC2C 3EHBC 1FI8C 1PY9A 2A83B 3EDFA 1FYTB 1EH9A 1KCUL 3OMNB 3SDXE 4AVHA 1L9NA 1J8HA 4J39A 5EEXA 5I9QB 1HNGA 3CMOH 4V2BA 3L1EA 5E08L 1TSRA 4GKOA 1CIDA 1MF2L 5F8RC 4B9IA 1EHLH 4PLOB 3PWJA 5EEZA 1NEPA 2X1QA 4O51A 4O02A 1LK3L 2E27L 2YD7A 4MCNA 5E7FA 3UACA 4Q9RH 3H4FA 2VLJE 2JI1A 5D1XA 1ZLSL 5A2CA 1EPFA 3UAAA 4FZEH 3L9EA 4DK3A 3V4PH 1HH9B 4Y9FA 1AOZA 4OM0H 3ARRA 1I7RB 4HHAB 5EV7A 3K2UL 5TDOA 1J9SA 4FD0A 3C12A 5C92A 3VI4F 3ZO9A 1PDKB 4ICXA 3WFCL 1U42A 1RH8A 5JZ7D 3TA3A 3D69B 4JFVA 1BJ1J 5ABDE 3CFBA 2F74A 1BM3H 5F8QC 4Z7VE 5TQ2L 3RTQC 3L4WA 2FGZA 4M1CD 1M6OB 5KJRL 1WTLA 4LLUA 3RZCA 4BZ2H 4IK6A 3VSQA 3X11B 1DDTA 4DOHE 2WUBH 1I8AA 5T1MA 4JPVL 1A7NL 2OMXB 5EU6E 2YRLA 3C8HA 2BMKA 2A77H 5I28A 2VZSA 3C9NA 2FJSA 4H1LH 5JA9A 2YAEA 4PVNA 4GRMA 1ZA6A 2DQIL 1ASOA 1MQ8A 2FSEA 3RGVB 1G94A 5EU4A 3JT0A 1EFQA 1QRNB 2UVFA 5F2FA 4QXUH 3T65B 2P8PB 1E5ZA 4PS7A 4X0KB 2R15A 1OW0C 1UB5B 3VWKD 3KPNA 4UM9B 2GJZB 5EO1B 4G72B 2OMZB 3BFWA 4FQCH 1F02I 2JSFA 1W8NA 2J3SA 3FSOA 4MDIA 2GJRA 2XC8A 1O5PA 1BFOB 1S7VB 4JJ5B 5E94B 4Z18A 4GG6B 2C9SA 1AS8A 4K3EH 2E76C 4JFZL 4PRHB 4KQ0A 5CS7A 4JFQB 5HHOB 2XTSA 4FCAA 3ARGB 4PJEB 2NYYD 3B2DC 4NENA 3RB7A 3CZKA 2NTSP 2XG4B 2RFXB 4YHOL 4G42B 4PRIA 1RI8A 2DICA 5SV3A 1MFAH 4HFWB 4R7NB 3QI9D 2ZE0A 5TDNA 1WWBX 2ZICA 2YRZA 4NZTH 2J1KA 5TJWK 4CMHB 1UG9A 4QJ4B 4DUWA 3UTTB 4NBXB 1NC2D 1SJHA 4D7PA 5F93C 5DJ2A 3RY6C 3ULVC 1FHGA 2WXFA 5KYNA 2B16A