5FYLH

Crystal structure at 3.7 a resolution of fully glycosylated hiv-1 clade a bg505 sosip.664 prefusion env trimer in complex with broadly neutralizing antibodies pgt122 and 35o22
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
232
structure length
228
Chain Sequence
QVHLQESGPGLVKPSETLSLTCNVSGTLVRDNYWSWIRQPLGKQPEWIGYVHDSGDTNYNPSLKSRVHLSLDKSKNLVSLRLTGVTAADSAIYYCATTKHGRRIYGVVAFKEWFTYFYMDVWGKGTSVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords BG505 GP120 ENV ECTODOMAIN
publication title Trimeric HIV-1-Env Structures Define Glycan Shields from Clades A, B and G
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 25
structure length 228
sequence length 232
ec nomenclature
pdb deposition date 2016-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fylH01
2V5YA 1WVZA 5D2LA 1R24B 3RZCB 3T0WA 1LO4H 4X4XB 5DA0B 3MA7A 5J6GB 5EIVA 4ZFZA 4HKBA 2VXQL 5K9KA 5LGJA 3GBMH 2J6EL 1MHCB 5F71A 4X6BB 1YEHL 2DBJA 9CGTA 4JQVC 4OGYL 1I7ZA 4UDUA 1EVTC 1MHPL 3O6KH 3TZVA 4R4ND 3T2OA 1AD0B 1E0OB 1PY4A 4HIHA 2A6KB 3ARYA 4LGSB 1I9IL 3WIFB 1XF3B 3GGWA 3IJYB 4TNWF 4LSUL 3HI1B 4PGCB 4QXUH 4X7SH 3H9HB 4U1MB 1JJUA 2HKFL 3F8UB 1ZA3A 5ADPL 2ZPKL 2D9QB 3W11D 3OR6B 3PXHA 5HYJB 1J8HB 2PTVA 4WO4B 1CL7I 2HT2C 4PJEB 1KTLA 3UTOA 3C5ZB 4PJEF 3UC0H 4WTZA 3ZE0E 1TTGA 3HZMA 3NZHH 1WZ1H 4P2OB 2CRZA 3U9PH 5DI8A 4NN5C 4LSSL 4JY6A 4N5ED 2H45A 5AEAA 2RFXB 3QDMB 4JE4B 3MLVH 3QP3A 3V6OA 3KPSD 1MFNA 1KB5H 1HQ4A 3KHOA 4JKMA 3UYPA 4UT7H 1CVSC 3D2UD 4M8QB 2EE6A 4MD0B 2VO5A 4LVHC 3STZA 2BSTA 3FAXA 5FGCE 4MAUH 4WI4A 3LN4B 3R1GL 1OD9A 2IEPA 3MACL 2FR4B 1MHEB 3O41A 1MFCH 4ZXBD 4QO1A 3L7EA 3C8DA 5BVJA 3TVMA 5M7QA 1Y0LA 5I19H 4WVRA 3BQUB 5JXAH 5DRNB 1LE9A 3MLXH 1FFOB 1IM9A 3NACH 1EFQA 1R3HB 3MBED 4DZ8A 4OGXH 4HDIB 1INDL 4LEOB 3BPLB 2Q8BL 2AJXH 3OXSA 4S2SA 2XNAB 1RD6A 2A38A 2Y36H 3FRPG 3WD5H 3GSVB 1GGCH 4HWBH 2YPLA 1RURH 2GITB 5KVEH 3ZKMC 2VAJA 1QNZH 1BFTA 1O0VA 3P77B 3K1DA 4EN3B 3MODL 3BSZL 5D5ME 2P43B 1HYSC 4HS3B 1AGFA 3P9MB 3RP1A 3BEVB 2YC1B 3RKDC 1F4WL 4LSDA 2W9EH 4UOJA 4NQEA 4PTUA 4PLJC 4FG6C 4LSRL 3GRWL 3MLRL 5FOBA 3BZ4B 4JO3H 2Z8RA 5KS9B 5MI0C 4NOFA 5KS9F 1KYOK 1WFUA 2Y9RT 4QF1B 2R9HD 4U31A 2AJSH 1T5XA 4GJTB 3GIZH 1KIQB 2DL2A 4X0KB 5F44A 4JRWA 3O45A 1GPOH 1F90H 1KLUB 3MCKB 3SE9L 1YEEL 4PJFE 1NAMH 4JKPH 3PWUB 4JM4H 4U1HB 4YH6A 3ZTJG 1C7TA 3P0VL 2DTSA 3QULB 4L4VB 4L4TB 4H20H 5DWUH 3N9GL 4YWGL 3LB6D 1NC2A 3BH9A 2JJTC 4QRSA 4GRWF 3V9FA 4P2QE 5GS0C 3AAZA 3OL2A 3RBSA 2WIIA 3QR2A 1CICC 2Z4QA 4GKSB 3K3QA 2YUZA 5HHOB 1GGTA 4OFDA 4N8VB 5C0BA 3QUKA 3U46B 2EDRA 4XPGH 5CJ8A 5JORB 4JHAL 1OOAA 4Z7UB 2ADFH 3GEWB 1RZJH 1T2QL 2FRGP 3G5YA 4WHCA 4I9WE 1XF4A 5D70H 4L8CB 1QFWI 1DUZA 1TZHB 3L3OA 1AFVH 2MFNA 1UG9A 1IC1A 4L29A 2AI0H 4I8DA 1FSKB 3V5KB 4KROD 1U36A 2YKLL 3HC4H 5ILTH 2V5RA 1K3IA 5I17B 5KTEH 1NQBA 2DKSA 4XMLH 3RWJA 2R0KH 4GBXC 3T3PF 3U7YH 2XKNB 4KTEH 4Y88A 3SGDI 3X17A 3DX6A 2AABL 4EDWH 5EBLA 1J88A 5KANI 1A22B 4PRHE 5GHWL 5HHPB 1QKZH 1FFNA 4K7PH 3QIWC 3QH3B 5F8QC 5CP3A 5ESVA 1CXIA 5DUML 4WHTA 3P4NA 4G6JH 1GGUA 5FECB 5SX5H 1ED3A 2G2RB 4XPFH 1DN0B 4P4KB 5BO1H 2P47B 5A16B 3UMTA 4L5FL 4OD2B 1NCWH 4HFUL 5CJ5A 3LS5L 4NBZB 2X10A 3MLUL 5D96B 5CUSH 5T3XH 2HAZA 4UIMB 5FYLD 3X11B 1LO2H 4AY0A 4FFVC 1CGXA 3ULVC 2BNQA 4NKOB 4G8IB 2VLRE 4YHMH 4YHOH 5DQJA 4OIIH 5D7LB 3IU4H 4MXVF 1BZ9B 1YNTB 5DMKB 3T2NH 1F3DJ 4P5TC 4UIKL 2BNRD 2FB4L 4OLUH 4F7PA 3KPRD 1WITA 1T1XA 2CLRB 5IF0B 3HAEH 4TSAH 5DJYA 1I85C 1T04B 5LCVL 1RAMA 2VXVL 4XP4L 1MCWM 4MNGA 3WIIH 4HUVB 5EA0L 1NC4D 5E1HB 4CW1B 4JRYD 8CGTA 3O4OB 4OZFB 5CHNA 1MPAH 2NNAA 3EDKA 4J6RH 4ODWB 1C5DA 5DURB 2Z93B 2Y25A 3FOMB 1FNSL 4L8BA 4MJ5A 2NXZB 4QTIH 3FN0H 5EIIA 7FABH 5F6IC 2DQUH 3WDIA 3PWVA 4JG0L 3U4EB 5TQ0H 3C8KA 1FNEB 4FMKA 3HE7B 3UJJH 4JRXB 1WAAF 5IQ9A 4R4BA 4K3JH 4GSDH 4NJ9H 4Y19A 2KUTA 4HJ0C 5FHBH 1KPVB 3UZQA 1CD9B 1LMKA 3R06B 2EC9T 1E6JH 2CSPA 1G7PB 1HHJA 4JDZA 1A9BB 2Z0BA 4C56B 3CXDL 3UO1H 2FX7H 3WNLA 2XWJA 4YLQT 2AXHA 5CILL 1R5WB 4YEEA 4HF5L 5BZWA 2D3VA 4BYHA 2E7LA 2DJSA 4YZFF 3C60C 1RIVH 3LAFA 5DT1L 2OYPA 4MA1B 5ENWB 2CDFB 2H32B 3RDTC 1IAKA 5CJBA 5DMIL 5ETUB 4N9GB 3NH7L 1FVEA 4WW2B 3VFVA 4Y4KA 1NEZA 2AEPL 2GJ6B 4YHPA 3WUZA 4MAYD 3HCVA 4Y1AD 5I1JH 4KKCD 3CK0L 2M2DA 1XGRB 5E8EB 4BQ6A 3VXUB 5I1KH 4ODVH 3V2AR 1DQLL 4G9DB 3BRDA 3ZYZA 2HMID 4TTDC 5BS0D 4Q97A 2YPKB 3BVNB 4GAYA 4M1CC 2CRIA 2C3HA 4ZOEA 4WDIB 2A77H 3K8KA 4OZIA 3PGCB 4NQDB 4F9PC 4EVNA 5LWYL 1M6OA 4YHKH 3EFFB 3MNVB 2X1PA 3P4LA 4JFEE 1RULL 1H0DB 1QVOA 5L2JA 4AK1A 2Y6SC 3Q1SH 3Q3GB 4FQ1L 5E6IC 3PWPA 4NQTA 3QQ9D 4D94A 4LPTA 2A9ML 5IJKC 1KIRA 1TMCB 1W8OA 4G80B 3DOSA 3DX9A 4KKBD 3ZYOA 4HIIA 4AIZB 1EFXD 3WJJA 1T20B 4GRLB 3L5XH 4ZD3H 2DWEB 5DFTA 5DGRA 4AEFA 4ZSOA 5C92A 3ZHKA 3EJZD 3BZDA 2VL5B 3VXPA 2XG4A 2EYTB 3KPPB 1YN7B 2MHAA 1EEZA 1MF2L 4MNQE 3QO0A 4L8SA 2WAHA 4BFIA 4Z7VB 2J4WL 3TBWB 1PZ5B 1TJGH 1G0YR 2DQGL 4B50A 5BOPA 1DCLA 1A6ZA 3GMMB 1IFHL 5L6YL 3U6RB 2XRAH 4P57A 5TH2B 3WO3B 1N5AA 5F3HB 1KYOJ 2AS5M 2W1NA 3TNNA 4Z76A 4OAWB 3TZVD 1IC7L 5J13C 3U83A 2XV6B 1FLRH 5F96H 3SE3A 3ZT7A 5E08L 1QRNE 3WN5B 5DHVB 1CYGA 3KLSA 2WV3A 1N7MH 1NFDA 1MFDH 4ZUSB 3IDNB 1S7TB 3GB7B 5MEOB 5IMKA 3CIQA 5DVKA 1I1RA 5CMAA 3DYPA 1CGYA 1MRCH 3MQIA 2F53B 1X7QA 2QL1A 3LQAC 4GRWH 4QCIA 3SDCC 4ODTL 5K9JH 2X6MA 4KI1A 4NO2B 3S37H 3UBXB 4FQXA 5ADOH 5IR1A 1J1PH 2Q6WA 1A2YB 4LDOB 3QG6B 4M5YL 5CP7A 1A6VH 5FGRA 1K2DA 4WHYH 5IBUG 1KJ2B 4OZGE 3VDBA 4LHUB 2VDMH 1AY1L 4PRBB 4WUUA 3W11C 4KI5D 4U0RC 4AT6A 1IQWH 4XP1H 1AQKH 5TDOB 1HSBA 2WUBL 4OCSL 5KW9L 4JGJA 3ROLB 5T1MB 4RQQB 4DTGL 2LVEA 3SDXF 1F97A 2YWYA 3TVMD 1UM6H 3LMJL 3CFBB 4PV8B 4D2NA 4N5EC 1VSCA 2C3XA 4ELMA 3UTSB 2NY5H 2W60A 3TCLB 1YPZA 1IM9D 4JFYA 1FDLH 3CDGA 4E5XA 3F65A 1B0WA 3QDGA 1IBGH 3RNKB 3GDBA 5FUOH 1Y6KR 3FMGL 2YPLD 4FQCH 5KBNC 5IHZB 4HAGA 3GMPA 3S88L 1ZA6A 4G9FE 5J6HA 5EOQL 1NAMA 4GW4B 3SDAA 4PB0L 4R7DB 4ZXBC 2MTPA 1X9QA 4OLYH 3RIAK 4GG8A 4KDVA 4WWKA 1MCLA 3CC5B 1EO8L 1FNAA 4TSCH 2X4NB 4NQED 3HPJB 1DDHA 2QJDA 3HI6L 5I8KL 1OAYH 2CH8A 1T83C 4NOBA 5KSAB 5C0AB 1OPGL 5IG7B 3SQBA 2EO9A 1NUFA 2JE8A 2X4PB 4KUZH 3FN3A 3IDYC 4U1IA 4XP9L 1NUDA 2FNBA 4M61B 3ZKQD 5I30L 3B9KB 1HSAA 1QOKA 4XWGH 1XCTB 4JDTH 1U92B 3S4SG 4NSKA 5C0JB 1XIWB 3AY4A 1JFQH 5LG1A 2EIBA 2CXGA 3MRDB 1F4XL 5HYEA 5MEQA 3SCMB 4BZ2H 1CFSB 1OW0C 4C4KT 5JIHA 3EZJB 3U1SL 5C0DB 5H37H 4KKAD 5FYKU 3LV3B 4Y5VA 1JPTL 4R3SB 4FFZH 4ERSL 4LL9A 1BOGA 2HFFB 3H42H 4ZAKB 3S36L 5C0BD 2QV2A 1M7DB 5GS2D 4APQC 3GBLA 1YMMA 2ED8A 3VG9B 1G7HB 4W4NA 4N0UA 3V4PH 5HYFA 2H2SD 5IHLB 3QDJA 3B2VH 1AP2A 3LB6C 4I3RH 3V6BR 4NC0B 4X5WB 2C3GA 5IFJB 4JDVB 3MUY1 5IQ7H 1TCRB 1MCPH 1OM3H 3I50H 4GMSL 1LDSA 3RY6C 2NY3B 2OBGA 1GOFA 4KJQD 4GLRH 4Y4HB 1A3RH 3M07A 5IB3A 1NGZB 1PG7L 4QXWA 2M1KA 4X4YA 3DVNA 4JZJA 4RGNB 1CDJA 1SYVB 4MJIB 3EOBB 3WS3B 1N3NA 2YK1H 3ARRA 5T5NG 2YRZA 4G7YL 1J86A 2ZSVA 3KDMA 3QXAA 4QNPF 3A67L 4LASH 1JRHL 4ZS7H 1CVRA 2FD6H 5GZND 1A9EB 1UB6A 3V0AC 4JG1H 3H7LA 2H26B 4FQPA 1H3PL 2BNQD 3QCUL 3WLWD 1FYTA 1JWSA 1QZ1A 2H8PB 1R24A 4Y4FC 5IMMB 3RZCA 5J6GA 2FO4B 1U3YA 1NBZB 5IMOB 2EIZB 1LE5B 3K1KC 3D0LA 1NGQH 2FLBT 1MHCA 3RAJL 4X6BA 3P2TA 5F7HA 5D1ZC 5IM7B 1SJXA 4IRZL 4DOHE 4EDXB 2BHUA 2VLJB 1S5IH 1AD0A 3DPBA 1OAQL 2A6KA 4DGIH 3WIFA 3V4VH 1CT8B 4GUPB 3IJYA 2ERJB 4EKXA 3HI1A 4KWUA 1GGBH 1NBVH 3H9HA 4LMQE 4U1MA 5GJTH 3QWOA 3TT3H 3BAEH 3PWJB 3IS1X 1OAUL 4MLSA 1SJEB 3OR6A 1J8HA 4ZNEE 4WO4A 3EUUA 4PJEA 1CF8L 4IEFB 1QG3A 2B4CL 4P2OA 1ZTXL 3IB4A 3KR3L 4Y19D 4PRIB 1U95B 3MLWL 5SWZE 4HPYL 5GXBB 4IDLA 2RFXA 3QDMA 4OCWL 3KJ4C 3VFGL 2CKBB 2DDQH 4FXLA 2EDFA 4LIQE 3N50A 1ZLWH 3MV8B 2FGZA 4M8QA 2F5AH 3ZKND 4MD0A 4ZTOH 3S36X 2DI7A 2V5TA 4EI5B 4JM2B 4QOKE 4HJGB 3LN4A 4JM2F 2UWEE 2FR4A 1HH6B 4FFWD 5INCB 1RHFA 1S7UB 3HE6A 1IC4L 3GMOB 4HXBH 4JN1L 1KCKA 4FP8L 3BQUA 2UZIH 1FPTH 5DRNA 1FFOA 3S5LA 1KOAA 3HUJB 4OI7A 1BD2E 1R3HA 2OX5A 3HUJF 1IZJA 3TO2B 5I1DB 3IRPX 4U3XA 3O3EB 4LEOA 3HMXH 2XNAA 5BJTB 1LGVA 3GSVA 1Y6NR 5TF1H 1E4KC 4BZ1L 1HXYB 1H5BB 1PG7X 1OB1B 3OKMB 4U7MA 4XNQB 3N85H 3VXRA 3P77A 2MKWA 2YD2A 4K2UL 4GQPH 4P5KA 4EN3A 3CNKA 4O9HH 3X3FH 4HS3A 3P9MA 3PHOB 3BEVA 2YC1A 4LIQL 2UV3A 1FZJB 3DXAB 2HJLA 1V7NL 4POUB 5TE7H 1ZT4B 5MP6L 3NIDE 3L3IB 4NZUH 1CIDA 3NA9L 3BZ4A 1HYRC 1EMTL 5KS9A 2NY7H 1AI1L 1SJHB 3HZYB 5F7DB 1FAIL 1X44A 4X7CC 4QF1A 3VD4A 4KKCC 3ZE0F 4EXKA 4PJAB 3PWPD 1U42A 3NTCL 4PJAF 3K0WA 4CGTA 5GS1B 1KIQA 2EH7L 4X0KA 2VYRE 4UUJB 3QCVH 2VH5H 1KLUA 3MCKA 1R3JB 3FHQA 3WHXB 1QLEH 4U1HA 2AQ1A 4Z8FL 3VDCA 4M6OH 1T03L 2FO1A 4HZAA 4YHLH 1UT9A 1L0YA 1AGEB 3QULA 1UADC 4UB0L 4L4VA 1QSEE 4L4TA 4RIRB 5DLMH 3RX8A 3MUZ1 1HCVA 2A1WH 1CLOH 5J3HC 1FCGA 4RGMC 1MCKA 4AJ0A 4RMQA 3E3QC 3D3VE 4MB3A 3QQ9C 3L3HB 3VGAB 5LKNA 1UM4L 2BDNL 1YNKH 1OP9A 2WBWB 1NGPH 5HHOA 3QPXH 1UYWH 4G6KL 4N8VA 4S1QL 5GGVL 1BM3H 1JNLH 5JORA 5FGBC 4Z7UA 1UWXH 4DKDC 3EJZC 1S5HB 4L8CA 1CXFA 4NP4H 1YY8B 1GL4B 1TZHA 3L3JB 3VFUB 5JA9A 5KVGL 3V5KA 1T2XA 3RI5K 3FB8B 5D5MF 5I17A 2AEQH 2VSCA 5E9DE 5L2KE 3QUXC 5F9OH 4J4PA 5ANMB 3DARA 2XKNA 4NPYB 1I8LC 2GW5A 4TVPE 5E4EB 3CSYB 3MJGX 5C0FB 4X5LA 4U6XB 4IRSB 5HHPA 2VZVA 3KS0H 2I5YH 3QH3A 3TWCL 5EU6E 1NGXB 3QUMB 6FABH 2A83B 5CGYD 1UZ6F 4NDMB 1V3LA 4ODHH 2EDKA 1RK1B 2A73B 5FECA 1BIIB 3O11B 2Z9TA 2G2RA 1DN0A 4P4KA 1OTTD 2ENYA 5A16A 4ZQKB 4OD2A 4WUUD 4PJFB 4NHCL 5GJSH 4PJFF 1BBJB 1H8SA 4XGZB 1HKFA 3F7RA 4D8PB 2VDQL 2DMCA 3X11A 4G8IA 5GRVK 3BPOB 1T7ZA 1DQJB 4GG6E 1IKFL 4DAGL 2W9DH 2P5WB 4G7VL 4HPOH 3FB6B 4P2QB 1I7TB 5D7LA 1BZ9A 1YNTA 4RFNC 4IS6B 5DMKA 4OUUB 3KPQB 1XEDA 3WKML 1JPFB 4CU6A 1JHKH 2CLRA 4XWOD 5IF0A 4R2GC 2PR4L 1T04A 2AJZB 3DMMB 4M93C 1A14L 3U4BH 1IGCL 1QLFB 3WHE0 4X4ME 4HUVA 3SDAD 4CW1A 1UXWB 1U8HB 4HK0B 4WWKD 3TVMC 4LCCC 1CFVH 4ODWA 5E95B 3UTTE 3MRBB 3WYRA 4K8RD 2Z93A 1T2JA 3FOMA 4KAQL 4UDTB 1P7QB 1U91B 3MRFB 4PJHB 1WICA 2EEBA 2X40A 3RVTD 3SOBL 3U4EA 1A4KB 2BSSB 1FNEA 1WAAA 3MOAH 3HE7A 3JTTB 1EEUA 4YPJA 4JRXA 3ZDYE 2GYSA 4CDHA 3WIHA 1MJ8H 3CSBA 1KPVA 4KK5D 1MAMH 1LILA 3R06A 1DFBH 3RJQB 1G7PA 1E6OL 4XCFL 3QRGH 1MCOH 1A9BA 4N8CH 4XHJC 4C56A 2DOCA 3PP3K 5I8OH 2MQCA 3DIFB 1R5WA 3AS3A 5FDWA 1SM3L 3FO2B 4U2ZA 3EHBD 3L95B 3DBXA 3P40A 2VLRB 2J6EH 1YEHH 3IAQA 4OGYH 5CIPB 2DM4A 5ENWA 5C7XL 4XVUD 3BZEB 2CDFA 1MHPH 1VADB 2H32A 5ICXB 1L6ZA 1TFHA 3EBAA 1YMMD 3MJ7B 1I9EA 1I9IH 2MJWA 5ETUA 3VXNB 5I6XC 4N9GA 4WW2A 2GJ6A 1A7NL 1CWVA 1FCCA 4LSUH 2VE6B 3QDJD 3UROR 4KGLA 3KPMB 2HKFH 1O7VA 2VWEC 5LXGH 4R0LB 2R56H 5DVLA 1XGRA 2E7HA 4IJ3C 5E8EA 4WFFD 2ZPKH 3VXUA 1R3LB 1FO0H 1KPRB 4HKZB 3VFWB 2XN9E 1D5ZB 4G9DA 2ADJB 4P49A 4C54A 2YPKA 4NO3B 4J3SA 4S1SL 1CIUA 4P3DA 5CKGA 5I1GL 4CDGC 4WDIA 1A7PL 4LSSH 3PGCA 2NY0C 4NQDA 4HMCA 2VISB 3EFFA 3MNVA 1B9ZA 1EBPA 3OTTA 1IT9H 1ADQA 1H0DA 5ICZB 2H2SC 3BW9B 3A6CL 4U1GB 4QHKJ 1C5CL 2FIRT 1NAKL 4JJ5B 1KFAL 1VCAA 2VDOL 5EO9B 1CL7L 4NM4L 1FYHB 4FQ2L 4PBVC 4G80A 1KLGB 2UY7A 3QFDB 2NY4C 4AIZA 4XP5L 1T20A 2HJFB 1MCFA 2GIYA 4GRLA 1PLGL 4DVRL 3LKRB 1A6WL 3LDBC 4NWTH 4W70A 3WFEH 1MRDL 2VL5A 3QHFL 4NQUA 3V79C 2EYTA 3KPPA 1FYTD 1YN7A 15C8L 3DSFL 4DKAA 5BW7A 4Z7VA 1WEJL 3RZCD 5MERB 3TBWA 1PZ5A 2HTLD 1ONQB 3Q0HA 1ZLVK 3KYAA 1WWCA 4XXDB 3IJSB 5I1IH 3GMMA 1OD7A 4XNXH 3U6RA 4S0TD 2X41A 5TH2A 3O0RL 2CKBL 1XR8B 5F3HA 5B8CB 3BP5B 1YEIL 4WEBH 4OAWA 1VA9A 3MODH 5GZNC 4JKKA 3QXDB 3EW3B 3WN5A 5DHVA 4DGVL 1MJJB 4Q9CA 3IF1B 4ZUSA 3MLPA 3GRWH 3IDNA 3MLRH 5D93B 1S7TA 3GB7A 5EUOE 5MEOA 2IQ9H 2WWMC 2AEIT 3FL7A 4F7EB 1DN2A 3LD8C 2F53A 4XC3L 5HYJD 2FHCA 1J8HD 4WO4D 3QHZH 1KT2A 4B5EA 3C5ZD 2GTWB 4TPRL 2QSQA 4NO2A 4P2OD 3UBXA 5AZ2H 4Y5XB 5FKPA 5H94B 3WSQH 1NBYB 3QDMD 1A2YA 1WIPA 3QG6A 2C4FT 4G6AD 4FNLL 1JGDB 3PQYB 4RAHA 4H88L 5H8DA 1ZV5A 5AYUH 1KJ2A 2CJUL 5DXWA 1I3VA 4ZFGL 3NGBB 4LHUA 4YWGH 4XAKD 5DZOA 4PRBA 1MOEA 4X80L 3CH8A 4XI5C 4YBQD 2RHEA 4YNYB 3ROLA 5T1MA 4RQQA 1GAFL 4AG4L 1K6QH 4PV8A 3O8XB 3BQUD 4QXTA 3UTSA 4G6ML 3TCLA 1I75A 4D9LL 1MCSA 1RIHL 2FJGB 2DIJA 1T2QH 1IEBB 3RNKA 3QUMH 2X4RB 3ZKNC 1U41A 3LQZB 1MJ7L 2Z92B 5IHZA 3SY0B 1YA5A 2YKLH 1IMHC 1RY7B 1QRNB 1QSZA 4GW4A 5ALCL 3V8CA 4R7DA 2M26A 2AGJL 3MRMB 4OCYL 5FYJD 1F4YL 3CC5A 1M71B 4UMGA 3TBVB 2ZKHL 3MV7B 1NSNH 1UENA 2X4NA 5HGGS 3MO1B 3HPJA 4F37K 3CMOL 1SJVA 4D3CH 4TNVF 5T3ZL 5KSAA 5C0AA 3VXQB 4P4RB 1I3UA 1G6RB 4Y4KC 3HG1D 5E00B 3LKSB 4HS8L 5LBSL 5IG7A 2X4PA 1JCKA 5JTWA 4FN0A 1CFTB 1MY7A 5E2WH 4XPTL 1B2WL 4JN2A 5HVWA 4M61A 1S3KH 2X09A 4L5FH 4NN5B 3O6FB 3LS5H 2N7BA 3B9KA 4NN6B 1A1MB 3TA3B 2ENSA 1XCTA 2ZCLL 5C08E 1U92A 3JV6B 5DD6A 5FF6B 1XIWA 5CBAB 1RZFL 3MRDA 4OZGF 4WTZG 5IT2L 1JI1A 1A6UL 1GGYA 3WUWG 1CZ8L 4OM1H 3QEHB 4OSUL 3MJ9L 1DJSA 4L4VD 4L4TD 5F1OB 4M4RA 1RSFA 2R1YB 4FZ8L 2WWKO 4UIKH 2FB4H 5C0DA 2VLKE 3LV3A 4MGXA 4LVNB 4M9OA 1JZ8A 1EA9C 4R3SA 4X6CB 1YEFH 5LCVH 4OLVL 2HFFA 4XP4H 3QNXB 4ZAKA 1QFPA 5L9DH 2PXYB 4TQEL 1M7DA 1BFOB 3TESA 4NQCE 4U1SB 1G7HA 2OJZL 2E27H 3BKCL 4N8PA 4X5WA 5IFJA 1PYWB 2BVQB 4JDVA 1S7SB 1D3CA 3HNTL 4JG0H 4KK9C 1TCRA 4YO0B 4J4PD 3RUGB 4I0PB 5C0EB 4XBGA 4NKIL 4Y4HA 3FOLB 1NGZA 4JPWL 3KWWB 5JMRA 1SYVA 4MJIA 3SE3C 3EOBA 3T77B 3WS3A 2IC2A 1CLZL 5IK3B 2CQVA 3VWJC 2X4UB 4J2XA 1ZE3C 4KV5E 3REWB 5BV7B 5EZJB 4HCRL 4LVEA 5CILH 4YGVB 2AEWA 4P4KD 2O26U 1T3FB 1G1CA 4HF5H 4CVUA 1IM3B 3LCYA 2Z8WC 1Z2KA 2EEDA 1A9EA 1CCZA 1EHLL 1F11B 1TTFA 2H26A 2IBBA 4H25B 4AMKH 4I13B 1QFWM 3LHPL 3K8MA 4FQXC 2H8PA 3L1OL 5HY9B 3CUPB 5D7LD 5IMMA 4Q9QL 3NH7H 2FO4A 2AEPH 3IKCB 3M8OH 1NBZA 5IMOA 2EIZA 4XH2B 1QFOA 1CICB 1SEBB 1LE5A 3L3KB 2BZDA 3C5JB 3PUCA 3OBAA 2ITDB 4MZ2A 32C2B 4QTHB 5F7NC 2IGFH 1BIHA 2FX9H 3GJFH 2VL4A 5IM7A 1SMAA 2ORBL 3IETB 4EDXA 3EOAA 2VLJA 3A6BH 3CX5K 3IAGC 1DQLH 1TZGH 2XQBH 1LEKA 4JY4B 1CT8A 4JPKH 3NCJL 3OR7B 1KC5L 4GUPA 3C6LC 4QRPB 4F9LA 5DURD 4PJ9B 1OP3K 1KCSL 2PO6D 2NXZD 2VDLL 1RIUL 3WFCH 4OZ4B 2J8UE 1CTNA 1RULH 1MQKH 3VGBA 5FO8B 3PWJA 3ARWA 1MFAH 3B5HA 1SJEA 5JW4R 2LTQB 4MX7B 2F15A 4GMTL 3BISA 1GGIL 3HE7D 1JMZA 4JRXD 2WLZA 3DRQB 4NM8L 4X99B 3PHQB 2FEDD 4GT7A 3D39E 3UJIH 4PRIA 1U95A 3BI9X 4C83B 1WLHA 3QIWB 2NR6C 1R0AL 1JHLL 2ICCA 2Y4SA 3T0VA 2CKBA 3OG6B 1KN2L 2JELL 1D5IH 2V2WB 4LCIL 4K8RC 4QEGA 3MV8A 1BP3B 4C56D 1OTSD 5BOZG 1GYAA 1S9VB 3AS1A 3T08A 4HUUB 3B8YA 4MDIB 4X5XB 4EI5A 2J4WH 4JM2A 3RVTC 4M1GL 2VERN 4HJGA 3S4SB 2DQGH 4GRMB 3WS6A 1HIML 2KZ1B 4RWYL 1HH6A 4NJAH 1IFHH 1N0LA 4FTVE 5INCA 1S7UA 3GMOA 3MRQB 4ZS6D 3VFNB 3E2HC 3S3JA 4K94L 3PNWB 3DECA 1IC7H 3HUJA 1INQB 3OHXB 5I1DA 3TO2A 3AY4C 4P5TB 4WU7B 2BOBB 5FUCE 5I74C 5BJTA 2GJ6D 5E8OB 2HH0L 5JQ6L 5I15L 4JAMB 1HXYA 4RSVA 1H5BA 1OB1A 3OKMA 4XNQA 3MRJB 2OMBA 1DVFB 3TIDB 5ACMA 2DMKA 4Y5VC 2ZUQC 2E7MA 1J18A 1NCCL 3PHOA 4NRXB 3G6DL 3DI2B 1FZJA 4XVUC 1ZT4A 3ISWA 4YDKL 1F45A 5CWSB 5DJ6B 4NQDD 3I2CL 3L3IA 5GISL 2HJKB 4Y7MA 4M5YH 3B6SB 5HHNB 1CR9L 4LPUA 1MFEL 3V4UL 5F7DA 5D7SL 1UEYA 1PFCA 3BOVA 4PJAA 1QP1A 3BRFA 4HULB 1A4JB 4UV7L 5GS1A 2RR3A 4UUJA 1X6NA 2F54E 1YJDL 2ATPB 5EULV 3VGDA 1L7IH 3L9RB 5JA8B 5KW9H 4OCSH 3GK8L 1R3JA 2XFXB 4GRLD 4URTB 3WHXA 2Z31C 4ZO6A 3TYFB 1FORL 4DTGH 2G5BB 2XWTB 3KLHD 3MOBL 1AGEA 1XGPB 4JZJC 3H9SB 3DO3A 4RIRA 4RISL 5DQ9B 4ODBD 3IFNL 1CXLA 1JIBA 2APVA 4ALAL 5CFHA 2D7QA 3FMGH 3L3HA 2HKHH 3C60B 2EYRB 4FQJH 1P4BH 4OZHE 1BD2B 4LPWA 1KGCE 4PB0H 5J56B 3DROB 3VA6A 5E56A 1S5HA 2AK4B 2ICES 4M6NL 1YY8A 2HA1A 2XKUA 4NZTH 4BELD 5I8KH 3H9ZA 3L3JA 1FE8H 2Y23A 3MFFB 5JIPA 2EDXA 1X5GA 3VFUA 3T1FB 4ZOCA 2HTLC 1ZEAL 3LY6A 3FB8A 4OF5A 1DLFH 4X7FC 2F53D 3AUVA 3E6HB 5ANMA 1CDHA 1RZKL 1NEZG 3P9WB 4NPYA 1Q0YL 4XP9H 3JBG7 1T89A 4TUJB 5I30H 3CSYA 3NIDF 5C0FA 3MGAA 4U6XA 3EO1B 4IRSA 2O61B 2WSKA 1AXTL 4HC1A 3SJVB 4L9DA 1JPSL 1NGXA 2ZG2A 3QUMA 5CSBA 5M94B 2DQDH 2C4XA 2A83A 2LV4A 4NDMA 1F4XH 5E6IB 1YEJH 1RK1A 2A73A 3CAFA 3O11A 1GC1C 2XTJC 3LKQB 2Q8AL 2DM7A 4LHUD 4ZQKA 3TH2T 1IAIL 1V7MH 2XIDA 4PJFA 3C2AL 4WO4C 5GRJL 1BBJA 3QBTB 5IOPB 1JPTH 5FM5O 4XGZA 4DW2L 4D8PA 1Z3GL 2V17L 4B7IA 1MI5B 4P2OC 3LH2L 1DQMH 3S36H 2ESVB 1DQJA 2P5WA 3UTSD 3FB6A 4P2QA 3ARUA 3QEQD 2FWOB 4IS6A 3GMRB 3B8SA 4OUUA 3KPQA 4ODXB 4NUGL 4YXKL 1JPFA 1S8DB 4LEXH 5J57B 4DWHA 4ONHB 1OAZL 2AJZA 4NT6B 4ORGB 3DMMA 1FZMB 3LQMA 1L7TL 3AVEA 1QLFA 4YBQC 2P48B 2G9HB 4XRCB 3MYJB 3FRPA 1UXWA 5TPWH 4HCRA 1U8HA 1PKQE 3HE6C 4HK0A 1F13A 4KTDH 4HSQA 2X1XR 1P5VA 4Z0XA 4OQ1A 3MRBA 5SWQA 4I77L 4Y8AA 1CBVL 3UYOD 5E5UB 3BZFB 4KZDH 1Z9LA 1P7QA 1U91A 5E9DB 3MRFA 4PJHA 3BPLC 5KSAD 5C0AD 1MSPA 1TJHL 1RZ7H 1A4KA 2BSSA 3SDCB 3JTTA 4PRHA 3TM6A 4P9HH 1JRHH 4HIXH 2DRUA 4RRPG 2YEZB 5I1LB 1MFBL 5JIKA 5HI5D 3TEUA 3B9KD 3MCG1 4EN3C 3GSNL 3V8OA 3WFBL 4KKLC 3VDAA 4HGMA 2GEEA 1XIWD 3MRPB 2VQ1B 1H3PH 1IRAY 4PJGB 3SCMD 4PJGF 3NN8B 4YE4H 3GO1L 1T80A 3DIFA 3ZE2F 2G5RA 1RUMH 1GHFL 4U0RB 5JQHC 3JWNC 3A6OA 2WP3T 2E6PA 3FO2A 1KENL 4JEGB 2VLRA 5AG8A 2APTA 3GSOB 5CIPA 5L88L 4HEME 4IRZH 1E27B 4X98A 5E1AB 4ZAKD 4G42B 5BVPH 5ICXA 4M6ML 3ARSA 3HRPA 3BYYA 4O2CA 3STBA 4XP6L 2IANB 1I7RB 3MJ7A 3VFSB 3VXNA 3BEWB 3G5VB 3ARFC 3NAAL 4LFHG 4M5ZL 1BHGA 1QSVA 4E42B 2DMBA 2VE6A 1H3VA 2D03L 4ENED 3KPMA 1IAIM 5ALBH 3KNBB 4P2YA 3ZT5A 4R0LA 1MAJA 1OAUH 1R3LA 1L9NA 5D2NE 3RVXD 3BUTA 4MQXD 1KPRA 4HKZA 4JPIB 4N0RA 3VFWA 4DKEL 2NY3D 2ADJA 25C8L 1CXHA 3TN0A 4TOYL 4NO3A 1JMXA 4Y4HD 5GS0L 3KR3H 2IALB 5EOTB 2DAVA 2VDKL 3MLWH 5IMLB 4M48L 5DRXB 3UCRA 2I9TB 3QNYB 4RGND 2VISA 1J0IA 2H1PL 3KYMB 4OCWH 4QHUB 2ED9A 4FQLL 4MJID 4PLKC 3QDHA 3VFGH 2DQIL 1OAXL 4KVCL 5EC1A 3GNML 3BW9A 3ZDYF 1IL1B 1TPXC 4WFED 4JHZA 3NFNA 3GJEB 2R8SL 4JJ5A 5EO9A 1OTUC 3KGRA 1KLGA 3QFDA 1X4YA 4J4PC 3MV9D 2HJFA 5CBEB 1BEYL 5SWSE 4JFDB 1C7SA 1UA6L 4RWHA 3LKRA 5EO1B 2FEEL 2NY5C 5KAQF 2GI7A 4PJ7B 4LCYA 3W0WB 4EBQL 1VEOA 2BK8A 3L5IA 3JVGA 1RFDL 3U30C 3EJYD 4AEHH 5MERA 4M7LH 5EORL 2R15A 3HI5L 3DSNA 4XXDA 3IJSA 4BZ1H 2J5LB 3N06B 1DSFL 5B8CA 1CI5A 3BP5A 4K2UH 1TETH 2HT4D 1TIUA 1JTPA 4XPHL 2CRMA 4GXUM 4APQB 3LPFA 3ZT6A 3QXDA 5DHYB 2ADIB 3ARQA 4LIQH 3GHBL 4Y8DC 3ALWA 4Q9BA 1V7NH 4LOUD 5KSUB 1MJJA 3IF1A 4ZFOL 1YEKH 3DVFA 4L3AA 5DFWH 5MP6H 2ED7A 4C59B 2DM3A 4AQ1B 3QA3B 5HYIA 5E2UH 1EMTH 3ULVL 1AI1H 1XGQB 1FAIH 4NBYB 3RU8L 1J1XL 4OCXL 3NTCH 2GTWA 1OQOA 3CSGA 5F7WC 5HHME 4PRID 4Y5XA 5H94A 1NBYA 4W4OA 4Z8FH 2APWA 2B7DT 3K8LA 1JGDA 3PQYA 4O58L 4U33A 2HLFD 3WNOA 3MV8D 5DTFB 5EIQA 3IVKB 1OLLA 4MS8D 4XNYH 3FQTB 4EI5D 4QRRE 1ES0B 1RPQA 3CVHB 4JM2D 5DS8B 1KJMA 3ARVA 4KMLB 5D1QC 3QJFB 1C1EL 5HHQB 4YNYA 3HAEG 1UM4H 2BDNH 4MVBD 1TITA 4QGYA 4MNQA 3MOQA 4Q9RL 4PGEB 3O8XA 5GGVH 1ZT7B 3D1MC 4Y4FB 4KHTL 2FJGA 4PJBE 1ZMYA 1IEBA 5EU7C 2OTWB 2X4RA 4TNWK 4EUPH 3IS0X 4OLWH 3LQZA 2FBJL 2Z92A 1EGJH 3TFKD 5D1ZB 5KVGH 4F57H 1T7YA 5K93A 4ETYA 1V3JA 1QRNA 4OD1L 2DWDB 1TTUA 5D8JH 5I76B 3MUHL 2YS4A 3PIQB 4JHWL 3MRMA 4KGJA 1G9NC 4D0CB 4LLDB 4MA1C 1M71A 3U82B 3SO3C 3TBVA 3MV7A 3DXAD 4OLEA 2ZCHL 2HWZL 3MO1A 3TWCH 4NNXB 1QACA 5EN2B 4FABL 4RDQF 4P4RA 1G6RA 3G5XB 1QRKA 1NDMB 2BVTA 1JGVL 5IESL 3FKUS 5E00A 3LKSA 4K71B 1CFTA 4C4KO 1TZIB 2X4QB 1WSST 2MCPL 3O6FA 3GKZA 4IM8A 1WC7B 1A1MA 1KIPA 3TA3A 2EZ0D 2XA8H 1HKLH 5J11C 5FF6A 1YEGL 5CBAA 1QFUL 2VDQH 1U6AL 1I9RL 3FT4B 5IB4B 4L3EB 3OKYA 1IKFH 4DAGH 1F3RB 4KK8D 3QEHA 3N1GC 5JOPD 2F58L 2J88L 1GXEA 3RHWK 3TPKA 2R1YA 1NDGB 4XPBH 4TVPH 5EOCH 2PR4H 4X6CA 5D1XC 1P2CB 5F7MC 1A14H 5AYQA 1NANH 3ARZA 1IGCH 3HTLX 3QNXA 1J1OH 2PXYA 4K3EL 3O2DH 1BFOA 4GO6B 2B39A 4XAWH 4U1SA 1K3ZA 3FT2B 5FFLA 5J1SC 4X4ZA 5DF0A 5BW7C 1BVKB 3S5LG 1PYWA 2BVQA 3DETD 1S7SA 2RCSL 3LEVH 2R0ZL 4IIQC 1TJIL 3GM8A 4R8WH 4LKXB 2DQHH 4YO0A 3RUGA 4I0PA 2P8PB 4XC1L 5C0EA 1EPFA 3FOLA 4LPXA 4HV8B 4IRSD 3KWWA 4P9ML 1NMAL 1G6VK 1Y18A 3T77A 4P23A 5IK3A 2YMXH 3WN5C 4ACPA 2X4UA 5FYKL 4U49A 3REWA 5EZJA 2QADC 2AK1L 3AROA 5JPMB 3F58H 3IKKA 3KLDA 3VRIB 2R4RL 4XB8A 1F6FB 1T3FA 3CDYA 4ZYKB 1IM3A 5IV2B 1T22B 3KPSE 1F11A 3ULUF 1QPXA 1WT5A 5B22A 3DLQR 4H25A 2XG5A 1WTLA 3LQAL 4LSQL 5JHDB 2QQQA 1IGFH 3VI4F 4I1NB 4CU7A 2P5WD 5HY9A 5T5FL 3PABB 3CUPA 2PNDA 3HN3A 4PJXE 3FO0L 3IKCA 1ITCA 2VKXA 5I9QB 4XH2A 1SEBA 4LU5H 2NY2C 3L3KA 3C5JA 4XPAL 5I18H 2ITDA 32C2A 4QTHA 2JIXB 4U2YA 3IETA 2V2XB 4HT1L 3U7WH 3VG0L 4KMQA 5JDSB 2VOTA 3KPLB 4JY4A 4P99A 2UYLB 4S1SH 2BHYA 4QRPA 1A7PH 1KB9J 4BK5A 3EYQD 4MQ7B 4PJ9A 2JB5L 4N8VG 5D2LB 5CEZD 4CKVX 3R0MA 4KDWA 1P7QD 1CD8A 4OZ4A 3QPQD 4IDJL 5FO8A 4OIAA 3VXTB 3QUXB 4MX7A 5A43C 1NAKH 4MDJB 3H3PH 1OCWH 3DRQA 3OJ2C 3OAUH 4X99A 3PHQA 4QXGH 4JJHA 4C83A 4XP5H 3QIWA 2QSCH 3B43A 2V6HA 2C1PB 4Z95L 1OY3B 4JFHD 1CE6A 1MEXL 2FECL 2J7LA 4KV5F 3AU1A 2V2WA 1MRDH 3MX0A 3QHFH 4TSBL 4ZPTB 1S9VA 5HYQB 3GUTB 4HUUA 3DSFH 4MDIA 3RL2B 1KEGL 3BKYH 4X5XA 3T8XA 4OQTH 3ZMRA 5E03A 5ACLA 4GRMA 1CQKA 4NFDA 5IB2B 4LAQL 4DEPB 4NCC2 2PN5A 1MH5B 3O0RH 3WUWB 3MRQA 1YMHB 1CFNB 1YEIH 3VFNA 5CCKL 2ZOKB 3B9KC 3PNWA 3C08L 4A6YH 1INQA 3OHXA 5A1AA 4LP4A 2DQJL 3CDFA 4HJJL 4P5TA 4WU7A 2BOBA 2B2XL 2Q3AA 2Y5TA 5ID0B 2AVGA 5E8OA 1VENA 1K4CB 5FM5M 4JAMA 3VA2C 1BFVL 2CPCA 2EICA 1I85A 1YNLL 3MRJA 3ECBB 1II4E 5HXMA 4HGWB 1DVFA 1FIEA 3FO1B 4PB9L 3S34H 2NLJB 3O41B 3TIDA 2F8XC 4TPRH 4U1JB 1QYGL 4LCCB 1ZANL 5EBWB 1LK3L 3HLAB 3MPCA 4NRXA 1AGDB 5AWNL 2ID5A 4O00A 1J10A 2K7QA 3MLTB 1B3JA 1BJ1H 3AB0B 3FFCB 5HD8D 5CWSA 5DJ6A 4DZ8B 3VG9C 2EH8H 2HJKA 4JQIL 4PJDB 5HHNA 3B6SA 4G5ZL 3I3DA 4H88H 4JFZH 3TV3H 2CJUH 4JCMA 3LIZH 3WFDL 1A4JA 5JW3L 3BJ91 3TT1L 1KIUA 2PW1B 2ATPA 3ARGB 1XMWA 3O4LD 1JNJA 3VXSB 3L9RA 4JANB 2NY3C 2XFXA 1HK6A 3Q5OA 1HZHL 5C0RH 1AGFB 1FV1B 3TYFA 2G5BA 4PGDB 3BE1L 2XWTA 4WV1B 1AC0A 4U6TA 1XGPA 3HZVB 1BAFL 3H9SA 4G6MH 2VIRB 4D9LH 5GRUH 4D9QD 5DQ9A 3QO1B 5GRVL 2LU3A 4WI5A 5F7EL 1J11A 2O5ZL 3STLB 4ETQB 5CGMA 3C60A 1MJ7H 1KXVC 2EYRA 2K9UA 3LEXB 5C6PB 5FYLE 3NIFE 1BD2A 3OKOB 4NNYB 4LPYA 1I8KB 3NOIA 3TJEL 4DKFL 2VQTA 4WI8A 4QHLB 5ALCH 4HKXB 2OP4L 3VD5A 2X1WL 3DROA 1ZLUH 4LCWB 2BNRE 3S8WA 5IFHH 1U8LB 3KPRE 3CVHL 1P84K 2X9WA 1EEQA 5I73B 1UKQA 4Y16B 1F3DH 5T3ZH 1NC2B 4L8DB 3EJYC 3BH9B 1EJOL 4IJ3B 4R26L 2RJMA 3T1FA 2NZ9D 1MRFH 4OGAD 3AAZB 4NC2B 1RUPH 3RTQB 1WGOA 3E6HA 4Y2DB 2Z4QB 2BRRH 4JRYE 4TUJA 3DWTA 1T5WB 3JWOC 1X5FA 3EO1A 2O61A 2NY0B 1T66D 2IF7A 1NBQA 2ZCLH 3SJVA 1CFBA 3VMPA 5TFSL 4CRPA 3K2MC 1RZFH 43C9A 5IT2H 1T7VA 4LOUC 4NQXA 4F9LC 3PQYD 5E6IA 1BGXL 1BZQK 3QI9B 5ABDE 4OSUH 2FX8H 3MJ9H 3RRQA 5C09B 4KC3B 4FZ8H 3MLSH 2NY4B 1U3HB 4KMTL 1HINH 4OLZL 3CFJB 3ZE1E 5IOPA 4Q0XL 5A40E 1WBZB 3EDJA 5EBLB 4HIJA 1NEUA 5A2KH 1MI5A 1C5BH 2A0LD 1PEZA 2ESVA 2F5BL 3O8XD 3HMWL 1G9EA 2E6QA 5ISZB 4TQEH 3BD4A 3M17B 3VJ6B 2OL3B 1J0YA 5DHXB 4LQFH 2FWOA 3GMRA 1AJ7H 4ODXA 2N4IA 5E70A 4Q6YA 1CU4L 1S8DA 4OZHF 2MOVA 3F12B 4OI9A 4ONHA 1CDCA 1SQ2N 2KZWA 4NT6A 2IPKB 3HNTH 4JM2C 2R69H 1QRND 4XRCA 1BQUA 3MYJA 1YC7A 4X83A 2IAMB 4J1UB 5BXFB 1INEL 3G08B 2GY7B 1OGTB 3MV7D 4Y1AE 4OJFL 3PG2A 4RMUA 2VITB 3BZFA 4LSPL 5E9DA 1CLZH 4GXVH 5DJAB 3LD8B 5JW4M 2I07B 3WLBB 3SDCA 3PV6B 5E2TL 5C86A 1H5BC 5BS0E 4EQ2A 1XF2B 2YEZA 4F58L 5I1LA 3O2DA 3O6FD 1T6WA 4YPGB 5CD5D 3TA3D 1OT1A 2FCBA 1EHLH 3O6LL 3N1PC 1EUTA 3MCLL 3MRPA 3OJVC 2VQ1A 4CJ0A 2VJXA 1DQQB 4PJGA 5CJOL 4F15C 3ZTNL 3NN8A 5EIIB 3LS4L 2BX5A 3UBXG 1KULA 3NCEB 4BH8B 1KPUB 1MCWW 2NQCA 3ARBB 1JBJA 1U8PB 3LPWA 2V5SA 4MJ6B 2OJEB 1TXKA 2KQNA 1QSFE 1NCAL 2P8LB 2KH2B 4RCAA 5KSBE 2W0KA 4A2MA 5IW3A 4J23A 5GS1C 3GSOA 4LHUG 3G6AB 5DRWB 4NWUH 2ORBH 4NRYB 1E27A 3VW3H 2EZ0C 5E1AA 4G42A 2PXYD 1QQDB 2IANA 1I7RA 3VFSA 1LO0L 3BEWA 3G5VA 1PX3A 3ZTJH 4E42A 4PPTA 4E41B 4J3TA 5FUZH 2VDLH 1RIUH 2P8MB 3KNBA 1A64A 2E6JA 1ZGLP 4QHNB 1BQLH 1I3RB 5C2UB 4Z0BL 4JPIA 4GMTH 3VGAC 5DUPL 1X5AA 4LDLB 3RKDD 2IALA 5EOTA 4GH7B 3TJHD 2MPAH 5IMLA 1KCUL 4MSWB 2I9TA 3QNYA 1RQ5A 3KYMA 1B88A 4QHUA 3E6FB 4GLRI 3L5WB 2DQCH 4BJLA 3JZ7A 4LCIH 4M7KL 3DHMA 1A6AB 1IL1A 1JL8A 3CFKB 2EEAA 2G60L 3GJEA 3DETC 4DFIA 4WGVB 4CU8A 4BQ9A 1HIMH 5CBEA 5C0GB 4JFDA 5E4EC 3V6OE 5EO1A 4RGOH 3RGHA 1TVBB 3R8BB 5MEND 2ZNXA 4PJ7A 1FH5L 4IRSC 3VGGA 3W0WA 2OK0L 4X9HA 3GI9L 5J4MA 5KVFL 5FK9B 1XGTB 2YPVL 4KI5E 1ORQB 5GS0D 1MCNA 5DVNA 1YYLL 5LAXB 2HH0H 5JQ6H 5I15H 4PRNB 1CICD 2CK0L 1UCBL 1P6FA 1N8ZA 2X89A 3OJMB 1DE4B 4HWUA 3O3AB 1H15B 1MNUH 3KAAA 3D6GA 4LARH 5D4QA 3MROB 4APQA 3FT3B 5DHYA 2ADIA 3VWKB 4RMTA 2NX5D 5KSUA 4QRPD 2QHRH 2YPLE 2YD1A 3B3IB 4OQTA 2HN7B 4YDKH 3PWNA 2BRQA 5GISH 5KVDL 3UTZB 3QA3A 4LGPB 1LVEA 1P53A 5INDB 1CR9H 2I60H 1XGQA 3MBXL 2R23B 3OJDB 5D7SH 4GAJH 3MV01 4WFHD 3RY6A 3QIUA 2V7NB 4F3FA 1N5AB 3DMMC 4KQ3L 4PY7B 4A6YA 3RY5A 1YJDH 4NQEE 1UJ3B 3JV4B 2Q3ZA 1KB5B 1CDIA 3QIWD 4X6FB 4DGYH 5B38G 3CCHB 4OLXH 1FORH 5IVXE 3RVUC 1PX4A 3VWJB 3ET9F 3FN9A 4NFBA 3MOBH 2DM2A 4H8WC 1XAUA 1H3WM 3IVKA 3QPQC 4L9LC 4RISH 3X12B 3FQTA 1ES0A 5SWSB 5EZIL 2A9NL 5IBLC 4ORZC 5DS8A 5K33A 4ALAH 2HT3C 4ONOA 3QJFA 5HHQA 1F00I 2APBA 3SGJA 1NCBL 1RUKH 1QA9B 1CTOA 4KJPC 4FFVD 3TPUB 4PGEA 3OAZK 3BT2L 5IR1B 4K9EH 2O5XL 5GGUB 1ZT7A 4Y4FA 4AH2B 3FRUB 2VWEE 4P5TD 3OF6A 4JLRB 2OTWA 1RJLB 4M6NH 2FH6A 4TUKH 1HQRB 2W59A 4I2XE 5D1ZA 1JZ7A 6CGTA 2NY1C 1ZEAH 1DVFD 1RZKH 1I8IB 2DWDA 2QLVB 4GKNB 2E9IA 4Q74A 5I76A 1Q0YH 3PIQA 1B4JH 2JCCB 1U8NB 2K1MA 2D7NA 2RGSA 4D0CA 4LLDA 4OF0A 3C6LB 2EDEA 1JPST 3QG7H 4YUEL 4KXZH 1VDGA 5JO5B 3T3ME 3L6FB 1BWWA 4NNXA 5EN2A 5F8RC 5D6DA 5DC9B 3G5XA 3OSKA 5IFAH 1NDMA 3EOYG 4KVNH 4PJ8C 3Q6GL 3UPAA 4X6DB 1TZIA 2X4QA 3G6JB 2NW2A 4UOW0 4IRJC 5ID1B 4CAGA 5HDQL 2ARJQ 4LNVA 4LLWB 1WC7A 4HJ0D 4CJ1A 2FYYB 2JJUA 1UKTA 3CU1A 4O4YL 4GKOA 4KU1A 3R0NA 3ZKXC 1Z3GH 4MB5A 3DNKA 3TN0C 1VPOL 2VLME 2FZ3A 3FT4A 2MNUA 3LH2H 5JPNB 5IB4A 4L3EA 2FATH 5CZVL 5HD8C 2DN7A 4IMKA 3H9SD 1CLYH 4PRPB 5CJQL 1U2HA 4H1LH 4YXKH 1NDGA 5B39B 4U1GC 5FM4A 5HJ3B 4LAJH 3C60D 1F8TL 4R4FL 4U1IB 1OAZH 4N9OB 1P2CA 2VUYA 4TRPH 3E2HB 2BNQE 5BRZE 5FA4B 2Y06L 1FGNL 3TO4C 5LQBL 4PJBF 4M02A 3F6LA 5CKAA 4R90L 2UUDH 3FT2A 1WFTA 2KPNA 3BGMB 2AK4D 4I77H 5DQDL 5J12C 1E4KA 2Q87A 3PL6B 5I0ZA 1FVDB 1BVKA 3JVGC 5FAAA 4DQOH 1YQVL 5C9KA 4XVJH 3BPNC 2KKQA 4MNGE 4LKXA 1NUGA 2FGWH 1M4KA 5GGRY 3K4ZA 2P8PA 4TTDD 3EIFA 5GSVB 1MFBH 4KY1H 4XVTL 4HV8A 4NZDA 1JZ2A 3IU3B 3GSNH 3WFBH 3CFCL 5KN5B 3SJVD 5JHLL 2CIIB 3B9AA 1NLDL 2Y6SD 5E6ID 1T0MB 1CD1B 5DD1H 5D93C 1A3LL 1IGYB 5JPMA 1KXQE 1GHFH 2NZ9C 3VRIA 4Y19E 1FIGH 4ZYKA 5D7KD 4WI9A 4PR5B 3GBNL 1KENH 4PJCB 2Z31B 5IV2A 1T22A 4P2RB 4C57C 2Y1VA 1MI5D 1NCUA 5ITBH 4LGRB 4X4YB 5JHDA 4Y5XC 5EU3B 2ESVD 4XMPL 3CJJA 1K8IB 1KJVB 1UWEL 2APXA 3QCTL 4UBDD 3EO9L 4ZUTB 1LP9E 4M5ZH 3HAEB 4L1DA 1GCFA 3NGBC 3RVVC 1RZGB 1MWAB 5DC4B 5KZCB 1FG2B 2JIXA 3QUYC 2V2XA 5FYKD 2YBRB 1HI6B 1MIEH 1U58B 5JDSA 1CGSL 3KPLA 25C8H 2UYLA 3AFLA 3ZDXF 4MQ7A 4M48H 5EZOL 2EO1A 5HI3C 2H1PH 5LGHH 2D0FA 3PDOB 1OAXH 1ODAA 1K85A 3OQ3B 3VXTA 3QUXA 2OS7A 1DTUA 3D0LB 3RZWA 3W2DL 1IAMA 3SDCD 1I8LA 2R8SH 3QXUA 5EC2B 4R9HA 1MVUB 1KTRL 3IRZA 4MDJA 4WCYL 5KANG 4V1DB 4RBPK 1NL0L 3P0YL 2NW3B 4OZIE 2VZUA 5HYSG 1BJ8A 3GZKA 2C1PA 2QKIB 3PHSA 1VGEL 3K74B 4M1DL 4KPHL 4EBQH 3P4OA 4ZPTA 4MZ3A 3PWPE 5HDLA 5HYQA 3GUTA 2XTJB 3MXWH 3RL2A 3FQXB 3QWOB 3LZFH 1IILE 4XXCA 5EDXA 3T0EB 5EORH 5F9WB 5IB2A 1JNNH 4RNRB 2X1QA 3IJHB 1E4WL 4UINH 1E4XL 1DBBH 2DBLL 5JLZB 1MH5A 3WUWA 1X5LA 5E2VH 4P59H 1YMHA 1CFNA 3O6FC 2ZOKA 4NN6C 5CD5C 3TA3C 4XPHH 3INUL 3MZTA 4HS6B 2IAND 1QPPA 3GHBH 1MREL 2PUQT 2XOTA 5ID0A 5L0QB 1VFOA 2OCFD 5C2BL 4HWZB 1K4CA 5L7XH 3IDIB 3ULVH 3ECBA 3RU8H 4HGWA 3FO1A 1J1XH 2NLJA 4ONFL 3GSWB 4LVNC 3HE6B 4HWEL 4U1JA 4LCCA 3QYCA 3EAKA 5EBWA 3HLAA 2OM5A 3CDCA 1QBBA 1AGDA 1U8QB 1D9KB 5DEGB 2BNUB 5GGTA 1NFDE 3MLTA 3MRHB 3S5LB 2PXYC 1LO3L 3FFCA 3QUZB 1WJ3A 2D7TL 4PJDA 2FJHB 3AS0A 3IGAB 4M4PA 5DR5L 1TVHB 3VXRB 4QXUL 4X7SL 2F8VA 4I3GA 4RZCB 2PW1A 2WBJC 3ARGA 4P5KB 3TLRA 3VXSA 1P4IL 1C1EH 2C5DC 4DN3H 4JANA 1H3XA 4HZLB 4I0PC 4JFDD 3UTQB 1FV1A 1TQBB 1J9CT 2FSEB 4PGDA 3CD4A 4WV1A 2HJLB 3UC0L 3TJHC 4Q9RH 3GSQB 3W0WD 3NZHL 3U2SB 1WZ1L 3HZVA 2VIRA 4JY5L 4EOWL 2CR3A 4JO4L 4LPVA 4P23C 4C55A 3HNVH 3QO1A 4WUUE 1EEYB 3D85B 1KB5L 3STLA 4JO1L 5E5MB 4ETQA 2DS4A 4TVSa 1UCTA 5BV7C 4UNTA 3LEXA 5IHBA 1Z9SA 5HDBE 2F74B 2OR7A 4JZOB 1G7IB 4NNYA 3OKOA 4HH9B 1I8KA 3CX2A 1IVLA 2P5ED 4ELME 4QHLA 4HKXA 2IFGA 1YPZE 3OMZA 4APQD 4JHWH 4LCWA 5I75B 3ARFB 4JB9H 1MFCL 1WT5C 1U8LA 5E2JA 1YC8A 3IFOB 4JO2L 2HWZH 1CDYA 2R2EB 4Y16A 1QBML 3MLXL 4L8DA 4GRWB 3X14B 2Z91B 3IXAB 4OGXL 3SBWC 1YYML 3RTQA 2AJXL 4P9HC 2Y36L 4Y2DA 2PETA 3S98A 5DJZB 1GGCL 1SY6H 1RURL 2OZ4A 4FZEH 5D9SB 1KUMA 1T5WA 2EDOA 3MNZB 1FN4B 1BOYA 4HLJA 2B0SL 3KYNB 1YEGH 4XCYB 1I9RH 3ARDB 1TPXB 2V5MA 4HBCL 3BMVA 2NTFB 3QI9A 4PJ9C 1NMBL 4K55A 1MLCB 2J88H 5C09A 4LSVH 5EBGA 1NFIB 3O2VL 1U3HA 3QFJB 4HQQL 2LTQC 5TDPB 3CFJA 2P7TB 4MXWH 5F6HI 1WBZA 1UC6A 2AJSL 1IAOB 3QQNA 1IC5L 3BKJL 3TNMB 5ISZA 2MKLC 2C26A 4K3EH 1DEEB 3M17A 3VJ6A 4ZMAT 1UEMA 5FB8B 2OL3A 1GPOL 1F90L 4AZ8A 4Y4FD 3U30B 2QR0B 4G8GB 4X7TB 2XKSA 1NAML 4JM4L 4U1NB 3NIFF 1XT5A 4UTBL 3OKEB 2B20A 2BC4B 1I1AA 3F12A 3FB5B 3V6ZB 1X5YA 3BH8B 2IPKA 5D1ZD 2R0ZH 4H20L 4K8RL 3LKOB 4MB4A 2JB6B 2DF3A 2BY1A 2J12B 1N26A 1YMME 2IAMA 4J1UA 5BXFA 3WFHB 4ZUVB 4IBLT 4N0UE 3G08A 4FQIL 1OGTA 1AR2A 1NMAH 2VITA 2XZCL 2BP3A 1WZKA 2B5IB 3O3UN 4WFFE 5DJAA 1RJCA 5DC0A 2I07A 2VZ1A 5I0DA 2WQ8A 3WLBA 4F33B 1MCHA 4IOIB 3PV6A 4NKMB 2AK1H 2P45B 2R4RH 1XF2A 3H7BB 3LKNB 2QHLA 1U9KA 2AI0L 3FTGB 1MWAH 4YPGA 1DVFC 2Q20A 2WP3O 1MCCA 3SGEH 3HC4L 5KTEL 2R0KL 2QQKH 2HLAB 3U7YL 4KTEL 1VB9A 1W72H 3CSPA 1DQQA 3UTPD 4EDWL 3LQAH 4JFFB 4L3ED 3W82A 3PP4H 5ERWB 4BH8A 5L8KB 1KPUA 1H8NA 3ARBA 3ZE1F 1U8PA 5D1QB 4WI7A 3FO0H 4MJ6A 2OJEA 4AM0B 2P8LA 4MA7L 4PLOB 4G6JL 3THMH 4ZO9A 4XBEH 4XPFL 3G6AA 5DRWA 1Q1JH 4NRYA 5BO1L 1FYTE 1NCWL 2C7UB 1QQDA 1LDPL 1OSZB 2ICEB 2ZOLB 4O02H 4I3SH 5T3XL 1GVIA 4E41A 2JB5H 4YHOL 5IGXL 4YHML 4TNVK 4BFGA 2P8MA 5B21A 4YDLC 5FDWB 2XWBB 3IU4L 4QHNA 4JZNB 1I3RA 3DBXB 3T2NL 2EC8A 4PJ5B 4XCEB 3U48A 3SO3B 4YXHL 5C9JB 4TSAL 4J3XA 1U8KB 4MSWA 4Z95H 3WIIL 3E6FA 2XZZA 3L5WA 4GOSA 5T1KB 3FQUB 1RMFL 4PUBH 1A6AA 5HYJE 1J8HE 4TSBH 3CFKA 1X5JA 4KDTA 4J6RL 4PIRF 3RNQB 2EECA 1HE7A 1SVCP 1CD0A 4QTIL 3FN0L 7FABL 2X2YA 5DA4A 2DQUL 4OKVB 4LAQH 5C0GA 3QDME 5TQ0L 5J11B 3ULUD 5BZDB 1TVBA 3QIBB 3QSKB 4P3DB 5CCKH 4GSDL 4NJ9L 3C08H 5JHDD 4X9FA 1T0NB 4XAKE 2DQJH 1QSFB 4HLZH 5FK9A 5FHBL 1XGTA 1Q38A 5KSBF 5J3HD 2B2XH 4HMEA 2I24N 5HVGB 1ORQA 5LAXA 4CL7A 1CFQB 4PRNA 2EDYA 2ZUWA 1BFVH 1ZHLB 2GT9B 4H26B 1DE4A 5D1XB 5C0NC 2Z8VC 3O3AA 1H15A 2JIXD 5E99H 4G3YH 4PB9H 3MROA 1GC1L 1S7XB 3FT3A 5BCAA 4K07A 3GHEH 3WNPA 3OB0H 1ZANH 1JTOA 1LK3H 4QYOB 3VWKA 4M62L 3TBTB 1RIVL 3O2WH 3BGFB 3CFEB 4WTWA 3B3IA 5JOEA 1N4XL 2HN7A 4UBDC 3UTZA 2BERA 4JQIH 4X7DC 5INDA 4IIQB 4Y89A 3SE8L 1N6QH 2R23A 3FB7B 4MQSB 4QKXB 1DR9A 3OJDA 3QUXD 5DEFB 2R0WL 5JW3H 2V7NA 5FYJE 5I1JL 4PY7A 1QLRB 1UJ3A 3JV4A 4Z5RB 1KB5A 4X6FA 4I48B 1CK0L 4ODVL 3CCHA 1VKXB 3VWJA 1EXUB 3PJSB 1JHTB 3HG1E 3V5DB 2AJYL 1BAFH 4RRPA 2QADB 5FXCH 2A77L 3M1BB 4O2EB 4P5MB 3X12A 3DGCR 1N64H 2F19L 5SWSA 3MA9H 4ODSL 1J5OH 3KXFB 2EDWA 3JUYA 1CQYA 2X4TB 1KT2B 4M3KB 4NRZB 1QA9A 5AZEH 1JGUL 1VFBB 1ERNA 2LAAA 3CZFA 4N0FB 3TPUA 3WEXB 3TJEH 2CD0A 4DKFH 5I1EL 2OR9L 5FKPB 4Y5YC 3EYOA 2OP4H 5GGUA 4KI5F 4L4TE 2PYEB 4AH2A 1FC1A 4HWBA 3FRUA 2B8OT 4BKLB 4S1DC 4F7MA 4JLRA 1RJLA 3QWQB 1DZBA 2R1WB 5LGKA 1HQRA 1K9TA 2NY2B 4R2GD 5FYJL 1S78D 4R26H 1EJOH 1KEML 3P4MB 4XBPB 1XF5B 1I8IA 4GKNA 4KZEH 4Z7UE 1TJGL 1EERB 3SDXB 2JCCA 1U8NA 3C6LA 2XRAL 4P48A 4QXTB 5JO5A 3L6FA 4G43B 3FFCD 3NA4A 5H35B 1LQSR 1FLRL 4NUJB 4LQ1A 4QGTA 4PRDB 2X44D 5CINH 4X6DA 5FYLH 3G6JA 3G9VA 4WIQA 5ID1A 1T6VN 4CADB 4LLWA 3ARGD 1EHAA 2ZUTA 5IVXB 3VXSD 2FYYA 3PP3H 5IVXF 4OLZH 3RWCB 1L6XA 1HCFX 3MRIB 3NFSH 5K9JL 3EFDL 5JPNA 4XHJD 2FLRT 1PSKH 3NPSB 3HMWH 4UILL 3KYKL 2VR4A 3D48R 4YDJB 4PRPA 4EI6B 4NBXB 4OV5B 5B39A 3ILQD 5HJ3A 5FIEA 4JN2B 2P24B 3MYZA 2YOCA 1AE6L 2E7CA 2VDML 5FA4A 1HWHB 5T1LB 4H5SB 1L0QA 5DD6B 3EJJX 4KQ4H 3UZVB 5D7LE 1AQKL 3BXNB 2N7AA 4LCWD 2VZ3A 1CG9B 3BGMA 4HD9A 4BH7B 2AQ3A 4PYHA 3PL6A 1Q72L 1F6AB 1FVDA 4LSPH 2VDRH 4A2LA 2NY5L 1NC2D 1FDLL 2KQMA 4ZTPL 1M05B 2H9GB 3MGTB 3RTQD 4Y2DD 2J5LC 1IBGL 2RIKA 5E2TH 5FUOL 1F2QA 4OCLC 5GSVA 3T3MF 3DYMA 1OGAB 4WJ5B 3T2QA 2W92A 2NY0D 3EYUH 3IU3A 1CE1H 5KN5A 3O6LH 2VR5A 4YAQB 2CIIA 2C3WA 4OLYL 1T0MA 2WZPD 2YR3A 1CD1A 3ZTNH 1WAAE 3QI9D 4KTYA 2ICWI 4QRQB 3OPZL 4JRXE 4TSCL 1IGYA 3WHE1 3BX7C 5C09D 1OAYL 3UXFA 2I25N 5B38B 2C9AA 2NY4D 4PR5A 2EDHA 4KRNA 4PJCA 1YY9D 4WFGD 3QIUC 2Z31A 3IDJB 3NFPA 4LBEA 4P2RA 3UEZA 4XBGB 2H41A 4JKWA 5EU7E 1ZLVH 4C56E 1OP5K 1U2CA 5EU3A 3N1QC 1JN6B 1K8IA 4XT1C 1KJVA 1BMGA 5ISZD 1RZ8B 3GI8H 1LO0H 1GOHA 4JDTL 1X5ZA 4ZUTA 1OARH 3HAEA 4YBHA 1YZZA 4J3OC 4LSTH 4YZFE 5C07B 5BRZB 1RZGA 1MWAA 1FG2A 1MAKA 4OFYA 5HGHB 2YBRA 3LOWA 3MRGB 3SGJC 1HI6A 3QDAA 1U58A 2IAMD 5DUPH 1W0VB 2GJ6E 3H42L 1UJTA 3BYTA 2J2ZA 4NNPL 3WIHL 2WWMD 1ZHKB 1AXSB 4FXGB 2J1KA 3PDOA 4PG2A 4M7KH 3X3GL 3WKNA 1OQXA 1YUHB 2G60H 3FAWA 4YFDB 5EC2A 1MVUA 4XZUB 4V1DA 2AQ2A 1TDQA 2HRPH 2NW3A 3EOAB 4NQDE 1KCVL 4U6VH 5IQ7L 5F3BB 1OM3L 1LEKB 1OL0A 1JRHI 1B90A 2QKIA 1G9MH 2BSRB 3ESUF 3WO4B 3HS0B 1EHXA 1FH5H 2OK0H 3K81A 1A3RL 3GI9H 2XZQH 3FQXA 1G9NL 2ZG1A 4JREC 5D6DC 3T0EA 3ARBD 5E24E 1JWUB 3DRTB 4EUPG 5TJWK 1YYLH 2YK1L 2VZOA 3PGDB 4XI5D 4ZUUB 4RNRA 4K71C 3IJHA 2CK0H 1UCBH 2ILLA 3L5JA 5JLZA 2WIMA 2OLDA 3I9GH 5K59F 3IAPA 3I6KB 2EDNA 1LP9B 2CDGB 4HS6A 2H2PC 1LP9F 5HPMB 4E9LA 2YN3A 3ZDZF 4Z7VE 3FQWB 4LRIA 2JF1A 4HWZA 5C0CB 4WY7L 4IMKC 2YSSA 2IQAB 2RAMA 1FO0B 4E41D 3IDIA 5DDHB 5KVDH 5LJYH 2P42B 3MBEA 3MBXH 2DI8A 1U3ZA 3V52L 5DK0B 3EDEA 3GSWA 4I0KA 3AREB 1SYSB 3BD3A 1ADQL 1XGUA 1U8QA 1D9KA 5DEGA 2BNUA 1NCTA 4HIEB 1EHNA 3MRHA 3WL9B 4BM7A 1T1YB 1O5DT 3QUZA 4EZMA 1A7QL 4PS4L 2L0DA 3B9VA 3W9EB 5FKAB 3T2PA 4YK4B 1S5IL 3JV5A 4AIXA 2FJHA 1X5HA 4Y4KD 3IGAA 3VD3A 1A1NB 2RB8A 1A0QH 2E9BA 5BMFH 3UJTL 2XQYK 1TVHA 1R3IH 2VAAB 4OZIF 1GGBL 4RZCA 5GJTL 3BAEL 1KN4H 2YN5A 1NCBH 4HZLA 3UTQA 2GJJA 2FSEA 4OTXH 4YHZL 1AHWA 1VESA 4F15B 3GSQA 3ULSB 5IB1B 1OT2A 3U2SA 2YZ8A 4CVWA 2V9TA 4MXQC 3B5TA 3BP7A 1EEYA 1WIOA 2R29H 1CS6A 3D85A 2DDQL 5E5MA 1MCBA 3QNZB 4LMQI 3SQOL 3VH8G 2HTKD 2XQYG 4N0YH 2F74A 2GSIB 4JZOA 1G7IA 4HH9A 2F5AL 1NLBH 4ZTOL 3I3BA 1IEAB 3OKLB 3UTSE 3RJDA 3VI3E 3QEQE 3ULUC 3ARFA 3VWKD 3D9AH 3IFOA 5FGCB 3D87B 4HXBL 4M43L 1Z0MA 4LNRB 2R2EA 3QQ4B 2UZIL 1FPTL 3X14A 2Z91A 3IXAA 4KJYB 1M1SA 4KK9D 1I1YB 5CEXB 1BBDL 1JUFB 5I9QC 1WWBX 4M7JL 1NCNA 3Q6GH 5DJZA 5TF1L 2QSVA 4LLUB 1CXKA 1NFDF 5D9SA 3ETBF 2X70B 3MNZA 5HTSA 4C58B 1FN4A 1KJ2L 5FCUH 3N85L 3REVB 1D7FA 2H3NB 3KYNA 5AUMB 5C0AE 3VFPB 4XCYA 1F42A 3VWJD 5LVEA 4O9HL 3ARDA 3X3FL 4J3WA 5CZVH 3F7VB 2NTFA 4DCQB 1MLCA 3JUZA 5TE7L 1KELH 3MTRA 2IFFH 5D5MB 5HYSB 1NFIA 1S7RB 5CJQH 4NIKB 4NZUL 3H0TB 3V7AE 5SWSD 3U0TB 4KUCD 3QFJA 5GS2H 5TDPA 2P7TA 1FNHA 1F8TH 4R4FH 4YX2L 4GXUN 4ONGL 1IAOA 3OKDA 2Y06H 3N1FC 2JJSC 4FQXD 5LQBH 3TNMA 3QCVL 1DEEA 1XGYL 3ELAT 1IGIL 5FB8A 2QR0A 1BX2B 4G8GA 4R90H 4X7TA 3UYRH 1OAKL 5J1AB 5KAQG 4U1NA 2GAZA 4HUNB 5HDBF 4YHLL 3OKEA 2BC4A 3ARPA 3FB5A 3V6ZA 4ELMF 3I6LD 1CGVA 3BH8A 4XXCC 3LKOA 1YPZF 2JB6A 5I16B 5H2BB 1WBXB 2A1WL 1CLOL 1I4FB 2ZCKH 3CPLB 1OP3H 1GJIA 1W2KT 1ZK9A 4OFPA 4DEPC 5CP3H 4LFHD 5F7LB 3WFHA 4DZBB 3S97C 5A3IC 3UAJD 4ZUVA 1EZVX 3SE4C 1R5IB 4XVTH 3FO9B 3C6LD 1NGPL 4GW5B 1A1OB 5J06A 5EZLB 2XI9A 2EE9A 5IUSA 1BM3L 1JNLL 3OAYH 4JRYA 4W6YB 5DK2B 4OB5H 1T7WA 5I71C 3QDGD 4QY8B 4X9IA 1NLDH 4F33A 4GKZB 4IOIA 4NKMA 4DN4H 1A3LH 1E28B 1S78C 1AGCB 1Z9MA 5DFVD 1BLNB 2IH3B 3H7BA 3LKNA 3FTGA 4OI8A 3MJ8B 2FIKA 3GBNH 5GIRB 4RGNE 2NR6D 1V05A 5FHAL 4MJIE 2AEQL 3T0XA 1ACYH 5F9OL 2MMXA 2HLAA 2VZTA 4Z0XB 5KG9B 1NKOA 5SWQB 4WFEE 3SDYH 3RWIB 1F3JA 4JFFA 5EBMB 1MCEA 3AB0C 3FJTA 4XMPH 4W68A 5ERWA 3QCTH 4L9LB 4YC2B 3NCMA 5EPMB 3WFZA 2I5YL 4PRPD 1YECH 3LSOB 2O5YL 5D1QA 3PGFL 4AM0A 1P1ZB 3CLFL 3MV9E 6FABL 2BSED 4J8RB 2NXYB 1Z9OA 5JDJA 4PRHB 1A3QA 2BVUA 4MD5B 3U7AA 1W8NA 1JZ6A 1JTTA 1JV5A 3ARGC 4KKNA 5SX4I 1BWMA 4MQTB 3RPKA 4RFEB 2C7UA 1OSZA 5GJSL 2ICEA 2ZOLA 3C8HA 4PLNC 2DLIA 1UKSA 4WV1C 1NANI 2VDPH 5ITFB 1LEIB 1TNMA 3MUJA 3VE0B 3BWAA 3JWDH 3PL6D 5EZOH 4LCUB 2NY1B 4HPOL 2XWBA 1U8IB 2QQNL 3ILQC 4JZNA 2VXQH 3W2DH 4PJ5A 5CGTA 4XCEA 3PWLB 1JHKL 4WCYH 4NKQB 1PZUB 1NL0H 4XB7A 2YA1A 1H9VA 3OZ9L 1ZLSL 2R39A 3P0YH 5C9JA 4X98B 2FBOJ 1U8KA 1ZLUK 4PV9B 4O2CB 3U4BL 2R0LL 2HFGL 1UQSB 1VGEH 5T1KA 4O5LL 3FQUA 4KPHH 3RFZC 5EWIL 5I73C 4PJ8B 4B7LA 5JUEL 2YA0A 4Y16C 3RNQA 3PDGA 4IRJB 5ADPH 5IBTL 4RDQG 4PRIE 5T3XD 4XTRD 3RTQC 4OKVA 1GOGA 3RIFK 4Y2DC 2DIBA 1E4WH 2Z31D 4RAUB 3VD9A 4P2RD 1E4XH 3ZKXB 3TN0B 5BZDA 4K9EC 3QIBA 2ADGB 3P9LB 2WQRA 4G8EB 4GS7B 4WI6A 5HVHB 2UVEA 5CJXC 3MV8E 3QZWG 3ZYJA 3VXOB 1MJ8L 5EOCJ 3INUH 5MEPB 1T0NA 1QSFA 4OIBA 1RK0B 1A7RL 1MAML 3JWOL 4UQ3B 5EC1B 1DFBL 1MREH 5C2BH 1CFQA 3GJFB 3NFNB 1MCOL 2CUMA 3QI9C 5EH1A 3DURA 4PGBB 1ZHLA 3DGGB 2GT9A 4H26A 5D1XA 5DSCB 3SDDC 5KZCD 4HGKC 5I8OL 3R1GH 5CZXC 1U3HC 1WCQA 2CO7B 3TO4B 3MACH 1YY9C 1HOCB 4OFYD 1OLZA 3HUJE 4ONFH 2MWCA 1S7XA 4HWEH 3ZSTA 4DVBB 4QYOA 4OCNC 4LCYB 2ZUUA 3TBTA 5J12B 3CFEA 5F7KC 1LO3H 2BY2A 2D7TH 5ECJE 1INDH 1UFUA 2Q8BH 1DQDL 4IIQA 3BPNB 3BN9C 3FB7A 1URLA 1TLKA 4KRPB 5DR5H 1D5XB 4FRWA 3DVGB 5DEFA 1I1AC 3OX8B 4V1DD 1LD9B 3DXAE 1SBSL 1VERA 2VLLB 2VDNL 1QLRA 4U1LB 1HHIB 1P4IH 5LXGL 4Z5RA 2R56L 3BSZH 3CVIL 3N1MC 3F7QA 1FO0L 4I48A 2IAMC 5DEZA 5JZ7D 1VKXA 4H0HB 1F4WH 1EXUA 2YD5A 3PJSA 1JHTA 3V5DA 5DUBB 3MSPA 4LSRH 1BF8A 1OF2B 4JY5H 4PJAE 5EFIB 4EOWH 4JO4H 5IP4A 3M1BA 2XTJD 4O2EA 4P5MA 4Q6IB 1FNFA 3KXFA 1W0YT 3T0ED 2VRAA 2NYYD 4XVSL 1D5MB 1DL7L 1IT9L 1ZVYA 2X4TA 4JO1H 1JNHB 2QBWA 1S9WB 4NRZA 5DMGC 1I1FB 1VFBA 4N0FA 2YUVA 3MRKA 4JFEB 3T0DA 4V2BA 3WEXA 3SE9H 1BREA 5E8NB 3HMXA 1YEEH 4U1KB 5JOPE 2NY6B 2PYEA 2BHZA 4BKLA 2GJZB 1UH4A 3V0WL 3P0VH 1WV7T 2R1WA 3CLEL 4JO2H 4GW1B 4NWTL 3WFEL 3N9GH 4HUXA 1QBMH 1B0RB 3SKNB 3LN5B 5T3ZE 2Y7QB 1K8DB 3P4MA 3ARBC 4XBPA 3QUYB 1KJMB 1JYWA 1YYMH 3RHWF 1XF5A 3MUGB 4U6YB 1NGWB 4FHBD 3SDXA 3HE6D 4K7PY 3KYOB 1GIGL 5I1IL 1YEDB 5GPRA 2B1AL 4MNQB 4XNXL 2AP2A 5ESQB 1D9KD 4Z7OE 2D0GA 5F1NB 2B0SH 1N2RB 4JHAH 4G43A 4WEBL 5H35A 3QUZD 4NUJA 4QHMB 2DB8A 4HBCH 1B6UA 4HX1A 5ANME 4PRDA 1NMBH 2VMFA 3S3SA 3HZKB 1FJ1B 2LE9A 4Z78B 3VXRD 4FS0A 3O2VH 4CADA 2IQ9L 3VCLB 4YXLL 5IVXA 4HQQH 4EN3D 3RY4A 3RWCA 3HG1B 4F7TB 4KKLD 5ESAB 2AABH 1UZ6E 2CO6B 3MRIA 3QHZL 5GHWH 2E5EA 5MHSD 1IC5H 3BKJH 4FFYL 1EDQA 1QFWL 3KJ6L 1FRGL 1KTKE 1HHHB 1V3KA 3ROOB 5AZ2L 4YDJA 3T1WA 4EI6A 4OV5A 4UU9B 5DUMH 3SKJL 3WSQL 2ATKA 4KDTC 3D85D 4UTBH 3VXME 2HYMA 2P24A 4QRUB 5AYUL 2DLFL 2MQ0A 4HFUH 4K8RH 2EXWD 5A2IH 1KIPB 5T1LA 3MLUH 4PP2B 4H5SA 3IDUA 2P5WE 4QT5B 1F4AA 3BXNA 4OZGB 1PDKA 2DTML 3ARFD 4JVPA 1CG9A 4BH7A 2OXGA 4FQIH 2EKSB 5I66B 8FABB 4I2XA 1F6AA 1K6QL 2XZCH 2G75B 3CMGA 2VTFA 1EV2E 1K5NB 1BJ1J 4Z7UF 5GQBA 1M05A 4HC1L 3MC0A 3OB8A 2H9GA 3MGTA 1J8KA 2HTKC 3QUML 2VXVH 5HHOD 2ICWB 2BY0A 1OGAA 2BOCB 5DRZB 5DJ8B 4WJ5A 5EA0H 5CEZE 2BVPB 3MJ6A 3BIKB 3FQNB 4N90D 4PLKD 4PJHE 3LRSB 4YAQA 1PBYA 3OWEA 1RJZB 3VWKC 3ARDD 5IIEB 1FNSH 4G9FB 5D2NC 1AXIB 4QRQA 1NSNL 1Y6MR 3AMKA 1ZHNB 1OTUD 2WBJB 4D3CL 5B38A 2P1YA 3QFJD 4Z7WE 2DLTA 3IDJA 4F2MB 4JFHE 4JFQB 4MA7H 4Z77B 1OVZA 4R6UA 2F8OA 5E2WL 1UJ3C 2JLLA 1S3KL 2X05A 1JN6A 1Y18B 1LDPH 1RZ8A 4P23B 4PJIE 2L7UA 3CXHK 3BJLA 3C09B 3E1F1 4G8GD 4YHNB 3QISA 3CXDH 2AJVL 5IGXH 1WFOA 5C07A 4ZOBA 5BRZA 3ZLQC 2QTEA 4IHOB 4OM1L 2GKIA 4H8WL 5HGHA 5CEZL 1KG0B 2ZNWA 3MRGA 5D7JB 3QAZC 4FA8A 5DT1H 2WMPA 1WK0A 5TE4L 1W0VA 1MCRA 4YXHH 1YEFL 3ILPB 5L9DL 5DMIH 1ZHKA 1AXSA 4FXGA 5TQ2L 1KBGL 1J0HA 1RMFH 4TN9A 4X6EB 1YUHA 3CK0H 1ZXQA 1EAPB 4XZUA 2E27L 2PO6B 2ITCB 2Y07L 5F3BA 3UPRB 3UAJC 3VMOA 2BSRA 4NN7B 1T21B 3HS0A 5CS7A 2OTUB 1P7KB 3W5NA 4JFFD 5LWYH 2D7PA 2PCPB 5FCSH 3Q5TA 3C2SA 2J6EA 3O4LE 1JWUA 3DRTA 5D1QD 4FQ1H 4ZUUA 3PGDA 2A9MH 2XPGB 3DUUB 3VU2A 5DFVC 1GSMA 2H6PB 4M7ZB 4DFHA 5JR1L 3QJHB 4R96B 3I6KA 5EU4B 2NZIA 3JTSB 4TUOB 1LP9A 2CDGA 1GC1H 1L0XA 5HPMA 4D9QE 1CE6B 1GZQB 1UZ8B 2ZWLT 3AU1B 3FQWA 1IKNA 4M62H 3BP6B 3VGFA 5C0CA 3U36B 1G7MB 2A2QT 1N4XH 5E6YA 2IQAA 1MF2H 1U0QA 1FO0A 5JW4N 4AMKL 5DDHA 3T8XB 3DTXB 3SE8H 2ZP0T 1A47A 5DK0A 3GFUA 5L6YH 3M8OL 4WW2F 2R0WH 4PJ5D 3P11L 3AREA 1SYSA 1AIFB 4DK6A 1RZJC 4HIEA 2IGFL 2FX9L 4R7NB 5C71A 3WL9A 3SO5A 2UUDK 1T1YA 1CK0H 5E08H 4ODUB 3A6BL 5FKAA 3W9EA 4JGUA 2BCKB 2Y5TB 1TZGL 4JQXA 4PYGA 5T1KD 2XQBL 4YHYB 1CDBA 2AJYH 5D71L 4NFCA 3VRLE 1A1NA 3PL6C 4JPKL 4DOHB 2VAAA 3DO7B 4H1LG 2F19H 4ODSH 4UAOB 3VXUD 3IDGB 3WFCL 4U7SA 5IROC 1LWRA 1MQKL 1NH6A 1FC2D 4OBRA 4HUKB 4ODTH 1MFAL 4YBLC 5CSZB 1JGUH 4NYLB 3QIBD 3PQYE 2N1KA 1HILA 5I1EH 4OD3L 2OR9H 3ULSA 5IB1A 1A21A 3UJIL 2OI9B 3F7PC 1QSFD 3VMNA 3DV4B 3MRRA 3EO0B 4HUWB 1X5XA 1D5IL 3QNZA 1EIBA 2W0FB 5SWZB 5J8OA 5FYJH 1AY1H 4NC1E 5D1XD 2GSIA 1KEMH 4XNMB 3MV11 4XTRC 1DBAL 4Y0GA 1IEAA 2WUBH 1QEWB 3OKLA 4Z7VF 3EYVB 5JNYB 3EYFB 3GRWA 4NJAL 4P46C 3LMJH 2YHGA 1RUQL 5C70A 4QOKB 4LNRA 4XMKL 3QQ4A 4S11A 5CZKA 3HNSL 5F21B 2UWEB 4OF8A 2UWEF 4YDLB 2MCG1 4KJYA 3H6JA 3NABL 1I1YA 4UNVA 5CEXA 1JUFA 4LLUA 3S88H 1R6VA 2X70A 5EOQH 3MV7E 3BPCB 2A6IB 3GIVB 3SKMB 3REVA 2GY5A 2H3NA 5AUMA 4J7RA 3VFPA 1EO8H 3EFDH 3LRHA 2IG2L 3F7VA 4UILH 3HI6H 4DCQA 3KYKH 4ISVA 2JK5B 2QADD 5GRZA 2Q7NA 4JGMA 4R4NC 3RQ3A 4HKJB 1OPGH 5D5MA 5HYSA 1S7RA 2D9CA 3H0TA 4YHIB 3U0TA 4PG2C 3KXFD 3NCFB 1JGEB 3I75B 1FGVL 5K9OB 4UV4L 1AE6H 2PW2A 2E8ZA 1VACB 5FV1L 4X8XA 5HGDB 4EJ1C 1JI2A 5DJ2B 1HH9B 4POZD 5JZ7C 1L7IL 2PYED 4EUPB 1BX2A 43C9B 4NQXB 5J1AA 4I18A 1DUYB 5B3NA 1MCQA 1Q72H 2NY2D 2APFA 4X6CE