5J9PB

Kcsa in vitro
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining in Vitro Folding with Cell Free Protein Synthesis for Membrane Protein Expression.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
molecule keywords Fab
total genus 48
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2016-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pB01
4N9OB 1FG2B 4NOFA 1HKFA 3DX7B 5HDBF 1BJ1H 1KIRB 1F58L 4YXLH 4F15B 1BHGA 4V1DA 3TNMA 5DHVA 1NANH 1HINH 3NA4A 2FO4B 1AY1L 1U91B 2B0SH 3EJYC 3IGAA 2I24N 2YOCA 4NN7B 5KVEH 3HUJE 5DHVH 3G5XA 1AKJB 2ZOLA 1DQML 4MQ7B 3C5SB 3C2AH 2CPCA 5D7KE 5DFVC 4JG0L 3TYFB 4DOHE 2H32B 1ZWIA 4IBLT 3DX8A 1F4XH 4NGHH 4JFOB 2PTVA 3QDMB 5F7NC 5I6XB 5EUOA 1OAQL 3RX5A 4AEFA 1T66C 5C07B 5DD1L 1UWGL 1SJEB 5GGUA 2R2HB 3GM8A 4UQ2B 2Q3AA 1OAZL 4OCWH 3CIQA 3WE6B 2ADGB 2G2RB 3U9UB 3T2OA 4F7TB 5FKPB 3WFDH 3GBLA 2VQ1B 4HJ0D 4I0CC 4M43H 5DD6A 4YDLB 1C16B 4P2RE 1S7VA 2JJUA 1YC8A 5IEHB 2FD6L 5H35A 3OJDB 1R0AL 4NQSA 3CCHB 2PO6D 3QCTH 4XNXH 4JM2A 3O6FC 1R0AH 4HIXL 3U36A 1KLUA 5CS7A 1F6LL 3TYGL 5AWNH 2QQNL 1JUFA 1W0VA 3NIFF 1INDL 5I75B 3T1FA 3KHOA 1HILB 5KS9B 5M7QA 1TITA 1F4WH 3KYMA 3B6SA 4LEXH 2XPGB 3N1QC 3PE9A 4PJFA 3TPUA 4UT7H 2X7LB 3HZMB 5FHBH 1P5UA 4KRPC 3GSVA 4UMGA 5EO1A 1MJUH 1C1EH 4DTGH 2NLJB 2ICEA 5SWZB 2JELH 4TTDC 1FL3A 5DRWB 4OD2A 4PJGE 1QKZL 3WFBL 3KJ4B 1Z6JT 4G9FA 1JHTB 1G6RH 4QHMA 3EDEA 3ORJA 2MCPH 1T0NB 1UB5B 1INQA 3HE7A 1H15B 1BGXL 3VFRB 5KTEH 4QTIL 5SWQA 4PRPE 5LGJA 4XWOC 5F71A 3WS3A 5IB3A 2GT9A 1J86A 1A4JB 5IB5B 3GO1L 2WV3A 5DRXA 1LVEA 4IRJD 1UXSA 2DKSA 1TMCB 1LK2A 1U36A 2QADC 3MXWL 3F62A 5DUML 2BRRH 4OLUL 2F19L 3LQZA 4C54A 5L0QC 2I5YL 4P3WA 1YY9C 1RQ5A 4JO1L 3HHRB 2A9MH 1PLGH 3AM8C 2V9RA 3SDXF 1FDLL 5C6TH 1WZ1H 5GIRB 1W72H 5ICZA 5B38G 5T1DH 5F6HI 5I66A 1A1OB 4KVCL 4UTBH 4XVTH 1XT5A 3V0WL 2ZUYA 4OFVA 1EHNA 2P44B 3GBMH 1HZHH 4JPVL 1GL4B 4YHPB 1MH5A 5LQBL 5DD5H 1BZQK 2F54A 4R7NA 2R15A 1K2DB 5IW3A 4LPWA 4P46D 3UZVB 1R5IA 2CXKA 4YDIL 3GMQA 1LO5A 2IQAA 2YR3A 5D96B 5CD3B 2KQNA 2R23A 3IDJB 3GRWH 4WO4A 4NNYA 2ITCB 3FO0L 5IUSA 1CTOA 1RFDL 1G6RA 1QRNA 4WUUA 1MIML 4K2UL 4WHYG 3QT2A 3V6FA 3ARGB 1T21B 3STBA 3RWGA 1FFNB 1QLFA 3OL2A 4WHDA 4NPYB 1I8MB 4NRZB 4JPKH 1C08B 2K1MA 1CG9A 3EBAA 4NUJA 3DVGB 1YY8B 2MKWA 4XP1H 5DK0B 4ODVL 3RNKB 5KSUB 3BUYA 3TPKA 1XGPA 2AK4D 1DQDL 1JHKH 5ESVA 4PPTA 4YO0A 3X3GH 2XQYG 4I4WA 3CMOL 3QDMA 5I0ZA 4KRNA 2OCFD 1MCHA 2IALB 4H0HB 4PJ5A 3U4AA 1MY7A 4I5BA 3ROOB 1CE1L 5EZIL 1JP5A 3QUMB 1DN2A 1FRGL 3AAZB 1MCCA 3VRLE 1AD9A 1XGPB 3I3DA 3P4NA 1FZMB 4DN4L 5HY9B 2EDLA 4L5FL 4LDEB 4DGIH 3IU4H 1B0GA 1NGWA 1EFXA 4GRLB 12E8L 4MAYB 1EFQA 4GRWF 4KK5D 5LGKA 2V7HA 5TE6L 5IP4A 5BZWA 5FYKU 3VXTA 1QBBA 4LHUA 3I2CH 2NR6C 4KV5E 1HNGA 2OI9B 4YXKL 2Y5EA 4Z78A 4MJ4A 3O41A 5TJWK 3CPLB 3DIFB 1LO5B 4O02H 5LVEA 1MCKA 2PXYB 3KR3L 2ATPA 4K23H 4NUGL 3KPRA 3RGVB 4ODSL 2DQDH 5E4EB 4OCSL 3L1OL 1CVSC 3HB3C 5E56A 3GJEA 2EKSB 4JFFE 1DZBA 4FA8A 3MODL 2BY3A 4NNXB 1ZEAH 4FQQA 4Y5XB 2J4WL 4NC1C 4C56E 3U6RA 1XAUA 4HHAB 4M7LL 1TZIA 4JHWL 1I1AD 2SEBA 4GKNA 4M7JH 2ZCHH 4WRLA 1BJ1J 3U4EA 1J8KA 2AEWA 1WIPA 1XIWC 5CIPA 1Y6KR 1BFVL 2HH0H 3VD9A 4BZ1H 1JE6A 3C5ZA 3Q2CA 5HGBB 4EOWH 4D0CA 3ARBC 1H3VA 2VITA 4RDQF 5FUZH 3QUXB 1NFDB 3BKYL 1CD1A 3VW3H 3FOMB 5JPNB 3KNBA 4TUJB 1P4LA 4LLQB 2ATKA 3QNZB 3U2SB 1G6RB 1QRNB 4WUUB 2G9HA 2AK1L 3H9SB 5BV7L 4OI7A 2BNRB 3FFDA 3DROA 1DUZA 3UTQB 4NO2B 5DTFA 4JDVA 1CN4A 1R5IB 4JR9H 2WBJD 1TJIL 1JNNL 3ZL4L 2AKRA 3IETA 3WJLC 1VA9A 5IB2B 4LCCA 4XPBH 2BMKA 4RGOL 2OZ4H 1QBML 1ZLVH 3KYKH 4F57L 1M7DB 3T3MF 1VFOA 3WS6A 3IDIA 4KJPD 3EYFB 3RWCB 4X6CE 1MFAL 4LOUD 4LPTA 3CFCL 4PJFF 2OMBA 5J6GA 4LAQL 1J87A 4DCQA 5D5ME 5F97E 2I25N 3ILPB 3BH9B 4OT1H 4A2MA 5I9QB 1T1XB 3OB0K 2DQCL 2NNAB 1OAXH 3HPJB 2E7HA 4K3HA 3WUWA 1UXSB 4LCYB 4X8XA 3SJVE 5DD6B 3O2DH 2OK0L 3F5WA 1MLBA 3KDMB 3SDDB 1FZOB 1E6JH 2YPKB 5DMKA 3VGDA 1A6ZB 2I07B 4XP4H 1HXYB 3S5LB 5DLMH 5JIHA 1J1OH 3TIDB 1BFSA 3ROLA 1TPXB 4FQXC 4WI4A 3TO4A 2QEJA 5E8OA 3FT4B 1ND0A 2DQIL 1MCSA 4ZFOA 1Z5LB 4YUEH 5J9PB 3OXSB 3U7WH 3UTTD 5HYQB 4D3CL 3FB8A 3ARUA 1ZTXH 4K8RH 3VWJC 5F7DA 3GM0A 2X4OA 4U6HA 3UROR 3VXPB 3WL9B 5I15L 1DANT 3ES6A 3KYMB 1HILA 1RU9L 2ILLA 2BY0A 3QNYB 3GMPB 4FQLL 1BQUA 4Y8AA 4YGVA 5I1JL 4PJ7B 3SDAC 4UT9L 1ORQA 3GNMH 3WXWL 2WSKA 1AGBA 5LWYH 4IM8A 2FO4A 3AGVA 2NY6C 2FJFA 5DURD 4N9GA 2AJVH 2OJZH 1MRCL 4NNPH 1RK1B 3R8QA 2NZ9D 5DRZB 4ZOBA 2DMKA 1C16A 4A6YA 5TH2A 3CUPB 3S97C 5AZEH 4QTHA 3VD5A 1AO7B 3D1MC 2F5BH 4LLYB 3DBXA 2Z31C 4YDVB 5F3HB 4WHTB 1VFBA 3FFCD 4OGAD 3TZVD 4HT1H 1A2YA 5T1KA 4YHYB 4QEGA 1FP5A 2NY5L 1JWMA 3OKEA 4YHMH 5C0IA 1U58B 5T5NG 4MA8L 5B3JE 2D0GA 1A4KA 2AV1A 4UV7L 4Y16B 3W9DA 4F2MB 2B4CC 4BUGA 4LSQH 5IK3A 4DVRH 3PL6C 3VD3A 4HCRH 1JZ2A 3RL1A 3QHFH 4G6KH 3BWAB 1QVOB 4OGYL 4MQ7A 4QNPE 5JW5B 3UC0H 1IM9D 5CMAB 1R5WB 3MNZB 1GRWA 3IU3A 3RY4A 3CFDB 1MLCA 2P5EB 4G80A 2P8PA 2OP4L 4Z0BH 1AI1L 1T83C 4MXWH 3RVVD 4RIRA 1R3KA 4ZSOE 1IC1A 2VDNL 3LN4A 2EO1A 4PJ9B 4KKCD 4J6RH 1AR1D 2WNGA 4NKQB 3BPCA 5JW5A 2E6JA 3ARGD 4M1GH 4RMUA 5CGYD 2L7JA 5HVHB 3C5JB 3MRHB 1HH6A 3LPGA 2HTLC 3H9HB 4JZOB 2VDNH 4PJ7E 1DQJA 2E6PA 2DIAA 5IBLD 3VI3F 2XN9E 2R56L 2FIRT 3PWLA 5DWUH 4PY7B 5DMGC 1KFAL 1UKSA 2EDXA 2WUBL 1GGCL 3RNQB 4JRYB 2B39A 4ZTPH 3DXAD 3IDXL 1ZLWK 2J8OA 3VDCA 3RIFF 5JW3H 1T89A 3DBXB 1DQQB 4NDMB 4NO0D 3TVMA 5D2LA 1WC7B 1QSEE 5F89B 4WEBH 3TLRA 3G6DL 4KRPB 5F1NB 3KS0J 4U33A 3RY6A 3FTGB 3L7FA 2AEPL 4RA3A 1LD9A 2QQQA 4ZS7L 2E9BA 1NGXB 5MHSE 1JGVH 4GXVH 2J1KA 1MHHA 4LVOC 3OTTA 4JFHE 2GK0A 2VR4A 4FNLH 4OD1L 5E99H 1R3HA 5AEAA 4X80H 3DPBA 1HH9B 5SX5H 4NP4H 3L5JA 2VXVH 1EAPB 3MLXH 2C1OB 2EYRB 1PG7L 5D7KD 5KJRL 5I2IA 2OJZL 5KAQG 2V17H 3O3DA 4QXGL 5DK2B 4W70A 1U3JA 3GKZA 2GTZA 1CGSH 1WBXA 4LRNL 2GJ6B 5GSVB 4QYOB 3N9GH 4WJ5B 1CDBA 2VZVA 3S96B 5E7BA 1KNOA 5DZOA 5ENWB 3RBSA 4IEFB 5IFHH 5MERB 3D85A 3WUWG 3BDYH 5GGRA 2ZUVA 5KVGH 1DN0B 1L6ZA 4MQXC 3M17B 1KENL 2MPAL 1RZ7H 1XFPA 5FYKD 1DVFC 4LSPL 5A1AA 3VXME 4M4PA 4HF5L 3O2WH 3QRGH 1GPOL 2BOBA 1I1AB 4PRPA 2OL3A 5FYLL 3CDGA 4YUEL 1CK0L 3TBWB 4GG6F 1YEDB 4DCQB 4X6FB 3AMLA 1LO4H 4G6AC 5IF0B 3MLYL 1YEDA 1B0RB 4PJXF 2DQFA 4YDKL 1D5ZB 1CL7I 2XKUA 4KKLD 3V0AC 2KPNA 1G7QB 5GISL 2P8MB 2CRYA 1WSST 5DJ2B 3EYVA 5FGSA 4Z5RA 3S35X 2YZ1A 4EVNB 2BY1A 4JGJA 3O45A 5EU6D 3D39B 3GGWB 2C3VB 4LLDB 5E03A 4UBDD 4OT1L 3MRFB 4NWUL 1FIGH 5F1OB 6FABH 5K9JL 4H20H 3SE3A 2AXJA 5GGRB 5IVXB 2BVPA 2R1XB 4RFNC 4JN1H 4C58B 5MEND 3BH8B 4K9EH 3D3VD 1FV1A 5DEFB 3SQBA 3NA9H 3SGEI 5INCA 4OUUA 4UINH 3SO3C 2BSED 4U49A 2ENYA 2HFEB 1OAKH 5CJXC 4YR6B 4TNVF 5J0BA 2VITB 4X9GA 2VDOL 4FNLL 3VXNA 3VMOA 4PJ8B 3STZB 1IKNC 1V5JA 3VWJA 2GK0B 1WC7A 5F89A 4U3CA 3WLWD 4Z6AT 1ADQA 4F7EA 5JXED 1FNAA 1MHEA 1A3QA 1HWHB 2HFTA 5CHNB 5CBAB 5K9QG 3EIFA 2VZSA 3J8F7 5BQ7B 3OJVC 2XQYK 4NM4L 1FFRA 3QDMD 4QRRE 3BWUC 5T3ZL 5JHDD 3QEQB 5CZXC 3I6LE 3D2UB 4RGMB 3IJSA 4PREA 3KLHC 3DRQB 3HNTH 5F9WB 2JJSA 1BWWA 1JZ3A 2VTFA 1SVZA 4I2XE 5J3HC 4DGYL 3BE1L 4MJIB 4RMTA 5K59F 4FN0A 2Z93A 5D1XB 5FGBA 4X4XB 4BA8A 5I1KH 3DV6B 2J4WH 4ACPA 2Q86B 1G9NL 2VLJD 4PP2B 4CNIB 1BZ9A 2APWA 4GMTL 4UDUB 1QHPA 2PO6B 4ODSH 1B2WL 1P5VA 4NQDE 4QLRA 3L3DA 1F6FB 1B0GB 1P53A 2X9WA 4K23L 2HKHH 3MLRH 2A6JA 4Z7UF 2VWEE 4CL7A 4M7LT 1R5WA 3MNZA 1CZ8H 2P1YA 3MRIB 4OZ4B 4Z0BL 3I2CL 1NLDH 4IRJA 2ORBL 2X4QB 3C6LB 2H2SC 3V6OC 3MQIA 3MV9B 5CP3H 3VFWB 3VRLF 2ADFH 4YBHA 1MCLA 1ETZA 5T3ZD 1LP9F 5ALCH 4CJ0A 4ZO8A 5ALBH 4F15C 1NLBL 2R4SH 1U58A 1YJDL 5ESAA 4HJJH 4BSWB 2W9EL 3REVB 1TVBB 5FGCE 1TQBC 4MA8H 5KSUA 5TQ2L 5FF6A 4MB3A 5DK0A 1A9BB 4ZD3H 5I76B 3WHXA 3EYSL 1CG9B 4NUJB 3RVXD 4Y16D 4LLYA 1MVUA 2YK1H 4W6WB 4RFOL 1ZLUH 4P9HL 3TN0A 3G5VA 5L8LB 1MUJA 5CSBA 5HDQL 4D9QE 1J88A 5H94B 1CU4H 3MPCA 5DJDB 1VFBB 2ZUQC 3EKCA 3WDIA 5KVDL 1VFMA 1N6QL 4JRXE 5C0BD 1I4FA 1S5IL 2ZUSA 5CFHA 4PBWD 4WHCA 3RWJA 3BX7C 3F7PC 3E3QC 3DJ9A 3SHSA 3CFBA 1NH6A 5E6YA 1MQ8A 4JFYB 1KTDB 4PJEA 4HGWB 1M4KA 3OKDA 2X05A 5F9OL 1FZKA 5C0FA 1T89C 1U8QB 4JFDA 5SWZD 5DI8B 1RZGA 4CU6A 5I1JH 3GRWL 5D9SA 5MEOA 5DGRA 5D2NE 2NMSA 1BAFL 1A6WH 5JORA 3QPXL 1Q38A 1YEFL 4X6CA 4RA0C 3VXMD 3VWJB 1ZA3A 4MX7A 3TBVA 1RZKC 1MRFH 3ROLB 3LQZB 3JWDL 1D6EA 4U2YA 4ZQKA 1T5XA 5BOZG 4NZTL 4QHNA 5DRNA 4NBZB 5SV4A 1JI1A 1QFPA 1U6AL 4MNQB 4PFEA 4X9IA 3VWKB 4OF3A 3FOLB 1VENA 4S1DD 1RZIB 5DMYA 4JFZH 1JHTA 4QHMB 4KGLA 4NQCD 1IGJB 3WN5A 2I5YH 1MLBB 2X4PB 4ETYA 3GZKA 1GGYA 1QFUH 4QRSB 4PLJC 1W0WB 4NQCA 3BEWB 3MBED 2PW2A 4G8IA 4WUKH 4R8WL 3ILPA 4R0LC 1PJ9A 2XKSA 1KLGB 3QQ4A 4QTIH 2Q1EA 1UKTA 1MFAH 3O9WB 1BGXH 2UWEE 2BC4B 3Q6GH 3MLTB 4Y5VB 1FNLA 1T7VA 3MO1B 3C09B 3WBDA 2DQFB 3DUUA 3MOAL 3NCMA 2YA2A 1B0RA 1NBZB 3D6GA 4TSAH 5GRYA 3O9WA 5JUEH 4GRLD 2WP3O 2OZ4L 5KSBE 4UOW1 1QOKA 3DROB 2WM0A 1U9KA 5I8CB 5L2JA 4AK1A 2B1AH 1HHHA 1OCWH 5JOFA 1OVZA 5H37H 5E1AB 3MX0A 1CD1B 1YPZB 5GRJH 3UPCA 3W81A 4KDTA 4MDIA 2VXUH 5HGBA 3PV6A 1JI2A 4XWGL 1UKQA 2NY6D 1GC1L 2RBLA 4O2EA 3HE6B 4XCYB 3SKMA 2DI8A 2ZUTA 3VXRE 3U0TB 1U3HD 1NFDA 4NKOA 2GTZB 2CLRB 3ZKMC 5DMIL 4AEHL 3CX2A 2GQHA 2VDRL 1UG9A 4HIHB 4TYUA 2RAMA 2VLKB 4JFHD 4XHJD 1VB9A 5MEOB 3EO1A 4HMEA 3NIGF 3FB5A 1FIEA 5AD0A 4JQXA 5TFSL 2QADB 3QHTC 4WFED 3HUJA 1U8QA 4JFDB 1AXSB 4H1LB 5IEKB 2R0LL 1N4XH 5DQ9A 2CRIA 4R3SB 2DQTL 3MREB 3NPSC 5IROA 3W11D 4PD4K 4V1DB 4BQ8A 2JIXB 5F1SA 3OF6A 2GY7B 4IOFD 1OAUH 4ONHA 3NN8A 1G9MC 2GFBB 4ODUB 1IQDA 5GQBA 5EBMA 1EHAA 1KCLA 2A6KA 1EBPA 3P0YL 3CSGA 1ZVSB 4X5WA 5JQ6L 1JNLL 4MJ5A 1TVBA 5JA8B 2EE9A 4FQXB 4KU1A 1Q8MA 1EDQA 3GUTB 2XTJB 1EZVX 3LEYL 3BP7B 1S9WA 1WK0A 5JQHC 2O5ZL 4OQTL 3TM6A 4OLWH 1JYXA 4KQ4H 4QO1A 1NBYA 2VC2L 3AY4A 2OYPA 4OJFH 3WO3B 1CE1H 2HT4D 4PJCB 3HCVA 1FH5H 2ZZUT 3QA3A 3C6LA 3PQYA 4CADA 3M8OH 1YN7A 4L4VA 5BV7C 5IMLA 2WQRA 5CJXA 3WSQH 1DBBL 1XGUB 1ZS8B 4NO0A 2YEZB 2FHFA 4NCC2 2CDGB 1QYGH 1I3VA 3ARDB 2IG2L 4POYA 4DW2H 1D5XA 3SDDD 2B1HH 4MSWA 2R2BA 2DDQH 4MJID 4NC0B 5EZJA 2G5BB 5GJSH 3D18A 3CFDA 2OTUB 2C3HA 1IVLA 2YPVL 1FCCA 2VDLL 3CZJA 3T0AA 4DZ8A 3VXOB 1IILE 3L3HB 5BRZB 5C6PB 3V7AG 4LHJB 1CFNA 1S7XA 4GAGL 1X5FA 2HG5A 5GHWH 2A77H 1ONQB 2ERJC 1RFDH 2UVFA 5EZOL 3JTSA 1XIWD 4QCIA 1IC4H 4RRPG 4AL8H 2VISB 1NEZA 3OXRB 4PLOB 5D1XA 5T5FL 3E8UH 3SEPA 3EFDL 4N0UE 5CD3A 2RJMA 4DKFL 3LKSB 1S9VA 3SCMD 1X5ZA 1XF2A 4M3KB 5DJZB 3MV9D 5I8KH 4CDHA 4KQ4L 5DJ0B 4YK4C 3CVHH 5HYSB 4FFVC 4F3FA 4LASL 2GUOB 4K3DL 1I9IH 1TTFA 4PJ8A 3STZA 5I66B 3DURA 1HEZA 1NC4D 4QWWD 5FA4A 3PWUA 1S7RB 2AEIT 1JTPA 3GMOA 1R3JB 4UV4H 3S5LG 3GI8H 5D7JB 1OF2A 4QHKI 5LGJB 4MQXD 4DJMA 4KHXL 4NRXA 1T7XA 4XTRD 3WJLA 3N0PB 5CJQH 5FV1L 1QLRA 2FH8A 5EPMB 2VSDA 4NT6B 1WEJH 2C1PB 3INUL 4HUUA 3WFEL 2YRZA 3UTSE 1N4XL 1Z2KA 2C9AA 5IQ9B 5FYJE 2F5AH 1URLA 3UX9B 1G6RL 4S10A 3RZCC 3TPUB 2COQA 5TFSH 3PWPE 4MXVE 3B9KD 2DKMA 4UB0L 4Y19E 3X12A 5J1AB 5D6CB 1DJSA 4AIXA 2YXMA 5HPMA 3NACH 5TDNA 4PJFB 4ZSOB 2DQJH 2EIZA 1PQZB 1U8JA 3SGJC 1KLGA 4XBEL 5EOCH 3TBWA 2PR4L 4GS7C 1VFUA 3SOBL 2F5AL 3A6CH 4XNYL 3ZDXE 1GGIH 2AP2A 4NFCA 3E6HA 3QFJA 3VWJD 4ODWA 4R97B 4OBRA 4CN1A 1VERA 3CCHA 4G43B 3DX9A 4W4NA 2UVEA 1CGTA 3CC5B 3LMJH 1S7WB 5C9KA 1ZLWH 4FABH 1KN2H 4KGJA 5E9DE 3IVKA 3TA3D 3I02B 1E4XI 2X6MA 1A7NH 3GI8L 1A64A 3IS0X 5IB1B 5C9JA 4KZEL 4P5TC 4RBPH 3UTSD 3MJ8B 3BJ91 3IDNA 4WIQA 3VFTB 3ALXA 1P7HL 5EO9A 1QA9B 1IGYB 2DLEA 1NFDF 2XZZA 5HI3C 1ZA3B 4MX7B 3LB6D 2OSLB 1BQLH 2HLFC 3VFVB 2E27H 1EAPA 5I8KL 1HH9A 5GJTL 4PYHA 5DUBB 5ISZB 1VEPA 3EJYD 1GC1C 4ZUUA 2ATKB 4M7ZB 1HHIB 3PF2A 1VFAB 4KK6C 4P3DB 4ZUSA 5J11B 5EBWB 4JG1H 4PJEB 1YMHB 3IB4A 3MUZ1 5CKGA 4YPGA 3C5SA 5CAYB 3IXAA 3IJYA 2ICWJ 2I9TA 1MHHB 1OGAB 5GS1A 5EIIB 5T3XE 2X41A 1XR8A 3A0OA 3QZWB 5F6IC 1AJ7H 3RX7A 1VSCA 2AS5M 5IMOB 2A83B 2VLJE 1MRFL 1D9KC 3B83A 5D7LE 3MCG1 1YEIH 4NDMA 3UJJL 1FL6B 5CSGA 3CLEL 4JRYD 2Q7YB 4D94A 1QSFB 5EC2A 4OLVH 2FGWL 1VEMA 1A6UH 1S9VB 5DVKA 2FYYA 4JRYA 1XEDA 2HVJA 2DD8L 5EC2B 4GAYB 1ACYL 2RFXB 4RQQB 2OJEA 5EU6A 1KC5L 4GRWB 4F7MB 2FRGP 2ZUXA 4QXTA 5E2WH 4G8EA 5B39A 4GSDL 5D5MB 1GOHA 3C5JA 4U3HA 2UWEB 4PJCF 4XCCH 4PRHD 2NTFA 3B2UC 4JFXA 2BOCB 2UZXB 1XR8B 4PB0L 5BRZA 1MLCB 3MRIA 5SWSD 3VGHA 1CU4L 1ZK9A 4XH2A 4PRIA 3MYJB 4WO4D 2H26B 3H3PL 4EDWH 3AY4C 4ZFFB 4G8GB 4OAWA 5CEZE 4OZIF 4NRYB 4HAGA 1QFWH 3VFOA 3OGCB 4R4NC 3QIBD 1NSNH 4L4TD 1MHCA 1UM5L 1SYVA 5E1HB 3OR6B 4KWUA 4YO0B 2VXQH 4X7EC 4EKXA 1G1YA 4FQXD 4XVSL 1NLBH 3BFOA 1EEZB 1A4KB 2C5DC 4FMKA 3L9RA 2P49B 2QQLH 3G9VA 5FO7B 1MFCH 4HC1A 1L9NA 4FXLA 4JO4H 4NN6B 3QH3A 4N0FA 1WAAF 3VMNA 5F7EL 3D2UA 1JWMB 3ZSSA 1AGDB 2J2ZA 3MA7A 1A7NL 2E7CA 3KVQA 2BNQE 5LXGL 1CZ8L 2FH6A 5EWIL 1MF2H 3P11H 4ZTOL 1MQKH 4G42B 4PRHE 3SQOH 3HMXL 3QXAA 3ZYJA 1OL0A 2HKHL 3IFNH 4FQ2H 1J0ZA 2GYSA 1GC1H 3CC5A 2PCPB 3RPIB 4FP8H 3PDOB 1OTUD 4I0KA 1Q9LA 4JZNB 4XNYH 4JPWH 2VXUL 1D5IL 2QKIB 3LS5L 2QR0B 2H2PC 5DQ9B 4NO5A 3C6LC 1MCQA 1XF3A 2CGRL 3ARED 3D25B 1NCNA 1E4WL 5E5MB 4QRRA 5JW4Q 1IEAB 3QIWA 1I7ZA 3G5YB 2KBGA 3BVNB 3BZ4B 4XAKD 4N5UA 3QG7H 5HYQA 1V7ML 1P4BL 3BZFA 3VRIB 4HIHA 3KPRD 3O6ML 2CDEB 2VLJB 1QA9A 3QWRA 4HEME 4U0RB 1DLFH 4RWYH 3DETD 5HHMB 5ADOH 4RAUB 3U0TA 2HRPH 3LKQB 3SCMB 3RKPA 3O9WC 1MREH 3QWRD 3NGBB 3UCRA 3HR5A 3GMLA 4TVPH 2IPTH 4RSVA 1S7SA 3O6KH 5JIPA 1FBIH 1JL8A 1IC7L 3MMEA 5D2LE 2FECI 1N64L 1IEBB 1OSPH 3MUGB 2I07A 4HFUH 3ZZ1A 2X4SB 2FJHA 4OD2B 3L95B 3I6GA 4X0KA 4X6FA 3RHWF 2IADB 4KDTC 1DQLL 4NZJA 5HHOA 4Y5VC 5KS9F 5D7JD 2W60A 2QSCL 5HVFB 4KUZL 3FZUC 5D71H 5HGDA 3MNWA 5IMMA 3GK8L 1RUPL 3ARXA 4U1JB 4DKFH 4MD5B 3SGKC 3EFDH 2HTLD 4Z8FH 5T5FH 3KPNB 5I18L 5E08H 2XRAH 2F58H 5FKAA 4QRQA 4G8FB 1M6OA 43CAA 5IQ7H 3BP5A 4JRWA 4LCCB 1W0WA 1ZVYA 4Y4FD 2H32H 3CZFB 4RISL 4GW4B 3LRHA 1T4KA 2DWDA 1I9RL 3SY0B 1QHOA 1G9NC 4F7TA 5TDPA 3RWIB 4GRMB 3UTZB 2BJMH 3THMH 3VXMA 4Y2DB 2VSCA 4FFWC 1U92A 4QRTA 2YBRB 1F13A 1LQSR 3PHQA 3ZDYE 3ULVE 2B1HL 3RZCA 5HGAB 5GGTA 4N0UA 1K8IA 2D0FA 5GRWA 1E4XL 3LN5B 4FG6C 5KANG 3NCJL 2NYYC 3HAEA 4P9HH 1ZWIB 4X6CB 1M71A 5IFJA 2YXFA 2XXCB 15C8L 2R8SH 1BMGA 3WNKA 3N9GL 1E6OL 4PRAB 3ZKXC 4ZD3L 3GSUB 4PJHE 2VC2H 4MNGB 3LKOA 3F7RA 4JJHA 5J1TC 1I7TB 3RI5F 5C0RL 1S7QA 4OCMC 3UTTA 3FQRA 1QACA 5I1HH 5A16B 3BXNB 3BSZH 4FFYH 4U6VL 1IC5H 4P57B 3P2TA 5I71B 5KBNC 1GIGL 5I1LA 4NP4L 2FSEB 2ADFL 3JTSB 1CDJA 5J56B 1ZV5A 1IGML 4N0RA 4EI5A 2R69H 1DQJB 2WBJC 1VPOH 1KCVH 5HHXL 3VFSB 1KTRL 1RMFH 2A6KB 2EXYC 4ZNEA 1UWEL 2LVEA 5K9KB 1DL7L 3DVIA 1FORH 5HYSG 3MBEB 4EDXA 4WU5A 1RIHH 1JGLL 1WWAX 3B5TA 4KJWC 3MREA 2AERT 3DNKA 4PJ5B 1ZT1A 2ICCA 4GBXA 4K8RD 3IDXH 1I1FB 1P7KA 3TBTB 1UB6B 4U1GC 4ZPVA 4BFIA 5ID1B 5CP3A 4GUPB 1MFBL 1UJTA 2V6HA 3QG6B 2ZSWA 2ZUQB 2J3SA 1I8IB 1MFBH 2IALA 1X5IA 4XMKH 2VZTA 4Q6IB 3SKUD 1G9MH 5FYKL 1NC2A 2AXHA 2IEPA 3V6ZA 4M5YL 3AFLA 3GUTA 2XKNB 4MXVF 4HWBH 2GJ6E 2XZAL 3MJ9H 3ZT6A 1ACZA 2WLZA 1ZT7A 3SDYL 3BUYB 4ETQA 2EDYA 5D1QD 4ZFZA 4FFVD 5CJ5A 5SX5K 1CE6B 2BDNL 3UEZA 2J5LB 4HS8H 4X98B 1EXUB 5D93B 2NY0D 2EDOA 4F33A 1RMFL 5GSRB 4HQQL 5FO9A 2JIXA 4X7TB 4ONOA 2Z92B 4NZUL 3MV7D 2ESVA 3M45A 5DEGA 1FVEB 5KN5B 5FKAB 3BXNA 3PQYE 4WO4B 3C60D 4H1LA 4ZAKB 5IEKA 1IC5L 1IGTB 4MD4A 4ZS6C 5J13B 4H25B 4LVNC 3IDMA 4PYGA 5CJ8A 5AYUH 4HIEB 4HS3A 4POZC 1K9TA 4ELMF 5AD0B 1KUMA 3OKOB 4HGMA 4DGVL 3GMPA 1MEXL 4DN3H 4WW1A 1X9QA 4PY8I 6FABL 2RCSL 4XPAL 4NO3B 4M6OH 1MFEH 2Y25A 2YPLE 3TZVC 4LLWB 4H5SA 4OCRH 5EA0H 4U7SA 1E4XH 3V95A 3ZE1F 1UCBL 5FDYA 1YEJL 3WN5C 1BD2D 1YC7A 3SKMB 5I17B 1FFPB 5E8OB 5JXAH 2Y6SD 3NFSL 3QB7C 3O2VL 2FECL 4FTVD 4JKPH 1Y0LA 4HWZA 3HE6D 2AXGA 1UYWL 2GIYA 4PP1C 2BJML 1T4KB 3SDDA 3SY0A 1K4DA 5K9OB 5DR5H 3BDXA 1E0OB 2ICEB 5SWZA 1GHFL 1S9XA 4RISH 3A6BH 3GMMB 3DMMB 4QOKD 4GKSA 3CX5J 1UB5A 2GJJA 2NW2B 4X6DB 2O5YL 3SKJL 3R0MA 3K3QA 1A6WL 4UILH 3OB0H 4OLEA 4QOKA 4WW1B 5T33H 3MGOB 2NLJA 1F3JB 3U36B 4UILL 4Z8FL 4OI9A 3DHJA 3TJEH 4ZFOL 5DSCB 2BC4A 3QUYD 5FECA 1U8HB 2CR6A 1AR1C 3UPRA 1CGSL 3ABZA 4NO5B 4R7DB 1WIOA 3GBNH 1MJ7L 4UOJA 5D72H 5HI3D 5FIEA 1BBDL 3FT2B 5IB2A 4KUZH 1JRHH 1T80A 1CXEA 1U3ZA 5TE4L 3FONA 3MLXL 5ICYB 2YPLD 3PJSB 3I6GB 4X0KB 5DLML 4Q9RH 2HN7B 4XP4L 5EOCJ 3FKUS 1IGJA 5JXAL 1KJMB 1DUZB 3TN0C 2NY4C 1FL5A 4WI3A 1PYWB 3BW9B 1I1AA 3R06A 4PRPB 4XP9H 1N64H 2XTJD 1IC7H 4RFOH 2NY7H 2VZ3A 2PNDA 3KHQA 4K7PH 4M5ZL 5CCKH 4LQFH 1NUFA 1OP5H 1JPSL 1JPTH 1V3JA 2MQ0A 5E2VL 3L9RB 5B8CC 3DX8B 3MRKB 5HGHB 4UQ2A 4J2XA 4ZODA 2OS7A 3DYMA 5JW3L 5IM7B 2R4SL 2G60H 1I8IA 5IROC 4XCFL 5C07A 1OPGH 2P48B 4K3JH 3BVNA 4D9LH 4OZIE 1JK8A 4ODBD 1N3NB 1YN6A 5IR1A 3N1PC 1HN1A 5DI8A 1YUHB 3T3PF 1JNNH 2E3VA 4FQQB 3FMGL 2F53B 2EKSA 3MLPA 4Z7VB 4NQXB 5C0JA 1E4WH 2N7AA 2HWZH 2NXZC 2CUIA 4MVBD 2WWMD 1F02I 1AKJA 1R3HB 5BRZD 5E2UH 3LIZL 2AJ3B 5DT1L 3BMVA 3MCLL 5KSAA 1U3HA 1KPUA 3MRNB 1ITBB 2XZAH 5F9JA 4X9FA 2PYEB 2GJZA 5DT1H 1EJOL 3FB7B 3SE3C 4QT5B 5T3XD 5E8NA 3SQOL 1TCRA 4AQOA 5I1KL 4LAJH 1F90H 3IDYC 4Y5XC 3RKDC 32C2B 3BE1H 3DSFL 3KWWB 4EZMA 3WDHA 3VXRA 3I84A 3KYOA 1FVDB 3SDDC 1NCWH 1U8NA 1BIHA 1X3DA 3MGAA 3ULUL 3NFNB 3OWEA 2YMXL 3DTXA 4CVZB 1TQCB 2FX9H 3MODH 4PGBB 3DVNB 4PY7A 4PB9L 4DOHB 3OR6A 5DFTA 1ZLUK 4HBCH 4R0LB 5GGQH 1KJ2B 5T3ZH 3O4OC 1KBGH 4F9LC 1N5AB 1BOGB 5E2VH 2EKJA 1XR9A 4JKWA 4O02L 3MRGB 3GSWB 4IRJB 1T22A 3QCVL 3SDAA 1QFWL 3CFEA 2QHRH 3PGFH 4GRLC 4UTAH 4XH2B 1I7RA 3QQNA 5HHVH 2Z35A 4JANA 1KCVL 1B90A 2EH7H 3BKCH 4OCLC 3HLAB 3VH8B 4X7FC 5EBWA 3TCXA 1DP0A 2XWTA 1FLTX 4N1HB 4U6VH 4DGIL 1DDHA 1BEYH 1WAAA 3RA7H 1FYTB 4KRMB 5FGBC 5B3NA 5ISZA 3WNLA 3BQUA 4X6CF 3IT8D 3BGFB 2BNUB 2H3NB 3U82B 4KROB 4ISVB 1KC5H 4YZFF 3P30L 4PJFE 5DJCB 5IM7A 2B2XL 5ISZD 2R8SL 4TSCH 3ULVD 4FQPA 3FHAA 2IANA 4OFKA 2Z4QB 3ZKMD 2DBJA 5I1EH 2F9BT 4NKDB 5T33L 3NFPB 1GVIA 1FL6A 1KPVB 1A1MB 2WK2A 1PGRB 4PJ9D 3KYNA 1N8ZB 3D39A 3GGWA 1DCLA 3R1GH 1A2YB 3I9GH 3ZLQC 1F2XK 3TV3H 1I75A 4NHUA 2DKUA 2VNCA 5BQ7A 2LAGB 2R0WL 3MOBL 5ANMA 5DR5L 4G9DB 4S1RL 3F12B 1FJ1A 4UNVA 2I9TB 2PUQT 5C09A 3NH7L 1WWWX 3GJFA 1OD7A 1QR4A 3MGTA 2VJXA 3O2WL 5B22A 2ZOKA 1L6XA 3OAYH 3Q3GB 2RGSA 5IHUL 1RIUL 4YR6A 1QSFD 4ZOEA 2AQ3A 4IOFC 4TVSa 1A4JA 3BZEA 5HDOA 4XC1L 1RHHA 1NCTA 3H0TB 4JFEA 4KAQH 3T09A 5TGBB 1RD6A 1TVHA 4I2XB 2X1QA 3KPTA 1O7VA 5E8PA 1KNOB 2IGFH 3S37L 1MEXH 3MV11 4HIIB 1OTSC 3IRPX 4RRPA 2FB4H 1F2QA 5AYUL 1PEZA 2Z8RA 4ONFL 4CW1A 3EO9L 2X7LA 1S9XB 3AS1A 1QBLL 3MJ8A 4Y2DC 2C3VA 2FX7L 2ARJB 3FQNB 4PJAF 1Z0NA 5F8RC 5IHZA 3V6OE 4JQXC 4XPBL 4U1MB 3NIDF 1RPQA 3ME0A 4OCYH 2P45B 2DM3A 2WUCH 3SDCA 3MFFB 3VGAC 3MGTB 5C2UB 3H2WA 1UXWA 3KPRE 4HQQH 4PJHF 1K8DA 1R24B 1YMMA 4ZS7H 4WTZA 5IIEB 3O6KL 1RJZA 5BV7H 4YIQA 5CZVH 2AK1H 4PLKD 3UTPD 4E41B 3LV3A 3RY6C 3H7BB 2FBJH 3FCTA 2PXYD 3U7YH 4YWGL 3F65A 4C56A 3ZKXB 4AH2B 1GGIL 1FG9C 3KG5A 2VQ1A 3O8XC 3CH1B 1DQQA 1X6NA 3OKOA 2CO7B 1CT8B 1OB1A 3QH3B 3HS0B 3QG7L 4LQ1A 3G6JE 4H25A 4J8RA 2VUOA 1IGTA 4UT7L 1P6FA 4OZFG 2ED9A 1FNEA 2GJ6A 5SWSE 1KPVA 2W65B 4M7LH 3MROB 2ESVB 4OI8A 5C0AE 5C0EA 1FFQA 5JNYA 3TYGH 4GG6B 3I50L 1UCTA 5IQ9A 4HPYH 1D5IH 1NDMB 1B4RA 2UWEF 5SWSB 1VACA 3DARA 2BNRA 1IZJA 3FFDB 1QUNA 3C2SA 1G6VK 3H9SA 4JE4B 4G6FB 4PLNC 3KPSA 5I9QC 1ZHLB 1QQDB 3O81A 5C3LD 4QRPB 1LK3H 5GGRY 3P11L 3H9SD 3TO2A 3PGCA 4KHXH 4U1NA 3QJHB 4OLYH 3GMOB 4M43L 3PWJB 3S98A 1CICC 1KEML 4LSVL 2P5WB 4XNZC 3X14A 3PXJA 4K3DH 3NTCH 4F7MA 4PRPD 2DQEL 4JKLA 3QG6A 4N0YH 4P0DA 1NCAH 1XR9B 5HI5D 4UV7H 3N85L 5EU3B 4TUKH 1IL1A 2X4TA 1Q94B 1CD9B 4PJXE 1NSNL 4S2SB 4UZGA 2IBGA 2BHUA 1ORSA 5F7YC 1ZMYA 4QY8A 1I3RB 2J8UF 3QPQC 4AL8L 2Z31A 3AB0C 4JZOA 1FVDA 2PYEA 2H9GA 4I18C 2BVUA 4GG8A 5JHDB 3QEQD 5H2BA 4YFLI 1ZT4B 4XNMB 4KPHH 1HINL 5FYLD 3E0GA 3VXTB 4L3CB 4OIIL 2JB6A 3THML 3IXAB 2YPVH 4E0RB 4JFQB 1XMWA 2CO6B 4AM0A 1I9RH 4OZFB 4P57A 2NW3B 4N9GB 4KMTL 2CDGA 5D7IA 2P43B 1A1NA 3NZHL 2IG2H 4BKLA 4Z76A 2HT2D 2DD8H 4U1LA 2VO5A 4XB7A 1CGYA 2NY0C 1LEKB 4LU5H 1SJHA 4I5BB 5EG6C 3MJ6A 4PRAA 1AGEA 4NSKA 1QFOA 3QNYA 2LABA 4Z7VA 2ZPKL 3T0DA 4Y16A 1L0YA 3PHOA 1SJVA 4YXHH 1OTUC 5JNYB 2HTKD 2DJ4A 3BIAX 2BVOA 2DQIH 2FWOB 5DURB 4ZS6D 1AP2A 3HMWL 1PKQB 3FB6A 5KSAC 1EHLL 4HK3N 4H8WL 2H2PD 3F7VA 1G0DA 1XF4A 4L8SC 2G75B 1OTTD 5HHNA 3C6LD 2Y06H 1I8LC 5IJKC 4MDIB 2OK0H 3P0YH 2JJWA 2BSRA 2LE9A 4P2QD 3CUPA 1OSPL 1NGZB 4XXDA 3HNSH 2O93L 2DQCH 1JTTA 4ODWB 1G7PB 3BP6A 4MS8D 1NMCB 4V2CB 5GS1C 5L2JB 1FL5B 5ID0B 3P0VH 3FRUA 1MCWM 5D8JH 4LSTH 3CFCH 5DQDH 2DIJA 2DQTH 3GSXB 4PD4J 4H0GA 2HN7A 1GZPB 1DLFL 4L3EA 1LEGB 2Y07H 1ORQB 1MHPH 5IESL 3MFFA 4HMDA 2AK4A 4U7MA 3HPLA 3LEVL 1P4BH 2OQJB 3ZE1E 3H9YA 1II4E 1MJUL 2DM2A 1CD8A 1JGUH 4CN4A 3SKOB 4NQEB 3ILQC 5C2BH 2VN7A 4PG2A 4LLUB 5KZCB 2VWEC 2IBBA 1KB9K 1G1CA 1HXMA 3E6FB 5T3ZE 1Z5LA 1DTUA 5ELIA 5ITBL 4D0DA 4WDIB 4HIIA 1I9JL 1RZJH 1U8PB 3RTQD 3LEXB 4Y1AD 2BNQA 5F93C 4AG4L 1ES0B 1CF8L 2AJUH 3SDXA 4K3GA 3VW3L 1CLOH 4EXPX 1NAML 5BJTA 4MD0B 4HH9B 4P48A 2XY2A 2HFGL 1FZJB 1HHHB 1T2QH 2APXA 3VFRA 4BH7A 3FL7A 4MAYC 2WLYA 4YX2L 2HJKB 3NBNA 3S37X 4KDWA 5DUPH 2D7TL 2LAAA 3B9AA 2NY4D 2MHAB 5JORB 1JGUL 1PY9A 4BZ2L 4FQCL 1KV3A 3MRLB 4MA3B 5D7LB 4UAOB 3VU2A 5DJ6A 3BISA 4AEIH 4KI5D 1RZGB 4OLXH 1LNUB 3VWKD 3LKSA 2M8XA 5EDXA 4NNXA 4C59B 3T65A 1T0MB 1W0VB 3UBXG 2EDJA 5IKCA 1UM5H 2VISA 4JFYA 4BFGA 3QXVA 4Q0XL 3BEWA 4R8WH 2VOTA 3KR3H 1OY3B 5D1QB 5L7XH 3IDMB 4PJ5E 2EDTA 4MB4A 2HG5B 3WN5B 4RBPK 4P9MH 3EO0B 1F45A 1J05A 3FQTA 1CD0A 1L9MA 5KN5A 1CE6A 4C57C 1U8OB 5IEHA 4Y4HC 3L3HA 5TE6H 4J3VA 3O3EB 5DC0A 4TUJA 4NQVA 4MVBC 4MA7H 1FPTL 2CRZA 3QUXA 4PRNA 4JM2C 4L29B 4ZQKB 3ZDXF 3MV01 5IGXH 1NMAL 5T3XH 3O6FB 3P4NB 4OKVB 1ADQL 4ZUWA 4NJAH 2A6IB 2FR4A 3ZE2E 2GAZA 5I73C 4XPGH 4LU5L 3ARFC 4U1LB 4PJCA 1LO3H 3QUKB 5CEZH 2BSTA 2DBLH 1I1FA 1P7KB 1WFTA 2CH8A 2ZWLT 4NOBA 5DJAA 3GJEB 5ERWB 4J1UA 1MFDH 3EDJA 3IAGC 1IQWL 3VGGA 4OFPA 1A7PH 4HKJA 2CLVA 4FQ1L 1IAOA 4G6JL 5DS8A 4F9LA 2A1WH 1DFBL 3Q5TA 3RZCD 3RQ3A 1BJMA 1U0QA 1DBJL 2BVTA 3FN0H 5B39G 3ARQA 3KXFA 5IHLB 1SBSH 3K8MA 2DIBA 5E6ID 5C0DA 4WGWB 4BFBD 1EEYB 5BO1L 5KSBF 1ZA6A 2Q86A 2DBLL 3HC3H 2QADD 4NCC1 2MFNA 5EH1A 2RFXA 5EU6B 4QRPD 1JF5A 4X4XA 3PWPB 2YUZA 1A9BA 1DBMH 3RWDA 1RUAH 3M8OL 4KZDH 2E8ZA 1MI5E 3V5HA 5TQ2H 2AI0H 4YAQB 2XZCL 1MJJB 4YHPA 4QXUH 4R97C 4XVTL 3P73A 2VDML 5IVXE 3EZ8A 4I13B 3G9AB 2X4TB 3QIWC 3BN3B 2AV7B 1CLYH 1YPZF 5TPWH 1PX4A 3MLSL 4J23A 4X7DC 2ID5A 2A74A 1Z0MA 4ZUWB 4XZUB 5I1IL 2H6PB 3RNKA 2VMFA 1GCFA 1U95B 4YNYA 1F11B 1EGJH 4GBXD 4U1NB 1KEGH 4WY7H 5LAXB 4Z7WF 5KTEL 2YA1A 2Y36L 4UU9A 4LPVA 2DLFL 4OTXL 4WFFD 3SOBH 2CUHA 3MUJA 4P59L 5C86A 4AEIL 1MAML 5SWSA 3LOWA 2NPLX 5IV2B 2R23B 4K94L 3KJ6H 2DTML 4GW4A 5D1ZA 2HYMA 5C0CE 4U6YA 5GGVL 1NBZA 2D7TH 3K2UL 2FX8H 5FYJU 3IJSB 3MR9A 4GQ9H 3MRDB 2M26A 5DMJB 4FG6D 1AIFA 1CT8A 1F8TH 1OB1B 1T3FA 4PRBB 1KIQB 3F58H 4QRQB 4AEHH 3MLUL 3HNTL 1INDH 3EYQD 4NQDA 1A6TB 1EMTH 4HWBA 3J7HA 3KPSE 3UAJD 4I3GA 1L7TL 1XGTA 4X9HA 4HIXH 1CLOL 2D4FA 3HS0A 3ULVL 5CBAA 2ED8A 4QRSA 4I77L 1RZJL 2FJHB 3D0VB 2IAMD 5I71C 3OJDA 4RZCA 3PQYD 1C5CL 2J8HA 1WQVT 2I60H 3O3BB 1QPXA 1FZJA 1EK3A 4UV4L 3W39B 1RJZB 3U0WL 2EIZB 1TNNA 3TJHC 3T0ED 2EXYD 4HS6B 3U9UA 5DO2D 2C3WA 3CDCA 5ACZA 3WE6A 1INQB 2BNQB 5IESH 1U8PA 5BMFL 4O4YL 5ENWA 3X12B 1FV1B 5DEFA 3BZFB 1NC4B 3Q6GL 5DD3H 2DN7A 4K7PY 4ZNEE 2GSIA 5DGQA 4I0PB 1TVHB 4I2XA 3S37H 5FFLA 4LLWA 4JFOA 4H20L 2XPGA 2BHYA 3BQUD 4WEUD 5ANME 4D9QD 1QFUL 4JY5H 1KELL 3K8KA 3QULB 4P3CH 5GISH 2I9LA 5AZ2L 1I1AC 5GHWL 5DHYA 1IJ9A 3QHZL 4PJHB 5ADPH 5GRVK 3QEUB 1FC2D 2Y06L 1W8NA 3NH7H 4NQED 3BN9D 4WV1C 4JFDE 4S1RH 4TNWF 2H45A 4NHUB 1FYTD 5F1NA 3VXUE 3ARZA 2DDQL 1QP1A 5E00B 3HAEH 5FYLH 4DK3A 4CVXA 3MNVA 3QRGL 5FA3A 2QBWA 4N8VG 5AAMA 1YEFH 1LP9B 4HF5H 4ZFGL 2FEEI 2P5EE 4XAWL 4M61B 1HI6A 1RZ7L 5FO7A 2OL3L 4FZEL 4F7PA 1C5DB 4RFNB 5F44A 5IFHL 4O5LL 1CFSA 4PG2C 1AGDA 1AP2B 2CXGA 4U1HA 1A7RH 3P30H 2NY4B 1ZVHA 1KJ2L 4OJFL 4GFTB 4Q9BA 2OBGA 2ICWI 5I2IB 1Z9SA 4QGYA 4JZJC 2H32A 1S9YA 1L7IH 2YA0A 3K81A 4IRSB 3HZYA 1S7XB 3QDJD 4PUBL 4C4KT 1D6VL 2ZSWB 4X6BA 4K7FA 1ED3B 1SJHB 4LEOB 2O5XH 4UUJA 5B3JF 3AREC 3MRPA 1I7RB 3OV6A 4XGZA 5F9AC 4UIMA 1U91A 4WTXA 2XFXB 1LE5A 3FO9B 4PJBF 4OZHB 1Q9WA 4LLMA 4MSWB 4P2OB 4AM0B 2OTWB 4KTEL 4IRZL 1BOGA 1WFUA 4UIMB 4J7RA 2DLIA 2EH8H 2HKFH 4L3CA 1CVRA 3F6IA 3G6DH 1HIML 1QRKA 4LGSB 3WEXB 3U30C 3CFEB 1Q0XL 3HE6C 3LS4H 4XWOD 4P4KC 4RDQG 1FGVL 1P6AB 2R0LH 3TH3T 3MC0A 1R3LB 4WCYL 3MV8D 4TPRL 3BGMB 2YD5A 5EB9A 4GKZB 1YQ2A 3FO1A 4GW1A 4IIQA 1E28A 1P1ZA 4JN2A 3KYOB 4QY8B 5J6HB 4LSUL 1S9WB 3L5IA 3JWDC 2HLAA 4WU7B 5EBLB 1QEWA 4K94C 3T2PA 1NUNB 1P1ZB 5DWUL 1F90L 4KHTL 4U2ZA 2H8PA 4OBSA 3FZUD 2B4CH 2D03H 4M61A 1NGQL 4TN9A 2Q7YA 1KPUB 3T2QA 3TWCH 1MSPA 5EIIA 3WHE1 3ECBB 3VE0B 4F58L 3MZTA 4UT6H 4LKXB 1VADA 2EICA 2D7QA 1C5BL 4XPFL 3V2AR 1U3HB 1U8IB 3QFJD 3SJVB 5C0JB 2HWZL 3RZCB 1WIUA 2OP4H 4YLQT 4KKAC 4QHLA 4ELKB 1ZHLA 4XB8A 5I1DA 3EJZC 4PJ7A 4PJ8C 1UJ3A 1T1YB 1IGIL 1SM3L 4L3EE 1EO8H 4YHYC 4NQXA 3QHFL 1FNGB 1RZKL 3W9DB 2Y23A 1SY6H 2NXYD 5C0EB 3PL6A 2CLRA 1M6OB 3SBWA 1YEHL 3HE7D 5CUSL 1C5DA 3B9EA 3DUHA 5CZVL 3BD3A 4K7PL 1WBZB 4M5ZH 3O4LE 3RTQA 3DGCR 2HVKA 4O9HL 3QQ3B 4W6XB 3FQWA 5FK9A 4HXBL 1T83A 2WUCL 3UJIL 4JZJA 4G43A 3H9SE 3S6CA 5E2JA 4DAGL 1QR1B 3EDFA 3QDGB 1U8KA 1OTSD 3I02A 3MCKB 5I8CA 4NKMA 1U8KB 2AW2A 5CJOH 4QXWA 1NFDE 1MCEA 1ZLSH 4Z18A 4L4VE 3MXVL 4ZSOA 3QWOB 3ARRA 1DBKH 2ERJB 1NJ9B 3KLAA 4JN1L 2CMRH 4CKVX 4GG6E 4WI8A 1T1WB 4LCUB 2F54D 2HFFB 3UPRB 5IBLC 2WBKA 1IAIM 3LHPL 3SDCC 4ONGH 4PRBA 3RY5A 1S7TA 3BPLB 4Z7WB 4PLKC 3SKJH 1LMKA 4FFZL 3P0GB 3RDTC 1F3JA 2UZIH 1UM6L 4KKNA 4MA1B 5DTFB 1QRND 4WUUD 5FOBA 4X6DA 4ORZC 2A38A 5HSFA 3DMMA 5DMKB 4D9RE 3QR2A 5BZDA 4LMQI 2C26A 1D5BA 1K4DB 5K9OA 3BEVB 1E6JL 3NFSH 1V8HA 4H5SB 2DMBA 1YEJH 4ONGL 2XA8L 2JJSC 1KENH 1CXHA 3QFDA 4GW5B 5C09E 4MNHA 2K7QA 4LKXA 3S9DB 5FM4A 2RCSH 4XPAH 2R9HC 4PRID 3LZFH 3ESUF 1MRDH 5JLZB 4LAQH 3UYPA 3QUXC 2D9CA 5MEPB 4FHBD 2AV7A 4Y5XA 1D7FA 5D1QC 1BEYL 1MVFA 1T1ZB 1DUYA 5CJOL 4ZNCD 4JPIA 1XZ0B 3Q1SL 1PG7H 4HGWA 2K3TA 4L8BA 5FDWB 1T3FB 4N0FB 3DX6A 4PJCE 5HBBA 4X9BA 4RMQA 2C4XA 3ARFA 4EEEA 3S36L 5MI0C 1J0HA 2HT3C 4HG4K 5HHVL 3H9HA 4YFEA 4KI5F 2P7TA 2EDWA 3T0WA 4ISVA 1AD0A 1ZHBA 4NN5B 4OF8A 4Z7UA 3PGFL 3ARFD 4RGND 3C60C 1A7QH 3BQUB 1FVEA 1QNZH 4YQXH 4L8CB 3WEXA 2IANE 2D31B 4LLQA 3H3BC 4LOUC 4XAKE 3DYOA 4HLZH 1B0WA 5F1IA 4GRLA 4GRWH 4BH8A 3BKYH 1ZANH 1VESA 4H26B 4HBCL 4M5YH 4UOW0 4E42A 2VH5L 2Z35B 4JANB 3U46B 3GSNL 8FABB 3IU3B 3D18B 1FSKC 1NMBL 3FHQA 3PIQA 1X5JA 5FCUH 2NTSP 4P2CG 1BFVH 2M2DA 3UZQA 3RGVC 5E6ZA 4I18B 3DSFH 5D5MA 5EUKB 3TBTA 4M6MH 3JTTB 2B5IC 4Z95L 5JPMB 5A2FA 1HQ4A 4JQVC 3X13B 1PAMA 3KPOB 2CLZB 3EHBD 4I18A 2LVCA 1MJJA 1D5MB 5T1MB 1YN7B 1EJOH 4L4VB 4AENA 4YAQA 4M1GL 3S35H 1O7SA 2E9JA 4WV1A 4UIKH 2A6DA 4O2FA 4NM4H 2DI7A 4NUGH 2VUYA 1YY8A 5K9KA 5L2KB 3VXRB 4L29A 1HYSD 4BH8B 1DL7H 1BQHA 2DQUH 4YQXL 3BPOC 3LD8B 5LKNA 1ZHNB 2Y1VA 4Y4KD 5F9DC 4IJ3B 5HHXH 3BIKA 3OZ9H 1WVZA 3UTSB 1JYNA 1DEEB 2V5TA 4R3SA 2X1PA 4E5XB 3EO0A 3WLWC 2AJ3A 2G60L 3VD4A 2QSQA 1N7ML 3IJYB 3RVWD 4NZRL 5C0RH 5EORH 5DHYB 5KSAD 4P4RB 4F37F 1J5OL 3OF6D 1HIMH 3RJDA 5A16A 4JPIB 2P5ED 3HFML 3V8CA 4P3DA 3ZDYF 4K55A 2NY5H 3QUKA 3OR7A 3T77B 1XCTB 5ETUA 1VEOA 5IR1B 5F9WC 4OGAC 2JCCF 3FB5B 4QGTA 3T0VA 5ICZB 2FR4B 2GK2A 1U93A 5HGAA 3DO7B 5HHQB 1HE7A 3TO4B 2VRAA 3QFJE 5AZEL 4HUWB 2H41A 2HJKA 2NY2B 3QI9B 4LCWA 4Y2DA 1IFHH 3UO1L 1CWVA 2LU4A 2NY1D 1D6VH 4MCYA 5TE4H 1A6ZA 1LO4L 3ARBD 3UAJC 5GGSY 5DRXB 3W39A 3CZFA 3WS3B 3JV5A 3WXWH 1TZGH 4JRYE 4OZGE 2UZIL 3O0RL 1MI5A 3LEXA 3FQTB 5D7LD 1W0YT 1KJVA 1GGBH 5JZ7D 1J10A 1NCDH 2FEDD 4XBGB 4HJGB 4ELMB 4URTB 2XRAL 4BSJA 1OM3L 1NL0L 1NCDL 1JIBA 3QFJB 3E6HB 2FHBA 3DUUB 1MIEH 1CICB 5TE7H 3VFUB 1H9VA 3BPNB 1OP3K 4KTDL 3A6BL 3T8XB 5DD5L 1FN4A 3NCFB 1RUPH 5GPRA 2X4NB 2WBWB 3ZTJG 1A1OA 2UV3A 3JV4B 3MV8E 3OAUH 3V0WH 3X11B 4ZUTB 2BMKB 4KVCH 4J3OC 1D5ZA 1A8JH 1NAKL 1NJ9A 4PRDB 3VFMA 2NX5E 4HWEH 2DWEB 2FATH 5F7WC 3QNXB 4Q2ZA 4WNQB 5IVZB 5ADPL 3MV7B 5IV2A 4R96B 4DEPB 3ARWA 3QISA 3RVXC 3O2DL 2XG4A 1UCBH 1KELH 4KV5F 4YK4B 5EA0L 4HFUL 2NY5C 4WTZG 3O3UN 4XRCA 3KJ4C 3D39D 4Q6IC 5FM8A 5SX4H 1NCUA 2BXYA 3KNBB 2VLME 2FHCA 3SGKA 1QFWM 4JCLA 3SDXB 4BQ9A 3HZVA 5BVPH 3WHE0 4L4TB 1W8OA 2HVKB 2VLJA 3H8NA 3D3VB 4YNYB 4AIOA 1XF4B 5HHNB 3QDGD 3RL2A 2XQBL 2DAVA 4R4FH 3HRPA 4QYOA 1SEBB 3GB7B 1KACB 3U4EB 3B8YA 2FWOA 3JUZA 1YYML 3LKNB 1KCKA 3KYKL 1I7ZB 1QBMH 5FGCB 5F3BA 4RGOH 4Y2OA 2UZYB 1M05A 2OM5A 2ICES 3ZL4H 3VRIA 5IWLC 3JV0A 5HJ3B 4NSKB 2I60L 3IDGB 4Y1AE 3W0WD 4BZYA 3HI6L 4PJAB 1QFWI 3LS5H 3SPVB 2EYSA 3EYUL 3OR7B 4MD4B 1UC6A 2IPKA 3CPLA 4M93C 3FRUB 5ESQA 4FQ2L 1C12A 2DTSA 1TNMA 4GQPH 5DJXA 2Q20A 4P5KB 2AJXL 1S8DB 1RV6X 4ZTOH 3QQ9C 3MLUH 2XZQH 5H2BB 4CRPA 4PJ9C 3AREB 4ZFZB 1UZ8B 2YD8A 3K46A 2G75A 4K9EC 1MOEA 5HDBE 3D3VE 4WI2A 4HUVB 3QXWA 4OGYH 5I74C 3MA7B 2O61B 3NMEA 4P2OC 5EFIA 3MBXL 2GCYB 4Q74A 4GT7A 5DD1H 4S2SA 1U8LB 5L2KA 5I76A 2FGZA 4Y8DC 1OAQH 3SE4A 5HHMD 1KJ3H 3X17A 4IIQC 2O26U 5EU3A 1P7QB 4PJBE 4IRZH 1JYVA 3QEQE 5K33A 3PQYB 4CADB 1DSFH 2J5LC 2AQ2A 4UBDC 2EEAA 5DJYB 2W1NA 1FAIH 4GH7B 1CFQB 1VPOL 2YZ8A 4GBXB 4H26A 4JDZA 3VMPA 3WYRA 3S3JA 4CAGA 1J7VR 5GXBB 2NTFB 4UNTA 5KOVC 2YSSA 1FE8H 1N0LA 4UDUA 1HHJA 5I16A 4LBEA 1FFNA 1QLFB 5DA4A 1RUML 4QXUL 4U1IB 5AUMA 5HYJA 2R1YB 3KPSB 4JEGB 5D7SL 3ARGC 1RJCA 7CGTA 3F7YB 5IW1A 3NGBC 2X1OA 4OV5B 1A6UL 1T20A 2V2XA 4YFDB 1UJ3C 1Q9KA 3VG0L 1FNEB 2XT1B 4ZFGH 1KCUH 3QUZC 4M1CC 4KJQC 3IXTB 5CSZA 1YNLH 1ZTXL 4K8RL 3GJFK 4YHKL 2FIKB 3GDBA 3IDUA 4ODVH 4K3EL 4PREB 3RGHA 1U42A 1OW0A 1NEUA 4S1QH 2X10A 1MAJA 1N2RA 3O4LA 2A0LD 5C71A 5GZNC 3MRMA 4B50A 3VGFA 4JB9H 1RZ8A 2DQHL 3WO4B 3AS2A 1LE9B 4ZUSB 3RUGB 4F7EB 2HFEA 2VE6B 2QQKL 4Y4HA 4PJHA 2DM7A 4ZXBD 4I9WD 3HNVH 1TVDA 3GSOB 3MJGX 2X9YA 4Y4HD 2RIKA 2LU7A 1BVLA 3RU8H 3VCLB 3CXHJ 1NMAH 1VFAA 2ICWA 2D7NA 4HW6A 2E27L 3CFKB 1YYLH 4O4YH 4TUOA 2W65A 3FB8B 4MAUH 4HD9A 2CDFA 4EVNA 2HFFA 2DLHA 1WZ1L 3T1FB 4APQD 5KS9A 2OQJA 3KPMB 3V7MA 4N90E 1KLUB 4HXBH 4JR9L 1K3ZA 1T2XA 3K1DA 4JFEB 3TT1L 4OCNC 3GSRB 1CDCA 1JWUA 2VIRA 4DVBA 2EE6A 4L3EB 3WNMA 2R29L 3CH8A 4XP6L 3IAPA 3QQ4B 3LMJL 2P8MA 4WFEE 1DLHB 1MREL 3MOQA 2HRPL 4HK0A 1PKOA 1YEKL 3EGSA 2CR3A 2G5RA 1A0QL 1IM9A 2V5RA 3QWOA 1YDPB 2LTQC 2EE2A 1FFOB 4BFEA 4Y16C 2BSRB 1YDPA 4YHLH 5TDNB 2NQCA 1IGIH 3F58L 3VXQB 3SDCB 2ZSVB 2BCKA 2OL3B 4KKLC 5BW7C 3NACL 5FGRA 4FMFA 3K2UH 2WANA 2W0PA 4ZDHA 4NQDB 1BLNB 2Y5TA 1JZ4A 3LSOB 2I26N 3LKPB 4JM2F 2N56A 3UTTE 4UNUA 1ULVA 4JPWL 4OLZH 4XNXL 3S4SA 2IAMA 1TJHL 1KEGL 1AQKH 5FYLE 1J9CT 4WWKC 1QLRB 5TGBA 4X5LA 2X2YA 1IEAA 3QIWB 1NDGB 5CIPH 4Y5YC 3SO3B 1CYGA 5CJBA 2ICWB 2R39A 1A1NB 3I6LD 4BKLB 4U6TA 3U48A 4M7KL 2W9DL 5L8KB 2NY0B 1R3JA 3Q3GA 3OSKA 3G08A 1LD9B 1S78C 4U1GB 5HI4D 3WKMH 3ZDZF 1UJ3B 3QEHA 2D4DA 5KSVA 5DHVB 2CIIA 3UJTL 1YZZA 5IG7A 3K4DA 2H6PA 4M62L 5E9DA 1F4YL 1OAZH 4YH6A 1A6VL 3ECBA 3C60B 5MP6H 5B38B 1LEIB 2NXYB 1IAII 4FQHA 1EUTA 4X5XA 2WP3T 1YNTB 2GUOA 3P73B 3BGAA 3HG1D 1Q9KB 3RGVA 4TNVK 1IC4L 5D93C 4S0SD 5KVEL 1E27B 4GJTB 3V52H 2ZNWA 2IAND 3O41B 4Z7VF 1SQ2N 1CFTB 2O5XL 1AGCB 1C7SA 2OR7A 3WD5H 4FTVB 4XMLH 5C0CA 4XCCL 4PJ9A 2XXMB 1RUQL 1PSKH 1HDMA 2RHEA 4NQUA 3NOIA 3W0WB 1F58H 4YXLL 3MV9A 1L7IL 4G6JH 1HHJB 2E9WA 3L3IB 3P9WB 2W92A 4P4KA 3BKMH 4MJ2A 1OOAA 5GJSL 4QOKE 1KJ2H 1G7JB 2ED7A 4AMKH 1P9MA 5AUMB 1KSRA 3BYTA 1CFQA 4JKKA 5EUOF 3DMMD 2YEZA 4O5LH 4BQ6A 4OSUL 3WIFB 1LO3L 4UUJB 3SE4C 1K5NA 5GGTH 1BBJB 4LGPB 4JFDD 1D5XB 3MRGA 1F3DH 1G0XA 2P8PB 4Y4KC 4XAWH 5IJVB 2C3GA 2P5EA 2XFXA 1KB9J 5FUCC 1NAMA 5HHOD 1B4JL 1QBAA 4PJDE 4JFPA 4NJAL 5F1KC 4GG6A 1XGUA 1ZS8A 2DICA 4V1DD 4YC2C 5T3XL 3R8BB 3QDGE 5DO2C 3KPPA 2VLRA 1TTUA 4ZPTB 3NAAL 3LB6C 1U3HC 2VB5A 1CBVL 3S34L 3O6FA 1UADC 1FO0A 4P49A 4LCWD 3REWA 4RGNE 3QHZH 4IJ3C 4AEEA 2X1XR 2R0ZL 4ODUA 2GCYA 3CH1A 3VFGH 5C08B 4R2GD 3VFNA 3GSNA 5EOTA 4LVHC 4OLUH 2A83A 3ARGA 1DSFL 2VQUA 5DJXB 4O51A 4LVOB 1H8OA 3SGDH 4NNYB 5J8OA 1AXSA 1LO0L 1JPFA 3MA9H 4OZGA 4TUKL 5TH2B 3PP4L 5FM5M 3QDME 4QRRD 3HE7C 3QUZA 2F54B 4OLXL 2DQEH 3QULA 1QSZA 3MACL 3NTCL 5FHAL 5C0GA 3TBSA 4C56D 4B0MM 3BRFA 2J7LA 4KTYA 3K80A 3DRTA 1F5WA 2VLKA 1WF5A 2DRUA 2F53A 4M62H 4JM4L 2NY3C 1HHIA 1KEMH 4YHZH 4OKDA 4P23A 5D4QA 3U79A 4EXKA 3V5KA 5JZ7C 2F53D 2V7NB 3TVMD 2GSIB 4FABL 2AJXH 5AWNL 4O2EB 1K6QH 3BH8A 3ES6B 4JM2D 3ZKQD 3ZKNC 1WITA 4S1SL 1JGDA 1IGYA 4XWGH 1AQKL 4OZGF 5ACZB 4BH7B 3RVUC 1LK2B 3H0TA 3QCTL 3BZEB 4MHHI 4TOYH 4ZFOB 3KDMA 4S1SH 2PR4H 4Z7UE 5AYQA 4HPYL 1F42A 5EU5A 3UBXB 3B2UD 5DD0L 1RIVH 1ES0A 2IH1B 3BAEH 1OCWL 5IW6A 3RIAF 3BH9A 5MEQB 1DVFD 4R26L 1B6DA 4KVNH 2DLGA 4WO4C 4OFIA 4XVUC 2A9NL 3F12A 1IGFH 5JTWA 3V5DB 1YYMH 4M9OA 2Z8SA 3MRJB 1JMXA 1UWGH 2X4NA 2DS4A 3GIVA 4R7DA 2DL9A 3HPLB 4IMLB 1V3KA 2V2WB 4PRDA 3VFMB 2EXWD 2FBJL 2P5WE 3PP3K 5IBTH 4LCWE 2IMNA 4RX4A 4JDTH 4Y1AA 5DJCA 2IQ9L 3HNSL 3V4PL 4OCXH 1EJ6A 1CTNA 1NBVH 1RZIA 3EUUA 1CFBA 1AHWB 3CGTA 3VFGL 1MI5B 3O8XA 3MR9B 3B5GA 3QRFM 3O3DB 1G7PA 1YNKH 4ELMA 3B2VL 1I9IL 4JGMA 4L4TE 4BQCA 5FKPA 3EO9H 3VCLA 4N0CD 5HVWA 4ONFH 2GHWB 5FYJH 2G2RA 3NAAH 4KH2A 1CIUA 1D6EB 3WFHA 4P2RA 2JKXA 3BKJH 4G6ML 3KAAA 3T04D 5CEXB 4H0IA 4ETQB 5GS0H 4NKIL 5EBGA 3F7VB 1LO2L 3JWDH 4PTUB 1MFNA 1QLEL 1BAFH 4Y88A 5C0BA 1OM3H 1CIDA 1JNHB 5GGTL 4EI5C 1Q0YH 2I27N 2AEQH 4L4VD 1RIUH 4XPTL 1K4CB 4Q7DA 3RAJL 3U4BL 1N2RB 1DBAL 4XHJC 3ULSB 2EDNA 2EEBA 3GMNA 3P9LA 4Z77B 2NY2D 4PGBA 4M6AA 3IKKA 4WTWA 5CP7B 1NGPL 2ADIA 3SBWC 2KZWA 3RWJB 4FQ1H 1RUQH 5AG8A 3B9KC 1ZLVK 1MNUL 1T20B 1S5IH 5IOPB 4FXGA 2YHGA 5ITFA 4CU7A 2HJLA 3HZKB 4HCRA 3V0VB 4BSVB 5GSRA 1DE4A 1VKXA 4I8DA 5HDQH 3HA0A 3GI9L 4GMSL 5C0DB 5JHDA 1DEEA 1HCVA 5KSAB 3TFKD 3LH2L 2RQ8A 3IAQA 1RZFL 1VKXB 4FQIL 1FZMA 1FH5L 2YN3A 4HLZG 1AD9B 2Z31B 4LBEB 1NKRA 2VDQH 2DMCA 1MVUB 2FSEA 4RIRB 5TQ0L 1NGYA 1NCAL 3G5ZB 4N0YL 5EORL 2WIIA 3REWB 1N7MH 4MXQC 4UQ3A 4KC3B 5CEYB 1HYSC 5JO5B 1JPST 2Z0BA 5ALCL 2EDBA 5C6WH 4MWFA 2XNAA 4MNGA 1NC2D 1XGQB 3B43A 1ITCA 3L3JB 2CJUL 4P5TD 5ID1A 2C3XA 4TULL 3KPOA 4JFPB 5IFJB 2HA1A 3T0EC 4UTAL 1OAUL 3RDTA 5TDOB 4LCCC 3EDKA 1NCBH 3G5ZA 3RDTD 1X5GA 1N5YH 5EFIB 3MJ7B 3K4ZA 1ZAGA 5GS0C 5I8EA 3OKMA 3PGCB 5LCVH 4Z7QF 4PS4L 4QRPA 2OZ4A 3WJJC 3WFHB 1ZVSA 4YHOH 3ALWA 3L3DB 1TZHA 3HG1E 1DR9A 4RAHA 3ULUH 2DWDB 4FQCH 4L1DA 3OKNB 1F6AB 1RK1A 5LJYH 2XZQL 5GRUH 4L8SA 1KPRA 2VABA 4LIQE 4MLSA 1J05B 3MRCB 1IT9L 4OB5L 1FYTE 3QUXD 1FYHB 3C5ZD 1QPPA 1Y6NR 4JCMA 1CF8H 3MTRA 4LFHG 3MGOA 4XX1E 3TT3H 2CKBH 4I3RL 1K4CA 3NCCB 4LRIA 5LGHH 5GRJL 3BI9X 1ODAA 2FEDC 2NW2A 3LN5A 1CL7H 3U1SL 2HRLA 3QIBB 1NPUA 3T1WA 3L5WB 1M1SA 4MD0A 5A40E 1MCOH 2ZKHH 5MEQA 3HUJF 3CVIH 3D69A 4P2RB 5EULV 3P9MB 1J18A 4OD3L 4MAUL 1GGUA 2D7OA 3JWOH 1YYLL 4YE4L 4KK8C 3NA9L 2XQBH 3BGFC 4ODHL 1KXTB 3U9PH 1PG7W 3FQXB 5EU6E 2Y7QB 4LLVB 1J0KA 1JYWA 4LQFL 3WMSA 3HZMA 2CRMA 1OGTA 3IFPA 1AHWA 5K9JH 3HNVL 4KAQL 4X6DF 5DQJA 3NZ8A 4XC1H 4XVJH 4NIKB 5DEZA 1MCFA 3FN3A 4X7SL 3BRGC 3MLVH 3GKWL 2YUXA 2DQGL 4DKEL 3ARBA 4PRIE 2YPLA 4ZUVB 4XT1C 3D25A 4H88H 4OZIA 2ZJSL 1U6AH 1NAKH 3MRJA 1T04B 4ZOCA 3CDGB 3GBNL 2VYRE 4JM2B 1NGZA 1CDIA 3JV6B 1V05A 4XBGA 1E4JA 2ZPKH 4F9PA 3OJMB 4Z7VE 1YPZE 3M17A 5IW6B 3EGSB 3QQ3A 4P2YA 3QNZA 3TA3C 4JHAH 5F8QC 3S96A 3HR5B 3AS3A 1CR9L 1JF1A 4IHOA 4HC1L 2QSVA 4D0BA 5D7SH 2ADGA 3F6LA 4NFDA 1JGDB 1J1XH 4Z7WE 2HLFD 1ZGLA 5K93A 2SEBB 4KPHL 2MSPA 3QAZC 2OMNA 3LRSB 4G5ZL 5KVDH 1CLZL 2AGJL 3CFKA 1AO7D 1XCTA 5ETUB 5GS3A 4PJDF 1DDHB 1QSED 2BVQB 3TZVB 3QXDB 4P2QB 1J8HA 1KTDA 2P24A 2VKXA 2YD6A 4G8GA 4OAWB 1WT5A 5SV3A 4Y4HB 3EOTL 2AK4E 3QI9C 3JVGC 1G9EA 5BS0D 2J8UA 1AR2A 4HV8A 4MNQE 2BOCA 2E7BA 2FO1A 1JPGB 2R1WB 4NZRH 5GGQL 1OARH 4GOSA 1YJDH 2MCG1 3RPKA 5ALBL 1N5AA 1H8NA 1BF2A 1VADB 1T7ZA 5F6IB 3ZHDA 4NFBA 1CQYA 1A9EA 1Z9MA 3RNQA 4ZTPL 3DX7A 1RJLB 4Y4FB 1UENA 4LSVH 1A6AA 3FT3B 3GFUA 3I3EA 1ORSB 2W0KA 5T5NF 4U3XA 1VGKA 2ORBH 1NLDL 5JDJA 1EVTC 5CD5C 4KQ3H 1T7WA 4XBPA 2DB8A 4Z0XA 2Q6WB 2V2TA 4JFED 1TENA 2A6DB 1SEQH 4X8JB 5D7JC 4HS8L 3TIEA 5GRVL 1R3LA 1SYSA 3MLRL 5EBLA 4ZPTA 4XPFH 1A7BA 1BVZA 2GY5A 3G6JB 4UIKL 2Z8WC 1E28B 4JN2B 5D1XC 1J0JA 4NM8H 1UZ6E 2BSSA 3UPAA 3ZYZA 5IJVA 1G9NH 1H5BB 2P8LA 3OX8B 5FYJD 4MLIA 3JZ7A 3SDCD 3TO2B 3TGXA 1NUDA 3ARDC 2V5MA 1HWGB 5CMAA 3QUZD 1IGCH 2P47B 1NFIB 3DXAA 4E41E 1KOAA 5GS2H 4HUMB 3V7AE 4DZBB 1NMBH 4LKCB 2UWEA 5F1IB 5DYOB 1VHPA 4XGZB 4R4FL 1P84K 3BT2L 3AXLB 5CGTA 5E94B 5EOQH 4DUXA 35C8H 1T7YA 4K7FB 4EIGB 3T2NH 4H8WC 1KXQE 3BHBA 2VL5B 1H3PH 4MMXC 3I75A 1KXVC 1WCBB 4NJ9H 3MV9E 2NY3D 5I1AB 4LPUA 1LP9A 4OCYL 3TBYA 4HJ0C 3RJQB 1A3LH 4YGAB 4F7PB 4X4YA 3BUTA 5IMOA 1OAYH 3O3AA 2VL4A 1UZ8A 4HUXB 3QUYA 2AABH 5C1MB 5E0QA 3H7BA 2ZUUA 3K2MC 3KGRA 1BBDH 4JJ5B 1AGBB 3MNVB 1J1XL 4HLJA 3RVUD 1OWWA 5LWYL 3U83A 3VFPB 1XGYH 2E6QA 4WI6A 3WNOA 4UT9H 1RK0A 2HT3D 3M1BA 3QDJE 3QO0A 4G3YH 2Q8BH 2XWJB 4L9LB 3QQ9D 5HGGS 4JHAL 4FZEH 3PNWB 3LQAC 4HPOL 5IB3B 1U8MA 3MLWH 1NDGA 5I19L 5SWQB 1OT2A 4CW1B 5HPMB 1BD2B 2X44D 5IFAH 2HJFA 2YWZA 5J9PA 4YDKH 5I74B 1NC4A 4TTDD 3STLA 4IDLA 4QRUB 5HYEA 4PJEF 2CK0H 3PDDA 1AGFA 5DVNA 5L6YL 3VXPA 3TIDA 4UDTB 2APTA 2VDKL 4HS6A 3U0PA 5I75C 5DXWA 1IFHL 2DI9A 3PXHA 1GPOH 3O45B 3S3PA 4FS0A 3I9GL 4DFHA 4Z5RB 5CKAA 4LCUA 3R1GL 1MCBA 2VZ1A 5DHXB 5E8PB 5I19H 2R0KL 1KCRH 3DI2B 3QO1A 5D1ZC 4PGCA 3HZVB 3VXSB 5I1EL 5MENA 3D0VA 2Q8BL 5I30L 2VE6A 1AHWC 4TRPL 3RUGA 3LRGA 1XGYL 4NKMB 4DN3L 5A3ID 3QUYB 1HQRA 5JW4M 4MNGE 3BOVA 4J4PD 4I1NB 1DLHA 3D9AH 1ZLSL 3PGDB 4ODHH 2CIKA 1I3UA 1N8ZA 2AABL 3KYNB 3L7EB 4CMMB 3L5XH 2VXVL 4YPJA 3MRDA 4L9DA 4LIQH 4XP5L 3UTPE 1A3LL 3BPOB 2IANB 1WAAE 4JKMA 3OZ9L 4RFEB 2DLTA 3IDIB 4N68A 5E99L 3UJIH 4P99A 2GEEA 2R2HA 3ZT7A 4W68A 5D5MF 5D70L 5GSVA 1BWMA 3ZMRA 4O9HH 4EI5D 3VFUA 3B9DA 3V6OA 1CICA 2AKRB 3IETB 4Q9CA 4ZO9A 2BDNH 1Y18B 1F6AA 4EN3B 2K9UA 3T2NL 2CKBL 3BHBB 1GGTA 1KIPA 4NO2A 2X70B 5ADOL 5JXEA 1H3TA 1EXUA 5F96H 4EUPA 4EQ2A 4N5EC 2AAVA 2GTWB 5HYJB 1EMTL 2D2OA 3D2UD 5FYKH 1MWAA 1OF2B 5JPNA 3EOAB 4JO2L 2BK8A 1NCWL 4GQ9L 2A73A 4N1CA 3UXFA 3TNMB 3MLZH 3VGEA 2DTMH 4RNRB 3TVMB 3G6JA 3CDFA 2F53E 4RQQA 5D7IE 2XIDA 2AXFB 1EA9C 4OZFH 2XWBB 4J6RL 4HKZA 1UVQA 1RVFH 2FYYB 2XTLA 1D9KD 1N5YL 4BUHA 1Q1JL 1HSAA 2PYED 5B21A 1AXIB 1VGKB 2B4CL 2D03L 2HLAB 1MQKL 5E8DL 1A6AB 3FT3A 4P4RA 4MXWL 1RJLA 5FM5O 3V5HB 4KK5C 3H7LA 2YWYA 4DUWA 3WV0A 5F7EH 1OW0C 2EDFA 1SY6A 1CFNB 1EFXB 5TPWL 3KXFB 3EW3B 5D2NC 5HPOA 4PGJA 3T0EB 2ADJB 2VAAA 3W2DH 4K3JL 4K07A 4HCRL 4BSVA 2BNQD 2OTUA 4DVRL 4PJIA 4OGZA 5IWLA 5EZJB 4OM0L 3HG1A 5JOEA 4QT5A 1J0IA 1FGVH 1X5YA 3EFFA 4MMZC 1BQHB 1C12B 5C0ND 3V8OA 2OTWA 1FRGH 2BXZA 1G7IA 2R2EB 5GS0D 1NGWB 2J12B 1Q9WB 3JWOC 3FQRB 4KZDL 3OKLB 4M1DL 4K8RC 4YBQC 4DEPC 4HKZB 15C8H 1YUHA 1DBML 3MRPB 2XWBA 2EYSB 1EBAA 1I8LA 4HT1L 5J57B 1WBYB 1BFTA 3AU1B 4ZMAT 3QA3B 4R4ND 4N8VA 3VFVA 3L3OB 5I6XC 5L9DL 4WFHD 1DQDH 2L7UA 5C0BB 5F3BB 3MRQA 1ZHKB 2VDPH 1DFBH 4ENEC 2A6IA 5D72L 3HE6A 4XCYA 4XNUH 5C0AA 4C83B 8FABA 3ELAT 3Q48A 3RFZC 4HC1H 3LCYA 1A7RL 4KROD 4Y7MA 4BK5A 4LVEA 3UYOD 4FFZH 1C08A 2EEDA 4L4TA 5ILTL 3ZTNH 3FO0H 1UH3A 2CKBA 4FQLH 1GJIA 3S36X 5HYFA 1KTLA 4JY6A 4KY1H 4NN5C 3X3FH 1GZQA 2FGWH 2ZUWA 2CMRL 3RHWK 2ITCA 3TH4T 3O6LH 4D3CH 5GS0L 5JOPE 3QNXA 4Q2ZB 3GK8H 3FONB 5FYKE 1WTLA 4Y0GA 4KJPC 4R7NB 2E9IA 2PYFB 4U1JA 1UYWH 1IE5A 2ZJSH 2DM4A 3EO1B 1TETH 2CK2A 4Y5VA 1DQLH 1NCCL 2CIKB 3IJHB 3NZ8B 1EPFA 1LNUA 3FFCE 1UH4A 4P3CL 1FNHA 3UZEA 2PW2B 4LHQB 3C6SB 1IM3A 4NQCB 4I0PA 1OAXL 4LLVA 5E8EB 4XVJL 1FBIL 3OXSA 4M6OL 4P2OD 3KXFE 2X4PA 2MHAA 2IPTL 3QP3A 5K9QI 3E3QE 1HSBA 2W0FB 1KJVB 1D3CA 2XA3A 3GO1H 1YEHH 3QFDB 2MQCA 2FBOJ 4RWYL 4NRXB 2Y7QA 3O9WD 1PW3A 4FQJH 3F5WB 2BZDA 4PJXB 3TNNB 4HZLB 3B9VA 4F57H 4LLUA 1V7NL 1IM3B 5FV2A 1HKLL 1Y0LB 1J12A 3B3IB 5F88B 4BZ2H 4X6EA 4RZCB 1JMZA 4I3SH 2Q8AH 4DQOH 1QSFE 4R26H 3IJHA 1PDKA 4KI5E 1F4WL 5DD0H 3C6SA 1AH1A 25C8L 2OR9H 1F4HA 5EC1B 2W07A 4Z9KB 3MRCA 3ULVH 1X6LA 2VABB 3MJ9L 1T0PB 1J8HD 3DSNA 2VZOA 5T1KD 4PGEA 4KXZH 4X7TA 4MZ3A 1ONQA 2DQJL 1WLHA 1MF2L 3GSXA 2UY7A 3HAEG 2QV2A 2FX8L 4G7YL 4M4RA 4XXCC 2ZCHL 2Z31D 1JGEA 2OTPA 2G9HB 4Y89A 3FOLA 4DZ8B 4LSUH 4R2GC 4U6XA 3KJ6L 5C0AB 4C83A 1MUJB 5HVHC 4MNQA 3OKNA 2W9LA 1I3GH 2APFA 3LEVH 3HRZB 3MACH 4CN6A 2WBJA 5I1AA 2AJZA 2EZ0D 3W0WE 2VXQL 2Y07L 1NC2B 4DK6A 1MJ8L 3C5ZB 5TDOA 4HUWA 1WBZA 2DQDL 5IMKA 2ZCLL 3LKRA 4NQCE 1N6VA 1F4XL 1WEJL 5F21B 4U7KA 4CU8A 1B3JA 2D9QB 2JIXD 3AU1A 1C8PA 4LL9A 3WNNA 5DVOA 3CSYB 3SE9L 1L4IA 1OSZB 3C2AL 1ETZB 3QIUD 1DQMH 4EDWL 4TULH 3RDTB 3DUSB 4EBQL 4NHCH 4NYLB 1IGMH 1TQBB 2B0SL 1AY1H 1T03H 2A2QT 12E8H 1TPXC 1AFVH 1LEKA 3CFBB 3NPZB 5KSBA 3EFFB 5I1DB 4P2RD 5D96C 3VXSE 4L5FH 3IGAB 3N1FC 4GSDH 1ZT4A 4E5XA 4UQ3B 1JHLH 2XACC 3WXVL 3QCUL 2IWGA 4APQC 3NN8B 5CGYC 1L0QA 4E0RA 1UA6H 4G8EB 5B39B 2AJSL 2JB6B 1FGNL 1ZHNA 1TTGA 3VGAB 5DJ8A 4FTVA 4C4KO 1FAKT 3UP1A 1CFTA 4M6NL 4GG8B 4HULB 4LCIL 3ARDD 4MJIA 2DYPA 3CLEH 4Y5YA 1BREA 1YEIL 3UJJH 2ARJQ 5T1LD 4WWID 4CUCA 4QF1B 2M1KA 3NVQA 3MZGB 4JRXD 3FRPG 5C0BE 4AMKL 1TFHA 5FO8A 4LGRB 5GZOD 1EEUA 3GSUA 4L8BB 5FDWA 1TIUA 2LTQB 4N8PA 5ERWA 1J8HE 3X14B 1HQ4B 1UVQB 4XMLL 5EUKA 4FZ8L 3LKOB 3S88L 1IQWH