5J9PB

Kcsa in vitro
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab
publication title Combining in Vitro Folding with Cell Free Protein Synthesis for Membrane Protein Expression.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
total genus 48
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2016-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pB01
3MXVH 3UTSD 2W0PA 4J3UA 3PWVB 1HEZB 3X11A 1OT1A 3TLRA 1GC1H 4G8EB 3MV9A 3G5ZB 1NCBL 4JDZB 1U91A 1YN7B 5E99L 4Q6YA 2VLRD 5IKCA 2XTJD 5F9AC 1UM6H 5DGRA 3NFSL 3GHEH 1NC4D 2CO6B 2JK5A 2A0LC 4M3JA 5ICZA 3T08A 4HKJA 5I76A 5EU4A 5EBLA 1WBZB 4YNYB 4R4BB 3REVA 4UMGA 1HI6B 1FN4B 3MGOB 3VGAC 5H35A 2DS4A 3JWOH 1JF1B 2LE9A 3R1GH 4OLYL 3DX8A 1OGAA 3STZB 4K3DH 3IU4H 3MRFB 4UUJA 2ZSVB 4R4NC 1A1OA 2HFTA 4MLSA 1ZLVH 1G7MB 3E6HB 2F53B 5IBUG 3O6FC 1HIMH 1X5HA 4MQ7B 1S7QA 2O93L 5CD5C 4LQ1A 2JB6B 4BYHA 4M43H 3R8QA 4GBXB 2CIIB 1T0MA 5CMAA 4PBXA 1S7VB 2H2PC 4YHML 2VLJE 2OR9H 2HTLC 5L2JA 2UUDH 3QEHB 5F7YC 4R97B 3O6FA 1NGYA 1DJSA 2YPKA 1H5BA 2F53D 3PHQA 5AD0A 1SYVA 2OR8A 1TJHH 3CNKA 3MLZH 4Y19E 4KK5D 4UDUB 4Y88A 5DSCB 3B6SA 5JW4N 4GBXD 3F7QA 4CW1B 4PLNC 4P2RA 1NH6A 4U49A 2HRPL 4M5ZH 4UV7H 4N5UA 2XXMB 3NA9L 4GH7B 3X13A 1VSCA 5DRWA 1OD9A 2UY6A 1Y6KR 4CU7A 1UA6L 2H3NA 2GFBB 1JGEB 1NGPH 2DYPA 1NBYB 4QHNA 3V6BR 3CU1A 3GJEA 4YHIA 3BWAA 3HI1B 5I15L 4NBZB 1MH5A 5HYSA 5GS2D 2X4PA 3R0MA 4Y5XA 4NPYB 5ALCH 4MA3A 4QRQB 5IG7B 4DFIA 3IDUA 4BFBD 1IVLA 2X4RB 3O3EB 4S11A 3IDYC 1CFNA 4UBDD 5ITBL 3PGDB 3Q5YA 1WIPA 3NCBB 1DN0B 2B4CL 3KHQA 1YPZE 1FFOB 3R06A 5GISH 3H8NA 1T5XB 4C83B 5FCUH 3KNBB 5KSVA 5ALBL 4JFZL 1JWSB 5IWLC 2I9LB 4K8RD 3ISWA 2HFEA 1SEQH 4KUCD 1RZ7L 1TVBB 5TF0A 4J1UB 4LCYB 2VWEE 4TULH 2DB8A 3SGJC 1OWRM 3LPWA 1ZKAA 1KN2H 1K5NA 4E0RB 4UU9B 1NDMA 4NKQB 1MNUL 1XEDA 5IV2B 3WDJA 3BPNB 1BJ1H 5CILL 1YEDB 2E9BA 1ZS8A 2V2WA 4MCZB 3UTSE 1GCFA 2BVTA 3SGJA 1MQKL 2E7BA 4G6KH 1W8OA 2IEPA 4PG9A 4K9EL 5KANG 5ESVB 4JG1L 4Z7VF 3RIFK 4WW2C 4P46A 2VLRE 1E4JA 4ODUA 3QCUH 3L3DA 5KZCB 2XTJE 4TSBH 2PXYC 4X6CF 3F6IA 4JRYA 5DD0H 4HFWA 4EDWH 4HAGA 1RJLA 1AQDB 2DICA 4OBSA 1V3MA 1Q1JH 4PJHF 3VRJA 4PGDA 3QISA 4WFGE 4PR5B 4HS6A 1CFTA 1HHIB 4NC1E 3S6CA 3BEWA 2DL9A 1WC7B 3V79C 4WW2A 4HC1H 2F54B 3C5JA 5FO9B 1N7MH 4LOUD 1BEYH 4PTTB 3CDGA 4FFWC 5BS0A 3JWDC 1JNHB 4KUZH 3SO5A 5KZCD 4TOYH 4WEMB 4JDTL 4RMUA 4XBEH 2ESVA 3MRHA 2Q7YB 2X2YA 1OARL 2VLLA 4PRAB 4QRRE 3ULVD 4K3HA 1I8IA 4XMKH 5DQDL 5K33A 3U4BH 4B7LA 5CGMA 2F54D 2QR0A 2A6DB 1INEH 4Z6AT 4WHTA 2NX5A 5DF0A 5EC2A 1T0PB 1U8IA 2FEDC 3RVTD 2XPGB 2EDXA 3MO1B 4HHAA 1RZFH 1QFWM 4X8XA 4MXWH 3K46A 1I3VA 1YYML 4YPJA 3DO7A 5LQBL 3IJHA 1QFHA 1MSPA 2J88H 1CE1L 3ULUL 1VB9A 1UZ6E 4DN3L 3VW3H 1KCUH 5J56B 3MFFB 4Z95H 3O45B 4OCWH 1RMFH 3S35H 5JMRA 4U05A 2EH7L 5B39B 1ZV5A 2AAVA 3NFNB 1H8SA 4ZXBB 1P5UA 2I60L 4TSCL 5E6IB 2NXZB 1C7SA 3V0AC 5IT2L 2BCKA 1GVIA 4Q58C 3V0WH 3OWEA 2W65A 2KQNA 1HKFA 3P3YA 2W9EL 4JEGB 3SPVB 4NNYB 4RWYL 2C1PB 2H45A 1PQZA 3JV6B 2XA8H 3KPSB 1EBAA 2V5RA 1F4XL 4KU1A 3W5MA 4S1QL 32C2B 4HSQA 4ZXBD 3HPJA 1KTLB 5E6ID 2HKHH 4ONHB 2F15A 2NXZD 1JI1A 5KTEH 8CGTA 1ADQH 5E08L 3O8XC 2FJHA 4FQ1L 4XPAH 4M8QB 3J7HA 3ZE1F 2FO4B 3TV3L 4LAJH 4LLDA 5T1MA 2VDLL 3LKPB 4OZFA 4XAKD 2CKBB 2PF6A 4MGXA 3SJVB 3MJ9H 4NJ9L 3UYOD 3KPSD 5C7XL 3LAFA 5J6GB 5E2TH 3SOBH 1MCOH 1XGYL 5E2JA 5CZXC 3O8XA 2PNDA 3T4AB 4BFGA 1AR1D 2X9WA 3E1F1 1LEIA 4CADB 1B0RB 1FVCA 2HJFB 3FKUS 1MLBB 4YHPA 1A6TB 2ZUVA 3BP4A 1WBXB 4WGVB 4PY7B 43CAA 2VLMD 3AM8C 3JV0A 1NCCL 3KPRA 1LDPH 3SJVD 1HHJB 5DFWH 4OTXH 3L3JB 3MXVL 4AMKH 2ZG1A 1J7VR 3TIDA 1S9YB 4LSQH 4X8JB 1L9MA 5F7LB 4DKDC 4W81A 3B9KA 5T3ZD 1DEEA 2V5YA 3HLAB 5GRJH 2P47B 4LCCC 2FR4B 1INQA 4PJCE 2V17L 1LEKA 4ELMF 4N9GB 2BSRB 4XB8A 3GHEL 5B21A 2BY1A 3P0YH 5HI3C 4KKLC 1KLUA 1XFPA 1PX4A 5T5FH 2HJKA 2ADJB 5HVGB 3G6DH 4NRXB 2BK8A 3ESUF 1LEGB 3T4YB 3DMMB 4EXPX 1C08B 4LCCA 4V1DA 1MCRA 2QLVB 2OZ4A 3MUHL 1L9NA 3R1GL 1UWGH 2V7HA 3WHE0 1TCRA 3LB6D 5EOQL 2N1KA 4ZUSB 3TO2A 4K3DL 1A4JB 1XIWC 5HYJA 3VWKC 4EUPG 3RL1A 5DFTA 1GGCH 4HIXH 4N9OB 1MCSA 1XR9B 3MBXL 3A6BH 3FTGA 3DMMD 1J0IA 4Z76A 1HSAA 3VG0L 4GKSA 2VAAB 3GM0A 1MREH 4MJIA 3PP4H 4Y4HC 1HIML 4Y5YB 3KLDA 1GGYA 3V95A 2YC1B 4YHZL 3V6FB 2IPTH 4M43L 3TCXA 1XIWA 2F54E 3VWKA 1RZJC 5HY9A 3HHRB 4XMLH 4JZNA 3TESA 3FO1A 3RPIB 4FMKA 3T0VA 1Q9WB 2OL3L 1KGCD 1YEIH 3D18B 3V8OA 2WUBL 1NC2A 4RFNC 4WU5B 1MRDH 1PVHA 1U8LB 3QUYA 2R29H 4OF6A 4L29A 3NIGE 4BSJA 3QIWA 4M5ZL 5I1KL 3WXWL 1XGQA 5BRZA 3VFUB 4UDTB 2ADGB 1CFSB 4H88H 4I77H 1D5IH 4NN6C 4OSUL 4OZGE 2GSGA 3A6OA 4ZUUA 1JTOA 5KVMC 1N6QH 3OJDA 1MJ8H 3VFPA 3HC3H 1YMMA 1JIBA 1Q94B 3GBML 1KSRA 1YY9D 4HT1H 5HGGS 1QD0A 4X7SL 5J89A 5D70L 5JW5B 1MHEA 1HWGB 3TBTA 4YO0B 4CJ1A 1QRNA 4J7RA 3LKRA 5C0FA 3UMTA 4GW1B 4JM2F 2EEBA 3ZSSA 3G9AB 1YY8A 3QPXH 5L7XH 1X5IA 1JF5A 3VH8G 3BRDA 4BQ8A 3BGMA 1S9WB 4KV5F 1XF3A 4TNWF 2XV6B 4POZC 3X11B 5JQHC 3C8KA 2LQRA 3PP3H 5FCUL 1DTUA 3MV9B 1U91B 3QUMH 5IKCB 2WBKA 2ZG3A 3KPSE 1SEQL 1TIUA 4FTVE 3FRUA 1X7QA 3T1WA 2JK5B 4JPWH 2D7MA 4R8WH 3QA3A 5ICZB 1HYRC 2Q3AA 4HKJB 5I76B 5EU4B 1GOHA 1CS6A 2FWOA 3MV9D 2VLME 1GPOH 3REVB 1NFDF 5F1IB 1A1NA 2DQTH 5IB1A 2JCCA 3SJVE 1NAMA 3PE9A 4GW4A 5H35B 1FG2A 5CEYA 2WW8A 5IM7A 3DX8B 4YXLH 1OGAB 1S7SA 3OG4B 1SJEA 4KKNA 4QXUH 4OQTH 4UUJB 2MHAA 5T3ZE 2DLEA 1A1OB 5I19H 3ARQA 2J5LC 1U95A 3QCUL 3QEQA 5F8QC 3SGDH 3VGAB 3ZT5A 5DMKA 1OLLA 2DBLH 4PGBA 4EDWL 1OP9A 4LPTA 1S7QB 1Q1JL 4PJGF 2HG5A 3LPFA 1I7UA 2A0LD 3CLEH 1OGAD 1T0MB 5CMAB 4HW6A 1N7ML 1BEYL 5DJ0A 1L4IA 5D1XA 5L2JB 4TOYL 2J4WL 3KPNA 4JY5H 4N0CC 3O6FB 4XBEL 3H3BC 1NGYB 2YPKB 1H5BB 1OQXA 3BKCH 3PHQB 5AD0B 1SYVB 5GZOC 4FQPA 3WL9A 4PFEA 5C9JA 3B6SB 4RSVA 2CRZA 3O6LH 4XMKL 4MJ6A 3U4BL 4P2RB 5C70A 1AI1H 1EZVX 1WFUA 4ZODA 2IWGA 3HA0A 1CLZH 2FSEA 2CDGA 4X7CC 3X13B 3VJ6A 5DRWB 3O6FD 4MWFA 2H3NB 3VE0A 1JHKH 3LEYH 5EZOH 3T2OA 5FYKD 1MCBA 3RAJH 4XP6H 5EFIA 4YXKH 2DYPB 4QHNB 3GJEB 5I8OL 4TNVK 3OKOA 4P2RD 4YHIB 3BWAB 2HTLD 4FXGA 2X4PB 4Y5XB 2J88L 4MA3B 2L4OA 3A67H 1K2DA 2FECI 1KTKE 4I0KA 3VW3L 1KCUL 2OBGA 2GIYA 4K7PH 4F7MA 4LPVA 1CFNB 3S35L 2DYPD 3RRQA 5KSUA 2VE6A 1VA9A 3R06B 3SGKC 3V0WL 4I8DA 5EDXA 1IEBA 2NTSP 2EO9A 2YUZA 1Q9LA 5KSVB 3PGFL 2DDQL 1NCNA 3KPLA 5KS9A 4GRWH 1T2JA 2HFEB 4UI2A 2XA8L 4JGMA 2WWKO 3SGKA 2JKXA 5KTEL 3P0VH 2VQ1A 1NDMB 5D6DA 1NANH 3O6KH 3GNMH 4JKKA 3EZ8A 5IHBA 1ZS8B 2V2WB 3GSXA 1ETZA 1FCGA 3L5JA 3MJ9L 4YHKH 3ARWA 3IFNH 5E2TL 3S4SG 1MCOL 1R3KA 5E4EC 3HI5L 1YYLH 4PG9B 1NJ9A 4ACPA 4ODVH 2WIMA 4P46B 4Z7WA 1UACL 5FGCB 4UT6L 4ZFOL 4ODUB 4M6ML 3L3DB 4CUCA 1DBAH 2IMNA 5EN2A 4JRYB 3VXUE 3MRDA 1WCBA 5I18H 4HFWB 4HJJL 3MRJA 1RJLB 5CEZH 1R5IA 1GZPA 1V05A 2A6IA 2DLFL 4KAQH 4PGDB 1LDPL 3AS2A 1N2RA 1CFTB 3BEWB 1VADA 4OTXL 3C5JB 4IOIA 1VFAA 3K1KC 1D3CA 3CDGB 3QG6A 4KK9C 4LSQL 4P46D 5DEFA 5GHWL 3U4AA 5BS0B 3QFJE 1LDSA 1MIMH 5GRJL 1NLBH 2WMPA 4JRYD 2ESVB 4UQ3A 1CLCA 3MRHB 1KV3A 4X4ZA 1P84K 2VLLB 2KQMA 4YX2L 3ZLQC 4D3CH 1KLFA 5IBTH 1BMGA 2DLIA 3G6DL 2QR0B 3RWDA 3ULUF 5HVWA 4W6WB 4WHTB 5B8CA 2NX5B 5BS0D 1HQ4B 4OGAD 5EC2B 1U8IB 3RWJA 2ESVD 3TC9A 2X42A 4D2NA 4HHAB 1A3RH 3QJHA 1OGAE 4JQIH 5FECA 4C59B 1ZEAH 4JO4H 4QXGH 4J4PA 4P5KA 3DO7B 5I8EA 5ACMA 4LCIH 4F58L 1GGCL 4HIXL 3IJHB 4I3RL 2E7MA 4RDQF 1XF4A 2NX5D 1S5IH 5GGRA 3V0VA 1A3LL 1MREL 3PP4L 2YEZA 3VXOA 1KB9J 1CQKA 3ARGA 4Q0XH 2IPTL 3BMWA 3HUJF 5DMGC 1E4KC 4A6YA 3RVWC 4ODTH 4NQDE 2BCKB 3PWJA 2W65B 3UYRL 5A40E 2FEDD 4JY4A 4IRSA 2CGRH 4Z0BH 4GMTL 4HWEL 5HYSG 4N8VA 1N5AA 1XF2A 5CJ8A 4MDJA 1PQZB 5FUOL 3QCTL 3QUKA 1C16A 1MRDL 5DD5H 2HT4C 1KUMA 4JRXE 5ANME 3HPJB 5DRXA 1AO7E 5GGTA 2J2ZA 3NVQA 2FJHB 3ARDA 4X6DA 5EO9A 5K9JH 1CK0L 3IJYA 1QSZA 1YA5A 5TJWK 4H88L 5JOPD 1V7MH 3EJYD 5SX4I 1D5IL 1PJ9A 4LLDB 5T1MB 4WWID 4OZFB 4XP5H 2BVPA 1N6QL 2ZUYA 1MJ8L 4DAGH 4NGHL 4C57C 2XKUA 3HC3L 2P24A 3O8XB 3VXPA 1IQDA 4HT1L 1PX3A 3MJ7B 4HV8A 1LEIB 3QDJA 3I9GH 1FVCB 4OQ1A 5MHSD 4YHPB 3BESR 3BP4B 5C8JA 4UOW1 43CAB 1DBKH 3CX5K 3KPRB 1KJVA 4EOWL 5D2LF 3NCEB 1SBSH 3BKYL 1OVZA 3O8XD 1SQ2N 2XN9E 3TIDB 3QZWA 5HGAA 3PHSA 3B9KB 3ES6A 1DEEB 3MRGA 1UKTA 4Z7QF 1NKOA 1INQB 4HD9A 1LEKB 3KPRD 1RV6X 3ARYA 4RFOH 4G8IA 1G7JA 3EKCA 3OR6A 5CAYB 3EJZC 1KLUB 3BPOC 4ODBD 1JGLH 2I5YH 1CXHA 1TJIL 5IIEA 4ORGA 4TPRH 3DYMA 1GPOL 3B9KD 4LCCB 2RFXA 1JRHH 4V1DB 4FXLA 3N1GC 4WHYH 1R3LA 1TFHA 2P8MA 2V7HB 3CMOL 3IKKA 3SDXE 1TCRB 3TO2B 4ZPTA 1WIUA 4OQTL 2QQLH 2WANA 5HYJB 2ZJSH 3GHBH 3BAEL 3RHWK 3RL1B 5L6YL 3O0RL 3FTGB 4Z76B 1HSAB 2AJ3A 3BT2H 4GKSB 1E0OB 4MJIB 4M03A 2DBLL 2MFNA 4V1DD 4NKOA 5FIEA 3QDGA 2CMRL 1UGNA 4ZUVA 4KKLD 4L5FL 4DN4H 3VWKB 5HY9B 1OQOA 3FJTA 5HYJD 3RJDA 1RULH 3RTQC 4NO5A 1A7PH 2NY0B 4JZNB 2R56L 3FO1B 3GJFH 2ESVE 5IW1A 2E9IA 1W0VA 2RJMA 2R0LL 2D0FA 1A6ZA 3CSYA 5D2NA 3BKCL 4MJID 3GUTA 1FZOA 4HUKB 3W82A 3ULVL 3CXDH 1QFPA 1JGUH 3CMGA 3ZZ1A 1NC2B 2ICES 3EBAA 4NZRH 3IDXH 1XIWD 3QUYB 3O6LL 3VWKD 3ZYZA 4M93C 3S36L 1PG7X 3UTOA 5HHXH 2NX5E 4P9HC 3D3VA 4L29B 3QIWB 1CLZL 2NY0D 1XGQB 3RWHA 5BRZB 4LP5A 4KJQD 5ETUA 2X1PA 3RHWF 3LEYL 5JIKA 5E8PA 2QSCH 1OAXL 4XP6L 2GSGB 4HCRA 4ZUUB 4AG4H 1NC2D 3OJDB 4NOFA 1N3NA 2ZCHH 5GSRA 3VFPB 1YMMB 2BMKA 1F4HA 3QUYD 4OFYA 3IF1A 2ATKA 4AK1A 2JJUA 25C8H 3DSFH 3QIWD 1OP3K 2OX5A 2FX7H 4HIHA 2F58H 1MHEB 5BRZD 3B5TA 3A67L 3TBTB 1AQKH 1QRNB 2FECL 3LKRB 4GS7C 3SDAC 5C0FB 3L3KA 4Z0XA 3LKSA 1YY8B 1CDUA 3BGMB 1XF3B 1BREA 2OTWA 3VMNA 1CL7H 1YMMD 2BSTB 2R1YA 1FG9C 1HK6A 1OY3B 3BIKA 3C8KB 5JOPE 3SDAA 1QRND 2W1NA 1CT8A 4KC3B 5JORA 4MHHG 4W4NA 3FRUB 1X7QB 5I9QC 3NA4A 1NMBH 1GH7A 3QA3B 1QG3A 5MI0B 3P0VL 5MHSE 3ZE2E 5F7EL 3BOVA 2FWOB 3HC0A 4LFHG 5ABDE 4NCC1 1REIA 1A1NB 3HNVL 3O6KL 4J3SA 5IB1B 2JCCB 1NAMB 4GW4B 3U36A 1FG2B 1D9KA 4XPGH 5CEYB 2X40A 4YHKL 1TMCB 5IM7B 9CGTA 4KRPC 4D9QD 1WTGT 4NOBA 5KVGL 1S7SB 4POZD 4LLVA 3UJJL 1SJEB 4HBQA 5GGSA 2MHAB 2P48B 5HI4C 5HGHA 3BE1L 1U2HA 1JWMA 1U95B 3L9RA 1RAMA 1DBAL 3QEQB 5HD8C 5DMKB 2CKBL 4LSTL 2W0FA 3GRWA 4JREC 4PGBB 4NWTH 1BGXH 3LDBC 3MRPA 3C08L 2HG5B 1M7IA 5AEAA 1I7UB 4CMHB 3GIZH 1G7QA 1LO3H 2A83A 3HRPA 1HH6A 2L0DA 5DJ0B 5D1XB 4H20H 1OM3H 3KPNB 1MIML 3LIZH 3QEQD 1Q72H 2GEEA 3RVXD 3L1OH 3VGBA 3T2QA 3IS1X 2HLFC 3WL9B 2X9YA 5C9JB 1FNHA 1K8IA 3QWQB 4HULB 1T66C 2VOTA 4MJ6B 2EE6A 4D3CL 3MLWL 5IBTL 1X9QA 1AGFA 2FSEB 1TNNA 2CDGB 2DTSA 5D1XD 5AWNH 4V1DE 3VJ6B 3AGVA 3VRLF 5MEQA 1FLRL 1C1EL 4MWFB 3WIHA 3VE0B 4EJ1C 1T6VN 1WWBX 1EGJH 1JMZA 3FQXA 3O4OC 3MV01 5EFIB 1ZEAL 1KN4H 1Q38A 4JO4L 4M6OL 1KCKA 4GAGL 4QXGL 4H25A 1ZGLM 5JR1L 3OKOB 5EO1A 4JPKH 5IROA 1YEHL 4FXGB 2Q8BH 2ZZUT 4N0CD 3QEGH 1OAKH 1DQLH 2VUYA 3QO1A 3O2WL 1P1ZA 5AZEL 1MHHA 3T0BA 5GZOD 4L4VA 4F7MB 4Q0XL 4B0MM 1ZA3A 3O2DH 5CJXC 5FM4A 4WFHE 4ODTL 1G6VK 5KSUB 2VE6B 2YMXL 5GSVA 4OJFL 1IKFL 1IEBB 1HNGA 1IAKA 4QWWC 3HTLX 4PP2A 1Q9LB 2CGRL 4GSDL 4Z0BL 5F7DA 1N4XH 4GMSH 1LVEA 3KPLB 5KS9B 4ERSH 5KJRH 5J3HC 3SE4C 3RVUC 2DJSA 1MWAH 3K8MA 3GMLA 2OYPA 5EWIL 4A2LA 5BRZE 2VQ1B 5EH1A 4XC3H 4MXQC 5J4MA 5K9JL 4TRPH 1CXIA 2IGFH 1E4XH 4QHKJ 3SE4A 5IB4A 5BV7C 1O7SA 3ABZA 3KS0J 1EIBA 1R24A 2CUHA 3GSXB 1ETZB 4XP5L 3BYYA 1G6RH 2VDQL 1X5JA 1IAMA 1R3KB 3AFLA 3NPZB 1GOFA 1NJ9B 1WUNT 1GAFH 1VFOA 1QRNE 3LQAC 4HWNA 1ZK9A 3I9GL 4KTEH 2E6QA 5EN2B 4C55A 3MRDB 4LHUA 1WCBB 1Y0LA 3MRJB 1DBKL 1R5IB 1GZPB 2A6IB 1M4KA 4TUJA 4LU5H 4J3TA 1N2RB 3S37X 1XZ0A 1VADB 3C6LC 3DECA 4ZO6A 1QBMH 1IL1A 4IOIB 1JF6A 1VFAB 3QG6B 5DEFB 1D6VH 2KUTA 5DJAA 1LK3L 2B5IB 3ZTNH 1BBJA 2WIIA 2QV2A 1S5HA 4UQ3B 2LAGB 3HMXH 3BEVA 5IHLB 3TIEA 5TH2A 4RFOL 1TJGL 4ELKA 1ZHBA 2APWA 2J8UF 3KLHD 1N0XL 1CR9H 4ZDHA 2J12B 1CIDA 1NCAH 2CXGA 1C5CH 5B8CB 4TPRL 4LVOC 2FJGA 5JDJA 3RWJB 4X6EA 1JRHL 1J0HA 1A6WH 4X99A 3QJHB 1MFEL 4LASH 4QXTA 5FECB 2D7PA 3LD8C 4P5KB 2QQLL 1T80A 3GHBL 5I8EB 4D8PA 4KK9D 5DFVD 5J1AA 1UKQA 1HYSD 1XF4B 2P49B 4ETYA 2BNRE 3VFVA 5GGRB 3BX7C 3V0VB 1G9ML 3BT2L 4OCLC 2YEZB 1T20A 3VXOB 1HCVA 4FS0A 1KJ2A 3ARGB 3GSUA 4WCYH 3RBSA 2G60H 1OAQH 5BJTA 4A6YB 4J4PD 4C56A 1RULL 2EDKA 3RZCC 4FP8H 1A7PL 1TQCC 3PWJB 1TENA 4KQ3H 4FQ2H 4RMRA 1FZMA 2DQGH 5C07A 4JY4B 4IRSB 5F7NC 5JO5A 4I18C 4EEEA 4JO2L 4PGEA 3VD9A 3K8LA 4N8VB 1N5AB 2VXSH 4RISH 1XF2B 4JJ5A 4RGOH 4MDJB 1JGUL 3ARGD 4FNLH 1FGVL 1OB1A 3QUKB 1C16B 3QWRA 2YUVA 4O2EA 3IDXL 5EIQA 4CVZA 5DRXB 1GHFH 5DD6A 4LEXL 3FHAA 5ECJE 3ARDB 4X6DB 5EO9B 1JPSH 4X6CA 4HXAH 5FYKL 1KG0A 4IRSD 4IRZH 5SWZA 3BUYA 3IJYB 2LTQB 1KULA 4PJHA 3VXRE 4R4FH 4YHLH 4XP1L 5DMGD 2BVPB 2NY6B 5DWUH 3SE3A 1PAMA 1DBJH 1H15A 2P24B 4DGYL 3VXPB 1IQDB 3QXWA 3OHXA 3CDFA 3RQ3A 1B2WH 2VNCA 4HV8B 3ARDD 3L3GA 3QDJB 5D4QA 1FAIL 1AQKL 2QKIB 3B2VH 5C8JB 3GGWA 4M5YL 3OR7A 1MFDL 4XHJC 2PTTA 4BSWA 1B0GA 1J8HA 4WO4A 5GIRA 1KJVB 3GBNL 2HT4D 4JAMA 1CDIA 3DIFA 2NY6D 1CL7L 3BN9C 3UJIH 3MRNA 3SKJH 3QZWB 5HGAB 1D6EA 4XAWH 5KS9E 3QDJD 2CLZA 3HNTH 1BECA 3ES6B 3MRGB 5FM5M 35C8H 3LRHA 3UPAA 1RJZA 4LDOB 5L0QC 2ORBL 3I84A 5B38G 4PGCA 3WHE1 3FOLA 3D69A 2YUWA 1GOGA 5C08A 4G8IB 1G7JB 3OR6B 3IJSA 4O5LH 4OGZA 1FSKB 4YFLF 4QGYA 5IIEB 4ORGB 3U2SA 4FA8A 5HDBE 1ZAGA 4RGMC 2RFXB 1YECH 3CFIC 3BXNA 2Y5TA 4LGPB 4XPGL 3G5XA 4HWBA 1R3LB 2P8MB 2VDOL 3OAYH 4RBPH 4UTBH 4ZPTB 4Z7WE 5F6IB 5C3TA 4DZ8A 4LCWE 1UCTA 2DTMH 3EYUH 3ULVF 5I1AA 2AJ3B 2QSQA 4Z18A 4NKOB 5DZNA 2D0HA 2W38A 3QDGB 4BQCA 2C5DC 1KEGH 1DBBH 4ZUVB 4XBGA 4WTXA 2BVUA 5L8KB 4KDTC 2H2SC 2OTUA 1LO3L 1XGUA 5C2UB 3GSNH 3CFBA 4NO5B 4OZ4A 4H20L 4KRMB 5IW1B 1OM3L 1MCLA 1W0VB 1TQBB 2O5ZH 2H1PH 1A6ZB 2FNBA 3CSYB 5D2NB 4QTIH 3GUTB 1FZOB 3MV7A 3QDGD 3FONA 1NUDA 1ZXQA 3Q3GA 4LSVH 5ADOL 1EO8H 3D3VB 1I7TA 5AWNL 3OX8B 3RWHB 3C2AH 5ETUB 2J6EA 3ZT7A 2I9TA 5E8PB 5GS0D 5IW6A 3ARXA 2OXGA 1N3NB 5GSRB 3W39A 2BMKB 3JV5A 3IF1B 5DS8A 2ATKB 2UZXB 4MA8H 3D3VD 5E2WL 4HIHB 3QEGL 4GRWF 4OIIH 1UWXH 3L3KB 4Z0XB 3HR5A 3LKSB 4K94C 5E5RB 1ED3A 4XWOC 3GZKA 4CMMA 5C86A 2OTWB 5J6HA 1U6AH 2R1YB 4OFYD 4LSUH 4FQXC 1HINH 3BIKB 5FV2A 3F7VB 4GS7B 3SDAB 1MAKA 4IMKC 1CT8B 2DQEH 3D0VA 3WFDL 5JORB 5TFSL 1IGJA 5DVOA 4X7DC 2VLKA 1MWAL 1FVEA 5JPMA 1C8PA 3MOQA 1LNUA 4EQ3A 2OQJA 4X6DE 2WBWB 1BQHA 4JPVL 1X4ZA 5SWSA 4XC3L 4LBEA 4TRPL 3SDAD 4YAQA 2QHLA 3HC0B 2VSCA 1OWWA 1YJDH 3DUUA 3U36B 1D9KB 2W91A 1K4DA 2FJFA 5I9QB 3I6KA 1KCVH 2QEJA 4XCFL 4JZOA 2Y72A 1E28A 2F8XC 4LLVB 1NAKL 5GGSB 3L5IA 4XCYA 3U7WH 3QDJE 4FZ8H 5HGHB 1JWMB 3L9RB 4KTEL 2AJSH 4TQEL 4DW2H 1F2XK 3UJTH 4U6YA 3IDJA 2W0FB 4PLKC 2NY5H 3MRPB 4APQC 1D9KD 4AQ1B 4K7FA 1JNJA 1M7IB 1I1AC 4LU5L 5JW3L 1KCSH 4PJIF 5I1JH 1JHLL 1G7QB 3LHPL 5IHZA 4ONGL 2A83B 3ZDZE 3ZMRA 1R3HA 1HH6B 2CKNA 1U58A 2GKIA 1I1RA 3L5HA 1T89C 4JREB 3ZTNL 3RX7A 5F96H 5FO8A 5JXEC 3HMXL 4JM2C 3SO3C 2ICWJ 1OGTB 2GW5A 3N85H 5C1MB 1U8QA 1CGSH 1K8IB 2EDDA 2FATH 3MLRH 1CR9L 3B9EA 2QADC 1AGFB 4LMQE 6FABL 5HXMA 1QRKA 3HZKA 5D8JL 2DD8H 1ZLWH 5HD8D 1QLEL 5MEQB 2A77H 4N90D 3H42L 1JZ7A 2DAVA 3NCJH 1X5FA 2F19L 2FHFA 2N4IA 4RMTA 4XRCA 2UVFA 1BM3L 3IB4A 4M61A 3OSKA 3FQXB 4LASL 1IGIH 4YHOH 5FCSH 5FDWA 2V2TA 4YZFE 3VI3F 3ARBC 3LQZA 3I75A 5GJTL 4H25B 3DYPA 1CVSC 2BX5A 4FFYH 3BD5A 3TGXA 5EO1B 4DZBA 4LLUA 4MXVF 5L88H 4EDXA 3DSNA 2FGZA 5CS7A 4N1CA 4PJFE 2FDBP 3QO1B 3QDGE 1P1ZB 1MHHB 4JO3H 4L4VB 1MELA 2EDJA 3ARBA 2QTEA 4D9RD 4WCYL 1D5MA 3BDBA 1DUZA 2G60L 1S8DA 1ZA3B 1F6FB 1OAQL 2IPUK 3AXLA 5C2BL 2VDPH 1PG7H 5GSVB 4FP8L 1OPGH 4HKXA 2J7LA 1IAKB 3MFGB 4FQ2L 2DQGL 4PP2B 1NFDA 5F7DB 1WZ1H 1ZGLP 2HFGH 1CZ8H 2Z93B 4JN1H 4ZO9A 4RAUA 1UZ8A 4L4VD 4RGOL 2NR6D 2GSIA 4R6UA 2NY3B 2YR3A 3L3HA 5JOEA 3QG7L 3D3VE 2A73A 3L95A 3GMLB 2NY4B 4LVHC 1SMOA 5T5NF 2IBBA 3AMLA 4S1DC 4MQXD 3VMPA 1JPSL 1QTYT 4HXAL 1RFDH 1R3JA 3MRCA 5IB4B 4P2OA 3T0EC 1DR9A 1LMKA 3BWUC 2X4TA 4R4FL 4PJGA 4YHLL 1R24B 4Z7NF 2NY3D 5DWUL 5HHVH 1DBJL 2NY4D 1IGMH 4TSAH 4R2GC 2AJUL 3FO0H 4QWWD 4OCYH 4LSRL 3AB0C 1B2WL 4N0YH 3U46A 3TJEH 1CTNA 5BV7B 3T0EA 4YLQT 2DKSA 5DRNA 4LHUB 2E7HA 4WY7L 1Y0LB 4GLRI 1Z0MA 3UBXA 2B4CC 4NYLA 4TUJB 3HI6L 1XZ0B 3FCTA 3T8XA 4U7MA 3UJIL 5IFHL 3ALPA 4H1LG 4ZO7A 4EUPH 1IL1B 1N0LA 5DJAB 1KXTB 1VDGA 35C8L 4M7JL 3QIBA 1BBJB 2WIIB 1HSBA 4AH2A 1S5HB 3FQWA 3WUZA 2GK2A 4LHUD 3WS3A 3BEVB 3B9AA 5F44A 5JTWA 4XNXH 2EO1A 1CN4A 3TIEB 4UIMA 5TH2B 4MX7A 4ELKB 1ZHBB 2D7NA 3B2UC 2CSPA 2PYFA 3H9ZA 4ZDHB 1JPST 4O5LL 3S5LA 3O3UN 4L1HA 1JPTL 3OMZA 5IP4A 1EMTH 1UXWA 2FJGB 5EORH 3V7AG 1RZKH 3QH3A 5I1IL 2XZAH 4X6EB 5C0IA 1OCWH 1A47A 1YECL 4X99B 4Y2DA 4QXTB 2B1HL 1WK0A 4K9EC 4NBYB 4PRHA 3PWPA 1H3WM 2F5AH 3WFHA 2YOCA 4KZDH 4D8PB 2VDKL 3DUSA 5HGBA 5J1AB 4LVOB 4BFIA 2I26N 3VFVB 3EYUL 1HKLH 5CGYD 1JVKA 3RY6C 5INDA 4IMLA 3TBVA 1UXSA 3D0LA 1JZ8A 1T20B 4NCC2 1KJ2B 2ZKHH 1KEGL 3LD8B 1DBBL 3GSUB 2IBZY 1EFQA 5BJTB 1CDCA 2X7LA 2V5SA 5CBAA 4C56B 1LE9A 2B8OT 2ADFH 2H6PA 3C5ZC 2RAMA 1Y18A 5IJVA 4N90E 4XVJH 5TQ2L 4Z78A 1U3ZA 4L3EA 3FMGL 5C07B 2O5ZL 5JO5B 3RWFA 4PGEB 1M7DA 4QTIL 3MODH 4JJ5B 3T09A 2QQQA 3BGAA 4ODXA 1YQVL 1OB1B 4O2EB 1BJ1J 2G2RA 3BPCA 4CVZB 3MV8A 4UV4H 1TLKA 1FDLH 4ZPVB 3MLUH 4C56D 3TPUA 5DD6B 4WI6A 1CLOH 1I4FA 4I2XA 1NCTA 4X6CB 5C07D 1KG0B 1CGVA 5SWZB 4JQVC 3BUYB 4D9RE 1X4YA 4XH2A 4PJHB 1JZ5A 1HQRA 3IDIA 1D5XB 15C8H 1VENA 3QWRD 2WWMC 4HLJA 4HUVA 4NQEA 4KKCC 4NDMA 1H15B 1QFUL 4P48A 3BD3A 3O11A 5CIPA 3OHXB 3ULUC 3F6LA 3U48A 1ZA6A 3T3PF 1D5ZA 3L3GB 4OIIL 4YDJA 5EUOA 4PJAE 2E6JA 5SWZD 5HYQA 3GGWB 5I1HH 3OR7B 2PTTB 4BSWB 1B0GB 1YDPA 1J8HB 2FBOJ 1RSFA 1FLTX 4WO4B 5GIRB 4JAMB 2EE9A 3DIFB 1U6AL 2HJLA 3MRNB 4LSUL 4FZEH 2P44B 3MPCA 1HINL 5IEKA 3AUVA 3ZDXE 3G6JA 1D6EB 3QXVA 2E7LC 3V6OA 2CLZB 3QHTC 3KYMA 1RJZB 5DJ2A 2DQEL 3QI9C 4PGCB 5HGDA 3KR3L 2FBJH 1J8HD 2AK1H 3FOLB 7CGTA 3D69B 2IAMA 4J23A 4WO4D 4MA7H 5C08B 3BISA 4XHQA 2MOVA 4TYUA 3FRPG 5DMIH 1BBDH 1IILE 4NIKB 5JHDA 3U2SB 3TA3A 3BW9A 5T1LA 4KY1L 5L0QB 3QIUC 1EXUA 1PDKA 1TZGH 4HDIA 2WQRA 3E6FA 1N5YH 1INDH 3BXNB 2Y5TB 1ZHLA 2BZDA 3G5XB 3HUJA 3OL2A 4NC2B 2HAZA 4P5TA 3BN9D 5C08D 5FYLD 4AEHL 2ICWA 2VXUL 5EU6A 3S37H 1AY1H 4DZ8B 3U7WL 3K80A 1G0XA 3QIUA 4Z5RA 2EDEA 4RGMB 4DW2L 5I1AB 4IIQC 3ZKXC 1A5FL 3GI8H 5J9PA 4LF3A 4HLZG 1GIGL 2K7PA 1SM3H 4FOMA 4XVTH 2OTUB 4Q2ZA 2MCPL 1Y6NR 1XGUB 2GJ6A 3CFBB 4DOHB 1HHHA 4OZ4B 2HMID 4IIQA 2HRLA 5CJOH 1B88A 3VD3A 4HBCH 5HHMB 5DD1H 5F96L 3DV4A 3O41A 3MV7B 4UTAH 1MCCA 3N85L 1PGRB 4JFEA 3FFCA 1CWVA 3AY4C 1CGSL 2FATL 3FONB 3RY5A 2OCFD 3TZVA 4L3AA 3Q3GB 1IGFH 1X5YA 4YC2C 5FKPA 4DKEH 5K9QG 1DCLA 5IFJA 4QRTA 5ISZE 1I7TB 4K3JH 4MJ5A 4OBRA 3UPRA 1GJIA 2A77L 1IBGH 4JN2A 3P9WB 3NH7L 2R23A 2YPVH 5HHMD 5DK2A 2I9TB 3EOBA 1RU9H 3AY4A 4LSDA 4YHOL 3STBA 3MV7D 5D2LA 5IW6B 1CFQA 3W39B 1IT9L 4FFYL 1X5KA 5DS8B 3NPSC 4M6AA 4MDIA 4ORZC 2L7JA 3GK8H 4R90H 5FHBH 3WJJA 2Z92A 4JR9H 3VXSA 3FFDA 3CH1A 3HR5B 4JO3L 4FFZH 1ED3B 3OBAA 1MCDA 3AMKA 2NW3A 4CMMB 1UT9A 1PLGH 4OLXH 5J6HB 2EXWC 3KJ4C 2FEEI 5CHNA 1PG7L 1OPGL 3OB0H 1QYGL 5I1CH 5GRZA 2NQCA 1CDGA 2NZ9D 4KQ4H 3R0NA 1CZ8L 5EB9A 3D0VB 4JN1L 4XI5C 1IGJB 1ZHKA 2A38A 2VLKB 3FT4A 3FB7A 1FVEB 4Z7VE 4HS3A 5JPMB 3TBSA 4XNYH 4GKNA 4EKXA 1LNUB 4U2YA 1YUHA 2AQ2A 2OQJB 2WBJC 3U83A 4ZNCD 4X6CE 3E2HC 1CE6A 1BQHB 3QDMA 5SWSB 1VEOA 4KJWC 4GAYA 1EFXA 4LBEB 2DQCH 4YAQB 4PJHE 1LO0L 1RFDL 5DYOA 3L7FA 3FL7A 3NIDE 3DUUB 5TE4L 2C3GA 3HAEG 2BC4A 3D2UA 4OZHF 2BHZA 2VABA 4Q7DA 1K4DB 2FJFB 2VLKD 3I6KB 1WBYA 3N1MC 3I3BA 4JZOB 1E28B 3VD4A 5GGTL 4HPOL 2ZSWA 4TSAL 4XCYB 5KN5A 4OCYL 5DUPH 4WV1C 5SWSD 3TJEL 1J8HE 4JZJA 3IDJB 4JKPH 4U6YB 1I9JL 4AEEA 2Z0BA 1MF2L 5SX5H 4M1DH 4K7FB 4WIQA 1B6UA 4KZEL 1ZHNA 5D96C 5E8OA 4OI8A 3VGEA 5IHZB 1R3HB 4OF5A 3MLPA 1MRCH 1U58B 4QCIA 2AXJA 1CICA 5LAXA 4X7EC 4X4XA 3VI4F 1HILA 5C08E 5FO8B 2DM7A 5FYLE 4XNXL 3U0WH 1IGCL 1U8QB 4EN3A 3T3ME 4XNZC 1FL5A 3HZKB 5EORL 1I1CA 1RZKL 4PLKD 2XZAL 3SO3B 4OM0L 4LNVA 1OCWL 1T2XA 4LNRA 2XRAH 1FBIH 4XRCB 4EVNA 4ZNEA 4M61B 5FDWB 2V2TB 1ZLUK 2XWTA 3LQZB 3I75B 1T7YA 2OXHA 2FL5A 4KZDL 4KPHH 4LLUB 3BQUC 1CD9B 1MCPH 4N0UE 1RK1A 1QR4A 2XIDA 4ZFZA 3JWNC 5LCVL 1CXEA 3ARBB 3UYPA 2ZKHL 1ZT1A 1I3UA 2W9DL 1DUZB 1S8DB 2P46B 4DOHE 5KSBF 4YFDB 3AXLB 2EE3A 3SQOH 3R4DA 4WEBH 1PZUB 2ADIA 3O3DA 3ZE1E 4XVJL 4HKXB 1JNNH 4LRNL 5TQ0L 5HHME 1NFDB 4ALAH 4N8CH 3MV7E 1JZ4A 3ARPA 1QFWH 3VGDA 2XZZA 2BHUA 3CK0H 1UZ8B 4HC1A 4PJDF 4RAUB 2AABH 3ARBD 2ZCKL 2GSIB 1UH4A 2PYEA 2DF3A 3L3HB 4RAVA 2EC9T 1EHLH 3LMJL 3I02A 4UV4L 1IJ9A 4C4KT 5EZIH 2A73B 3L95B 3RJQB 4CRPA 4LLYA 4MD0A 1C5BL 1KIPA 5L9DL 5L2KA 3DGGA 4NNPL 3U30C 3V8CA 5GS0L 1R3JB 3MRCB 1MVFA 4U6TA 3NAAL 1JYWA 3K2UH 4P2OB 1DZBA 2X4TB 2X9XA 4PJGB 4OM1L 1F4AA 15C8L 3NGBC 4G6JH 1SJXA 3TVMC 4I0PC 2Z91A 4HXBL 4ZSOA 4F37F 5J11B 4LK4A 3U46B 1XGTB 2VN4A 3T0EB 5KOVC 1JJUA 4ELME 5I1HL 5DRNB 5D7JA 4P2OD 3QUZC 3UBXB 4NYLB 5JZ7C 4I0PA 2FIKA 5AG8A 5GS1A 3FCTB 4IHOB 3T8XB 4BSVA 4HUMB 3AB0B 2HTKC 4S1DD 3X3FL 3FHQA 1L6ZA 1GZQA 3THML 3GMNA 3T0ED 1RI8A 4N8PA 3QIBB 1WF5A 3QUZA 1AJ7H 4OCSH 4AH2B 1HSBB 3FQWB 3WS3B 3U1SH 2AK1L 3FN9A 2PTUA 4WUKH 2LFGA 4MA7L 4UIMB 4MX7B 3IFLH 3B4NA 4XX1G 2C1OA 2PYFB 5DMIL 5SWSE 3S5LB 1IQWL 1BBDL 4NUGL 2Z4QA 3QHZH 4P9MH 1UXWB 2CQVA 3QH3B 1TZGL 2V2XA 3QIBD 4UZGA 1CGWA 5C0IB 1N5YL 1INDL 3T65A 4AY0A 4Y2DB 1IC7H 4TTGA 1ADQA 1T22A 3OB8A 2XNAA 3S37L 1P7QA 4PRHB 4ZUTA 3PWPB 4OV5A 1JNLL 1AY1L 1OSPH 3WFHB 3DUSB 3UROR 1WSST 3QQ3A 4BFIB 3MJ9A 5INDB 4IMLB 5CEXA 4XX1E 5EIVA 3TBVB 1UXSB 3D0LB 3GI8L 1CGXA 1NEUA 3BYTA 2IQAA 4Y2DD 4CBPA 2GQHA 3B2UD 4PRPA 2JJTC 4B50A 2RR3A 5C0JA 2X7LB 4PRHD 5CBAB 3PWPD 1LE9B 2H6PB 4YEEA 1Y18B 5AG9A 5IJVB 1ITCA 4Z78B 3GRWL 5CJOL 2VUOA 1K6QH 4L3EB 3RWFB 4NZTH 4TUKH 1DL7H 1M7DB 2Y06H 5DD1L 4KKBC 4J3VA 4ODXB 2JJTA 2DLGA 1GGBH 4X9FA 2YD5A 3BPCB 2G2RB 1B4JH 3MV8B 5ADPH 3KYOB 5C0AA 4JHZA 3RNKA 4U1IA 2ZNXA 5D9SA 4DKEL 5J13B 2ZUXA 5AZ2L 3TPUB 2DQIH 4ZQKA 3U6RA 1I4FB 3BSZH 4K3JL 2C4FU 5F71A 4I2XB 1JBJA 3CDCA 4L3ED 1CFBA 3LZFH 1IBGL 4KV5E 3Q1SH 1I9EA 4POUB 4EI5C 1NBZA 3IDIB 4MHHI 4NRZA 4HPYH 4HUVB 3MV8D 4NQEB 1MHPH 3MCG1 3L7EA 4NDMB 1NMCC 2H32H 1MI5A 1U8NA 3HRZA 1DANT 3O11B 5CIPB 3SQBA 5F7WC 4U7SA 4R90L 1ZA6B 3WIHL 1D5ZB 5JHLL 4FABH 5E94A 4EI5A 4YDJB 5EUOB 5HYQB 1UM4L 4FFZL 1AD0A 1JTPA 1YDPB 5LKNA 5LXGL 4NHUA 5I71B 4R4BA 4DEPB 1PLGL 4OLXL 2DI9A 1L7TH 2J8UA 1T7WA 1OF2A 1M6OA 5DT1H 4NQED 4P57A 1IC5H 2HJLB 4RIRA 2XY1A 5IEKB 5I1CL 3RY4A 4KK5C 3G6JB 2ZP0T 4HAFA 4GBXC 4R3SA 3PDDA 1TETL 2ZSVA 4QHKI 4PJ7E 3KYMB 3BPLC 1QBAA 5DJ2B 1Q9OA 5HGDB 1LWRA 3MLYH 3WFCL 5EULV 3OJMB 2IAMB 3MLXH 3V5HA 4Y16A 1Q0XH 4DQOH 4R97C 2DQJH 1QFOA 2HT3D 3ULUD 4U6HA 4LLAA 2P5WE 3D25A 1BF8A 5DK0A 5JHDB 3OXSA 4HUWB 1RIHL 2DQCL 3TA3B 3BW9B 5T1LB 3P9MA 1HDMA 4JFPA 4PJGE 4HH9A 1MAMH 1EXUB 1PY9A 4HDIB 3E6FB 1CDHA 4R26H 3EOAA 1ZHLB 3HUJB 3LRGA 4DTGH 3D48R 2IAMD 2VZSA 4P5TB 2ICWB 3ZHLA 5EU6B 1U93A 3HMWH 3L3IA 3SN6N 2JELH 3T0EE 4UBDC 5JHDD 3QIUB 5I66A 1MCQA 2D9CA 2GTWA 3TA3D 5T1LD 5J9PB 1IGYA 4LF3B 4OGYH 4JQXC 4K2UH 4M1DL 4HUXA 3PXJA 2UV3A 5DUBA 2P5EA 4XTRD 3T1FA 4P5TD 2EZ0D 4Q2ZB 2LU4A 2YA2A 5EU6D 5BO1H 3WFBH 3L5XL 2GJ6B 5D71H 1RZJH 1HHHB 2EIBA 1MRCL 4IIQB 1T5WA 4PS4H 4U1JA 3QIUD 4XMPH 3GI9H 5HSFA 2BVOA 4JQXA 3UAJC 3UTPD 3F7RA 4LGSB 3VWJA 3DV4B 5BZWB 3O41B 3OAZK 3U0WL 5IF0A 4JFEB 4YHNA 1DQDH 3FFCB 4QHMA 3UZQA 4KI5D 3CVIH 3C09C 3TZVB 5TE6L 3MR9A 5FKPB 2GJ6D 3QUMA 4QRTB 4MAUH 5IFJB 1FORH 4MJ5B 3CLFH 3UPRB 4Y7MA 1L6XA 4PB0H 3JVGA 5HJ3A 4JN2B 3INUH 1O7VA 2R23B 1KTRL 5DK2B 3EOBB 1MEXH 4KMTH 5D2LB 4NP4L 4PRHE 4JFED 3FFCD 3MGAA 5I0DA 1CFQB 3BPNC 3TZVD 4Z9KB 1AE6H 5F7MC 4MDIB 3DO3A 4Z7UF 5GZNC 2XZCH 1WWCA 1O0VA 3VXSB 1F5WA 3FFDB 2AV1A 3CH1B 1LO4L 4XZUA 3TH4T 2YSSA 1MPAH 3MRKA 4LOUC 4OQTA 2NW3B 3NPSB 3O3BA 1QKZH 3SQOL 4WEBL 5CHNB 2UWEA 4HMCA 2ITDA 2NY2B 1IM3A 3G6AA 2BDNL 4N8CL 3VXSD 4PJBA 3ULVC 4EBQL 1QVOA 4AIZA 3CK0L 1ZHKB 2AABL 2AS5M 2KPNA 3FT4B 3KWWB 3FB7B 3KJ4B 4HS3B 1EHLL 1I1FA 3TBSB 2MMXA 5EZIL 5E2VH 3RVTC 4GKNB 12E8H 1MCNA 1NEZA 1YUHB 4Q9RL 4LHJB 2NY1C 2AJYL 1IC4L 4I2XE 3HZYA 1CE6B 1KCLA 3QDMB 2NY2D 4GAYB 1EFXB 1V3KA 4OAWA 1EJOH 5DYOB 3K2UL 2X70A 2BC4B 3D2UB 2VABB 3CSBA 2IFFL 2XY2A 1WBYB 1QNZH 2EXWD 4G6JL 3E3QC 4NUJA 2YRPA 1I9RH 4FFVD 4Q6IC 2ZSWB 5KN5B 5C0ND 3DRTA 1XGPA 3QDMD 3WBDA 2YN5A 1EFXD 1RUMH 4JCMA 3F7YA 4JZJB 4L4TA 3S98A 2IC2A 2NPLX 4YGAB 2DIAA 1NGQH 3D2UD 3MLVL 5GS3A 1YNKH 5J12B 3EOTH 3U9UA 3VGFA 3ULUE 4MQTB 4Q6IA 1ZHNB 1J11A 5E8OB 1KCRH 5ICYA 4OZGF 1SBBA 4X6FA 4JY6A 5CSZA 5EOTA 1GGIH 2BNUA 2P8PA 4KJWD 3V6OE 4JO1L 4HGKC 4QCIB 5F9WC 1CICB 1FC1A 2Q20A 3DETC 4X4XB 5EUKA 5LAXB 3TYFA 3IXAB 4OCSL 4ZXBC 3UBXI 1HILB 5E6IC 4PRIA 2NXZC 3RWIB 3U1SL 5E2UL 3BJ91 4NKIH 1L0QA 2RIKA 3BZFA 5DJYA 5D96B 1NCWL 4EN3B 5I1DA 3TP4A 5JIHA 5JHDE 1Z3GH 4K55A 1FL5B 2LAAA 2HWZH 4P9ML 5C0CA 1JP5A 1CICD 3WD5L 3HUJE 3WDHA 1FJ1A 1GXEA 3K4ZA 4LNRB 4X9GA 1QQDA 2Q87A 1PKQA 1UWEH 4XCNA 2EDQA 4EVNB 1IC7L 1AR1C 2HT2C 5EU6E 1RD6A 2XWTB 3H9YA 2AGJH 4EN3D 3FQRA 2FL5B 1OSPL 4XNZB 1IAII 5EG6C 1ZT4A 3UTPE 2RGSA 2BOCA 1RK1B 3UPCA 3W9DA 2YK1L 2EC8A 2A9MH 4HWBL 5BQ7A 3RA7H 4QRPA 4ZFZB 3OG6B 3MBEC 1CF8H 5DK3A 1CQYA 2FYYA 5ILTL 1DSFL 3NCCB 1ZT1B 4MZ2A 3V4VH 2GJ6E 5FUZH 2AK4A 3GSRA 4UT9H 4PTUA 2ADIB 1XAUA 3O3DB 1YEFL 5LBSH 1W0YT 5DO2C 5AYQA 1K6QL 4P49A 5DA0B 2HH0H 2VDRH 4NZTL 1OP5K 1GL4B 3MBEA 1AD9A 4TUKL 1DL7L 3IDNA 4JFEE 3OKEA 5FA3A 2DQHL 4XC1H 2PYEB 3SE8L 3X3GH 4RAVB 1RHHA 3I02B 4FHBD 5ADPL 4BK5A 1J18A 3H2WA 2IH1A 3RWCA 4LLYB 4MD0B 1VEMA 5TGBA 3P4LA 1KIPB 1MJJA 4B41A 5J1SC 5L2KB 1V3LA 3DGGB 4NN7C 3LZFL 4O2FA 1H0DA 4LP4A 3MA9H 5JNYA 1A3QA 2WUCH 2BP3A 1YEKH 4IDLA 4U1KA 5BMFH 4PJ5B 4PJIA 1DLHA 2VB5A 2PYED 4RFEA 2BY3A 3DMMC 5GRXG 4YR6A 4HPYL 1R3IH 1UCBL 1I7RA 1ACZA 2AP2A 2GJJA 3ARTA 2Z91B 3VXSE 4Z7QE 1YEGH 1BIHA 3NZ8A 4ZSOB 5L2KD 2J6EL 4FABL 3EYSH 1LO5A 3GIVA 3RVVC 5D7JB 3ZYOA 5HPMA 2XXCB 3NGBB 3QO0A 1L7TL 2R0KL 4I0PB 5T33H 2FIKB 1QLFA 5DT1L 5GS1B 4NKDA 4BSVB 3FO9A 4Y5VC 1V8HA 3SE9L 3U0TA 3CZJA 5DQJA 1WT5C 4Y5YC 1GZQB 2Z35B 5H94A 3GMMA 3GMNB 3QUZB 5DVMA 4S1RH 5D7JD 2WLZA 2CK0L 3M8OH 3MLXL 1FFNA 5FYJH 4Y5VA 4YGVA 4NJAL 4DQOL 4I0PD 4GG6F 1KB9K 3V5DA 2DQJL 2CH8A 2C1OB 5IMOA 3QDME 3VA6A 2AEIT 4PG2C 4AEIH 1S7RA 4OD3H 5TF1L 2Z4QB 3MZGB 3DJ9A 1X5GA 4X6BA 3RI5K 4XCCH 5KW9H 1MAML 2V2XB 1A0QL 3QUZD 5C09A 3SKUD 4Z8FH 3T65B 3MROA 5L8LB 3ZKNC 5HDQH 4DTGL 5HYIA 1T22B 3CU7A 5F7HA 1KC5H 2XNAB 1E27A 2QQKH 2HTKD 3HMWL 1P7QB 1QEWA 4ZUTB 3P40A 4R7NA 3P11H 4RMVA 3K4DA 3QQ3B 1YQ2A 5M95B 1MY7A 2B1AL 5DQ9A 5CEXB 2V9QA 3B8SA 1BWWA 3LN5A 1N8ZA 3BH8A 4K2UL 2ICWI 1RURH 2IQAB 2O5XH 5F7FA 4PRPB 1YC7A 3CC5A 1V7NL 1T1YA 4M62L 5BO1L 5C0JB 1P7QD 3WFBL 3QHFH 5D71L 2DBJA 3GI9L 4X7FC 3EO0A 4YQXH 2GY7B 5I1GH 4DKFL 1DQDL 3F62A 3CVIL 4PRPD 5I1EH 2R2EA 1WQVT 5C0AB 3RNKB 2NLJA 4U1IB 3M1BA 5D9SB 4Y89A 4FQQA 4KJYA 4MAUL 1FORL 5DHYA 4ZQKB 3U6RB 3CLFL 2WLYA 4OLUH 4PB0L 2AXHA 4ZNEE 1NBZB 4G3YH 4M00A 5F1NA 4NRZB 5INCA 5C0AD 4G6FB 1B3JA 3L7EB 1AE6L 1RUQH 1WGOA 1MI5B 1U8NB 1G9MC 2C9AA 3HRZB 1U0QA 4NQUA 3PWLA 1KFAL 5E94B 5LGHH 4EI5B 2FX9H 3DHJA 4KKBD 1MPAL 2BXYA 1AD0B 2Q76A 4NHUB 4KHTL 4NQVA 2J8UB 5F1IA 1NMCB 1F4WH 1FCCA 1OF2B 1M6OB 3MMEA 5IW3A 1OAUL 4G6FD 4P57B 4RIRB 1JWUA 3UP1A 4PLOB 1MI5D 4RRPG 5DGQA 5MENE 4DUXA 4R3SB 4KGJA 2XQYK 1AGDA 5HDOA 5T3XH 4GOSA 5I8CA 4EI5D 1Q9OB 3WNOA 3MRBA 4HMDA 1NQBA 3V5HB 4Y16B 3GJFA 1BVZA 1KXVC 12E8L 1H5BC 5L2KE 4U6HB 1KELL 2NYYD 3D25B 5C6PB 5DK0B 3OXSB 3BPLB 1EJOL 3P9MB 1HDMB 4JFPB 4HH9B 4HK0A 5ITFA 1XGRA 3EOAB 3ILQC 5HYFA 4D0DA 1QNZL 1I1YA 4Y16D 3KYAA 3ZTJG 4PD4J 1I9RL 1ZWIA 1U93B 1FIGH 4ZSOE 3L3IB 4MNQA 3HZVA 5I66B 4U7KA 1RUML 2GTWB 3EGSA 4XPTH 1IGYB 4N1HB 4DUWA 1NGQL 4HUXB 5DUBB 2P5EB 4P4RA 4M7ZB 4Y5XC 1A1MA 4OD1H 3T1FB 4UOJA 4XVUD 4I5BA 3VRLE 3GM8A 1GGIL 1T1XA 1T5WB 4U1JB 4PRDA 2BVOB 3GMQA 3QXTA 3PDOA 4ZUWA 3OAUL 3VWJB 1IKNC 4NN5C 3CH8A 3NMEA 5CP3H 2P5ED 5IF0B 3S88H 4YHNB 4QHMB 5D5MF 3BMVA 2MTPA 4WI9A 3MR9B 3OTTA 4MNGA 1F42A 3QUMB 2MPAH 2HWZL 1XCTA 3WHXA 3KPOA 4D9LH 4P9HH 1A7NH 1IKNA 5HJ3B 1A7OH 4FQJH 1RIVL 3VWJD 1X5XA 4W6YB 4GXVH 3C09B 4ODSH 2Y1VA 2VXTL 1BD2A 5GRUH 4O02L 1DP0A 3JBG7 1MQ8A 1T03H 1IAIL 5FGBA 4MLIA 2E9WA 4HFUH 4JFQA 3UAJD 2AV1B 3HB3C 3VFGH 4XZUB 3LSOA 1MJUL 2YSSB 3MRKB 4X5WA 2VRAA 4M6NH 4P46C 2QHRL 4U6XA 1JYNA 3HG1A 4UT9L 3O3BB 1UJTA 4JM4H 5MEOA 2UWEB 5EU3A 4GO6B 3SDXF 5LBSL 1BQLH 2ITDB 3VDCA 1IM3B 3IDMA 5E00A 3G6AB 2HH0L 4OCXL 2VDRL 4PJBB 1QVOB 2FGWH 3ORJA 4AIZB 4M4PA 3S34L 5C0AE 1CLYH 1IC1A 4XC1L 3X3GL 1I1FB 4OGAC 5H37G 1VERA 1NEZB 1F3DH 3KHOA 1E4WL 4PUBH 4C54A 3T2NH 5GZND 3K3QA 1BPVA 1B6DA 3HZYB 5BVJA 3W2DH 4H1LH 1FZKA 4OAWB 4WWKA 1T1WA 3MA9L 5D7SH 2VKXA 2X70B 2WUCL 1SYSA 5IQ9B 1IFHH 3Q0HA 5BMFL 1A7QH 1IGTA 2ATPA 5AYUL 1G0DA 1R3IL 4NUJB 2NY1B 3SCMC 3V4UH 5IGXL 5IB5A 2XQBL 3RKDC 1EGJA 3DRTB 1XGPB 1KB5H 2O5YH 3EYSL 2OR7A 3F7YB 4L4TB 4XPHL 4YE4L 3KGRA 2J8UE 3WLWC 1HQ4A 2IF7A 4JKLA 4BH8A 3U9UB 3SCMA 1FP5A 4OLVH 4Q6IB 3KJ6H 2NY1D 2UZIH 5ICYB 4LDLB 4X6FB 1HHKA 3LH2H 4JY6B 4OLZH 5CSZB 4YUEH 5EOTB 2BNUB 2P8PB 3IFOA 3VCLA 5J7CC 1DQTA 1N26A 5EUKB 2DN7A 3TYFB 3O2DA 2EDBA 4L4TD 4PRIB 3H6JA 2F53E 2O26U 3M8OL 3BZFB 5DJYB 5FYJL 3RUGF 5I1DB 1FO0H 3EFFA 4LIQH 3EJYC 2IJ0C 5F9WB 4GRWB 1W0WA 1BVLA 4KXZH 5C0CB 1MWAA 4XCCL 5KW9L 3D9AH 3WO4C 1RZ8A 1FJ1B 3TYGL 1P4LA 3WJLA 1QQDB 4PRID 1PKQB 4XCNB 5HDQL 4GRMA 5EZJA 3DPBA 2QQKL 3FQRB 2EDYA 2Y07L 3RGVB 1G9EA 3P11L 1RIUH 1ZT4B 5CJQH 2XTLA 3DETD 5KVDL 5C0CD 2BOCB 1G6RA 3IYLW 3W9DB 8FABA 2ZPKH 2P5EE 5BQ7B 1K8DA 4JVPA 4QRPB 5D72H 2FYYB 4CU6A 1RURL 4OD2A 3WIIH 3EYQC 1UC6A 3FT2A 1QR1A 2AK4B 1BFVH 3GSRB 3GO1H 4LSSH 5LG1A 4PTUB 2R8SH 4JFFA 3DTXA 2AI0H 4YH6A 4FQLH 4TVPL 3MBEB 1AD9B 4UB0H 4YQXL 4OZHA 5C0RH 3IDNB 4QRPD 4Y4KC 3OKEB 5FA3B 4GJTB 4UAOB 1MJ7H 2HT2D 3MJ7A 5FUCC 4MMXC 3CUPA 5IVNA 1RHHB 4XNUH 3B9KC 5I1EL 2AK4D 1PSKL 2IH1B 3SEPA 3RWCB 1MFBL 4HK3J 5D6CA 3ALXA 3HMXA 5TGBB 5CEZD 1MJJB 4HGMA 1TXKA 4Y4KA 4O2FB 4EIZC 1S7XA 3MBED 1H0DB 4JVWA 5JNYB 2OSLA 1KBGH 3DVIA 4DCQA 4OV6F 1GC1L 2XT1B 4G3YL 3BDXA 2I24N 4K23H 4U1KB 4RFEB 4PJIB 1DLHB 4YR6B 1H3TA 1MCIA 3PL6C 1I7RB 3D1MC 1RUQL 1UM6L 5DI8A 5DO2D 3WUWA 4NN7B 3NZ8B 4IS6A 1KENH 1TVDA 1KEMH 2JE8A 1LO5B 2FX9L 3GIVB 4OUUA 4NNXA 4XP9H 3GMPA 3IAPA 5HPMB 4Q97A 4FQHA 2BRRH 3QO0B 3PL6A 1G1CA 3SY0A 1QLFB 3OPZH 5KOMC 1U8MA 4NKDB 3FO9B 3JWOL 3U0TB 4YWGH 5DQJB 1DLFH 5H94B 3IU4L 3GMMB 1YNLH 4OCRH 5T3XL 4P59H 4DUVA 4ZS6D 4BJLA 1JYXA 2C3XA 2NY0C 5JOFA 4HLZH 1FFNB 4N0RA 4Y5VB 4YGVB 4WTZG 4JFXA 5DUMH 2VXVH 3V5DB 4KJQC 2YXMA 4CN6A 2R0ZH 5IMOB 3ULVE 1I3RA 3TT1H 1S7RB 5CFHA 2XKNA 1P53A 1P4IH 1BVKA 4X6BB 3RVVD 2LV4A 1RJCA 3QUYC 1B9ZA 5C09B 2OR9L 3MROB 1QACA 3QIWC 3ROLA 4OFVA 3BHBA 4TNWK 3PQYA 5KSBA 1KPUA 2IQ9H 1E27B 1JGVH 2B20A 1FIGL 1QEWB 4LAQH 4X5XA 4R7NB 1TJHL 3MLZL 2CPCA 5K9QI 1SJHA 4IOFD 4L4TE 2EEAA 4XPTL 5DQ9B 2MQ0A 3PV6A 4KVCH 2DI7A 3E3QE 1R5WA 4PJDA 1FZJA 3LN5B 5B39G 4UV7L 5C09D 1N8ZB 3BH8B 2X44D 4B53A 4L4JA 4OD1L 2CUMA 3CC5B 1IRAY 1U2CA 3SDDA 3TWCH 1KIQA 1T1YB 3UTTA 4MCYA 1NGPL 2P45B 3DWTA 2APFA 4XVSH 4PRIE 3EO0B 3QQ4A 3ZKND 4PLJC 4PBWD 2WINA 3DVGA 5ALCL 4N0FA 3SKMA 3KDMA 3S88L 1OD7A 3PUCA 5A3IC 2R2EB 2NLJB 3WDIA 3M1BB 1BZ9A 4GRWE 5CD3A 3PWNA 5C0CE 2FO1A 4FQQB 1EO7A 4KJYB 1QSEB 2MPAL 5DHYB 3OXRA 4ONFH 1A14H 2BSTA 4RQQA 1HNFA 5GISL 2ARJQ 1TVHB 5IB3A 5MI0C 3IFPA 1DUYA 5DR5H 3MLSH 5F1NB 4ODSL 1F3RB 4XAKE 3T0XA 4KKAC 5INCB 3BP6A 3JTSA 2AKRA 4IBLT 1T03L 3FAWA 4HFUL 5CZKA 2PN5A 4TULL 4BKLA 5FM8A 3GSVA 5EBGA 2FRGP 1H3GA 3PWLB 2W9LA 3TFKD 2OM5A 1J05A 3VFGL 1KN2L 1Q0YH 2UYLA 3C87A 2Q76B 3HAEH 4M6NL 4NQVB 2FH8A 1NL0H 2BJMH 1W72H 3MMEB 2Q6WA 4JM4L 3RVXC 1JWUB 3PDGA 2BSED 2G5BA 3PXHA 4AJ0A 5DTFA 4G6KL 3CZFA 1EEQA 4L9LA 4CMHC 3G04A 1AGDB 5I8CB 2FGWL 4I3SH 2BVYA 3MRBB 1X3DA 4JANA 4QEGA 3MOBH 3GSNA 1E6OH 4TSBL 5D1XC 3SGDI 4YFLI 5DD0L 3GJFB 2XWJA 4R0LC 3T2NL 5B22A 3ALWA 1KJMA 3W2DL 2DQDH 4X5LA 4UILH 3F5WA 4HC1L 1A6VH 3OKKA 4HK0B 5ITFB 1XGRB 4PJIE 3AREC 1DQMH 1IFHL 4KUZL 3DX6A 4D0DB 1I1YB 1FNSH 4R0LA 3LV3A 3V4UL 1ORQA 1ZWIB 5JQ6H 4MNQB 3HZVB 3CFDA 1MFNA 3BUTA 1G7PA 1BWMA 2RHEA 3EGSB 2W60A 3AREA 2Z31C 1INEL 4OT1H 2RB8A 3U9PH 1NBVH 4P4RB 4FQIH 1A1MB 4OLVL 2GY5A 3K2MC 4XWGH 4CGTA 1EEYA 4X98A 3KJ6L 3S3SA 3CDYA 2GT9A 4I5BB 3WNKA 1RZFL 5TDPB 3MRRB 3H7LA 3LH2L 4OLZL 4MNQD 4MXWL 1T1XB 4QLRA 2Z31A 4O2CA 4PRDB 3GMQB 4DJMA 3IU3A 3PDOB 5E7BA 3ILQD 4ZUWB 5A16A 3M17A 3G5VA 5ID0A 1KGCE 3NN8A 1F3JA 4MXVE 1IE5A 5JIPA 1FO0L 1QHPA 4QRRA 4Z95L 4OCWL 4MNGB 1UQSA 1RMFL 3F58H 1XCTB 3WHXB 3KPOB 5CP7A 1RUAH 3PGCA 3FN0H 4NN5B 5E5UB 5FF6A 4LPYA 4AEFA 3NIFF 5EOCH 4V2CB 3MNWA 1BD2B 5D6DC 4KGLA 4M02A 1WFTA 3O6MH 3C2SA 3W11C 3PV7A 1LO2H 3B9VA 4JFQB 4XXCC 5DXWA 3FZUD 5CJQL 5KSAC 1O5DT 4NQCB 2RCSH 3Q2CA 2Q1EA 3VG9B 1NCDH 2HKHL 2ZPKL 4MS8C 1ADQL 3LSOB 2IPUG 4WUUA 4XPAL 4X5WB 3WIIL 2OI9B 4F7PA 1NANI 2CUIA 4KTDH 1KT2A 4J12A 5BVPH 1DBMH 4X4MA 4U6XB 1BD2D 1F58H 3HG1B 3GO1L 2R8SL 4XXCA 2A1WH 2Z9TA 5KSAA 5MEOB 5EU3B 3Q5TA 2HKFH 2AI0L 1L7IH 3IDMB 5E00B 4FQLL 3T0DA 3N06B 3SOBL 5I73B 1G0YR 4Z7NE 3KLHC 4G6AC 5FFLA 1J8KA 2GAZA 4NKMA 4ZOBA 3O2VH 2OJZH 4Y1AA 3P4OA 4L8SA 4PIRF 4XNUL 2Q8AH 2B5IC 3HG1D 3HFMH 2VR4A 4HKZB 5BVJB 5SV3A 2C3HA 2VR9A 1FZKB 5KG9A 3HB3D 1VPOH 4AMKL 3VA2C 4O58H 1FFQA 4WWKB 1T1WB 1ZOXA 3MV9E 1KBGL 4N5ED 1SYSB 5DFVC 1HYSC 2ZUQB 3MUZ1 1X44A 3BD4A 5B8CC 1AHWC 2VL4A 4F33A 2BXZA 1IGTB 2ATPB 5EUOF 5IB5B 3DRQA 3MJ8A 1EHXA 3JUYA 3GKWH 1KENL 5IESH 3P0YL 2EKSA 3RKPA 5T5FL 4G9FA 4J4PC 4WWKD 3CVHH 4XP9L 3W81A 1AHWA 4KTYA 2BRRL 4BH8B 4YHYB 7FABH 3SCMB 4H0GA 4E5XA 3G6JF 2E27H 4PGZA 2CIKA 3OPZL 4XBPA 5HTSA 1A6AA 1UWGL 1G7LA 1HHKB 3VCLB 1FNEA 3IFOB 3ARGC 2H9GA 1NCBH 2PKDA 4XNQA 4QNPF 2VDMH 4Y4FC 1IEHA 3FQUA 3A6BL 2BVQA 2E6PA 4BQBA 3SCMD 3ARFC 3DLQR 5IB2A 4IRSC 4Z7UA 2R0ZL 3EFFB 3RKDD 4Z7OE 3MOAH 1W0WB 2EE2A 1BVLB 4Y4FA 1SVZA 4CN4A 1MWAB 4XMLL 3WLWD 1FNGA 1RZ8B 1P4LB 5KVEH 1X6LA 3QJFA 1T6WA 3ARFA 4GRMB 5FYKE 4OLYH 1L0XA 3ARDC 5EZJB 1YEIL 4MNQE 2UY7A 3WV0A 1JGVL 1EV2E 2AW2A 4LAQL 2LTQC 4UQ2A 3TN0C 4P2RE 5DLMH 1A7RH 5HHNA 1YEJH 2R29L 4KI5F 1VFUA 3WO4B 1I7ZA 4KK6D 2NY6C 1G6RB 5EIIA 8FABB 4KVCL 4LHQB 1K8DB 4U31A 3V52H 2BNQB 2HYMA 4OD2B 1DVFC 3FT2B 3WIFA 2A74A 1BQSA 3TWCL 1QR1B 4I77L 1ZLVK 3TN0A 4S2SA 4JFFB 3MLTA 3DTXB 3I6LD 1JI2A 1EAPA 4QOKA 3V9FA 4OZHB 3E8UH 2X4UA 1DVFA 5J1TC 2D03H 1S7WA 1S78D 3P4NA 3CUPB 4EUPA 2QKIA 4E9LA 3EYOA 4MNGE 1FH5H 3T3PE 2UUDK 3SDCA 3QPXL 4O00A 5L7XL 1CDYA 1G84A 4CDHA 2HRPH 4JFFD 3FB6A 5D6CB 1TCMA 1RZKC 4ONFL 1AGEA 3WSQH 4HG4J 4L9DA 4Y4KB 3ZDZF 1S7XB 5EA0H 1UA6H 2OSLB 4I3GA 1KPVA 5E56A 4DCQB 3EYQD 1FSKC 5CINH 5DR5L 3MLSL 2MWCA 1FRGH 3QUML 4OZGA 1BIIA 4P23A 3UDWC 5DI8B 1ZMYA 2YA0A 3WUWB 4IS6B 4J6RH 4JB9H 1F97A 4JPWL 4R8WL 3OKDA 4KROB 4DKAA 4Y4KD 1B4RA 4OUUB 4NNXB 1Q0YL 3GMPB 5F6IC 4FQHB 3STLA 2W07A 1X5ZA 4M8VA 3BZ4A 3PL6B 5ITBH 3MACH 2DQTL 3UDWA 4I9WD 1JRHI 3SY0B 1U8MB 2A6JA 2B4CH 1PY4A 4LL9A 4MA1C 4YXLL 5D7KD 4NFDA 1G7IA 3O9WA 2Q3ZA 4QXUL 5FGCE 2WV3A 4XGZA 5I19L 3BZDA 4JRYE 5JOFB 4PJFF 3B5HA 1E6OL 3PL6D 3QNYA 1N6VA 1TQBC 2XYCA 4JFXB 3V5KA 5HBBA 4FTVA 5D2NC 2OJEA 3VFTA 1I3RB 3F65A 3WS6A 2Y6SC 5GS0C 2XKNB 2DQDL 3CLEL 4WI8A 2M1KA 1BVKB 4UILL 1FQ9C 2A2QT 1A6VL 3VH8A 5BS0E 1DQML 4JRWA 3X17A 2Y36H 3ROLB 4JY5L 3C8DA 3BHBB 1W2KT 3PQYB 4U1GC 1MQKH 5EO0A 5KSBB 2CRMA 1KPUB 1CGUA 3GBLA 4X5XB 1UKSA 1SJHB 5M94B 2R69H 2VR5A 3BI9X 1AI1L 3DI2B 3PV6B 1R5WB 4OT1L 1FZJB 4PJDB 2P7TA 1MUJA 1T1ZA 3OX8A 3LKNA 5J57B 3FB8A 3PQYD 1JHKL 3SDDB 5EZOL 1KIQB 2JIXA 5BOZG 3TF7C 4QHLA 4PJ8A 1U3YA 3RAJL 3UTTB 1IZJA 4YXKL 4MCYB 1CD8A 5I30H 2JJSC 4JDTH 3QQ4B 4WHCA 2GITA 2WINB 3DVGB 4OF0A 1TPXB 4N0FB 3SKMB 4UOW0 1SHMA 1OARH 3KDMB 4U0RB 1P7KA 1Z9OA 5CLWA 2EDWA 3SDDD 5JLZA 5DQDH 4K7PL 1BZ9B 5CD3B 3PWNB 3UTTD 3F58L 3KYKH 5FO7A 4OKVA 5IFAH 5IBUB 2QBWA 2JJSA 1CL7I 1JPGA 1XMWA 3OXRB 5GGRY 3SBWC 1RUAL 4OZFG 2VAJA 4RQQB 5CCKH 4NHCH 2HVKA 5IB3B 3F7VA 5EOCL 3IFPB 1MFCH 1DUYB 3KYNA 4F3FA 5MP6H 3B9DA 2EECA 3I6LE 2YD2A 3BP6B 3P2TA 3JTSB 3O6ML 2AKRB 5SWQA 1LO2L 3HNSH 4AT6A 3SBWA 1D9KC 4BKLB 2GTZB 4HJGA 3CXHJ 3GSVB 1FV1B 4PLJD 1CE1H 1J05B 1NCDL 4P4KC 4DN3H 4NT6A 2UYLB 4YXHH 2CLVA 2HA1A 5A3ID 4KTDL 3I6GA 4CJ0A 4GG6A 5BVPL 3MQIA 4MJ4A 2L7UA 4ZAKA 1EVUA 1F90H 3GNML 4JFFE 4JCLA 2Q6WB 5E95B 2P43B 3VMOA 2BSSA 2G5BB 3RFZC 3IFNL 4OZHE 5DTFB 4P4KA 3CZFB 4L9LB 1YYLL 3G04B 2BOBA 1LE5A 3S3JA 4ODVL 4JANB 5I75B 3BGFB 3GSNB 4H26A 4KKAD 2N7AA 2Q8AL 3IKCA 3KPRE 4RGNC 4NM8H 5I18L 1CD1A 1II4E 2XWJB 5CEZL 1F6AA 4GW5A 4KAQL 1QSFA 1KJMB 5E08H 3OV6A 5JA9A 2BRQA 5FUCE 1VPOL 3F5WB 1EEZA 3OKKB 1X5AA 4ISVA 3TV3H 4XXDA 4G8FA 3BKJH 1U8KA 4I9WE 3RWEB 3QQ9D 3DX6B 5HVHB 1NLBL 3D39A 5DD3H 4R0LB 4F9LA 3LV3B 4OCNC 1ORQB 1U36A 2UZYB 3HN3A 1T7XA 1OGTA 4X0KA 3VI4E 5F6HI 2XWBA 3CFDB 1G7PB 1BF2A 2DWDA 2W60B 3AREB 1ZT7A 3O3AA 3WO3B 3OJ2C 3QULA 4KK8D 5IROC 3VXUA 4JHWH 5DC0A 5FAAA 3P4MA 1EEYB 4X98B 1P9MA 2ARJA 2GT9B 1A3RL 2D7OA 2J1KA 3ZKSD 4JQIL 5FK9A 1OTSC 5DJDA 5HYJE 1RPQA 2NR6C 1XF1A 1QBLH 2Z31B 5D7IF 4O2CB 2VDML 4LCIL 3ARED 3HE7C 3IU3B 3L6FA 3WKMH 5A16B 3QFJA 3M17B 3G5VB 3QNZA 5ID0B 3S4SA 5C92A 4MJIE 1S5IL 4WU7A 1QSVA 2V17H 3NN8B 1F3JB 4MQXC 4G9DA 4PJAF 1TZHA 1JFQH 1I3GH 1Z2KA 4QRRB 4WFGD 3FQNA 1UQSB 1LGVA 3S9DB 3HZMA 3MOAL 2NY3C 5CP7B 5I1LA 3HE7A 5F89A 2Z31D 3WYRA 2ZUUA 3PGCB 5JUEH 2NY4C 1EJ6A 5FF6B 1GYAA 5KVEL 3PQYE 3ZDXF 5KSBE 2EYSA 2WP3T 5LJYH 4IM8A 3EDEA 3MNWB 3PG2A 5HI5C 5EOQH 2Z93A 2ENYA 5F3BA 4QRRD 2ED7A 3K74B 4JKWA 4F57H 3QR2A 1SJVA 4Y8AA 5DLML 1A7RL 1YEJL 3MBXH 5DD5L 5E8NA 4PJDE 4P2QA 3N0PB 1LP9F 3VDAA 3QPQD 3VG0H 3V52L 1MCFA 4WUUB 4YHZH 4F7PB 1KT2B 3O81A 1E4XI 1NUGA 2IALA 3UTTE 4LPWA 1V7ML 3NABH 2YD1A 2EYRA 3HR6A 5KSAB 1YMME 1T4KA 4DAGL 3EDJA 4NQDA 4LARH 1JZ2A 1WVZA 3LKOA 4ZG1A 1UFUA 1ONQA 2OL3H 3GMOA 4XCEA 2GAZB 3E8UL 2D03L 4HS8H 4WUUD 4NKMB 1SVCP 5TDOA 2WUBH 4Y1AB 3P4OB 3C8HA 4L8SB 1FH5L 3QXUA 3W11D 1V3JA 1KLGA 5KSAD 5I1KH 2XZQH 4LQFH 3WXWH 4JRXA 2MNUA 5ANMA 3T2PA 1SBSL 4WFFD 1YC8A 4HEPG 5KG9B 3WSQL 4MS8D 1UJ3C 5C0GA 1AO7A 5EA0L 3DX7A 3KPMA 2WAHA 3TH2T 5CINL 4ZTOH 4OSUH 5GGVY 4Y1AD 3K8KA 4F33B 2IPKA 5CGYC 1EUTA 1FRGL 2XA3A 4D9QE 3P0GB 3DRQB 1DQQA 1MCHA 3MJ8B 3GBMH 2MKLC 4YDLB 4X7SH 1UJ3A 2ZUSA 4N1EA 4J6RL 5D70H 4JB9L 4G6AD 2EKSB 4G9FB 1JGLL 1P6AB 2I5YL 1AHWB 5D93B 2JCCE 5HYEA 1EAJA 3DI3B 5D5MA 5CKAA 3MACL 4E5XB 2CIKB 4XBPB 2PW2A 2P42B 1A6AB 1G7LB 3PIQA 3HKFA 1FNEB 2XN9A 2H9GB 2ZJSL 4XNQB 2X10A 1ND0A 4G9FD 3QEQE 3FQUB 1A9BA 2BVQB 5IVZA 2H41A 5IB2B 4PJCB 3PP3K 4Z7UB 3RWGA 5GGSY 5HHOA 6CGTA 2KDGA 4DN4L 5IWLA 4Y4FB 5IK3A 4NQSA 3PWUA 1BHGA 1KYOJ 2N56A 1FNGB 3CIQA 1T04A 3EYFB 4ZOAA 3QJFB 5DHVH 1F11A 1T21A 2Y36L 3ARFB 3DX9A 2EIEA 4LVEA 4M7LH 2APBA 4C4KO 3SDXA 1VKXA 3CXDL 4OI9A 4OF3A 4UQ2B 3OKNA 4NZRL 1JCKA 5HHNB 4C58B 2ENSA 1I7ZB 2R69L 4ZPVA 5HHXL 4Y4FD 5EIIB 3SE3C 1AGBA 4WENB 3ARFD 2R9HC 3WIFB 1S9XA 2A74B 5HHPA 3NIDF 1OP3H 3TN0B 4S2SB 2QSCL 4XNMA 1D5XA 4AG4L 3MLTB 4MMZC 5I30L 2ZCHL 4WO4C 4DK3A 2PXYA 5C3LD 1EAPB 2J4WH 2RBLA 4HH8A 4QOKB 5CSBA 1A4KA 1D5BA 25C8L 3DSFL 2FX7L 2X4UB 1DVFB 2AQ3A 2CO7B 4KRLB 1S7WB 3P4NB 2F58L 1PYWA 4HF5H 4EUPB 3RZWA 3DROA 3EYOB 4FN0A 4OFPA 4KDVA 3SDCB 3TN0D 2YWYA 3KYKL 5IFAL 3FB6B 2Z8RA 1ZVYA 1BLNA 1OAZH 1AGEB 4HIJA 2VL5A 1K85A 4AQOA 4QOKD 3QAZB 2AJXH 5CCKL 3K7UA 3RIFF 1KPVB 4NHCL 1DVFD 1MFCL 5MP6L 4F7CA 4MD5A 4OZGB 5I8OH 1BIIB 4P23B 1HZHH 3SDCD 5IR1A 3WNLA 3HNSL 4FG6C 1M1SA 1I8LC 3T3MF 1NMBL 5JIIA 3ARRA 3OKDB 4WUUE 4BUHA 4MNHA 2F9BT 2UWEF 1FGNH 4X4ME 2ZG2A 4YXHL 3STLB 3RUGA 2HMIC 3BZ4B 3IVKA 1QOKA 1F90L 1S3KH 3M07A 4PJBF 4U3XA 2A6JB 3ZTJH 4WFFE 4P23D 1I8LA 2VXQH 5E24E 1R6VA 1JK8A 4MZ3A 3WCYA 3B43A 1G7IB 3O9WB 4IRJC 1JV5A 4AYFA 3PGFH 1FVDA 4XGZB 2DDQH 4Y1AE 5DVNA 2ZWLT 2NXYC 3QNYB 4AIOA 4NM8L 3V5KB 4NWTL 1BGXL 1TTFA 4MA1B 4FTVB 2OJEB 4U6VH 3VFTB 5IMLA 4IRJA 2X1OA 5E7FA 3J8F7 3GIZL 3O9WD 4NFCA 1T2QH 3DVFA 3VH8B 3EDFA 2OMBA 5JDSA 3BKJL 4YBQD 5EBWA 1GRWA 3K81A 4HJ0D 2X1QA 3LIZL 1Q72L 1NUNB 5DD3L 5EO0B 3L1OL 3AS3A 1MVUB 3HI5H 4FQCH 4FTVD 1MFAH 5F7KC 2YPLA 5I2IA 4W6XB 1UACH 4G9FE 4UT6H 4UNTA 4M6MH 3NBNA 4JKMA 4P99A 2RQ8A 5A2IH 1RHFA 4ZO8A 5DJCA 4HJJH 2P7TB 1MUJB 1T1ZB 4RA3A 1WICA 4U1GB 3LKNB 2H32A 2R4SH 4JHWL 2DLFH 3DXAA 3QDHA 3UO1H 1H3UA 3FB8B 4YK4C 3WKNA 1VEPA 2NZ9C 1EGJL 4K3GA 2JIXB 4F8TA 4QHLB 4PJ8B 2Y6SD 1AC0A 4PJEF 3WMSA 1KN4L 4N8VG 1FFRA 4HGWB 5E9DA 3DNKA 5GHWH 1QBLL 1QLRA 4JPKL 3WKML 2YD3A 5TDNA 2Q8BL 3AM8A 2GITB 1BP3B 1AH1A 3TCLA 4M7KH 4Z7UE 1OAKL 1DQLL 2VMFA 1P7KB 2JJWA 4XT1C 4YX2H 5JLZB 1JFQL 1I3GL 4ZMAT 3CSGA 2JIXD 4PJ8D 5FO7B 4OKVB 4G7YH 3O2DL 1JPGB 4R9HA 3EO1A 3K0WA 3KXFA 5JUEL 3X12A 5KANI 2Q86A 2HVKB 2BFVH 3KYNB 4F3FB 3BRFA 1N4XL 4GMSL 4ERSL 5DVLA 5H37H 5KJRL 5SWQB 3MUGA 4F57L 4F58H 4I3RH 4AT6B 5B3JE 1T3FA 5H2BA 3RL2A 3IGAA 4I1NB 4HJGB 4XPBH 2Y9RT 5GGQH 1A3LH 4NT6B 5L8JB 1QPPA 4J3XA 3EJJX 1NMAH 2CLVB 3BVNA 5DURB 3I6GB 2IGFL 4GG6B 1E4XL 4ZAKB 3SHSA 3QZWG 3NABL 3UTQA 2QSVA 2BSSB 4QOKE 1G6RL 4K07A 4X9HA 3UYRH 4LARL 4P4KB 3OKLA 4Y4HA 4GMTH 1J87A 4HWEH 2BOBB 1LE5B 1GAFL 4HS8L 4YBLB 3MNVA 5FUOH 5DURD 2I07A 2Y5EA 3QCTH 1F4YH 4H26B 4ZAKD 1WZMA 3IKCB 1CD1B 4NRYA 3ZHDA 1F6AB 1SY6H 4GW5B 2XZQL 1QSFB 4LQFL 4DVBA 2DMBA 5E1HB 4TTDC 4NZUH 4P4KD 2X05A 1CK0H 1EDQA <