5J9PB

Kcsa in vitro
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab
publication title Combining in Vitro Folding with Cell Free Protein Synthesis for Membrane Protein Expression.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
total genus 48
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2016-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pB01
1NH6A 2H6PA 4P2CG 1V7NL 2JJUA 1QO3A 4WI3A 5IVZB 3FB7A 1S7SA 2E6JA 3CXHK 2R0LL 4B53A 3MREA 2VL5B 1VGEL 5AZEH 2IQ9L 4HWBL 1TVDA 2P24B 4OKVB 4CMHC 1QLEH 3HA0A 5E4EB 1JPGB 1HCFX 2BHYA 2FH6A 2P5WA 4JCMA 1K4DB 1T0MA 3QQ4A 4TUKL 5I1AA 3RWEA 1CT8B 2DI7A 1JFQH 2XN9A 2L7JA 4QCIB 2DIAA 1HINH 4MVBC 5EUKB 2YUVA 3RL1A 3W39B 5FGBC 3BP5A 4OLWL 3QG7H 4WFHD 1DL7H 4MAYC 4U31A 3ULSB 2F5BH 3UTQB 1YEJH 1S7RA 4PJCA 4A2LA 5T1LD 4ONGL 3RY6C 4ONFH 3K0WA 5FYJH 3FO1B 3S96A 2OZ4H 1QLFA 3V0AC 1J0YA 1IBGL 1I1RA 1T89A 5C0AD 4UAOC 3DXAA 3FQTA 1P4IH 3QISA 1QSFE 2HMID 4I4WB 3W0WD 4NC2B 3U0TA 3BDYH 5CBEA 1YNKH 2FYYA 3SGJA 3IS1X 4LCWB 1SJVA 3L3HB 2YS4A 2JCCE 1ACYL 1IL1A 1EHLL 3QFJD 5FYJD 3QRFM 2EYTB 5DTFA 2HVKA 5DRXB 3MRCA 1QPXA 1FNSH 2DM4A 5C0BA 3MV9B 1DLFH 2NY3C 4JPKL 4QHLA 4H1LG 4OCYH 1H3WM 1A1MA 3MLRH 3ZKXB 1LD9B 4S0SD 3Q1SL 4EQ2A 5F1SA 3WKNA 4UILH 1I1FB 4YGVB 4KDWA 2ZUSA 1L4IA 4LHQB 2EZ0D 3BD3A 3C5JA 1FNFA 1HNGA 4X6DA 3HR5B 2HP4A 3UYPA 1CICB 5HHXL 4M93B 1DANT 5M7QA 2P48B 3M1BB 5E2VH 3BZFB 2LFGA 5CGYD 1KB9K 2BVEA 4J3VA 1QFUL 4D8PA 1G7JA 4EXPX 3S4SB 4UZGA 2C3HA 4LCYB 3SJVB 3LH2L 1QRNB 1BFTA 1OY3B 2QKIA 3CSBA 2PW2A 5AWNL 2N7BA 2V5TA 5LGKA 3HZVA 5C6PB 1CIUA 5DMIL 1W0WB 3X11A 5D70H 5L0QC 2IBBA 2MPAL 1GC1C 4U7MA 4MD0B 1W2KT 3EO1B 4L4VE 3WO3B 5IW1A 4Z7WE 3LS4H 1XR9A 1RVFH 1G6RH 1EGJL 1NMCB 5D7LA 1IGMH 3ZKQD 1L0QA 2J6EL 1LVEA 2BSTB 2AKRA 1IAII 5JPMB 4HX1B 4XC1H 4YFLF 2W65A 1FL5A 3ILPB 1DQQA 2PTTB 4E41B 4M4PA 1S9WB 2W91A 1JGDA 3L95B 3KHOA 5H37G 4I18B 4X8JA 3TF7C 2HFFB 2DN7A 3MJGX 2A74B 4KFZC 1CBVL 4K7PL 4CVUA 4ZAKD 1F11A 2VH5H 4DN4H 4OFVA 1UT9A 2AQ3A 4DZBA 4KH2A 5SWQB 2G2RB 5IFHH 5IB5B 1KBGL 1QBMH 1ZE3C 1LK3H 3TO4C 3NFSH 4ZUUB 4FQQA 2J6EA 1YNTB 5DR5L 1D5MB 2ICES 1QG3A 2JB6B 3H9SA 3MNVA 3QUXD 3IXTA 4KUZL 5EG6C 4EOWH 1IGJA 4B50A 4L5FH 4FFZL 4PRNA 2GUOA 3LKRA 3PP4L 1S9YA 1B88A 1L6XA 4DN3H 5ACLA 3BH9B 1FP5A 3GSXA 2IH3B 4ERSL 2F74B 4K9EC 1N0XL 5IJKC 5E4EC 5DJAA 1P5VA 4WFED 4Y16C 3WEXA 3PWPE 1P4BH 2ADIA 1HHGB 4L29B 2VSCA 5JW4R 3QHFH 3V7MA 3G6JF 1LEKA 3S34H 1KYOK 2DQHL 1MVFA 5DHYB 4XBEL 3ARRA 5IHBA 1DUZB 2AJ3A 3LKSA 3QEQD 3SCMC 1U8MA 5HTSA 4HPOL 5LWYH 2F19H 3UTTA 5E8DH 3UTSB 4LASL 5TQ0L 1DQDL 1PLGL 4X7SH 1JTTA 3EYQC 4N0UB 4TSBH 1KN4L 5DC4B 2UUDK 5I66A 3S3PA 2EDDA 1M6OB 5FV1L 2YD8A 2CO6B 1CXIA 3D25A 1NMBH 1BJ1H 4CKVX 4R97B 4IDJL 5KN5A 1FRGH 2GSGB 1I9EA 4HD9A 3LKPB 3GHEL 1VADA 5DQJB 2UWEB 1TZIB 2WM0A 1DEDA 3HI5L 3FB6B 4JM2A 5D2LF 2BNQB 4W6XB 4GRMA 2HN7B 4PJEE 4N5UA 4YAQB 1MUJA 5ERWB 3HTLX 1T7ZA 5I1EH 5E4IA 3F62A 1KUMA 3MACL 5CBAA 2EO1A 2F8OA 2D0GA 4HEPG 4R90L 3TV3L 3CC5A 2ZPKH 3ECBB 2AGJL 4F3FB 3I6GB 4BFGA 3REVA 3KYAA 2KUTA 5GRZA 1VKXA 4Y5XC 3PQYB 3UP1A 4HC1L 1OPGL 2G9HB 5KSUA 3D69A 4XPTL 2R2HA 1CICC 1AKJB 2HVJA 3BQUB 2QR0A 4M93C 5KSVA 2BNRA 3V7AG 4X7CC 5BRZB 4GKZA 1B0RA 4IRJB 1BGXH 3G08B 3P77B 4FNLH 2JIXD 3IT8D 2PYFB 2C4FU 4Z8FH 2DMKA 3LV3B 1CU4H 2GY7B 4G9DB 2VXQL 4NP4H 1T2QL 4ZTOL 2FB4H 4FQCL 1Q38A 2VQUA 3T3ME 4G6FB 5AZ2H 2AJVL 1HZHH 3D2UD 2IFGA 3QXUA 5HHOB 5EZOL 5IMMA 2O61A 4YHKL 1UENA 1EPFA 3TA3A 3L6FA 4LAJH 5JXAL 1IGIL 4I3SL 1D9KB 5GGSA 5KANI 1A7PL 2XFXA 1IC7H 2R4RH 4L3CB 4KRLB 1CI5A 1FVEB 3ULVH 4LHJB 3CFJB 3CD4A 5DYOA 4PJDA 4BZ2H 3FFCE 3VI3E 1PG7X 1R3JA 3SGKA 5F1IB 1IEBA 2QQKH 5F7HA 1G9MC 4P3CL 1T1XB 3RPKA 4PGZA 3M07A 5EZJA 1Y6NR 3V2AR 1J10A 1IGTA 2Y4SA 2BOBB 4TTDD 3ULVD 1MCDA 5DFTA 2EC9T 3CZFA 2ARJQ 1RMFL 3RRQA 4Y4FC 1CDJA 1IVLA 2HG5B 1HKFA 2GJ6B 1F3JB 1T0NB 3EYOA 1MJ8L 1U8IA 4P9ML 1CF8H 4OV5B 4PBXA 4G7VH 2AEQL 3GRWH 4XNYL 2X10A 2X1QA 1T21A 4RWYH 4ODSH 3K8LA 4K7FB 1CL7L 4WO4A 5GRUH 1D5IL 2VIRA 4GRWF 2EYRA 2FIKB 5E8OB 1UXSB 3DSNA 3EFDH 4XX1E 5C1MB 1CG9B 1QSED 3HPJA 4LKCB 8FABA 1U8KB 1X5AA 3CSPA 1IAKA 3VGDA 1HH9A 2XWTA 4WFGE 2Y06H 2XWJB 3FQRA 1U58B 3KPRA 1R3IL 5JZ7C 4JDTH 5KVDL 5C0CE 5L7XL 2YD7A 4GW5B 1SY6H 4DZ8B 4WDIB 1CXKA 2CO7B 1MCFA 4LCUB 5I75C 1D5ZA 2C9AA 1NPUA 4QRQA 5H35B 1WZLA 3WSQH 5CZKA 2LABA 2ZCHH 4X4XB 1JHTB 5JDSB 2J3SA 4JFDD 5IM7B 3HZKB 5J3HD 4Z7NF 3AFLA 1EAPB 2NY4B 4QXTB 2BDNH 2P46B 4HJGB 4JKPL 3LEXB 4KKLD 3N9GH 3HKFA 1KIPA 3GMRA 1RK0B 4L9LA 3VFWA 4G6KL 4XT1C 2OK0H 5DJ8B 3CFKB 1U3ZA 2OI9B 1L0XA 1LNUA 3FQNB 1LHZA 5EO9A 2Z35A 4ZDHA 2DLFL 2VAJA 4PYGA 1FVDA 4R97C 3VD9A 5JMRA 1T1WA 2AK4A 4IRZH 4U6HB 5JORB 3HN3A 2YEZA 4F58H 5HYSB 5DMKA 4HUKB 4QRRA 4YWGL 4KK9C 1IC5L 5FYLE 2WIMA 4NZTL 2R0KL 3TYFB 5D71H 2I9LB 2A1WL 2K9UA 3MNWB 2UY7A 5DD5L 2VXSH 4HSQA 4JDZB 1L7IL 5GQBA 3V6OA 4WCYH 5E08H 4UV4L 5CIPA 3QWOA 2FJGA 4BFIB 2X9YA 4YHZH 4KVNH 4J3SA 3PHOA 4GLRH 4PRIA 2VISA 2V9RA 3ZE0E 2VQTA 1FFNB 1G1CA 4QTIL 3BQUC 5C0GA 5C0DA 1CFVL 4JFQB 5BJTA 1A1OA 5K33A 1JGUH 2FL5B 4IRJC 1FFQA 3GB7B 4A6YB 4P23A 3IFLL 4HFUH 2R56L 4PJGA 4DCQB 4LHUG 3GJFB 4PG2C 4R8WH 2GCYA 1U8JA 1BJ1J 4JGUA 2EIZA 1CK0H 4AQ1B 5CS7A 2FO1A 2W9LA 3CXDL 3B9KB 3NFPA 3DTXA 4PY7A 2P8MB 3QO0B 5JUEL 1YMMD 1RJCA 3TLRA 4IOFD 5GRWA 3BGMA 5SWSD 3HE6A 3KPSE 4AH2A 4FQXD 5A16A 4KRNA 3DGGB 1N6QL 2A83B 3B3IB 1W8OA 4HZLB 4ZFFB 1MFAL 2GAZB 2YRLA 3MA7B 5I8OH 1J7VR 4ONOA 4LNRB 1DR9A 3ZSSA 2GSIB 2XXMB 3PWVA 1EK3A 1UM5L 3U4EA 5MEQA 4L4VB 1EFXB 4MD4A 3HG1A 4P49A 4D9RE 2GITB 2DQTL 4EXKA 5C0RL 5E00B 1FNLA 25C8L 3VH8A 4LQ1A 4P2RE 1KACB 5EZLA 2P8PA 4WGWB 1NC2D 1EHXA 1ZLVK 5BOPA 5CJ8A 4XB7A 1VACA 5DVMA 3EJYC 5DD3H 1QPPA 3AY4A 4YBQD 3I50H 3WNMA 3I02A 2J8OA 1CGVA 1CXHA 2R9HC 4P2QA 3MRLA 4X7FC 1EXUA 3M45A 2NMSA 1ZLSH 4PPTA 3ARUA 4Z95L 4UQ3A 3GFUA 5L88H 4LLUB 3FZUC 4QHMB 4XNQA 1WLHA 1A02N 3OXSB 1MREL 1IT9H 2XA8L 4QY8A 5C0IB 1OD7A 2D9CA 1B6UA 3TBVA 5KS9E 3C60B 4DKDC 4JZOB 4W68A 4JVUA 1Y6KR 2I07B 2Z93B 3KPTA 1CE1L 4CADA 3RNQA 3NZ8A 5F44A 4GKOA 5ADPH 4G8GA 2HT4C 2W60B 7FABL 1X4YA 2GFBB 2IPTL 2NY4C 3L3IB 3ZDXF 1UEMA 4NKMB 4JZJB 1TQCC 2DWDA 3CU1A 1BFOA 3UPAA 4DVRH 1I1AB 2O26U 1R3KA 3OKEA 3MYJB 2VLKD 4M9OA 2E7MA 5CP7A 3VFGL 2R15A 3PWPB 1OAZL 2V2TB 1F97A 4RISH 3P40A 4YDLB 2OI9C 1AGEB 1MVUB 5L2JA 4Y88A 3PXJA 2NZ9C 1U8NB 3WXWH 5EC1A 3DX8A 1P6FA 5GGVL 1AHWA 3SDCD 5D8JH 5EIIB 2WUCH 1I7UB 3BAEH 5IESH 3MV7E 5IR1A 1B4JH 3K8MA 3QEUA 4K3JH 4BKLA 4NKOB 2QQLL 4U1MB 1KIQB 5DQDH 3IFPB 2XQBL 5GZND 1N0LA 4EIZC 3UPRA 5D6CB 3RBSA 4AENB 3PV6A 1RU9L 1WBXB 1T7VA 4XWGH 3ZHDA 1N4XL 4R0LB 4WW2B 2OJEA 4PJ7F 1NGYA 3PWNA 4JPVH 4PJEB 1AP2A 2VDQH 3A67H 5FDWB 4U4BA 4XPFH 4LU5L 1DUYB 3PJSA 4IS6B 4ZUWB 1M7DA 3QUZA 2KZ1B 4YX2H 2M1KA 2VQ1B 43C9A 2VLRB 4R96B 3CX2A 5I17A 5ICZA 4R26L 4ZFOB 2BSRA 3CH8A 4PGCB 3WKMH 3HCVB 1BIIB 4D0BB 3B9KC 1AFVH 1IKFL 1JYNA 1H3TA 2IAMB 4AEEA 2NXYC 1OWRM 1N8ZA 4N1HB 15C8H 3KYKH 1XAUA 1N64L 4RQQB 1IM9B 4G80A 5D5ME 4F33B 5BV7B 1XCQB 3BMWA 5IHUH 1DE4A 3V0WL 1JNJA 3QDMA 4AQOA 3MRIB 5DT1L 3RWGB 4RMSA 4Y4KA 3DI2B 1H5BA 4KKAD 5ECJE 2E5EA 4NT6A 4K3EH 1RV6X 2R1WB 4MXVE 3KLHD 3CGTA 5ITFA 3I3BA 3SKMB 1T2XA 1YQVL 3D9AL 4FQHA 5HVGB 1HSAB 3MLWL 2ICWA 1S78C 4PJ9B 1D6VL 1TMCB 3VRLF 3G5ZB 1HEZB 3WO4B 3JXAA 4LEXL 4LPCA 4X4YB 3T4AA 1VGKA 3DO7A 2Q1EA 3DROA 4OUUB 1WZ1L 1KJ2A 1OTTC 4CMMB 3FFCB 4MJIE 1MNUH 1A6WL 3MLPA 3OPZL 3QQ3A 3VXPB 2N4IA 2E7LA 2VC2H 3RWFB 2Y25A 3UTZB 3VGEA 1WWWX 3G6JA 1HWHB 5IK3B 2J7LA 4OFYA 1GZQA 3DX9B 1FC2D 1UGNA 4DFIA 3CPLB 2Y7QB 4JFXA 2W9EL 3L3OA 1AR1D 3LS5L 4U1KB 5FGSA 5EO0A 4M6MH 3S5LB 4JRXB 5FYKE 3BP4B 5IF0B 5CEXB 1HI6A 3GSUB 3CFDB 5HDQH 3U30B 4CNIA 3IJHB 4YBLC 1NCWL 2HFEA 1N59A 3ILQC 3ISWA 2HRPH 5D1ZB 2YR3A 2NY5C 3WUWB 2AJZA 2FBOJ 1E27A 1XGUB 5CFHA 3EOBB 3V9FA 5DMJB 4F7MA 3OTTA 3JTTA 3P11L 4JLRA 4CGTA 1DBJL 4ODVL 4EUPB 1SM3H 3MRGB 4KJWC 5ACMA 5GS0H 3HZMB 1EEQA 4AL8L 3EGSB 1I7RA 4LCIL 3HC4L 1I1AC 5D72H 2BVOB 4JFEE 2FGWH 4J4PD 3O0RL 4LKXA 5TGBA 5GS0D 1JZ5A 2CDEB 3O3DA 4NC0B 4O9HL 3CJJA 3NBNA 1P4LB 3CFEB 3BW9A 7CGTA 1ITCA 3P4NA 1T22A 3D85D 3LN5B 4N8VA 4P4KB 4WWKD 1E6OL 1ZTXH 3NACL 3JTSA 4GAGL 1KTDB 3MNZA 1FNHA 4W4OC 1YQ2A 3JWOC 1IKNA 3MGOA 1HSBA 4GQ9H 1LO2H 1SJXA 2D7MA 1IAOB 4UT7H 5SX5K 3UZVB 3ARBA 3MLYH 4S1DD 4K9EH 4R0LC 4JO1H 4WW2C 5F9WB 5A2JH 5CLWA 4L8DB 1KCKA 3QDJA 3X13B 4DKAA 4KXZI 3QHTC 3WE6B 1MY5A 3VXSA 1GGTA 1YY8B 1RIHL 1TTUA 1X5JA 4KMQA 2FJFB 3PIQB 2ZCLL 5HHME 5E9DD 3BIKB 1VCAA 4KKCD 1KLGB 2W1NA 3TPKA 3GM8A 2Y9RT 3B5GA 1QKZH 3MZGB 2E8YA 2P5EE 4YPJA 3CDFA 4NC1E 4JG0H 12E8L 3EYVA 1NCTA 4M61B 4M6OH 3MRBB 2IAMC 3VI4E 1EMTL 4MDIB 5JR1L 5I1IH 1GIGL 3BEWA 2BJML 4UOW0 1FFPB 1E4XI 1HQRB 4XWOC 5HI5C 3O9WA 1OL0A 4EVNA 3O6FB 3MV8B 4M1DH 1WBZB 3QJFA 5CSBA 5F96H 5CJQL 4HHAA 5HGHB 4LLQB 1YN7B 4ELME 5TF1H 5IFJB 4J3TA 1R3HA 3ZDYE 4TSAH 5CZXC 5FGCE 4IIQA 4CW1A 5IB1B 1F42A 2FO4A 3B2UC 1BX2B 4QT5B 3SGDI 3WO4C 3C9NB 5BVPL 4JHBA 4PS4H 5FAAA 2P42B 5BW7A 3T0VA 1PZ5A 1E6JH 3TNNB 1R24B 1V3MA 2BY1A 5HGBA 1CZ8L 2XG4A 3MRPB 4QTHA 4ZPTB 3VRIB 3OGCA 4QLRA 5MP6L 1JUFB 1A5FH 4NNPL 3OJDA 1IC4L 1MJ7H 2WK2A 3FB7B 4K94L 1S7SB 3RZCC 5JW3L 2YBRA 4OLUL 5T3ZH 3ZT5A 3IJYA 1GAFH 3VXRE 3H42L 3WXVL 3G5VB 4Y7MA 3KS0H 4KTYA 4MNHB 5KOMC 3U6RA 4FTVA 3MRFA 1Q8MA 3PGCA 4JY5L 3MOBH 1FFRA 1CICD 4Y5VC 4NJAL 1PEZA 4TNVF 1T0MB 5FKPB 5I1AB 5T3ZD 2H1PL 1S7WA 3SOBL 1NCAL 5DS8A 3U30C 3D39E 1RJYA 1NAML 1BBJB 5B3NA 5HVHB 1WZKA 5T33H 4JY6A 1JNHA 4APQD 2VDOL 3SDXA 3DUUA 3RL1B 1J18A 5D1ZC 3BP5B 2H9GA 4R7DA 4XPAH 5MERA 4HIJB 4G3YH 5IV2B 1S7RB 4PJCB 4OZHF 1JZ7A 1ZSDA 1W72B 1G9MH 5IHZA 1ADQA 5I0ZA 4BQBA 4D0DA 4OLZL 1A47A 3S96B 1OP9A 3PWLA 6FABL 2F53E 1X5FA 2BSSB 3EHBD 1YEGH 3DXAB 3FQTB 1HXMA 1CXEA 1ED3B 4X0KB 1I8IB 1ZA6A 3D3VE 4LF3A 4XMPH 1X4XA 1UWGH 2FYYB 3VD5A 4E41D 1WQVT 5IB2B 3BKYH 4OCXH 1CYGA 2LU7A 1IL1B 1J0JA 4YDJB 4P5MA 3OG4B 1NAMA 5DTFB 2HVKB 3MRCB 4DUVA 5C0BB 4QOKA 4OZGF 4QHLB 3FQUA 3RVUD 5LAXB 4I2XA 2RGSA 3E6HB 4HPYL 4YH6A 1P2CA 4OBRA 3SKJL 1JF1B 2X4OB 4AIXA 4EI5B 2VB5A 1SYVA 4MXQD 1I8KA 4HIHA 4XCFH 4PJ5A 1A64A 1ZEAL 4PB9H 1HYSD 2QHRL 1PG7L 1Q9OB 1JPSH 4LGPB 2NYYC 4D8PB 3DI3B 5F9WC 3G9VA 4F7EA 4NQEA 4P5TA 3QIBC 1ZS8A 4LSRH 2ZJSH 3CMGA 4PGEA 5AZEL 2QKIB 3IDGA 2PW2B 1QLEL 3OX8A 5E8EB 2I25N 1S7VA 3SDAA 3LOWA 4FABH 3VWJA 4YHIA 4KTEH 1Z2KA 3QEGH 3VW3H 1JFQL 2E27H 2V5SA 3DETD 3E0GA 1HINL 1IGYA 1CDHA 4LLDA 43CAA 2AKRB 3MMEA 4NKDA 2C1OA 3L7EB 4IJ3B 5C0JA 3C08H 3LPGA 1IAMA 3OKLA 1FL5B 3QG7L 1DL7L 2F5BL 3O6FC 3STLB 1YEJL 1LO5A 3C5ZB 1IRAY 3DWTA 3UO1H 4M8VA 5FV2A 1T83C 4ONFL 1AQDB 5FYJL 3T65B 1T7WA 1YN6A 2OZ4L 1OAQH 4JZNA 3DSFH 1P4IL 2OR9H 1BLNB 1PDKA 5E1HB 4D94A 4FZ8H 2WZPD 3BDYL 1YNKL 4R4NC 1FNAA 3MLVH 1T04B 1EUUA 1IILE 2ED8A 2BNQD 5BO1H 4KK9D 5T1LA 1S7TA 2EDHA 1FNSL 2YD6A 5ID0A 1DLFL 1NDMB 4OCYL 3H9SB 3MNVB 1AJ7H 4FN0A 1IC1A 3MLRL 3IXTB 4J3OC 4QRPE 4I9WE 2BNUB 4Z7QE 1IGJB 4TUJA 5I0DA 1RQ5A 2GUOB 4ZSOA 3LKRB 1HYRC 1S9YB 2VLJA 3PQYD 3GSXB 1UQSA 4ZOCA 3S6CA 3EJZD 4YHLH 1WWCA 2DD8H 5JIHA 2FJHA 1AKJD 3BQUD 5E2VL 4P59H 3O3BA 4F8TA 1U2CA 4IRJD 2IPKA 3MLTA 5F7YC 1NDGB 5IG7B 5HVHC 1Z9OA 4L8SA 1Z5LA 5DSCB 3LKSB 1UXWA 3MV11 1DSFH 3U9UA 2YN3A 5D70L 4G6FD 3GEWB 4XNMA 5ID1A 1D5BA 1HHIA 3LRHA 4PGDB 2EDXA 3KAAA 1HXYA 4ETQB 3LS4L 1D9KD 5D7JB 1RVFL 4Q6YA 1G6RL 2R29H 1IGML 4R7NA 1INDH 4GRLA 1NGWA 3SE3A 4DW2H 4XBPA 5I66B 1G7MA 4MQXD 4XC1L 5DJZB 5KN5B 3KDMB 1BVLA 4MXWH 1VADB 3VXNA 3KS0J 2X4PA 1G7LB 5JA8B 1OWWA 4GRMB 1CXFA 1MCWW 4PJ7A 2XQYK 4X4ZA 1T5XA 3UBXB 3QEHB 2BC4A 4JDVA 2Z8RA 2NZIA 4X7EC 5CBAB 3ULUD 2VH5L 4HXAH 2VR4A 5DO2D 3R8BB 1F00I 4DN4L 3T1WA 4RAUB 3AC0A 5IFHL 4DGVH 4JRYA 1VKXB 3AM8C 4EI5C 1QBML 5ICXA 2FR4B 1LK3L 1FL6B 3NFSL 5DJYB 3EJYD 5KSVB 2WBJA 2ZNXA 1KGCE 4YHOH 2VXTH 1B0RB 2NXZB 5D2NA 2EDFA 5E8PA 4EOWL 2NTFA 5EULV 5MENE 3K1DA 3MLSH 4RMQA 2YSSA 2Z31B 4L5FL 2R0ZL 5IUSA 3OJ2C 4DN3L 2OYPA 3DMMC 4X98B 3FZUD 4XAKE 3MFFB 5F72S 4WUUB 2X05A 2O61B 2C3GA 2A77H 1VB9A 3L6FB 5GIRB 3QH3A 1B0GB 1P4BL 4X5WA 5DRNA 5BQ7A 4RFOH 3QHFL 4ZNCD 2WWKT 1RFDH 5IOPB 4WVRA 1BFVH 3S34L 3WFBH 5J7CC 4G6AC 4PJDB 5LWYL 2F19L 1A2YA 1R3JB 2NY4D 5E8DL 4H25B 1IEBB 3ZKMD 4U1JB 3FCTA 5B4MC 3C5ZC 5F9JB 1OVZA 4X7SL 1FGNH 2P5EB 4TSBL 3GIVA 3EOTH 4OLYH 1BBDL 4FP8H 3CZFB 1NMBL 3VG9B 1KTKE 2NZ9D 4NOFA 1FRGL 4OFDA 1YPZF 4OUOA 4RMUA 4CJ0A 4M1CD 5I8CB 1VERA 1BJMA 3EYOB 3NCYS 2CIKA 1GH7A 1FLRH 3AU1A 4X4ME 1FSKC 4ESKA 2VZUA 4EN3B 4JPIB 1RIVH 3CVHB 2A73A 2NY6B 1Q1JH 4HCRA 5I1EL 3DARA 2XY1A 5E5UB 1T21B 4I8DA 3KXFE 4YC2B 2VIRB 3WDHA 2EYRB 5FGCB 3TPUA 2BVTA 1FZJB 2E9BA 2ZPKL 5D2LE 4A6YH 3HPJB 1CDBA 1UH2A 3GJFH 8FABB 4QEGA 1LO3H 1IAKB 1YC8A 1JWUB 5D7KE 1S5HA 3GSQB 4L3EA 3O8XA 4MX7A 3FQRB 3KPRB 1AGFA 4K8RH 1F3RB 1BGXL 3BHBA 5J1AB 4X9IA 1TVHB 3EO0B 4WIQA 5KG9B 2YD4A 3QWRA 1AQKH 4HIXH 4FNLL 4IBLT 5KVMC 3DURA 4U6YB 3FHAA 3HFMH 1Q9KB 4Z8FL 1KTLA 1J1XL 3MRKB 4TVPE 1CU4L 1MCEA 4NP4L 2FB4L 2XQYG 4K7PY 3VD3A 3G5YB 4NQSA 4K8RD 4KVCH 3B9KD 5AZ2L 1HZHL 2ZKHH 4L9DA 1SJHB 4LMQI 1P9MA 3O3AA 5KAQF 1HILA 2QSCH 3DNKA 4MJ6A 1KIPB 2XZAH 5D7JC 4L9LB 5IMOB 2ZSWA 1K4CB 4WI8A 1Q9WB 4HS8H 1HHHB 3D39B 1IC7L 2R4RL 1LNUB 1PGRB 2Z35B 4ZDHB 3WMSA 3ULVL 2BRQA 1FVDB 2CUHA 4PTTA 4BZ2L 4D3CH 3CDGA 1T1WB 2QQKL 2EECA 5ESVA 5IJVA 1I8LA 1EFXD 4L8BA 3V5DB 1QFPA 3CDCA 3BRDA 2F53B 3FB8A 4ODWA 5DA0B 4OZFH 1GCFA 2ZOLA 1E28A 1I4FA 3UPCA 5AG8A 2J8UE 5DK0A 1OTTD 5E6IB 4ORZC 5EO1B 5K9QG 3ZE1F 2FJGB 2XRAH 3IDYB 4WUKH 1OW0A 1CF8L 3C8KB 3PHOB 4PRIB 4LBEA 4G7VL 2VISB 3GRWL 4C56E 2VDKH 1FIGL 2W38A 5C0GB 5C0DB 4B5EA 1A1OB 4RWYL 3D48R 4ODSL 2NXZC 5GRUL 5IGXH 3QRGH 4P23B 2K7QA 3GBLA 3EFDL 3AREA 2AXFA 3DV6A 2NY5H 2Z31C 3G5XB 3HNTH 4Q6IB 2DLIA 4NBZB 3B8SA 2EH7H 2OTUA 2NLJB 4JFPB 2Y06L 1KXTB 3RZWA 4PRBA 4JDTL 4YZFE 3DTXB 4PY7B 2YD3A 3EDKA 1SY6L 3C60D 4Y2DC 3VA6A 2X70A 4M62H 2ZUTA 3HC0A 2DTMH 1WBYB 3HE6B 1QSEA 3FT4A 3HAEA 1I75A 3WSQL 3IF1B 3BWAA 2ZCHL 4IMKA 4Z7VF 5EU5A 3GRWA 4K3HA 4PP1C 4WTWA 5CEZE 5C86A 1TQBB 5GGSY 2BDNL 1A7RH 1JF5A 3SE9H 2WIIB 5H2BA 2E9JA 1ZWIA 3H7BA 3N9GL 3U4EB 2NX5D 4RRPG 5M94B 5MEQB 2OK0L 2VO5A 4NC1C 1CLYH 1SVZA 1ND0A 4EDXA 4UQ2A 3JWOH 2X41A 3QIWB 3RWJA 4Z7UE 4OF0A 3VH8B 1ZANH 4O51B 1YDPB 3B9AA 4IRZL 4NCC2 4F58L 1NJ9A 5L6YH 4Y19E 4P2YA 1VACB 4EN3C 1O5DT 2NY6C 5D71L 3T0AA 3OJVC 2VXSL 3O3EB 1LO4H 4NZRH 3ZT7A 3HMWH 2CDFA 5I9QC 3GMPB 4WCYL 5E08L 3MQIA 3UJIH 4HWZA 4M8QA 4XXCA 5DD1H 4YHZL 4KVNL 4UQ3B 1UWEH 4PREB 4NFCA 5I18H 3RTQC 3BH8A 1DQMH 1KFAH 2NY2B 3QWQB 4QY8B 1I8MA 5E7FA 1JGUL 4OD2A 1ZT4A 3TBVB 1F4HA 3O4OC 5C0FA 4HFUL 1TCRA 4CADB 2VLRD 4R8WL 5BV7H 4NUJA 5FA4B 3RNQB 3NZ8B 2HLAB 1CK0L 1BM3H 4JGJA 3PHQA 4NBYB 4H0HB 4HIEA 5B3JF 2IPUK 3LEYH 5DMGD 3SPVA 4OZGA 5C3LD 3UDWC 2DWDB 3A6BH 3QUYB 4PB0H 1F4YL 1R3KB 4V2BA 4LDEB 4U0RB 1GGBH 1IM9D 4OLVH 5ETUA 5DUPH 5IMLA 3GMMA 3RPIA 3TIEB 1NUFA 4NUGH 3MJ9A 5K59E 3GGWB 4NQDE 2PO6B 5ISZA 4HBQA 1PW3A 3VGHA 5I8OL 3QFDB 3GSNA 3TT1H 5CZXD 4PJ9D 2OR7A 1YMMA 3B2UD 3MRNA 4Q0XH 4UDTA 2PCPA 3H3KA 3RA7H 3QEUB 5M95B 3MO1A 1S3KH 2DMCA 2DQDH 1OHQA 4KK6D 4P3DB 1SEBA 3V6OC 5DJDA 1UKSA 4JFHE 3LN9A 3PV6B 5E6IC 2XA3A 3C2AH 3QPXH 3WDIA 2OJEB 1NGYB 1OD9A 1PY4A 3MXWL 4BSVA 5JHLH 4Q9QH 3F58H 3IETA 5ESAA 5DD3L 3DBXA 3I50L 3T2NH 3EBAA 1GZPA 5DK2B 1M7DB 4P23C 3PDOA 4C4KO 3PHSA 5I17B 1T4KA 4FMKA 1ZLSL 3ZYOA 3BN9D 3O11A 4Q6IC 3I6LE 5L88L 4JRXD 1ORSB 1JBJA 4YNYA 4DKEH 5JIPA 1NC2A 1X5HA 5IVNA 2CR3A 1RUPH 1TPXC 4EUPH 5I1LB 1IT9L 2I24N 5HDLA 4PY8J 3N85H 1QFWH 4D0CA 1ZA3A 5C0EB 4NPYA 5D1ZD 1SEQH 1PKQE 1S5IH 4QRUA 4MYWB 4HIIA 3HE6C 1DN2A 3QDMB 3HB3C 5MENB 4PP2A 2VAAA 1LGVA 1ZAGA 5ADPL 1H5BB 2GTZB 5DWUH 3T1FA 2LTQB 2HJLA 4HG4K 3G9AB 2C7UA 1TQBC 3VFRB 5JNYA 1CVSC 4G7YH 4FQHB 4U05A 1EO8H 5HGDB 1WTGT 1BQUA 4DVRL 5DEGA 4RGMB 1SMOA 3FO0H 1BQSA 3JWNC 4RISL 4DTGH 5IEHA 3S98A 3UTPD 4JCLA 4FQLH 3QIWC 3SBWC 3WXWL 3DO7B 2CLRB 3DROB 1KJ2B 3MJ8A 2WUCL 5I8EB 3QXVA 4G5ZH 4ENED 5I1JH 4GKNB 3BAEL 4P4KD 4C83B 1FHGA 1R5IB 5IESL 3QQ3B 2FSEA 3QZWG 1B4JL 3EYUH 3PGDA 4K3JL 4HQQH 2VLKA 5IQ7H 5CJOH 5DQDL 4W70A 4NGHH 4LNVA 4MAUH 3F8UB 5INCA 5FYLH 1OQXA 4JFXB 3L3OB 4NDMB 1KJMB 3H9ZA 4XWGL 5EO0B 4HK3N 4UBDC 4LRIA 2FHFA 3IDJA 3F12B 4CNIB 5HVWA 3LKNA 4JPVL 2NY2C 2VDQL 3A67L 3VMOA 1N59B 4XPFL 5FM5M 3BRGC 5EU6D 2IALB 1TJHH 5BS0D 4UB0H 4YX2L 4CVZA 1L9MA 4ALAH 1PSKH 2F58H 5D2LB 4F7MB 3OR7B 4JLRB 3WKML 1AFVL 4J8RB 1NCDH 1I7RB 3K4ZA 1FNGA 15C8L 3KYKL 3QUYC 4UINH 2VKWA 1OM3H 3X14B 5IHUL 3WHXA 1C7TA 3O6FD 3MV8D 3BPNB 4PGBA 5F3HB 1K3IA 3MJ6A 4Y4HD 1UZ6F 4K3EL 4UUJB 5TH2A 2PO6C 5C07E 1DVFD 3BW9B 3P4NB 2FEDD 4WHDA 3VXMB 4N8VB 4AJ0A 1Z9MA 4WTZG 3EKCA 3JTSB 1DBBH 1RUAH 3GSRB 3MNZB 4PG9A 1RZ7H 4M3KB 5FGBA 5J4MA 4RX4A 1Z6JT 5SV3A 1WFOA 2YPLA 1DDHB 4MAYA 1HSBB 5EIVA 1U95A 5HJ3A 1BIHA 1KIUA 1YEDA 2LAAA 3RY6A 3ARBB 5CEYB 5JXED 1B9ZA 1MNUL 4DOHE 3DIFA 4DAGH 1BZ7A 2K7PA 3QDJB 4WU7A 2VC2L 1F6AB 2Q7YA 2WW8A 5I19H 1IE5A 5JOFB 4ONHB 2X40A 1U8HA 3H3PH 1CFQB 3PP3K 3RUGE 4LSQH 1I3RA 4XBGB 3RY5A 3ARWA 4H0IA 5E95B 5IBTH 2P5WD 2QLVB 4M6ML 4YO0A 1OAYH 2J8UB 3KLDA 2R2EA 4KI5E 1ZGLA 5HDQL 2XN9D 1FCCA 3EYVB 2DIBA 4DK6A 5GGVY 1W72H 1IARB 2NNAA 5TJWK 5HPOA 3EIFA 1QNZH 2HRPL 4X7TA 3FHQA 1G84A 2VITA 3BDXA 4J1UA 1YPZA 3S3JA 1GGIH 4ZO8A 2CDGB 3VXOA 4XZUB 3GKWH 2A9NH 3SDDB 4HHAB 5JW4N 3ZDZE 1SM3L 4JHAH 4I13B 5GS0L 1R5VA 1IEAB 2FZ3A 2LTQC 4LVHB 2CLVA 3TC9A 3B9EA 1R3HB 2A6DA 5J06A 4IIQB 4NQCE 4X5XA 4CW1B 3K2MC 1D3CA 3DXAD 4RGMC 3RGVC 3W9EA 5D72L 1P7HL 4KGJA 1A6AA 2FDBP 1H3XA 1UADC 2J8HA 3GMOB 4MA8H 2FGWL 5C8JB 3UYOD 4KROB 4FFWD 3MOAH 4M7LH 1PZ5B 1CFBA 2Q8BH 3VFOA 1QD0A 4GT7A 1JPST 5HGBB 2APWA 5HYJA 2CK2A 2OJZL 3CUPB 3OGCB 5KSBA 5C0BD 2VNCA 1N7MH 2JCCF 4GG8B 3MGTB 5IWLC 5CUSH 1O0VA 2KKQA 1ZTXL 1LILA 3RX7A 2YBRB 4X6CE 4ZXBA 4NFBA 1G1YA 3IJYB 4LVEA 1UVQB 2FECL 4GQ9L 3U0PA 1LO2L 4EI5D 3PGFH 2YHGA 1S7XB 5A2LH 3PGCB 1CGUA 3HS0A 4MB3A 5ICYB 2ZUWA 2F8VA 3MLYL 4K9EL 3MLUH 4PRPE 4JO1L 5FM5O 4PV8A 3D85A 3VXUA 1S7WB 5DS8B 3AS2A 1RJYB 4Y19B 3S4SG 2YKLH 3WS6C 5J1TC 1JE6A 3MBXH 5EOCH 4LQFH 3GK8L 5AYUH 3DUUB 5L8LB 3GBMH 4V1DE 2H9GB 2LVCA 3TO4A 5TDPA 1QKZL 1C12B 4QXGH 3BKCH 5IVZA 5IHZB 4JG0L 4D0DB 4LIQH 5D7LD 4M6OL 1FJ1A 5I1IL 1LP9E 4EZMA 4Z7WF 2J5LB 5CAYB 3NFNA 4G6AD 2P24A 4OKVA 5I76A 1PD6A 3WUZA 1NCUA 4QF1A 5IJKA 1JPGA 4M1DL 2YN5A 4HKBB 3GDBA 3BPNC 5F96L 3C5ZD 2UVFA 3V6FB 3OKNB 1AGBB 4Y16A 2BNRE 1CT8A 1QQDB 3GJEB 5TF1L 4M7KH 4QCIA 4LOUD 3FQUB 1T7XA 1QR1A 3Q2CA 4I2XB 2E9WA 4RGNB 5K9QI 3SCMA 2PXYB 3W39A 4NRZA 4PS4L 4N8CH 3ULSA 1RJLB 3GMNA 3UTQA 1E6JL 2DQCH 5DZLA 4OF5A 3RI5K 1WCBB 5FO9A 3ARBC 3DRQA 1LO0H 2X2YA 3FO1A 3O81A 1A5FL 3H9SD 1MJ7L 4NQEB 3WHE1 5CJXC 5J6HB 5J1SC 5T3ZL 2AJSH 5HHQB 2CKBB 4GLRI 2J12B 1ZS8B 4I4WA 1GAFL 3ARZA 1G6VK 1CQKA 4Z7VA 2DLEA 5I16A 4LCWA 3L3HA 3OX8B 3MOBL 1S7VB 1GGYA 3OB0H 3VWJB 1CLZH 3MV9A 1LD9A 3MSPA 2FX9H 3P3YA 4LLDB 1XGPA 1I1FA 43CAB 5T33L 5FYKH 3BESR 2C1OB 4H8WC 2HA1A 1ONQB 3ZT6A 4Y5XA 1QEWB 3OKLB 4XPAL 5SWZA 5E5RB 3UTTD 4HGKC 4G3YL 2YUXA 5CZVH 3SDDC 5DVOA 2COQA 1MI5B 1G9ML 5D7JD 4BZYA 1VFAB 4LVHC 5CSZA 4DGIH 1IGCH 3EW3B 5FYKD 2ZOKA 1YN6B 3QNYA 3SJVA 3V4VH 1J1PL 1QRNA 3LY6A 1MCNA 1YEGL 4JZNB 3SQBA 2VLMD 4ACPA 3Q6GH 5ESQA 1A9EB 4OZHE 4AIZB 4XMPL 3BKYL 4KROC 4OCXL 2XKNA 4Y89A 3WLBA 4MD0A 3EO1A 3DVIA 3WHE0 3MLXH 1XR8B 3MBEB 3IDMB 4RWHA 3H0TB 2P43B 1W8NA 3ZZ1A 2BSTA 2B8OT 1U41A 3EO9H 2ZP0T 3PDDA 5JPMA 5JOPE 5K9OB 3RFZC 3BJ91 1IZKA 4TUJB 4TNWF 4U2ZA 4D2NA 3ILPA 4PJHE 2IGFH 1BHGA 1MAMH 2VLJB 4PJAE 2EDNA 4X83A 3L95A 4XCFL 1UQSB 3PV7A 1X5KA 3U7YH 2X4SB 5D9SB 4PB9L 2LU3A 3PWUB 1JPSL 4UDUB 2HFFA 2A74A 3MFGB 2EO9A 4KK5D 4MLSA 5L2KE 3QULB 4Y4FA 3GSOB 1IQDB 3FMGH 2Z31D 4LSRL 2ZJSL 3TIDA 5LGHH 5SWQA 1Z5LB 2G2RA 1UXWB 2E3VA 3ARFB 3G04B 4X9BA 4OLXH 5T5NF 5I30H 5EWIH 2XTJE 3U9UB 1CGXA 4GKSB 1ZVSA 2YD2A 5JHDE 4AM0B 1LMKA 4WUUD 4FABL 4XNMB 1D5BB 3TA3D 4KTEL 2P45B 3QEGL 2FATH 1D5MA 1HXYB 2E27L 2VL4A 3VU2A 3T3MF 2FEEL 3QXDB 3TVMA 3ZHLA 1V3JA 2HH0H 4GRLB 2XZQH 1NGWB 4KK8C 3QJHB 4PRHE 1G7MB 2J5LC 3C08L 4JY4B 4M1GH 3THMH 1BVLB 2IH3A 2F74A 2IFFH 4ZO9A 3NABH 3VXNB 1HQ4B 3C09B 3GJFK 5JMOC 2X4PB 5GGTH 2ZUQB 4N5EC 3UO1L 4XCEB 3BYTA 4PJ7B 3I3EA 5DVNA 1S8DA 3VI3F 3C6LC 3EUUA 4L29A 4JDVB 5FK9B 4HUNB 5HXMA 1JJUA 1OAQL 3CVHH 5SX4I 3DSFL 2OR9L 5DHYA 4E9LA 3ZYZA 1BPVA 4NJ9H 1DUZA 4OIAA 4FZ8L 2PXYC 1BQHB 5EOCJ 3LQMA 3O4LA 5GGRA 3UTSA 4JRYB 3MLVL 5FHAH 5BO1L 4I1NB 3WFHB 3QDHA 4EN3D 4YDIH 2WBJB 4LPWA 4MCYB 4AMKL 1J87A 1AJ7L 4WO4D 2R0WH 2IBGA 3IDXL 1RUQH 4MWFA 3KR3H 3LKPA 2NPLX 4J2XA 1TZIA 5H94B 3FB6A 3CFCH 4YHLL 2DD8L 3KPRD 4YAQA 4P59L 3VWJC 3W2DH 3RKDC 5DRNB 4DOHB 1CD1A 2N7AA 1RZKC 3I6GA 3BO8A 1DSFL 4KQ4H 3PQYA 2R23B 1A2YB 1MCQA 1UYWH 3BPLB 1YYMH 3BQUA 3FCTB 2LQRA 5BRZA 4OI9A 4IRJA 3MZTA 1MHHB 3G08A 1A4KA 2R29L 1LDSA 3S36H 1INDL 32C2B 4QO1A 3GIVB 4DW2L 1NEUA 4PG2A 4MNQA 3NCYP 4G9DA 2JJWA 3GUTA 5LBSH 4FXKA 4RNRA 3QG6B 5KSAB 4MXWL 1OOAA 5DURB 4KZDH 5HHOA 5C08A 2AK4D 3OKMA 5HYSG 3NIDE 4BSJA 4QRRD 3RVTD 3O2VH 3ARDB 4B41A 4Q9RH 3MBEC 5HPMB 2X7LB 2JJSC 5F1KC 1HH6A 5CP3H 4HXAL 2F53D 3OKDB 1IEHA 1FVEA 3TPUB 2GJZA 2ILLA 5D96B 4AK1A 5E6ID 2OP4H 5F1IA 4DGVL 5L8JB 3FN3A 4PRID 1S5HB 1T1XA 3BYYA 1I3GH 1GRWA 4MX7B 4BQ9A 4KI1A 2RJMA 5GS3A 4YHOL 2VXTL 4H1LB 2WP3T 3RWCA 1C7SA 3U9PH 2D7TH 3ZE0F 1QSVA 4P23D 5DVLA 3MLSL 2XXCB 3DURB 2HG5A 3L3KA 4QHKJ 4OBSA 3J7HA 4X6CB 4LL9A 2GJ6A 1JF6A 3D18A 1F3JA 4OGAD 1T0NA 4KRPB 3ARFC 3VFUA 4NQSB 2H3NA 5MHSD 1NFIB 5F1NA 2A77L 1U42A 4MJ6B 1JCKA 3CXHJ 3FN9A 4RFOL 2FIKA 1UXSA 3RQ3A 1RFDL 4YHMH 3VWKB 1BFVL 3HE6D 4ZOEA 3HB3D 2X9XA 2X5PA 3WFBL 4LKCA 1U8KA 3KPLB 4AZ8A 4PTTB 2C3XA 1FVCA 1CIDA 3MUZ1 3CDGB 2XWJA 5DC0A 1KV3A 3EDFA 1DEEA 4XTRC 3O6KH 4NN6B 5IJVB 4YQXH 1FGNL 4JGMA 1X6LA 5KZCD 4GUPB 3OJMB 4WDIA 4O02H 1VDGA 4L8BB 3HG1D 3EOTL 4LLYA 4OLYL 4FP8L 5ILTH 4YGAB 4JN1H 1NGZA 1BD2E 3QIWD 5F8QC 3X12B 3VFVB 5JDSA 1JHTA 2ZOLB 1I4FB 3HZKA 3V5HA 4XNUH 1EAPA 3IRZA 4QXTA 2GT9A 2YRZA 3QCVH 1FLRL 3LEXA 4YFDB 1MJUH 1N2RA 5TDOB 1RIVL 3MV01 4Y1AE 4F7CA 1Q1JL 3DECA 1C16B 5DJ8A 4GFTB 1RZGB 3CFKA 4MJ4A 3T2OA 3FQNA 4JQXC 4OZ4A 2BFVL 4OZFG 2AXFB 4HT1H 5BMFH 4P2QD 4A6YL 5TE4H 3F7YB 4ZS7H 1LO3L 4UBDD 4YPGB 4U6HA 2OTUB 5JORA 3DYPA 5A2IH 3L5JA 5K9KB 4MQSB 3QXTA 4K8RL 5T3XH 4LPVA 2I9LA 3V52H 5F7NC 1XF2B 4DWHA 2CH8A 3P0YH 4JDZA 4HIXL 1AQKL 3HRZB 1TVBB 5IB4A 3V6BR 3HFML 3FT4B 5KS9F 3HAEB 2OR8A 4HUVA 1FYTE 4LLAA 3BWAB 4G8GD 2A6JB 5I1DA 4KVCL 3L3JA 4UV7H 5T3XD 5TPWH 3U36B 2ZKHL 4DQOH 1N6UA 2BY2A 2PR4H 1FFNA 3H6JA 1AGCB 1KB9J 3HMXA 5H2BB 2QSCL 2FL5A 2XZAL 3GB7A 1PZUB 3QDGE 4DCQA 4HS8L 4KI5C 2X09A 4QGYA 1JRHH 1MRFH 4EDXB 4UQ2B 3DUHA 3RWJB 2PO6D 1J11A 3WNKA 2I60H 5KSAC 3B9KA 3QCTH 2JF1A 1AGDB 1UCBH 2CUIA 3CX5K 1NJ9B 2P8MA 1MFCH 2NR6C 4KRMB 1X5ZA 3CLEH 3T0BA 3IDNB 3ARDC 4EQ3A 3BP7B 3GKZA 5KW9H 2GI7A 4XMKH 4KJYA 3WBDA 1UM4H 2CDFB 3IKKA 5D96C 5F6HJ 1MHCB 4JVPA 4ZFFA 4L1HA 4HS6B 4Z5RB 4M8QB 4Z18A 3MA7A 3BISA 1OGAE 2XRAL 2YZ8A 4WUKL 4OZHB 4LNRA 5E1AA 1C5CH 5J56B 1T1ZA 4L4VA 1EFXA 3DGCR 4YDVA 2AP2A 4YHPA 3AGVA 4HJ0C 4OD2B 1ZT4B 1WV7T 1K8DB 5F7FA 5IGXL 3QRGL 1EIBA 4BUGA 3QUZD 4PR5B 1MWAA 4TYUA 2NY5L 3HNTL 3ARGB 4NUJB 4U1GB 5C09B 4KRPC 1VENA 1LE9B 3ALWA 3PHQB 4PJAB 2AERT 2X1WL 3UC0H 1RIUH 1OGTA 3SPVB 3LDBB 2JB5H 4JFFE 5GZOC 1Y6MR 5FO8B 4M62L 5ETUB 1PJ9A 2DTML 4OIBA 1OLZA 1E4JA 5KOVC 4GW1A 3RWHB 3VWKC 5IMLB 1MQ8A 4X99A 3QDMD 1BZQK 5MEND 4ZOBA 5D5MF 5ISZB 2HT3C 4Q2ZB 1A7RL 2DYPB 3SE9L 3O2DA 3AAZA 4XVSH 1LEGB 1KJ2H 3ARVA 4MXVF 4NN6C 3BGAA 3T3PE 4UDTB 2PCPB 2I07A 2Z93A 4G6JH 3MO1B 4W6WB 2X4RA 1CLYL 1CCZA 4QXUH 3JWOL 3LIZH 3DRTB 5DA4A 3S88H 2W60A 1ZANL 2QADB 5MEPA 1K2DA 2GFBA 3KNBB 3L3IA 5AG9A 4KWUA 5L6YL 4ZO6A 4NKMA 4U1IB 2RBLA 2Z4QA 1K8IB 1I1AA 4BSVB 4ZQKA 3MYJA 5DFWH 5B38A 5ESAB 3FO2A 3PWPA 1P69B 3DBXB 2V2TA 2EDRA 4OFYD 2NY1B 1AH1A 1LO4L 4NZRL 1MVUA 3HMWL 3RL2A 3UAJC 2EKSB 2EXWC 3CSGA 2MTPA 3KPMB 1U8NA 4HUUB 3UJIL 4QRTB 3K4DA 5EIIA 1EJ6A 5DD1L 1WAAE 1UWEL 1SYSA 4ZFOL 3S36X 4XPGH 5ABDE 5I18L 3H8NA 2GK2A 4HV8A 1DQML 1KFAL 3WV0A 4W4OA 4RMRA 4NKOA 5ACZA 4D0CB 4BZ1H 3IFPA 2DB8A 3WUWG 3AXLB 3NVQA 2O5YH 1YUHA 2XWBA 3ARSA 2B39A 1JTOA 1OB1A 2DJUA 3VDBA 5BV7L 4AENA 1WBXA 2VAAB 1D6EA 2Y36H 4R0LA 3TCXA 4K55A 2SEBA 2IBZX 4M43H 4WW2A 4XGZA 1BM3L 3T1FB 4EUPG 3EFFA 2HJLB 5F7KC 2VOTA 5JNYB 1W0VA 4TVPH 3LEYL 5D7KD 3SE4C 3L3GB 4LMQE 4NO3A 5EUOE 1NEZA 3A6BL 4PJEA 4PB0L 3VCLA 1NL0H 1P6AB 1GGBL 1RUKH 3MCG1 2WUBH 4IS6A 4OLVL 4MQTB 5DLMH 5DUPL 4ZUWA 2GK0B 3RDTA 5F7DA 1XIWB 2MCG1 3MRQA 4NUGL 5E5MA 4ZFOA 2XACC 1HHKB 4JJHA 3QI9B 1S7QA 4XVUC 4PGCA 4TVPD 1BIIA 2IANE 1JZ8A 1IAIH 4D0BA 3TT1L 2IAMA 5FCUH 3N0PB 1U0QA 4P57B 4WGVB 3QA3A 3VXMD 5BOZG 3U4BH 1G9NC 2DBJA 4Q0XL 3RA7L 3SDXE 4RQQA 4L1DA 4F33A 1BZ9B 2VLLA 2QHLA 1S3KL 4N0YL 4P9HC 1UKQA 4RFEA 3NA9H 1KXQE 3BSZH 2DQDL 3MRIA 2VZTA 5INCB 4XVJH 2MWCA 1YY9C 4KDTC 5E2WH 2KZWA 1A7BA 3ARBD 1YNLH 4XXCC 3C2AL 2P8LA 5EU7E 2BY3A 3HE7B 3QPXL 1HSAA 2RR3A 3S35H 2X4NA 5JHLL 3IDJB 3QDJD 4Q9QL 3QPQD 3F58L 3G5ZA 1HEZA 4H26B 3IGAA 2WWMC 3FN0H 1XMWA 1PVHA 4NHCH 4X4YA 5AAWA 4Z78B 5JO5A 3T2NL 1VEPA 2Y07H 3OGOE 5IW3A 1MLCB 3ZKND 4H8WH 3KPNB 4CVZB 4OUUA 3ARGC 2BOCB 4CMMA 2W07A 5HHVH 5A3IC 4U1GC 3FFCA 5FCSH 4DKEL 1J0KA 3RZCA 4GW4B 1RUPL 2YC1A 3QNZA 4FFVD 5GXBB 4MQ7B 4YDKH 3RWFA 3LVEA 3N85L 3LDBC 1L7TH 1QFWL 1FL3A 1WIOA 1FNGB 1JPFA 1SEQL 1S5IL 3CPLA 4LHUB 2Y7QA 3O9WD 4U7SA 5JIKA 4ISVB 4M7LT 1CFTB 4Z76A 4YUEH 4Y5VA 2FNBA 4PGBB 4U1KA 1UB5B 1UC6A 2PUQT 3S5LA 5C92A 3ESUF 5HD8C 5DWUL 5B22A 3CVIH 5IF0A 3GSUA 3CFDA 4M48H 3GHBH 3IJHA 4G7YL 4M7JH 5AD0B 3VA2C 5FO7B 1EO8L 3IRPX 1CN4A 1KJVA 3P0VH 2F54E 3ES6A 4ELMF 4F57H 2JK5B 4E0RB 3ETBF 3FO0L 4PG9B 2KH2B 3ZDYF 1OTUC 2YPLB 4M7ZB 4DTGL 4ETYA 4PUBH 5C0NC 3EOBA 5ITBH 1FAKT 1FZOA 2VABB 4FQLL 1IMHC 2QADC 3HZMA 4G5ZL 4HS3A 5I1JL 2BERA 1X9QA 2KL6A 1CE6B 2RCSH 4UAOB 3FAXA 4RZCA 4WU7B 3EYUL 1A6PA 5C0CA 4HQQL 5IQ7L 3CH1B 5CJOL 4NGHL 2B20A 2Z0BA 4MAUL 1AXIB 1K5NA 2ICWJ 5FYLL 1I3RB 3HPLA 4FTVD 1NANH 2CDEA 1RZJH 4GMSH 1P4LA 4YO0B 1QHPA 4P4RB 2NY3B 2R2EB 3LN5A 3B5TA 4ODBD 1OT1A 5FXCH 3OF6A 4FFYH 4OCWH 3MRRA 1KTDA 4WHYH 1IFHH 4Y19D 1ADQH 4OCSH 2D03H 2FRGP 4ELKB 2IQAB 4Y1AB 2VMFA 4WFHE 1TJHL 2VITB 2MQ3A 4N0FA 4UB0L 4BUHA 2GW5A 1YPZB 3WJLA 1IAOA 2VDMH 3FT3B 4WU5B 4XNZB 3RNKA 3WLWD 3X17A 3VXOB 4ALAL 1PSKL 1URLA 1NBQA 2EYSA 2WBWB 2W9DH 2G5RA 4LLMB 1NCDL 4HKXA 4KK8D 5C0AE 3X13A 3QIBA 5J6GB 3ARXA 3WE6A 1HN1A 4UINL 1A7OH 3JV4A 3W0WE 2QBWA 4QNPE 4ZSOE 5DJCA 5T5FH 1F2QA 2FJFA 1I9IH 3PIQA 1OM3L 2C4XA 3BIKA 5L0QB 1KLGA 1XIWC 3QFJE 5D7IE 5FYJE 3QI9C 4JFOB 4GOSA 5HYJB 2AVGA 1T66D 3WIHA 4M61A 4Z77A 1RHHA 3MRBA 3OB0K 4ODHH 3R1GH 2MNUA 2OM5A 3QCUH 5JQHC 1FFPA 1DBBL 1RUAL 4ZXBB 1HQRA 4RGND 1RZ7L 3H3BC 2OTWA 4F7PB 1J0ZA 2CKBH 3NAAH 3U0PB 1XGRB 5EOQH 1X5YA 3PL6B 3A6CH 1I7ZA 2C5DC 1MRDH 3HS0B 4PJ5D 4BFEA 4LLQA 1T83A 2H2SD 1YN7A 1EAJA 3HE7C 4LRIC 4DAGL 4KZEH 3VXUB 4FRWA 1RUMH 1KELH 4NQED 1BX2A 1NQBA 5I19L 3R4DA 3BPCA 2EKJA 4QT5A 1OP5H 3C9NA 2HRLA 3LQAC 1SHMA 3H3PL 1DBAH 2P7TB 4O2CB 4LSQL 1RZKH 3OAUH 1I9RH 1CDUA 1R24A 4Z7OE 5IBTL 4CJ1A 3MRPA 1OAYL 1HIMH 3VWJD 4ZPVA 4JHZA 1JUFA 4RFNB 1OGAB 3OXRA 2Q3ZA 5DHVB 5ANME 1W72L 4RA0C 2Z8VC 1FJ1B 1ZV5A 2B1AH 3KVQA 1QNZL 3G5VA 2BMKA 4MNHA 1UCTA 3NFNB 1GGIL 5I76B 3TH3T 4QF1B 3BGFC 2W0PA 3GKWL 2A9NL 1TTGA 4HMCA 2GTWB 5FKPA 4JHAL 4Y16B 1MI5D 3ARQA 4P2RA 1BBJA 4GJTB 1QR1B 2A2QT 3SCMB 1NBZB 4PY8I 4MA8L 4NRZB 3X3GH 4M7ZC 2NY0B 5SX5H 5DRWB 4M7LL 3DLQR 3MOAL 4HIJA 4ZO7A 3GMNB 5IV2A 2Q8BL 4JFYA 5FO9B 1W72A 4IHOB 3DRQB 4PLJC 1N7ML 3MBED 1M71B 5CUSL 3JZ7A 4MMXC 3MCLH 2BSSA 2BZDA 1ED3A 3GNMH 3HLAB 2X42A 2R1YB 4X0KA 5EORH 5KS9A 4WI9A 1I8IA 5IB2A 4Z7VB 5I16B 2WQRA 2VLJD 4Z7QF 3PGFL 4G42B 4YDJA 4ZG1A 4RA3A 5DVKA 3MTRA 4WFEE 1QRKA 5TF0A 2PYEE 3MLUL 5AAMA 5C7XH 1QTYT 4ZUSA 4ORGB 2EEAA 5BCAA 3NGBB 5LAXA 1MCLA 1WVZA 2YKLL 3E6HA 1CDIA 1XGPB 5J13B 1ZOXA 4LQFL 5EOCL 3QEQE 5AYUL 3ARFD 1JF1A 3AM8A 2X4OA 2OCFD 4GAYA 4Y5XB 3GBML 3RWIB 4EI5A 4QYOB 5D4QA 5IBUB 4XNZC 5SWZB 3VJ6B 1Q9OA 4QXGL 3BKCL 5IROC 4D9LH 4Q74A 2KQMA 4LIQL 5CSZB 5F7UA 2ZOKB 1I3VA 3QNYB 4GRLD 3MV7A 3VFMB 5ESQB 3RIFF 5HI4C 3C6SA 2Q76B 3DMMA 5E8EA 1NAKL 4R3SB 4NCDA 2XKNB 3S35X 3WLBB 3ZYIA 3UBXG 4M7KL 1T5WA 4OT1H 3T0EB 1EEYB 4OGZA 3QXAA 2CKNA 3L7EA 1I85C 4PIRF 1KENH 4ZXBC 5L8KB 2B2XH 4PJ8B 4N8CL 4YHNA 2OL3B 4JRYD 2EDJA 3STLA 4JQVC 2DQCL 3C5ZA 3PL6C 2X4UB 4CN6A 3OAYH 2EDLA 2P47B 5HYIA 2VR9A 5C6WH 1LO0L 2WBJD 2XOTA 1IM3A 1AQDA 1IGFH 3T65A 2CK0H 4FQIH 1NKOA 1BLNA 1NGXA 2AJSL 4Y4FB 5JW4M 2A9MH 4MDJA 2FX7H 3TIDB 4YXHH 1J9CT 5DXWA 5D5MA 1C5DA 3DOSA 3IJSA 4XRCB 2DQGH 4UIKH 1T04A 3QBTB 2AV1B 2VWEE 1ZVSB 4YR6B 4DJMA 1NC4B 1CLZL 5F70A 3F7VB 4KHTH 1NDMA 4RFNC 3TVMB 3BP6A 2FX9L 2BNUA 2BY0A 3NMEA 5FYKL 1L0YA 2VR5A 3DPBA 2LE9A 2VRAA 3T8XA 3NCJH 1FZMA 1W0YT 5CZVL 4R2GB 5ELIA 1S8DB 1J8HE 1WTLA 4DGIL 1IGCL 4KY1H 4N0CD 3ULVE 1WGOA 1NDGA 1P7KB 1MH5A 4NNYA 5I75B 1DCLA 1TJGH 3V4VL 5IG7A 4BSWA 1MHPH 1G9EA 2X1OA 3Q6GL 4PV9B 4HCRH 4WI5A 1GOHA 4S2SB 5DSCA 4U1NA 1H15B 2NY0C 3O4LB 5GGRB 1B4RA 5E94B 3L5IA 3BRFA 4PGDA 2NR6D 4ETQA 3MLXL 5D7JA 1QFOA 5C70A 1CS6A 4G8IA 4PGJA 3EO9L 5DQ9A 1NGQH 1ZLUK 1CBVH 1WCQA 4H1LH 5DJZA 4MWFB 4PLKD 3K8KA 3KDMA 2IGFL 1MAML 4CBPA 1KPVB 3DHJA 1G7LA 1JNLH 3U7YL 5EIQA 2C1PA 1GJIA 4L3ED 3O8XD 4MA3A 3UBXA 3QEHA 4HJ0D 4KKNA 4J6RH 1ZT1A 3RVVC 3NGBC 2Y23A 3QWRD 4KAQH 1CD1B 3FMGL 4RAUA 5J13C 5DGRA 5LGHL 1SBBA 4MJ2A 4JFDE 4M3JA 3BO8B 4JFEA 4OLXL 4KRPD 5I30L 4GSDH 3FRPG 5EWIL 2FR4A 3MXVH 1FL6A 1RJZA 1Y18A 5DJYA 3RKPA 4FMFA 2Q86A 2YPVH 4NRXB 1A4KB 2ARJB 2HH0L 2XZQL 5IB3A 3FFDA 2Z31A 3N50A 2QTEA 2R8SH 1H9VA 2BRRH 1A6ZB 4MNQB 1NSNH 2F5AH 2DDQH 3GUTB 4X98A 4FXKB 4RNRB 4M1GL 3THML 2IFFL 4FQ2H 3NABL 3HI6L 3MFFA 1U36A 4WUUA 5GGTL 5GRVK 5C08B 3OKMB 4C57C 2PTUA 5GIRA 3GSWB 4NN7B 1PLGH 3LRGA 1B0GA 4Y2DA 1G7PA 3T0EC 5IOPA 5MEOB 3CVHL 5H37H 4OB5H 2YPKB 3TNMB 5C0AB 4Y5YB 4NJ9L 1HH6B 2CMRH 5BZWB 2GJZB 4PJ8C 4H25A 3PG2A 4U1JA 5GSVA 5FHAL 1A3RH 3VG0H 5F9JA 2J8UF 3M8OH 1QBLH 1M05A 1V7MH 1ZT7A 4YDIL 3R8QA 4KJPC 2P5EA 1QA9B 3MRMA 3RWCB 3IU3A 3KHQA 4OI7A 2R0WL 4LSPH 3ARED 1RUQL 4R90H 3VXQA 1DLHA 3L3KB 5GGTA 3KR3L 2AV7B 3D18B 3SGEH 5I8CA 3TWCH 3HAEH 3VFUB 1F4XH 5DHXB 2H3NB 3CFCL 4EIGB 4JEGB 5F1NB 4EN3A 4JPIA 1YMME 3CVHA 1JN6B 4NNXB 4YEFA 3W2DL 4K94C 4ELMA 1HK6A 3IVKB 4LGRB 5SWSE 5KTEH 4YZFF 1X5GA 3TVMC 2BHUA 1FZJA 5EOTA 4KQ4L 1T2QH 3BKJH 1JWUA 1FVCB 1UYWL 1JP5A 3GSQA 3RTQA 4JN2B 3NPZB 1YYML 4HH8A 4R2GC 4YHKH 1DEEB 2MMXA 2UZIH 5J1AA 1U3HA 5EN2B 1TVHA 3S36L 3EO0A 5KG9A 3UJTH 1FQ9C 2PF6A 1G9NH 4LLYB 4U6YA 3WFCH 1DANU 1Q9KA 5ANMB 2QV2A 3MRKA 4XVUD 1NGZB 4P9HH 3V5KA 3K1KC 5KVGH 5LBSL 2A38A 3FRPA 3G5YA 3VXRA 2IMNA 1XF4B 3V5HB 4KZDL 1FG2A 3VH8G 2GT9B 1FORH 3E1F1 3LEVH 3OG6B 1SJHA 1TQCB 4UTBH 3UDWA 1OTSC 4Z7UF 2YD5A 3U83A 1N2RB 3O6MH 3O2VL 5IMOA 1K4CA 5HI3C 4F7CB 4Q9RL 1Q9WA 1HHHA 3D39A 1FFOB 5GGRY 4OZ4B 4ZAKB 1YY9D 4GG6E 2YRPA 1EDQA 2OP4L 1EV2E 2MQCA 3OBAA 3MUJA 4I3RH 1I3GL 3Q5OA 4XNYH 3SHSA 2WWMD 1QLRB 1MSPA 5HVFB 1JGVH 3LQZB 2HJKA 3U9PL 3V5DA 2D7TL 3EDJA 1FBIH 4W6YB 3LPWA 2F53A 5EBMA 5IB4B 2J88H 3NCFB 4JREB 4URTB 4HUVB 1UM6L 3ARGD 5E6IA 1FYHB 5EO1A 1QSFB 3NA4A 1ODAA 4ZTPH 5FDYA 5C09D 4KXZH 5I1DB 3C8KA 3L3JB 2OSLA 3MJ9H 3MR9B 4EDWH 2JCCB 4EI6B 2B4CH 3KPQA 2P49B 1AI1H 5CP3A 3GSNH 2PYEB 2D0HA 3PNWB 3TN0B 3CK0H 1CFNB 4YHML 1CTOA 1JI2A 4G8EA 3G5XA 1TDQA 4BH8B 4Q6IA 3J8F7 2MFNA 3IAGC 3QEQB 5ISZD 2NLJA 4JFPA 4JPWH 1RURH 2DYPD 5K59F 1E4XH 2NXYB 3O6KL 3GMQA 4TULH 4NN7C 3TBSB 3W9DB 4YQXL 1CWVA 2FD6H 3NCEB 1F2XK 3C2SA 3L3DB 4U1HB 3R0MA 4O02L 5D6DC 5GHWH 1WBYA 4LEOA 5ILTL 4JN1L 4PJFE 4KJYB 3IF1A 3X3FH 4Y5YC 4X80H 4LARH 1MFDH 3V4UH 2QADD 4XNUL 2KBGA 3QCVL 5E1AB 2WIIA 4IEFB 4JO3H 2Y1VA 3TYGH 3CAFA 1A1NB 5DDHB 1T1ZB 4YDVB 3NIFE 4YHPB 2BXYA 4Z7WB 5HYQA 1KCRH 2NY1D 5FUZH 3VGBA 1BF8A 2O5ZH 3SBWA 3QIWA 4HT1L 1MWAB 5BMFL 5JQ6H 5JXEA 5TE4L 4FXGB 2EZ0C 4O51A 4ZS7L 5GRVL 1N5AA 1YDPA 4AEFA 1TNMA 4G43B 3B83A 1OLLA 2JTDA 5IBLD 2ADFH 2V5RA 1WJ3A 3OQ3B 1MY7A 3CMOH 1OGTB 5T3XL 3HZYA 5CGYC 3V52L 3O3EA 3P0YL 3O41B 4CN4A 2QQNH 3GMPA 4GW1B 4L4TE 5CMAA 4X99B 5EFIB 3NH7H 5HGGS 2NY7H 3QQNA 1GSMA 2OX5A 5L9DH 4MJ5B 4PREA 4UV7L 5TPWL 4DQOL 2X6MA 2PR4L 4YBLB 3AAZB 4F9LC 1LQSR 2ADGB 1G7IA 5A40E 1JZ4A 3VXTA 3LMJH 4P3WA 1CTNA 4QRPA 2X4RB 1JRHL 1XIWD 4PJIE 4XI5D 1MRFL 2B7DT 1FH5H 2G5BA 5FA4A 2HLAA 4JJ5B 2I60L 4D9QE 2RIKA 3QCTL 5MEPB 1WEJH 5B8CB 1K2DB 4HAGA 4UT6H 1MFCL 3QUYA 2Z4QB 3CLEL 3E2HB 4ZQKB 1UM5H 5B38B 4FOMA 1J8HB 3GO1H 3FO2B 4H5SA 4K3DH 4NO5B 1Q9LA 4LVOB 4U6VH 4MZ2A 4LSDA 5KW9L 1RPQA 4XMKL 3TIEA 3LQAH 5FF6B 1UM4L 3VDAA 4ZAKC 1A6VH 3RL2B 1WICA 4WNQB 3GGWA 5C0RH 4TTGA 2PO6A 3BX7C 3Q0HA 3F5WB 3QFDA 4HGWB 4JG1H 2XY2A 3HE7D 1SYSB 4FS0A 1C5CL 4MS8C 4PTUB 3TZVB 4NOBA 2ED9A 4HV8B 3MLZH 1AY1H 2BVQB 3IAQA 4F9PC 5ACZB 1MF2H 5GRYA 4LCCA 1H0DA 4QWWD 4NCC1 3BVNA 4P3DA 1YUHB 2XWBB 4OAWA 2VN4A 3V4PH 4JREC 1OB1B 4KKBD 1YEIH 1D6EB 2AXGB 1P84K 2SEBB 4XGZB 1MHEB 3AS1A 2CQVA 2EC9U 3EFFB 1UZ8A 3UC0L 1MJJA 1W0VB 4BYHA 1RIUL 4NO3B 2ITDB 1NEZB 1Q0XH 2JB5L 5GPRA 1ORQB 2R39A 3VCLB 3TN0C 5F1OB 5DK2A 1QVOB 1TNNA 3RDTB 5F7DB 2DQIL 4DEPB 3MRQB 3EOAA 5E5MB 1S7QB 3UBXI 3KWWB 1ORSA 3QUKB 4QHKI 3OB8A 4XPBH 5TQ2H 5I1LA 4MVBD 3KYOB 4XVSL 1KJ2L 3EAKA 5GISH 2LVEA 3QA3B 3UMTA 4N8VG 5C0EA 4PJBE 4K23H 3QUMB 4G6JL 4RX4D 2VLLB 5E8NB 1ERNA 2YPLD 4MAYD 4RFEB 4N9OB 4CDGC 5MENA 3LIZL 3Q48A 1EZVX 2I27N 1CLOH 2GTZA 3S88L 2M2DA 2DQFA 4NQXA 5SV4A 5LKNA 3VFRA 2P8LB 5HGDA 5EU3B 2X4NB 4Q58C 3RGVA 4WENB 1QZ1A 3IGAB 5JO5B 1FGVH 5E9DE 1U91B 3BT2H 3Q5YA 2CLRA 1FO0A 1XZ0A 4YXLH 3RUGF 3KGRA 3FQWB 5I8EA 3KPPB 1JVKA 4GKNA 5IWLA 2WAHA 2NY3D 2MSPA 1X6NA 4XPGL 4C83A 1R5IA 3RZCB 2YC1B 1ZHBA 3QNZB 5IVXE 2DJSA 2VZVA 4I77L 1FN4A 1FL3B 4KI5F 4BZ1L 1JPFB 1QACA 2AW2A 2O5YL 3DX6A 3B43A 4JFZH 4Z76B 4NDMA 1KJMA 4Y5VB 5JPNB 2ATKB 1VEMA 2Y36L 1GGCH 3SO5A 4M43L 4KUCF 1GC1H 3JSSA 1RZIB 3F12A 4TVPL 1RY7B 3WS6A 2M26A 4X4MA 3ZDZF 2VWEC 1KJVB 4I0PA 4KTDH 4HXBH 3ES6B 4U7KA 5I1CH 3FOMA 1NL0L 4Q9BA 1RUKL 2WUBL 5DLML 2FX8H 2IALA 1OP5K 2IEPA 4LLWA 1P53A 3KXFA 5SWSB 4U3CA 5D2LA 1FZOB 3OR7A 2WMPA 5JDJA 3KG5A 4GO6B 4WHTB 1IAIL 5HYJD 2NQCA 4J8RA 2NW2B 5B8CC 4BQ8A 4HS3B 1T6VN 5FCUL 1MFEH 5J9PB 1JMZA 1KN2H 4LSSH 5A2KH 3U4BL 3WDJA 4OCRH 3E2HC 4UI2A 4RZCB 4ZXBD 5C0CB 2Q87A 3H9HB 4IMLB 1KT2A 1E4KC 3G6AA 4LVOC 4TTDC 3X14A 1JZ6A 3FJTA 3NA9L 3BSZL 1K5NB 4X6CF 4UOW1 5F3HA 4XVJL 3PL6D 4O4YH 3HPLB 4YJZL 5E2WL 4UUJA 5JLZA 1I7TA 5D93B 4G9FE 1ZHNB 1YNLL 5T3ZE 4ZD3H 4DGYH 4MHHG 4WFFD 4XHQA 3T77A 4OJFH 3VXUD 3S35L 3VXMA 5FECB 3TZVC 3MRRB 3SN6N 3GSRA 3E3QE 4NHCL 3FN0L 4M03A 5DHVH 2JJTA 1DDHA 3S3SA 1XGTB 3ROLA 3DYMA 4N0FB 4H8WL 4LFHD 3T08A 3RNKB 3TO4D 3BZ4A 1CL7I 1OARH 2CD0A 5ALBH 5CEYA 1VA9A 1ZHKA 5HHVL 1S7UA 2EYSB 1FG9C 3LSOB 1A7NH 4HUMB 3V8OA 5F6HI 4JM2F 4WHYG 1P7QA 1IJ9A 4HKXB 5CJXA 4YDKL 1F6AA 1NFDE 4LPUA 3QIBB 1L7TL 5JOFA 4ONHA 1EEZA 1BF2A 3JV4B 3O45B 4NQTA 1CFQA 5DJCB 4CN1A 3BJLA 4XBGA 4E41E 4TSCH 1LP9F 4KMTH 3RDTC 4YUEL 2MQ0A 4DEPC 3VFTB 3CVIL 4Y16D 2J8UA 3ZO0A 4CU7A 3B9VA 4OGYH 4M48L 5J3HC 3PWJA 3GHBL 4M7JL 5F71A 1RHHB 4Z77B 1ROWA 3WNLA 4C56A 3P0VL 4U1SB 2OTWB 4OF6A 3SCMD 1Q72H 2NY0D 1H8OA 4L8CB 2CDGA 4PJXE 4PUBL 5ITBL 4XZUA 5FUCE 3SDDA 2Q6WB 1I7ZB 4HEME 1Q0YH 2HJFB 1IEAA 2NTSP 4J3UA 3EYQD 3MRDB 3RJQB 2RCSL 5AUMB 3IKCB 1A0QH 3BIBX 2FBJH 3QAZC 3BPCB 1C8PA 1YMHB 3GMOA 3SY0B 1UJTA 5C8JA 2FH8A 4LCWD 1YC7A 3KPSB 1A14H 1RZJL 3CUPA 4XCYB 4ZPVB 4MMZC 4GG8A 3MGTA 3MV9D 3BMVA 2ERJB 3RVVD 4X6BA 4OSUH 3OXRB 4FFYL 4OCWL 1PFCA 5AEAA 1IFHL 1HNFA 1ADQL 4OCSL 2D03L 2DM3A 1UVQA 2BMKB 1S7XA 1KG0B 2EDEA 2MKWA 2VDML 5EPMA 3T09A 5EU4B 4YEEA 2OMBA 5SWZD 5ICYA 4Z7UA 3WFZA 2W9DL 4N0UE 3OAYK 4POZC 4PRDA 1HOCA 4P2RB 5E6YA 2ZUUA 1I9JH 4Y19A 3SJVD 4HKZA 1QRND 3UXFA 1YA5A 2JELH 1B2WH 5EBLB 1A7OL 1UKTA 2ATPA 5T5FL 1I9IL 3P73A 2UWEE 2V9QA 4IOFC 4XNXH 5E24E 4P5KB 2BNQE 2CXKA 4FQXC 1VEOA 4LSUH 4L4TB 2A6IB 1C12A 4X8XA 4YE4H 2OL3H 4B0MM 2DKUA 4JFYB 3SKNB 3RU8H 2E7HA 3EOYG 4ODHL 1U6AH 3R1GL 4M4RA 3T0ED 4G8FA 1JHLH 3QCUL 1DBKH 2D31A 2EEBA 3PP3H 5EBGA 3WNPA 3K3QA 1I1YB 5KS9B 4PJ8D 2WWKO 3PQYE 2CKBL 3NAAL 1U2HA 5EOQL 1EHAA 4HKBA 3BPOB 3A6CL 3V6FA 2EDQA 2AJYH 3OKNA 1AGBA 1MRDL 4N90D 4PJHF 3C6LA 3OKYA 5D93C 4KJPD 4MB4A 4PJAF 1QQDA 3GJEA 4KQ3H 3NN8B 4KZEL 4ZUSB 1RUML 2GJJA 3W82A 4Y4FD 2PXYA 3JV5A 4CL7A 1DBAL 4NYLB 1RZ8B 4YBQC 1JGEB 1RJLA 4GAYB 1RZKL 1KLUA 1F3DH 3OAUL 1I9RL 3WJLC 1B0WA 4MA7H 1F13A 1WCBA 1LEIB 2HTKC 1M7XA 2PKDA 1HIML 1KTRL 3ARPA 2Z92A 4JAMA 4KV5E 3SOBH 1MCWM 5E56A 3TVMD 5J6HA 4BJLA 3QXWA 4XCNB 1CVRA 1NBVH 2CKBA 5HHQA 3MV7B 2B1AL 1WFNA 1K9TA 2Z91A 3C6SB 3DMMB 5EZIH 1EFQA 5HBBA 2JKXA 2XPGB 4YXKH 3WCYA 3MGAA 2D3VA 5JZ7D 1ETZA 4ODUB 4R2GD 3L5WB 2AEWA 3C8DA 1JRHI 3IB4A 1T5WB 3ULUE 5IP4A 4RBPH 4UIMA 3QXAB 1AXSB 1A6TB 1ZLWK 5T1DH 1ONQA 5IFAH 2HKHH 3MRJB 1QEWA 3X3GL 4YHNB 4GBXB 3O4LD 3UTSD 2IF7A 5LCVH 1XF5B 3S97C 5F88A 5I71B 3MROA 2X4TB 1MI5A 4HG4J 1VFAA 2DWEB 2W0FB 3SDCC 1IM3B 1NKRA 1EH9A 5CCKH 2V2XB 3IU4H 3MCLL 3WFEH 2H26A 4KDVA 5CILH 4YFLI 2Y5TB 3GNML 1NGXB 2UYLB 5EORL 2VZSA 4MDJB 5F7MC 2ZUYA 5HY9B 1A9EA 4AIZA 3HUJE 2ITCA 5D5MB 1PKQA 1C5DB 3IJSB 3WIFB 2XNAB 1ZGLM 1FSKB 5E99H 1XR8A 2C4FT 3MBEA 3IDMA 4OIIH 3H0TA 5C7XL 3U1SH 2JJSA 2ERJC 3SEPA 1JV5B 5K9OA 3BP6B 3O6LH 4UILL 4M6NH 1MELA 2V7NB 3FB5A 1VSCA 4QGTA 1JZ2A 3T8XB 5E9DB 2X4SA 5D9SA 1FZMB 4QHNA 2ICWI 3WIIH 1LK2B 3PWUA 4UDUA 4D9LL 2QQQA 3P4OB 5BRZD 4ZODA 4MJIB 3QULA 1MH5B 4NNYB 3GSOA 1IQDA 4NZJA 4BSWB 5IVXB 2APXA 4MNQD 5DI8A 3N1GC 3G04A 2XI9A 3ARFA 5F9OH 4XP6H 3AUVA 4U1NB 3U7AA 2QEJA 4GKSA 4AM0A 4NO2B 5HHOD 5C08D 2QSTA 4OF8A 4KKAC 3BUYA 5FFLA 4UT9H 3QXDA 3RAJH 3KLHC 4OT1L 4G8IB 5CINH 1FV1B 5DQ9B 2OBGA 3NIDF 4HWBA 5E0QA 3QJHA 5TDNB 3WNOA 1QOKA 1KENL 3DVGA 5FYJU 2B2XL 4JY4A 3QIUA 1F8TH 2DLTA 1KIRA 5FOBA 5DUBB 1HQ4A 1HKLH 3BPOC 5GRJH 4XCEA 2C1PB 3RX8A 5AYQA 4Z0XA 4FZEH 4MA3B 3L9RB 5FK9A 1IGFL 5IVOA 2CK0L 4TNVK 4CUCA 4KPHH 1UACH 4FQIL 4NO0B 1ZT1B 1JWSB 2D7QA 4J12A 4K3GA 5C71A 1XH3B 2A9ML 2OXGA 4P99A 2FX7L 5F7EH 1BQHA 4YXHL 3W5NA 2GJ6D 1MQKH 1Y0LB 4JFEB 2DQGL 4UIKL 5LGJA 2R4SH 4DUXA 3WFHA 1RJZB 1Y18B 1MAJA 1AR1C 4MCYA 2Q86B 4G9FB 4KHTL 5C07A 1FLTX 3IFNH 4YIQB 3VFSB 4JQXA 5IB3B 1P5UA 2R9HD 3FFDB 5DJ6B 2YA1A 4APQB 2V9TA 1XF3B 3QQ9C 5GS1C 5H94A 3WL9A 3NCJL 2OQJB 1FAIH 3ZLQC 4LRNH 4Y2DB 4KY1L 1WZMA 3C5SB 3OL2A 1JMXA 1U8LA 3TH2T 1G7PB 1TJGL 1MHPL 3SKOA 4ZNEA 1NFDB 4HCRL 3B6SA 2HT4D 4H88H 2R23A 2R69H 3RUGA 1M4KA 4GBXC 4J4PC 5HHMB 1F3DJ 5GSVB 1NLBH 5GS0C 4OFIA 5I71C 1MHHA 1KXVC 1M05B 1ZT7B 2IWGA 4LDLB 32C2A 3MRMB 1NGQL 3IU3B 4YHYB 4WWKC 4JVWA 2MHAB 3VXQB 1DLHB 2LV4A 3QG6A 3M17A 5KSAA 1MRCH 3I84A 1DFBH 3LKQB 1JNLL 4O58H 4OD1H 5JA9A 4PJXB 1EUTA 1DBMH 3OR6B 1EGJA 4MS8D 4E42A 1INQB 4TVSa 5E03A 2FLBT 4S1DC 3ARDA 4JQIH 5HPMA 3VRJB 4ELMB 4J6RL 2X7LA 2UVEA 3HMXH 4KAQL 5I9QB 3ZTJH 3OKDA 4NQCA 4H20H 4EKXA 1AC6A 2R0ZH 3HAEG 1QSFD 4CDHA 1MEXH 2D0FA 1KCSH 5EOTB 3TCLB 4GSDL 3ZMRA 3MXVL 3OKKA 3RTQB 2YD1A 4KKCC 1UJ3B 4BK4A 4N8PA 2NX5E 4H1LA 2YPVL 2PYED 1U3HB 3O4OB 3TN0D 3QNXB 4ODTH 2R8SL 2BRRL 4X6CA 2FHCA 1NSNL 3Q3GB 2F5AL 3U4AA 3V5KB 2DDQL 2N56A 3VXRB 1XFPA 2AABH 4FQ2L 1V3LA 1FG2B 1NFIA 4NHUB 2NXYD 1EJOH 3HR6A 5FB8A 3JV6A 4PRPA 5I8KH 3VWKA 4RCAA 4OB5L 1BBDH 3H2WA 2CMRL 5F6IB 1PKOA 3N1MC 3NZHH 3KPLA 3BFOA 3MODH 4MHHI 2YMXH 1MWAH 2H32B 4V1DA 5EC2A 1A3RL 3VG0L 2AEIT 3U7WH 1S78D 3FONA 3M8OL 1QBLL 2DKMA 2VZ3A 2FWOB 1V7ML 3A6OA 1R5WA 2CUMA 4GUPA 4L4VD 1NANI 4PRAB 1G0XA 2IADA 2HJKB 3UCRA 3UROR 2VLRE 4LSPL 3ZKXC 4BELD 5EBMB 3X12A 3VFVA 1LP9A 2ESVE 1WFUA 2JE8A 3V0VA 1SJEB 3LZFH 4J3XA 3TWCL 3D6GA 1F4XL 4MSWA 3D3VB 5DZNA 2OSLB 1JGLH 5TDOA 4FQ1H 4HUXA 3TP4A 3KPQB 1C16A 2G75A 1RZGA 3O2DH 4LDOB 1CGYA 5KTEL 2B1HH 3KLSA 4R4BB 4G8EB 4APQC 4GMTH 3F7YA 1J1XH 3E3QC 1JZ3A 4GXVH 3BKJL 4YPGA 4OZIE 3I75A 3AS3A 4NSKB 5K9KA 5BXFB 1TPXB 4CU6A 5A43C 1UH4A 3ILQD 3GMQB 2UZIL 3IAPA 1XF2A 3CFIC 3MX0A 5HHPA 3UJTL 1JIBA 1G9NL 4P2OB 1NMCC 3HRZA 1TVBA 3WFCL 3E8UH 4LEOB 1A9BB 3RVXC 3T3PF 3EHBC 5T1MA 4P9HL 2IG2H 4HC1A 5KVGL 1XCTA 2A6JA 4KJWD 4HDIA 3U36A 5HGAB 1FORL 3LEVL 3SE4A 4FA8A 5I1KH 4UTBL 3DUSA 1AGCA 1PQZA 1M7IB 4I0CC 1EO5A 1I1AD 4HH9A 3V8CA 1NMAH 3O6ML 3QDAA 5GGUB 2NW3B 1J8HD 3PWPD 5HYQB 4I18C 4XXDA 1KEMH 4YHYC 3RVUC 1VFMA 1LDPH 3RHWF 4JRXE 3RBGA 1N5AB 1AGDA 2PN5A 4I3RL 1BEYH 4MXQC 2AJXH 5FM8A 3TZVD 5I1GH 1FIGH 3K74B 5FUCC 1HYSC 1WAAF 3IDNA 3HZYB 1JGVL 3BP7A 3LRSA 1FBIL 4X5LA 1MCHA 1Q94A 2J88L 3ELAT 4FXLA 4KDTA 5C9KA 3GI9H 5CMAB 4XC3H 1MHCA 5T1KB 5C9JA 4HS6A 4Z5RA 4ZTPL 4OCNC 4OZHA 3HUJB 4N9GB 3MJ9L 3JVGC 4EDWL 4MB5A 2CIIB 2B4CL 3P9MB 1C08B 1G7IB 1UJ3C 1AI1L 3GSNL 4NWUH 1PBYA 1K8DA 3VXTB 3DETC 1U3HC 3CK0L 4WI7A 5EUOF 3WFDH 4PR5A 3UTPE 4HWUA 3OZ9H 1JNNH 4QRPB 3RDTD 5BVJA 1JYXA 3QUMH 3ARGA 1PYWB 2EC8A 2G5BB 3BE1H 2HFGH 1ZMYA 5C09A 1OAKH 4PJHA 5BZDB 3UJJH 1LE9A 4JPWL 1RURL 4PJAA 1ES0A 1WWAX 1E4XL