5J9PB

Kcsa in vitro
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining in Vitro Folding with Cell Free Protein Synthesis for Membrane Protein Expression.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
molecule keywords Fab
total genus 48
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2016-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j9pB01
4L8BB 3IKKA 1QBAA 5FKPB 1T7ZA 3BT2L 3MV01 5K59E 4V1DD 3IJHB 4WI3A 3MRFB 4M1GL 1TCRB 1VGEH 3BISA 3HAEB 4NKOB 4MJIB 5D1QA 1N4XL 5D1ZA 1U8NA 5E9DB 3DMMD 2X4PB 4EBQL 2YPKB 1L7TL 5F71A 1RZFH 4EXPX 2Y25A 3SE9L 3SCMB 1I1YB 1M7DA 1FLRL 1FNLA 3AS2A 1AGFB 1HSAA 4HUNB 4NHCH 5DRZB 2I27N 1T5XA 3TYFB 2NYYD 1EUTA 2DJ4A 3TWCL 5J1SC 1ZHNA 3OB8A 4M61A 3HC0A 3W5MA 5GGRB 1DL7L 3BHBA 5A16B 1ZT7A 4OLZH 2EEBA 2P8LA 5ADPL 4CL7A 4POZD 5DVOA 3VW3H 2YD7A 3BPLB 5D1ZC 1RULH 2R39A 4FTVA 1A5FL 2AXHA 2WWKO 4JZNB 4YQXH 5T1LB 4JGJA 3MXVL 1NGZA 4FQHA 2VXSL 2XOTA 4KI5F 1MCRA 1Y0LA 4L5FL 4X9FA 1RIVH 4JFDD 5D7JC 3CXHJ 4Y2DB 5J6GA 1H5BA 3CK0L 4NKMB 1KB5A 3SGKC 4G8FB 1VPOH 3QUXD 3FAXA 5E5UB 2OXGA 2VLRB 5EWIL 3HI1A 3WNOA 3GSNH 2YKLL 3KPMA 4LOUC 3QDGA 5MEQA 3V95A 1HNGA 1BZ9A 4HT1H 2R1YA 2HT2C 3G04B 4LLYA 1RZ8A 3DSNA 2F54B 4FNLL 5L2JB 4QHKJ 4MZ2A 1RUML 2X4SA 4JZOA 4F7CA 5FYJH 5SV4A 3QFJA 4Y19D 2R0ZL 1JIBA 4KTDH 5F9AC 5LVEA 2WBKA 5CIPB 5B3JE 4NQDB 4HWNA 4X0KA 2JB6A 4LKCA 3ARGB 1W72A 5EN2B 5JNYA 3OF6D 3L5HA 5AZ2L 1WC7A 5TQ2L 5BZDA 3GRWH 1KIRB 1CF8H 1B9ZA 1WEJH 4XC1H 3UX9B 3V4PL 2CRYA 2Z31B 5AZEH 3S97C 1WWAX 3LEVL 3DRTA 1C5DA 1I4FB 1NFDB 3C08L 3TLRA 4XP5L 1L9NA 4JLRB 2D7MA 3M17B 4ZQKA 4F9LC 5DD1L 2ESVA 1NUNB 5F1NA 4M7JL 4TNVF 2Q1EA 4N0CD 5IFJB 3T0BA 4UV4L 3BZFB 5J12B 1J1PH 2FX8L 4XMLH 4PTUA 3PDGA 2E9IA 5F7NC 3KLDA 1MCNA 2GT9B 1W0VB 1BBDH 3NPSB 3JWOC 4NKQB 1MCJA 3ARRA 5C8JB 4N68A 5D7SL 2NPLX 4UTAH 4J23A 2DQJL 2DIBA 3LCYA 1T21B 3TN0A 5IV2B 3OV6A 4QT5A 4HIXL 5CGMA 3QCVH 4HUMB 1D6VL 4JQXC 1MUJB 4ETQB 3NA4A 1NMBL 4OLXH 2CLZB 4F8QA 4XVJL 2O5XL 3RBGA 1UCTA 1BFOB 5GGTH 3I6LE 2VDLH 2HWZH 1BFOA 3FHQA 3ULUE 1T1ZA 3CFKA 4YX2L 2HJFA 5K9KB 2DDQL 4HS6A 1HINH 3IVKA 2VB5A 2R2CA 1ZVYA 2CUMA 3V5DB 1JN6B 4PRPE 3MV7D 2A0LC 1P9MA 4QT5B 3PUCA 4OD3H 5DGQA 4S2SA 5KAQG 4XMKH 5C7XH 4XNYL 2R23B 4PJXF 5DHVH 2IFGA 4GT7A 4DVRL 4YBQD 1VFMA 5CWSB 3FT2B 3OKKB 5HYSB 2CIKB 1TQCC 1VFBA 3HI5L 4N0CC 3MRRA 4YHZH 1OHQA 1SM3H 3SGEI 1J88A 5BW7C 2AKRB 1CQYA 2XN9E 4YK4C 5D9SA 5LQBH 3UTTD 4WI6A 3VFVB 1ZKAA 2DLGA 3EJYD 3GDBA 1FO0H 4HXAH 5T3ZE 2WW8A 1GGYA 4K7PL 4ZS7L 4LDLB 4PPTA 1S7QB 2NY3C 1INEL 1J12A 3DRTB 3T0AA 3PP4L 1HDMB 1JTOA 1FIGL 4ZOEA 5I16A 2YRLA 3VFPA 2EDNA 3KPLB 4M3JA 5JOPD 1YPZE 5GZNC 4JM2C 3SDXB 4GQPH 2OTUA 2FGZA 5SWSE 3QUYA 1PFCA 3S3PA 2YZ1A 4LCCB 4G7YL 3NAAH 3RHWK 3L3OA 2R0WL 2YSSA 4ORGA 3PV7A 2ICWI 1INQA 2VDKL 3CK0H 3IKCA 3UYRH 5ADOL 2ATPB 4QXWA 3EKCA 2B4CH 3GSWB 3B6SB 1WBXA 1MJJB 1WQVT 3MRKA 1NCCL 4NDMA 4PJ7A 5IEKB 1AH1A 4Y4HB 4NUJA 1EO5A 4M48H 1TVBA 4ZUTA 5TQ0L 4JGMA 3AM8C 1J18A 2C4XA 1YEDB 1DBML 1PG7W 4FA8A 4K23H 4NBXB 3JUZA 1CS6A 1UADC 1DL7H 4K3DL 5JO5A 4AENA 1KJ2B 4FQXA 1I9JH 3QPXL 3RY6A 1YYML 3O11B 3BWAB 4JDTH 1ZSDB 4MA7L 3RY5A 5J9PB 1T5WB 5JXED 4DN3L 1E4JA 3SE9H 1OSPL 2EYRB 4P5MA 2AEIT 4S10A 1QA9A 4HX1B 1U3ZA 4YBHA 4MHHG 2GCYA 1KB5L 2ZG3A 3PWNA 1H3VA 4LK4A 4F7PA 5HYJB 3IFNL 5J8OA 1NLDH 4NWTL 5K59F 5H2BB 2OZ4H 5ISZB 4GBXB 1JYVA 4MD0B 4XP6H 5I1CH 4S1DD 1HQ4B 2R0LL 4U1MB 1HKLH 1XF4B 2A9NH 1N0XL 3DUSB 3O6ML 1F11A 1RIHH 3TZVD 2EDKA 1L7IH 4AIXA 3LD8C 1LO5A 3H2WA 3GMOA 4OM1H 5H2BA 1DEEB 1MJ7L 3QQ3A 4LCIL 4F9PA 4RFEA 3G5XA 1HSAB 1Q72L 5DMKA 1ZT4B 1UQSA 3RRQA 4HHAA 1T0PB 3NTCH 1U2HA 3QEHB 3VWKB 1JUFA 1SJXA 3BWAA 4OLEA 4Z7WA 1IARB 1F2XK 1EHNA 1ZANH 2Y5TA 1U8NB 5HDLA 4NFCA 3K4DA 1BREA 3TJHC 5GS1B 1D9KD 4PRHB 5ESAB 4I77L 5HI5C 4HIJA 4WV1B 4QYOB 4P57B 4JO1H 4GG8A 1OTSD 4H88L 3ULVF 1GCFA 4BZ2H 1A3QA 5DJ0B 4K3GA 3O9WD 2ENYA 5GHWL 3JWOL 1A6AB 1NAMA 4H20L 3SOBL 5J3HD 3S96B 1F4XH 5DJYA 5DURB 5F3BA 5JOEA 4XHJC 3TVMD 3MCG1 3REWA 1N0LA 3BP7B 4NQEB 2GJ6B 2VABB 2A9ML 3SE8H 5AUMB 2ZSWA 1HHGB 3NMEA 4FN0A 1HXMB 3CXDH 5E24E 5C3LD 2V7NB 4OGZA 4R4BA 4X7DC 4JREC 1H3GA 4XWOC 5FUCC 1CTNA 1A6WH 1YYLL 2AABH 3CDGA 4G9DA 2G2RB 4Z76B 1JGUH 3BKJH 2BNQD 1JGUL 2Q76A 1VKXB 1B6UA 4HS8H 4XRCA 5C0GA 2XA3A 1UM6H 3AVEA 1TXKA 4ZODA 2XN9A 1IC7L 4M1CD 1JZ6A 2A1WH 3M1BA 5IG7A 1UWXH 5DD5L 3TBWB 3MYJB 5C2BH 4ZMAT 4RZCB 4MQTB 3TO4B 1PLGH 5IGXH 4DFHA 4GG6E 3CCHA 3FRUA 4J12A 4ZAKB 3MLVH 1MAML 1K9TA 1RIUL 4AEHH 5M7QA 1IEBB 3W0WD 5BV7B 2XWBA 5FUCE 3W0WE 1MWAL 2MJWA 3MV11 2UZIH 4LCIH 2GI7A 5IUSA 4LSSH 1KEMH 4MQXD 1T7WA 5BW7A 3T4YA 1P7QD 4KJYA 4PV8B 4PJEA 1YPZA 2E9JA 2G60H 3MJ6A 4D9LL 3RKDD 5JDSB 4U6XA 1Y6NR 5EOCL 4LARL 3GJFK 2FD6H 4BQ9A 2NXYC 2JIXB 1IL1B 1BVLB 5CUSL 5D93C 3CX2A 4NRZB 4YWGH 3S98A 2QHLA 4PJHF 2IPTH 1HHJB 3ULVC 3L3GB 5IMKA 3VFNA 1P4LA 3QNZB 2YMXH 5HI3C 1QRND 2CLZA 1HKLL 2A9NL 3CCHB 1KTRL 1NCTA 4TSBL 4DZ8A 3KYNA 5EORL 3TN0B 4JG0L 3ARDB 2MTPA 3WFZA 4RMVA 2AP2A 3IXTA 3TT3H 1AE6L 2IAMA 2PR4H 2WUBL 3QAZB 2XWJB 3QR2A 2GT9A 3E3QC 4ZPTA 3QHTC 3H7BA 4PTUB 2HP4A 3FO1B 1X5AA 4MA7H 1RUMH 2V7HA 4LSSL 1NFDF 4LSUH 4AM0B 4UBDD 3OAYH 3OJVC 4POUB 3INUH 3ULUL 2UVEA 4ODHH 1AGBB 2KPNA 2ZWLT 2PKDA 5TDOB 4S1DC 3CSGA 15C8H 2A74A 1F13A 1J8KA 4PJ5A 1E27A 3UYRL 3P4OB 3PL6B 4R4BB 3D3VE 4WV1C 4I0KA 3SJVD 2J3SA 4K7PX 1LP9F 3SGJC 1FRGL 1MFDH 3Q1SH 4LU5H 5TQ0H 1P84J 3QSKB 2EDRA 4PGZA 2ZJSH 3MJ7B 4OZIA 4ZNCD 4I9WD 3OJMB 1A6AA 1NAMB 2Y72A 1WJ3A 4O02L 3KPRE 3C5ZB 3QWRD 3U7WL 4ZG1A 3HR5B 1NGYA 5DRWB 3ILPA 3MCLL 2NY1C 1Z2KA 1DP0A 3L3IA 4G80B 3EYOA 5GISL 5MEPA 5C07A 3QFJB 3GZKA 3OQ3B 2CJUH 1HKFA 4JFZH 4E41E 1G9ML 4OFYD 5HYIA 1OAKH 1QACA 1KN4L 1M1SA 5DTFA 4I0CC 1U8OA 3K0WA 3KYMA 3SBWC 3MLXH 5T3ZD 2VZSA 2P7TA 1BZ9B 3QEQA 4F7MA 4H20H 3NCFB 4OUUA 3IFOB 3HPLB 4XAWL 3MOAL 5IJVB 1S9KC 1FO0L 4TOYL 4L9DA 4CMHC 4D3CL 3MGTA 4WW1A 4QXGH 4U1MA 4LCWB 3TO4C 4BYHA 1YMMD 4Y4KC 5A2JH 1LO2L 4X7SH 4U1HB 5DSCB 4NZRH 3QUZD 3TZVC 4U3XA 2A77L 3P9LB 5DJ2A 3NACH 4FQHB 5A1AA 5I71C 1ZOXA 3QWOA 3RPKA 2EIZA 4B7IA 5EB9A 4YHPB 3BSZL 5HGBB 3SDCD 3ZDZF 5GZOD 1FZKA 2D03L 4HJ0D 4APQB 3S34L 1YMHA 3HC0B 1L7IL 3LKSA 3MYZA 4YAQA 2FX9H 4JREB 3P4LA 2D31A 1FCGA 3RA7H 2IF7A 5I19H 1MHPH 2O5YH 3EOAB 4G8IB 2UYLB 1YEDA 2VUYA 1K5NB 4ZTPL 1KLGA 3QDJE 2Q86A 2NCMA 1T1YB 4WHCA 5GRJH 3GUTB 1A6PA 3IFNH 1IAIH 2H2PC 2QSQA 3QCUL 3RGVA 1ZLUH 3LRSA 1A7OH 4LLMA 2VISA 3KPQB 4K8RH 3ZT6A 1NMCB 2R2EA 5D1ZB 3B6SA 3UAJC 4HUVB 3BGFB 3P2TA 2F53D 3UZEA 3M45A 3T0XA 4KHXH 5KN5B 1MFBL 1LNUB 3WFHB 4X6DA 5IK3A 3UXFA 3CFCL 2BSTB 4KJPD 3E8UL 4DGYH 2ZPKL 2IALB 3F58H 5C0EA 1E6OL 5GGUB 4LVHB 1A7QL 3UJTH 2NY5L 2UY6A 4HIIA 1OWWA 1RU9H 5KS9E 3GRWL 4ZO7A 5L7XH 4JFFA 2ZNWA 4UIMA 5FGCB 1Q9OA 1V3MA 1XFPA 4HUUB 2VDMH 4YXLH 2V9QA 1OGAB 1U8JB 4FOMA 3RP1A 3UTPD 1U8IB 2OL3B 1OWRM 2VQUA 5F89B 3EJZD 1IGFL 1FAIL 3EZJB 4QRQB 4R2GB 1MCOH 4TOYH 3WLBB 3UYOD 1T2JA 1M4KA 2OS7A 2YD6A 1CFQB 5T1DH 1QR1A 2Y07L 3VXOA 4HWUA 3HE6B 2W9EH 3F6IA 2OI9C 2EICA 3H3PL 3C60A 4Q9RL 1GC1H 2DD8H 4OJFL 3NN8A 3RDTB 1FL5B 1RJCA 2FX7L 5DHYA 5C70A 3L95B 4I4WB 4H1LG 5E5RB 1KJMA 1RV6X 1Z9MA 4HLZH 3DX7A 1QVOB 5EWIH 2HN7B 1HZHL 4QRPB 2XQBH 1ZEAH 4HKJB 1J0JA 4P2QE 2HFGH 4P2QD 3W39B 3VI3E 2AS5M 4NBZB 3BXNA 4Z5RA 5F7LB 2P48B 3PWPD 1KTDA 1LHZA 3LB6D 4G9FE 4X4ZA 2BVPB 2Y07H 1MFCL 1NC4D 4XNUH 1CG9B 3SDDB 3FFCA 3U30B 1MREL 3SDYL 3C9NA 2BNRD 2WWMD 3K2UL 1JZ8A 5IVNA 3DLQR 4H8WL 2BVQB 3CX5J 1SEBB 4HCRA 2DBJA 1QNZL 1IAII 2CR6A 5C8JA 1QLRB 4LLWA 4M93C 3W0WA 1G9NL 5H94A 3IXAB 1S9XA 2FLBT 4GG6A 4JN1L 2DQCH 4QRTB 1IC4H 2ICWA 3P3YA 4HKBB 5GGTA 3ARBB 1M71A 4GMSL 3BIAX 3V6BR 3BW9A 2Z31C 4PB9H 3VXNB 3ZE0E 2DMKA 1YC7A 3VRLF 2XTLA 4Z95H 3U2SA 3VG9C 1CD9B 5HHOE 1GGBL 5I15H 2D7QA 3DWTA 1I8IA 4D0DB 4JN2A 2OQJB 4WIQA 4A6YA 2ERJC 3CSBA 3VFUA 1PVHA 1S7TB 1FFRA 1XGPA 5I19L 1T3FA 4J4PA 3RA7L 4HIXH 4PG2C 4RGMC 5CEZE 4UILL 3HRZA 5SWSB 3W9EB 3VGHA 1I4FA 1CDYA 1CICA 4WW2C 5IFAL 1GIGL 1N5AB 1VFOA 2VQ1A 1OF2A 2B7DT 5E8DH 3FCTA 5IVXA 4G3YH 3SGDH 4ODXB 3V4VL 4JB9H 3CH1A 1T03L 5JHDA 5IROC 1RZIB 4PTTB 5ALCL 2D4DA 4PTTA 3GSNB 4QRPE 1YUHA 3RUGA 3S34H 5E8PB 4GRWB 3GI9H 1G7HB 3DV6A 2FB4L 2EDBA 3O6FC 3I2CH 4FQJL 1DEDA 1UXSA 1CCZA 1K3IA 1CDBA 1KN2L 3VGAB 1CDIA 1EERB 1RIUH 3HC4H 5CJ8A 1S7SB 4LSVH 1K4DA 1SJEB 4OD1L 3PDDA 5DD5H 5KTEH 3V5KB 3KPMB 1QTYT 4D0DA 3L3KB 5DJDB 2VLRA 1ADQH 3U2SB 4UV7H 1FZOB 1UGNA 2IWGA 5F96H 4G8FA 4MVBC 3VXNA 1H5BB 1R0AH 3KPSB 5MENB 4JHWL 1JYNA 4PP2A 1YY9C 2H26A 4OI8A 2JJVA 3GSVA 3CZFA 2XV6B 4HPYH 2H9GB 4CNIB 4M3KB 4PJ8D 2J8HA 4F7EB 1R3KB 4DAGL 3BKJL 4URTB 3RTQD 4YE4H 1DUZB 3PIQA 1QLRA 4LLWB 4ZDHA 5ITBL 1T66C 4MA8H 3MXWL 5CCKL 5J0BA 4FG6D 3GMPB 3MSPA 1I7TA 3GSOB 4UTBH 2P8LB 4U1GB 5EOQH 3V9FA 3MV8B 1V3KA 2ATKB 1FRGH 3EOBA 4TUOA 3UCRA 2L7UA 2QQLL 2KUTA 4UDTB 2R69L 5I74C 1KLFA 3LKRB 2DLEA 2KL6A 5DRZA 4MXQC 1F4WH 2OL3L 4FQXD 1G6RL 4LIQH 4Y7MA 2GSIA 1B4RA 3QXAA 3SDAA 3UC0H 4FFZH 3RNKA 1CU4L 3ZT7A 4TUKL 3VXRB 2NW2B 2I60H 3W2DH 5I1KH 1NSNH 1HWGB 1OAYL 2MSPA 3VGGA 3ZDXE 4N0YH 1KJMB 1A7NH 3MUGA 4YPGB 1PJ9A 1W8NA 4HEPG 3VH8G 1RULL 2B5IB 3RDTA 5I9QC 4WTZG 2ESVE 2J2ZA 2LTQB 2DIJA 1F45A 4Q9RH 4CDHA 2GJ6E 3W82A 3DVNB 3D39D 5EPMA 5KS9A 4XZUA 1EHLH 2W65B 1UC6A 3NFNB 4ODSH 5I1EH 3GO1L 3I6KA 4XWGH 1WK0A 4XH2B 4Y8AA 1NC4A 3W11C 3H42H 3IFPA 5EU6D 4XCYA 4K3EL 3VD5A 2X1OA 4G9FA 4FQQB 5DMIL 3TJEL 4TNWK 2YA0A 4E0RB 3PP3K 3OKNB 5DUBA 4YEFA 1TDQA 4K71B 3MCKA 5FYKU 5C0CE 3RVXD 4HUUA 3HMXL 4DCQA 5JLZB 5EO0B 3V0WL 2DF3A 3VDCA 2ZG1A 1A3LL 1JV5A 1KNOA 4L29A 2WIIA 5E6IB 2IALA 3KS0J 3QDJA 1DR9A 5F7WC 1C5CH 2V5RA 3GNML 4YHIA 2AV7A 4XI5C 4OLYL 5D7JB 3WIHH 3PGFL 3GO1H 4JFYB 3I50L 4TVPE 5ID0A 5HPOA 4NQCA 4TVPD 3WS3A 5DO2C 4LASL 4U1GC 2R56L 4C4KT 4M5ZH 5M94B 3CJJA 2R2EB 3ARBD 1I3GH 1D5IH 3DO3A 5EOCH 3RPIA 3GUTA 5I8KL 4Z77B 4QLRA 3KLHD 4IHOB 4U33A 4EEEA 3SKOB 1K5NA 2E3VA 2JJTC 3WLWC 1UH4A 3FRPG 4Z7UF 3FO0H 3ULVE 2I60L 3W2DL 5JORA 4OZIE 4PJBB 4Z7QF 5DT1H 4UDTA 4ZUWA 3BQUD 3WNKA 3MLTA 4FQXC 3VXRD 1UA6L 2DTSA 3GMPA 4O2CA 3KR3H 4K9EH 2EDYA 3AUVA 4U6YA 1ZHKB 3OSKA 5E2TL 1U6AH 1W72H 2QJDA 3DMMA 4U1JB 1S7WA 3QHFH 5LGJB 1X5ZA 2FNBA 1YA5A 2F53A 1DE4B 3ZE2F 3RJQB 2A73A 4X6EA 2HLAB 4EUPG 1JPFB 1FG9C 4YUEH 2D7TH 4D3CH 3OAYK 4N1CA 1WZKA 3HPLA 4LF3B 3MOAH 2WMPA 1LO4H 1YNKL 3EFDL 4ZFFA 1SJEA 5EU5B 2CSPA 5E2WL 1QYGH 1HQRA 3DROB 3KPOA 4Y5YB 3RNQA 4BELD 1MJUL 4DUWA 4E5XB 2CPCA 4L8SB 2EH8L 4OB5H 5DTFB 1I8KB 4LCUB 4OT1H 1NH6A 2VLKE 5I66B 4MWFA 1E4XL 1ZANL 4QHNB 4UB0L 4JFZL 2ZOLA 1QSED 5GHWH 2VN4A 3ARYA 1TMCB 4JY5H 4YUEL 2B1HH 1WBZB 4H88H 4MA3B 5DRWA 1XZ0A 3KPTA 3HS0A 3F7YA 4MX7B 4P59L 3BUTA 2L0DA 4HCRL 4HC1H 4FQIL 1ZGLP 1PYWB 4KZEH 5CJ5A 2BY2A 5I18H 1CDHA 4Y5VA 3V6OE 3G6AA 4PJIA 4OZFG 3O3AB 1RIHL 5IVXB 4WRLA 1T1WA 3MJ8A 3PF2A 5FF6B 1JNJA 5I1CL 4U1IA 4OGAD 1KCUH 2F15A 3IDXH 3OG4B 4IS6A 3N1GC 3LDBB 3LPGA 3DX8A 1DQLH 3MV9D 3B43A 3AXLA 3VFUB 5D6DC 1GIGH 4GXUN 4HUWA 3D39B 4P23A 1S7VA 1V3JA 2OCFD 4UUJA 5E8EB 1QO3A 1KFAH 4MWFB 4APQD 5FYKD 2FX8H 3LV3B 5LGHH 2OZ4L 1OW0C 4GKZA 1QPXA 3HG1E 4TRPL 4WHYG 4JPVH 1PY9A 5F6IC 2X44D 1E4KC 1HSBB 5EU5A 4Y8DC 43CAB 4JY6B 1TTFA 3ZE2E 1SEBA 3TC9A 5J13B 5E9DE 2P5ED 5T3XH 5IHZB 3UTTE 3ET9F 3Q2CA 2CRZA 1I75A 4ZYKB 3HUJE 4ZXBD 2HMIC 3RIFK 2FO1A 1RUKL 1XIWD 4XC1L 3V4PH 4Z6AT 4ZUSA 1JMXA 1A3LH 5LGJA 4R90L 3IS0X 1MFCH 4XNUL 2R1WA 3IU4L 2WBWB 4Y5XB 2O5ZH 1X4YA 5E4EC 5EOTA 4NKDB 4O2CB 4F3FA 5JDSA 5DA4A 3V2AR 5LBSL 4GH7B 3C09C 3O2VH 1UJ3A 5JQ6L 4KJYB 5I75B 3SKNA 3P4MA 2HKHL 2B4CL 4HFUH 2QBWA 5I18L 4JPIB 1ZA6A 4IIQB 4PJBA 3S3SA 1ONQA 3C60B 4BUHA 1A4JB 3H8NA 3QDAA 1S9WB 2GAZB 2JCCE 1MAMH 1NGWB 1LO3L 4Z77A 1NDMB 1Q38A 1IBGH 5DEZA 4LMQI 2YN3A 5C09D 1NFIA 3LKQA 1CGSL 4WW2F 3D1MC 3HA0A 2AW2A 5JXAH 3MV7B 5HHPB 3NOIA 3Q3GA 5IIEB 4G6ML 4XNYH 5EZJA 1RZKC 3PL6D 3FQRB 3U79A 4GRWF 3WS6A 3MA7A 5HPMA 1JV5B 5GIRB 2VIRB 5HPMB 2CK2A 3PWVA 25C8H 4ZFZB 3BQUA 4KI5E 4EI6B 4DGVH 1K8IB 5FM5M 5HYSG 1FC1A 4NQDE 3HUJF 5DUBB 3ROOA 4MNHB 5B8CB 4KPHH 2GJ6A 2VABA 4M1DL 1U6AL 1W72L 3U83A 5AAWA 5BVJA 1V7NH 4XPGL 1T83C 4GXUM 4LNVA 4L8DA 4M6AA 1X5YA 1VCAA 2W1NA 5KS9B 1UB6A 1KG0A 4JDVA 2EYTA 3TZVB 2N7BA 3X14A 2X9WA 2HWZL 1MRCL 2RCSH 1OT2A 2AEQL 3NFSL 1EUUA 4HWBA 4W6XB 1YMHB 5GS1A 3MUGB 4YPGA 3BN3B 2W60A 4HS3B 4PD4K 5HXMA 3G5VB 4FFWD 3QUZC 3HNSL 3VWKA 4U6HB 3UZQA 4LVOB 2EIZB 2C3XA 4XPFH 5FYKE 3T0EC 5EOTB 2PW2A 5DMKB 5DJ2B 3P9LA 2H32A 3C6SA 1HI6A 4C54A 1SY6H 5DSCA 3PNWA 4P2OA 4U49A 5C0CD 5I1AB 4IMKC 1FVCA 5GJTL 5TFSH 4JO2L 4P9HC 1JYWA 2EDTA 4OF3A 3FB5B 3SKMB 4YR6A 5C6TH 1VB9A 1N0XH 5GRUL 2NY1B 4XTRD 4HXBH 5FKAB 5ISZA 4S0SD 1NC2D 1IM9D 3U4EA 4PLOB 4F7MB 4G6JL 4P3DB 5DD6B 5IM7A 4XNXH 1YN6A 5T33H 2OR9L 1CT8A 4WI9A 1FPTH 2J6EA 3GBNL 1QFUL 3QUXC 1YY8A 2NW3B 5C9JA 4K7PY 3MLYH 1I1AD 3SGKA 4AIOA 3IDIA 4B50A 1QO3B 2AXJA 1N6VA 1AY1H 2G75A 2BSED 3L6FA 4KV5E 4YFDB 5C07B 3O3EB 2YBRB 2XYCA 2NX5B 1X3DA 2P4AB 4UINH 2CK0H 4QGYA 3MRBB 5KSUA 4XBGB 1OAXH 1DTUA 3VXPA 1VDGA 4MSWA 2DWEA 3FQUB 2E27L 1Q8MA 2X4QB 3AU1B 2P5WD 5FF6A 4Q9BA 4DKFL 3HE6C 1T1WB 5MERB 4DTGL 2ADIA 2IANA 1ED3B 4I2XB 2G9HA 3UC0L 1C08B 1OQOA 5IW6A 1YNLL 5BQ7B 3ISWA 1I8LC 3WD5H 3TN0C 1JNNL 4ZSOB 1X9QA 2ADFH 5TDOA 3F12A 1LE9A 4WEMB 5JXEA 4OD2A 5GGSB 4AM0A 2XG4A 1PAMA 4GRLC 1PX3A 2NY2D 3WNLA 1OOAA 5FYJD 3STBA 1I8KA 4LCUA 5B22A 3U0TA 1FAKT 4G42A 3HRZB 1J10A 3KPOB 4L3ED 3ROLA 2PYEB 5KSBA 1XGPB 5DZOA 3D25A 4X80L 1LEGA 1JPFA 2XACC 5D9SB 4G8GD 5KSAC 2KQMA 5ADPH 5J6HB 5KSVB 4IRJA 4D8PA 4F2MA 2YPVH 3Q48A 1BFVH 3LKPB 2OK0H 1X5JA 4F15B 1UT9A 1MNUH 1FNAA 1P4LB 2E7LA 4KDWA 3TWCH 3F8UB 3F65A 4EDWH 2Z91A 5TPWL 1BECA 4M6NL 4U1JA 3OKYA 4LLAA 3W0WB 5ICYA 1P6AB 4UI2A 3D18A 3VXSE 5GZND 4OD3L 4JR9L 4G6FD 1BM3L 5AG8A 2X89D 3IDUA 3OAZK 2GSGB 1UKSA 3TPKA 2DI9A 2NZ9C 5JW4Q 3QUZB 1RVFL 3RVTD 2CDGB 2VE6B 4KDTC 1D3CA 3QUMA 4LNRA 2HJFB 3O8XC 2H2SC 4M1GH 1BVZA 5HHME 3VWKD 4X6CB 3LKNA 4LCWD 3DX9A 5HYJE 5JW4R 1KIQA 1P7KA 3WE6A 3H9SB 3VFGL 5LWYL 3N1QC 4OZHB 4JO2H 1MEXH 4R4FH 4HIEB 3GKZA 4RNRA 4RRPA 3NFPB 1MCFA 3V0VA 4OZ4A 4XNZC 3QZWA 4P4KA 1KIUA 4KHXL 5E03A 5C0BA 43C9A 1T21A 2H45A 3TFKC 4ZNEA 1HOCA 1WBYB 3MX0A 5IG7B 5JOPE 3RL1A 2HN7A 4ZSOE 3MV8E 1S7RB 1QSZA 3MRCA 4K8RL 1QEWA 2GK0B 1ZT1B 5DQDL 4OCXL 4P4RA 3IS1X 2GJ6D 2MPAL 3C2AL 3SQOH 3TYGL 2JIXD 3TO2B 5JW4M 2AK4D 5HYQA 3E2HB 5EBLB 4QXUL 1RK0A 3LRHA 4KQ4L 4WFED 4ALAL 5EO0A 2AJZB 3RUGF 2O26U 4RWYH 2AXFA 1TJIL 4AQOA 4UIKL 3QYCA 5ILTL 5DDHA 4G5ZL 1IT9L 4FQQA 2E27H 2OP4H 1NC4B 2H2SD 3VWKC 5D2NE 1Q9OB 1KPVA 4YGVA 1WT5A 1IQDB 3EYFB 4LPUA 5K33A 3IJYA 4PY8I 2ZKHH 3HZKA 3I3EA 2HLFC 3NFNA 4NC2B 5EUOF 2NR6C 3U7AA 4EN3A 4GXVH 3U9PL 4F7TB 1KEGH 4WHYH 2LU3A 4LGSB 3RJDA 5A2KH 3X3FH 4QWWC 4OQTH 1UACL 2VITB 1XR9A 2R0KL 2VDQH 4QXGL 3DVGA 1NEZB 4Y2DD 3HLAB 1MCBA 1I85C 5D7IB 1YY9D 1A47A 1EMTL 5GQBA 1MY7A 2R4SL 4PP1C 5CJOL 1U2CA 2D9CA 1R5VB 3IFLH 4PJ7F 4B41A 4OF8A 2VJXA 2FH6A 1X5FA 3PQYB 3QG6A 2ITDA 1DEEA 1CLZL 4AG4H 3KXFD 5TFSL 5GS2H 5GISH 4XHJD 2Y06H 5F1SA 4LSDA 3IDMA 1Q94B 1K6QH 4GKSB 3LMJL 4ZD3H 3DBXB 4FQ2L 4M6ML 2BCKA 5E99L 5J13C 1MCOL 2NY0B 2I25N 2NTSP 4IMLB 1Y0LB 3VGDA 3ZKMD 3HNVL 2AJUH 1NCWH 4NJAL 1EJ6A 5C0DB 1RURH 3TNMB 3L5WB 4NT6A 4U1HA 3MMEA 5GS2D 5EZIH 5DEFB 2FYYB 3FZUC 3O11A 5CP7B 4F33A 3NFSH 5FYLD 4P2OD 1QBML 4JG1L 5C0CA 4AENB 3RWCB 3MA9H 2EC9T 4WU7A 2VDPH 5JO5B 5D7LE 3KGRA 3MLUL 2EEAA 3E6HA 5AEAA 5DJ6B 4ZFOA 1WUNT 2ID5A 5IQ9A 5FUZH 3VG0H 2NMSA 1I1YA 1S7SA 3E0GA 1FLRH 1A6TB 3V5HA 5IBTL 3GGWB 5FAAA 1R5VA 1A7OL 3V52H 1CGVA 5KZCB 3TT3L 2X9XA 4MJIE 1IFHH 1JTTA 4ZAKC 1N4XH 1WBXB 4MQSB 4TULL 4K07A 1VHPA 1KFAL 2AK1L 3IJHA 3U36B 1U95A 3ZYJA 4G80A 1MSPA 3L3OB 3R1GL 1GPOL 1U8MB 1A6VL 2F5BL 1B0GB 3HR5A 1RZJH 3QRGH 2PTUA 3BP5A 4PJXA 2AJVL 4KTEL 4TUJA 3IJYB 3MJ7A 2Z92A 4CVZB 5E1AA 1KXTB 3N1MC 5J06A 1HDMA 4D9QD 3OHXA 3W9EA 4NSKA 1Y18A 2XA8L 2ARJB 3M8OH 1AD0B 1C7SA 3U0WL 4LHQB 4RCAA 4LEOB 5L8JB 3L1OH 5A2LH 1H3XA 3IDJA 4OFYA 3T3MF 3ARVA 5FUOL 1T20B 4ONOA 5FUOH 1G7JA 3DPBA 3UBXG 4OLWL 4YZFE 1U91B 4ODVL 1QLEH 2QQKH 3S37X 4Q9CA 3CGTA 1WFTA 5BJTA 2YOCA 1TTGA 1LEIB 4AJ0A 1G7QB 1H3UA 3HB3D 1JRHL 1U8KA 5CMAB 3MREA 1ACZA 4JFDB 5FA4A 4XMPH 2BP3A 1RZKL 4QO1A 2VDNH 4YHMH 4S2SB 5LJYH 1U8HB 3B9EA 3HZYB 3HI5H 3AMLA 3KYNB 4OZ4B 1JN6A 1OTUC 1I1AB 2V17H 4RNRB 3VFTA 1YNKH 2CJUL 3IVKB 3QQNA 1N5YL 4Z78A 4PUBH 1UWGL 1NDGB 1S78D 4ONHA 4NO0A 4ELMF 4QY8B 1CE6A 4QOKE 2YD8A 3LKNB 3G5YA 4R97C 4MGXA 2WWMC 3ZKXC 1MF2L 2VR4A 1S7UA 5I75C 2VE6A 4LNRB 3RWHA 4AH2A 2ARJQ 4HKJA 5BVPH 1J0HA 3EFFB 3UDWC 5IV2A 1N3NB 4QRPA 4DKEL 4L9LB 4PJAE 5E2TH 3AC0A 2D7OA 2NLJA 4WI4A 1LK3L 2NXYD 5GJSL 2OSLB 1GHFH 2HVKA 5BJTB 2BVTA 4HK0B 5JA9A 2IBGA 3HE6A 3GSRB 2VSCA 1JGLL 1U0QA 5B38B 3MV7E 1X5KA 3INUL 3JUYA 3HB3C 2P46B 3IDJB 3UTZB 3P30H 4AQ1B 3D25B 4EI5C 1J11A 9CGTA 1T2QH 2QADD 3SDCB 3U0TB 3DX6A 4HPOL 5BVPL 4WDIA 1J1OH 1CFVH 1RAMA 2I07A 5E99H 4HMDA 3T2OA 4Z7VF 3X13B 4M1CC 4XRCB 3FN0H 4FQCH 2G2RA 4Z76A 4G9DB 3IGAA 4NO3A 1DVFA 3VD9A 1AQDB 4LHUD 4YDJA 5FXCH 4QCIA 3GBMH 3SDXF 4X6DB 5IK3B 3WFHA 5TH2A 1E4XH 3QIUC 1U95B 5CD5D 5TQ2H 1JBJA 3EYQC 1AQKH 4NQEA 3NIFF 4WW2A 4JZOB 3BP7A 1WIOA 2HAZA 3MRJA 3NCMA 5MERA 1XGTB 3X12B 1SMOA 3AB0B 1RZ8B 4UAOB 3JXAA 1LO4L 3EFDH 3O0RH 1LILA 2FCBA 3TF7C 1IGIH 1J5OH 3B8SA 3P9MB 1XEDA 3EOAA 4G8IA 1XGUB 1K4CB 4P5TC 5MHSD 1ZLSH 3SDAD 1WAAE 1GRWA 4M62L 3LKSB 2AJYH 1J9CT 3ESVF 4LPYA 1EK3A 4KDTA 2YXFA 3MZTA 4L3CB 4WTXA 5F3HB 2W0FA 3HHRB 1YY8B 3QNXA 3DRQA 2DMCA 1KXQE 1B2WH 3S5LA 4LKXA 1YJDC 2IQ9L 3AM8A 4YNYB 4N0RA 4POZC 1CT8B 5BMFL 2B1AH 4Y1AD 4Y5YC 3VFOA 3G5ZA 4Z8FH 2EC9U 3LKOB 5DC9B 3U4EB 1I1AC 4OM0L 3C6LA 3BMWA 4FTVB 5HHVH 5HDQH 3I84A 3H0TA 5HHVL 5E0QA 1RZJL 2ZZUT 3T09A 2F5BH 1DCLA 1O7VA 2Q8AL 1HIMH 4I2XE 1PBYA 4M61B 5ERWB 3KG5A 1F8TH 4LRNH 2E9BA 5L2KE 5FM8A 1C16B 2XXCB 4V1DB 2H32B 3KLAB 1ZTXH 1EX0A 1IGMH 3KNBA 3QDME 3SE8L 2P1YA 1VSCA 3OJ2C 1A7BA 5J4MA 3KVQA 2IADB 1KPUA 4MA1B 2W0FB 2BNQE 5JHLL 2HT3C 1GH7A 1FNEB 3V6FA 4YHLL 2Y1VA 4NGHH 2FJHB 3QP3A 1ADQA 3I3BA 1AXSA 1PQZA 1F3RB 4JM4L 1P5VA 3TZVA 2CKBB 4M03A 4Q0XH 4EZMA 3C5ZA 1AQKL 1UB6B 3HG1A 4Y16B 1A14L 1MRDL 1AO7D 3O41B 3GSUB 2GW5A 5KVFH 5DC4B 1EGJA 2P49B 5EH1A 4Z7WF 4D0BB 3LZFH 4WW2B 3MRKB 4OLUH 4P46B 3G08A 4U6VH 4RGOH 2R2BA 1WV7T 3LMJH 4ZD3L 2ZUSA 2YSSB 4ORGB 1C12B 4CMMA 5TE4L 5DWUH 3P4OA 3BDYH 3TH3T 4EI6A 1QFWM 4M8QB 3LRGA 5EIQA 4ZFZA 2X4TA 4YX2H 4U1LB 4NFBA 5F8QC 1FORH 4G43B 1OARL 4KROD 5HYQB 3PXHA 2D0FA 3PXJA 5C08B 7FABH 2V7HB 1FCCA 1J0KA 1I9IL 5HHMB 4I13B 4JANA 4BA8A 4C59B 4MQ7B 1ZGLA 4MB5A 3RQ3A 4ONGH 5ECJE 2VLJE 2J88L 1KB5H 2FHFA 2X7LA 1NFIB 4GFTB 3RL1B 1G0DA 3ARDA 3PJSA 1IAOB 3UTQB 5F44A 1L0YA 4XBPA 1NGWA 4RAUA 4AEFA 4FXGB 3U9PH 3RFZC 1ZVHA 1KEGL 2LTQC 5E94A 5EC1B 2B5IC 3EOYG 1INDL 2MOVA 1DBMH 5D7LA 5AWNL 1PGRB 2XRAH 2YPLE 4TTDC 3J8F7 2MQCA 12E8H 4J4PC 3C5SA 3O45B 1IKNA 5C0JA 2R1WB 1INDH 3STLB 5HHMD 4Z7OF 3L3HA 4EIGB 1EVUA 1F4AA 4KK9D 1NPUA 4ZUSB 3NAAL 3D3VD 1I3RA 1MH5A 4NO0B 3B2UD 5D2NB 1CVRA 1BZ7B 4FXGA 5D1XD 1OTTC 5L6YL 1EFXD 2I24N 4QHUB 2E7BA 3OB0H 5ITFA 2FRGP 3OKEB 2A2QT 2B2XL 3GJEA 3H9YA 5KSBB 2K3TA 4MAUH 1OQXA 1SQ2N 3MO1B 3QIBD 1ZE3C 4U1KB 4XCEB 2AI0H 4WWKD 3TPUB 1SBSL 4I3SH 4NPYB 4RISH 5I1DA 1CGYA 1RJZA 4MD5B 1MFEL 5E08L 4G7VH 3MJ9A 1NL0H 3GSXA 3RTQC 2MQ3A 4ZSOA 2ESVB 1KACB 4U3HA 2QTEA 2DQTL 5IW3A 3VXUD 2V2WA 3VXUE 1HHGA 4OLUL 1AXTL 1BMGA 2V2TA 1FYHB 3O9WC 4I2XA 1IGFH 4PJ9B 1XCTB 4GOSA 2ADIB 1MI5A 3QG7L 5HY9A 1MIEL 5DR5H 2DOCA 1N64L 4WO4D 5CZVL 4MNGB 4FABL 4CKVX 1KIRA 4Z7VA 4Y5VB 3C6LD 2NTFB 2M26A 4YDVB 3UPCA 4NN5B 5JNYB 2CKBA 3W9DA 5DLML 3QBTB 5F7FA 3MNVB 3EIFA 4Y1AA 3N9GH 1WBZA 5E95B 4PJCE 2BFVH 4X80H 5CJXC 4DGIH 2ZUUA 3ZTJH 3MRPB 4APQC 4OLVL 5T3ZL 4GMSH 1MFBH 1WSST 3OXRB 4I3RL 4H8WC 4R7DB 3BJ91 3CDCA 4NOBA 4XPAH 1U8QB 2VNCA 1Z0MA 4L8SA 1C1EL 2KDGA 1ZT4A 3BH9B 3O8XB 1KIPB 2V5YA 5GRJL 5DLMH 4LF3A 5DJ6A 3GBLA 1F8TL 4N0FA 4EJ1C 4LSPL 2EDJA 2LABA 3LEYH 4WI2A 4UDUA 1CYGA 1AC0A 2CDEA 3AREC 1F11B 4OAWA 5IOPB 4WU7B 2WANA 2ZUQB 3RI5F 3KJ4C 3CFJA 3G6DH 2JELH 4NKMA 1OAQL 5F97E 2VDRL 3RUGE 4G6MH 4DK6A 5I1AA 2C3VB 3GHEL 3KPNB 2VXTL 2QR0B 4J6RL 3PWNB 4G6FB 1RUPH 4GSDH 3OB0K 1WZMA 5CSGA 4JO3H 4P5MB 2F19L 1NL0L 4G6AC 2FX7H 2A77H 2X10A 1GC1L 2DD8L 3IDMB 3AREA 4OJFH 4LSTL 2X4UB 3T1FB 4ENED 4ZUWB 3DVFA 4PRBA 3VWJD 3WUWA 3IFLL 1WITA 3OXSB 4RMTA 2ZCHL 5JW3L 1IGIL 3VD4A 4GMTL 4PYGA 1KGCD 1Q9WA 5INCB 4GMTH 3C5ZC 1AGCB 4ZFOL 4GW1B 3GKWL 4PJCF 4FZEH 1MQ8A 5FYLE 4JFHD 4WVRA 1C5BL 2WNGA 4QHMA 3T77A 3WUZA 2HJKA 2EXWD 2O5ZL 4K9EC 4NKOA 2ATPA 1OAKL 1EO7A 1Q1JL 3MUJA 2VL5A 3PL6C 3GBML 4JFYA 3WO4B 1RUKH 5DJZB 2VYRE 5D1XB 1BD2A 2AJ3A 4AY0A 3FN0L 2VIRA 4OF7A 4EN3B 2DLFH 1JGEB 3VFPB 3HE7D 4HWZA 1R3JA 1ACYH 4WJ5B 3QFDB 3MLSL 4JPKL 5B4MC 4PJEE 1FH5H 4ZFGL 3SEPA 4WDIB 2DJSA 1A9EB 2SEBB 4OSUH 1G0XA 2Z4QA 2APFA 2EDDA 2HLFD 3Q1SL 3OPZL 4ZS6C 4UOW0 3O8XD 3MUHL 3WLWD 3V4UL 4D9RD 2YK1H 1HXYA 4YDIL 2DQHH 3ZE1E 2IPKA 5IB2A 3LS4L 3K8KA 5CFHA 4AIZB 3RIAK 1FFNA 3WDJA 1BQLH 1F4YL 3GHBH 4NQXA 5A40E 2VLLB 3CVHA 4OCNC 5I76A 3SCMD 4FXKA 5FGBA 2MCPH 5TE7H 5JA8B 5JPMA 5HVHC 4Y4FB 1L0XA 4UQ2B 4FQLH 2CIKA 1JFQL 5FDWB 4NHCL 2NLJB 4P9HL 3B9KD 1RZ7L 4MXQD 2R15A 1TITA 2VDOH 4L9LA 1SVZA 1WBYA 5HGGS 1S3KL 2IQAB 3DGCR 5D2LB 43C9B 5I2IA 5ICXB 3V5DA 1EDQA 1DLHA 3VRIB 2QADB 4KZEL 1VGEL 5K9KA 1NCDH 3B83A 5C0RH 3H9SA 3PHQB 4J7RA 2CMRL 2I9TA 5C0IB 1NDGA 2CLRB 3BMVA 3FKUS 3V7AE 4Z78B 1OP3H 4KC3B 1JZ7A 4JHZA 5GS0C 1ZHBA 3B5TA 1N59B 2XZAH 1I7TB 5KVDL 2Z8SA 5DHVA 2VL4A 4YHNA 3D48R 3Q5OA 4JY6A 1LE5B 5EU6B 2YPVL 4JVPA 1MFEH 3FQTA 4XCFL 1G9MH 4F7EA 2G60L 3LPFA 3TJHD 3LV3A 3QDHA 4PP2B 2R8SH 4ZUUA 5DMJB 2H6PB 1WISA 2BHYA 5E8EA 4DW2H 5F7DB 5LKNA 4Q9QL 1HHIB 4KAQL 3AROA 5F9OH 3L1OL 3VGFA 4PJAB 5HDQL 1XGRB 1FVDA 3O6LL 5SX4H 4XVTH 5IGXL 3M17A 4ZQKB 4DUVA 2YUZA 3SO3B 1Y18B 1IRAY 4XP4H 5AYQA 2Z0BA 1PKQA 5DRNB 4XX1G 1G7LB 3EDDA 3QH3B 2CKBL 4MCZA 4DN4L 4PRAA 5T1LD 1OD7A 3O6LH 1RMFH 2BZDA 1WC7B 5EU6E 1PYWA 4TSAH 3ARGA 3GSNA 1SJVA 4ISVA 4Y4FC 12E8L 4TYUA 3R1GH 3MUY1 1U8PA 1XF3A 4M4RA 4PJFA 4NCDA 2IFFH 2Z8RA 3VXQB 1MHCB 3VI4F 2GIYA 4K55A 3UJJL 1N5AA 2X4QA 3AU1A 1G7LA 1EEQA 3MZGB 4LLYB 4FQ1H 1V3LA 1BVKB 2H8PB 4M4PA 1P84K 4HKZA 4ZFFB 3FONB 5MHSE 3O4LA 4ZFOB 3CLFL 3SE4A 4GAGL 1NJ9B 1HHIA 1QZ1A 5GS0L 3PE9A 2HFEA 3TIDB 1BQHA 2XY2A 4WGVB 4X4MA 3BGAA 4F33B 5JR1L 1WZLA 3EYQD 4ZO9A 4Y2DA 4GBXC 4XXCC 3S35L 3ARBA 1F58L 1RURL 4OCRH 3TT1L 1CBVL 4OCRL 4FZ8L 3A6BH 5T5NG 3NTCL 4PV9B 3NCCB 4J1UB 5GSRA 4X4YA 4XCCL 1OP9A 1H15B 1AO7E 1OSZA 5DHVB 5GGQH 3MRMB 2A6KA 1HYRC 4PB0H 1H8SA 3FJTA 1BIHA 6CGTA 1OAZH 1AJ7L 3CPLA 2BVPA 4OCSL 1KCVL 1UEYA 2PYED 1E4XI 1ZHNB 3WFBL 3A6BL 1NGXB 3WYRA 2GITB 4LL9A 3PWJA 4PYHA 1PLGL 2R0LH 2ITDB 4YDIH 1CE1H 4XP6L 3OBAA 1GGIL 2EO1A 3WEXA 1BP3B 2EH8H 4OB5L 5HJ3B 2YD9A 1NLBL 5A43C 4JO4L 2AEQH 1ZS8B 4WUKH 4Z9KB 1TETH 3T3PE 4LSRH 3G5VA 3OAUL 4Z7UE 4HS3A 3BKCL 1JWSB 5E2UL 3HLAA 5DHYB 3PGCB 3T0DA 1GHFL 4HS8L 3AGVA 4NO5B 5DQJB 1X5HA 3KPPB 5GJSH 2X4OA 5FKPA 2VITA 4NQXB 4MJ6A 2AV7B 3BO8B 4KTYA 4L4VB 1QQDA 3KJ4B 5ALBL 3RKDC 1VFUA 4P4KC 2E6PA 4N9GB 5B21A 2IPKB 1U8LB 1JPST 2FLRT 4PRPA 1E28A 1WCQA 2CXGA 3BH8B 4LPVA 5CILH 4PJCA 2FO4A 3MXWH 1ZLVK 4DCQB 5JLZA 3OKNA 4P23C 3ULUF 2Z4QB 4HZAA 4ZUVB 2NY3B 3VFRB 4IBLT 4QOKD 3QA3B 2EKJA 3P77A 1K8IA 1OGAA 4Y19B 2QSCL 4ALAH 4Q74A 4KKBC 3NIGF 4WFFD 3QQ4A 4XTRC 4O9HL 2VDKH 4JFEA 4XVSH 4X9HA 3WFEL 4Z8FL 3DHJA 3FO0L 3WIIH 4LGRB 1GGUA 3HNTL 4I5BA 5EZJB 4C57C 3VXME 1NEUA 5KOVC 1GZQB 1B2WL 4IRSB 5JW5B 2X4OB 5HHPA 3PABA 1II4E 3K46A 3KPPA 1B88A 4D0CB 3TNNB 1OB1B 2NY4B 5ETUB 5BO1H 5F9OL 3T0ED 2VISB 3KPQA 3DSFL 4KAQH 3WIIL 1I9RH 1I3UA 4G8GA 3I2CL 4ORZC 1TNNA 3R4DA 1G7IA 4HIEA 5INCA 3UTSB 5ID1A 2GSIB 2UYLA 5I8EB 2AXGB 4P9ML 5E7FA 1NCUA 5IKCB 2ZP0T 5CAYB 3WFCH 4EOWH 3N0PB 1F5WA 4PRBB 4R0LA 3SKJL 1T89C 1F00I 3EOBB 4TUOB 5C86A 1A8JH 2F74B 3SKNB 2WAHA 2CDGA 3IU4H 4K94H 3GSOA 3OTTA 5LG1A 4PRID 5HGBA 4CUCA 4NKDA 4PD4J 5IFHH 3V8OA 3KWWA 4M7ZB 4M6NH 1JFQH 5K9OB 5I1HL 2QL1A 3ZHDA 2QR0A 5IB3B 1HEZA 1IC5L 5K9JL 2JB5L 3CZFB 5DVKA 3FOLB 4XBEH 1B4JL 1FL3A 5J12C 1U93B 2GJZA 4JKPL 1BQHB 3G9VA 3IDNA 1FZOA 2H2PD 1CZ8L 1DJSA 2BC4B 5GGVL 3IU3B 1NJ9A 4Y16D 5DJDA 1T2QL 4MDIA 1DANU 1A1NA 5DJ8B 4HKZB 1OAYH 1K4DB 2P7TB 3U6RB 5E4EB 2EDXA 1NBVH 4IOFC 1U8QA 4M6MH 2HRLA 1P9MC 3ZTNH 5FYJU 3U48A 1ORQB 4E42A 1HHHB 4WU5B 2DLFL 2ZUQC 5IJKA 1LE9B 4I48B 2VAJA 1TENA 1YUHB 3JWDL 2VZ3A 5JIHA 1BF8A 4Y1AB 1QSFD 2DRUA 5CZXC 3W9DB 4P3CH 4GS7B 4G6KL 1K3ZA 4IRSD 1CXHA 3ARDD 1AHWB 1DBJL 1BJMA 1KTLA 3I02B 1YEEL 4OZIB 3P0GB 1NKRA 5GRWA 3G6JF 1GOGA 1FG2A 3QH3A 4Y2OA 4HXAL 4PJ9A 3LEVH 4DVBB 5FO8A 4WHTA 1OLZA 3L7FB 4YEEA 4R6UA 4Q97A 5F7YC 4LPXA 1S7TA 1VENA 4H0HB 1B3JA 4EQ2A 5SWQA 2YBRA 3O3EA 2YRPA 4ZPVB 4RBPK 4Y5VC 1RZKH 4GAFB 3ZTJG 2WINA 3PGDA 2G75B 4MD5A 1MJUH 4WU5A 4JFHE 3SN6N 2PO6A 5IR1B 35C8H 4YXKL 1IQWL 1QLEL 2QQKL 2Y7QB 3HRPA 2DL2A 3T8XA 1CI5A 3RWEA 4W4NA 2W91A 4S1RH 3WDIA 1OTTD 1YEEH 4PJBF 5FO9A 1LE5A 5D7IE 1R24B 1MCEA 2CKNA 1S9YB 3NIGE 1EAPA 4YXLL 2JJUA 4YHNB 4HJJL 1DN0A 3C9NB 3TEUA 3IDNB 4FTVD 1WGOA 1A4KA 3NZ8A 4K3JH 1EXUB 3FB5A 1FL3B 1DE4A 3MV8D 2DB8A 3UBXA 4YFLF 2X6MA 4F8TA 4NJ9H 1J05A 3D5OF 2C1OA 2KQNA 2XNAB 3TV3H 3KWWB 5HI3D 2JF1A 2VDRH 1BWMA 2P8MA 5IB4B 3G6DL 4NO2A 1YPZF 4DEPB 3T65B 4LLUA 4YZFF 5KZCD 2J8UE 3SE4C 5C9KA 2EIDA 4OZFH 4PJEB 5KOMC 4TQEL 3D87B 4PJGA 1MLCA 3L95A 4U2YA 4UV4H 3VGAC 5EC1A 4BH7B 1YZZA 5DQDH 5LWYH 2V2XA 1X7QB 3N50A 1ZVSB 1BIIB 3TA3B 3BAEH 4JFOA 5BS0B 4JDVB 3VG0L 1R6VA 3FRUB 2R56H 4OCMC 2NY7H 1WZ1L 2CUHA 4XP5H 2P24A 5DMYA 3WO4C 1V7NL 2DQUL 4LEXL 1QNZH 4WGWB 1OM3L 2X7LB 2IPUG 4KPHL 2GTWA 2CQVA 1WFNA 5H35A 3HMWL 4H8WH 5D5MB 3KLHC 4HK3J 5ID0B 1U8JA 2D3VA 4UIMB 5FGCE 1ULVA 1FL6A 4AT6A 3PWVB 5E08H 4E41D 1K2DA 4MDJA 5IVZB 2AJUL 3BPOB 2HYMA 2BMKB 3HI6L 4PRIB 5JQHC 4RGMB 5H37G 2AJ3B 3I9GH 5EO9A 4HWEH 2R29L 1FE8H 4U3CA 5JHLH 4FQLL 3QA3A 3RZCA 4MAYC 4XCYB 3X11A 3T77B 3IFPB 3T4AB 4RQQA 4BJLA 5KW9L 3OF6A 3BH8A 3I6KB 3AB0C 2ILLA 4WY7H 3O41A 5T5NF 5TF0A 1T1YA 5E2VH 1F6LL 1KLGB 5FIEA 4NQSB 2FH8A 1SBSH 5DJ0A 4U0QB 5EULV 3L7EB 3FQWB 2XWTB 1TPXC 4LFHD 5D5ME 2KH2B 3CC5A 2ZNXA 4APQA 2J8UB 2IJ0C 3IB4A 4IOSD 2B0SH 4XNMB 2P44B 3J7HA 4L3EB 1R3LA 2A6DA 4HBCL 2C7UA 1JUFB 1JZ5A 3GIZH 4CU7A 4F3FB 4P3WA 4YQXL 4NYLA 4RGNC 4X8XA 4OFPA 4JRYA 3SDXE 3NGBC 4XWOD 4Z0XB 4RMWA 3VW3L 2VXUH 2NY5H 4D94A 4YDLB 5FCUH 4XI5D 4GO6B 4X4XA 4KROC 4FMKA 3B4NA 4TVPL 1WCBB 3RVUD 3HZVB 4OCWH 5E8OA 4KKLD 2BRRH 1NFDE 5IOPA 3RDTC 3MGTB 3QXDB 4N90E 2MKLC 2Q8BH 3WDHA 4IM8A 1XMWA 2B20A 43CAA 1TQBB 4RFNB 4HX1A 4QRPD 4R4NC 4U0RC 3BPNB 3DXAB 2H9GA 5LGHL 4ODUA 4PJ9C 3ULVL 4ZOAA 5FK9B 1KJ2A 5CZKA 1XGYH 4A2LA 4QGTA 2RJMA 4QRRB 2F19H 4R97B 4JFPA 3L3IB 4DFIA 3LH2H 5KANI 4WNQB 3O4LB 3AXLB 5GGQL 3DX8B 2LAGB 1CK0L 4R2GD 1UM5L 3VD7A 1SEQL 3D85B 4MNGA 1G9EA 3VFGH 3GM0A 3MJ8B 1XGTA 4RX4D 5HY9B 2EDOA 3PP3H 4OCYL 3G6AB 3QI9A 4Q0XL 5D5MF 2YHGA 4AZ8A 5DK0B 5DWUL 4JGUA 4PJIF 1S7XA 4J3SA 3ELAT 2FBJH 3JV4A 1P7QB 1RZIA 3QUYB 3BPNC 4NO3B 1OM3H 1JI1A 5J1TC 4AEIL 1UB5B 1TQBC 1MQKL 5B39G 2V5TA 5CSZB 4MD4B 1LK3H 3L9RB 1KOAA 2PO6C 3T0VA 2NXZC 4KY1L 3O6FB 1KN4H 3VFSB 4XCEA 4LSQH 5IJKC 1Q9KB 1OP5H 1VADA 5IBUB 5F7UA 2IFFL 4AMKH 3IXTB 5JPNB 5E6ID 4U1NA 5ITFB 5J1AA 3MACH 3WIFA 4QHUA 2GY7B 2VH5L 3FHAA 3VD3A 3T1WA 4KHTH 3S7GA 4PFEA 4PUBL 2Y9RT 1IGJB 5KVGH 4DKDC 3ILQC 2MKWA 3PWLB 3DV4A 3MGOB 2XTJB 4NJ9L 1CLCA 5D70L 1IGCL 2A9MH 1BF2A 4UT9H 4GG6B 3WHXA 2VZ1A 3ZDYF 1X4ZA 4EI5B 2ERJB 3O6FD 1G7MB 1N8ZB 3FFCB 4O5LL 5T1KD 3BKML 5IMMA 3ZL4H 2CLRA 5CD5C 1OTUD 3QO0B 4OM0H 4TTGA 1MRFL 4WHDA 5C0AE 3VI3F 4N1HB 1KJVB 3CFDB 4XVUC 4ZTOH 1JMZA 1I9RL 4LHUG 1LO0L 3BPCB 4HV8B 5CJBA 4NCC1 3QIWA 4YFLI 1AKJD 4ZAKA 1FFPA 5JUEL 5CEXA 4XPTH 2VZTA 3FT4B 4RZCA 3TO4A 1EBAA 3EO9L 4OIBA 4OKVB 5EIVA 4N0UE 4UINL 1CXIA 4HFWA 2AJYL 4X6FA 3O4OB 1QVOA 4N90D 1Q72H 1W0VA 1YNTB 5MP6L 3U30C 2EDHA 1FL5A 4ONFH 3VFWA 4FXKB 4NQCB 2BVEA 4MQ7A 4OM1L 4OLYH 5AYUH 1QFUH 4O58H 4X7TA 1D9KA 2H1PH 1G7JB 1MIMH 5FYLH 2OR9H 4L29B 1U41A 1WF5A 5C0RL 1I8LA 4BSJA 3S6CA 1DQJA 2LVCA 1G6VK 1EV2E 1M7IB 1FGNH 3BE1H 4P3CL 4LARH 1C12A 4C56A 1HXMA 1NCBH 5GRUH 4GQ9L 3WXWL 1C5DB 4KK6D 4PJGE 3P30L 4ODSL 5I1EL 1HN1A 1R3JB 2MHAB 5TE7L 2MCPL 3DARA 3ZYOA 4X6BA 1JGLH 4XHQA 2AJSH 1W72B 4N0UA 1BQLL 5D1XA 2BSTA 1ZK9A 5DJZA 1AGEA 5CIPA 4WUKL 5FECA 4HIJB 4WV1A 2RBLA 1S78C 1NCAL 4ONGL 3RWDB 4JJ5B 4NIKB 5EG6C 1P4BL 4N0YL 4NNXB 1P4BH 4ZOBA 3JBG7 2Y5TB 1NBZB 1UM4L 3RGVB 2DWDB 2RCSL 1T0NB 2IADA 3GGWA 1FH5L 3ALPA 3DIFB 2D0GA 1AGCA 2X4RA 4UNUA 3CLEL 1MF2H 1ACYL 1J0IA 2C3WA 5K9JH 3RVVC 1N7MH 3OXSA 5GZOC 3D2UD 3QDGB 5FECB 4PLKC 3GMQB 3OR6A 4S1QH 3GMOB 1SJHB 3L5XH 3PHOA 4YAQB 1UYWH 1YJDL 4N0UB 1YQ2A 4M1DH 3BGFC 2J8OA 2WSKA 1CBVH 4X6BB 1Q1JH 3VA6A 2UWEF 4KRPB 3CXDL 2XZCL 4XXDA 4MJID 3O3UN 4WFHE 1BQSA 3C6LB 4PR5B 4ODTH 1E4KA 4MLIA 1QBBA 2DYPD 3CH8A 5FOJA 4O00A 4ZS7H 3RHWF 5FYLL 3BYYA 1MIML 5C0NC 4KQ3L 1R3KA 2B1HL 3Q6GH 2OBGA 5AYUL 4XPBH 4JHWH 2H26B 1JWUA 3DBXA 4KKNA 2EE2A 3L3DA 3HE7C 3F5WA 1LQSR 1QD0A 3KYKL 4KJQC 5BOPA 1SHMA 2W59A 1YEIH 2XQYK 4JQIL 1G6RB 3FQNA 4X7TB 2J4WH 5F6HI 2WK2A 4Y4KA 1T5XB 3TYFA 3QDGE 3I6LD 4U2ZA 3PHSA 3QEQB 1N2RB 3ZSTA 2ICES 2R2HB 3KYMB 1JTPA 2NY0C 5SX4I 1OAUL 3WL9B 1FNGB 2YPKA 4L1DA 4S1QL 4R7DA 3UTTA 1V5JA 3DYPA 3O6KL 3QI9C 3RWDA 3ZMRA 2E7MA 3O6MH 5F1KC 3KHOA 3VDAA 1TPXB 3MNVA 1UM4H 1MCWW 1DVFB 2JJSC 5BMFH 3WKMH 2MPAH 3C2AH 3CH1B 1EZVX 3IYLW 4UT9L 3WNPA 4YHYC 3BGMB 4O2FB 1ORSA 1AI1L 1FIEA 2MHAA 5DD3H 1E6JL 3X13A 3U82B 2OMBA 4U7MA 4UTAL 4MB3A 4EI5A 5DRXB 3FL7A 5DDHB 2NY6C 4UBDC 4N5EC 3PL6A 2AXFB 2QEJA 4L9LC 3PWLA 4P2QA 1FZJB 5SWZA 3MLZH 2GQHA 4AL8H 2OQJA 4UT6L 4Y0GA 3UPRA 3O0RL 3RIFF 3U0PB 5I8KH 3OKMA 2EIEA 3DO7B 3BOVA 5C6PB 1D9KB 4PRHD 5IBTH 2WM0A 4M7JH 2HFTA 3H7BB 1EGJH 1VFBB 1BAFH 2OSLA 1IM9B 3QXWA 1FVEB 4NJAH 5HYSA 1MCLA 2VZOA 2ORBH 5TDPA 3VFSA 1S9XB 3IXAA 1CL7I 3MV9B 1TIUA 4DJMA 2YEZA 2YD2A 5F9DC 4C55A 1JNHA 4DZ8B 5ADOH 5CEXB 2C1PA 1JHKH 3VE0A 1MJ8H 1D5BB 5MP6H 3D69A 4WFEE 5T5FL 1UB5A 1XF1A 4OZHA 3QDMA 3QJFB 5BOZG 1T1ZB 3CFKB 3ZSSA 3G5YB 1A3RL 1MH5B 5CEYB 1FGVH 1FHGA 4QNPE 4JVUA 4K3EH 4WTWA 5FYJL 4LAQH 4WUUE 1IL1A 1HH9A 3JZ7A 4XNQA 3O45A 1MUJA 4ETQA 4M5YH 1KXVC 4L4JA 3FB6A 2DQGH 5BRZE 1IC1A 3NIFE 1IGTA 4DEPC 1G7PA 4ZXBA 1S8DB 4PGCA 1YPZB 4GAGH 1EHXA 1U9KA 4HT1L 1NC2A 4I4WA 3MLVL 3MROB 1G7QA 3QIUD 3MGOA 2JCCB 1G9NC 1T04B 2PN5A 4OQTL 4WNQA 3S36L 3DYOA 2PF6A 3SY0B 4N1EA 2YC1A 3NIDF 1QR1B 2FR4B 2D7PA 2R4SH 2GTZA 4JPKH 4LEOA 1QFWL 2W9DL 3DXAA 4CGTA 3ROLB 1IT9H 4OCWL 2YD4A 5KSBF 1NFDA 3OHXB 2CIIA 3O6FA 1ZA3B 3F6LA 3O2DA 3QPQD 2FHCA 2Z31A 2YUWA 2WWKT 5DO2D 4KXZI 4X98A 2X1PA 4MNQE 2Z92B 4NN6B 4UNTA 4OD2B 4OLZL 3HZVA 4LSQL 1ERNA 1AR1C 5E6ZA 1S5HB 5C0EB 4U1LA 4U7KA 5C1MB 3HE6D 2VDNL 1OP3K 2BERA 4ACPA 5IHLB 5IBUG 1EBPA 5M95B 2M1KA 1JPGB 4GRLD 4DAGH 1GAFL 4XVTL 1YMMA 2ZSWB 1W2KT 1A2YA 1ED3A 3KJ6H 2X4SB 4PREB 4UQ3B 4QOKB 4CW1B 5TF1L 1DUYB 2W0LA 5I1JL 2G5BA 4ZTPH 4R4FL 3V5HB 1MEXL 4FG6C 3VXPB 2HG5A 2FWOA 3V7MA 3MJ9H 1MHHB 4I0PC 5KG9A 5MEQB 1PQZB 3MRBA 3K80A 2YPLA 3MLPA 1SEQH 2ZG2A 4QYOA 5E00B 4GW4A 3HI1B 5ESAA 2Z35B 3L6FB 5TE4H 5IT2L 5DQ9A 3F7VB 1OPGL 1BM3H 5J6GB 3B9KA 1U3HB 3WMSA 3QUML 4FXLA 3QRGL 5D1ZD 4HHAB 3O2DH 1YN6B 2AAVA 1XGYL 3G5XB 4V1DA 5E70A 2AK1H 4Z7VE 2QQQA 2BCKB 4NKIH 4OFIA 1UH3A 1FBIH 1LO5B 3LN5B 1G1CA 5EU4B 4Z95L 5EU7C 5IVZA 3NPSC 3V6ZB 1K2DB 4MDJB 1ZT7B 2XPGA 1QPPA 2VDOL 3FFDA 5DMGC 1OCWL 4MD0A 1NCNA 3WBDA 2PXYA 4OUUB 4EDWL 2GCYB 2V6HA 4OLVH 5CEZD 1EHLL 3G5ZB 4JN1H 3MLXL 1MVFA 1Q0XL 3BAEL 4PJDA 1F4YH 1GGCL 4Q2ZB 4LKXB 4U6HA 2FJFB 2BHUA 5E9DA 3LS4H 4OUOA 2Z9TA 4YGAB 2D9QB 4KK5D 3U46A 2PW1A 2W60B 3HAEA 3EO1A 1JNLL 4TQEH 1DBBH 4R3SB 3SE3C 3BIBX 1X7QA 4PGJA 1KTKE 4MZ3A 4PJAF 1L9MA 1QLFA 4XP1L 4UOJA 1XR9B 3MNWB 2XWTA 3X14B 1NSNL 3HKFA 2JTDA 1NGYB 1G9NH 1HK6A 1A1OA 4QNPF 2IEPA 4JFQA 2Q6WA 2HFGL 3TBSA 2PETA 3NABH 4GLRH 4YIQB 5BVJB 1CQKA 2FSEB 3LAFA 2Z31D 3GSQA 1CDJA 4NRYA 5CHNA 4BQ8A 2IAMC 4MNHA 5A3ID 5EUOA 1ZV5A 3MLRH 1LO3H 4QCIB 4PIRF 4PJ5B 5HDOA 2QKIB 2E8YA 3KPRA 3QXUA 2BMKA 3DTXB 5D4QA 4DTGH 3HTLX 2Q87A 5EBLA 4YE4L 3KPLA 3VXRE 2EKSB 3JWNC 4OGXH 1A9BA 2N56A 5KAQF 1FL6B 3DVIA 2OM5A 3BX7C 3KYAA 4M5YL 2YD5A 4XB8A 2R29H 1A1MA 4J2XA 3FO1A 3O3DB 3Q3GB 2XI9A 5IIEA 3D0LB 4JRWA 4ZPTB 2LE9A 1F6AB 2GK0A 5LQBL 5JOFB 1QEWB 2B4CC 3P4NB 2LV4A 3RWEB 3WSQH 3QNYA 1NBQA 5E4IA 1A7PH 1AKJB 3TP4A 3RDTD 1J1XH 2UZYB 1ES0B 3QZWB 4P4KB 3VFVA 2DKSA 3NFPA 1I7ZA 3REVA 2QADC 4NM4L 4LSVL 5B38A 3HC4L 4RGNE 3WHE0 2OP4L 2QHRL 3CFCH 2DQUH 2AGJL 3WE6B 3GI8H 3C6LC 1SY6L 5T1KB 4NQCE 5EBMB 1HHJA 4QRUA 4Q6YA 4GKOA 3BPLC 4KRPC 1ZLUK 3FT2A 1GL4B 5HHNA 4WHTB 2DDQH 2QQNL 1KENL 1J1OL 3F62A 2BY0A 3QJHA 2ZUWA 1TJGL 3ULUC 1U92B 1TZHB 3RVWC 4JPVL 1Y6MR 1MCPL 3F58L 2P8MB 5DF0A 5IB4A 4AH2B 3SQOL 3TYGH 1KTLB 4NZTL 3V4VH 5HGHB 2XT1B 2VTFA 4OCXH 2R9HD 3C60C 1PX4A 4X8JA 4ONHB 4TSCL 5EZOL 2ADGB 4ZYKA 1A4KB 2D03H 3OKLA 3QULA 1TZGH 4WO4A 4BZYA 1IAIL 1JPTL 3ZO0A 4TPRL 1DQLL 1HHHA 5F72S 1JGVL 3FMGL 3TA3D 1EAPB 4PJIE 3M1BB 1MHPL 1MCKA 3MREB 1BFTA 4NNPL 5C0AB 4WEBL 3MFFB 4KZDH 5F6HJ 2Y7QA 5CBAB 2ED7A 1W0WA 1U91A 4XBEL 3IU3A 4KGLA 1LK2B 2HJLA 1RJLA 4RA3A 5GGSA 3EYUL 2Q76B 4WO4B 1VKXA 4H1LH 4FFYL 1IC4L 1YEHH 1JP5A 3NA9H 3CDGB 1NUDA 1JRHI 1U58B 2EZ0D 4JKMA 3SDDD 5F1NB 3LPWA 1IZKA 2DKMA 3L7FA 4NC0B 3MR9A 5F6IB 3SKUD 1DLFH 1MREH 1A14H 2I9LB 4NSKB 3SDYH 4UNVA 5IW6B 2BXZA 2DTML 5FO8B 4Y4HD 5ESQA 3TIEA 1I3VA 3WFCL 1TZHA 4EOWL 5F3BB 3STZB 3LVEA 4NP4H 4CVZA 5I6XB 4XAKD 1U92A 4TUJB 5C0BD 5FGBC 3FB8A 4LLQB 3ILQD 1VEPA 4PJIB 5HGAB 3IRPX 3K3QA 2E8ZA 4R0LB 1J87A 3O4OC 2JB6B 4JFED 4LKCB 5JXAL 1U8MA 3M07A 4GG8B 4MA3A 5IKCA 1CGSH 4GW5B 5BO1L 1YN7B 4X5LA 3BD3A 3EGSA 4S1SH 2Y36H 3PQYE 3EOTH 5D7LD 3RWIB 3OKDB 1CIUA 1OLLA 2CDFB 4NCC2 3T2NH 3P73A 4MAYB 4IEFB 4P3DA 5DD6A 2I5YL 2Q8AH 1EFQA 5CS7A 2FZ3A 5TDNA 5DFTA 4CVWA 1MFAL 4YXHL 2BVYA 1KLUA 2HLAA 5I30H 2VXSH 5LXGH 4XP1H 4YLQT 3KPRB 2XRAL 4H26A 4GBXA 4RFOH 2N7AA 1HEZB 2G5RA 4LBEA 1JGDA 2UUDH 5CINL 5I9QB 4F7PB 5HYJA 5L0QC 2COQA 3C5JB 2OMNA 3GSQB 3UTOA 4U6YB 3PWPA 5I1LA 15C8L 2DLHA 1AD9B 3D39E 3BD4A 5EORH 4E41B 1UH2A 1T7VA 1CL7H 1V7ML 1CDGA 1AGDA 2K7QA 4G8EB 5GGRA 1A6UL 2F54E 4LIQE 5D96B 2NXZB 1QLFB 1YEFH 4MLSA 5GPRA 1ITBB 2DI7A 2C4FU 3PQYA 4TRPH 5F1IB 5BZWB 3UTSA 5ID1B 4QTIH 4HXBL 1UG9A 4HMCA 1ND0A 3RTQB 1TVBB 2OXHA 4G8GB 2XFXB 1ND0B 3RTQA 4Y4HA 3MGAA 3L5JA 5CKGA 5D7IA 4NWUL 4IOIA 2FBOJ 3MRFA 3OR7A 1OB1A 1INQB 2VN7A 3WS3B 3RX5A 5DUPL 1GZQA 4P46D 5D7JA 3RVXC 5HBBA 1NGXA 5LCVL 1C8PA 3ES6B 2MNUA 3E6FA 1KCUL 4JRYE 3SDXA 2WIIB 2UWEA 4UB0H 2J7LA 5IQ7L 2XKUA 1N6QH 3BP4A 5DEGB 1XH3A 4BKLA 5I16B 3W11D 1QSEE 1KULA 1MCCA 3VFMB 4JFFE 1LO2H 3BDBA 5EBWA 3D9AH 2C9AA 4PV9A 4FQIH 4HCRH 5I1LB 1LO0H 4JM4H 4Z7QE 1WIPA 3C5JA 3KYKH 3ULSA 5D2NC 4JCLA 4JY5L 2XG5A 3ZL4L 4AEHL 4NGHL 1UCBL 1QFHA 4XC3L 1U3HA 4YHKL 2D7TL 6FABH 4PRPB 3T0EA 1IAKB 1RK0B 3ARGD 3BEWA 1JHLL 3EYVA 4GKNA 4JAMB 4OT1L 3CXHK 5D1XC 5CJQL 2IH3B 4UT7H 2NY5C 1IGCH 4DKAA 1QYGL 7CGTA 3BRGC 5BRZA 4YFEA 4DVRH 5CWSA 1TVDA 5I8OH 1UM6L 5L0QB 4KMTH 5IEHB 3ARFC 5IF0B 1ZS8A 4TVSa 4QOKA 3VXQA 2AABL 1Z6JT 3KHQA 4CADA 1AHWC 4Y5XA 4F37F 4PY7B 1ETZB 4IDLA 2EIBA 3PWJB 4M43L 1LP9E 2B39A 5L9DH 1TTUA 1FNFA 5I8CA 4LU5L 4ISVB 5I0ZA 1S5HA 5J11C 1NMBH 5F8RC 1I7UB 1D6VH 3A6CL 3QUZA 3SOBH 3EDJA 2BY3A 1UXWB 4N8VA 2A6KB 3MRMA 3NCJL 3OGCB 1RK1B 3ARFA 4NQED 4YHKH 3BKYL 1I1CA 2W92A 4TSCH 5EZOH 3WS6C 4N8CL 2N1KA 3FRPA 5LCVH 1KUMA 4NNYA 5DRNA 5DT1L 2HT4D 3G9AB 4IDJL 4JQVC 1BWWA 3OZ9L 3HFMH 4U1SB 3IAQA 1J1PL 1U58A 3O2VL 3E3QE 4FFVC 2LU7A 3RX8A 2ZCLL 3K81A 4XB7A 3TIDA 4IRJB 4D8PB 4F2MB 1NCBL 5IW1B 5IQ7H 1RJLB 1T03H 2QQNH 2VKXA 4XX1E 2Z8VC 5F70A 3HMXH 2HT2D 4HUWB 4MNQB 1MLBA 4LQFL 2PYEA 2H8PA 5DMIH 4KRNA 5DHXB 3PDOA 4LOUD 4EVNB 3EBAA 2OTPA 3LIZL 2QHRH 1A6UH 2RB8A 3MRGA 3HUJB 1A6VH 3OGCA 1IGTB 4PGBA 4JPWL 4M9PA 5BZDB 4MJ5A 1MNUL 2ICCA 4X8JB 1U8PB 3DYMA 3OMZA 4WI5A 3SPVB 3HS0B 3AFLA 5F7KC 5FV1L 4DQOL 5HI4D 4ETYA 1A7NL 3GMRB 3HZMA 5D7KE 5E9DD 1DLHB 4QHNA 2BK8A 1QOKA 1JNHB 2F54A 2HKFH 2X40A 1KC5L 2VKWA 2YEZB 3G6JA 5FCUL 1UJTA 3B2VH 4E5XA 1FYTB 2F54D 4M7KH 3UTPE 2KKQA 5KVEH 2R1YB 3BZ4A 4Y4FA 2PXYD 1T3FB 2I5YH 4L4TA 3K74B 4DN4H 2YK1L 3JTTB 3TBYB 4IRSC 4MHHI 1NAKL 3IDXL 3BZEB 1RPQA 5FHAL 1NCWL 2GFBA 2EH7L 1KB5B 4TUKH 3S4SG 5B39A 1PDKA 4HQQH 1FIGH 1HXYB 4KJWD 5BXFB 5KVGL 5HHQB 4P2QB 4HG4J 1MCQA 3VXMA 2ICWB 3DMMB 5T1LA 1DBBL 4GRWE 4JZJA 4WWKB 4L4VD 3MBEB 1IILE 4JRYD 5DVNA 5EBWB 5F93C 1I8MA 1N59A 3H9ZA 3BP4B 2VXQL 4IRJC 3MLTB 1U42A 2JJTA 3HPJA 4NQEE 2J4WL 4R8WL 3ARED 3NH7L 4JQIH 1SM3L 2NY3D 2CLVA 3SJVB 1VA9A 4P5TD 3CDFA 1HI6B 4PJ5E 4OF5A 4JFXA 4RDQG 1CD8A 1O5DT 5F7MC 1M7DB 4K8RD 2IBBA 4QHMB 4OGAC 3MFGB 4HWBL 5EC2B 2XFXA 3DI3B 1ADQL 4P0DA 1UEMA 1RD6A 2CO7B 4MXVE 3DX7B 1RUQH 4H0GA 3HCVA 4UQ2A 5FV2A 4GRLA 3NN8B 3HMWH 1DBKH 5GGTL 3RZCD 5ALCH 1YQVL 5I76B 3PWPE 4L8BA 4Y4KB 1JYXA 4U6TA 1DQMH 4BSWB 4OLXL 1FDLH 4P9HH 4YPJA 1YEHL 1CFQA 2ZOKA 1RUPL 4GSDL 1WZ1H 3JTSA 4GS7C 1N7ML 3A67H 1FNHA 5GGSY 1YEJH 4E41A 5C0FA 5FYJE 5DK2B 3QPQC 1AD9A 4PJDB 4XPFL 2B8OT 4OZGF 3UMTA 4KK6C 4ERSH 2IMNA 1NGPH 5IVXF 5FHBH 4E0RA 4Z7NE 3ROOB 2BOBA 5IMOA 4LBEB 3CSPA 2O5XH 2PXYB 3H9SE 2C3VA 2OI9B 1XCQB 4OZHE 3FMGH 3KPSE 5MENE 1IFHL 1NANI 4GAYA 3TESA 2OJEB 3VXSA 4XZUB 1D5ZA 1IE5A 3TVMA 1BD2B 1KENH 1AO7B 3BIKB 3VXMD 1SJHA 3PHOB 3QWRA 1CL7L 4FHBD 1MI5D 1KIPA 5INDB 2CDFA 4LHJB 4HLJA 1GGBH 1C5CL 5I15L 1YQVH 2A6JA 3VDBA 4KJQD 3GFUA 1DQQB 1J1XL 4L4TD 4DGVL 3VXRA 2PTTB 2XY1A 1F42A 2ICWJ 4HBQA 1JWMB 5HD8C 2D31B 2OR8A 4JM2D 3ARQA 4OIAA 2YPLB 4HWBH 1ONQB 1JL8A 3CIQA 3GI8L 5EU3A 4KRMB 4IIQA 3QDMD 3HE7A 3HAEH 4YXHH 1X5XA 5DFVD 3H42L 4IJ3B 3PV6B 4X6CF 3MV8A 4EDXA 2NTFA 3T1FA 2X4UA 3MRIA 1FZKB 5EUKB 3QIBA 2BVOB 2R4RL 4ONFL 3AAZA 5F9WB 1LEKB 1R3HA 1U3HC 3EYSL 3ALWA 4O51A 4F58L 3KXFB 4EQ3A 4PREA 1BX2A 3EDEA 4CU6A 2J12B 3JV0A 3OJDB 1IBGL 4C56B 4S1SL 3UEZA 2R0ZH 2MCG1 3EW3B 1DQJB 1NEZG 4I3SL 3H3PH 2GEEA 2MQ0A 4MYWB 5H37H 3IDGA 1ZEAL 3ABZA 2HTKD 1VPOL 2J1KA 2FECI 3CAFA 5IHZA 5HHXL 3QUKB 1RZGB 3OKOB 2CDEB 3GMMB 4OZGE 2IG2L 4WCYH 2PYEE 2E7LC 1RIVL 5HTSA 1H3TA 4YBQC 4Q6IC 3IFOA 2OL3H 4OFKA 4ZS6D 3TPUA 2ZJSL 5FA3A 5DFWH 5DS8B 5GRZA 3BP6A 4PGDB 3N85L 1TVHB 3MO1A 3T3ME 1IMHC 4LP4A 2QQLH 3EO0B 2VDML 1W0YT 3EYSH 1B0WA 4KRLB 4F58H 1AP2A 2GTZB 3R06B 1QFPA 1JNNH 4YHZL 2Y6SD 1G7HA 4KK8C 4GBXD 2FR4A 5KVEL 3ZT5A 3LQMA 3QIWB 4KKAC 5D1QC 3OKLB 5DK3A 4LLDB 4MA8L 3D39A 4P23B 3NA9L 4NN6C 1IM3A 1T04A 2HKFL 4I3RH 2FJGB 4LSUL 3MXVH 2BY1A 3WN5C 1A5FH 4NQVA 1P7HL 4NQTA 4PJHA 4LDOB 1GVIA 4X7CC 4ZXBB 3FCTB 4W81A 4OZGB 5T1MB 3RX7A 2P42B 4XGZB 5D7LB 5SWSA 1I85A 4AK1A 5F7HA 5CIPH 1BBJB 4TSBH 4OD1H 1A7RL 1JPTH 1E27B 3LHPH 5CZVH 5EBMA 1B0RA 1XZ0B 3MLYL 4NFDA 1MIEH 4X6DF 2YMXL 2FIKB 3B8YA 3KXFE 3OAZH 1T0MB 3RGHA 3SO5A 5JMOC 2X89A 1M05A 4FRWA 4XNXL 4LHUB 4RAUB 3CVHL 5IT2H 2KZWA 3WIFB 5J1AB 1A6ZB 3UTQA 4XMLL 5JPNA 2V9RA 4KI5C 3QNYB 4PJGF 5DURD 5A2IH 3NACL 2NXZD 4LCWE 2IAMB 5JOFA 4D9LH 5H94B 5HGDA 4JB9L 1QRNE 3KS0H 4LPCA 3JWDC 4JANB 5FO7B 4IRJD 1RVFH 4G8GE 5TF1H 2CO6B 3QEGH 4GAJH 1A9BB 1M05B 4KKLC 1CG9A 3SDDA 3GMLB 3OKMB 1OAUH 5DYOA 3QNZA 4CRPA 3RAJH 2X4TB 5LAXA 2VLMD 5SX5H 1I3RB 1B0RB 3C8DA 1FJ1B 1BJ1J 1D5MB 2EXYC 5C2BL 3GMNA 3DHMA 5EUOB 3RL2B 1BVLA 3MJ9L 2R2BB 1CLYL 2CGRL 4WWID 5GS1C 4XGZA 5C0JB 1O0VA 1V05A 3VCLB 2GUOA 3B9DA 3C5SB 4OGYH 2OK0L 5IB1A 4R2GC 2AK4E 3MPCA 3RY6C 1QSEB 2BOCA 5E2WH 3GSUA 2J5LC 5I17A 1OGAE 3HG1B 3T4YB 4NQVB 1TNMA 1WWCA 3MJGX 4FNLH 4M7LH 1J8HE 4NHUB 3P0YH 1GYAA 5IVXE 2W9DH 4QWWD 4JFPB 1A6WL 1YYLH 2FJHA 1I1RA 2R1XB 3D0VB 4HAGA 4I3GA 3VXOB 3OX8A 4W70A 5IHUH 1F4HA 4XBPB 1D6EA 3UTTB 3IJSA 3MLRL 1K8DA 2DJUA 3PQYD 2VXUL 4YHOH 4KGJA 3I6GA 3C8KA 1JE6A 3EO0A 1Z3GL 1UYWL 1YJDH 3T2QA 2XN9B 3CUPB 4HZLB 1TZIA 1HIML 3N85H 2DBLL 3BESR 3QEQE 1N2RA 4YHYB 5J7CC 3WD5L 1IAMA 3NABL 5I73B 1C16A 5I1GH 3UO1H 5DVLA 4F37K 1KJ3L 1KC5H 3O81A 3QDJB 3QT2A 2XPGB 5E8OB 4PRPD 4BFIB 2V5MA 4HUXB 2XQYG 1MFDL 5EU4A 1W8OA 5HVFB 3B3IB 3S36H 2XICA 1I9IH 1EVTC 1NCAH 1O7SA 4H0IA 5DMGD 8FABB 4KK9C 2V7NA 3OJDA 2WBJD 3ZKNC 2Q3AA 4OKDA 4PLNC 3G08B 4JKPH 4G9FB 4M7KL 2IBZY 1EEZB 1XR8A 1RHHA 3DRQB 2JB5H 1QKZL 4HJGA 5EUKA 1R3LB 4WI8A 4BZ1L 3F7VA 3MRIB 2W65A 4LDEB 5FOBB 2VC2L 4HFUL 5EPMB 1GGTA 4I18B 4QRSB 1PZ5B 2Z35A 1F3DJ 1FAIH 1FFOB 3HE7B 1KT2A 2FL5A 5E00A 3GMQA 3OR6B 4MMXC 5C0AD 5KVFL 3MOBH 2JKXA 2FL5B 3E1F1 2AK4B 3V0WH 5K9QI 1H3WM 1CLOL 3P9MA 1DN2A 2HG5B 5IVOA 4NN5C 5CSBA 2X4RB 4W6YB 4JDZB 1M6OA 5ANMA 4HJGB 1T0NA 1WT5C 1KPUB 1FZMB 3QEHA 2NW2A 3BEVB 1E6OH 4NQUA 1EEZA 3X11B 2W0KA 3RNKB 3E8UH 4DGYL 3TCLB 4LLVA 5KSAB 2QSTA 1I9JL 2IPTL 2APTA 2ZCKL 1T7YA 3QQ3B 4X6DE 3B9VA 5TH2B 1EGJL 2BNUB 3NIDE 1AO7A 3QEUA 2ATKA 3MRNA 4JRXD 4YH6A 3LSOB 4F80A 5DD3L 4AT6B 3LEXA 3MLWL 3HC3L 1XCQA 4UT6H 3MBXL 3ARZA 3WKML 1Z5LB 1KEML 3MRLA 1DBAL 2O5YL 1AFVL 1FNSH 1SVCP