3GSNA

Crystal structure of the public ra14 tcr in complex with the hcmv dominant nlv/hla-a2 epitope
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
199
structure length
199
Chain Sequence
LNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCARNTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDAYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2009-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsnA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsnA02
1OAXH 2G2RB 3P4LA 4G9DB 4LSTH 4WVRA 3HZVA 1VA9A 2X4UA 4ZPVB 5E5MA 2FHCA 3ROOB 1OGAE 4D0CB 5CLTA 3SDCD 3BOVA 4LCCB 3T3PE 5D6DC 2LU3A 4L3ED 3THMH 1SM3H 4I3SH 3BMVA 3D25A 3HZMA 1AE6L 4P5TB 1YEGH 3WFEL 3VXME 4UDTB 1ONQA 2NY0C 1B0RB 1ULVA 4GKZB 1EX0A 3QO1B 4HT1H 4LL9A 5K9QG 1G7IB 3EYOA 3PJSB 1BX2B 1T0NA 2E27L 3ZT6A 1DQTA 5LBSH 3MREB 4OUOA 4JJHA 1UACH 2R8SH 3VFRA 3WNOA 5AD0A 4JM2C 2GSGA 4CVZB 3G6DH 1MCPH 4Z7UE 1JNHB 2HLFD 4GW5A 2CDEA 4NNPL 5C6TH 1KG0A 5DDHA 1BM3H 2H9GB 1I9RL 3TPKA 1KIPB 3MLXH 4GQ9H 3TJHD 1DBML 4X99A 4MCZA 4TSAL 4LAQL 3HI1A 1X5GA 3KJ4C 3OR6A 3LQZB 5DVLA 3ZE0F 3CFEB 1BQLL 3W0WB 5EDXA 4JN2B 1U91A 4NDMA 1DEDA 4TTDC 3U36B 1MCBA 2EH7H 4PD4K 5E6IB 3BP4A 4UUJB 4KI5D 4NQSB 3F7PC 4C54A 1I1AD 1T0MA 3MBED 5BS0E 1KIQA 3QUMB 1MFAH 5KS9A 3PWPA 1IM3A 2WUCH 4HUUB 4F8QA 2FIKB 4UZGA 5GPRA 2R0LL 4RMRA 1C5DA 2AABH 1CXLA 4HS8H 4CU8A 1ND0B 3VWKD 2ADGB 2PW1A 1NL0H 3MLZH 1MI5E 2PYEA 3JWOC 1AJ7L 1FC1A 3QO0B 1Q9LB 1JRHH 3K4AA 4OLYH 3VW3L 4YFDB 4Y1AA 3WFBL 3R4DA 2VKWA 4R7NB 2WBWB 2D9QB 5ESAA 4D0BA 1E4XH 5DRXB 4TPRL 5I1DB 1YC7A 4JB9L 3STLA 4AMKH 2MTPA 1I9JL 2A9ML 2WQRA 1FP5A 4J4PC 4WEBH 5DHVH 2A73A 2PTVA 1SY6A 2MNUA 2MMXA 1N7MH 1BVKB 4D9LL 2JJSC 4IRSA 3D85A 4I18B 1IGYB 2CLZB 3CLFH 2B1HL 3LIZH 2WINA 4K7PY 3DNKA 4MYWB 2J7LA 3NFSH 5D5MB 2GY5A 2X4NB 3DX8B 3LS5H 4U6TA 5IHUL 4BZYA 1WAAF 4NP4L 3DXAB 2VR4A 2FX7H 3MODH 4LBEB 5I8EA 4OV5A 4PJ5E 2VOTA 1KYOK 3OAYK 4JPWL 3IVKA 4CAGA 1JZ7A 2VZ1A 4LLUB 5FA4B 3KPNB 4HWZB 3RVXC 1OAQH 1M05B 5C08B 4ZSOA 3RDTC 1WEJL 4ZFOL 2XQYG 1KJMB 5JOEA 1EAPB 3RGVB 1F6AA 3D9AH 3O4LB 4FQ1L 4KI1A 5LCVL 4OFYA 3ULUF 3TO4A 2RCSH 4I2XB 5IK3A 4P2RD 2V6HA 3FN9A 1MY5A 1OTTD 3LQAL 2P5WE 4PTUA 3TA3C 4Y5VC 4OQTH 3BP7A 1PKQB 3EDEA 1V7MH 3RX7A 3OJDA 4KZDH 2YUVA 3HC3L 1P7HL 5JIHA 4K3GA 4OTXL 4YXHH 4HPYL 4X4ME 3U7WL 3QPXH 1IGTB 4TUOB 1AQKH 5C09E 3FCTB 4JZOB 1I7UB 3GBMH 1NCBL 4MNQD 5IW6B 1WZ1H 1V05A 1OAYL 3GSRB 4G43A 4XRCA 1C5CL 2WUBL 3ULVC 2XKUA 3UBXI 4NSKA 2WWKO 4GRWE 1A9EB 5FYKH 1DBAL 2VWEC 3BW9B 5J56B 5C2UB 1YUHB 3HUJA 3MUJA 1PEWA 4QRPB 3SKMB 1GH7A 2ZOLA 3QNXB 1FSKC 1CFSA 4RMVA 1MCQA 3FQUB 2W0FA 3JV4A 3QR2A 2XTJE 2NY4D 3UXFA 1RUMH 4KVNH 1VGEH 5CEZD 5EFIA 5DO2D 2VQ1A 4F58L 1B9ZA 2C4FU 5D7IE 1HQRA 2D31A 4LLWA 1JWMB 1AXSB 1U8PA 2XXMB 5DJ2B 1UKTA 4CVXB 1XGYH 2ZUYA 3W9EB 1WWBX 4LVOC 1SEQL 1YY8B 3MR9A 2ARWA 1OB1B 5JA8B 5JHDA 3KYNA 4QXWA 4M1GL 2Z93B 1VESA 3QNZA 4LCWD 3M1BA 3QUYB 3NZHH 4QF1A 4JKPH 4MDJB 4LLMB 4A6YA 4PD4J 4G8IB 3QHFH 2A6IB 1JP5A 2HTLD 2GT9A 5HGAB 3O41B 5DK2A 3SDCB 3F6IA 3KDMB 5BZDA 5KZCD 4L3EB 5EPMB 4M1CC 4DGIH 3MRLA 4OD3L 4JDTH 4UILH 5J6HB 2VISA 1OGTB 3TWCL 3GIZH 2JJVA 4UQ3A 4ETYA 1N0XH 4RGND 3WN5B 4YC2B 1YNLL 4KTEH 3KYAA 5DXWA 1E4WH 3ULUD 2MKLC 4KRPB 1CE6B 2V9TA 4YHLH 1M6OA 2ATPA 3ZSTA 1XGRA 2MCPL 5AG8A 1MAKA 3JUZA 4HKJA 1MFEL 3JV0A 4HF5H 1HE7A 3QPQD 1WT5C 1GYAA 4HCRL 4HIHB 5HYJD 3LKQA 5JPMB 1MRCH 4F3FB 5IOPA 3ARSA 4ZG1A 1HWHB 4WUUD 3SDYH 1LO0L 3DURA 4KH2A 3MJ9H 2IH3B 3MBXL 2ZUWA 3D5OF 5D71L 1WICA 4DTGH 4CJ0A 1DSFH 2ZG2A 4EIGB 1Q1JL 4F15C 4U6YA 4XNQA 1XAUA 2Z9TA 4Z7VA 4GG6B 1QR1B 1K8IB 2YPKA 3L3DA 5F7WC 5DD0H 1D7FA 2Z35A 1K5NA 1QBLL 1A8JH 3QHZL 4PRID 4XH2B 2GK2A 3O2DA 5EU3B 4BQ8A 3FB8A 4GAGH 2X4PB 4XNYH 4M1DL 3B2UD 3HZKB 1WWWX 4YBQC 1FAIL 3IAGC 4YUEL 1I1AB 2HJFA 4OZIF 5EG6C 3UJTL 1FGVH 3I6KA 4LSDA 4ZAKA 2XN9A 1WLHA 2CR6A 5FYLD 1JNLL 2BOCB 1KYOJ 3QCUL 3H42H 4D0DA 3PNWA 4M7KL 3ZL4L 4JFDE 1NPUA 3HR5A 4X6DF 1T3FB 4F7TA 2VH5H 1KV3A 2A0LC 4XHJC 1AY1L 1IL1B 4OD1L 5HHVL 4Z9KB 1IKFL 2QQKH 1FDLL 5TQ2L 1A4KB 2X4RA 1FNFA 5HI4D 4ZUVB 1NEZB 4XP6H 4UT7L 1XF5A 5HY9B 3DI3B 2NZ9C 4JFED 4WV1C 1HCVA 1FL3A 5GISL 2AV7A 2AGJL 3KXFD 1CCZA 4GAFB 4AM0A 5C92A 5DQ9B 1YEHL 3F12B 1J05B 2GJ6D 1EO8L 3IDNB 1ZLSH 2XNAB 3WSQL 5IFAH 4NGHH 4JQXA 4TUJB 2X4QB 4AT6B 1UC6A 1EPFA 2X10A 1DQLL 5I76B 3SPVA 4IS6A 4QHUA 4R8WH 3T0BA 3TVMB 1CG9A 4U1NB 1AQDB 1EXUA 3VFGH 3T0EA 3WFHA 3DRTB 3BPLB 5KW9H 5BRZE 1MHPL 1N6UA 5E1AA 5K59E 3CMOH 1GHFL 3RIAF 4PJXF 4NN7B 1MCKA 5ICXB 3UJIH 1JZ3A 4UIMB 1OL0A 2YPVH 1U42A 2HJLB 3L1OH 5I1IH 4FP8L 4P2RB 5L0QB 4KROD 5H94B 1PKOA 3ARZA 2ADFH 2NY0D 4S2SA 3OJMB 5GGRB 1CXEA 2CUMA 3ZKSD 1A5FL 1NAML 3AAZB 1N6QL 1NANH 3QDGD 3BGAA 3NFNA 2FBJH 1HEZB 2AXGB 2V5SA 1UVQB 4P2QB 3BZEA 4PJIA 4EDWH 4GRMA 3O8XA 1RVFH 4JM2D 2C4XA 4M8QB 3UBXB 3ULSB 3OKNA 4MNQB 3OKMB 5EOCJ 4KKAC 1FO0A 3BPOC 5CMAA 1DL7H 4Q2ZA 1QFUL 1BZ9A 1QUNA 3ZKNC 1MHCB 4R0LA 1PFCA 1R3HB 1WZKA 5D96B 2IG2L 4DFIA 4U1KB 2VXTL 4UV4H 3P73A 2RAMA 5CUSL 3HMXH 4R6UA 4TTDD 4ZTOL 1NGQH 1ODAA 4P3DA 1DUZB 1HCFX 5F8QC 3WNNA 2HVJB 4WFGE 5M94B 4U1HB 1KN2H 5A2LH 1FORH 2EO1A 1X5LA 1IC4L 2FATH 1A7RL 1GZQA 1NH6A 4KRMB 1MHHA 1M71A 5JZ7D 3QIBC 2HFEA 4OF8A 5CKAA 4J3XA 3JTSA 3VRLE 2QQLL 4ELME 5EBMB 2VDRL 5F1SA 3WUWG 2GAZA 2VZOA 1RV6X 3M8OL 3FRUA 4KWUA 5D2NE 5L6YL 2WW8A 6CGTA 4LCWB 3BGMB 3D3VA 3MRHB 1TNNA 2X42A 1BQUA 4HUVB 1QHPA 5ISZD 4WI9A 4HGWB 4XNZB 2R29L 4PGBA 4YDLB 1MCIA 5KZCB 2X9XA 3IDJA 2W9DL 3QEQD 2YWYA 4J4PD 1I9EA 4PJGF 1HXYA 2IFFL 4HS3A 3C60C 5GJSL 3VA2C 3ZT7A 1KPVB 4Y2OA 3O11A 1LDPL 1B3JA 2UWEB 5KSAC 3OAUL 1C7SA 5FO7B 1X5AA 1A3LL 4ZUSA 2EDOA 5DFWH 3VMNA 2BK8A 4X6CE 1RPQA 1WBXB 1JGDA 1A1MA 2AXJA 1HHGA 2F8OA 4JFQB 2F53D 5TE7H 2C7UA 1O7SA 4L5FH 1JNNL 1KF9B 1NC4A 4LP4A 4WUUB 1CE1H 4Z0XA 5IW1A 2GTWB 4RMSA 2RFXA 2YC1B 3GMOB 32C2A 3AU1B 4LFHG 4MA3A 1NSNH 3RVXD 5SWSA 1EK3A 1M1SA 1YA5A 5HGBA 1PQZB 5IFJA 2DI8A 4GAJL 3T8XB 3TNNA 1I3RA 4KMQA 4OD2A 4WHDA 2ITDA 1HOCA 2M8XA 2NTFA 5CZXC 3KR3L 3DV4A 3HG1A 1NC2A 1MJ8H 1XGQA 4PRIB 5IB4B 3MNVA 2WLZA 1OPGL 3VG9C 2BHYA 2CK0H 1XR9A 2ESVA 1NCDL 2HFTA 7FABH 4JJ5B 1G1CA 2YSSB 2C9AA 2CK2A 2KUTA 2W91A 1LP9F 1MFBL 4XPBH 1CVRA 5L8KB 1P9MC 1RUPH 3IF1B 5E2TH 1UQSA 3CCHB 5CBAB 1OP3K 1CWVA 3LS4H 1FQ9C 3IFOB 3MRBB 3VD9A 5I15H 4HAFA 1CGYA 1EAJA 3WFDL 2XRAH 1N59A 1MCHA 2PR4L 4Z78B 3SKUD 4ODBD 3SDDA 3HPJA 2C3VA 4NQED 1IEBA 5IEKB 2HKHH 2X4SA 3O0RH 3I9GL 1TVDA 2MQ0A 2VLJA 3P9LA 5F3HA 5F9JB 1L7TH 4GO6B 1L9NA 4OZ4A 4AEHL 1U8JB 5GRYA 2AEQL 2APTA 3BEVB 2VSCA 3BH8A 3KXFB 4UDUB 5SWZD 4KQ4L 5C0FA 5IWLA 4WFED 1QLFA 1T4KA 3GJEA 4DOHB 3S5LA 1BFOA 1IT9L 4PBXA 2GJ6B 1F4WL 2RQ8A 2RR3A 3NIFE 3S5LG 3ZO0A 1S7UB 3IGAB 2EYSA 5C8JA 4ALAL 3LV3A 5I66A 1JHTA 4KZEL 4I77L 4MXVF 1KN4H 2IPTL 4C58B 2R1WB 4JO4L 5EO0A 3S88L 4GLRI 1VSCA 2P8LB 2XZAH 1PEZA 1PSKL 5E56A 3FOMB 3TEUA 3O45B 4N8CH 1UZ6F 1UH3A 1OTUC 1AR1C 3BD3A 4MA8H 2ZUQB 3C5ZC 3MV8E 2VQUA 4MAYC 1U0QA 3W81A 3QEUA 4KKCD 2AK4E 3V52H 4JFHE 2BNRE 3GKWH 1QLRA 4XCCH 1JPGA 4X6EA 5IMOB 4EDXA 5J4MA 1FRGH 1UEMA 1YN6A 2R69H 4KROB 1Q9WA 1KEMH 1WK0A 5D93B 1S9XA 4X0KA 1JIBA 2Q6WB 3S3PA 4YR6B 4GT7A 1INDL 3QDGB 1TJGL 5MI0C 1N6VA 1VKXB 3I3EA 1BQHB 2F8VA 4B5EA 1CFNA 3PQYD 1RIHH 3DV6A 5D2LF 3ULVH 3W5MA 3QUXC 2CDGA 5IBTH 4XP4L 2D7PA 1PGRB 2F74B 1Q8MA 4QHMB 2VR5A 1HHJB 4OZIB 5GS2D 4PLKC 4OZHF 1AHWC 4XC1H 1ZGLA 3WKMH 5LQBH 4YPGA 3W2DL 2W9LA 1MY7A 2N4IA 1FPTH 5DURD 5B38B 1YEFL 4NWTL 1UKSA 2EDKA 4X6DB 3UO1H 4NKOB 3TNMA 4H1LA 4EUPA 2MHAA 2FGWH 1MJUL 4H1LG 1MCSA 2YEZB 1ZANH 3EYVB 1JF5A 4AIZA 3KNBB 4XC3H 1JFQH 5EULV 1A6ZB 1QFHA 1ZS8B 1D5BA 2GITA 5GIRB 2I60H 1H8NA 5CWSA 2YD7A 4HMDA 1H5BA 1RIVL 2GQHA 4OLXL 2DQDH 1CL7I 1U2CA 5E95B 4N8VG 2HWZL 2IBGA 4JN1H 2G9HA 3BVNB 4U7MA 3WXVH 4QOKA 3EGSB 1SY6H 2AI0L 4FZEL 4KTDH 3WD5L 2BY1A 3SDXE 1MCCA 4Z77A 2FCBA 2EYRB 1OF2B 4FQPA 4E5XB 4PJHF 4K8RD 5H2BA 5B39A 5ISZB 4P4RB 3OAYH 5C0IA 3ZTNL 5T5NG 3H0TA 2BCKB 3QEQB 4JVPA 3P77B 1HKLH 4Y5YB 1DBBL 4XCEB 1KJ3L 4S1QL 2X41A 4PJXB 4X80L 3VG0L 12E8L 2Y6SD 3HC0B 1WC7B 1MFDL 3OV6A 1YYLH 2G5RA 2ZUTA 3NCEB 2OP4L 4BSWA 4KKLC 5HDBE 5GS2H 1CDIA 1UFUA 5INCB 3O6LH 5DQJA 4PRBA 3FQRB 2F53B 4Y0GA 3QIUA 2A74B 1YEIH 4PJ8D 3OKDB 5DGRA 3T65A 3FFCE 3SO3C 3VD3A 1HK6A 4YDJB 4OZFG 8FABB 4R26L 1YYML 5T5FL 1U6AH 3NTCL 1NGZB 3VXRA 2DMBA 1G6RA 4UTAH 3MV11 1EZVX 1A47A 1QSFD 2VZSA 4WWID 5EOQH 1DLFH 4DVRL 2VDOH 1F3DJ 1I8MA 4JRXE 2V17H 4MWFB 2B0SL 4NKMA 4J3UA 4CVWA 2AJZB 3FO2A 2DYPA 1ZSDB 1G7JA 3U9PH 4MS8D 3OSKA 2HT3D 5T3ZD 5IMMA 2DQUH 5D7JD 4Z95H 1AGEB 1CDUA 4S10A 4XPHL 4JQVC 4KKAD 1JGUL 2Z8SA 4OLWL 4X5XB 2XTJC 3TCLA 3SKNB 2A6KB 2XPGA 5D7LD 1Q9OA 3DWTA 4NC0B 4EOWH 1B0GB 1U8IB 3C8DA 1NGXA 2CLVB 4NQEB 1DE4A 4KKNA 2O5YH 1D5XA 2QKIA 3ARQA 3C6LD 5EIIB 3S96A 4I48B 1QFWH 2DN7A 4U6HB 4LLDB 3CVHA 4PV9A 5J06A 3OQ3B 4ZUTA 2XY2A 5FUOH 3RU8H 4M5ZL 5EOCH 5SWZB 4HIJB 1RIUH 3CDGA 5GRUH 5DFVD 1BF8A 4WENB 3EOAB 4HWUA 3MV7D 1H15B 4PTTA 1PG7L 3C6SA 3IDGA 4R4NC 3RI5F 3SKJH 1F4YH 4PJGB 3QIBD 1CLOL 3CNKA 4QRRD 5C0BA 4X4ZA 3UTSA 1IKNC 4LVOB 3UTTE 3CH1B 4DKFL 1K8DA 3H7LA 4WUKL 5IB2B 1XH3A 3OKEB 1A6TA 4C55A 5T1LA 1F11A 3X3FL 1CFTB 4JPVL 1H8OA 2VAAA 1MCRA 5TJWK 4G7YL 3VE0B 4UOW1 2JCCE 4UV7H 3BZFB 4YE4H 3OKKA 1KC5H 1LK2B 3I02B 4P4KD 4NQCA 3REVA 1XF3A 4GW4B 2J8UE 5CZVL 3O3AB 1I9IH 2J5LC 4TQEL 4ODUA 3DVGA 5GHWL 1N5YL 4HLJA 4YDIH 2GFBB 1I1CA 3T3PF 3C60D 2A1WL 1GC1L 1WGOA 5T3ZH 5KSAD 3D18A 5C0RH 5DC0A 3BH9B 2NYYC 5CINH 3PQYB 5L8LB 3IS0X 3BJ91 5E8DL 3MLRH 4I0PA 4CJ1A 4X7TA 3O2DH 1LP9B 5IB3B 3BI9X 4PREA 3SGDH 4Y89A 2JB5H 3T2NL 1ZHBA 5EU5A 1HQ4B 4Z7UF 3SGEH 3LQAC 3P2TA 2BSTA 2LVEA 1RU9H 4FMFA 1JN6B 3G04B 4PJCA 2I9TB 1Z9SA 3HHRB 4WU5B 4P2OC 4PRNA 4F15B 2XY1A 3HNVH 3MRDB 4F7PB 1Q72L 1QNZL 4R4BA 1DDHB 5C0AD 4NPYB 5A16B 4NC1E 4UAOC 4K3EL 2PTTA 3REWA 5ANMB 3P0YH 4AEIL 1S8DB 4QHLA 5IIEB 4OF5A 2RGSA 5DWUL 1XCQB 3HE6A 1I3GL 5E2WL 4GXUN 3PABA 3RWDB 1ZEAL 2W65A 4HDIB 4CBPA 5EZJA 1AIFB 3I6LE 2FYYA 2XFXA 4O2EA 1BFVH 1CT8A 1ZHNA 4EQ3A 2BHZA 1I7ZB 3X11B 1S9KC 3PV7A 2ZUUA 4B50A 15C8H 1VEOA 4OIAA 3QUKB 3VI4E 1X5ZA 2IFGA 2R0WH 3MA9H 3L5JA 5D70H 3ARXA 4F7EA 4JFPB 3AVEA 1MCOL 5IHLB 2C3HA 1BBDL 1KJ2L 3O2WL 4PRDB 1P2CB 4F7MA 4XMLL 3BN9C 3T04D 2JJTA 4XCNB 4ELKA 3I2CH 2BRRH 1JGVL 1EA9C 3W9DA 4X7DC 5CJQH 3OG4B 2QTEA 4TTGA 4KUZL 4WV1B 3EZJB 4OF7A 4P3CH 1DBJH 4U1GB 1RK1A 3T0XA 3VXNA 2NX5E 1GGYA 4XZUB 2VL5A 1T5XB 2JB6A 5LGKA 4W68A 4OLEA 5CKGA 1NGPL 1GGUA 1NMBL 1D5IH 3R0NA 5AZ2L 4JDZA 1D9KA 4QRTA 1V7NH 5EOTA 5IJVB 1X6LA 5JMOC 1AH1A 3QDJB 1EHXA 1OGAD 3DIFA 4NN6C 5JW5A 1H3GA 3TBVA 3F58L 4C83B 3KLAB 3HLAA 2D0FA 2HT2D 5ADOL 1S9WA 2VLKE 3VXMD 2F54A 1OTUD 3S3JA 1F4XL 4B41A 3C5ZD 4PJ8B 2R23A 4PYGA 3WYRA 3RJQB 1A7OH 5D2LB 2Z8VC 2GI7A 2DQIH 3QXDA 4OIBA 2H6PB 1S7WA 4WHYH 4HKZB 1G7PA 4NRZB 3WFZA 4JANA 2QQQA 4K3DL 1T83A 5DRZB 5E8OB 1T22B 2BDNH 3CZJA 4OZHB 3VDCA 2DQFB 4RGMC 1QSFB 5I8CA 3L5WB 4YPJA 2CRYA 3SBWA 3LRSB 5BVPL 4NO0A 1P4LB 5HGDA 3ZKQD 5DZOA 2E7LA 4JFYB 2R1YA 2HKFH 4OLZL 3GUTB 2DL9A 5JQ6L 1E28A 1MWAB 5JHLL 5D7JB 3W39B 1M7DB 2ADJB 3QDME 1KCKA 3RWHA 1CXIA 1ORSA 4G8EA 5DJAA 4I4WA 3EFDH 3CFJA 5C0CD 4PG2A 1QFOA 3TT1L 5JUEH 4NO5A 3P3YA 3S37H 4BFGA 3VFUB 4K7PH 3GBNL 2DTSA 4HXBL 5DD3H 2UZIL 5BS0D 3BKJH 2BNQE 4U3HA 5JW4Q 1NBVH 3OXSB 1T7XA 4DZ8B 3C6LB 1GPOL 2N1KA 3A6OA 3VXSB 3WL9B 4AL8L 2HRLA 1RJLA 4UIKH 3S37X 1L7IH 4P23D 5DUPL 1NGYB 4Q9RH 2BC4B 3ZZ1A 5BQ7B 2PW2A 1MI5D 4PJHB 5DRNB 3WFCH 3OHXA 5D2NC 5E8NB 4U6VH 2AS5M 3MV7B 2VO5A 5EZLA 5IEHB 4JLRA 3WS3B 1S9YB 1CLYL 4WFFE 3L5HA 2KZ1B 4QRRB 3L3KA 1AP2B 1KTLB 2HRPL 2VE6A 4G42A 3MUGA 4P48A 2WBJD 4LARH 1WFTA 3GRWH 4EI5C 3IXAB 1XIWC 3S8WA 1BFSA 1JBJA 2YUXA 4HHAB 3IFNH 1W72B 5HD8C 5TFSH 1XGPA 4YO0B 3C2AH 3VD4A 4P4KB 1D5MB 2IPKA 4H25A 3VXPA 4S1SL 1P4BL 1FJ1B 3GMRB 1KGCE 2C4FT 5GSVA 1UXSB 1JL8A 4WO4A 4XGZB 3DUHA 1T89C 3U4BL 1K4CA 4I5BA 3IJSB 5KSAB 1NCWH 4OSUH 4X6FA 4V1DA 4PRPD 1Z9MA 1FV1A 1IGFL 2XZQL 3KPMB 4KKLD 5HHNB 3DX6B 1AD0B 5H35A 2GK0B 1VGKA 2HN7A 3PGFL 3PP3K 5FKAB 3MLSH 4G8GD 1MJ7H 2F5BH 2A77H 4MXQC 4NUJB 4FXLA 2VTFA 2P5WD 3HRPA 1OP3H 1JHLH 1S5HA 5FDWA 1DQML 3N1MC 3AY4A 1G84A 3MFFB 1YPZA 4NZJA 5IROA 3L3GA 4NQUA 4HQQL 3P11L 3B5HA 4K94L 1KCSL 4FZ8L 5C0AB 2NY6C 5C09D 4HG4K 1QVOA 2VDLH 4FQXC 4LEXL 1R5VA 3KYOB 4LVNB 3VG9B 4L8BA 1NGWA 1U58B 5ADPH 2EECA 3BJLA 8CGTA 1S7QB 2DWDB 3PP4L 3BP5B 2V2TB 3BP6B 1K4DB 3ZYJA 1G7HB 2R1XB 1EJ6A 1GVIA 1ZLVK 3WIFA 5L9DH 3DO3A 2YR3A 3B4NA 4QY8B 3TJEL 3IDYC 3LEYH 5EWIL 4YDKH 5IESL 1MFCH 1VEMA 1WCBB 3RJDA 3K4DA 4IRZH 4NJAH 4OI9A 5I1HH 2C26A 5K9JL 2EDDA 1T5WB 4P46D 3FQTB 3RZCB 2XTJD 5B8CB 4XPAL 4K55A 3E1F1 1FGNL 1F3DH 3KS0J 4JHAH 43C9A 5IVXA 3MOAH 4L29B 4ERSL 5DK0B 1Y18B 4UQ2A 3AREA 4KHTL 4YHOL 4M48L 2ZJSH 1TQCC 3HKFA 1QSEE 2EZ0C 3BDXA 3O2VL 2LTQB 4XP1H 4NUGL 4PP1D 5E2JA 4K7FA 4XCYB 4U2ZA 4MAUL 5JR1L 4LPVA 1EBPA 5JDSA 4QXGL 2BNUB 5DYOB 4Y19D 1QP1A 5J6GB 1NFIB 2BVOA 4ZS7L 1UM5H 2NY5L 3ARFC 4QHNB 4R4ND 4JZNA 4OGAD 1JWSB 5DD6B 1FN4A 3ARUA 1MQKL 4ZO7A 1AE6H 3FQWA 3WFEH 2DLTA 5KSUA 3V8OA 4X8XA 5I1CL 4PP2A 3MOBL 1BAFH 3PIQB 5I1LA 5GJTH 2OMNA 4U1SA 3KYMA 2AV1B 1Z9LA 1QYGL 3O6FA 4QXUL 4LKXB 4O00A 2E27H 2VC2L 5EC2A 1N2RB 2OL3H 4TVSa 3RNKA 5DZLA 3BMWA 1XFPA 4M9PA 1S5IH 3FN0L 3CVHL 2H1PH 2H32A 3BKCL 3RBSA 1JPTL 5K59F 4DGYL 5DJDA 3GM8A 4LGRB 1AO7A 1LVEA 4GRWH 5EZIL 2D7MA 2NNAA 4LPUA 1JF6A 1IEAB 3D39D 2Y06L 4NFCA 2VLLB 4JFFA 4KTYA 3VWJD 4BH8B 1UZ8A 3HAEA 4O2CA 2ZWLT 1HXMA 2VDPL 4I3RH 5I9QC 4FABH 4EUPH 3C08H 5EIVA 3RHWK 1TTUA 5FO8A 5I75C 3HAEG 3L3IB 5DK3A 3QEGL 3K4ZA 2NY7L 5C0CB 3U6RB 5K9KB 2Q3AA 3LEVL 2BOBB 1J1XL 3CZFB 4ZXBA 1X5XA 4PJ9D 4MCYA 3L3OB 4Z7NE 4XP5H 2W1NA 4NQXA 2EH8H 4FTVE 1LO2L 2VZ3A 1TMCB 4G7VL 3S34L 1Z9OA 3IDMA 1BVZA 5DI8A 3RUGE 5I17A 5GRJH 3QUZA 3KVQA 4OLUL 2Y1VA 4OIIL 4RA3A 4H0IA 1QA9A 4HH8A 5HHPB 4P23B 2NPLX 3VW3H 3VA6A 4YZFE 4HK3J 3WFBH 1MI5B 2B7DT 4R96B 1I1FA 4NN5B 4HBQA 4YHKH 3RFZC 2DWEB 5T1DL 2P4AB 3K1DA 3NCYS 2JIXD 3QAZB 3EO0A 3T0VA 4G9FA 3J7HA 4M6NH 1YEJL 3STZB 1P7QA 3GJFB 3O6ML 4DW2L 1X3DA 1PLGL 2PN5A 4D9LH 3K2UH 4NBYB 3C9NA 3QA3B 2WBJB 3CUPA 3TBTB 3VMPA 5JOFB 3EOBA 4N0UA 3UP1A 5T33L 4HG4J 1EEYA 3ARDC 1S7VA 1OQXA 5A2FA 3SOBL 4CADA 3DRQB 5JNYB 3VFPB 4H5SA 3FT3B 2GHWB 2EDTA 5KVGL 2F8XC 2FH8A 3ZYZA 5DHYB 1LWRA 5K33A 5EH1A 5F88A 1KBGL 3SE9H 1YEDA 4LU5L 5FM4A 1BF2A 1YMHB 2HAZA 2V2WA 4MJIA 5BRZD 3NABL 5F1KC 5GGSA 5F7MC 1S7SB 4HUXA 4JFOB 3W11D 1U3YA 5LCVH 2FJFA 5SV4A 5F3BB 4PRPB 1FLRH 3F7RA 2WANA 4IOFC 4HFUH 2Q8AL 4JDVA 1NANI 4R3SB 4U3CA 2FBOJ 3GSOA 4BUGA 1CU4H 3ZLQC 3ECBB 5IQ9B 1CZ8H 3LMJL 4G8GB 5I2IA 5JIKA 5MEPB 1YMME 3PDOA 4QT5B 1OP5K 2AQ1A 4LPXA 2P5WB 1IBGH 4NT6A 1MNUL 3SO3B 2EYTB 4CU7A 1QBBA 5ACMA 2D9CA 5L8JB 2VXSH 25C8L 3FFDA 1JWUB 1DZBA 5I19L 4GQPH 4YHPA 1NCBH 4HEPG 1N64H 1C5CH 2WUBH 4L4VE 2PCPA 5GRXG 2OZ4L 5J9PB 4GUPB 1E4KA 3RKDC 2ZCHL 1XZ0A 3V7AE 4FQIL 2MPAH 1KB9K 1ZTXL 4PRHA 4JCLA 2ORBL 4XCFH 4NO3B 5C6WH 1KCVL 3W5NA 3CJJA 1LE5B 5TDOA 1C1EL 3G5YA 4L8SB 2DIBA 2GSIB 1HINH 2FGZA 2P8MA 1ITCA 4YH6A 2W38A 3LKSA 4JEGB 3DUSA 4OFIA 2FEDC 2YRPA 4P46B 4X98A 5SV3A 3SKOA 2OR9H 5F7NC 3UTZA 3GSQA 1X7QB 4WFGD 5E8PA 2ICES 1GOFA 1RZIA 1OSZB 4KPHH 1R3IL 2ZSWB 1F42A 3HC4H 4N0YH 2EIEA 5CSGA 2VLRB 4NZUL 3K80A 3LRGA 3VGEA 1T7VA 4FXGB 2FZ3B 3KPRA 2X7LA 3LSOB 4NZRL 3ME0A 1MQ8A 4Y19B 4X7SL 4ZNEE 1FZOB 3CFIC 1SBSL 5D4QA 4APQA 4FQJH 3EDJA 5HVHB 5H8DA 5ICYB 5FOJA 4L1DA 4JHWL 3PHOA 1MVUB 3MCKB 4PY8J 3EZ8A 1Q9KB 4EI5D 1U8QB 1XIWD 3IJHB 4Y16A 4G5ZH 2EEAA 5KJRH 1E0OB 2CH8A 4XNXL 5I73C 5HD8D 4KV5F 3TP4A 3VFMB 5FAAA 1B4JL 1KPRB 3QH3A 4P59L 1LE9A 4YWGH 4JRYE 3MRPB 4OCWH 4DCQA 1P7KB 4LCIH 1BFTA 1IC7H 5D71H 3PWVB 1RZJL 1ZV5A 3QZWA 4EN3A 5HGGS 3HNSH 1J8HA 4CMHB 4EZMA 2C1OA 5D1ZA 3QZWG 4LLVB 5A2KH 3B5TA 2Z31D 3D39B 3HNTH 1E6JH 3VWJB 4ZFOB 2CKBL 1WBYB 5KVEH 4LHUD 1MCJA 5FA3A 4DAGL 1NUFA 4M1DH 1OAKL 3B3IB 2EC9U 5KS9F 4YEFA 1FAIH 4DVBA 3B5GA 3SCMB 4MXQD 1T80A 4JRWA 3UJTH 1JUFA 2V9QA 4W81A 3T2PA 2AJUH 4MQXD 4PJ9B 5C0GA 1CD9B 4U6XA 5F6IB 2DQEH 2EE3A 5L2KD 2XG5A 3BPNC 5D1QA 3UTPE 1EO7A 1ZT7A 4WTXA 2NY6D 3QI9A 3RIFF 2YPLD 4JVWA 4PJDA 1AY1H 1XF2A 5F9AC 5HHVH 1NBYA 3H3PL 4FQQB 5E7FA 1TJIL 1A22B 1JE6A 1IKFH 3X14B 3DXAE 4KDTC 1J1OH 4G6AC 4ONFL 1QBMH 3HMWL 4R4FL 3GI8L 1DVFC 5DMYA 3DMMC 2P5EA 3CFDA 3IU3B 4LCYB 2AGJH 5C08E 4X5WB 2DI9A 1KTDB 1KIRB 3OXRA 1F2QA 1QO3A 5KSBE 5LGHL 4Z7QE 3S98A 4I2XE 2MQ3A 2GJZA 5I1AA 3E8UL 2EIDA 3QISA 2X70B 3GEWB 1YC8A 4IDJL 4JG0H 5EUOA 1QEWA 4KXZI 1ZK9A 5K9QI 3FHAA 4BSJA 1PKQE 5J13B 2EZ0D 4RWYL 1KB9J 1T21B 1AGCA 2J6EA 2X4OB 1HHIA 4NJ9L 3QP3A 1BBJB 4ZOEA 1F6LL 2GJJA 3P4MA 5BRZB 3KS0H 3I50L 1ZLWK 4HWEL 5MP6L 3FO9A 3MV8D 5JIIA 4OCXL 4M4PA 4ZUUA 3ARFD 5GGTL 1DN0B 4JO2H 2IQAB 5L7XH 3MJ8B 4JFHD 2BNRD 4X7FC 3GIVA 1ZAGA 1LD9B 2A83A 4KJWD 3V5HA 3ZDXF 1DFBL 3GB7B 3MMEA 2Q86A 1N8ZB 3BKMH 4LCUB 5TF1L 1NLDL 1N6QH 1OLLA 3ES6A 2X1WL 1AXTH 3L95A 4GAYB 1E27A 2EDEA 3AB0C 3JWNC 5CSZB 4DK3A 1A6UH 4PB0L 1AXIB 1N3NB 4HK0A 1DQJA 4F33A 3HR6A 3PWPD 3X12A 4A2LA 3QT2A 4PBVC 3HS0B 1YNKL 3W82A 1OM3L 1FLTX 1TZHA 3GSNA 3V4UH 3G6JE 2PYED 5HYEA 5MEOB 2ICCA 4Y1AD 2E7CA 4WI6A 5CIPA 1FIGL 4WI5A 3IU4H 5EZOL 5I30H 5JXEC 2NR6C 4L9LB 4P5MB 4YGAB 3EO9H 3C2SA 2Q7YA 1JTTA 2C3GA 3P4NA 4ONGL 4L3EE 1IC4H 1A7RH 2WP3T 5F1NB 3S35L 1FE8H 3DETC 5BO1H 4MD0B 1F6FB 4L8DA 1JI2A 1KB5A 2VDRH 1CD1B 1QRNA 4JY6A 4KKBC 1A1NB 3QQ4A 4F9PC 3EFFA 3PGDB 5H37H 2E9BA 4ODVH 1MPAH 2D03H 1FYTA 4JR9H 2CJUH 2R4SL 3FONB 2P43B 3MGTA 1PX4A 5DQDH 1LEGA 3QJHB 4HMEA 5EC1B 2HJKA 3BQUA 4RZCB 3OTTA 1WTGT 2GKIA 3RWCB 1T20A 2VABA 3V5DA 4GG6E 1LDPH 4EI5B 1Y6MR 5TDPA 1SHMA 1C12A 4TYUA 1XIWB 2UYLA 3JUYA 4KAQL 4NKIL 3E6HA 1A3LH 3N1FC 3K3QA 4QTHB 5GGVY 1KNOB 3KYKH 5IV2A 1FVCA 1MAML 3TPUA 2BXZA 1NCUA 5SWQB 2Z91A 3F7YA 4KI5E 5DJYB 5I74C 5EBWB 1D6EA 3HE7C 4YIQA 2A9NL 3MV9E 3VFOB 4BK5A 1TCMA 4PGEB 1FL5A 2JCCF 1U3JA 4Z7VF 5HHXL 5DEFB 5GXBB 5C07E 5HDQH 4YDVA 1QSZA 3BXNA 2IH1A 4DEPC 2W60B 3EDKA 4JO1L 4JZJC 5FGBC 1JGEA 2IANE 3AROA 3MLPA 3ZTJH 2Z31B 4Y4HC 4CGTA 3RTQA 3R06B 4Z5RB 4LHUB 1G1YA 4M03A 1AGFB 4NKQB 4KQ3L 4OZGA 1KFAL 3B9DA 4RQQB 1ZWIB 5D72L 6FABL 4Q6IB 4HLZG 5F89B 5JO5B 5F7LB 2G60L 5E7BA 4BFIA 1H0DA 4Z0BH 1UB5A 1OAZH 4RAHA 5K9OA 4D3CL 4ODHL 43CAB 4KK6C 5KVDH 1NAMB 1JZ2A 1LO3L 1RJZB 4G6JL 5L2KB 1OP9A 3QCTL 5DMKA 2YPLB 5EU4B 5INDA 4FQHA 1UA6H 2P45B 4XPGH 5F1OB 5JHDD 1U36A 1WZMA 2LVCA 3RKDD 3QQ3A 5EO9B 3IXTB 3MRRB 1I7TA 2OQJB 3MPCA 2LV4A 3HZVB 3UZQA 5IG7B 4Q0XL 1FZMA 4GSDH 2PXYD 2IMMA 3IDYB 1SJXA 1NFDA 5CD5C 3INUL 4YQXH 4KQ4H 2FJHA 4OKDA 4FQCH 3D25B 4WY7L 3HZMB 1IQDA 2FEDD 1QFPA 1MF2H 4LSVL 1ONQB 5E4EB 5CS7A 2DIAA 2PNDA 2ERJC 4R7DA 4P2RE 1RUQH 4KZEH 4X9IA 2DM2A 2FJGA 4WWKA 2IPTH 1T0NB 1OAUH 4JO4H 4N5UA 4PUBH 3VFTA 2QQNL 3VFRB 3VGAB 1PSKH 5AD0B 1T03L 2PO6C 2V5MA 3H3BC 2GSGB 3ZE0E 4LSSH 4P2QE 4HZLA 4IMKC 4RFNC 2LQRA 2CDEB 2CMRL 2EIBA 1KG0B 3V4VH 1GCFA 4MNQE 3F7VA 4X99B 1RY7B 4MCZB 3MV8B 3HI1B 2R9HC 3OR6B 3MRQA 4HJJH 4M4RA 2H32H 4W70A 5IFHL 3QXAA 1XCTA 1FHGA 4PJIF 5HVWA 4NDMB 2WIMA 3BP4B 3DI2B 2DBLH 3PHQA 1TJGH 4JPKH 1CXKA 3RY6A 3RY5A 2YD2A 1T0MB 4L8CA 5IUSA 2OMBA 4IMLA 2BVPA 3C5JA 2XN9D 4PV8A 5HPOA 5KS9B 3PWPB 5CEZE 1IM3B 4CDGC 1EUUA 4Y4FC 4J7RA 1C5DB 2YXFA 5HSFA 3G08A 5HVFB 3Q3GA 2PW1B 3VCLA 1T2JA 5FOBA 3W2DH 4I8DA 2PYEB 2WV3A 3RZWA 5I18L 2J2ZA 4NWTH 3ARGC 2ED8A 4Y1AB 1SYVA 1OCWL 5DTFA 3WCYA 4KGJA 4ZPVA 5ESAB 3CSBA 3FHQA 4D0BB 3ROOA 3C87A 5I9QB 4D0CA 3STLB 3N06B 3VRJB 1NDMA 4K94C 4RMQA 1MH5A 2V7HB 2A73B 1ZT4B 4P5TA 5TH2A 3UJJH 4K9EL 3D85B 2EO9A 3WHXA 1RIVH 4OLXH 4H20L 5A3IC 1G7IA 3NGBB 2W9EL 4IRJC 3I6LD 4XP9H 2UWEE 4BYHA 4FZEH 4LKCA 2O5XL 4QCIA 5BV7C 3ULUE 4HWBH 4DN4L 3ARBA 4OLVH 4QNPF 1HIMH 5D6CA 1JNHA 4JKLA 5I8EB 4OV5B 4YBHA 1ED3B 2VDKL 3B9AA 4JY4A 3S97C 3RL2A 1UJ3C 5CILL 2NY2C 1KIPA 4WI8A 2ATKA 3HI5L 4WUUE 3ZTNH 4QHKI 1DVFD 1T1YA 3QB7C 1AC6A 3DMMD 2HFFA 4Z8FH 3CFEA 3TO4B 3W0WA 5HHQA 4IIQC 1DBBH 4JN2A 4QRUA 5IK3B 1TVHB 3UEZA 1IAIH 4NQDA 5AUMB 4X80H 3U36A 5E6IA 12E8H 4PTUB 1MFDH 1PX3A 3OJDB 4HIEA 4PRIE 4UTBH 5GGRY 1MUJA 3TFKC 5DR5L 2CRZA 5C7XH 5AYUH 5BZWA 3O8XD 4L1HA 2NY5C 3DROA 3HZYB 4G43B 1KLGB 4XRCB 1CGVA 1TTGA 4HXAH 1B2WH 2VLKD 3PWNB 2DKSA 1FNSL 3QO0A 4NSKB 1YYMH 2DLHA 4NKDA 1OW0A 1GZPA 4MQ7B 1RZFH 3J8F7 5DRWA 5MENA 4YX2L 1TXKA 1CICA 2FRGP 3DBXB 1CFSB 1Y0LA 1Z6JT 2W0FB 4XPTL 3JV4B 3QIWA 4NC2B 3GMQA 1U3HC 1W0YT 1RZ8A 5EU6E 5EFIB 1IGYA 2VQ1B 2E6JA 3IYLW 4O9HL 1HQRB 2D31B 5D8JL 3KXFE 3LN5A 3MROA 4JVUA 1U8PB 4LLWB 5D5MA 4DOHE 3GHBL 5J11C 1A4JA 5C2BL 2GJ6E 4W4OC 3HFMH 4ZO8A 2J6EL 4PB9H 2IAMA 3VGGA 3QDMD 4EJ1C 2FL5A 1FBIH 3MR9B 4XNUL 2AQ2A 5JHDB 3FO1A 3KYNB 4LIQH 5GS1A 3TYFA 5FF6B 1KTKE 1X5YA 2HG5A 4LCCC 4YAQA 2RHEA 1NMAL 3KPNA 3M1BB 4HWZA 4QF1B 3ZDZF 3WO3B 4POYA 5SX4H 4A6YB 3BKYH 3O3DB 2VDQL 1EAPA 2W92A 3O4LA 2PXYB 2GT9B 4POUB 3TH2T 5DK2B 4V2CB 5BZDB 4M5ZH 2CRIA 5JXED 2NR6D 1OHQA 5E5RB 1ERNA 3MRLB 1YEEL 4IJ3B 1EEUA 4GG8B 2VZVA 5HJ3A 3UPAA 2QHRL 2VISB 1S3KH 1NKRA 2IBZX 4LVHC 1KLFA 4UQ3B 5ID1A 2DQGL 2VXVL 4U05A 2BVQA 1CLOH 2BERA 2ATPB 4ZPTA 1XGRB 1HH6B 4HKJB 4NZTL 4DKFH 3PL6A 4WUKH 3QDGE 1I7UA 3S36L 4AZ8A 5IW6A 4KKBD 3LKQB 5CGYC 4LFHD 5IOPB 4JPVH 3E3QE 1UM4L 5F9WB 1OSPL 3DURB 2I5YL 4K71B 4RDQF 3RQ3A 3FB6A 4AJ0A 3MV01 4O02H 1I8LC 5CZVH 5E9DA 1RFDL 3A6CL 1L0QA 4XX1G 1YUHA 2JCCB 3CDFA 4OCRH 4U6YB 4QRPA 4XNQB 4Z7VB 5AWNH 4IOIA 3G5ZA 3QNXA 2YPKB 4ZD3L 3HG1D 1YEKL 4FG6C 2Z35B 4HV8A 1VFAA 4YXLH 3TYGH 1KGCD 4X6DE 3FB8B 4LSPL 4XVTL 4C4KO 3P9MA 5KN5A 5EBGA 4GKNA 3KPPA 1E6OH 2HJFB 1CFQA 1BGXL 3RNQA 1AXSA 3WLWC 2XN9B 4D0DB 2EDQA 5IBUG 5BMFL 3PNWB 4CVXA 1NEUA 4RFOL 5FHBL 3HR5B 3T2NH 1RZKC 4HD9A 4F7TB 1SYSA 3WIHA 4AIXA 3WNPA 5BXFA 5B3JF 1KCRL 2NXZD 3CFCH 3LDBB 3ARVA 1X4ZA 3LN4A 1N26A 4Y4HD 4MDJA 1QG3A 1QNZH 1CXHA 1NBQA 2X4RB 3N1QC 4K3EH 3TC9A 1XF5B 2ILLA 3MJ7A 2I9LA 4I18C 2VLJD 1EHLL 2ZCKH 1FL3B 2GTZA 4JM4L 5TPWL 2AV7B 5J6HA 4AM0B 1F4HA 4NM8H 5ITFA 3ELAT 5HYFA 4I1NB 1ZHLA 4KK6D 3O3EB 3QEQE 1LEKA 2D0GA 5DHVA 5GGUA 3P9WB 4H8WL 2I07A 4OCYL 2EDHA 4JKWA 2BX5A 4XBGA 3U7YL 1JPSH 4PJXE 5CCKL 1A7PH 3SPVB 3H6JA 4IS6B 5T5NF 1CG9B 1MCOH 2BFVL 1BBDH 1KJ2H 3GMMA 1BJ8A 3T0EB 5CP3A 2ICWA 3RUGF 3O3BA 4XTRC 4FNLH 3RGVC 5KOVC 5FKPA 3K1KC 4U1IA 5E1AB 2BVEA 1CI5A 1A7QL 1R3JA 2VDNH 3RAJL 3DMMB 5EIQA 1BLNA 5CD5D 4QTIH 5KVMC 1PZUB 1QSED 1CGSH 2L4OA 2X1QA 3TIDA 2G75B 4F9LC 3HCVB 3GZKA 1I1AA 3VD5A 3MBEA 3NFNB 4HULB 1VADA 1VPOH 3BZEB 1CL7L 4PJIB 4GRMB 4OQTA 4MSWB 3RBGA 3O8XB 3L3HA 2P24A 3G9VA 3OKNB 1BHGA 1T3FA 3VWKA 1IGIL 3DJ9A 3QQ9C 1FO0B 5CMAB 3E0GA 1R0AH 1IL1A 1BZ9B 5FK9A 4R0LB 2VDML 4M00A 1LNUA 5T1KD 2EDFA 5C0DA 3EJZC 4NYLA 1F13A 1BIIA 1NEZA 2Q8BL 4UOJA 4MVBC 4NQEE 4K2UH 3V9FA 5E99H 3IDXL 3MCLL 3GSNH 4OCMC 4P3DB 4FMKA 2FLBT 5DQ9A 4O58L 2JLLA 3AB0B 4UBDC 4M6OL 1KCUL 1RZJC 1A64A 4TUJA 1F90L 2X4QA 4AT6A 5SWZE 1NBZA 4WFEE 1GZQB 4Y5XA 3JXAA 3KLDA 5I76A 1MHHB 4Y4FD 1CFVL 1M71B 4EQ2A 1FG2A 1JYWA 4YJZL 3QUYC 1U2HA 5IMKA 3WUWB 3QFJA 1F8TL 1CGUA 3JTSB 3SQOL 5DJ8A 4QOKD 3AS2A 1IILE 4XBEL 3DRTA 3R1GL 4YHZH 2B2XH 2H2SC 2GAZB 1WISA 3FRUB 1UCBH 3SDCC 3WHE0 3ARGD 1FFNA 1FYTE 1BP3B 3D3VB 2IADA 4FTVD 3SE8L 1MRFL 1I1RA 3IDJB 3D1MC 3WN5C 5E08H 4DKAA 1IE5A 1KB5H 3CD4A 3MLTA 5H94A 2YXMA 4KRPC 1HXYB 2JJWA 4U1JA 5DLMH 3P30H 3O11B 3SGKC 4MZ3A 4BH7A 1MJJB 2AXGA 5DMGD 5JXAL 4IRJD 4ZUSB 3FT4A 1JGDB 5BJTA 4L4TE 1HHGB 2CUHA 3TJHC 4FQLH 5IW1B 3QIUD 4EXKA 2HTKD 1A3RH 1MWAL 3PQYE 2RFXB 3BRFA 4WU7A 1ACYH 4I0KA 5GS0L 2D7TH 1LP9E 5HGBB 1N5AA 5IFJB 5BW7A 3TNNB 1I3RB 2DBJA 3MJ9A 4OD2B 2ITDB 1HOCB 4KI5C 2AJYH 4Y8DC 1P84K 2NTFB 4LPTA 4RBPK 3Q5OA 3DV4B 3HG1B 5JIPA 1NC2B 1XGQB 4WCYH 1MSPA 3U4BH 1XR9B 3QG6A 2NTSP 1AR2A 4N0CC 1IGFH 5ANME 2HVJA 4U1HA 4M43L 1UQSB 3CFBB 4M7ZB 3FN3A 1WBZA 2DYPD 2UZYB 4OCSH 1DQDL 1I85A 2G5BA 1MCEA 1DQMH 1V8HA 1A1OB 1YMMD 3FB7A 1N59B 5DVKA 5E6ZA 2Y7QA 3OPZL 2NXZB 1UWGL 3HPJB 1RZGA 2C3VB 5IJKA 1EHAA 3SDAA 3EYSL 1IEBB 4Y4HB 4K94H 1WAAA 2X4SB 3U2SA 3DO7B 1JV5A 2FX9H 1EIBA 2FEEI 5D9SA 4DGVH 2VLJB 5F3HB 4L4VD 4OV6F 4G6ML 4OZ4B 4LHQB 1R24A 5IMLB 5C0FB 1QLFB 1T4KB 3GJEB 3KPTA 3S5LB 1BFOB 4KJPD 1C7TA 4ZOCA 3TVMC 1UZ6E 3TJEH 5BV7H 2EYSB 3TZVC 5C8JB 4OFDA 1MCLA 4XPFL 1ZKAA 3LV3B 4KK5D 1JHTB 3BPLC 3KPSA 1DANU 2H3NB 5K9JH 4TULH 5C0BD 4OZFH 5EO0B 3NIGF 4LSUH 3WBDA 1IGJA 5HYJA 4LGPB 2ZOKA 4NN7C 3U0TA 3MXVH 3NACL 3QDJE 4JPIA 4ZFFA 4ERSH 3GMOA 1FZJB 4F57L 4YHOH 1LILA 3SE4A 5C0EA 2IALA 3PE9A 4FFYH 3QEUB 2Y5TA 3Q1SL 1OTTC 3VFWA 4TSCH 5DUML 2J12B 1A7BA 3DVIA 1JPGB 4X6EB 4MAUH 5D2LE 5CJOL 1R5IA 2X1XR 1YN7B 1YN6B 4TNVF 3AMKA 4AIOA 1W0WB 3RPIA 1Q9WB 3SHSA 1OWRM 1FNEA 1G7MA 2NY5H 1QSFE 2CUIA 3NPSB 5KSBF 3NMEA 2O61A 4QGYA 1KELL 4TNWF 4XVJH 1CFNB 3MOBH 1T2QL 3Q2CA 1DEEA 4JQIH 1QYGH 3MLWH 5D96C 3V6FA 1X5IA 2Z92A 3AS0A 1HYSD 4XVSL 2GEEA 3X3GL 1ZGLB 2VUYA 4NHUA 5CJXA 2ZUSA 4YPGB 2FO1A 1A2YB 5T1KB 3BKCH 2FH6A 4DGYH 1J5OL 3TBSA 1AGDA 2IPUK 3TNMB 4H1LB 4EUPB 2MHAB 4JRYD 4FG6D 1F2XK 4JFEA 1NLBH 2BY3A 4ODTH 3LHPH 4WW2C 1EBAA 4AIZB 1SM3L 4I3SL 1TZIB 3VXSE 4UU9B 1D5BB 1OD9A 3HMXA 1K3ZA 1OTSD 2VDPH 1S7UA 2A2QT 1H5BB 4ODSL 3DLQR 4N8VB 3VGBA 4PJHE 3PGCA 4HT1L 3LPGA 3QEHA 3QEGH 4Y4FB 1Z2KA 1K2DA 3VU2A 5EO1B 3LEVH 2QSTA 5IJKC 1UACL 2R8SL 4QOKB 4P9MH 5IB5A 1NAKL 4XNZC 1FFPB 3G6DL 5ITBL 1CFBA 1P84J 4YDLC 4Z77B 3FAXA 5C6TL 3G6JF 5L88H 1BM3L 4FTVB 2Q87A 5B39B 3MLXL 4GQ9L 3UTPD 5C0IB 1CGWA 1GSMA 3RUGB 1FNHA 5D6DA 1MREH 3H0TB 3ALWA 3ULUC 3FO0L 4LRNH 5T1DH 5IBLC 2Y5EA 4U31A 3UTQA 3TH4T 2EH7L 3DXAD 1J88A 2F58L 4QXTA 2B39A 5KSVB 1OD7A 2GY7B 4DW2H 4ENED 4BSWB 2YD9A 2PETA 1BD2A 4RAVB 4ZMAT 4AH2A 3TBYA 2VITA 2E5EA 5C08D 4JM2A 5DQJB 3QULB 4PRBB 4PJ7A 1SVCP 2WUCL 1QQDA 4CW1A 1SBBA 5T33H 3QIUB 4OZIA 2AABL 2F54D 4HS8L 3T65B 1NL0L 2DTMH 3MLZL 4M7LT 5C9JA 4PJFA 3BRGC 4KY1H 3T4AB 1EGJH 4CKVX 1JRHL 2DF3A 4OLYL 2EEBA 2HVKA 3QUMH 2QBWA 1PD6A 1G6RB 3GSXB 2QJDA 4FXKA 4IIQB 1E4XL 1EV2E 4AMKL 5MHSE 3RWGA 3RWFA 5CBEA 1UWXK 3KNBA 4MB4A 1I8MB 4WEBL 2XXCB 1ZS8A 3DGCR 1HNFA 4ZTPH 1G7LA 4LRIC 2Q8AH 1N7ML 3SJVA 1RZKH 4NKMB 3CLFL 3FO2B 2DYPB 3LIZL 1G7JB 1YPZF 3LMJH 3NFSL 5IMMB 4NO2A 2BJMH 2OM5A 1QLEH 3DYPA 4MJ2A 1U8OA 3H9SA 2M2DA 5F93C 5JPNB 3OKLA 3TCLB 4Q9QH 2EE2A 5DFTA 2XPGB 2WBKA 1Q9OB 2FX7L 3BT2H 3MODL 1NGXB 4EEEA 4DN3H 1DE4B 3EJZD 5E5UB 2QKIB 5ISZA 2B1AH 1OAQL 3S96B 2KBGA 4MVBD 1YY9C 2OZ4H 4QYOA 2VUOA 4M7JH 3CVHB 3D9AL 4PV9B 2ITCA 4J4PA 4ZUTB 4F8TA 2YK1H 2RCSL 4XCEA 2JJSA 1GIGH 1J1PH 1Y6NR 1KCVH 4ODXB 4URTB 4WTZA 1C1EH 2NY1D 3E2HB 1V7ML 2OLDA 4KZDL 3IDGB 5IVXF 2X9YA 4YXHL 1QR4A 3RIAK 1F3JA 2ZUQC 3QUYD 5INCA 2P1YA 5C0BB 3UTSB 1TENA 1UCTA 1PW3A 2DQHH 1AQKL 2F53A 1K8DB 5EA0L 3VXQA 1XH3B 2E8ZA 3GBML 2H2SD 4HJGA 5GGVH 1WZ1L 1A6TB 1PVHA 3KPLA 2XZCL 1F11B 3WJLC 2VAAB 4EBQL 2UVFA 3RDTA 5ALCL 1G9NC 4KROC 4C56E 8FABA 3GFUA 4HUMB 5C71A 4OAWA 5D93C 5FYKL 4NQCB 4NZUH 1XF3B 3REVB 1OARL 1C8PA 4ODUB 3CPLB 4F7CA 3DVGB 4U3XA 3BZ4A 4KRPD 2R2HA 4F2MB 3TA3A 3QDHA 4X7SH 4Y5VA 3E3QC 4TRPH 4LVHB 5F96L 4J8RA 4HKBA 1I3UA 2IQ9H 4WHTB 1VGEL 2KQMA 3B8YA 4JHWH 5KTEH 5FM5O 1R3LA 1AGEA 4X7TB 4YHNA 1JZ6A 5FGCB 1C5BH 4PREB 4U7KA 1XGYL 4QRSA 4U1MA 1U8HA 1ZHBB 5EU5B 5E2VH 4JKMA 1B4JH 2BSTB 4N9OB 4P59H 4O5LH 5C0CE 4MQSB 1FCGA 2UY7A 3L5IA 4PRNB 2YOCA 4EXPX 2BVTA 3GSUA 5EIIA 4KJYA 2AEIT 4R4BB 4JRYB 4OBRA 2Z0BA 1RZJH 3MV9D 2PTTB 3REWB 2Y07H 4MLIA 2EDWA 3WIHH 2FR4A 1GOHA 2ADIA 5C07D 1DN2A 3WMSA 1M7IA 4HIJA 1EEQA 1X4YA 2R0KH 4N0CD 5HI3C 2H26A 5JZ7C 3L7FA 4RFEA 4XXCC 2IAND 3EOAA 5C0JA 3F7QA 1PBYA 2W65B 2XWJA 5GSRA 5EZJB 1N0XL 2FYYB 4O2EB 1ZHNB 2WK2A 4PLJD 4KTEL 3ESVF 1RD6A 4RMTA 4PJGA 2EIZA 3GNML 4YHLL 1C16A 4LLYB 3PF2A 4CNIA 4LASL 4F7EB 4ZUWB 4KDVA 4F7MB 3JTTB 5LKNA 4KHXL 4WW2F 3SDYL 3OZ9H 3MJ9L 3MGOA 3GO1H 3LD8B 1J7VR 3W9DB 1CLZH 3MACL 4HW6A 4Y5YC 4DTGL 1DSFL 1LK2A 1HSAA 3U0PB 1UXWB 4YK4C 1O7VA 5F7EH 3MUY1 1RK1B 3DSFL 3VXNB 3FOLA 3F6LA 2VL5B 1Q0XL 5CP3H 5DD0L 3TH3T 5I1GH 4HFWA 4BZ2H 3JVGC 5DC4B 3HMWH 3N0PB 3TVMD 3GI8H 4GAGL 4XNYL 3TZVD 4AENA 2YN3A 4QRTB 3SEPA 5EOTB 5J0BA 1Y6KR 4K3JH 4R97C 3WDIA 4NRXB 3DIFB 5JW5B 1WT5A 3TBVB 3DARA 2NXYD 3HLAB 1QPXA 4PRPE 3H42L 3D6GA 5HGHA 1S9WB 2UWEF 2F54B 5FUZH 3O6FD 5KSBB 4PGCA 2R23B 4G8GE 3BUYB 3G9AB 1PG7W 5IHZB 1S7WB 3FJTA 3ARRA 1G7PB 3QG7H 1J11A 1FZKA 4JANB 3MRDA 4F7PA 1KCLA 2QQKL 1EJOH 3RVWC 1AO7D 4XP6L 5ETUA 5I8CB 3TT3L 4X8JA 4Y4KC 4P2QD 4HWEH 1FFOA 2VB5A 4NO0B 4OCXH 4P5KA 2DQCH 2HLAB 3KJ6H 2R1YB 1ES0A 1WJ3A 3IKCA 1I8IA 1ZLSL 4HDIA 2X2YA 1VHPA 4NGHL 1CK0H 1I7ZA 3JV5A 3MRCA 3UPRA 4ZODA 3RWHB 1ORSB 3BISA 2W0KA 5DJAB 4I4WB 4M8VA 4NO5B 4R8WL 2HT4D 2PTUA 5AYQA 2DMKA 3QRGH 4UB0H 1YZZA 2KKQA 3ARYA 5KW9L 2YA1A 4NFBA 5HYIA 2D0HA 3CMOL 3T0WA 2NLJA 1G9ML 4WV1A 3UJIL 3V6OE 2YPVL 3NH7H 4E0RA 1KT2A 4TOYL 3RVUC 5I1IL 3G6JB 2PW2B 3FT2A 4P9HC 3I85A 1S78D 2BSSA 2QSQA 3MC0A 1V3LA 3OHXB 4J3SA 3MRMA 4NBZB 4MX7A 2VLRE 2CLRB 5HHOE 2NY1B 3PXJA 3BAEH 5EZLB 4JLRB 3QDAA 4G9FD 5JW4M 2DKMA 4Y19E 2CKBB 2P7TA 3L3KB 4LMQI 4XMPH 5C3TA 4G42B 2CD0A 5I0ZA 3MUGB 3EBAA 1RVFL 4KKCC 4AG4H 3P4OA 2YMXL 3IAQA 4OB5L 3LB6C 4JY5H 1FFRA 1DL7L 2K9UA 3LH2H 4HKZA 4GW1A 1XGPB 1XF1A 1CD0A 4H8WC 2IPKB 4H25B 4YXKH 3VXPB 4OZHA 4UV4L 2DQFA 4HBCH 4E41E 1JMZA 3VXOA 5IBLD 1JTOA 3HMXL 1NGQL 4M93B 4RBPH 1V3MA 4TUKH 1K4CB 1UADC 3G6AA 1FG9C 4X6FB 3U0WL 3GUTA 3I84A 5JA9A 2B4CH 1LGVA 4UNVA 1CDYA 5IKCA 3RX5A 3V6BR 5HTSA 1VGKB 2HN7B 3D39E 3H8NA 3H3KA 5JORA 2AJSL 5ERWA 4G6FB 4NKIH 5DEGA 1WFUA 3IFPA 1H3WM 2R15A 1S5HB 5FDWB 1XT5A 5D7LA 5CEZH 2AVGA 1J12A 4LF3A 1YPZB 2CO7B 5E2UH 2DQTL 3WUZA 3V4PL 3DUUA 2OJZL 4XVUD 3B6SA 1QVOB 3MV9B 4I9WD 3MXWL 4MNGA 3NPZB 4L8BB 1NGWB 1NGYA 5C07B 5DD5H 3QWRA 3QCVH 5MERA 3MLVL 3DGGA 3MRKA 5EBLA 2FO4A 3BDBA 2IANB 2GUOA 3A6BH 3MV7A 4KQ3H 1NCAH 1KFAH 2X05A 3GSWB 3H9HA 1T66D 6FABH 1J87A 5D72H 3GMPA 5CAYB 2CKNA 2GCYA 3WS3A 3QIBA 3EYQC 5LWYH 4QRRA 2G60H 1KTLA 1ORQB 3OF6D 1NDGA 3RWEA 4K8RC 1EFQA 4PJBA 5J1AA 1GAFH 2BZDA 4PJDF 1GXEA 3IXAA 5TE7L 4L5FL 43C9B 1RURH 2DI7A 5EU6D 1JK8A 1CE1L 5IVXB 1ZT1B 4U1GC 2IJ0C 3B9KD 1W72A 5FIEA 3ULUH 2DM4A 4UQ2B 2EICA 4WHCA 1YY9D 1RJYA 1XGTB 4JREB 4U0QB 2Y6SC 5I71B 4K7FB 2IC2A 1UXSA 2X09A 5K93A 1MJ8L 3C60A 5EB9A 4ZYKA 5JDSB 3WS6C 1D5ZB 3PDDA 4HPOH 4N5EC 3IJSA 7FABL 5KSAA 2BVOB 1MEXH 4Z7WA 4APQD 3TZVB 1DUYA 3HPLB 4JZNB 3GSVA 1FN4B 1RUPL 5E2TL 3FQWB 4PJ8C 4DUVA 5EUOF 2GK0A 2K1MA 3BWAA 4RA0C 5FEBA 5KSUB 5FKAA 2NXYB 4PP2B 2J4WH 3LS4L 5I1LB 5CP7A 2V5RA 2VNCA 3GI9H 3DSNA 4LDEB 4U1SB 3KYMB 5I15L 3ZKMC 5KBNC 3O6FB 3T0AA 5EC2B 1NQBA 3RNKB 2XRAL 2YD1A 3D0LB 4M3JA 4X83A 1T03H 1BWMA 2APVA 3LRHA 1ROWA 1HNGA 1NUGA 1S7TA 5FYLH 4LPCA 2HKHL 5C0AA 4LPYA 5DJDB 3GK8H 3O0RL 1JPFA 3ISWA 1AO7B 3KYOA 1ZXQA 2X5PA 1ZGLP 4EN3D 1KJVB 2AEPH 2EKSA 1F97A 1J8HD 1L7TL 4WHYG 5IVOA 2V2TA 4MS8C 2HT3C 5D7JC 3U30B 1P9MA 2R1XA 4PJEA 2YZ1A 3Q6FB 4QY8A 1UZ8B 3HAEB 3BGFB 3I3BA 4O2CB 1HXMB 3U4AA 4RAUA 3VH8A 1KN4L 4GBXC 3TV3H 1YJDH 3L3JA 3FQTA 3C6LC 1IC5H 4ZXBB 4XBPA 2XZAL 3VH8G 1MVFA 2C3WA 4MCYB 1UEYA 4UNUA 4N8CL 1I3VA 3IDMB 3LKNA 5D1QD 5DI8B 2HFGH 3MRIA 4OJFH 5DFVC 4M6AA 4MDIA 3QI9D 3QUZB 3UYOD 3V52L 2DJ4A 2ZZUT 1QA9B 3RI5K 3BWUC 1G7QB 4NM4H 4WW2B 3ZDYF 4XCCL 5F6HI 2SEBB 1QSVA 5EN2A 3O81A 4RX4D 1OCWH 5HI3D 2R69L 1I1FB 5I1EL 5J6GA 1J86A 4U4BA 4WI4A 4WFHE 4F37F 2I24N 4G9FB 1OGAA 4XB7A 4ZQKB 1MCDA 2WWMC 1RIHL 3ULVL 4OFVA 3C9NB 4LSRH 1P1ZA 3N1GC 1G9NH 3CUPB 4JHBA 4YHIA 2CO6B 5FM8A 3VXMA 3EOBB 2AV1A 4N0UB 4P4KC 1QOKA 4M5YL 3C5ZA 1EEYB 1S7VB 3MRJB 4MAYA 5DS8A 3V0VA 4M62H 2YD4A 4CADB 5BVJA 4H5SB 2XWBA 3GRWA 3MRGB 4WI3A 2KZWA 4PJAE 1RZ7H 4O51A 5CEYA 1A0QH 1T2XA 1UWEL 2VDKH 5F88B 4DUXA 4XXDA 4Z7UA 3MZGB 2FGWL 1YEDB 1T6VN 2EEDA 2VR9A 3PXHA 5GGSB 2RB8A 3NZ8B 2WAHA 4XC3L 4HUXB 3N85L 5FB8B 1PYWB 3CFKA 1UWXH 2I60L 4JDVB 4RGOH 3L5XH 4PGZA 3QUXA 1XR8A 3NA9H 3NFPA 4U33A 4KUCF 4LLQB 3PDOB 4RSVA 4JN1L 1AHWA 4OT1H 4NT6B 3WXVL 1SY6L 3WE6A 4WJ5B 4KTDL 2E3VA 4LVNC 3FFDB 5BS0A 5HYQB 2DLFH 4YHPB 5E24E 3QBTB 5I8OH 3RVWD 1A02N 2KPNA 2PCPB 1ADQA 5LVEA 5FCUH 1CS6A 5I1JH 4HIXH 1FNSH 4Y4KD 5L2KE 3OKOA 2XQBH 4I3GA 4N1EA 1BOGA 5ILTH 1MI5A 3JWOH 2PKDA 2YPLE 4GXUM 4YX2H 2DWEA 4PRHB 3S3SA 4YHMH 4ONOA 2UV3A 3EYFA 3RZCC 5B8CC 3G5YB 1YYLL 2AJVL 2P8MB 3GMNA 2ID5A 4RNRA 3SE3C 4R90H 4G80A 2ZNXA 3QA3A 5DGQA 3O6LL 4YNYB 4X98B 5GZOD 3SKOB 1J0ZA 4HC1A 4LDLB 2L0DA 5EU6B 4QRQA 3UTZB 1GGIL 3GSQB 3GJFK 4PGJA 2LTQC 5EORL 5C2BH 1CDJA 2AW2A 1YEIL 3DRQA 3B9KB 1JCKA 5FHAH 3VFPA 4FFZL 4KVCH 4EVNA 2OXHA 1U93B 3PG2A 4N0FA 1QRND 4MD5A 3I3DA 1YDPA 2DS4A 1NFDF 3RVUD 1NMAH 2E7HA 3MNZA 3KPRB 3L9RA 1YMHA 4PJ5A 5EOQL 1EO5A 5JW4N 3QRFM 5A1AA 1FYTD 2VDOL 2H8PB 2LAAA 2HT2C 4APQB 2V17L 5F3BA 5TE6L 4KV5E 1L4IA 3ZT5A 1YEEH 3MOQA 2HH0L 5F7DA 5IQ9A 3PHOB 2EE6A 3FQXA 5T3XL 3U9PL 2FX8L 2DQGH 2Z4QA 4Z95L 1HHKB 2A6DA 3VI3F 2FB4L 2P5WA 5I8KH 3OGCB 4Y16B 2A6JA 3LB6D 1DTUA 2PUQT 3ZKXB 4J6RH 5L2JA 3QH3B 1T7ZA 4RDQG 1LE9B 5FDYA 5IVZA 4X4MA 2IEPA 4KUCD 2OL3A 2O5YL 5C09A 1OSPH 1BOYA 2I5YH 4L4TD 4R2GC 3OWEA 1QFWL 2QHLA 5KS9E 3PWPE 3QZWB 4EN3B 2E6PA 1A6WH 1J8HB 3RU8L 5FUOL 2C1OB 5D1ZB 4OGXL 5EOCL 1DANT 3AUVA 4G8FA 1RIUL 5GRUL 2ZG3A 1YEKH 3RTQD 4LGSB 2PYEE 4HEME 4UOW0 4NHCL 2BP3A 1MLBB 5FA3B 1Z3GH 4LSPH 4XVTH 4A6YL 1MAJA 4Y1AE 5J89A 5ICZA 1Q0YL 4DVBB 2Y36L 5IGXL 4JQVA 1F4YL 4HJ0C 4X4YA 2QADC 4WI2A 3U83A 1JUFB 4DKEL 4YHYB 3AS3A 5HDOA 5C0GB 4EUPG 4U6XB 3BPCA 5D7IA 4BFEA 2OK0H 4P23C 4GLRH 1NCNA 3WXWH 5D1QB 3BE1H 1ZT7B 2ZSWA 4P9HH 2ZNWA 3QI9B 1IC1A 4NN5C 4UV7L 2BVYA 1KC5L 4PJDB 1RK0B 3LKOA 1CR9L 1MCFA 1I9IL 1KCRH 1NBYB 3QAZC 2N56A 2OSLB 4FXGA 5E70A 4DUWA 2MKWA 3LSOA 4GRLC 3WJJC 1FZOA 2WBJC 2A38A 2P5EB 3BIKA 3CFDB 5C0RL 3EYQD 3LQMA 3BEWA 4ZSOE 4ISVA 1X4XA 1IKNA 1MVUA 2R4RH 1HDMA 3OXRB 3SQBA 3MLRL 1GL4B 1QO3B 2AP2A 4H8WH 3O2DL 4OCYH 5B39G 2JB5L 1VCAA 5ESVB 5I1AB 2GJZB 4WWKD 3MRNA 5TDNB 5EUOB 2ARJA 1QEWB 2DDQH 4XAWL 2BFVH 3CK0L 4YK4B 3H7BA 5IQ7L 1AGCB 1TVBB 3ZDXE 3WO4B 4Y2DC 1HHIB 1R3KB 3QDJD 3P0YL 4N5ED 5CHNA 4ZUUB 2E9IA 4ZFOA 3X17A 4R97B 1UM6H 3O4OB 4NNYA 4V2BA 3GIVB 1J9CT 3V5KA 2A83B 3V5HB 3VJ6A 3SY0A 3NN8A 1BFVL 3QYCA 3MMEB 2Q86B 3HUJE 4GXVH 15C8L 5T3XE 3ES6B 3OJVC 3ZKMD 4YBLB 3L95B 2R0WL 5D70L 5DVNA 4OQ1A 1CL7H 5DEZA 3LAFA 4HK0B 4H88L 4P2OA 4GJTB 2BRRL 3X12B 2P44B 1IGIH 2O5ZH 5TQ0L 3U79A 5CJQL 3GSNB 1TZHB 3BSZH 4JFDA 1Q94A 4S1RH 4Y4KB 35C8H 4P3CL 4FQQA 2X89A 3UC0H 4L8SC 1RSFA 1DQQA 2Q8BH 3SN6N 1P4IH 5JHDE 5GS0D 4K8RH 2YRLA 5CIPB 1S9VB 3T1FA 2JIXA 4P46C 3MRFA 1D5IL 4NWUH 3IU3A 1ETZA 4GMSH 5FFLA 1V7NL 4C59B 3ILQD 1C08B 3UTOA 4M6OH 4GBXD 1F58H 3V6OC 2Q7YB 1GGCH 5KVFH 4TSBH 4MHHG 3O9WC 3ESUF 1IAKB 3VXSD 1NMCB 2P49B 4PP1C 5J7CC 1J0IA 1UG9A 1A7OL 3AXLA 4L8DB 4JGMA 3MCG1 1LK3H 1RHHA 4GS7B 1KB5B 3R1GH 1AFVL 3CC5A 1QRNB 2C1PA 4PRAA 3QQ4B 3B9VA 3T2OA 1SMOA 2BDNL 4U49A 3UDWC 1ZA3B 1BBJA 5HVHC 3LZFH 4OGAC 3SE8H 5DJZB 5BRZA 3LKPA 4X7EC 4J23A 1FYTB 1FO0L 2NW3A 1LEGB 4BZ1H 1DN0A 2L7JA 5FXCH 5CEXA 4MXWH 1KSRA 5ACZA 2WWMD 1ZOXA 2HJKB 3BQUB 3VFSA 4OGZA 1T20B 2VABB 4Z7VE 5TDPB 1UKQA 1C12B 2UYLB 3EFDL 1CTNA 3DYMA 5CSZA 5JUEL 3S37L 3MYJA 5IV2B 1FVCB 1N3NA 3TPUB 2Z91B 3F7YB 2XG4A 3T1WA 5DD3L 5HYSA 1D6EB 4CMHC 3WIIL 2R0ZL 3BKJL 4YIQB 2PYFA 1JJUA 3RWIA 1MWAH 1NBVL 4L4TB 5M95B 3AM8C 4OCLC 1I8KA 2XN9E 2DD8H 4YDVB 1HILB 1L9MA 3VWJC 3BXNB 5E8EA 2IH1B 5LG1A 1VFOA 1NJ9A 5FO9A 4UIKL 1L7IL 1JGEB 4Q9RL 3LKRA 1A14H 4BJLA 3SCMC 5MEND 3RTQB 4GOSA 1TCRA 1CICD 1GGBH 1ZMYA 3B8SA 1X5HA 4J3TA 4OZGB 4LNRA 1BEYH 4PJ9C 1YQVH 3AS1A 1RUAH 4GMTH 5F6IC 4MGXA 3HI6H 4MJ6A 5MHSD 4BFIB 1AKJD 5CSBA 5K9OB 4LHJB 4LARL 3OB0K 3GRWL 2KDGA 4OF0A 3MLYL 1N4XL 5DMKB 2FSEB 4CL7A 4P49A 4HGKC 5TFSL 1YECH 4WGWB 5INDB 4FQHB 3C2AL 5LXGH 2UVEA 3NCYP 2QR0B 3U4EA 3QQ3B 4ELMA 3CDCA 2FWOA 5D2NA 2YD6A 3T0EE 5DJ6B 2H45A 4CDHA 2DQJH 3VXUA 3EYUL 4RISH 1W72H 3RZCD 1FZMB 4HUNB 1BJ1J 4G6MH 4OSUL 1UB6A 1NFDB 1NCCH 2FJHB 4X6BA 1IQDB 1G9MC 1IFHL 4RZCA 4EI5A 2OI9B 3MLSL 1B6UA 1SJHA 2ARJQ 5IR1A 1XIWA 5J13C 1QKZL 4R7DB 1MJ7L 3UYRH 2A77L 2V7NA 3FTGA 2FJGB 1JHLL 4WWKB 3BD4A 5F7FA 2XTLA 1CQYA 3VFTB 4HH9A 3OR7A 3PL6D 4X6CA 1W8NA 1OLZA 4MJ4A 1FYHB 3F5WA 4K23H 5FYJL 4NQVB 1VACA 3EJJX 3W11C 4PJIE 4F57H 1H3XA 2VDLL 1TZGH 4PR5A 2DJSA 1T89A 2W60A 3PWJA 1EMTL 3Q1SH 3CLEH 5ADPL 4PJEE 1BVLA 5DUMH 2AKRA 3FB5A 4C56D 5CJOH 3R06A 3MRQB 2MQCA 1IAOA 3QXAB 4UINH 1XCTB 2FLRT 3UZVB 4RQQA 3KPOA 1S7RB 4OCNC 1QPPA 1S7XB 3LEYL 4YDKL 5F89A 3PHQB 1MFCL 4MA1B 5JO5A 2ZCLH 3AC0A 4JFZH 4XWGH 4IRZL 5I1HL 1INEH 2YA0A 1DJSA 2APBA 1RULL 4IMLB 2BVPB 3MLUL 3C5JB 4JHAL 3BO8B 1HHHA 5LGJA 3FZUC 3MOAL 4ORGB 2ZKHH 4FQXA 4R2GD 4XVSH 5J57B 3QXTA 3G08B 1V3KA 2ZJSL 3Q3GB 3VCLB 5FOBB 4XP1L 2EDRA 5DD1H 1ZE3C 3VXTA 5I6XB 1J5OH 2VERN 2OQJA 4MD4A 4L9LC 1SYVB 1WV7T 2VZTA 3ET9F 5GGQL 3U9UA 5DTFB 2HMIC 1QBAA 5IG7A 1SJEA 1TITA 3DX9B 2CXGA 3PWLA 4J3WA 1UM5L 1AD9B 3T4YB 3ZE2E 3D3VE 3MUHL 1NDMB 1U8KA 2X40A 4HJ0D 1MH5B 4GBXB 1FIEA 3EOTH 2QADD 2WIIA 5TH2B 1AGBB 4QNPE 1JRHI 5IW3A 1BAFL 2K7PA 4ODSH 3WHXB 4N9GA 4WEMB 5E00B 5GJTL 3FMGL 1E4XI 4K7PX 2OL3L 3MA7A 5JOPD 1S5IL 1NAKH 4LKCB 4OUUA 5TE4H 4QCIB 5ITBH 5CD3A 4GFTB 2H1PL 4D9RE 2K7QA 3ARBB 5D6CB 3D2UA 1V5JA 4JY4B 4WRLA 2QV2A 3RL2B 4GRLD 2OJEA 2ATKB 2ICWI 3MV8A 5B4MD 1BMGA 1T1YB 3KPQA 3ARFA 2AK4A 4MA7H 2HFFB 3Q6GH 1X5KA 2BNRA 1HI6A 5SWSE 3FO0H 4JG1H 5F9OH 5HHQB 4QRUB 3TM6A 2NCMA 5T1MA 1UH4A 2XA8L 5H37G 4NQDB 4I3RL 4FABL 4BM7A 3C08L 2DICA 2F58H 3HG1E 4ODWA 1LO5A 4HIEB 2MSPA 4LEOA 3TCXA 3Q5TA 1MUJB 3D0VA 2ESVE 3H9ZA 1MLCB 4XP5L 5FUCE 3M07A 2EH8L 2CIIA 5BZWB 1SVZA 4D94A 1K6QL 4LP5A 4NOBA 3DROB 2Z31C 5GRJL 4Y2DD 5FYJE 4BQ6A 2JELL 3A67L 5M7QA 2WM0A 4NKDB 5F44A 1GZPB 5DRWB 4Q6IC 5MENB 4UT9H 1MIML 4YHKL 1CICB 3VMOA 1Y0LB 4MQXC 5FYKD 2NMSA 3VRJA 4IM8A 1ADQH 3QIWB 2B5IB 2V7HA 4M6NL 2AEWA 1IMHC 3GMQB 1ZT4A 3RIFK 3ZTJG 5C0ND 1RZ8B 2VLJE 1AKJB 3K2UL 3JV6B 2UZXB 4H26A 4M02A 1MFNA 3K2MC 3G5XA 2EXYD 3LN5B 3MROB 3TN0C 1H3TA 5F7HA 3OAZK 2NW2A 2V2XB 3ZDZE 1A4JB 2VXQL 4NCDA 1U8MA 1SJVA 2IAMB 3GJFH 2FL5B 1NUNB 3QFJD 5IT2H 1VFBA 1AI1H 3FO1B 1ED3A 5GS1B 2X9WA 4DQOH 1JNJA 2EDJA 3PV6A 3TYFB 2AJXH 3KLSA 2HG5B 5FYJU 4HC1H 4YAQB 5HDLA 3SE9L 4KRLB 3SDXA 1TPXB 3VRIB 2QSCH 2XQYK 2XKNB 5E4EC 3QXVA 1FLRL 5DT1H 3QFDA 1TVHA 1UGNA 4HFUL 5HJ3B 5AUMA 5IHBA 2F19L 5DMIH 1G6RL 2P8PB 3CU7A 3WEXA 1CU4L 3O9WD 1CZ8L 4EI6A 5ID1B 3VGAC 3ARDA 5EUKA 2VLRD 2AK1H 1A6VH 5HHOD 4F80A 3C5SB 4FQ2H 2BVQB 5F70A 1IBGL 2GIYA 4JFXA 4ZPTB 2VXSL 3PL6B 5EA0H 1VB9A 5FECB 1RUKL 3RL1A 1T1WB 3HZYA 1T1XA 4P2YA 4NNXA 3NAAL 2XZCH 4HIIA 1N64L 1KLGA 4B7IA 4EBQH 5ALCH 3BHBB 3PWNA 3FB6B 4KJWC 3FFCA 2CIKA 1H3PL 5E9DB 1R6VA 4MQ7A 1OARH 4C56B 2MPAL 4J1UB 2FEEL 4IOIB 3G5ZB 3DBXA 4XCFL 4HV8B 1VFAB 3IJYA 5F96H 1A9BA 5J8OA 1HINL 4E41D 4E42A 3P9MB 3F8UB 2X4TA 2V5YA 5KN5B 5B3JE 4GKNB 3KPPB 4GKSB 4JRXA 4ACPA 3MO1A 1CFQB 4NNPH 2X1OA 1BZQK 3RNQB 1I9RH 4QGTA 5IBUB 2OR9L 1W0VA 1DBMH 1G0XA 1KPUA 1TETL 4TSAH 4LAQH 4KPHL 4R2GB 4KMLB 4OKVA 4BA8A 3HC4L 4BSVA 4N0YL 1SYSB 1BQLH 5BXFB 3GMLA 1XF4A 3BN3B 5FF6A 1BECA 1F5WA 3LN4B 3SDAD 4MJ5A 1DLHA 4QOKE 3SCMD 3EDFA 3P0VL 3O3DA 3U82B 2BMKB 2PXYA 5J12B 4WEUD 3MJ7B 4IRSC 2I9LB 3OX8A 2BY2A 3HTLX 1DP0A 4FQJL 4DJMA 3K81A 2GTZB 4WNQA 3P40A 4GG8A 2R0LH 3NGBC 1E4JA 2QADB 4M61A 2Q3ZA 5ITFB 1WUNT 5KAQG 5DHXB 1ZHLB 5F21B 1LEKB 5JDJA 5DHVB 4QKXB 5GGUB 1AJ7H 2I07B 3GNMH 4Q9BA 4XBGB 4G5ZL 5KJRL 3OKYA 2RBLA 3KPSD 1HH6A 4FFWC 4LASH 2ICEA 4OFPA 3K8KA 5D7SL 3BD5A 3GMMB 4YWGL 4TPRH 1LEIA 4JB9H 2ICWB 4OCWL 4KHXH 1I9JH 2A9MH 3UTTA 3O3BB 4LCIL 1FVDA 5FKPB 5ID0A 1IC7L 1TLKA 4GRLB 3TO4C 3MACH 4U1IB 4HWBA 3HNSL 4C4KT 1R3JB 5KG9B 5D1XD 2B1HH 5KANG 2JCCA 4GH7B 4UT6L 3DSFH 1BLNB 1Q0XH 3HNTL 1E6JL 2J8UA 1T04A 2I26N 5KVEL 4O2FA 5IHUH 5IP4A 3TIDB 4NP4H 3VXRE 4JM2F 4PJ7F 3MBEB 4JPWH 3QJFA 4C57C 2AJUL 1VADB 2D4DA 5DA4A 3TBWB 1WEJH 1BJ1H 4PJFF 2XACC 5J1TC 3CXDL 3CSYB 3L3HB 2DQEL 1DBKL 2AERT 2P24B 4FQ1H 1OOAA 3IETB 3VWKB 3ZSSA 1CN4A 4Y2DB 4PJAF 4IDLA 2VXUL 3DHMA 3N9GL 5FK9B 3LQAH 5DJ0B 1LNUB 4ZO9A 5C0DB 1JYNA 4NYLB 2YA2A 3HC3H 4BELD 1BIIB 1J1OL 4OTXH 1XGUB 3TT3H 4HPYH 4HUWB 1QBML 3RWJB 3U7WH 5E03A 3RVTC 1I4FA 1OAYH 2XA3A 1KLUA 3O3EA 2FNBA 3IKKA 1NBZB 3FZUD 4Y5XB 2ZSVA 4PFEA 1DBAH 1FG2B 2YUZA 5ENWA 4JG0L 4U1LA 4OI8A 5IMKB 3QFJB 1IM9A 3JWDL 1SEBA 3GGWA 4HZAA 5DJ8B 1QACA 2PXYC 3F62A 5C0BE 3UTSE 1FFNB 4KDTA 1HSBA 5D7KE 3V6ZA 5IVNA 7CGTA 2HMID 2IADB 1G9MH 4IJ3C 1DVFA 4F58H 3DMMA 3WLBA 1MRDL 2VIRA 3UPCA 2VN4A 4N0RA 4TOYH 2Y9RT 5A43C 4JO2L 4BKLA 5L7XL 3MLTB 2F5AL 3CU1A 2G75A 2NX5A 3TLRA 4NQCE 4PGDA 4U1JB 5IF0B 3O9WB 1SEQH 3HCVA 3BKML 2OS7A 4M1GH 4BH7B 1AXTL 3SGJA 5HHOB 5F9WC 3FT4B 4K71C 2BSRA 1A6UL 2RJMA 1BD2D 1U95A 4MSWA 4WFHD 3K74B 5BJTB 4S1DC 1U8LA 3T08A 3ILPA 1U92A 4M7LL 4P57A 2YMXH 4OB5H 4WU7B 4OD3H 2VLKA 3CXHK 3V4UL 1T7WA 2E7MA 3DX7A 2Q76A 3TWCH 5FGCE 1N5AB 1YNLH 5ECJE 1KOAA 5CJ8A 4PJCE 3H9YA 2VSDA 1MHEA 3EO1A 2JF1A 2MCPH 3MNWA 2R2BB 1LHZA 1OT1A 3IU4L 3IB4A 1MFEH 3R0MA 4DWHA 5I30L 4ZAKC 4E41B 3V7MA 4MNHB 4HCRH 3VGHA 2NY4B 3QG6B 3EO9L 1P6FA 3U0WH 1TQBC 3N50A 4HKXA 1LO0H 3S4SA 2CDFA 3SJVD 3ULVF 3MBXH 1CQKA 3G5VA 1T1ZA 1LO4L 3