3GSNA

Crystal structure of the public ra14 tcr in complex with the hcmv dominant nlv/hla-a2 epitope
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
199
structure length
199
Chain Sequence
LNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCARNTGNQFYFGTGTSLTVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDAYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural bases for the affinity-driven selection of a public TCR against a dominant human cytomegalovirus epitope.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 29
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2009-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsnA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gsnA02
3VFPA 4OF6A 2D7PA 2ESVD 3DMMC 4LP4A 3H9YA 4AQOA 4PGEB 5FOBA 4TSCL 4ZYKA 3I6KB 1C5BL 2KL6A 3TJHD 4TUKL 4Y19D 1MFAH 3H3KA 5E7FA 4UDTA 1CLYH 4D0BB 3SEPA 3PP3K 2NY0D 3WV0A 1FNGA 3HB3D 3TESA 2A9ML 4TSBH 3ULVE 5ACZA 4GBXB 3LKNA 1OTUC 3G9VA 3TO4C 3HR6A 2M8XA 2K9UA 5IBLD 1SM3L 3S5LA 5TDPB 3BKYH 5C07A 4F15C 1AGBA 5IK3B 4OUUA 1U92A 1G7PA 1MHPL 1MCBA 4V1DD 2P7TB 2V2WB 3CSGA 4PJ9B 1NANH 2AK4E 4JHAL 4JRYD 2X9XA 2FEDC 2DLFL 1YEJH 1A1MA 5EBWB 2CUHA 2NY6D 3QQNA 5T5FL 1CDHA 2GITA 1I1RA 4BYHA 4JFYB 4HIEB 4ZPTA 2HYMA 4J23A 4M1DH 3ZKMC 4HGKC 4GKNA 5GS3A 5D70L 1X5HA 4N90D 4WTWA 3VXMB 2B4CC 3QDJA 1GC1L 3PGCA 2NY2D 3FT2A 3ME0A 4JRXE 4NWTH 3DIFA 3ESUF 3THMH 1C08A 5MENA 1WEJH 2VDML 2D7TH 3FT3A 5LGJA 4HLZH 5FO9A 4F58L 5IVXA 2X5PA 5F7DA 3HPJA 4XP6L 3MRMB 4FQ2H 5JUEH 3IDIA 4JFEA 4YHZL 1RUQH 4PJGB 1A5FH 3HNSL 1BQLH 2CIKB 4YHIB 5ALBH 2DI7A 1D5IL 4PY8I 3MBEC 5C8JB 1SQ2N 1UKQA 1ACYL 3K2MC 3SKJH 2R9HD 3KXFB 3MRJB 3WO4B 2J6EA 2KPNA 3UDWA 1BBDH 1IGCL 2C1OB 1ZLUH 1T0MB 3G08A 4GJTB 3MLWH 2Y06L 4JZJC 2BNQA 3H42H 4LFHD 3LN4A 4OZFB 3E6FB 5ACLA 5FHBH 3B2UC 3MC0A 3DYPA 3P4MB 5IB5A 4N0FA 4ZFGH 3NTCH 4QHNA 4KTDH 2BSTB 4KRLB 4XX1G 4U05A 2Z92A 1LD9A 3NCEB 1A9EA 3RVUD 1OAZH 5JPNA 1R0AH 2R2HB 5CILH 4ZNCD 4HW6A 5LAXB 2VB5A 2CDGB 2HJKB 5KBNC 2WBWB 3F7YA 3ETBF 5DRZB 4QHMB 4A2MA 3LPWA 2EYSA 5E6ID 5EO0B 5BCAA 2BVTA 1GAFH 1XGPB 1BBJA 3U6RB 4FXKB 1J1XH 4W6WB 3U7YL 1IKNC 2W9EL 1UCBH 4CUCA 2GJJA 1A7QL 3HAEG 5IROA 2Q76A 3AY4C 3W39A 1KACB 4JGJA 4WI5A 3LRSA 1BJ1H 1VB9A 3B9KB 3BN9C 3DGGA 1JGDA 5CGTA 5IBUB 4QEGA 4MDJA 3MRNA 4PGCA 1H3PL 4OBSA 3HUJB 1UYWH 1BQUA 4MSWB 5FYJL 4YGVB 3BPOC 2A73B 1GL4B 5TE6L 2C1PA 4HFWA 4MA1B 4R90H 4LLMA 4K07A 3ZZ1A 3OJDB 3RTQC 1T3FA 3GK8H 3LN5B 3O6FA 3NPZB 1NKOA 3HN3A 2KZWA 4KI5D 3WE6B 4N5UA 3JUYA 3OKLB 1A6VH 5EUOA 35C8H 3QDGB 4OZHB 4UNVA 4YDKH 3EDDA 3KPSD 3BIAX 1IC5L 1BGXL 1MJJA 4MXVF 3MZGB 5EBGA 4ZFZA 5E8NB 3BQUB 4I18B 1AO7A 2F53E 3MRCA 1R5WA 5EU4B 1J0HA 5C0EA 4KRPB 4NN7C 3REWA 4WI4A 3D25B 4K94H 5IQ7H 1CDGA 3QWOA 5ANME 5I17A 1CGVA 5J9PB 4GQ9L 4RAUB 4PJDE 5IT2H 5HYJE 1R3KA 2GKIA 3VXSB 1REIA 4Y4HB 2EDRA 4RFOH 5EU6B 3U30B 4F33A 2KH2B 1F58L 1Z3GH 5DLML 4YDVB 3DX9B 4PJAB 1JNLL 2ADIB 2AEQH 1AXSB 1R24B 4KZEH 5HGBB 4Z7WE 4GG6A 1YUHB 4IS6B 5E2WH 3IDMB 3MUGA 3UAJD 1XGRB 3UPCA 4QNPE 3CMOH 5C6PB 1LEKA 5J89A 4TTDC 3SE3C 5JW3H 2ZG1A 3F58L 3V4PH 2HJFB 2VXVL 1Y18A 5GGRB 1OGAD 1OAQL 4BSWB 4NCC2 5C92A 2JB5L 5FHAL 3HZKA 4OQTH 1J88A 1UM4L 3JTSA 4IRJB 5HTSA 4ZOAA 4A6YH 1N26A 5CJOH 4NZTL 1Y6MR 4GKSA 4D9RE 2PTTB 3LKOB 2VKWA 4ZSOB 3LB6C 3NACH 4RGMC 2W60B 4WY7H 3CX2A 5KAQG 1KCRH 5CJQL 2EZ0D 5D5MA 2D4DA 5JW4N 1OTSC 2YUXA 1UWXK 1K85A 4YXKL 2FJFA 1WAAE 4UU9B 4U6XB 5I74B 4L4VA 3PQYA 5C0FA 3CX5K 1U8NB 2NQCA 3D87B 2O61A 3G5XA 1A6UH 1FFOA 1DJSA 1FNEA 3LKQA 3WD5H 1IM3A 2R2EB 4OQ1A 4FFZL 3FFDA 4AMKH 2FJHA 5EWIH 2OL3L 4Y16D 4YGAB 3TYGL 3DECA 3K2UL 5C09E 2W0LA 1KN2H 5IFHH 2EH7L 1G9ML 1DUZA 1CICB 3FOMA 3MPCA 4HGWB 4X80H 5IW6A 1T89C 5B38A 2DBLL 2H26A 1WZ1L 3QPXL 1AGEA 3MYZA 2L0DA 4P4RB 5BOPA 4ONHB 4LSPH 1JPST 5GISL 2JIXA 1J05B 3BEWB 4I0CC 1KGCD 2HJLB 3W0WA 4EXPX 3X14A 4TUJA 2XOTA 3VFOA 2EO1A 3GMRA 4PB0L 1KN4H 4OCSL 3W5NA 4N1EA 3D85D 2PW1A 4CU7A 3T0EC 4AYFA 4YEFA 2VRAA 5KSAA 1ZGLB 2YWZA 1U36A 1UKTA 4KKAC 5C0AB 4Z7VF 3ZHLA 5C70A 1RURH 4NQVB 4UI2A 2DQDH 3INUL 2Y23A 5CZXC 5GRYA 4YBLC 2CGRH 3P2TA 2V2XA 5ITBL 1S7VA 1F6LL 3TPUB 2BVOA 4HBCL 1R3LA 1XCTB 5BV7H 5JHDE 1KTLB 5D1ZA 3SDYH 3QDME 4D9QE 3GJFA 4R2GC 3FTGB 3VMNA 5F7EH 4QRRB 5JIPA 4PUBH 5I1IL 2PXYD 2P8MA 5E1AB 1G84A 1AD0B 1I7ZB 1WFUA 2WBJA 3CSYB 2ARJQ 5FDWB 3UYOD 1MNUL 4H0GA 3OB8A 4GSDL 5IVZB 3H2WA 2CDFB 3HNVH 4HWBH 3C2AH 3OBAA 2EKJA 2Z8WC 3LIZH 3QUZD 4E42A 5MEPB 4C58B 3UTQA 4ETQA 4PRHE 1IGTA 3KPMA 4Z0BL 3CFJA 1VPOL 3QEQD 2WWKO 2FHBA 4GH7B 4Q2ZB 4U3HA 4LCWA 3PP3H 1AE6L 4JM2B 1OHQA 3MGOB 3KPPB 3F65A 4Y2DA 1RUPL 2DQTH 4XCFL 3OGCA 1I7TA 2EDNA 2R8SL 1B6UA 2LTQC 1IAKB 4F9PA 4MHHG 1MFBL 1YEEH 1F6FB 2CRZA 3KYOA 4F7TA 4FA8A 3T4YA 4P23A 2ESVB 1P1ZB 3QXVA 3OKNA 3RNKA 5IM7A 4X6DB 1OVZA 1SBSL 5INCB 1EO8H 4Y19B 4ORGA 4MD5B 2HLAA 4U1MA 5DJDB 2NY0B 3FFCD 5HHOD 3I6LD 3DVIA 5I1AA 1D5MB 4R0LC 1U58B 4CVXA 5FB8B 5FKPB 3CZFA 4X7SL 4K9EC 3UTTD 4YHYC 4H5SA 3DX8B 4MYWB 4YXLL 1F02I 5IJVB 4G6KL 3PWVA 1Q9LA 4U1KA 2VISA 4H25B 5SWZE 3S35X 1EPFA 3UJJL 4V1DB 3H9ZA 3PF2A 3K1KC 4JRYB 2XZZA 1MQKL 5JPMA 4HCRH 2V5SA 2NY6B 4FHBD 1BQHA 2VIRA 1MH5B 2ADFH 1U93A 3K1DA 4OSUL 4G6JH 3REVA 4RMVA 5E9DE 4YIQA 4X4ME 3D69B 5F9WC 2H32A 4ZUUA 1A14H 2NY2B 4F2MB 5F7UA 5IMMA 4ODTL 3H3PH 4WW1B 1AGDB 3ULUD 1FAIH 4KQ4H 4R7NA 5DK0A 5D1XD 1CYGA 5H35B 1W2KT 2HVJA 4PJ8A 3VRJA 2A83A 3L5IA 4YFDB 1R5VA 2MPAL 2PUQT 4OKVA 5IUSA 3RHWF 2CRMA 2VKXA 2NTFB 5JXEC 1X5FA 1NGXA 4QRUA 2V7HB 5F7FA 5SWSD 2UY6A 3ZYOA 3QCUL 1PX3A 4G7VH 1I3RA 3V6ZA 3AUVA 1ORSB 4M7ZB 3C6SA 3IDYC 2ZWLT 2RGSA 4JFFE 2HMIC 4POUB 5JOFB 4OZGB 5F7WC 4TVPL 5D71H 1N4XL 1CDBA 5L7XH 5I73B 3HA0A 5DHXB 4H1LG 4TUOA 3L7FA 1P7QD 1TJGL 2ICWA 5EBMB 3VXOA 1TNNA 1WGOA 3DROA 2WP3T 1MPAH 4OFYD 5ADOL 2X4QA 4XWOC 4KKCC 3EGSB 3WLWC 3O4LE 2I26N 4CW1B 5AWNL 4NP4L 1BFOB 3QT2A 4HJ0D 1DVFC 1MF2L 1YNKL 1YMHA 2Y5TA 4XP1H 1KIPA 3MUHL 1GXEA 2W0PA 3LKPA 3KR3H 4PJ7F 4R4NC 5E8PA 5FO8B 2DQUL 5I0ZA 3LV3A 5E6IB 3AXLA 3LOWA 4IDJH 3BKML 4RRPA 1WCBB 4GW1A 5I1JH 4JRXA 1T21B 4YO0A 3L3DA 3EO9H 4C59B 4LEOB 4ZO8A 5CKGA 4NM8H 3IS1X 5IW3A 4NPYB 2H41A 25C8L 5ISZD 3ULUL 5D2LA 4HFUH 1O7SA 1QA9B 2CUIA 1RMFL 4XPAL 4RMUA 5IVNA 1AHWA 4PJIB 5F1OB 2Z31C 4PG9A 4QGYA 4P57A 4TNVF 3RGVD 5E5RB 3TNNA 1PZ5A 1T6VN 3O3BB 3VGAB 2PR4L 3S36H 3SDXE 4W4OA 2AV1A 4MAUH 4YXHH 4O51A 2EECA 1JTPA 3QO1A 4M9PA 2ZUUA 4EDWL 4HMCA 4AEFA 4RWYL 2ICCA 2FWOB 4GLRH 3GHBL 2G60L 3QPQC 2AGJL 2PTUA 2Z93A 2EDYA 4PJHF 1FNLA 3VRLE 5T1DL 3BPNC 5I15L 1B4JH 4M5YH 3FQWB 4QHLA 5HHPA 3KPSB 4KGJA 1YN7B 4N5EC 4ZDHB 4Z9KB 2KQNA 2EC9U 1FGVH 2EDFA 3PXJA 3DMMD 4J6RL 4NFDA 5BVPL 2HAZA 1V3JA 1HHKA 3MLXH 4YHLL 1Z9MA 3KPOA 3U4BH 4PGBA 4JFZH 1S9XB 1IT9H 5DMKB 4NQSA 3TBSA 2A0LD 4Z76B 4X6FB 4NDMB 1RIUL 4PJCF 4OIBA 3QI9A 2WLYA 1K8DB 3AB0C 4KKLC 4WHCA 4YQXH 1QKZH 4GUPB 2IBZX 1NGYB 4HUMB 1FL6A 1D5XA 1QPXA 2XQBL 4N8VA 3QXTA 1EZVX 2JCCF 2BVEA 4MJ5A 1FZJA 1JV5A 1CE1H 2E5EA 4WO4A 1D9KC 1UKSA 3VXTA 3RL1B 5LBSH 4X4ZA 4PS4H 1OGAB 1U8OA 3MJ8A 1FFPB 5HHQB 4HD9A 3HC3H 5EFIA 5IV2B 3SE9L 3KJ6L 4AM0B 3NZ8A 5BQ7B 4I4WB 2D7MA 5DEGB 4U4BA 2R2BA 5EA0L 3FQNA 3J8F7 4MQ7A 2UYLA 1OAYL 2DJUA 2VC2L 1U2HA 3FMGH 1U91B 1YY9C 4F57H 2F53A 4F9LA 4LARL 1AGFB 1WK0A 1RU9H 4O5LL 2X9YA 1EO5A 2VAAA 4I3GA 2C3VA 1S7TB 4N0UB 5I9QC 1CFTB 1QACA 5ANMA 1MHEA 4J8RA 3BYYA 3KS0J 4C54A 1NEUA 4PJDA 4DVRH 5HYJA 2O5XL 3BIKA 3ZT5A 4EDXA 1E4KA 5JA9A 3NCMA 4M6NL 1QNZH 2CLRA 3ZYIA 5HYSA 4OM1H 4Y16B 4Z77A 5DURD 2H2SD 3MNVA 2AP2A 3SOBH 1MHHB 2DAVA 3GMQB 3NH7H 2ARJB 2WIIA 1W72L 4Z7WA 1WT5C 2CLZB 3WNLA 3IU3B 3DOSA 5BMFH 1S9YB 3BEVB 5GRUL 3P0GB 5DJZB 1HILB 3B2UD 1JNNL 1YY8A 1HI6A 3GSVA 4NYLA 3L3OB 2CLVB 3Q2CA 1E4JA 3QNYA 1M6OB 3VH8B 4G3YH 4I77H 2R1XA 4Z5RA 2WMPA 2OLDA 1JGUH 2AABH 4HV8A 2HT3D 2PKDA 1DZBA 1B0RA 1N3NA 1WIUA 3HMWL 4P59L 4HUXA 1UH2A 5K59E 3UZVB 4HEPG 3D85B 1FL3B 3QHFH 3X3FL 3SGJC 1FH5L 4ZUWB 3MLUH 5I76A 4AIXA 3ZKSD 1QP1A 1I8KB 3Q1SL 3VFNB 1NAKL 5KVGH 1NGWB 1FNAA 1WAAA 2VXSL 4ZS7L 5EZJA 43CAA 4KHTH 4HJGA 1NJ9B 5EO1B 3MRBB 5DD1H 4BFIB 5CBAA 4D0DA 5MP6L 4OCMC 2O5YL 1FZOA 4OCXH 4OQTA 3EFFB 1SYSB 4A6YA 4ZUTA 3RU8L 3SHSA 2J8UF 1N7MH 5C09A 1E28A 1UACH 3HI5H 2VQ1B 1IAOB 1NL0H 1UA6L 2P5ED 5AYUH 1A7PH 1F90L 2HN7A 2PXYB 4JJ5B 4NBXB 2Z4QA 2GSGB 4URTB 1F4WL 1GGTA 3QCVL 5KVDL 4ZODA 1QSEE 4GQPH 4CU8A 4Y7MA 4JFDD 1NFIB 1HEZA 1IEAB 2YPVL 2DQFB 3ULSB 4P2OA 3E6HA 4MNGA 1FV1A 1KIUA 3QUZB 2BVPB 3BZFB 2X4OA 2ATKA 1FPTL 2HT4D 3M1BA 5GGQL 5GQBA 4AEIH 4DEPC 5HGHB 5K9OA 3PL6A 4G8EB 3FN0L 3QEQB 1NCWH 3SDCC 1ZT7B 1YC8A 2GUOB 3BIBX 1KCUH 3I75A 3PGDB 4XNXH 4MJ6B 1QLEL 3U2SA 4CVZB 5IMKB 4O2EB 4PR5B 5E7BA 3C5ZC 1NKRA 4LHJB 4NJAL 4I48B 5DK2A 3RWEB 4NQCD 5E0QA 4APQA 1MFCH 1NAMH 4MVBD 4Y88A 4A2LA 4UTAH 4XB7A 4KUCD 3UBXB 3TT3H 4AEEA 3BPCA 4WTZG 4AL8L 1HHHB 1R3HB 4E9LA 4EUPG 4H8WC 4GRMA 1U8QA 1DQDL 3WN5A 1KG0B 1HSAB 4L9LA 3B5GA 3QNZB 4EIGB 4IJ3C 4ONGL 3RVTC 4Q58C 4KVNH 1I1AC 5JMOC 8CGTA 4JQXC 2UY7A 1A47A 3FFCB 5HHOB 5JHDA 1QFWH 4K9EH 4M61B 2Z8SA 2C5DC 4GRWB 5DQJA 4MD4A 3DUUB 4NHUA 3UTTB 1T03L 3CLFL 3EOAA 4FQPA 4FN0A 1L7IH 3BVNB 3MLYH 2X7LA 3U0WH 3L7EA 2EH8H 5TGBA 5ITFA 3OX8B 4MB4A 1BIIA 3DTXA 3QDAA 3ARGC 4HXAL 3IS0X 1UZ8A 3WUZA 4CMHB 4TNWF 5CWSA 4ZTOH 1INEH 1YYLH 4ODWB 3G6DH 1T4KA 5DDHB 1YYMH 3LEVH 2B2XH 4ODHL 2VZ1A 4NRXA 3X3GH 2ZUYA 4LNRB 4HWBA 1Q72H 5D1XB 3CCHB 1BOGB 3FO9A 4NNPL 5IESH 3L1OH 3LMJH 4WHYH 4YK4C 1TVBA 4XC1L 2P24B 2VDLH 2J6EL 3IDXL 4JFQA 3VG0L 5SWSB 5C1MB 2AKRA 4TOYL 2BDNH 2V7NB 4NWUL 4XCNA 1V3LA 4F3FA 2YA1A 4E41E 2QKIB 5J12B 3AROA 1BWWA 1JPSL 2XZQL 3GDBA 2F54D 1G7MA 2YPKA 2BSRA 2XWTB 4TPRH 1MY5A 2H6PA 2YD7A 1P7QB 3QIUC 3WFBL 5E08L 4P9ML 2VITA 4LDOB 5D7SL 4G8GD 5SWZA 4JKLA 1QEWA 5E56A 2BZDA 1C16A 5IGXH 4S2SB 2HP4A 1DEEA 4L3EE 1AP2B 5GGTL 2IWGA 1IQDB 4U49A 2APWA 1KNOB 3T0ED 3GM0A 3RP1A 3S34H 3L5XL 1MAML 2VL5B 3OHXB 4NO5B 2KQMA 2NY3D 5E9DA 3C08L 2MTPA 2BERA 4X4MA 4HGMA 4NM4L 3C8DA 4ZQKB 3GJEA 3PWPD 4ZTPH 2FDBP 3OQ3B 2FD6L 4HIIB 1OSPL 3MSPA 5CMAB 3UCRA 2NX5D 1H9VA 2YSSA 3IJHA 3C8HA 1ERNA 4BFGA 5BO1L 4P99A 1HXYA 5HHXH 4JFOA 5AZEH 4HCRA 1N8ZB 5ISZB 5TDNB 1OPGH 1JBJA 4UNTA 2F5BL 3ROLA 5KANI 4L29B 4JG0H 5HGGS 3DVNA 4POYA 1UG9A 2OM5A 3BHBB 3ARTA 3HFMH 1SVCP 4UQ3A 2DJ4A 3MA7B 4JFFA 3BE1L 3RGVB 5D7IB 4OT1H 43C9B 3FB7A 4PRDB 5GGVY 1BJ8A 3V9FA 2D03H 1KCKA 5FO7B 1FG2B 4XAWH 4UT6H 3C5JA 2XI9A 3PQYD 1S9WA 5DS8A 1B2WL 2AXGA 4LAQH 2DBJA 4G43B 3O4LA 3MBEA 1U9KA 5CHNA 5KAQF 5JO5B 2XG5A 4NNXA 1J1OH 1JRHI 4M6ML 4F7CA 4KMTH 1LNUA 5IB1A 3DMMB 1F4XL 4JZJA 1I85C 1J8HA 3FRUA 2C3WA 1H8SA 3ILQD 4O4YL 3SE4C 3MV9D 1MHCB 1BEYL 1ZHLA 2ERJB 3MXWH 4P0DA 3AFLA 1EEYA 4JO1H 4YR6B 2JK5A 3T04D 4CNIB 4WTXA 4FTVE 3BP6B 3OKKB 3V2AR 3TT1L 5JLZB 2E9WA 3EAKA 4NQDD 3FCTB 4Y5YC 1FGNL 3TNMA 3WUWG 3ALXA 1NMCC 3JV5A 3C5SB 4FFYH 2DICA 3GMMA 2UVFA 1N59A 3B9AA 1UXWB 4WW2F 3RUGE 3QG7L 4G6AD 3U9PL 1F4AA 1ZGLM 1WQVT 4IIQA 4YDIL 3JV4B 5JHLH 3MV7E 3AY4A 1D6VL 4OF3A 5CP7B 3HI1B 3SDXA 4NO3B 2J88H 1TTGA 5J4MA 3EOBB 4DTGL 4JQIH 2CKBH 4YHML 3VG9C 4AQ1B 3D18A 1NEZB 1NMBH 1V7ML 3FL7A 2AERT 4G9FE 4ZD3H 1N64L 1QBLL 4K3DH 4YHKL 1OWWA 4NKIH 1FNSL 4UIMA 1L9MA 3DV6B 3E1F1 4R4FL 5CSGA 3SGKA 1M71A 3EOTH 1NBYB 5EPMB 1FZMA 4I9WE 1KJVB 5D1ZD 2PO6D 4NQED 4WRLA 3V6BR 3IKKA 3W81A 1CT8A 2DM4A 5FV1L 4H88L 2A6DA 4RMSA 1ETZA 4KMLB 1U41A 2O5ZL 1EHXA 2I25N 4MXVE 3UTPE 3T0WA 1M1SA 5J3HC 2P47B 1UVQA 3P3YA 5DURB 3VDBA 5T1LD 1CD8A 1XT5A 2YD2A 2VN7A 4UIKH 1U8HA 3QIBD 1OQXA 4Z7OF 5GSVA 1EXUB 5E4EB 5GJSH 5T3XE 4BK4A 4NC1E 4JDTH 4R6UA 3U4EA 2HLFD 3BWUC 4UOW1 5C0JA 4XWOD 1MVUB 4KKCD 3ARFD 3WLWD 3GSOB 3DYOA 3TJEH 3DUSB 5KVEL 3L3JB 9CGTA 3IAPA 4GRLD 2E8ZA 3CD4A 4RSVA 5GRJL 2HRPL 3BT2L 2EC9T 1FVDA 4D0CB 2PYFA 4JPIA 2H2PC 2DWDB 3O2WL 4LRNL 1OD9A 3MJ7B 4GAYB 4OLXH 5DR5H 2VH5L 2VLJD 1I3VA 4RMWA 3HKFA 2JJUA 4PJXF 2E7LA 4YC2C 5FUOL 2NLJA 2X1WL 1ZHNA 5D4QA 3MOQA 1XR8A 5CEZH 2FBJL 4I13B 1S7WB 2E7MA 1L4IA 1M05B 1RULH 2H9GB 1KC5L 4L8CA 2BOBB 4XP5H 1JNHA 3Q3GB 4XPGH 4NHCH 4RGOL 4BQ9A 4HS8L 2NY7H 2R0LL 3WFZA 3PP4H 1S7RA 2BCKA 2I9TA 4MA3B 1WZKA 4Y4KC 2YUZA 3BH8B 5ERWA 3SGEH 4OUUB 2DQJL 3MRPB 1VGKA 2DTMH 3BPOB 3VFTB 1YDPA 3QFJD 3LY6A 4HK3N 1IBGL 1CVRA 4PYGA 4JM4L 3QQ3B 4X6BA 2QR0A 3FQTA 2XV6B 3VXUD 3IKCB 1ZTXL 1NH6A 3HLAA 4N8CH 2X4UB 1DFBL 1I7UA 3QUXA 4LHUA 1KB5H 1KFAL 2OTPA 4HC1L 1CG9A 1EHLH 5I1DB 2AJVL 1KB9K 4FS0A 3NCBB 3WHE1 1XCQA 2R1WA 4JFDB 5EU3A 1TLKA 3FN3A 3NFSL 2DD8L 4JHWH 2F58L 2FZ3A 1JGVH 3E2HC 5SWQA 5KS9E 4XMKH 1C5CH 4GW4A 5L2JA 3DRQA 2X1OA 4JZNB 3IDJA 1T1XB 1G7QA 1DE4A 5IOPB 4JZOB 4N0RA 5FO9B 5F7DB 4DKEL 4OCRH 3ZKXB 3OXSA 4NNYB 1U8MA 3QJHA 4WV1C 1KENL 4LU5H 3BKCH 4MXQD 1BVKA 1OT2A 2YRZA 3UPAA 3VE0A 2F19L 1XFPA 1X4YA 1T89A 4XNZC 1RZFL 5I30L 3IRZA 4NQCB 3V4VH 3LKSA 3T3ME 3NIDF 4O2CA 1N5AB 4XVTH 3SCMA 1X5AA 1KPUB 2QQKH 2APXA 4H8WH 1YJDL 3ULVD 1FIGH 2EE9A 3SJVD 4PJGF 1FYHB 2WUCL 4KKLD 1LO0L 4QOKE 5EIQA 3V4UL 1A3LH 4OCYH 4P9HL 1IL1B 4X99B 1F11A 3U7WL 2X4PA 4PJ5D 4XXDA 3P4NB 1EEQA 4HIXL 1U3HA 2OJEB 1K6QL 4EVNA 3UC0L 2PETA 4HDIB 4X9FA 1AY1L 3LPFA 4QTHA 1I4FA 1W0WB 2AK4D 3DXAE 4WNQA 1Z5LB 2Q87A 4DVBB 5DYOB 1RUKL 5B39A 2CUMA 1U95A 5IW1A 3ILPB 3O9WA 4Z7VE 1PYWA 1W0VB 5FUZL 4P3WA 5IQ9B 2GJ6D 1QSEA 2XZAL 4K7PH 1GYAA 2BVQA 3G6JF 3ZMRA 5B3JF 1BZ9B 4Y5XC 1YEIH 4RGMB 2BOCB 2IFFL 4IRZL 1F4YH 2QSQA 5GPRA 4LEXH 2UV3A 1HQRB 4OLWL 1TIUA 3AC0A 1IAIM 4PGCB 4PP2A 1RK0A 3MLZL 4LSRL 1YEGL 3BSZH 3CK0H 3GMOA 1HIML 4M1GL 4O2FB 4U6YB 4RDQG 3C09B 4HS3A 1A7NH 5TQ0H 4XVSH 3LZFL 2HT2D 2P42B 1F45A 3AU1A 4LLMB 3S7GA 4NBZB 4ERSL 5JW4R 1X5YA 4JY6B 1B6DA 4UQ2B 3TVMC 3HUJF 3O6FB 1EV2E 3IAGC 4XZUB 3FHQA 1PLGH 3ULVL 2W59A 5JTWA 1S3KH 4MJIE 2VXQH 5GRZA 4XRCB 5FK9B 5DUBB 3CC5A 4FQJL 3MRLB 4NOFA 3DSNA 5C9JA 2WUBH 1MJJB 5LGHH 3ZDXE 1NAMA 2X10A 2F54B 2V6HA 4IOIB 3BWAA 1QRKA 3BDBA 1NANI 1KF9B 2W1NA 3JTTA 4XBPB 2UWEB 1N6VA 4G8GB 1XF4A 4TSBL 1HOCB 2J5LC 1SEQH 2DQEL 5CCKL 1NC2A 5HYIA 3MO1B 3OPZH 3T0EB 4XNUL 2YK1L 3GSRA 4JREC 2GT9B 3NGBB 4R0LA 3KYAA 3VFSA 4NSKB 5C08A 2IJ0C 2NZ9D 2NY3B 4KRMB 2XKSA 4M03A 5A2KH 1FORH 4YBQD 3PWPB 4AH2B 2D0HA 5I8KH 4PJAF 4IOSD 4BUGA 2NX5B 4M1DL 2OBGA 1Q0YH 2V5RA 3KYKL 5KVFH 2GFBA 4UT9L 4TQEH 3IB4A 5GS0D 4G6ML 4OD3H 3TZVC 1HXMA 1MRFH 1D5BA 1Q9OA 4M8QB 4R96B 4PGZA 3O4OC 3TWCH 4NWTL 3TO2B 5DMIL 4OJFH 3THML 4R3SA 3MLVH 3GSNB 1WEJL 2VZUA 5TE7L 5K9JL 3QP3A 3RVXD 4FQ2L 5JUEL 5I19H 4CMMA 1RUQL 4NN6B 5F1KC 1CXEA 5EBLB 1BQLL 2YMXL 3VXNB 1MOEA 4ENEC 5EDXA 2FJFB 5FGCB 5JXEA 3EYOA 3FO1A 3PQYB 5DUPH 5EZLA 3SKJL 1T7ZA 3NIGF 2EYTA 4PRAB 1IZKA 2UZIH 4YWGL 4Q6YA 1FFOB 1FNEB 4QCIA 4IMKA 1IM3B 1B9ZA 3MFFB 5HI5C 1CL7H 3MLWL 3RA7L 2LTQB 4HH9B 4PREA 3H42L 4HWNA 2X2YA 1ORQA 3ECBA 5FECB 3OF6D 5FHBL 5CZVL 3VD9A 4XBGA 4LCYB 3NTCL 3PGFH 4ZFGL 3DURA 3BP7B 1X3DA 3DI3B 4IMLA 4PLKD 1X7QB 4XTRD 1P84J 3RVTD 2CSPA 1BVLA 1R0AL 5CILL 1P4IH 2FBOJ 4N9OB 1S7XA 3T1FB 4M00A 3HG1E 3TC9A 2VLLA 1A6WL 4NQDB 4PTTA 1DVFA 2WQRA 5D7JC 2OTWA 2K3TA 3OKOA 3IJSB 5E8EA 3RFZC 4YHYB 2X70B 1NFKA 3PV6A 1SJEA 3N50A 4U1NA 1J1XL 1FYTD 3S98A 1RAMA 5L6YH 3X14B 5GS0L 3VD3A 5DD5H 4QGTA 3GB7B 5K9KA 5F93C 5IFJA 2CJUL 5CAYB 3ARDD 5IG7B 1XF5A 1CDCA 4PJEF 4LVNB 5FCUH 3UMTA 1R5IA 3OB0H 1ZT1B 4O9HH 1CI5A 5HYQA 1VGEH 2QL1A 1UYWL 1I1CA 2CIIA 1JHLH 4F37F 3WS3A 1AIFA 3MODH 2BHUA 3G5ZB 5E5MB 5I66B 4ELKB 3D3VE 1E4XI 3LQZA 4GMTL 5ALCH 4KRNA 3KPRA 1DBAL 5FA4B 3V7MA 2IALA 1HE7A 2ITDA 4DZBB 3L5WA 3OWEA 3A67H 1I9RH 2OSLB 4Y1AA 4NQTA 5JIHA 3NA4A 1NLDH 3RL2B 4ZFFA 1UC6A 4LQFH 1BQSA 2P8PB 4K8RC 3MREA 5D1ZB 5H37H 5GZNC 2PO6B 1A6VL 4NQEB 35C8L 3FAXA 3L5HA 4YBHA 1C1EL 3FB6A 1D5ZB 5F7HA 4IM8A 3W11C 5F72S 2VLRD 4R4BB 4M7JH 3VA6A 4UMGA 3ARWA 2VE6B 2ICEB 4X7TB 1ZANH 1GZQB 4DCQA 1MIEH 1LO3L 4LF3A 3IXAA 5T1LB 5IQ7L 4X4XB 3QIBB 3QIUD 4KROD 3HRZB 5IT2L 4WW2C 3RI5K 3RUGA 1CR9L 1UZ6F 1TCRA 1XGQB 3T8XA 4LK4A 4RFOL 4HJJH 2K1MA 3RWDA 2BC4B 4RX4A 3ARFB 2MOVA 5J56B 4NRYB 3MV7A 4GRLB 1UM5L 5IKCA 1T20A 3PV7A 1MCFA 4OLYH 5E2WL 2VLME 2C7UA 2VLJB 1T7YA 2BMKA 4U1IA 4JM2F 3T4YB 3CMOL 2G9HA 1OM3H 4Y8AA 3OKNB 4WU5A 1FZKA 4KJQC 4G9FA 4JDVA 1LE9A 2JCCE 4XP4H 3V4PL 3OR7A 1LILA 2ARWA 4FQXD 5E95B 5JDSB 1D9KA 3BO8B 4OQTL 2IH1B 1JYVA 3KPNA 3QDMD 4X6DF 3S5LG 4PRPD 3RVWC 5CJOL 3O2DH 2FHCA 1EAPB 1TFHA 3I6GA 4M6OL 4ONOA 2UUDK 3NACL 3LRHA 2BNRE 3A6BL 1H3GA 5BS0E 2CKBA 5I8CB 4NKDB 1L6ZA 2VISB 4IHOB 1QSZA 4POZD 2PTVA 3QFJB 3CSPA 4OFVA 3IGAA 4IRSC 4NKMB 2GTWA 3VXUB 4KY1H 5I16B 5BJTB 3UJTL 1I8IA 2EIEA 4PRHD 3ZKNC 5DT1H 1MCRA 1CXFA 3JWDC 3RZCD 3CVHL 1OLZA 1A6UL 3C6LC 1JWUB 3WD5L 1YEHL 1DLFH 4X7DC 4AMKL 3GO1H 1I9EA 5EWIL 5F1NA 2DRUA 1UJ3B 2Y36H 3CGTA 1MCOH 2P8LB 1TJIH 1KN2L 1FO0A 2XTJE 1F8TH 4ODVH 3DJ9A 4S1RL 5ICYB 5IFHL 5IMMB 1FL5A 2J7LA 4H1LA 2Q3ZA 3EYUL 2NPLX 3IFPB 4FP8H 1K5NA 1R3IL 4X80L 5HGDA 1I9IH 5CD5C 5F89B 15C8L 1CLCA 2E8YA 2VR5A 1QSVA 3K8KA 4OLUL 5AG8A 3KYNB 1PQZA 3UTSE 3PHQB 3RIAF 3SJVB 3OXRB 4ISVB 1CFSA 4TUOB 5J11B 1KN4L 3L7FB 5JA8B 2LVCA 4PJ5B 1YECH 3P77B 4JANA 1AI1L 4OZGF 2LAGB 5JMRA 4QHUB 4OLZH 4Z7NE 2AK4B 3F7PC 1BD2E 4P5TD 4K3GA 3SGJA 1WBZA 2LV4A 3AM8A 2QQLL 1N2RB 4AZ8A 3M8OL 4MD0B 4ZXBD 2Y5TB 3VDCA 4NGHL 4L4TE 4NO2A 2WNGA 6FABL 3F6IA 5FYJU 1XIWC 2OTUA 2EXWC 2CO7B 2GJ6B 4QYOA 5BV7L 2AEIT 3WIHH 3D39D 3RAJH 4DGVH 1CF8H 1U42A 1PG7L 5AD0B 5KS9A 4YO0B 1XF2A 3A6CL 4XVUD 4PUBL 2OK0H 4S1SH 4Q9QH 3IFOA 2W0FB 3D2UD 1IEBA 1MCQA 5DF0A 4I2XA 2RB8A 3HNVL 4K7FA 2V9QA 3C2AL 2HTKD 1EFXA 1KB5A 5EN2B 3LIZL 4C57C 1NGPH 1E6JH 5A3IC 4G8IB 4H20H 4P57B 1KTDB 3J7HA 4PRNA 5J3HD 4AENB 5GJTL 3DBXB 4M7LH 5LGKA 1YNTB 3HPLB 3KJ4B 4QOKA 4HXBL 3SDCA 3QJFB 4QT5A 5D6CB 3WO4C 3MV8E 3NFPB 4XCYB 1U8LB 4WGVB 2Z93B 3ARBA 3C5ZA 3HCVA 1YEEL 1KJ2H 3EHBD 4U3XA 5ICZA 2RAMA 5KZCD 2CH8A 2F74A 3TBYA 3FQUB 5DI8B 3VFWB 3WEXA 4KI5F 5L9DH 2XIDA 1XAUA 4Z7VA 4CDGC 3LKRB 3S4SB 2X09A 1A22B 4MXWH 1EO8L 1BM3H 2F8VA 4PB9L 2XA3A 3OR6B 1WFNA 4D9LH 4QRTB 4GOSA 3QWRA 4LOUD 1MRCH 4JRWA 5ABDE 1ED3B 2HKFH 1I1AA 3N9GL 3RDTD 3P0VH 1XF3A 2Q86A 2VZVA 4WHDA 4KJYB 1EX0A 4DOHE 2ICWJ 5DO2D 3UJIH 1BLNB 3BISA 3DX6B 5D72L 2FRGP 2EEBA 2CMRH 3N85H 2Q8BH 5FUCC 3V6FB 4OB5H 1TETH 4HCRL 3BRDA 3JV0A 1DQMH 4F7MB 4D8PA 1OTTC 1HNFA 2DWEB 2JJTC 4DQOH 4Z18A 5E8DH 4G6JL 3FZUD 1Q9WB 5GGSB 1JV5B 2X4SA 4EEEA 4WI7A 3O41B 1QO3A 1GGIH 3ARGA 1TJHH 4Z95H 1AGCB 1RUAL 1A14L 1UB6B 4MA1C 1ADQH 1VADA 2P44B 2BY2A 5DRXB 1FAIL 4MJIA 2XRAH 4KQ4L 3BP4B 4N9GB 3F12A 3NZ8B 4OV5B 2HTLC 2XN9E 4LPTA 3EFDH 3C8KA 1TZIB 3IDGA 5D8JL 5TE4L 2H8PB 1CGSH 3GSWA 1SMAA 3CSBA 1CD1A 2OJZL 4LCCB 4RBPK 4L8BA 4DAGH 4S10A 1BHGA 1I1YA 2NCMA 1OCWH 4MNQD 4Y5VA 4I18C 4LLWB 5LQBL 1MFEH 1JHKL 3DRTA 5B8CA 4PJDB 5L0QB 5D71L 4KRPC 1BECA 1IC4L 2AJYL 2MCPH 2VOTA 1XH3A 5HD8C 1W8NA 5D1QD 3G5YB 1RJCA 4AT6B 5IP4A 4Z77B 3L3KA 4RCAA 1I1FB 3UPRA 4HUWB 1MPAL 4N0CD 2IMMA 5B38G 5EOQL 3VXRE 1QBBA 3U30C 3VCLA 3HE6C 3QQ9C 2N56A 3TYFA 3H6JA 4KDTC 3CXHJ 3U0PA 5C3TA 4XP1L 3QXDB 4GKZB 1HI6B 1R3JA 3SDAD 5MHSD 4U1JB 1UQSB 1AFVH 3CH8A 3MRQA 4JO2L 2FJGB 4IDJL 3CFKA 1K4CA 2R29L 1ND0A 2R1YA 5I1JL 3WLBA 3ZSTA 1FYTB 2FGWH 3GZKA 3TBWB 5ICXB 1EO7A 5L2KE 5GS2D 4U7MA 1AKJA 4X8JB 3PWJB 3ARDB 2XPGB 3TH2T 1F42A 4IRJC 1IGIH 4AEHL 2Q6WA 4P2QE 2WM0A 3NFNA 5AAWA 4WCYH 2EIDA 2EXYD 5JNYA 4O02H 4E5XA 5EIIB 3GMNA 3MUJA 4AIZA 1A2YB 2ZOKA 2IF7A 4BZ2H 4FABH 4J12A 1EEUA 5INDB 5I1EL 1OGTA 3MUZ1 1KLGA 2A6KB 3S36L 4MAUL 2FX7H 4YXHL 5I74C 4XGZB 3RY5A 4LRIC 2PCPB 1E28B 3B8YA 3TVMD 2MHAB 4L8SC 1BJ1J 3GEWB 1B4JL 5KVMC 2YBRA 3F8UB 1E6OL 2Z4QB 4ODXB 3D1MC 4GW5A 4G7YL 5DJAA 1Y0LA 4Q6IA 5IEKB 1S7SA 2VLRB 3RWFB 2BSED 4XB8A 3DNKA 4PRIE 4G80A 3U36A 3CVHB 3HG1A 1P7KB 5T1MA 2X4OB 3VI4F 1QBAA 3MLXL 1EEZB 1S5HB 2C3HA 2OZ4H 5K9OB 3LEYL 1JN6A 3RWHA 1G1CA 3U4BL 2ORBL 3I02B 4KROB 4JFZL 1GJIA 1I85A 3S35H 1U6AL 1PBYA 4WFHE 5BZDB 1ZXQA 3SE4A 4Z7UE 3PIQA 1NCDH 3NABL 5J06A 3LQAC 4LLQB 4M48H 4HIHB 3PJSB 1A3QA 4PTUA 1ZHBA 4YQXL 4X7CC 2OR8A 2FIKB 4U1SB 1DQTA 5FYLH 2BSSB 3QA3A 2P5WA 4KV5F 1L7TL 2UUDH 3PWLA 4XP9L 3WN5B 3D3VA 4HKZB 3X12B 1QQDB 4FFVC 5DZLA 4CN4A 1CE1L 5D2NC 4FQXB 3BJLA 3G6AA 5LBSL 3UZEA 4YJZL 2E27H 3WIFB 4WWKC 4LSTH 1CGUA 1ZS8B 5F1IA 4G8FB 2AK1H 2IANE 3HC3L 4BKLA 3QDMB 3TZVD 4PRPB 1NCBH 1QFOA 3MRGB 5L88H 4PY7B 2L4OA 3U9UA 4PJHA 5FYLE 1NFDE 1D3CA 2XKNA 1LEGA 4LPUA 3HC4H 1J0YA 3QISA 1E4WH 3FMGL 4KJWD 1KV3A 4WUKH 4HEME 2NYYD 1BQHG 1FC1A 1EHNA 4GRWF 4PG2A 3L7EB 4P2RE 3VWJD 1S78C 3HHRB 5C86A 3VGBA 4XWGH 3KPTA 4J3TA 4PRHB 1WBXB 4Y4FA 3RZCB 4DVRL 3Q5TA 3X17A 3HZYA 3QRFM 3L95A 4PLOB 5DA4A 3P0YH 2IG2H 4OM1L 2MWCA 3WYRA 1J0JA 3B3IB 1T4KB 4HUUA 3LPGA 3P4OA 2EIZA 3FB8A 4PJ7B 4XCEB 2AVGA 5F3BA 4JM2C 3BOVA 3SGDI 1Z6JT 5C2BL 5JW5B 3ULUF 2R15A 3VFGH 3K8LA 2JCCA 3QEGH 5F96L 2VDRL 1NDGA 4G3YL 4U2YA 1JTOA 1RFDH 4RDQF 4KUZH 1M7IA 3V52H 5AZ2L 5IHZA 2ADGA 3TJHC 4OZIF 5I1CH 4P46D 4B7LA 5CEYA 1HH6A 5C0CE 2NY0C 3SY0A 3HB3C 4GMSH 4ZS6D 6CGTA 4PD4J 3D48R 3I50H 5BS0A 3MLUL 1LP9B 1YPZF 2AJUL 2FYYA 3QZWB 1C16B 1KPRA 3IDUA 5BVJB 3ZDYE 1P2CB 4NBYB 4P5TB 2DMKA 5KVGL 1NGZA 5C0ND 3FO2B 4HHAB 5T5NG 4WDIB 4ZXBB 1QFUH 3JVGA 4GFTB 4YDJB 4YPGB 3QUKA 4G42B 4RRPG 4AJ0A 2X4NA 3GKWL 3MA9H 3BDXA 2OXGA 3O2DA 1HHJA 2AEPH 4Y4KA 4QTIH 1N7ML 4XPTL 1JF1B 2FR4B 1UACL 5ENWA 2E7HA 1S5IH 3D39B 1RK1B 1NL0L 5FYKH 1XR9A 3MRKA 1QR1A 5AYUL 1A7PL 2NMSA 5JIKA 4R97C 1M7DA 4K8RD 4DJMA 3D2UB 5GZND 2G2RB 4M7KH 3CXDH 1FBIL 4HS6B 2EEAA 4J7RA 3GJFK 2PF6A 3FJTA 2SEBA 5F21B 1LGVA 3M17A 4DUWA 3HMXL 3S3PA 4PJCB 1JPFA 4MWFA 4E41D 1NCWL 1FRGH 3WFCH 2WINA 1KCVH 1KCUL 4XNXL 5CEXB 4HLZG 4UUJA 2QTEA 5BZWA 5J0BA 5DQDL 3O2VL 1BIHA 4JR9L 3BD3A 4HIJA 1QFWI 1ZA3A 2X89D 4P49A 4WV1A 1C8PA 3RWGA 4UTAL 1GZPB 3EO1A 3TT3L 1YMME 5I73C 4OZFH 2FH6A 3DHJA 4L9DA 4L3ED 5KZCB 2A77L 1RD6A 5F1SA 1F6AA 4JPWL 2GTZB 1CK0H 5CLTA 3S88L 1B3JA 1HNGA 4L4TA 3EYVA 3RY4A 2WW8A 3TPKA 1OF2A 5F7MC 1XGTB 4KVNL 1TVHB 3KXFE 4ACPA 3RVUC 2BHZA 4K9EL 1L0YA 5IWLC 2JK5B 3RDTB 4YHOL 5E6IC 1UXSA 4C56A 3GBNH 3LSOA 1GHFH 3TNMB 1L7IL 1H3UA 4N8VG 2EYRA 1XF1A 4NZRH 5T33H 3U0WL 4C4KO 3VW3L 2EH8L 4QXUH 5KTEL 3P73B 5B3JE 2Z35A 2VABB 4I3RL 3QEHB 2LU4A 3FT4A 3GGWA 1G7HB 2Y7QB 3VJ6A 2J3SA 1XGYH 3WIHA 5DK3A 4NT6A 3UEZA 4IRSD 4RBPH 5C07E 4FQ1H 2VQUA 4XC3H 4HKBB 5A40E 1INEL 1YYLL 3QUMH 3HE7A 3G6DL 1YYML 3S96B 2M1KA 3MV8A 2GY7B 2KBGA 3QG6A 3O6KL 1S8DB 3X3GL 5FUCE 1P6AB 3T65A 3TIDA 1Q72L 3KLAB 1KSRA 1WIPA 5IESL 3L1OL 3LMJL 4KI5C 3NVQA 2VDLL 4I0KA 4X4YB 5ID0A 3V5DA 3FRPA 1FZMB 1TZHB 5JR1H 3WXVH 4G9DB 1PSKL 5DVKA 2BDNL 3BYTA 4MNQB 1OT1A 1CGTA 1DQJA 2BXYA 3T0BA 4LCUA 5HYSG 5JXAH 2ZSVB 3B2VH 1WZLA 2RFXA 4TPRL 5LVEA 3BRGC 4FTVD 4NUGH 2OQJB 5D1QB 1KPVA 4C83B 1KJ2A 3IYLW 4OZHE 4RZCB 4J4PA 5IGXL 1G9MC 3CH1B 4F7PB 2HFEA 1G7IB 3O8XA 4FXGB 4HBQA 3PWUB 5DJ0A 1TTUA 3KYMB 5C0JB 3SDAB 5IMOA 3VD5A 2IH3A 4OAWB 1FQ9C 3MV7D 3WDIA 5C2UB 3U1SH 3GKZA 2X42A 3UAJC 2I9LA 2DYPD 5DTFB 3BI9X 3HC0A 3AAZB 1V8HA 3VXSE 1XIWD 1QSFA 5EU6E 4YX2H 2EXWD 4MCZB 1F2QA 2KKQA 2IPKA 2ZG3A 2XN9A 3OKEA 2C3GA 4PJAE 2PW2A 4P5MB 5ETUB 3VFMB 2FL5A 2APBA 5HHXL 1YN6A 5AZEL 3EYQC 2ITCA 2C4FT 3GSXB 1A1OB 3VXMD 3V6OC 1OAXH 5KSUA 2D7QA 1PAMA 4NC2B 4EQ3A 5E99H 4YAQA 3WBDA 5DD6A 1F3JA 5F9JA 2EZ0C 4RNRA 4BH8A 1S7RB 5DMGD 2MQ0A 1JUFA 2B0SH 2IAMD 5ESAB 4CJ1A 3AGVA 1KYOK 3WNOA 4HUVA 1CFQA 4OF8A 4FQIH 1YDPB 4YHNB 4XAWL 3DV4B 4UT6L 3WL9A 3FQTB 4TVSa 3EJZC 3TVMB 3CPLB 1MCPH 2GAZA 4LAQL 4ZSOE 3CUPA 5T3XD 4Y16C 1T66D 1RZGB 3IAQA 4PFEA 5IMLA 4HMDA 4NJ9H 2HG5B 1EJOL 1Z2KA 2J4WL 1TMCB 1J1OL 2R1WB 3O3AA 3RKDD 1SJHA 1C5DB 2QQNH 1T04B 4XVJL 2FZ3B 5FM8A 4WU7A 3DARA 3TBVA 1WCQA 4GW4B 5DJCA 4JQVA 5EUOE 1T5WB 4NKOA 3CXHK 3U46A 3MXWL 3GRWH 3WFDH 4JO1L 1A6ZA 3MGTA 5FKAA 4U0QB 2ATPA 3LQAH 3OKMA 3FONB 1JZ7A 1AO7E 1IGMH 3IXTA 5L2KA 4KU1A 3WSQH 1XZ0B 1DBBH 5C0BE 1VKXB 4M8VA 3O11B 3P9LA 1G7JA 5IHBA 4ZNEA 3KNBB 4P2QA 5FOJA 5TJWK 4FFYL 5M95B 4X98A 3VXQB 4J1UB 5D7JA 2MMXA 4PV8A 4MLSA 3KDMA 2JE8A 3FB5A 1T5XA 5HPMA 1CFVH 4LIQL 1CBVH 5JHLL 3PHOB 4ONFH 4KUCF 4XHQA 4V2BA 5GSRA 2CO6B 1TPXC 3H0TA 3HAEB 2RQ8A 1TNMA 5CS7A 1VDGA 4FQCL 1QYGL 2CKBL 2QHRH 1IGFH 1M7XA 4MA8L 3VMOA 5J6HA 4JDZB 3TZVB 4EI5A 1GPOL 1JWMA 5DHYB 4ZD3L 3QEUA 4LKCB 4K3DL 5FM5M 3O4OB 1ZA6B 1PKQB 3GBMH 4JFXA 3G5VA 4DK6A 1MCJA 2VMFA 1MWAB 5T3XL 4PRIA 5C0AE 1PKOA 2W38A 4EKXA 2PXYC 2DLFH 1WBYB 4LSUH 3ARUA 3VWJB 3RIFF 2JTDA 3BGMA 1FO0L 5HPOA 2CDEA 1Q94A 1ZVYA 1HHGA 2Q7YA 5TH2B 1RZKL 3QO0A 2BRRH 1NLBH 3QUZC 2DQGL 3BKJL 4Z7UA 1HDMB 4RFNC 5DJ2A 1KT2A 2Q8AL 5FM5O 4YHPA 3WJJC 1HQ4A 1S7UA 4QRRE 4W6YB 4L5FH 2VWEE 3KWWA 3Q6GL 1GSMA 1MI5D 4L4VE 5FF6B 5GJSL 4F58H 4XP6H 4J3OC 3MRDA 1EGJL 4WW2A 2OZ4A 5HJ3B 1E0OB 3HE6D 3TJEL 5A2LH 3ARSA 1RZIA 5DSCA 1ZOXA 3OJ2C 1ACYH 2DQHH 5DR5L 3DXAD 1P4LA 5T3ZD 5ADPH 1VFBA 1EA9C 2YRLA 2IANA 2OR9L 2PNDA 4UNUA 4P3DB 3LQMA 5LJYH 1VFAA 1CDYA 1S9KC 4P46B 5KSVB 1E27B 3A6OA 3U79A 1FVCA 1NFDA 1SJVA 3AREA 1N6QL 4YDLC 5MEOA 2FX9H 5EC2A 2HVKA 5L8KB 1IE5A 5CJXC 5DRWB 3SPVB 5DQ9A 4XP5L 3U7AA 4XPGL 1MJ8H 2NW2A 4P2RA 3KPQA 3W0WE 3CFDB 5I75C 4X6DE 3V5KB 3PP4L 3BZEB 3VXPB 3EKCA 4JAMA 3K7UA 3K81A 4YNYB 3LS4H 2X6MA 2DTML 3G04A 5TFSH 2DDQL 5EORH 4DGYL 3W9DB 4S1DD 1ES0A 4EOWL 1I7RB 3MJGX 5E94A 4TSAL 4N8CL 3WXWH 3UTOA 2W9EH 3OAYK 3FQXB 1B0GA 3T77A 1KB5L 3GIVB 4XNQB 4DKFL 1JVKA 1EHLL 4ODUB 4GG6F 1HKLL 1WWAX 4V1DE 2NNAA 3C6LA 1MUJA 1D5BB 4JRYE 3ULUC 1H3PH 5D1XC 4FQLH 1JGVL 1JPGB 4XMKL 1C5CL 4LLDA 3QCTH 3B6SA 4XNYH 1G0DA 3U0TA 4E41B 4NZUL 2NW3A 4N90E 4NUJA 4LU5L 3BKCL 4CMMB 1V5JA 3MUY1 1IM9A 5C0CA 1U8PA 1A4KB 5J12C 2Z0BA 3V4VL 4OD1H 4PP1D 1ZEAL 4XVTL 1QPPA 1Q38A 2QQKL 4H8WL 5D5MF 2VZOA 4L3EB 4XH2B 2VR4A 4PGEA 1A3LL 1PG7X 4OCYL 4PD4K 1RJYB 3I6KA 3ZLQC 4LCWE 5IVOA 5K33A 2JJVA 3OG6B 2Q3AA 4D0BA 3ECBB 4UILH 1I9JL 3RPKA 4XBGB 1Q0XH 4OZGE 4HJ0C 4GQ9H 4GBXA 2ZSWB 2EDEA 3O6LL 2E7CA 2A1WH 3CDGA 3MRIB 1JGLL 2W65B 4WWKD 1D6EB 5TDPA 3NZHL 3QRGL 3WJLC 1F58H 5DLMH 5IK3A 1JNLH 2IFGA 4NO0D 4JB9H 3VI3E 1L0QA 2OTWB 2P7TA 2V2WA 4PJ9A 1RIVH 3IF1B 3S6CA 1YEIL 5EBWA 1LO5B 4BZ1H 4JFYA 2VUYA 4HIEA 5ID1B 4NZDA 1SEBB 1UWGH 4IRSB 1KEMH 1FN4B 1OAQH 3I9GL 1UM4H 3BSZL 4RGNC 3W82A 1A7NL 5TQ0L 4KC3B 3ZE1F 7CGTA 5TQ2L 1IARB 4MJ2A 5I8EB 2FATH 2H3NB 3NPSB 4Z78B 3MRMA 2ITDB 3L5WB 1V3MA 3KGRA 3MNWB 1DDHB 1GGCH 4PJGA 4X9IA 1PLGL 4JY5L 4PIRF 1HKFA 2CIKA 1S3KL 4PJIE 1CCZA 5H94B 4PJXB 2VXQL 2MQCA 5C8JA 3BD4A 1WSST 2AQ1A 1Z9SA 3KXFA 3MRJA 4X5LA 2C1OA 3IRPX 3MXVH 2W07A 5LGHL 2RBLA 2ED9A 2GCYB 3ORJA 4ZOEA 4FTVB 3PNWB 3K2UH 5GIRB 4OZFA 1UJTA 1UFUA 4OGZA 5J6GB 3E6FA 2ERJC 1FJ1B 3P4MA 1G9MH 3HNTH 1TITA 3NN8B 2BSTA 4M5ZL 2A0LC 1SEQL 3SDDC 4PJBB 3RUGB 2DBLH 3DVFA 5E70A 5EUKB 5F70A 2R2HA 2QSVA 5LAXA 1WZ1H 2CDGA 2HJKA 3QPXH 3RWDB 2V2TB 2ID5A 5DRZA 4QHMA 4HULB 1IGJB 3MV7B 4TRPL 5EO0A 1T0PB 1FVEB 5GISH 1XGPA 1CLOH 4IDLA 4XAKE 3L6FB 1FORL 3U6RA 1OW0A 3FN9A 3SE8H 4L3CB 2DYPB 2BMKB 3ZE0F 2AW2A 1XIWB 2B20A 4HK0B 4PB0H 5I1GL 3HRPA 3TBTB 4LVOC 4OCSH 5KVFL 4TQEL 2CK0L 5DC9B 3B9KA 2BJML 3NIFF 2JJTA 2ZCHH 4OD3L 1A1NB 2ZUVA 1MRFL 4BJLA 3LEXB 5DEZA 4XXCC 5IF0B 3HUJA 3TWCL 3CNKA 4YGVA 5IB4B 4UTBL 3MLVL 2A73A 1FSKB 1CL7I 2F5AH 4KGLA 1ITCA 1KIRB 1MCIA 3PXHA 4QRQA 3INUH 3QUMA 3OJDA 1A7OL 2WSKA 4N0YL 2IAMB 3LN5A 3V95A 5ITBH 5I19L 5D2LE 5FYJD 2A6IB 4LASL 1I3GH 4ZO9A 3WE6A 4U6HB 3VFVB 1MLBB 4LHUG 4QRPD 1K8IB 2Y6SD 1DQQB 3OKLA 3V6OE 2R0ZL 3QDGA 4OZHA 1INQB 1JPTL 5I1IH 3HTLX 4Y4FD 2IEPA 1A4JB 3QQ4B 5E8NA 3BQUA 4I18A 2H2SC 4YEEA 2VDOL 5K93A 5MERB 2ZG2A 5EU4A 1DSFH 1INDH 1P4BL 2VR9A 5E4EC 1FO0B 1O0VA 3D25A 4N0UE 4XHJC 1FL5B 2UZXB 4H1LB 1MSPA 2ZCKH 4Z0BH 5J9PA 4RAUA 1NC4D 2OP4L 2O93L 3QIWD 1V7NH 4OCLC 5E2UH 3VXSA 4Y4HA 5EU6A 1P4IL 3G6JB 1AE6H 4HWZB 4YDVA 1I8LA 3DX9A 4KDTA 4PJAA 4Z7QF 2ADIA 4JLRA 4XCFH 2R8SH 1AXSA 1R24A 5HGBA 4IS6A 2HT3C 3IDMA 5L6YL 4KK9D 1NGQH 5DD5L 4F8TA 4B50A 2NY4D 4OF5A 2DLHA 5CZKA 3CFEB 4JFPB 3KHOA 4NZJA 1OLLA 4Q0XH 3RPIB 3B43A 2BNRD 4LP5A 2HJFA 5FCUL 3RWCB 3X13B 3SKUD 2O26U 3GI8H 1IQWH 5B39G 3WKML 3ULVF 1CU4H 4O9HL 1KULA 4BSWA 4MMXC 2C4XA 1KGCE 5DHVB 1JHLL 4IRJA 2WWMC 1JI1A 4OI9A 2X4RB 5ESQB 4WVRA 3MLTB 4JHBA 4LLVB 5ALCL 2PTTA 3AS1A 3ESVF 4ZSOA 4U31A 2W60A 3A67L 1I9RL 4FQQB 3DSFH 3PDDA 3F5WB 1NLDL 1J5OH 5AUMB 3OKDA 1EMTL 2FSEA 3BZ4B 2GSIB 4UU9A 3T0XA 4KKNA 1U8NA 4LRIA 3IFNL 5HI4C 4OSUH 4L8DB 5CSZB 3TLRA 2R2EA 1MY7A 5DMJB 4K7FB 1YC7A 2N1KA 1E4XH 1EFXB 2VLKD 1KB5B 1ZANL 2DB8A 2HT4C 1MIEL 5CUSL 4ODTH 2BVUA 4ZUVA 5C0BA 1CXKA 3ZKXC 5C0DB 1CICA 4UV4H 5DJXB 1MI5B 4KFZC 4RIRB 1TCMA 4HGWA 3UTSD 2ADJB 4AIOA 4QOKB 4MVBC 4XNMB 3KAAA 1S7QB 3HE6B 4P4RA 3B9VA 4S0SD 1MLCA 4HSQA 4MX7B 3UDWC 2D2OA 4ONHA 2AJZB 1J05A 2HWZL 1MAJA 3BEWA 4I0PD 2VZTA 3NCJH 2HJLA 4QKXB 1BD2D 3DXAB 2EE2A 4OI7A 2A2QT 4IBLT 4OI8A 1GGBL 1H8OA 1OM3L 3O6MH 3H9SD 4XP4L 5E00B 4GRWH 3I3BA 1A0QH 3K4DA 4BFEA 1U3JA 4JVWA 1ZGLA 1T0NB 1IAIL 3OAYH 5C0AA 5HDQH 4MCYB 1IC1A 4KPHL 1JWSB 3EYQD 4NP4H 4NQVA 5E5UB 5DGQA 1C7TA 1MF2H 4OGAC 2W9DH 2RR3A 2DQUH 3MNZB 5FGBC 3CVIL 3TPUA 1F13A 4WUUD 5HHOE 1XCTA 1BJMA 3I6LE 1KTLA 5B3NA 3BXNB 3FTGA 1QRND 4GRWE 4JKWA 4QRRA 2R2CA 3UTTE 5DT1L 1WTLA 4M3JA 5E1AA 3TV3L 1AD0A 1I7ZA 3C60D 3CSYA 1AXTL 5FDWA 1P6FA 1DLFL 3D0LB 3PG2A 4P48A 3EJZD 5C0IB 5IVZA 3ULUH 1BPVA 4GG8B 2CDFA 2Y36L 3HR5B 1MCOL 4L8SB 3C09C 3HE7D 4OKDA 1JZ2A 1RMFH 4N1CA 1F8TL 5MEPA 1P53A 2DKUA 3L3GB 1NCCH 3T3PE 2H45A 4LCIH 3PHSA 1J0KA 3O6FC 5J13B 3D6GA 2XY1A 1TQBC 2RCSH 1URLA 5LCVH 1QD0A 3TN0D 3T2QA 1I9IL 4HQQL 3HS0B 5LXGH 3STLB 1ZT4B 1F00I 3R06B 3ZYJA 4JM2A 4WHYG 4RWYH 3SO3C 4EDWH 5D96B 3IT8D 3MGOA 3KPPA 3DUHA 1ZWIB 1IVLA 4MNGE 1RJLB 2YD8A 1IAKA 2AGJH 3OAUL 1K9TA 3QHTC 3U82B 5I15H 2R56L 1ZVSB 3QFDB 3ES6B 5B8CB 5DJYA 4PJEB 2EKSB 1P1ZA 5GHWH 4X6DA 4EZMA 3MYJB 2XZCL 2YD3A 5INCA 5SWSE 1KOAA 4Y19A 4MD5A 2CRIA 2AJXL 5DJDA 1LEIB 4PJDF 1F5WA 3EDJA 2HA1A 4OLZL 2Z9TA 4QY8B 1WIOA 3EJYC 3NGBC 1D5MA 3VCLB 5D2NB 1U58A 4W81A 3TYFB 5IB2A 4W6XB 3TA3D 1T1ZB 4OGYL 5FKPA 2D0GA 4PRBB 3QYCA 3FOLB 3BN3B 2NY3C 1BAFL 2AJ3B 3DX7B 4WWKB 3MLPA 5IJVA 3EO0B 2A9NH 3B83A 3STZA 3RWIA 2EDXA 4H25A 4Z7WF 1CD0A 4TN9A 4PJFE 3BDYL 4V1DA 4NO0B 4ZO7A 1QLFB 1C12B 1Z9LA 4JRYA 4QNPF 3TM6A 1CF8L 3WLBB 3TCLB 1RZ8B 2EC8A 2XQBH 5I71C 2OK0L 3I85A 2OCFD 1KJMB 1OWRM 3BGFB 4YZFE 4Q9QL 3BJ91 1N0XL 3D69A 5HHMD 4XT1C 1U8JA 4DN4H 5EIVA 5HVHC 4YFLI 4F2MA 2YC1B 2ZPKH 4LSQH 1X5IA 1NGPL 4WW1A 1E6JL 1KEGL 1AGDA 3SE9H 3KJ6H 4H20L 2E6PA 3ZL4H 5H35A 4WHTB 2XNAB 3MZTA 4NN6C 4M7LL 5ISZE 2VC2H 5D7KE 4UBDD 5J7CC 2NTFA 1FFQA 1T1YB 4KVCH 1FDLH 1OSZB 1WAAF 2V7HA 1JK8B 5TF1L 1RJZB 5DEFB 5L8JB 1ORSA 5JIIA 4LPXA 4BH7B 3GIZH 1KJ2L 3VXRD 5JOFA 5D7IE 4OZGA 2GQHA 2YZ1A 1H15B 5L9DL 4Q6IB 4M9OA 5EBMA 3DO7B 4MXWL 4U1LB 4EUPB 3ILQC 3HG1B 4OTXL 1H3WM 2MSPA 3MCKB 4WFED 4D9LL 2IGFH 5HHVH 4TVPD 3Q48A 4PBXA 3EGSA 3D0VB 1U8IB 4CW1A 4U6VH 3RWHB 3JBG7 2HKFL 1NBVL 1BFOA 4JGMA 3P0VL 5A16B 3PIQB 5L2KD 2IBZY 5BW7A 5FO8A 5IWLA 4DUXA 2R0WH 1JMZA 4WEMB 3UJIL 5E6IA 4GAJH 1EZVY 3N85L 2GK2A 4G6AC 1WCBA 4MDIB 2Q8BL 3S37X 5CD3B 4OB5L 4PV9B 2VDPH 1T21A 3DI2B 1UADC 4LVNC 4DQOL 3HMWH 5KSAC 5MI0B 2EDTA 4XMPL 5B21A 4NPYA 1GGIL 1DANU 1TJHL 1QA9A 4I5BB 2B4CH 1FH5H 4Y8DC 3SQBA 4R97B 4JO4L 4GAFB 1GH7A 4J3WA 4PJIA 4RISL 4ZFOL 2VXSH 2XRAL 3EFDL 1JZ5A 5DWUL 4RFEB 1SYVA 2G5BB 5TDOB 2G5RA 3O3BA 5D1ZC 4HAGA 2Z91B 1YQ2A 2PO6C 3KVQA 4W4NA 2FWOA 1VFOA 4RQQB 4QRPB 2JB6B 3H7BA 1UA6H 3B9DA 3FQWA 1QVOB 5DUML 4BZYA 1F90H 3KPSA 2DQCH 3GI9L 1YN7A 4LAJH 4Y4FB 4EBQL 1ZHKB 4C4KT 4ZDHA 3WFHB 1KTRL 2MCPL 2ZUQB 3IJYB 4WFHD 1WVZA 4X83A 1A21A 2JJWA 3QIBC 4IEFB 1HN1A 2AXJA 5GGQH 2AV7B 2HLFC 4NN5B 3FN0H 1NC4B 3ARFC 3IVKB 2HFFA 1S9XA 4Y2DC 2QJDA 3QIWB 5DMKA 3O3UN 4GRLC 3GUTB 1QLEH 4Z76A 4X6FA 4NDMA 2VXUL 4LDEB 4LLUB 4U7KA 1KLUB 4GUPA 4P23C 3R1GL 1J8HE 1NGYA 4M62L 1M7IB 4NQXB 4K23H 1MCWW 4AL8H 5LWYH 1JGEA 4DUVA 2DM2A 1YJDC 2NY4B 3JWNC 3VFRB 1SBBA 4FOMA 3MLSL 3RQ3A 3SY0B 3CDFA 2QV2A 4P9HC 5JORA 1IGYB 3FO0H 5GRVK 1F3RB 3ARED 3RL1A 2BNRB 1IGIL 2N7AA 4XPHH 3V7AE 1OGAA 3F7QA 2K7QA 4MZ2A 3EYSL 2ZJSH 4PY8J 5HHQA 2B5IB 5IV2A 5I1KH 3MRRA 3ARZA 4AM0A 3V6OA 5BQ7A 4I4WA 5DEGA 3CLEH 4HLJA 2J8OA 1DUYA 5EO9B 2QADD 5GRXG 3CLFH 1JI2A 1LP9F 5BRZD 3WFEL 4BZ2L 1A6AB 4FABL 4RGND 5C0RH 4U2ZA 1ULVA 3JV6B 1U91A 1OAUH 2XFXB 5E24E 1F97A 1VCAA 4UDUB 1A7BA 1AGFA 4B0MM 5KN5B 1ONQB 1S7TA 4N0UA 1CFTA 1G6RL 4HZLB 1UJ3C 4OCNC 1V05A 4NFCA 3FAWA 4PBVC 3MR9B 4CADA 4LKXB 5IBTH 3NCFB 2VLKB 1XGUB 3SKMB 5T1KD 1MHHA 4ODHH 1ZSDB 2I5YH 3GMQA 4K3JL 2P5EE 2ARJA 3VRIB 1YQVH 4MAYD 2CLZA 3BH9B 3IU3A 4MXQC 2OL3B 1S9YA 4MWFB 3BEVA 1X9QA 3H9HB 5DJZA 3UTSB 1HILA 2EE6A 2YKLL 1NCTA 1MIML 3K74B 2CR3A 3AVEA 1NCDL 3P9MB 4JFDE 3SKNB 5KJRL 3L3OA 2CLVA 2ILLA 4M48L 3KPLB 1M6OA 3SDDD 4K55A 1K2DB 3VH8A 4OM0H 4EN3A 3ULVC 5AEAA 3RWGB 4KDWA 4TOYH 3EBAA 4I0PB 4RMQA 5J11C 4CDHA 4S1QL 1I8MA 4Q9RH 1BD2B 2XZQH 1JPSH 3RNQB 5GRWA 3UXFA 1VENA 3VWKD 3WUWB 2YA0A 3IETB 3H9SB 3D85A 1FL3A 3P11H 3WFBH 5E08H 5D7SH 2C26A 1HWHB 4CVWA 4ODBD 4ZUWA 4KQ3H 4P4KD 3ET9F 3IU4L 4EQ2A 5I1LB 2AXFB 2E27L 4LSTL 4ZAKA 3VFNA 1I8KA 2AK1L 2R23B 5GGTH 3WNKA 2EICA 2VDQL 1NCBL 3LN9A 1NJ9A 5EO1A 1HINL 3MRBA 3PABB 3L5XH 4BFIA 5L88L 5FV2A 3BUYB 3QUYD 3HC4L 1E4WL 1T80A 4WUKL 3EFFA 1SYSA 4WUUB 4JKMA 3C08H 1NUFA 2EYRB 2VQ1A 1IAOA 2FD6H 1QRNB 4M43H 5EOTB 1LDPL 4PGDB 2PXYA 4JJ5A 2GSGA 4LPYA 3C60B 5F7NC 5BO1H 4UT7L 4MHHI 5E4IA 2EDBA 2L7UA 3P0YL 5C0GB 2IG2L 1NFIA 1IEAA 2DQFA 5ELIA 2F5BH 3HE7B 1UH4A 2HT2C 2GI7A 3KLHD 3QUZA 3RY6A 2BVPA 4WFFD 3BZFA 1KB9J 2BY0A 5HGHA 3W9EB 3KJ4C 1U3YA 1YMMD 5D9SB 1WWWX 4G8EA 3K3QA 3UTZB 2APVA 5EOCH 3WJJA 3QEQA 2R0KL 4MNHB 3TN0B 1ZT7A 4XHJD 2GUOA 1CIUA 3PGDA 4BQ8A 3SQOH 5B22A 4MJ6A 4GT7A 4CVZA 3WNMA 5IMKA 4O2EA 3AMLA 4PR5A 4E0RB 3H3BC 3V5DB 1CGYA 1DBML 4I48A 4M4RA 1HHIB 4I3SH 3RWEA 1PW3A 3QEGL 2IPTH 1FFRA 3VRLF 1AQDB 2W0KA 4UB0L 2P46B 3UBXA 2OI9B 3SBWC 1PX4A 1HHHA 1R3HA 4ELME 1YEDB 4HWUA 4X6EB 3UZQA 5I1CL 1KG0A 1NBZB 3Q6FB 1H0DB 1NMAL 4GMSL 5EZOL 1G7LB 3I50L 3KLSA 3SGDH 4DWHA 1J1PL 1MELA 1RV6X 3FFCA 5HHOA 2NY5L 3K4AA 4HKXB 3SO5A 4M61A 5EU5B 3O8XB 2F54E 2YD5A 3QI9C 3TA3B 5CJXA 1TPXB 5ILTL 3DUUA 3UTTA 1QFUL 2X40A 3C9NB 1MJUH 2NZ9C 2UWEE 2WWMD 5C07D 1CXLA 4G8GE 4YBQC 3BVNA 5F9DC 1A3RL 2AEPL 5J1TC 1VACB 3P30L 2I9LB 1WZMA 2AEWA 3U4AA 3OX8A 3MJ9L 3O45B 4LBEB 2NXZD 3T0EE 1DLHB 4ODSL 3EYFB 4N8PA 3U9PH 5GS0C 3LDBB 4YDIH 3OKEB 2I07B 5HY9B 1FFNB 3GSNH 2ZOLB 4P5KB 4M4PA 2FB4L 4ODWA 5HHMB 1CE6B 1SY6L 4FNLL 5HI4D 3QDJD 5DDHA 3ZYZA 3PWPE 3MOBH 5JOPD 4YHMH 5F6HI 3RVXC 2NX5E 3IFLL 4LNRA 1V7MH 3QXAB 5MEND 2D31B 5D1XA 1F3JB 5F9JB 3CCHA 2YXMA 1BOGA 4RFNB 1QBLH 3MACL 1FRGL 4LCCC 3WFCL 4F9LC 3S8WA 3KHQA 4JG1H 3RJQB 4ZFOB 4R4FH 1MRDL 4NRZB 1FNHA 4JFED 2XA8H 1BX2B 5SWSA 1OP5H 1U8KB 3CU7A 5L0QC 1KELL 3GMLB 1CXIA 1E4KC 5CFHA 3O81A 3VXRB 2QKIA 1A9BB 4ZPVB 2XWTA 3EZ8A 1WUNT 2G75B 5GGUB 1P7QA 1CK0L 1ACZA 2BNQD 5FGCE 4PBWD 5HVWA 4PLKC 1YEKL 3ZDZE 4XTRC 4YUEH 4PJFA 4OFYA 1JF6A 5K9QI 4S2SA 2FH8A 2EDHA 1AP2A 1IQDA 2VZ3A 3BP5B 5DJ6B 3T4AB 1KNOA 3QNXB 3DWTA 4XMLL 2ATPB 4YFLF 4YDLB 2QEJA 4K2UL 2IADB 2VL5A 3OHXA 4HF5L 3R8BB 3IXTB 5L2KB 4OFIA 5GRJH 3WNNA 1RHHA 1G9NC 5I75B 3WJLA 3KLDA 4OGAD 3O2WH 5T33L 4P2QB 4ZQKA 2AS5M 5I2IB 3MV9E 2VH5H 4QXUL 3JWOC 3WHXA 1ZLWK 5CMAA 3ARDC 1HSBB 4OZ4B 3TGXA 3ALPA 1RZJL 1K4DB 1XGYL 4NQDE 2FBJH 2HH0H 4DGIH 5C08E 3DVGB 4P2YA 4XC3L 5ISZA 4EJ1C 5TDNA 3JZ7A 3QUML 4LL9A 3BW9B 3SKOA 4L29A 5FA3B 2YOCA 3E8UH 4AK1A 3ZE2E 1PEWA 3BHBA 4JVPA 1O5DT 2R0LH 1QG3A 3MA7A 5KSBB 1KCLA 1JWMB 3RGVA 5D7IA 3QEUB 43C9A 2LU7A 1JP5A 4PRDA 1N5YL 2DQJH 1YZZA 3O6FD 1Q1JH 5GXBB 5DC0A 1IBGH 2D0FA 5GS1B 5FO7A 1FG2A 2YD6A 4KAQH 4OZIB 4LSVL 1ZLVH 5E8OB 5E2VH 5H37G 1QLRA 1H5BB 1A6PA 3BGMB 4HC1H 3PWNB 5JXAL 3B2VL 3GSUB 2AJVH 4P2OC 2A6JB 5I8OH 1YPZB 5JO5A 4NUGL 5IHUL 4N1HB 1G6RB 2XWBB 1AO7D 3T0DA 3PL6C 3NFSH 4NQEE 2F58H 3DMMA 5DD3H 2FIRT 5C0BD 5MEQB 4KROC 2DTSA 3BPLC 3ZTNH 1S7UB 3O3EA 1NPUA 1QR4A 1Z0MA 4FQHB 4WI2A 3KWWB 1MHCA 2IQAB 5LG1A 3VFUB 4RMRA 3UO1H 4YR6A 4WJ5B 4HKJB 4CNIA 4LVHC 4KZDL 1QBMH 3OKKA 3V0AC 5C7XH 1KENH 3EJYD 5JLZA 1AQKL 3FCTA 4RAHA 1RZFH 4QXTB 3U1SL 5I30H 4JN1H 3TO4A 1FLRL 3C5SA 1KXQE 3WN5C 1UXWA 4R8WH 2WUCH 3V4UH 4OCWH 2DIBA 1OARL 4FQXC 1HCVA 3QAZB 3JV4A 5DZOA 1YEFH 3IDNB 1MFDH 2X41A 2R69L 5DZNA 5CP7A 3AREB 4HIXH 4D3CL 3BUTA 4KTYA 1K6QH 4OF7A 3UC0H 2HVKB 4QO1A 3EOBA 4HPYH 2VLJE 1OAXL 3NCYP 2I60H 2NW2B 1NEZA 1ZAGA 5E99L 3GSQB 1RZ7L 2MFNA 1WC7B 2LU3A 5I1HH 1M4KA 2QADB 4POZC 5CGYD 5BRZB 4RGNB 4RAVB 5FUZH 1CD9B 5SX4I 2YN3A 3G04B 5DRNB 3CFCH 1NBYA 2XZAH 4MA7L 5EPMA 4FQIL 3OV6A 3RHWK 1KJVA 1DANT 3F7VB 2P48B 5EZIH 5F9OH 3RZCC 3WNPA 5BV7C 1F3DH 3QULA 4IRZH 4MS8D 1MCPL 5DJ8B 5BXFB 3N1QC 1B0GB 4L4VD 4QRSB 1CDIA 1KIQB 3O3DB 3KPRE 4JPVH 1BZ7B 2BNUB 3EDKA 2WQ8A 4OLWH 1JHTB 1FE8H 4Y1AE 2DLGA 3MLZH 4DZ8B 4EI6B 4IOFD 4M1GH 5JQ6H 1LO2H 4X5XB 5T1KB 3RX5A 5IEHB 3LZFH 3QH3B 5DVMA 1EXUA 3RBSA 4MAYB 3WFDL 3QR2A 1Q9KB 3LQAL 4CN6A 3UROR 1XMWA 1MVUA 4OD2B 3GSOA 3DUSA 1IGML 3EUUA 3ULVH 3L3JA 3WSQL 3L3IB 5C0CB 4NOBA 1Q8MA 4XPFL 1B90A 4QXGL 5SX5H 3SDDB 4D0CA 1W72B 4HX1B 2DWDA 3MJ7A 4GAYA 3DLQR 1T22B 4FQJH 4JJHA 2JIXD 1UEYA 1PJ9A 1JRHL 2CPCA 2D4FA 3L3HB 3W0WD 1AC6A 2FO4B 2X4TB 1OL0A 3ALWA 5H2BB 4OLVH 2HFGL 3VWKB 3TIEB 1CFVL 1CBVL 4ONFL 1S7WA 1M05A 1IKNA 4P5TC 4P4KB 7FABH 2H9GA 3N1FC 12E8H 4ORZC 5KSAD 4KWUA 4LVOB 2BOBA 4X8XA 4ZXBC 1NCAH 1RQ5A 2QHRL 1IGFL 3Q3GA 3SJVE 2DQEH 5CCKH 2OS7A 1Z0NA 1FHGA 1PD6A 2E9IA 3CDGB 4XNUH 1OB1A 2YK1H 5J1AB 4MA3A 4PJ5E 3BH8A 4TNVK 5GGVH 3QUYB 3GBML 4HT1H 3MRPA 1HH9B 3VFTA 3HZMB 3V0WH 4XVUC 3QQ3A 1CFNB 1A7RH 2LAAA 3RTQA 3IKCA 4LSUL 2EE3A 5CIPB 2X4UA 3OB0K 2PN5A 2NTSP 3OG4B 2P5EA 2X05A 1CIDA 3KYKH 2HTKC 2FHFA 4UT9H 5I1DA 2WBJD 1PEZA 2BRRL 2XWJA 1NLBL 3K8MA 4G6MH 2GJ6E 3MRFB 4P2CG 5ESVB 1JYNA 1DP0A 1MCCA 4JFDA 4QF1A 2LE9A 4NIKB 5FIEA 5DMIH 4X6CB 4L5FL 4JZNA 4KK6D 1T1XA 5TE7H 5IOPA 1YMMB 4JZOA 5CBEB 5K9JH 3FRPG 1ZGLP 4NNYA 4OFPA 1ROWA 4JN2B 1LK2A 4LCWD 4U33A 3EHBC 1S9VB 2YMXH 4NQCA 3OZ9L 4H26B 4Y2DD 1N5AA 3NBNA 1KPUA 2DQHL 4FZ8H 4UAOB 5ADPL 4YWGH 3VFPB 1VESA 5F7KC 1Y6KR 4P23D 3RA7H 2V9TA 5D93B 1IL1A 4X99A 1KCSH 2XACC 5FOBB 2FNBA 3CU1A 3X11A 3GNMH 3P4NA 4ZYKB 2IC2A 2BFVH 4LOUC 5I18L 2NXYC 2OJEA 2CK2A 2FX9L 4HDIA 4UDTB 5CZVH 3RDTC 3SE3A 1W0WA 1Z5LA 4DVBA 5DYOA 1FNGB 3LCYA 1MJ8L 1RUML 1KBGL 3ILPA 3TFKC 5ACZB 3LKNB 3LS5H 5DO2C 2X1QA 2DS4A 1W0VA 4GXUM 3LS4L 5GGTA 3S5LB 1A6WH 1NDMA 2I24N 4Y0GA 1AGBB 5IQ9A 5EORL 4MLIA 5C07B 1CXHA 5TFSL 1U92B 1G7PB 3OMZA 4PJBF 5FGBA 1BZ9A 3RUGF 4IIQC 3RJDA 5GS0H 2BOCA 3WXWL 3FZUC 5CEZE 2NXZB 1A1MB 1OAKH 2EDKA 2RIKA 2CJUH 2GITB 3AS2A 2YRPA 4ZPTB 3HI6L 3BD5A 4Q9CA 1HQRA 1GIGH 4GKNB 4U6TA 3RX7A 4KK5D 4GKOA 3QDJB 4FQLL 2YPLE 3PGCB 3FT2B 4O2FA 1VHPA 4U6YA 3MBXH 3QCTL 3DIFB 1R6VA 4GMTH 4XNYL 4QRQB 1C08B 3S97C 3SGKC 5MENB 1DBAH 4RWHA 3QUMB 3GFUA 4PJ8D 4ELMA 4JY6A 4UQ2A 3FT3B 5LGJB 5IVXB 3HPJB 4XZUA 4I2XE 2YWYA 4TULH 3IDIB 4ZO6A 4JFEB 3K46A 1FCGA 1JL8A 3BAEL 4OD1L 4XRCA 5FK9A 5DUBA 3MRLA 1C1EH 4PYHA 5D1QC 1AR2A 5CJBA 3GHEH 4NFBA 2F54A 4IOIA 4CAGA 3G08B 1VERA 4N0CC 4XBPA 2BNQB 1FP5A 2UWEA 1LO3H 1SJXA 3LN4B 4G8GA 4UILL 1ZLWH 1Q0XL 4XAKD 1WICA 1HOCA 4N0FB 5IB5B 3SDAC 2L7JA 4QHNB 5JQHC 4XBEH 1J8KA 4EXKA 3MO1A 3T0EA 2A1WL 1CR9H 1BF2A 4J2XA 2Z92B 2GT9A 4GAGL 1LD9B 1IAII 1A9EB 1AR1D 3ARPA 4NSKA 5JPNB 1G9NH 3F7YB 4JLRB 4JB9L 2EYSB 1UM5H 2E7LC 3JWOH 5F6HJ 5F6IB 1RIVL 3CDCA 3DETD 3OAZH 3O0RH 3F6LA 1J0IA 1OP9A 3PWPA 4AH2A 5I6XB 1BBJB 4BZ1L 4OIIL 4JRXD 3ARVA 3LAFA 1QHPA 2NX5A 2E6QA 1DQLL 2Q76B 1UWGL 2V17L 3W39B 1LE5A 4HPOH 2EXYC 3LRSB 4J3UA 1KEML 3ZTJH 4M8QA 4R96A 1IJ9A 3R8QA 3DGGB 1JGDB 1FYTE 3S3JA 4F80A 4MDJB 3MRNB 3TO2A 4JKKA 3GSNA 3B9EA 2YUVA 1EHAA 4M6OH 3NAAL 2C1PB 4HFWB 2Y07H 2FATL 1CLZL 1QHOA 3A6BH 5E2TH 1T3FB 2A74A 4JKPH 1GGCL 1DL7H 3TF7C 4OF0A 5EBLA 3QUXC 3OKDB 2JELH 5FGSA 1TQBB 2FSEB 3VXNA 4JO3L 2YA2A 2XKUA 3UJTH 4PRAA 5EUOB 3SO3B 5DD0H 3CVHH 3UYRH 1MCHA 2DIAA 2ZKHH 3MXVL 1NSNH 3MFFA 1YEHH 3MTRA 3ZT7A 4HH9A 4ZFZB 2GJZA 3MROA 5KS9F 1GOHA 2VTFA 1AO7B 3MRCB 5FECA 1R5WB 4S1RH 2ED7A 3CDYA 1MFAL 5C0BB 4ZUVB 5C0EB 1CLYL 3HNTL 4LCYA 4B41A 3REWB 1RVFH 3EYUH 3BP7A 1X7QA 3MV9A 3QWOB 5I17B 1R3IH 1FLTX 1J0ZA 5F7LB 2VLRE 15C8H 1R3KB 5F3HA 3SCMC 3T1FA 1WV7T 4OLUH 3T3MF 4F33B 4NQDA 3BKYL 4EN3D 1PVHA 1P7HL 1MLCB 3QI9D 3GMPA 1CLOL 3IJSA 2WWKT 2X70A 3SE8L 1OP3K 4R7DA 1CDUA 1ODAA 1AD9A 4GG6B 1YEJL 3GB7A 3MUGB 3T1WA 1U3HC 1LEKB 1JYWA 5IG7A 3H8NA 3Q5OA 2ZCHL 4WO4D 1WWBX 1AI1H 1ZT1A 5I71B 3OKYA 3O9WC 4TNWK 1Y18B 4ZAKD 3G5ZA 5E5MA 4Z6AT 2QQLH 3HZKB 5I66A 4ELKA 2F5AL 3JTSB 3M8OH 4BSVA 4KJWC 5HVHB 5FA4A 2NYYC 4NGHH 4M1CC 6FABH 2D7TL 3H7LA 1NBQA 4GKSB 4DZBA 4DKAA 5TPWH 1BFSA 2OSLA 3VWJC 2YHGA 4MGXA 1I3GL 3RL2A 5D5MB 1PG7W 4KKBD 2P8PA 3MQIA 2DJSA 2F53D 1A5FL 1PG7H 2PO6A 4NQEA 4PRPE 5ALBL 3A6CH 1WJ3A 1A6TA 5M94B 1D5ZA 4L4VB 3WO3B 1NUNB 5C0FB 2J12B 2XT1B 1DBJH 2O61B 3G5XB 1BBDL 4X5WA 3LKQB 4DN3H 4R4BA 5HYJD 3V8CA 3FFDB 5C6WH 2FJHB 1DSFL 2VE6A 2ICEA 4X7TA 5JZ7C 1INDL 2AI0H 1GZQA 4HC1A 5T1LA 1WLHA 4X4XA 2FLRT 2ZCKL 2ZUTA 3QIBA 5GJTH 3HRZA 4KTDL 1DUZB 3FOMB 1W8OA 2VDKH 1IEHA 1V7NL 1XGQA 5E2UL 2B8OT 5IW6B 5B38B 2BC4A 1JNJA 4HXBH 1OAZL 4U0RB 3ARFA 1NCUA 4JE4B 2H26B 4HG4J 4NRYA 4GRLA 4L1HA 1AGEB 4UOW0 4PJ7E 3T08A 4FG6C 1GAFL 4P46C 3ZDXF 2VLJA 2JIXB 1NGQL 4Q9BA 5DJYB 1H3VA 3W0WB 1EUUA 4ZS6C 1B0WA 3C2SA 1UCBL 4TUJB 2NY1D 4Q0XL 3VFOB