4AY0A

High resolution crystal structure of the monomeric subunit-free caf1m chaperone
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
205
structure length
188
Chain Sequence
GVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDENKEKESEDPFVVTPPLFRLDAKQQNSLRIAQAGGVFPRDKESLKWLCVKGIPPNCIKLLVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLLAGARNVSWRIINDQGGLDRLYSKNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords CHAPERONE PROTEIN CAF1M
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
total genus 33
structure length 188
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ay0A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ay0A02
4GRLA 5ICYA 4F7TB 2CLZB 1U9KA 1FBIL 2WIIA 1CI5A 4Z9KB 1XGTA 1BMGA 4PJDF 4ZYKA 3O6FD 4O2FA 5HI5D 4M6NL 2E27H 2H2SC 3T3ME 1MOEA 5GPRA 3BP5A 3N0PB 1BWWA 3CZJA 5MHSD 3GHEH 1J0JA 1WTGT 1GGYA 2V5RA 3RWCA 4RGMC 1CLOL 5FO8B 4NO3B 1RZ8B 3PQYB 2OTWB 5J6GA 4LRIA 3UTSD 2EIEA 4BQ6A 1K4CB 3P4NA 1TZHA 2FECI 4R8WL 35C8L 2VB5A 4G9FA 2OTUB 5EA0L 5EU7C 4JFOB 1A4JA 3R06A 3P40A 4XNUH 4OIAA 4YE4H 3UTZB 4JDTH 3IDUA 4UB0H 4MCYA 3C6SB 3SE8L 5C0DB 1P7KA 2GY5A 2V2TB 2P5WB 2CK2A 4O00A 2ADFL 2QADC 4I0PA 3C60C 3U2SB 1YMMA 2FSEA 1I3GL 4OQTA 3PABA 3GGWA 4UU9B 2EDDA 1IQDA 2OCFD 2R2HB 1MCLA 1NFDB 3G6JB 3PIQA 1HDMB 5DJ8A 2ENSA 5JUEH 1ZS8B 4L3CB 3U7YH 3GJEB 4Z7NF 3X11B 2ZP0T 4I77L 3SKNB 1G0XA 5J0BA 3SJVA 1BIHA 3IDMA 3IFOB 3RI5K 5A2IH 5KVFH 2A9NL 1AI1H 4JQIH 2IBZX 1R5VB 1J12A 4LRNL 5AAMA 2X4RB 3SBWC 5I6XB 3ARGB 5D7JA 3QXVA 2GT9B 4OAWA 4FXLA 5J56B 4OCYH 5EPMA 2AXJA 3OF6D 4E41B 2F54B 3BD3A 5DUML 2EKSB 4X99B 1I8IB 3D85A 1C08A 3M1BA 5EN2B 4NWTL 3B2VH 2DWEA 1PGRB 4CADA 4QRRD 2DJSA 4Y5YC 4A2LA 2G75A 4PV9B 1JGEA 4HPYL 3TPUA 3DHJA 5HDOA 1L4IA 4D8PA 1RZGB 3V6OC 4O2EA 4OUUA 4JHBA 3NPZB 3IFPB 1XMWA 2MSPA 1E4WH 4NYLB 1U58B 3OZ9H 5FB8B 3HG1D 1AGDB 5F9WC 1WZMA 4Y5XC 4ZUUA 4HIHA 1QRNE 3HB3C 1IAIH 4TYUA 5ACLA 2YD7A 5I18L 4LVNB 1LO5B 4I2XB 4N0YH 3S36X 3TC9A 4F9PA 3MUZ1 2IEPA 2EXWC 3HZVB 1VPOL 4G7YL 2VQ1B 3RBGA 1F00I 1TLKA 2NW3A 3QUXB 3T4YA 1MHCA 1MUJA 3PV7A 1K3ZA 4PREA 4XWOC 3ARWA 4JFXB 1A3QA 1CXKA 5ABDE 1IGYB 4TVPL 1G9NH 4CW1A 5GJTL 3F6IA 4KV5E 4LLDA 1BZ7B 1CDUA 3DPBA 1U92B 3BVNB 3ZKMC 4Z77A 2X9XA 1ORQB 3MACH 4FFWD 3TH2T 2ID5A 2N4IA 2CKBL 3AREB 3JVGC 4OD3L 4NHUB 2EO9A 3OKKB 4L1HA 3ZTJH 2ZKHL 3V5KB 1FG9C 4EUPG 2DQUH 3LKQB 2HKHH 4CNIA 3PWUA 4ENEC 1KC5L 4OBSA 3AS0A 3V7AE 2E9IA 1U8HA 4FXKA 1WAAE 3MRGA 3GHBH 4HIXH 3PL6D 1G7PA 4PJXE 4KJWC 1ZMYA 5DK2B 1FNSH 2DLTA 3TN0D 1H0DA 2MWCA 2IAMD 2F15A 3VG0H 3JTSA 2EDRA 4CMHC 5T1DL 5TF1H 4G3YH 4XBPA 3RY5A 4D0BA 1N64L 1OVZA 3H9SB 1CFQB 1TVHA 2V9QA 4LCWE 3SPVA 2D03H 3GMOB 4L8SA 4PB9L 4M9PA 3BW9A 5KVGL 1NLDL 2N56A 4XPTL 2NW2B 1U2CA 1EZVX 4JHAL 1AO7A 3RWEA 3V4VL 5K9JL 5C0CA 1FORH 5LXGH 3UTTD 1FLTX 1AIFA 1ZTXH 1DEDA 3FB7A 5K9QG 5CSBA 1MCPL 2YPKB 1XGRA 1VFAA 4RWYH 4L9DA 4PY7B 1ED3A 4NCC1 1C1EL 3OGCA 12E8L 1A2YB 3S34L 2OQJA 5TE4L 4KRLB 3GSXB 4XAWL 3FRPG 3F58L 4KFZC 2AK4B 5MENB 4NQCA 3LRSB 2B1HH 4HBCL 4NJAH 3FL7A 4GFTB 2E8YA 4EN3B 4JANB 4OJFL 1V8HA 2A83B 3OG6B 3MGAA 3LD8C 3CFBA 1CL7H 3TP4A 4XP6L 3MBXL 3TZVD 3ABZA 2P5WE 3QSKB 4JRXB 5T33H 2DL9A 1TVDA 4BZ2H 4E42A 1ZT7A 1HYSD 5E7FA 1H5BA 5J9PA 3LCYA 2R9HC 5FYKU 5IVOA 2ICES 4NNXA 2G9HA 5DEGA 5F7MC 4JQXA 4MJ5B 3MJ9L 1FO0B 2GSGB 3ZYOA 2ZUXA 1NFDE 3G6JE 3MRQA 3D9AL 3VU2A 1FO0H 3GRWL 1KCVL 1LWRA 2W92A 5JDSB 1LEGA 1NMBH 2BVYA 4L4VB 2VLRA 1E6OL 1C12B 1SJHB 4O51B 3OXRB 3V6ZB 4HKBA 3NFSL 3HZYA 1FZJA 3ES6A 2VWEE 4JFFB 5IMMA 3RKPA 4PG9B 3UTQB 5E0QA 5FECB 4PTTA 4PJCA 1T66D 3SQBA 3E8UL 1BM3L 1DEEA 3SDAC 1S7UA 2GHWB 1JWUB 5MEPB 5BVJA 3QI9A 3HG1B 3L1OL 4E41E 4NGHH 2F54E 5E99L 3CSYB 1MFAL 3X14A 4K3DL 4R6UA 4PJFF 3GSNL 1EVUA 2BNQA 4DVRH 4BK5A 4OCWH 2JKXA 4P9HH 4H26B 4V2BA 1UB6B 2KZ1B 2VISB 1MVFA 2CRZA 1FPTH 1OAZL 4U1LB 2C1PB 4LPUA 4XPGH 5IVXF 5DJ0B 2WBJD 1GJIA 1IGIH 2AAVA 3WNNA 3QWQB 5BOZG 4X6BA 1JMZA 5I8CA 1HXYB 3O9WA 1QBMH 4WV1A 1N5YL 1CICB 1NGPL 1OP5K 1B4RA 4KK9C 4YDLC 3OR6B 4MHHG 1U95B 1DVFA 4XP1H 5IEKB 1HK6A 1G1CA 1FL5A 3BXNA 4PJIE 3DURB 4O02L 4OFDA 5T3ZH 1ND0A 2KQNA 2VDRL 3NIFF 3L3IB 1YDPA 3BJLA 1KCKA 4MD5A 4I2XE 5EULV 3CH1B 4N90E 3CFDA 5L2JA 2R1XB 4OCXL 5BQ7A 5EORL 5C0EA 3ILPB 4DVBA 3S5LA 4LLQA 3GI9L 1B4JH 3TWCL 5CJOL 3TYGL 2EYTB 3PHSA 1IGMH 3LEYH 1VGKB 1I7UA 3OKYA 3AS3A 1WWWX 4WW1A 1CTNA 1TITA 1IC4L 3EFFA 5IT2L 3U0PB 2IAMB 4ZNEE 5KSAC 2FD6H 3QDMA 4JFYA 4LIQH 2DLGA 1Q1JL 1EBPA 4YXLL 2EE3A 5FM5O 5E6ZA 5C0AD 4KVNL 2EZ0C 3RVXD 1WBZB 1FFPA 4Q7DA 3AXLB 5FFLA 4HF5H 2X9YA 3RIAK 4CMMB 5MP6H 1OQXA 2W0FB 3DXAD 2FWOB 2ATPB 4ZOAA 4G43B 4EOWH 2V7HB 5D93C 4YO0A 3BSZL 2ORBH 3JWDC 5I16B 1CD1A 2NY4D 3QDHA 4YHOH 1MQKL 1C16B 4BSVA 5GS0D 5MHSE 5T3XD 3ARFB 1OSZB 4ZPVB 4QWWC 4NQED 4OZ4A 2I07A 3UMTA 1OD9A 2BHUA 3AAZA 3DHMA 1CQYA 4S10A 3H9SE 4K71B 3BQUA 3RGVC 4KK8C 1QQDB 3WCYA 1EMTL 2A77L 4P48A 5C2BH 4ODVH 3FMGL 3QH3A 3U36B 1FIGL 1LP9A 3S36H 3VXPB 4KRNA 3O6ML 2QR0B 1MFEH 2WLYA 2ZUWA 4W81A 3ULUL 4K3GA 3TZVB 5J11B 5ICZB 5LQBH 3VFTA 4PGDB 3QIUA 3BO8A 3VD3A 5EBMB 3TBYA 1M05A 1YEIL 2W0KA 4OD2B 4G9DA 1U6AL 3WLBA 1G7QA 2K3TA 1EXUA 5F7YC 1FC1A 4GAFB 1U8MA 4ZQKB 4N0RA 4QGYA 1PG7X 4KKLC 2AK4E 1VB9A 5MENE 3LKPB 4X7EC 4HGKC 5DF0A 4ISVB 4Z76A 1F02I 2GW5A 1MCJA 2Y06L 5FOBA 4ENED 3V4PL 2GSIA 3NN8A 1MREH 1J0YA 1JCKA 1VGEL 4G8FB 4K3EL 4XPAH 4FP8L 4YPGA 1F3JB 3EYVA 2AERT 4JRXE 1ITCA 4OZIA 3HR5B 5D7KE 2C7UB 1FDLL 4OZHF 1IC5H 4NZJA 1FYTA 5IEHA 3WFCL 1S5HB 2WWKO 4YK4C 3PGFL 1JGLH 3PWNB 1HYRC 5AD0B 3SO3B 4M1CC 3RHWF 1GPOH 5E08L 2BY1A 5CCKL 1SBBA 3BGAA 4RX4A 1U3HA 1BFVL 1F8TH 4L4VE 5DO2C 7CGTA 4NN7B 3DLQR 1P84J 3TA3B 2XZQL 5CIPA 1J0KA 3QNYA 5DK3A 4D0DA 4G9FD 2W65A 5C8JA 5CZKA 4NCDA 4JFFE 1WIPA 1MFBH 4HH9B 4YGVA 4IRZH 3GRWA 2LFGA 3LSOB 4CVWA 5FF6A 5IUSA 5KVMC 2GITA 1INQA 4IOIA 1KELL 3NCCB 5DMIH 3HG1E 4H88H 5I1IH 1YMMD 3G5XA 5DK0A 2IWGA 3ARTA 1QFWH 1P7QA 3I3BA 4ODSH 1IVLA 4P59H 4X98A 2V5SA 2BOCA 4L29A 3O11B 2HG5A 3HRPA 5L7XH 1SHMA 4F3FB 5CINL 2HJLA 5DJ2B 4X6DA 4XVJH 3SJVD 1NDMA 5F21B 1B3JA 3DX6B 4XZUA 3D3VB 2WIMA 5GGSY 5C1MB 4XCCH 2R9HD 4AM0A 1ACYL 2NPLX 4OZFG 3UC0L 4U1NB 5T3ZE 5D7JD 1OP3K 1CFSB 5FK9A 3UAJC 3MV9A 1WT5A 2X09A 4L5FH 3P0YL 1RUMH 1IGTB 2D0GA 3L3GA 4EUPH 3AMLA 1YECH 3LKRB 1E4KC 2VWEC 4G80A 1A1OA 3TT1L 1T89A 3OB8A 2KUTA 5CP7A 3D85D 3QZWA 4JZOB 3MJGX 4FZ8H 1DQDL 3ARGC 1FFOB 3S97C 2Y25A 3DNKA 3HI5L 1J05A 1DBBL 5J12B 5AYUL 3SGEH 4IDJH 5DMYA 4H1LB 1MIMH 1S9YB 3ARSA 3SHSA 3RNKB 4P23B 3SDAD 5E24E 5FGSA 5SWSB 4F7PB 5IJVB 4FQHA 1G1YA 1CE1H 4S2SB 5IIEA 4LIQE 2EDKA 3T65B 2HT2D 3IFLH 4P57A 4AY0A 4JKMA 2D7QA 3TIDB 3C5JB 1A3LL 3QIBC 5GS0H 3GIZL 4NQEB 4Q2ZB 3RTQA 3CVHB 1LO3L 4QRPA 3DUSA 3UJTH 3IDGA 3CVHH 3QPXL 5ETUA 5C9JA 5DRZB 4IBLT 3WDIA 2P1YA 4AEHL 3W11D 1JPGA 4AJ0A 4HWEH 2EDTA 3WIIL 3ARVA 3VXTA 2AABL 2MPAH 1WCQA 5DD5H 3SE9H 3H8NA 3U4BH 1DCLA 1DLFL 1NBYB 3KPNA 3ZLQC 2UZYB 4ZFFA 1T21B 1G6RA 2HP4A 5T5NG 2GK0B 3VXUB 1NGXA 4XP4L 4UTAH 2GUOB 4K94H 1HOCB 2ADIB 2N7AA 3PF2A 4NKQB 3VG9C 3KPSB 4P3DA 2NX5D 2E7BA 4M1GL 3CX5J 2B1AL 3ULVD 4GRLB 5ICYB 4WHDA 3RY4A 4I48A 4MQXC 2WIIB 4M6OH 3BZEA 1XGTB 4PRAA 4ZYKB 4O2FB 2JCCF 5E94A 1F4WH 5MEOA 3RWHB 5F88B 4QOKA 4X4XB 3D6GA 3BP5B 4X9FA 5KSAD 3WS3B 4OLYH 4PJ8B 3HR6A 3U7WH 3RWCB 2B5IC 1IAIM 1R5IA 2EZ0D 1R3IL 2L4OA 4UBDD 5J6GB 4GUPA 4Z7VF 5SWQA 2YUVA 4I18B 2EDHA 2R4RL 5HGAB 1TZHB 2FECL 4LVOB 4G9FB 1A4JB 3R06B 4LEOA 4PY8I 4EZMA 32C2A 2KKQA 4QNPE 4U2ZA 4JO3H 1AO7D 4MCYB 5C0CD 4MA7L 1P7KB 5EO0B 5FCUL 5B39B 5IFHH 5I8OH 4WFGE 1CDBA 5DJXA 4I0PB 3UJJH 3BIKA 3EO1A 4JY4B 4PR5A 5DT1H 1D5BB 4HZAA 3PABB 1JZ4A 3DSNA 3GGWB 4AYFA 5DRWA 1IQDB 4YXHH 3ARDC 3DVFA 2PYFA 4OQTH 1OLZA 3RGVD 4WFFD 1T2QL 3WJJA 4JVWA 4X9IA 4BFEA 4U6HA 4C4KT 4X4YB 3IKKA 3DECA 4QEGA 5DJ8B 3VXOB 2CRMA 4C58B 4NQCD 1GYAA 4XP9H 2VXQL 5E6YA 4M6ML 2Z31A 2CSPA 1KTKE 1BVLA 3FO1A 3SJVB 4NCC2 1ZHLB 3BAEH 4YQXL 3MODL 4EEEA 1N7MH 1QA9A 3GNMH 3F7YA 1BEYL 2Q86A 1A3RL 2YXMA 4EN3C 2P47B 4OAWB 4PJHF 2Z91A 3S6CA 3T8XA 3PGCB 2DQEH 4MD0A 4OZGF 5E8EA 2L7JA 1PYWA 2XZAH 2FATL 5GGRA 2MCPL 4U6VL 4P2RA 1TJHL 4OD1L 1OF2B 1MLBA 4JKLA 1C08B 2VLRD 1Q38A 2YK1L 2EO1A 2DWEB 3E0GA 2ZOKA 4LCCB 4PPTA 1OGTB 2G75B 3HC3H 3TPUB 3D3VE 1LILA 3LZFL 1EA9C 4D8PB 3UYOD 3G9AB 4QRTB 4K3JL 4OUUB 1F90H 5GS2H 3GMMA 1OAYL 1HZHL 1DQTA 5AEAA 3QI9D 1RK0B 4R4FH 3HI1B 5HHXL 2ZCLH 4WI3A 4ZUUB 1X4XA 4Z7OF 5DUBA 3F5WA 4GAJH 3THMH 2BNQD 4P4KA 4R4BB 3X12B 1OTTC 3QFJB 1EJOH 4W6WB 5D6CA 1Q8MA 5FO9A 1U8JA 1A14H 4KI1A 1HWHB 4XRCA 4DKEH 1BIIA 3VGDA 3ARRA 4BZ1H 4PJEF 3K8KA 1YYMH 3BOVA 4YEEA 4HWUA 2NW3B 3T4YB 3MLTB 4XI5C 1MHCB 1MUJB 5FGBC 3C6LA 5HHMB 5SWSE 2XKNA 5CS7A 1F3RB 5IJKC 1YQVL 3O9WD 5H35A 5LCVH 4CW1B 1N6QH 3GMRA 5F6IC 4GW5B 1J11A 2WP3O 1M71A 2WMPA 1MHPH 5DQDH 1U8KA 3NFNA 3J8F7 4HLZH 4Z77B 4YC2B 1HXMA 1EGJL 3L5IA 4ZTOH 1JL8A 1LEIA 4JAMA 4HH8A 2ZNWA 3O3AB 4K3HA 3NCMA 4F33B 5KSBF 1C5DB 3VWKC 2LU3A 5CMAB 1EEQA 3U4EA 3N1PC 3MRKA 2NY5H 1CICC 1OCWH 4PP1D 4W70A 3BHBB 5HYFA 4ZUWB 3PWUB 1QZ1A 4WI8A 1QLEH 1LO0H 1MVUA 1U8HB 5DRNB 1KG0B 3QZWG 3U1SH 2XY2A 1JPTL 3QB7C 1E0OB 1QSEA 2XWJA 1H0DB 3CK0L 1F3DJ 1XR8B 3JTSB 3MV11 4B7IA 3VXUE 1T6VN 1OHQA 2IFFH 3QDMD 1J86A 4XBPB 1LDSA 3INUH 4LKCA 3I6LD 4OLZL 4F9LC 3KPSE 4JHZA 3N85H 1S7SB 1OSPH 1TVHB 3Q5OA 3FKUS 1MEXH 4L8SB 3BH8A 3BW9B 5DGQA 4OFYA 2NXYD 2EDNA 5EOCJ 3OXSA 2XPGA 3EYSH 4O4YL 2AJYL 3RWEB 1S3KH 4IRSC 5D7SL 2RFXA 3IETA 4WI2A 3ZL4H 3JTTA 2Z4QA 1AIFB 3KNBA 4BH8A 3IAPA 3P4LA 2FX8L 4Q0XL 4KHXH 3QIBD 1RJLB 1XGRB 2VLKA 5F97E 3U7AA 2W07A 2Y6SD 3VGEA 2PN5A 1X7QA 5JOPE 1BX2B 1L6ZA 4JM2C 1QLRB 1D5XA 3PDGA 1FBIH 1FNAA 3SKOB 3WBDA 1CLZL 3EDKA 4HAGA 2AK1H 2EKJA 4K9EL 4Z7UB 2VLME 4BKLB 4U7SA 5LKNA 3CFBB 1BAFL 1LEKA 1KF9B 1CXFA 5EO1A 1DN2A 1TIUA 4N1EA 3QIUD 5E03A 4J12A 4KK6D 1CLOH 4K71C 1DL7L 1KTLA 1ZT7B 1T7VA 4M93C 4E42B 1H5BB 2H1PH 3O2DL 4IOFC 5HYJD 3SGDH 4KVCL 3V79C 3SDXF 1HE7A 4NRYB 4UDUA 1T04A 2G9HB 5DEGB 3KR3L 2NZ9C 3QDGA 2JJTA 1PKQA 4R8WH 4OM0L 35C8H 5EA0H 4RAVA 4TTDC 3MRQB 1T1ZA 3HFMH 4PYGA 5J11C 4MGXA 4L9LB 3GMPA 4GW1A 3BKYL 3MLRL 4DFIA 1DQML 3WL9A 5IBLC 3O3DA 2F53B 3QNXB 2VITA 2ADFH 1MI5D 4TTGA 3STZB 4Q97A 4HJJL 4HUUB 1I3GH 1KEML 1P53A 3HZYB 4Y19D 3RDTA 4KHTL 2IQ9H 2OMBA 4JFQB 3TNMA 3CFEA 1PEWA 4QT5A 4Q9QL 1JGVL 2MCG1 1FYTD 3RY6A 4LLWA 5K9KA 2Q8BL 1A6TA 1S5IL 1S7UB 2NYYC 1J0ZA 4I77H 1NDGB 1ETZA 1RK1B 4ZAKA 1JZ7A 3SDCC 1PY9A 3RBSA 3X14B 2NY2C 4RX4D 2A9NH 1WQVT 4B50A 1NMCC 1U3HD 3D0LB 5DGRA 4KPHL 5E8DH 3RZWA 4L8DA 1HNFA 1EEUA 4LRNH 3MJ6A 2MNUA 2VDPL 5T1LA 4Z78B 1JF1B 3CFIC 4I3SL 4I0KA 1FL3A 1E27A 2BY2A 1MY7A 2HRPL 5IVXA 1DUYA 1T7WA 3TBSA 5E8NA 3CDYA 5EBLA 5DUMH 3VW3L 3QYCA 3IGAA 3IKCA 1RJYB 5I1AA 5E4IA 1F45A 3PHOB 1MPAH 1AJ7L 1DVFB 3UX9B 3QUZB 1FL5B 3PP4L 3BXNB 5D7IA 4HPYH 1WBXB 2BVPA 4D2NA 4D9QE 3QFJE 1YDPB 2BY3A 4MD5B 3CFDB 1IEHA 1UZ6F 3CC5B 3OBAA 2RCSH 4F15C 3S5LB 2QQQA 4ODUA 1IAII 5HHME 4PJAA 5KN5A 3LRGA 4Y16A 5L9DL 2XRAH 4WW1B 3UBXA 5I18H 2A6IA 2QTEA 3EFFB 5KZCD 3MV9D 1YEGH 3VXSB 4HX1B 4JHWL 1VPOH 4G7YH 3UTPD 43CAA 5KAQF 1RZKL 3BN9D 3ZO0A 2DQCL 1VFOA 5BS0A 1DQQA 1FFPB 2W1NA 1JZ8A 3NZHH 3P77B 3VFUB 3ZE2F 2J6EA 4TVPH 1YEFL 1I1YA 5GJTH 1EGJA 2X4UB 3RP1A 1JYNA 2CKBB 4XHJD 3OJDA 4EI5A 3WIHA 3EIFA 5JOFB 1Z3GL 1T5XB 2H32B 1U8NA 3FT2A 5D1XA 4U1KB 2CKBH 4OD3H 3ARUA 4PG2A 2H32H 4NZUL 5I19L 5GSVA 2GJ6B 1GSMA 2ZKHH 5BXFA 4KZDL 2CDFA 2J1KA 1QFWM 5D96B 5EUKA 4DEPB 1BPVA 5J12C 4OZ4B 2I07B 4TNVF 5FXCH 3RTQD 2BVOA 2D3VA 4QRPD 1KC5H 5FV2A 3QXUA 4PJ5D 3BQUB 2M1KA 1OT2A 5SWZB 1FLRL 3QH3B 4UT9L 1T0NA 2OR7A 2VMFA 1T3FA 2DBLH 4LBEA 4XI5D 3I75B 2I60L 1D6EA 3C5ZB 1CG9A 2ZPKL 4HWBL 4DKFL 3VFTB 2I26N 3W5NA 3WNKA 1HQRA 3LV3B 2AEQL 3BO8B 3QIUB 1UENA 3TBYB 2CDEA 3G6AA 4JKKA 3B3IA 1N64H 4G9DB 3S8WA 2P8MB 1G7QB 1EXUB 4DK3A 1VEPA 4UTBL 1M7XA 4NRXA 4PB9H 2D7TL 5KVGH 3VD9A 3P11L 4OSUL 4OFVA 4Y4HA 4UT6H 3VWKD 3K2UL 1KPUB 4Z18A 4XPTH 4Z8FL 3V4VH 4JHAH 4HPOL 3CSBA 4XTRC 5DA0B 2P7TA 3FQXB 2R56L 5GISL 5C9KA 2OZ4L 4Z7UE 1A22B 3F7QA 5C07A 4YPGB 3WN5A 3EYVB 2WWKT 2QEJA 3BEWA 1PDKA 2DKSA 12E8H 1I1RA 4OZIB 5TE4H 2UYLA 1NBQA 4XAWH 3F58H 4U2YA 4QOKD 5BV7C 4HBCH 1UH3A 2A73A 3Q6FA 1CL7I 3J7HA 2PCPB 4X7SL 5CZVL 5I9QC 5F96L 2CQVA 4OB5L 3QEQD 2HLFC 4O9HL 4UUJA 2FH8A 4XP6H 2ED8A 5BW7A 1B6UA 2F53E 2OL3L 2WK2A 4CVXA 2YD1A 2PETA 3HKFA 5CIPB 3A0OA 3QNYB 4QTIH 5CBAA 2CDGA 4FFVD 2BSTA 1BZQK 5CIPH 4IRSD 4WO4B 4YGVB 3OPZL 3MJ9H 4PJ8C 5C08D 3WUWG 3AY4A 2H6PB 3RWIB 3MRDB 2AI0H 4IOIB 1EAPA 3D9AH 5TPWL 3GRWH 4PJBF 1K3IA 3G5XB 2XTJB 3HPJB 4I18C 3FCTA 2VOTA 1FZMA 2DOCA 5DK0B 1E6OH 1K6QL 3STLA 4Y8DC 1MFNA 3NFSH 1P7QB 4NT6B 2BOCB 5C6TH 43C9A 5HTSA 2HG5B 2FX9L 4TUJA 5E6IA 4R97B 1BM3H 5HPMB 2HJLB 4M3KB 4UMGA 4X6DB 1NDMB 3L5WA 4WW2C 5ILTL 3WXWL 3GIVA 4R0LA 3WEXA 4XZUB 3R4DA 5E99H 1MFAH 3O3BA 4IOFD 4CN4A 3ARYA 4MB5A 4K3DH 4AM0B 4QYOA 4KI5D 5E4EB 3OAUL 1OM3H 2DRUA 2NZ9D 2GTZB 3WNPA 1UWGL 3A6BH 3GMNA 4UQ2B 1OAZH 2L0DA 3L3GB 4J8RA 4YBLC 2C4XA 1OP5H 4F2MB 1T7XA 5IHUL 4G80B 1A1OB 1NC2A 2NY7L 4QRQA 4RFNB 5C09D 3TO4B 2PO6A 5CP7B 4NJ9H 5D2NA 5DEFA 4PLNC 3OHXA 2DLEA 2A6KA 4DTGL 1N5YH 5IHLB 1J05B 1MHHA 3ZKXC 1PFCA 4O02H 3N1FC 3TVMA 4PS4L 2IADA 3D25A 1GVIA 5DJ6A 5I1DA 2NYYD 3QG6A 4FQHB 4OLUL 4MD4B 1EK3A 5GGTL 1JV5A 2NY3C 1IM3A 3SDCD 4LCCC 2ICWA 4P57B 3VXSE 2LV4A 3OJ2C 2I9TA 4P46A 1P9MA 3U9UB 4R26H 4R7NB 5GIRA 2ITDB 5DYOA 4WFEE 4RMQA 4DGVL 2X4QA 4TVPE 3GI9H 4P4KD 3TWCH 2YD8A 1OAQH 4KRPC 1OY3B 4PJ7B 5ETUB 3TYGH 5C9JB 1EEYA 3IRZA 3PGDA 3RWGB 3MLZL 2J8HA 1JPGB 4URTB 1IC4H 2FBOJ 5GRVK 3KPLA 1DTUA 5IT2H 4GSDL 4NUJB 5DVMA 3MFGB 1KPRB 1Q1JH 2NY1C 3MX0A 3NCEB 3HC0A 2DQTL 2GJ6E 4YXLH 4PRBA 3KPNB 1IARB 1RJZA 5L88L 1BFSA 5DZLA 4NNPH 1HI6B 4G8GB 3VXRA 3ZKSD 2IMMA 5HVHC 7FABL 2IG2L 1G6RH 4MDJA 2IPUG 3HZMA 5SWZE 4XPHL 2J4WL 3B9KC 3V7MA 4P3DB 3UBXG 25C8H 2VDKL 1L9NA 5ITFB 5F9JA 1MQKH 3K1DA 4APQA 4YC2C 5A1AA 5DHVA 3W82A 4PJDB 3BZEB 1KN2L 2JCCA 4BH7A 1JVKA 4FQ1H 4W4OA 1CDIA 5E94B 3VGGA 5MEOB 5IBTL 4QOKB 4M7KL 3WSQL 4WHTA 1EMTH 2A77H 4BFGA 5EU4A 3FMGH 1QSED 4LDEB 1FIGH 3BPNB 4ZXBB 3WXVL 1K4DB 4HWBA 4KZEL 4UZGA 3ZDYE 3O6MH 1R5IB 4J3TA 4Z7VA 3SE4A 2F8XC 4GUPB 1E4JA 3VXMB 5SWQB 4N1HB 2RAMA 4F37F 1YEIH 1HHIB 1W0YT 1U6AH 4LEOB 4NKMA 3G08A 32C2B 4FHBD 2H2PC 4OZIE 1ULVA 4LAJH 4YAQA 2ICCA 2FJGA 5H94A 3BIKB 3EO1B 4Y1AB 4C83A 2OZ4A 2JK5A 4PR5B 3AFLA 1IZKA 2VLKD 1YEDA 5DRWB 4HS6A 5E8OA 2PYFB 4M02A 4K3EH 1MQ8A 3RIFK 2ENYA 1D5IL 4ZODA 4U6HB 3AGVA 4OKVA 4D94A 1ZHKA 5JHLL 1FDLH 2J8UF 5D6DC 1XH3B 1WIUA 4XXCA 5IQ9A 2Z31B 4R7DA 2VKXA 1BVLB 3WFCH 3FO1B 4DW2L 4HUKB 3PGFH 4XCEA 3PWJA 1RIUH 2IALA 3TM6A 4N0CC 5C0GB 3F6LA 5AWNL 5F7EL 1D5ZA 5E08H 5EZJA 1UM5L 2NCMA 2EDOA 1QA9B 1BFVH 1IGCL 1HNGA 2XTJE 4K7PL 4PJHA 1NCUA 3MOAH 3K7UA 1GOGA 2XZQH 3T8XB 1I8KB 3QDGD 5EFIA 3U6RA 2UZXB 2XNAA 3RVVC 1PYWB 1JGUL 1MF2L 4HULB 2AQ3A 1UWEL 4P2RB 3LQAH 3QO1A 3BX7C 1LO2L 1P4BH 3KPOA 1VACA 3SKMA 2ATKA 3HI6L 4ALAH 1KELH 3CLEL 2OP4H 4DGIH 3ZE1E 1PLGL 2XIDA 4XCNA 1KUMA 1AFVL 1FAIH 4OIBA 3TH4T 2DYPA 3QDJA 3RDTD 2P8LA 3I2CL 3KPQA 4ZUTA 4L9LC 3QQNA 4OT1L 3GMMB 4WUUA 3VA2C 1EH9A 2FLBT 1KJVA 2FEDC 1V7ML 4ZO7A 3QT2A 1IC7L 4XGZA 3WHE0 1IT9L 4ZFGL 4ZAKD 5CINH 2F5AL 1OP3H 2EDWA 5DWUL 2DQDL 3I02B 4H5SA 3B9VA 4M43L 4LOUD 5T1MA 1U8JB 2QHRL 4XRCB 3QUYC 1JHKL 3UC0H 4PJEA 3CMOL 3K1KC 2VDOH 3B5TA 4NQUA 5LWYL 2DTML 3BP4A 3UZVB 1UT9A 1OW0C 3KPPA 1H9VA 3P0YH 4OGAC 4HIJB 2KL6A 3C6LB 2XKNB 1TCMA 2JELL 3KDMA 4NPYA 5IB5B 5H35B 3TT1H 1ZA3A 1DQDH 1I9JH 1UJ3B 1M71B 3R1GL 5C0BA 4YDJA 3GSVA 1U42A 1HXMB 3FJTA 3HI5H 3MUY1 1DBBH 5EC2B 1GIGL 2HTKD 5AYUH 1CXIA 5DMKB 4JAMB 4PJ7E 1UB5A 5KSBA 4GAYA 1HHHB 4U1GB 5HGHA 3VFOA 1FVEB 3U4EB 3AM8C 4QY8A 3GSOA 5CD3B 4FQJL 3RL2B 3QUZC 5FYKL 4EDXA 1MVUB 1A3LH 1AHWC 5I1EL 1RHFA 2AJVL 1R0AL 1OOAA 4RNRA 1LO3H 1Q9WA 1CDYA 1MAML 1FE8L 3S35L 1RMFL 3QPXH 4S0TD 5K9QI 2VE6A 3VI3E 3WMSA 1KXTB 1QSEB 2XWJB 4G8GE 4TNVK 4AEHH 4PJGF 4HC1L 5GGUB 1RUPL 5IBUG 4FS0A 4LLVA 5JQHC 4LNRA 4GH7B 5BS0D 3UDWA 4LSTH 3FQRA 3QBTB 5DS8A 3DVGB 1I9EA 3BH8B 2C3VB 3HTLX 4ZMAT 4LP5A 3MRCB 4PJDE 3OXSB 2FO4B 3HMWL 2Q7YA 5IVZA 3D18A 4PRNA 3MBEA 4EI5D 5EC1A 3MC0A 2CKNA 2QQNL 3WYRA 3IETB 1PSKL 3JTTB 5D1XD 4XP4H 2APWA 4AQ1B 1YNTA 2OLDA 3H9HB 4XVSH 9CGTA 4X5WA 4FTVE 2FIRT 4YDIL 4M1GH 3OV6A 2B1AH 1SY6A 5D1ZC 1X7QB 4LSDA 4KRPD 4GBXC 4JZJB 3WIFA 3VXME 4BM7A 2EXYD 4JKWA 4PJ9C 3VH8A 5I73B 4QXUH 4XNMA 4LPCA 2ESVE 3QQ4A 1YC7A 4ZSOA 3MRPA 3Q2CA 2NY1D 3M07A 5BCAA 5FUZL 1XCQA 2CJUH 1P69B 1Z0MA 5DC0A 2DTSA 3SE3C 1KTLB 3JV5A 4MXWL 5MI0B 5FHAL 4Y1AE 5TDNA 2V7NB 2ARJQ 4JRYD 5C0FB 3EHBD 2D0FA 3MMEB 4QGTA 5I0ZA 2R4RH 4JFDB 2OXGA 4LKXA 3QDGB 3PV6A 1PKQB 2E9BA 2N1KA 3VRJA 1CIDA 4FQIL 3C5ZC 1T1ZB 3B9KD 4JLRB 4Y4HD 3TCLA 1ZGLA 1GCFA 3GMPB 3UPAA 5D2LF 4Z7NE 4U1SB 4MA7H 1SMAA 5FCUH 1RUKL 1II4E 4RGOH 2AEIT 2BNRA 2RQ8A 5GRJL 1NFKA 4JG0L 3ZYJA 2X4OA 2XQBH 4MJIA 1Y6MR 4RGNB 2GK2A 3TNMB 3CFEB 4QT5B 1KJ2L 1A6AB 1T2QH 3O45B 4PBWD 3U7YL 1NGQL 2IBZY 2VDML 3KPTA 4LLWB 4NWUL 3FN3A 2Q6WA 5E1AA 4N0UA 3M17A 2VXQH 1JP5A 4XT1C 5KVFL 2YD6A 1KB5A 1AI1L 4JQIL 4UV4L 2BFVL 4FFYL 4MHHI 4POUB 4PV8A 1NCNA 4X6CF 4PJFB 5JO5A 5CJ8A 3MROB 4P2RE 4X8JA 3BP7A 4X0KA 4Y2DB 3MODH 4YQXH 3IXTB 1VCAA 2UZIH 4QXGH 1V7NL 3DX7A 4YXKH 5AG8A 5T1LB 3K4AA 1LNUA 3IFNL 1U91B 1BEYH 1FL3B 4NSKA 1I4FA 1A3RH 2YKLH 5IVXB 1ES0B 3TBSB 5E8NB 4Y4FC 1U8LA 2JJWA 2FATH 4X4MA 5D70L 5EBLB 1DZBA 2CIKA 2MCPH 3B2VL 4U6VH 1I8MA 4UNTA 1TJHH 2CUIA 4OD1H 2WINA 3T77A 1YYLH 5I1AB 3MV8B 1Q9OB 2YK1H 3SOBL 1N5AA 2Z93A 4L4TA 1WISA 3RWDA 3VGAB 3L3JA 5D7IB 4WO4C 5SV3A 1HINL 4S0SD 4OQ1A 3TESA 1YY9C 1IGJA 3LZFH 2L7UA 2V5MA 1E4WL 2F74A 2WQRA 1XIWA 2YA1A 5E6ID 1OAYH 5J7CC 1CLCA 1MJUL 1HZHH 4ODUB 4LCIL 5HHXH 4EXPX 1IAIL 3L3DA 4PJAB 2APTA 3OTTA 3BGFC 4Y16B 1T4KB 1U2HA 4N0YL 5F7WC 3RWFA 2VLJA 4WWKB 1UEMA 1FQ9C 5ESAA 2CLVA 2A6IB 4R97C 1YNLH 1BQUA 1DQJA 1IM9A 2R0LH 5TE6L 3TYFB 3KYMA 2BJMH 3QHZL 2YS4A 5ICXA 3KLAA 43CAB 3JV0A 1HEZA 1NC2D 3P4MA 3OB0K 1Z2KA 5JZ7D 1G9NL 1BP3B 2A0LC 3CLFL 1TJIH 4GG8A 2X70A 4HKXA 5JIPA 1YQVH 3FQNA 3DV6B 3MACL 3Q3GA 5JDJA 1I1YB 4AENA 2HFTA 2Y5TB 1X5FA 2R39A 1EGJH 3TVMD 2UVEA 1U8NB 4DWHA 3FT2B 2C3XA 4RFNC 3FB8A 3TO4C 2FJFA 3AB0B 1N4XL 3MFFA 2P45B 2VIRA 3IRPX 4ODWA 2FGZA 1QSFA 4CGTA 5BXFB 3UPCA 2CDFB 3PDOB 1C8PA 1MRFL 4P46D 1QR1A 2BVOB 4YHLH 3UPRB 2CRIA 3GHBL 4NOBA 4HIXL 3QUYD 1DUZA 1QACA 1FNSL 3QEUB 4M48H 2OK0H 1AP2B 1U8OB 1T0NB 3B83A 5FOJA 1IAKB 1T3FB 4LBEB 3U0TB 3MUGB 4YZFF 5BZDA 1JPTH 3IDIB 4OGAD 1D6EB 1CG9B 3CK0H 4LU5H 3C5SA 2WUCH 4X5LA 3DYPA 1G84A 5I66A 3MGTB 4XCFL 5EUOF 4YHIA 5EBWA 4LLAA 1EZVY 2CDEB 1FCCA 3B3IB 4FQLL 4OLZH 4LCUA 1FG2A 1QVOB 2EEDA 3N9GL 3FO0L 3MQIA 4KY1L 4LSQL 1S78C 1WLHA 3VXRD 2ADGA 4HUNB 4YNYA 1ZTXL 4O4YH 2AJYH 2BERA 4F37K 1LHZA 3O4LD 1JNHA 5D7SH 5IR1B 3FFCA 1EEZA 2FX8H 4Q0XH 1FZKB 4DCQA 4WFHE 4MXQC 1JWSA 5C07B 3WN5B 4KTYA 1V05A 2R1WA 3QWOA 4AMKL 4OZHB 1WUNT 3JSSA 2B1HL 5L2KA 2ZUQB 2B4CC 1SJVA 1I1AB 1CGWA 4JFDE 3QDGE 5F93C 1OARL 2A73B 3HMXA 1CL7L 1TZGH 3W0WA 5T33L 4K9EH 4BZ2L 4UUJB 3ZSSA 2BSRA 3EKCA 3MREA 3NCJL 3P0GB 4CVXB 1EVTC 1DL7H 4PGCA 1OLLA 4AL8L 3EYOA 4KVCH 5CBAB 5GZOC 3DMMA 3HUJA 3K4DA 5IFAL 4RGNE 4ZXBC 2BSTB 5FYLD 3ULUC 1JNLL 3T0EA 3KR3H 3E2HB 3IDXL 1AD0A 1FO0L 4I8DA 4OM0H 1I3RA 3QA3A 5D7LD 2X4SB 2LE9A 1ITBB 5EOQH 4PJBA 4UDTA 1EAPB 1DQMH 3FCTB 4M7LH 4GBXD 1R5WA 3STLB 4PJFE 3MCLL 2IQAB 4HJJH 4KKBD 4NQDA 4LGPB 3BMWA 4J3OC 4OUOA 5I8EB 4HFWA 1B88A 4PJ9D 3ALPA 4MA3A 4KHTH 3LS4L 2DM3A 2H3NA 3ELAT 43C9B 4Q9QH 3VFVA 1FRGH 1F13A 1BJ1J 1FNLA 2VSCA 4TUJB 5E6IB 3S96B 2Q8BH 2DQGL 2X42A 4NGHL 2EDBA 3CXDL 5IVNA 5IVXE 2ITCB 3WNMA 4ONGL 2XA3A 4O2CA 4R0LB 3WEXB 3HC4L 4DVRL 2VABB 1ODAA 2ICWJ 4NDMA 4OCWL 4P9HL 4CDHA 2VUOA 1P1ZA 2AJSL 4NM4H 4QYOB 5LAXA 5CGMA 4KPHH 4IOSD 3MV8E 3VXNA 4MNQA 3TV3L 4LF3A 3GMNB 5CZXC 4M61B 4XPGL 1SEBB 2Q76B 2AW2A 4I3SH 3NIFE 4YUEL 3D39A 1S7VA 4J8RB 4PRHA 5FGCE 1GZPA 1NC2B 2PO6B 1K8IA 3JV6A 5DEFB 2JJSC 3OHXB 1A4KB 1Q9KA 2XA8L 1TTFA 3LS5L 1EDQA 2G5RA 3VW3H 5JQ6L 3I3DA 5CJBA 2OTPA 4Z7QF 5F3HA 1I85C 1MHHB 1RZJL 3CDGA 2IMNA 3WFEL 2DYPD 5TQ2L 5ITBH 3PP4H 3QJHB 4MAYB 2OM5A 3TVMB 2IADB 5HYSA 3D25B 5DJ6B 5IV2B 2LTQB 1BD2E 1MHEA 1JV5B 3RVUC 1IM3B 2QSTA 3IU3B 2FL5B 5DJDA 2I9TB 4MNGA 4UILL 5GIRB 1IGML 3QIWB 5DRXB 1K2DA 2X4QB 3OX8B 1FFNA 1X5LA 1MJJA 5L9DH 3SCMA 2WWMC 3O8XA 4XNZB 4YHKL 2EDYA 2DAVA 1UKQA 5DMGD 1FAKT 3KPLB 2MKLC 4RWHA 1UH4A 1RZKH 1FSKB 1YJDH 4OIIL 1EPFA 2DQCH 1VADA 1RJZB 3HAEG 5B38B 2MKWA 4EJ1C 2FGWL 5C0BD 4FZEH 1YY9D 3NH7L 3ZKQD 1D9KA 1XF5A 2ORBL 4NO0B 4ZS6C 1WC7A 2D4DA 1MCQA 3TNNB 5IWLC 4YHOL 3HZMB 4JN2B 1HKLL 2HH0L 1Z3GH 5GGVL 1J1OL 1R3JA 1P2CB 4OLEA 1OTUC 4TNWF 1LMKA 3D0VA 2WW8A 4NZUH 3ULVF 3KWWB 1UJ3C 2IANA 1ZLUK 4APQB 5F7UA 3S3SA 1KPVB 4KZDH 2OR9L 5DHVB 3D1MC 2W9DL 2JCCB 4J4PC 5C2BL 3FT4A 3O6FA 4ODVL 1SBSL 4BH7B 1DN0B 5HHQA 5ESVA 1KV3A 3TBTA 3HRZA 5DHVH 3S36L 4IEFB 4WJ5A 1MCWM 1A1NA 2Y36L 4WHTB 2CUHA 2JJVA 3QJFB 5EU4B 2OMNA 3LQZB 5SX4H 1FLRH 1MNUH 4UT9H 4F58L 3HS0A 1N2RA 3RJDA 2ZPKH 2YPLA 4HWBH 1W2KT 4FABL 1MSPA 4DKFH 2XKSA 3FAWA 4Z7VB 2OI9C 3C9NB 5C0IA 1BWMA 2NY6C 3MRBB 2R69L 1IEAB 2ZSWA 3FOMB 1U3ZA 3ARBC 3LN5A 5BMFH 5J6HA 5C07E 2VDQH 2XICA 3KYAA 3T2QA 2E7LA 3EGSA 4OZHE 4UTBH 3D48R 3MBED 2D7TH 5FYLH 3P11H 4V1DD 3K2UH 2DB8A 4Z8FH 4LVHB 5H94B 4C83B 4PBVC 2BCKA 2DICA 2DJ4A 4XPAL 1YEDB 1XAUA 1TXKA 1W0WB 2GKIA 2R56H 2OZ4H 1IC5L 5J1AB 4WTWA 4YBQD 4RFOH 5IB3A 2JTDA 4XAKD 4KTDH 3HHRB 1XZ0A 1JGLL 5IQ9B 1MJ8L 3N1QC 3EDDA 4KKAD 3L9RA 5CD5C 4XCEB 1NGZA 3D87B 5DVOA 3PWJB 2IALB 1NAML 3BIBX 2QQKL 2BXYA 3GSUA 3PWVA 1CGVA 5CZVH 3IDYB 2AJUL 5C92A 5F96H 1D5ZB 4OB5H 5EZJB 2OX5A 5EIQA 4JZJC 4PRPA 4O9HH 3HLAB 4NN5C 3JV4A 1S78D 3BP6A 4PJHB 1RURL 1MFBL 5EFIB 4EDWL 4OZGB 3OF6A 4AT6A 4NQSA 1QRKA 1JMXA 2F19L 4HJGA 2VZUA 5L8KB 3HA0A 5CHNA 4NC1E 1VACB 3SKMB 1W0VB 2ATKB 2NLJA 3L5XH 5MI0C 1JF6A 3O41A 5JMRA 4MXQD 5TPWH 3ZDZF 4U0QB 3ISWA 4QRRA 4U6YB 5C0ND 4XBGA 3ZE0F 4N5EC 3NABL 3KPRA 4MJID 4P59L 3QDJB 5JLZB 1A6VL 1FNEA 2P8LB 4ZPTB 3RI5F 3WFZA 5K33A 4IM8A 4LPVA 2YEZA 4ELKB 4ZUTB 5HHOA 4Q6IB 4PJCF 1VFBB 1CLYH 4WUUB 1EUUA 2HKFH 5D1QC 1K5NA 3V52L 4JB9L 2FX9H 2DQFB 5BJTA 4KRMB 1QSZA 1NBVL 3WXWH 1WZKA 5E95B 2VSDA 2M8XA 1PQZB 1IKNC 4H5SB 1CFBA 1JK8A 4RMUA 1SJEB 1CVSC 4EI6B 4PLJC 1T20A 4PJEB 3OAUH 3BESR 3I50L 1RUML 3BP4B 3MOBL 4M8VA 1G7JA 2Z92A 1TCRB 3FRUA 2QLVB 4JPWH 4FQXC 3FQUA 1YNKL 1A9BA 4Y2DC 4OLWL 5IHUH 3KDMB 2NY7H 1U8IB 4WWID 4GKNA 1L6XA 5BOPA 3QQ3A 1AXSA 1ZA3B 4G6FD 1I7ZB 1A1MA 2YA0A 5B22A 5J3HC 1VKXA 3I9GH 4YHNA 5C0BB 3GSVB 2OJZL 4DTGH 2WLZA 4L4TD 1DLHB 5T1KB 1J0IA 4RZCA 2FB4L 1MCSA 3G5ZB 4NNYA 5KSBB 1U36A 2F5BH 1TTUA 3OKEB 4PS4H 2R8SL 1XIWD 5HGHB 2XZZA 3VWJB 4QY8B 5GGTH 1AGBA 3GSOB 5GS0L 1N3NA 5AZEH 3DIFB 5T3XL 2GAZB 3VGAC 3UJTL 3A67L 5T5NF 5JPMB 4RNRB 1Q9WB 3VFNB 2GFBB 2O5ZL 2VLJD 2X4PA 3CVIH 5CZXD 4DGVH 2VE6B 3TN0A 3MLZH 2UWEA 4M7JL 4JJ5B 2MPAL 3BH9A 3O3EA 4GSDH 4Z5RA 4LLVB 4WDIA 3SE9L 3U4BL 4YHYC 1Z9SA 3QISA 4LNRB 2XZCL 5GRWA 4JM4L 3ARPA 4WWKC 3FQRB 2PR4L 1SJXA 2DQTH 5IB2B 4MS8C 4JPKH 1LO4L 1DDHB 1JHTA 4GRMA 5FYJD 2JCCE 1UH2A 5IVZB 4DN4L 4LEXL 5CGYC 5EC1B 7FABH 3UTTA 2IG2H 3RVUD 3KXFA 2R2BA 4P5KB 1YNTB 2J4WH 5KBNC 4X5WB 2VDKH 1GGBH 4FXGA 4XX1G 3RAJL 3TJHD 2FNBA 3E3QE 3EOBA 2HVKA 1NCDH 1JNNL 1OTSC 4Z7VE 4KJPC 3WIFB 1RZIA 3GMLA 2E7CA 1NEZA 1KN2H 5TQ0L 4WEUD 2B8OT 3VH8B 3AB0C 1NGYA 4XNMB 4TOYL 2VL5A 3QQ4B 2UY7A 4M7KH 3CUPA 1LP9F 3WSQH 1WFOA 4L3EB 1LK2B 3MRPB 4PJIF 1F4AA 4YDVA 1PD6A 4KZEH 4MJ6A 5I8KL 4LCYA 2FIKA 4DQOH 4R3SB 1H3UA 5CJXC 5IROC 3SDXB 5TDNB 4KKCD 4XNXH 5I71B 3BPOB 1YC8A 4LKXB 1JTOA 2CR3A 3PV6B 4P2QA 1WICA 2EYRA 5E9DD 3BPLB 3MNWB 3TCLB 1UQSA 1ZGLB 3EJYC 1FVDB 5DDHB 3UJJL 2CLRA 5EB9A 2HFEA 4EIGB 1CFTA 4F80A 5FUCE 4RA0C 2I25N 2C1OA 3NGBC 3FFCD 4NHCL 1VERA 2BNRB 2K1MA 4OQTL 2WNGA 4DFHA 4IIQC 4MJIB 4X6EB 1MELA 4LSRH 15C8H 1KLUA 1GC1L 4HFUH 1D5IH 5L2KD 1S9WA 4QRUB 2Q6WB 4PJHE 4NKDA 4M4PA 2X40A 3RWJA 4ZS7L 4N0UB 4KGLA 4OZGE 2AXHA 1NAMA 3BAEL 1KB5B 1DR9A 4AG4L 1ZSDA 1J8HD 5HGBB 1T22B 5JO5B 3BT2L 4P5TB 4H8WH 3RKDC 5CEZD 1UACL 4X8JB 1KB5H 5DD6A 2EC9T 4X0KB 3MRJA 4KROD 1HSBA 5F7EH 3HE6C 1UM5H 5HDQL 3DX7B 2D0HA 2HTLD 1I1AC 4NSKB 4K7PH 2XZAL 1PG7L 1JGDB 3QDJE 2P5EA 1BBJA 2Z8WC 5L0QB 3FT3A 3T0ED 5E8PA 1BF2A 3BE1H 2X44D 3O3UN 1U8LB 4A6YA 3C60A 1JYXA 1UWEH 1TVBA 4WUUE 1NL0L 5IP4A 2WINB 3T77B 1LO2H 3MRRA 1TENA 1XR9B 1RFDL 3KYKH 4WIQA 1B2WH 4U1IA 4Z7OE 1HHJA 1N5AB 4GJTB 3IS0X 1HHKA 1MAJA 1PLGH 2A9MH 2ZUSA 3X3GL 1EFXA 2LVCA 4WI6A 1IGJB 3I2CH 4F7CB 1XIWB 3KLHC 4PJEE 2VZ3A 4JREB 3LIZL 3GB7A 1CFVL 1OGAE 3DROA 3KS0J 4OT1H 1V7MH 2YSSA 2XWTA 4GAJL 4ZFGH 3SBWA 2HN7B 2FHCA 3B2UD 3L3DB 4YWGH 1EJOL 2F5AH 2CK0L 5DWUH 3I6GA 3L7FB 2DQDH 3RWFB 2VLJB 3SKJL 4BZ1L 5MERA 4NC1C 4G6AD 3R8QA 3HZKA 4IJ3B 4MDIA 1JHKH 1DQJB 1IM9B 1P5UA 1TNNA 2GYSA 3CMOH 4HKJB 3SGJC 5LWYH 3D39D 5E5RB 5DJCA 2DTMH 1QPXA 5AG9A 1XCTA 3KLAB 5ICXB 4NO5A 5KSBE 3ULSA 4GG6F 4RA3A 3P4MB 4TSCL 4YFDB 4HMDA 1B0GA 2BP3A 4Y5YA 2ED7A 4GG8B 2X70B 2X4TA 4RBPH 2JELH 3B6SA 4N5ED 3ROLA 2X2YA 4E0RB 2EDFA 1B90A 3ORJA 2DIJA 3V6OA 4XMPH 3R1GH 4YLQT 4TUOB 5DZNA 4HXBL 1M4KA 1GIGH 5EU6D 2R0KH 3DARA 2FR4A 3FB8B 2ARJB 4HCRA 5FYJH 2FJFB 3KS0H 4BUGA 4Y5XA 4BFIA 5ELIA 3OR7B 1CFNA 1QSFB 1H3TA 3T2NL 1A6ZA 5DURB 3ULVL 3VFRA 1WJ3A 5I76A 4F7EA 3WD5L 3PE9A 4WY7L 1PZUB 5FYKH 4MAYC 5D5ME 2HWZH 3EOTL 1DUZB 4PLJD 5I1EH 2AJVH 1R0AH 4LSSL 4HK0B 1MAMH 1PAMA 3BWAB 3SCMD 3ZTNL 1FE8H 3T3PF 3S35H 1RMFH 3L6FA 1LQSR 3MV7A 3RIAF 4FQXD 1IAOA 2X1WL 3C5SB 4YEFA 5E5MA 5I66B 5EUOA 3QIWC 1RUPH 4PUBH 4YHIB 4OI7A 4U49A 2CIIB 2VDLL 3TBVA 1UWXH 1IRAY 4LCUB 1K8DA 1OB1A 1WZLA 2YZ1A 2R0ZL 1T0PB 3EJZC 3RA7L 4RMVA 5HD8D 3EYSL 2DMKA 3P4OA 3JVGA 4FOMA 1D9KD 1S3KL 2ADGB 1RZKC 3ZL4L 1X5XA 3P0VH 3HMWH 4J23A 1DANT 1JNHB 4KHXL 2QQNH 1G0DA 2P43B 3RNQB 1PSKH 1ORSA 3RZCC 1OL0A 4L3EE 3FFCB 3LN9A 1KCRL 1PJ9A 1G7IA 4S1RL 3VGBA 2IAND 1JWSB 4H25A 2W9LA 3HE7C 4YDIH 4XCYA 3QWOB 2R1WB 1V3KA 3UXFA 3L7EB 1NSNL 3SDXE 3UP1A 4HG4K 3QNZA 5J89A 2AK1L 2V5TA 5IOPA 3HPLA 4L8BA 3U30B 3W0WB 5EOTB 2OSLA 2YPLD 5DD1L 2DD8L 4KROB 2H1PL 5FUZH 3MREB 4J3UA 1WVZA 5CEZH 5HYEA 4CVZA 3KAAA 4JFHE 4MS8D 4PGCB 2PYEB 2BNRE 4L3AA 4MXWH 4ZO8A 4TSBL 5FHAH 5EOCL 3EYOB 1J1XL 2CXGA 3DMMB 2P8PA 4LLYA 4MAUL 4MQSB 5CGYD 3T0EB 5JHDD 3HFML 1JNJA 3F7VA 1AD0B 3TBWA 1JI2A 2YWYA 1I3RB 3QA3B 4FQIH 3DO7A 1NEZG 5FKPA 4PJBB 1KGCE 5EIIA 1HCFX 4Y4KC 4UINL 2IH3A 1S7TA 3S3PA 4Z0BH 2XN9B 5B8CB 2P24A 4E9LA 5I1CL 1RUKH 4G42A 4JM2F 1OTSD 1I9RL 1R5WB 4IS6A 4GW4A 2IQ9L 3OAZK 5GRJH 3VGHA 4NQDB 3L5HA 4DGYL 4JG0H 1KJ2B 4HFWB 2FYYA 4IHOB 4NBZB 3GUTA 4MX7A 4P4RB 5BO1L 1YEKH 5INCA 1KJ2H 3GSWB 3VFVB 5CKAA 5AUMB 1BREA 1NGQH 2VDMH 4NWUH 5ISZE 4C4KO 3W9EB 1M1SA 4OCNC 5GSRA 3O4OB 4XPFH 1QP1A 2PXYB 3UZQA 4UV4H 2BFVH 4FFYH 5E8DL 1NBZB 4IMLB 5F1SA 5E2WL 2NY0C 3QR2A 4NDMB 4PRPD 2FCBA 5DSCA 1JUFA 3DRTA 4KI5F 4AIOA 3VXNB 4MNQB 1V7NH 4LF3B 5FUCC 5B4MD 2Y9RT 3IFNH 1ZAGA 4B5EA 3OMZA 4PRHB 4KUCD 1MCNA 1GZPB 2VXTH 5I1KL 1UZ6E 3TT3L 1K8IB 1CK0H 1Q9KB 5D70H 2W60B 4NQVA 1MPAL 4GMTL 3FONA 2R2EA 5F3HB 3KGRA 3KYOA 4JO4L 1URLA 3KPRD 4ZDHB 3SOBH 1XEDA 4X80L 4G6JL 4KMLB 2VXSH 5HYSB 3GO1L 3O2WL 3SDAA 4XNQB 1S7WA 5HHOD 1HINH 1T0MB 3VRLE 3TFKD 1MHEB 2RCSL 2FEEL 4GS7B 4MXVF 4LHUA 5DJDB 2BRRL 2XXCB 3PUCA 4PGZA 4U1MA 5HDBF 1MJUH 3TO2A 3VMPA 4XC3H 3HE6D 4LCIH 2XRAL 1WGOA 2OXHA 2ZWLT 1NC4D 1FFNB 1P6FA 4Q6IC 3ZE2E 4HSQA 1H8OA 3SCMB 4MA1B 3O8XB 3UBXI 1GHFL 1YEGL 2WM0A 3OB0H 3SDDB 1WFTA 2NXZB 4NKIH 5HVFB 5JW5A 4Y5VB 2I9LA 3RVWC 1I1FA 3E6FA 5TE6H 4YFLI 1NUDA 3QHZH 2ZJSL 4H0IA 3DRQA 3ROOA 3EO0A 3NZHL 4RMSA 5F8QC 4R2GB 1VADB 1IL1B 1QSFE 3CLFH 1CZ8L 5FYKE 1NANI 1P4LB 3P9LA 3KJ4B 4JFEB 4HT1L 1RULL 5BRZD 1IMHC 4CKVX 1O7SA 3MJ8A 2D4FA 1D9KB 3NAAH 2XFXA 4MVBD 3MXWL 4I3GA 4QRSB 2Z0BA 1Y0LA 2KQMA 3U48A 4GKOA 1FL6B 1R3JB 3BKCH 2NX5A 3D0VB 5B3JF 1N4XH 3OAYK 2IH1B 5F3BA 1UZ8B 2LAAA 2IANB 4IRJC 2MTPA 3QCVL 2IGFL 2R23A 3HNVL 3ET9F 3CD4A 4UIMA 1AGEA 1MRFH 3MRHB 3DGCR 5D8JL 3O6FB 3WHE1 5HHQB 5ESVB 3HRZB 4CVUA 4WJ5B 1AGFA 4K8RD 2DBLL 1A1NB 3VWJC 5KSAA 4XBEH 1TDQA 3BZFA 3HS0B 4HJ0C 5GGQL 4NRZB 2YC1A 1BFOA 4AEEA 3VFGL 4U0RB 5C0IB 4XCFH 3UTSB 4NUGL 4DUWA 1GXEA 1DBAL 2ZSWB 5GGRY 3ZT6A 3LN5B 4FQLH 5J6HB 3N9GH 5FHBH 3FO0H 3BGMA 4UT6L 4KY1H 3V0VA 1AR1D 1QRNA 3MRIA 4LSQH 4QXWA 3SKUD 2EE9A 2APBA 4JR9H 3V2AR 5FA4A 1T7YA 4ETYA 1WV7T 4P2OC 3KXFD 4HIEA 3EYQD 1IILE 1J1PH 2BK8A 4XVUC 4JPVL 2BCKB 3U46B 5F7NC 4ODXA 2XYCA 1CF8H 3W0WE 1FZOA 3LOWA 1CIUA 4DZBB 3RGVA 5IMLB 4KDWA 1TQCB 1ZWIA 3PQYE 5GQBA 2VR9A 2BOBA 4LFHG 3V5DB 4M3JA 3WFDH 5IB3B 4R4NC 2J8UB 4AMKH 1JTPA 2PYEE 1KJ3H 1XZ0B 3FOLB 1FCGA 4UNVA 3T0XA 5FYJU 1OARH 1IE5A 3GEWB 4HUMB 5CBEB 3OKLA 2A6JB 1KB9K 4PJBE 3G9VA 4LNVA 3BYYA 3LB6D 3JV4B 3NCJH 4QTIL 2XN9E 1GH7A 1ZHBB 2HMIC 3Q0HA 2ZG2A 2BVEA 3RVTD 4NQDE 4AL8H 4HK3J 4P2QD 1BOGB 5IFAH 2XG4A 4AT6B 4NQSB 1JNLH 2AI0L 1WAAA 2BDNL 3IDXH 3RZCD 5CHNB 3MPCA 3V0WL 3VDBA 2NTSP 4KQ4H 1T03H 2NLJB 4OZFA 5KW9H 3O41B 1YPZF 5JR1L 1WFNA 3HE7D 4QRRB 5I71C 3ME0A 4PFEA 3IF1B 3BPOC 4WHYH 3H0TA 1MIEL 4KWUA 1QYGH 1QHOA 1FNEB 3MCLH 1HH9B 4H0HB 5C6TL 3MJ7B 2H2SD 2YEZB 1T1WB 2GIYA 5HHOB 1O0VA 3QHFL 4MNQE 5INDA 5F44A 3LS4H 3FO9A 3NPSB 4HDIA 1YUHB 1GGIL 1WBYA 2DQGH 1KTDA 2GI7A 4QHKI 3CXDH 4LHJB 2Q8AH 4PRHE 2LVEA 3EDFA 1ZT1B 4ONGH 1I3VA 1MCDA 2X1OA 4LPXA 4QHMB 4ELMF 2A74B 3HC4H 4N8VB 1OM3L 3PWPD 1JK8B 2VNCA 1QEWA 3A6BL 3LKOA 1NCCL 5IW3A 3VFMA 3B9DA 2AJSH 5E2UL 4NN6C 3EYUH 3RUGF 3KPMA 3STBA 3TV3H 4PTUA 2P5ED 5FO8A 4NO3A 3FRUB 2OTWA 3MA7A 2B20A 4W6XB 4P5TC 4YUEH 4NJ9L 2PNDA 2QADD 3B9EA 3C60D 1IBGL 4Y4KD 1A9BB 1UGNA 4I0CC 3DTXB 1G7MA 1X44A 2VAAA 3Q6GL 4CDGC 3H2WA 3QQ3B 1AXSB 4JFOA 2XA8H 3UTZA 5CEXA 3LS5H 1A1MB 1ROWA 4BELD 1VKXB 4E5XA 4YHNB 5JQ6H 5ERWB 4YX2H 2D9CA 3C6SA 5F8RC 5C0DA 3I6KA 2P5WA 1EFXD 1RZJH 4G8IA 3WFEH 5D7IF 5TQ2H 1TPXC 1ZGLM 3LDBC 1A9EB 4XNYL 1E4XH 5JIIA 5I17B 4I9WE 4UU9A 1MFCL 3GSRB 3V9FA 1H3XA 4WW2F 1N3NB 4XB8A 4R26L 3MGOB 2ICWI 1HKFA 4BA8A 3O6LL 3NIDF 1NFDA 3G6JA 4RRPG 3N1GC 1JIBA 4KMTL 1OAQL 4UILH 1ZS8A 1X5IA 4L3CA 5ID0A 4JQVC 4PJAF 3X11A 1HIML 3I84A 4WHCA 3PL6B 4CUCA 1YEEL 4D9RD 4JFEE 4JREC 3TN0B 2AXFA 1PZ5A 4PJGB 1A6WL 1E4KA 4HQQL 4K8RH 4YDKL 4YHKH 1R5VA 4HEPG 4KJQC 5K59F 1FC2D 4YFLF 1S7QA 3O3EB 1KULA 5HI4C 4WDIB 3VFSB 1A5FL 2VZOA 3ARGA 4AIZA 1DSFL 4HAFA 3JUZA 1BQHG 4NNPL 4OIIH 4AK1A 5TDOB 1M7DB 4LHUG 4B53A 1HQ4B 1KFAL 4RMRA 4GRMB 2FGWH 1TJGL 1G6RL 3FB6B 3NH7H 1I8IA 3CH8A 3MOQA 3VI4F 3UTTB 1QR4A 25C8L 1GGTA 2X41A 1QBAA 2R2BB 1KBGL 1HKLH 4PLOB 2HH0H 3QIBA 5GGVH 4HUVA 1J1OH 1MRCH 5I15L 1RZGA 5IHBA 3HB3D 4M1DL 4QCIA 2J3SA 3EOBB 1HH6A 2DI8A 2HVKB 4FQ1L 4OV6F 3VDAA 2ZOLA 2OR9H 3UTSE 1NEZB 3BRGC 1U58A 2W9DH 3U79A 3WE6B 3GI8L 1SBSH 1AGDA 1NGYB 1G9MH 2EXWD 4XVTL 5SX4I 2DDQL 4PRID 4HV8B 3RVWD 2Y36H 5IMKB 4GQPH 2FX7H 3MV7D 4PJIA 5IQ7H 5DJAA 3B43A 1L0QA 4F58H 3RX8A 4XWOD 1B9ZA 4CBPA 1KLGA 2BMKB 4MJ6B 3Q1SH 2VERN 4LCYB 2FIKB 3EDEA 1LO5A 1BJMA 1NCAH 4LFHD 5DJYA 4FABH 4RAUB 5HYJA 4YJZL 3ZKMD 5IB1B 4ZTPL 5BVPH 5GXBB 2VQ1A 3TH3T 2R69H 5DJZA 4NQXB 3H9YA 3V4UL 2EYRB 1MLCB 1D3CA 1EO5A 1UQSB 2X7LA 5CAYB 2J8UE 5D2LB 2CLRB 2HFEB 3ILQC 5FM4A 2C1OB 1BZ7A 5L6YL 1WCBA 1U92A 4HIIB 1MI5A 4K7FB 2HVJA 5KTEL 4Y19A 3UYPA 4GXVL 1UKSA 4NHUA 4EKXA 3RPIB 4KJWD 3MLPA 4X9BA 1S9WB 2EIZA 1ZVSA 4NKDB 2FLRT 3RWJB 1MAKA 2A38A 1NMAH 1RIUL 2C3GA 4NFCA 1MJ8H 1NAMB 4X6CB 3EZ8A 2G60L 1ZSDB 2PW1B 2KH2B 3RL1A 2XTLA 5E2TL 1NAMH 2QQKH 4QO1A 5DD6B 4QTHB 1CDJA 5GS1B 2AJUH 1HSBB 1INDL 4RQQB 4OCLC 3MOAL 4QRRE 4BSJA 2VXVL 5IG7B 1JF5A 1RURH 2P5EB 1BBJB 1KIPB 3FT3B 4KU1A 5E8PB 1G7HB 2WBJB 4EDWH 3LQAL 3U30C 1P4BL 2R29L 3H9SA 1CFQA 2QL1A 3K0WA 4ALAL 1I9IL 4XVUD 1TVBB 2F19H 5DVKA 2D7PA 2OP4L 3MRRB 4DGIL 3LN4B 3DSFL 1WFUA 3ARDA 3GBML 5B3NA 4U4BA 1FAIL 2R2CA 1F6AA 4MCZB 4U1IB 1HHJB 4G7VL 1HHKB 4R4ND 3VXQA 2PF6A 4POZC 4FQCL 3IXAA 3NABH 3O6KH 1A6VH 1H15A 2YPKA 4JPIB 4KGJA 4Z95L 1ERNA 1JN6B 4EVNA 1H3VA 2GTWB 3DROB 1A2YA 2UY6A 5B8CC 3V52H 4JB9H 2YSSB 2DWDB 5DHYB 2B0SL 3MLWL 5IW1A 3S37X 1T5WB 2YOCA 3V7AG 5KOMC 5MENA 1NBVH 4Z7WF 3H7BA 4EN3A 2HMID 2VDOL 5MERB 2A83A 3S4SG 3HZKB 4EUPB 2ZUYA 2EDEA 4MDIB 4ACPA 3ZZ1A 5IB4A 1Q94B 3I50H 5DJCB 2PXYC 4JRXA 5EU5B 2O5YL 2AJ3A 3GK8L 4GG6A 5EO9B 3MOBH 3ULSB 3BI9X 4GRWF 2EICA 5MEQB 5C0AB 5I6XC 4Y5YB 1YNKH 5C3TA 4OLWH 2X4TB 2A2QT 3ROLB 1I9JL 2CPCA 4MJ5A 3DXAB 3DVIA 2EH8L 3IJHB 1MCHA 3ARQA 1RU9H 4OTXH 1AH1A 2JB5H 4X7DC 2OJZH 5DXWA 1D5MA 1I8LC 5JDSA 1TMCB 4L4VA 2FR4B 4H0GA 1C12A 2NY4B 2FB4H 4OM1L 3V6ZA 4Y5XB 4BFIB 2R8SH 4PJGE 4JGMA 3CCHA 1CFNB 5E2JA 4HCRH 5HYQB 1A6ZB 4JFFA 4LHUD 4F7EB 1UCBL 1HSAA 5T3XH 3NMEA 4GKSA 3UO1L 4PJ5A 3A67H 4M7LT 5CWSB 3LMJL 1JWUA 1YN6A 2O5ZH 2YD3A 4GS7C 2DMBA 5FGBA 4FG6C 3L3OA 3EOYG 1IAOB 5ADPL 5IJKA 5EUOB 4M7JH 3UTTE 4EBQL 1ADQA 5I1GL 2FO1A 1UB6A 2PTTA 4UQ3B 4LSTL 3TBVB 4OI9A 4FQ2L 4KK9D 4LVNC 2XZCH 4HHAA 1CD9B 1K8DB 1OB1B 4JM4H 4MSWA 4MA1C 4Y88A 1JYVA 5LVEA 1AE6L 5HPOA 4NM8H 2PR4H 3FQWA 3SDDC 4PRDA 5FGRA 2NXZC 1LO4H 4Y5VC 4LPYA 3QUXC 3VWKA 4J6RL 1G9NC 1IGFL 3BKJL 1CICA 3DWTA 4DN4H 4XVSL 4LEXH 4JY6B 5FAAA 1ORSB 1U95A 5IEKA 1AQKL 1FNGA 4F8QA 1G7IB 3DURA 3KJ4C 3V95A 1FYHB 1KJMA 4H25B 2H8PA 3L3IA 3WLWC 4XCYB 3RAJH 3BPCA 3W81A 3CH1A 1JNNH 3AREC 3G04A 4QXUL 3QQ9C 8FABA 5TQ0H 3ILPA 4KJQD 1UJTA 4CMHB 4OCRL 4YBHA 1XFPA 4TOYH 1BBDL 4LQFL 2CJUL 2EYTA 4L8BB 3QEQA 4F9LA 5D2LE 2OSLB 1CT8A 4UOJA 2B2XL 4RCAA 2AKRA 5I8KH 2DQIL 3DUUA 5HI5C 4CVZB 2NNAA 3T2OA 3P4NB 4G6KL 5TE7L 4Q58C 2DLFL 4LLYB 1ZVYA 4IRSA 1T83C 1QRND 3M8OL 5C08A 4MA8L 3LEXA 1WBZA 3B8YA 3BKMH 5FKPB 4U0RC 4HZLA 4KC3B 4RGOL 2FHFA 4X9GA 5EIIB 1YMMB 2FSEB 2IH3B 2ATPA 2JLLA 4QWWD 3NVQA 2XQBL 2APXA 4G43A 4JM2A 4X6CE 4Q9RL 2V7HA 4WUKL 3MRLA 4IS6B 4GW4B 3QXAA 4NHCH 1KN4H 5IK3A 4PY8J 5I16A 2FYYB 4KK8D 1N26A 3GUTB 4MX7B 3PIQB 5A40E 5INCB 1GC1H 4S1SL 3LD8B 2ZSVA 4ZS7H 4B0MM 3IDMB 4NZTH 3QCTL 1P5VA 3R0NA 2UUDK 1N0LA 5TDPA 1EX0A 4AG4H 1F4XH 1QQDA 2UZIL 3BT2H 4QXGL 1UACH 4YXKL 3U36A 1XGQA 5DSCB 3PHQA 3VXPA 4BQ9A 5D7JB 5C7XL 5HDQH 2YKLL 3PG2A 2QR0A 4KKLD 4X5XA 2JJUA 5GJSL 5EPMB 3ZTJG 3V8OA 5C71A 2X1QA 1PG7H 4PGDA 1F4YL 5C09A 4UV7H 1YYLL 1ZOXA 3D85B 1A7NL 3F62A 3M1BB 1NL0H 4N5UA 5ID1A 4CADB 2MMXA 5I75B 3U4AA 3FONB 5A16A 2B39A 2E9JA 1JGEB 1RFDH 2X9WA 5GRUL 3SGKC 3ZDYF 5F7KC 4ISVA 2AEWA 4O2EB 3SDAB 5ALBH 3X3GH 1S7WB 1KT2A 4FQQA 4ORZC 2EE6A 4LCWD 3PP3H 3H42L 4G8FA 4M1CD 3F12A 4P9ML 3SDCA 1F3JA 3LIZH 4OFIA 1CFVH 1IKFL 5CEYA 4U1MB 1CDHA 4HIHB 4J1UA 3TO2B 2C7UA 4MZ3A 5DO2D 4TRPL 4J2XA 2A1WH 5C0AE 1S5HA 2ZCKL 4HXAL 4JDZA 1LDPH 2CK0H 2Q1EA 3B5GA 1Q72L 1QTYT 1MCFA 4JVUA 3DETC 3DXAE 1YNLL 3NPSC 4IMKC 3SKJH 5JXEC 2R0LL 3V6OE 3QDAA 2BJML 1KENL 1Q0YL 1EHAA 2RHEA 5JW5B 1I1FB 3E6FB 4NC0B 3CPLA 4P9HC 2IPUK 2QQLH 3LHPH 4U3CA 1RIHL 3WO4B 4PREB 1TJIL 3DRQB 3TGXA 5JNYA 3EO0B 5FV1L 4TSCH 4YDLB 2GJZA 5JW4R 5T3XE 3P9LB 3QAZB 3SDYL 1HN1A 3EYFA 4LLDB 4HH9A 4NQEE 2J6EL 4JN1L 1X6NA 1S9VA 3O2VL 2RJMA 1SEQL 2P5WD 2XFXB 4DZ8A 3WIHL 4HXBH 4YZFE 2NX5B 1CYGA 5F3BB 1QKZL 1LD9A 1KYOK 4CNIB 4YHLL 4JCMA 3T2NH 1VEOA 2R23B 3ULVH 4UIMB 4FFWC 4HG4J 1XF3A 3WD5H 3MLVL 3O11A 4FXKB 4WY7H 4M48L 3MRGB 2OK0L 2R4SL 1L7IL 1VFMA 1G7PB 3EOTH 3MLXL 3UAJD 4LSSH 5KSAB 1DE4A 3BZFB 5HJ3A 4LU5L 2VXUL 2UVFA 3ZTNH 2WUCL 1C5CH 5HGDA 1JI1A 3D3VA 3BDYH 4ZOCA 3C08L 4KTEH 2YC1B 2I24N 2FJHA 2DMCA 4D0BB 3ARGD 2ICEA 4KDTC 5DTFA 3IU4L 3PL6C 4ZFOL 2VYRE 2VDLH 3SPVB 1QO3A 1NUGA 3JXAA 1IGTA 4E41D 2F54D 2R0ZH 2IAMC 3BGMB 2VN4A 3LEVL 4FMKA 3RA7H 3V0VB 2R0WL 3MRIB 4H20L 1AO7B 5C0CB 4JZOA 2GQHA 2WANA 3JWDH 4YR6A 1QFOA 2YN5A 4OF8A 3NACL 3FB7B 4HIEB 1FFOA 3NOIA 1VFAB 4ODXB 1MCEA 1ED3B 4X6FA 4RMWA 4H1LA 4Q9BA 3OGCB 1KCRH 5F7LB 4S1RH 1M7IA 5FIEA 1OT1A 2OQJB 3RGVB 3RNKA 3WUWA 5SWSA 4POYA 4F7PA 1T7ZA 4NOFA 4ZD3L 3SEPA 1TTGA 4NQCB 2D7MA 5HGGS 3ZHLA 3T65A 1NSNH 3BEVA 3TIDA 3VMOA 2NZIA 4LDOB 4G9FE 1GGCH 1F3DH 3C5JA 4FG6D 4CN6A 4TPRL 4Q2ZA 1TZGL 4HKZA 3ARFC 3N06B 3LVEA 3T0VA 1CGUA 2JE8A 2DL2A 3OKLB 4P5MA 4N90D 1DJSA 5DD1H 2DD8H 1DBMH 1L0XA 1YMME 5T5FL 4XH2A 5JIKA 5J9PB 5CJ5A 4WENB 4NNXB 2IPKA 4J7RA 3QUXD 4TSBH 5EOCH 5ADOH 1J1XH 4TUKL 2P48B 4MAUH 1A7PL 5EOQL 1JJUA 2F58L 3TZVC 3WUZA 2P44B 5J13B 5F1NA 1NBYA 5F72S 3RIFF 3VFPA 1LEGB 2W9EH 5I30L 1HYSC 2VLRB 1YPZA 4OZFB 4X4ZA 4M7LL 4UAOB 2XXMB 4MQXD 4WTXA 2EYSA 3AROA 3SJVE 4HKBB 3H0TB 4UINH 4KXZH 4OZFH 2GK0A 1FZJB 3ES6B 5TFSH 5I1CH 1I9RH 2ZNXA 3QQ9D 5IMMB 4DGYH 3KPSA 4YHPA 1FRGL 4PTTB 4PJCB 5E2VH 3MTRA 5INDB 5BO1H 2Q3ZA 1DEEB 4HDIB 4BZYA 5BVJB 3QI9B 4QF1A 4ETQA 1WBYB 2HFGL 1KTDB 2DN7A 1I7RA 2BXZA 3WJLC 2WSKA 4NM4L 4JG1L 4ELMA 2ZCHL 5IESH 2BNQB 4M7ZB 5F88A 3RWHA 4X4XA 1T66C 1VDGA 5E2WH 2QKIA 1QEWB 3LKOB 3VFMB 1NUNB 4NP4L 1CGSL 4FNLH 4LHQB 3RUGA 4Z7QE 3WS3A 3KPMB 3ULUF 3RX5A 4PJ8A 1UM4L 3H9ZA 5KANI 4PTUB 3SO3C 2YUXA 5CKGA 3MA7B 2D7NA 2XG5A 1KCUL 2YR3A 3H9SD 4CRPA 5GS1C 4I18A 4X6BB 5HGAA 4QHUA 5I8CB 5I1KH 1AKJA 1G7MB 2VAAB 3O9WB 3S88L 4NN7C 2DS4A 3TT3H 4WV1B 3QEGH 3ARDD 3TA3C 5CEXB 2WBWB 4GMTH 2RR3A 4E5XB 2CUMA 1UCTA 5ITBL 1LK3H 4N8CL 1TNMA 1ND0B 3EDJA 3I6KB 5EO0A 2WBJC 4JO4H 5B39A 5HHVH 4G8IB 4X80H 4G6JH 3NCYP 2J2ZA 4JY4A 3GO1H 5L2JB 3O2WH 1D5BA 1X5YA 4WW2A 1MRDL 4UIKL 5BQ7B 5CILL 4LSPL 1CS6A 5C0EB 4DVBB 2D2OA 4LLQB 4X4YA 2BRRH 3VXOA 2AK4D 5MEND 4AEIH 3PWLA 5ID0B 4ZFZA 1I7UB 4EN3D 4KDVA 1ZHLA 2AXFB 1PZ5B 3WNLA 1GHFH 4PP2A 4JRXD 3QDMB 4JFYB 4WRLA 5D7KD 1S7QB 1T1YA 4XPBH 1I3UA 1YJDL 4AIZB 4UT7L 1ZLWK 2ZJSH 2NX5E 3HCVA 3ULVE 3PGCA 3MV01 4FZEL 1X5AA 3LPFA 3MNZA 1CZ8H 3MLYH 2NXYB 3L95A 1OPGL 4HT1H 2ZUVA 1RULH 3NA9L 4WI7A 3MR9A 4XP5L 3OAYH 4YO0B 3GKWL 1OF2A 4L4VD 2IPTL 1CD1B 2I5YL 3MXWH 1SMOA 4LCCA 2ADJA 5JXAL 1OGTA 3RVXC 4BSVB 3QIBB 4HUVB 4ZUSA 1S7RA 1JRHI 4JFFD 5TH2A 4FN0A 1DFBL 2E9WA 4QRTA 4QCIB 1NCBL 1HH6B 2P46B 1OTTD 3QCVH 2IGFH 3AAZB 4N68A 4C55A 3HNVH 2ZOLB 3DETD 1MY5A 2H45A 5JXED 4P23C 3RFZC 5D8JH 2NY4C 2OJEA 1RK0A 3QP3A 5JPNA 1RD6A 3HI1A 1MNUL 1LP9B 5GS0C 3CFCL 1KB9J 4PJIB 1FNFA 4XMKL 4PYHA 5DJAB 4K7PY 1AO7E 5C0CE 1KLGB 4R4BA 5LJYH 3X12A 3QFJA 5GGQH 5DJYB 4K07A 1M05B 4HS8L 1H3PL 3VJ6A 3VFGH 4ZFOA 2C4FU 4P49A 5HYJB 1UG9A 5BMFL 4JRYA 3WLBB 5JW3L 2VDQL 5DC9B 4NUGH 1DBAH 1U8MB 5DJZB 4NZDA 3MLTA 4WFFE 3WS6C 3DYOA 5FYLL 5TGBA 3B9KA 3VG9B 2X7LB 3MRMA 4NQCE 3QXWA 1CICD 5T3ZD 4RAHA 2X89A 4GW5A 4Z76B 5J1TC 4ONOA 4PIRF 1WCBB 5FOBB 1MI5B 2GSIB 1RZ7L 3NN8B 2HVJB 4JPVH 1FV1A 1FIEA 4BSWA 4Y19B 4RFOL 1J8KA 3O3AA 4K94C 5J06A 3KHOA 4F33A 5ACZA 2XWBA 1C5DA 4KTDL 5CMAA 1FYTB 5IEHB 2EIZB 1ZVSB 3CIQA 4FFZH 3BHBA 4ZUWA 1IQWL 3GM8A 1PX3A 2E6JA 2HT4C 2B5IB 4GRLC 5DRNA 3RL1B 3VD4A 1F11A 1KG0A 1U3HB 2VLRE 2X1XR 3NIGE 3ZDZE 4D9LH 4EXKA 3KJ6H 3ZE0E 3K81A 1XR8A 5I1JL 4D0DB 1DBJH 3N50A 3P9MA 2W65B 4H1LG 4HBQA 3TLRA 5C8JB 5CGTA 3HUJF 1MWAA 3BRFA 5ENWA 4PJCE 1CD8A 1S7SA 1Y18A 3IYLW 5FF6B 2GITB 1INQB 3L5XL 4OLXH 2BDNH 3S9DB 4KKNA 4LRIC 3V0WH 4S11A 4N1CA 3ARDB 3MRFA 4TULH 1F6AB 4JM2D 1EV2E 4LVOC 5JR1H 2EDJA 1MIEH 5J8OA 3VXQB 4NIKB 2BNQE 3IXAB 5D6DA 2GJJA 4X98B 1CLYL 1YEJL 2HKFL 4L29B 1H15B 1RJLA 3FFDA 3GDBA 1JYWA 2UV3A 4I0PC 4EVNB 3ARFD 3QHFH 3SQOH 5KS9F 1QBBA 1BX2A 3AS2A 1QLRA 1GGIH 5IW1B 3SKOA 4JKPL 1GC1C 4Z7WA 4BYHA 3H7BB 2HFFA 2MQ0A 1NGWA 1NCCH 1M6OA 5FK9B 4Z7UA 5E2UH 5KZCB 4BKLA 3MV9B 4TTDD 3QO0A 5IB4B 5D9SA 4C56A 3MYZA 4TSAH 4JPWL 2AJ3B 1CR9L 4GG6B 5IBLD 1CU4L 2Q20A 4MLIA 1FJ1A 4NRYA 1IBGH 3QZWB 4M5YL 4GMSL 3NCBB 5D7JC 3I9GL 3Q6GH 1OAKL 4AQOA 4L9LA 2F5BL 1D5MB 1E4XI 2AGJH 5L8JB 2F53A 3QNXA 1G0YR 2EECA 1PG7W 3STZA 4HUUA 5IIEB 4XNYH 5AZEL 3CCHB 5I75C 4ESKA 3C8HA 1MFCH 2NY2D 4JFQA 3QDME 3RTQB 1HSAB 2F9BT 3O6LH 4QRPB 3I6LE 4GKSB 3DUSB 5GRVL 1HHGA 5GRYA 5A2FA 5A2JH 4KMTH 3CVIL 3QUYA 4PJ5B 3IDGB 4WFGD 1JZ5A 1HIMH 1YN6B 2ZUUA 5I2IA 5JMOC 2CRYA 1NDGA 1RK1A 4K23L 1OW0A 1F6FB 1YEEH 4NFDA 5E7BA 1VSCA 2HT2C 2V17H 3L3OB 1A6WH 3D0LA 4HQQH 4YDKH 1J5OL 5B39G 3VXTB 1ZV5A 4JO1L 2QV2A 2PTTB 5A2KH 4Z78A 3TA3D 5F6IB 1JF1A 1A5FH 4JO2L 4HHAB 3CX2A 1ADQH 1DSFH 5C0RL 1AD9A 4JPKL 4MSWB 2E5EA 4F9PC 2YUZA 3W11C 5FEBA 3FQWB 3QULA 4PRDB 5J57B 4ZFFB 4Y8AA 1G6RB 2BSSA 3ZKNC 1KFAH 3VWKB 4RISL 1NGXB 3MCKA 1TJGH 1J10A 3P9WB 3AM8A 3WO4C 3O4LA 1RJYA 2Y07L 1FGNL 3PHOA 1LP9E 3F65A 4U05A 3QUZA 1GGBL 4LVEA 1FNGB 4QXTA 1KBGH 2VUYA 4OF3A 3QAZC 1AHWA 1TZIA 1NCDL 4I48B 1KJMB 1WBXA 1X5JA 2H8PB 5I15H 4DAGL 1SY6L 4M1DH 3BPCB 5A3IC 4PRAB 3CC5A 3G04B 1AC0A 2NY5C 5HYJE 3IAGC 1GL4B 2MJWA 4JY5H 8FABB 3GI8H 4XVTH 2DDQH 3ULVC 2VQUA 2K7QA 1XGYL 3D3VD 5FM5M 1LE9A 3QEQB 4CAGA 4DQOL 1CT8B 5DQJA 2AKRB 3DUUB 3W9DA 4XNXL 1V5JA 3OGOE 1MCIA 2NNAB 4F57L 1MI5E 3VXSA 1R3KA 4DN3H 5ECJE 4HX1A 4Y19E 4ZTPH 4IRSB 5C08B 1MCCA 1UM6H 3V4UH 5D7LA 3MYJA 1FYTE 3LEXB 3UTOA 3IDNA 4UBDC 2GCYA 4HZLB 3P77A 5DJXB 3VFUA 5DVLA 5KSUA 4J3VA 5D1ZA 1W8NA 4JM2B 2X4UA 5L6YH 3MRLB 1AR2A 4GBXA 2CKBA 4L8SC 3QXAB 4LSRL 15C8L 1ZHNA 5JOFA 5IK3B 5KTEH 3F7PC 2H32A 1T5XA 4P23D 1P4IL 1IFHL 4HFUL 4U1KA 3RU8L 5SWSD 4PJ9A 1RUQH 4GXVH 2B4CL 5IF0A 3EO9L 3TEUA 2GJ6A 3OKNA 4UOW0 2ZSVB 4H8WL 1IEBA 3JUYA 5IKCA 1KB5L 1INEL 4M93B 3SE3A 1U93A 5TDPB 1U41A 2G60H 1TFHA 4J3XA 2O5XL 5SWZA 4R96A 4HLZG 5E2TH 1XGQB 2DJUA 3PHQB 2WZPD 3F7YB 1INDH 3I75A