4HIPA

Crystal structure of the pseudomonas aeruginosa azurin, h126no yoh109
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQFMFFCTFPGHSALMGTLHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hipA00
2IDSA 2PP8A 3HEIB 1CURA 2FQFA 5B1AB 1NICA 1SF3A 1WA2X 1FA4A 3FQYA 3AG1B 6PCYA 1OV8A 2XVBA 1GS7A 2Q5BA 2HZHA 1CC3A 5B1BB 4N8UA 2XWZA 2VM3A 3T6VA 4JHUA 1AZUA 1QNIA 2EIJB 1ETJA 4DP4X 4F2FA 1J5CA 4YSPA 1BAWA 2XV3A 1PNDA 2YARA 3HB3B 5B1KA 1PAZA 1ASOA 5I6KA 4E9VA 4G7RB 4KO6A 4HIPA 2PPEA 1KGYE 1X9RA 2EIKB 3NJHA 4RH4A 4A2EA 2IDTA 2YAPA 2OV0A 2HX8A 4CSPA 1PZCA 4G72B 1W6LA 3TBBA 3T6ZA 1W6WA 2DWSA 1N70A 3AW5A 1DYZA 1W8EA 2H3XC 3EF4A 3GXUB 7PAZA 3S3BB 5TK4A 4YL4A 3KW7A 3V9CA 1EHKB 2GSMB 2QT6A 3UAEA 4FAAB 3FS9A 3BVDB 4YSUA 1M9WA 4Q8BA 2DYSB 4YSQA 2R7EB 1E30A 3NJMA 3ZIYA 3QPKA 1ASPA 1HFUA 1V54B 3X1FA 1PY0A 3X1GA 3ZX1A 4G70B 1JZEA 1WAEA 2I85A 2ZONA 1J9RA 4F2EA 1SFHA 4E9YA 2XU9A 4DPAX 3NJLA 3NSCA 2BP0B 4W1TA 1ET8A 7PCYA 2WSDA 3UGEA 1MG3C 4DP8X 4KOBA 3NYKA 3EHBB 4BDVB 3NT0A 1J9QA 1UATA 1ILUA 3NJFA 4YSOA 2OJ1A 3MBWB 1FFTB 1GSKA 1PMYA 2XX1A 4A2FA 2VM4A 3FU7A 2I7SA 4GXFA 2B3IA 1V55B 2GI0A 4HZ1A 4YSTA 2J57A 1J5DA 3FSZA 1A65A 4KNTA 2IH9A 1I53A 1IKOP 1BQ5A 2EINB 4HALA 1NINA 3PXLA 1GS8A 2N0MA 1L9QA 2BP8B 1A4CA 1NWPA 3FSVA 5I28A 4ZK8A 2RACA 3EH5B 1JVLA 2CJ3A 3NP3A 2J56A 2WO3B 1IUZA 2FNWA 1J9TA 4UF7C 3OD3A 3NJNA 3G5WA 1JOIA 1AZBA 4BXSV 2JFCA 5B1JA 1JXDA 4DP7X 1ZDSA 3DTUB 1OE1A 3TA4D 2PP9A 1CYXA 1WA1X 2PPFA 3TU6A 1QLEB 2EIMB 1NIDA 3CVBA 1BQKA 4TXVB 2B08A 2AZAA 4BXVA 4KNUA 3WKPA 3QJRB 3NJGA 2FJSA 1TEFA 1BXVA 4GP8B 5AZUA 1L9RA 1F56A 3IEAA 4FA7B 1ZDQA 3UACA 2P80A 4DP9X 2GHZA 2IWEA 3NP4A 2IWKA 1GY2A 4Q89A 1JVOA 5I6LA 4A68A 1SJMA 1A3ZA 4KNSA 3OMNB 5A7EA 3SQRA 1AZRA 2BW4A 2IDUA 4G7SB 8PAZA 3FU9A 2BZCA 1XB6A 5AKRA 1AZNA 1KCWA 2FT7A 3QJQB 1XB8A 2BO0A 1PZAA 3X1EA 2LLNA 3FT0A 1HAUA 5B1JC 3QJVB 3WG7B 4ENZA 2TSAA 3CG8A 4JHVA 3D12B 2UXTA 4E9XA 3CDZB 1RZPA 2XXFA 1BQRA 4AKPA 3ASNB 3QJTB 4HCFA 3CVDA 4P5RA 1BEXA 4BWUA 4NB7A 3PAVA 4P5SA 3T6WA 3N2JA 4KO5A 3H4HA 2AZUA 2BHFA 2DYRB 2FWLB 2NRDA 1ADWA 4YSRA 2BW5A 3UAAA 2YQBA 1SHWA 4G71B 5B7FA 1QHQA 1L9TA 2CAKA 1AAJA 3NJKA 2QDWA 1PNCA 1J9SA 1NTDA 3PCYA 1NPNA 3NSYA 3JTBA 2JXMA 3IE9A 3H56A 5I5IA 5EHFA 1SDDB 2PCFA 5D4JA 2TSBA 2XUWA 1WS7A 2DY2A 3S8GB 2I7OA 5I5JA 3WI9A 5B3SB 9PCYA 1AG0A 3S3CB 1NWOA 3QQXA 1GW0A 4BK5C 1PLAA 3GDCA 1PLCA 3T9WA 3GYRA 1E65A 3L45A 1AS8A 4QKTA 1L9SA 1BXAA 4F7KA 2J5WA 2JKWA 4NAJA 2PPAA 1IC0A 3T6XA 1A8ZA 5I6MA 2XX0A 2GB2A 4A2DA 4YSSA 1V10A 4WKXA 3KW8A 4HCIA 1MZZA 2HXAA 2WO2B 1KV7A 2UXFA 4KO9A 4WTQA 1ET5A 4YSAA 3JT2A 1JXGA 1PLBA 1RKRA 1PF3A 2MTAA 3SBQA 1KCBA 1YLBB 2E86A 1JZIA 3OM3B 1CYWA 4UAHA 2IDQA 5F7AA 1B3IA 1ZPUA 2FQGA 4GP5B 1TEGA 3BQVA 3FPXA 4BWTA 1NIEA 2CALA 1ZIAA 2VSMB 2X87A 1GS6X 1JZJA 1SHXA 3QJSB 2EILB 1CUOA 3TASA 2DWTA 2J55A 2OCCB 1HAWA 2YAHA 1JZFA 3WNIA 2R7EA 1L9PA 2IAAC 2HX7A 5I26A 1AANA 1R1CA 3AG2B 2MRYA 3X1NA 3IN2A 4AKOA 2IDFA 2PP7A 3N55A 4M3HA 2A3TA 4PAZA 1FWXA 4YVNA 4NERA 2XV0A 5PAZA 2VN3A 1AOZA 4CSZA 2BP0A 1NDTA 1RZQA 4UANA 2VSKB 1SNRA 4BDVA 4X4KA 2W88A 3AG3B 2BWIA 2UXGA 5D4IA 1M56B 4GY4A 3AY2A 1ILSA 1MG2C 5I6PA 3PPSA 1ZV2A 3TBCA 3NSDA 1PZBA 1OCOB 1SF5A 2GIMA 1IBYA 1AS7A 4DP1X 3PAUA 4G7QB 4A67A 2YAOA 3IN0A 1N68A 1DZ0A 2PPCA 3NSFA 3EH3B 3FYEB 4AZUA 1NIBA 1M57B 3PLYA 4DPCX 4PCYA 1KDIA 3H4FA 1JERA 1NZRA 5B7MA 1E67A 2GC4C 4YSDA 6PAZA 1OF0A 1E5YA 1ID2A 5AFAA 1EZLA 1VLXA 4AKQA 3FU7B 3ABLB 3C75A 3S3DB 2CUAA 4HHWA 4DP0X 1OE3A 2YAFA 3ABMB 4DP2X 1BYPA 1PCSA 2XXGA 2FQEA 2ZXWB 3OMAB 3UADA 1AS6A 4GP4B 3FYIB 5TK2A 2Q9OA 4DP6X 1A4BA 2IH8A 2BWDA 4QLWA 3X2QB 1AR1B 2UX6A 2FT8A 1XB3A 2DV6A 3V9EA 1TU2A 5ANHA 4YVUA 2HRHA 2FTAA 4A2HA 5I5MA 3FPYA 3ABGA 5IY5B 4GYBA 2VW4A 4A66A 4E9RA 3FQ2A 2ZOOA 1AIZA 1A4AA 4E9QA 1MZYA 4DP5X 1AACA 1AG6A 1KDJA 1NIAA 1IBZA 2VW6A 2QPDB 3NJIA 4JKNA 4E9WA 5FC9A 2QDVA 3OMIB 3T71A 1OE2A 4AX3A 4KO7A 1X9UA 1ASQA 2XV2A 2YAEA 2Y1AA 3CZUB 3IBOA 5LDUA 2BZ7A 3OQRA 3AZUA 2GC7C 2CCWA 2PPDA 5E9NA 4M4RB 2P80D 3WKQA 1SFDA 2UXVA 1OOWA 3CDZA 1RCYA 2HRGA 3NJJA 2YXVA 4HCGA 3WIAA 1OCRB 5D4HA 3X1BA 3CVCA 3DKHA 3RYMA 1ET7A 2VMJA 4MFHA 1JZHA 2ZWNA 1XMEB 3ASOB 4EF3A 2FQDA 1L9OA 3ERXA 4E9TA 1E5ZA 1AQ8A 1TKWA 3QJUB 1KBVA 2H47C 4HHGA 5F7BA 2HLEB 2YAQA 1T5KA 3FSWA 3FU8A 4W9ZA 1BYOA 3SBPA 2XYBA 1NIFA 5I6OA 2AANA 3AG4B 1JZGA 2IWFA 2XLLA 2YXWA 3PAZA 2AFNA 2HX9A 4N4YB 1KYAA 4HAKA 1GY1A 1SDDA 1MDAA 2UX7A 2FT6A 1ZIBA 3WNJA 4YSEA 3ZDWA 3ZBMA 3DIVA 2H5UA 1WA0X 3EH4B 1OCZB 2PCYA 2VW7A 1GYCA 1NPJA 2W8CA 4E9SA 2QPEB 2X88A 4YSCA 3FSAA 1OCCB 3FQ1A 3SBRA 5B7EA 1AZCA 4BWWA 3UABA 5I6NA 2YAMA 3MX0B 4KOCA 1URIA 3U25A 4K9JA 2PLTA 1BXUA 4DPBX 1GR7A 4AI7A 2CBPA 2BP8A 3S8FB 1JXFA 1KBWA 4A2GA 2GBAA 3ABKB 4L0PB 5PCYA 2AVFA 1WS8A 2Y69B
chains in the Genus database with same CATH superfamily
3LSOA 3S5ZA 1D7CA 1J1OL 2AV1B 2WTPA 4I2XB 3HS9A 1TDQA 1IKNC 5GGVL 3RDTC 3EGXA 4QI3A 2IWGA 1ECZA 3VFNB 5KYUA 1RIHH 3MV9E 2ZXBA 2Q8AL 4K8RH 4U1JA 3KLLA 4U1KB 4AGMA 3TJPA 2ZX9A 4NBYB 1T2XA 1U8PB 2G4GA 1S7WB 3GM8A 2J6EL 5I6KA 1IZJA 4BK4A 4OB5H 2J20A 3BGFC 3QFJD 3P02A 3VGGA 3HBPA 5F0PB 5EU3A 1P4LB 4MXWH 1TEYA 3N40F 1J87A 1I8IA 1PZCA 1UD4A 2UWEE 3PWVB 1Q0XL 4WJ5A 4IOIB 2FEDC 2DMCA 4GRWH 4WK2B 1H9DA 4JZJB 5D7IF 1H6UA 4PREB 2E7BA 3ZE2F 2ARJA 2NY6C 2N59A 4NUJA 3SE8L 3T0XA 3TYFA 4AEIH 5LXGL 4PR5B 3VI4A 5T1MA 1RVFL 2VDKB 4N90D 4DQOH 5TDPB 4JKMA 3HPLB 2NTSP 5HYSG 3VH8A 2IANB 4EI5C 2A9NL 1OSPL 3OKMA 1F45A 4JDVB 4XO3A 4I1NB 1BD2A 4JR9H 2VM9A 1NA8A 2WXGA 3ZX1A 2DQFA 4I0PD 5C0EA 1FG2A 1MPAL 4LAQH 4N5EC 3QHZH 4XPGH 2H3NA 1H5BB 2KS0A 4YDVB 3ARFC 2QVFB 4LSRL 3DUUA 5C6TL 4X99B 4F58L 3HUJB 1FVDA 5IB3A 3D39E 4M5SA 1A0QH 3JBG7 5AEAA 3RA7L 5I1EH 3MOQA 1HL8A 1AR2A 1BVNT 3N41B 2COQA 4OGYH 4A6YB 1DN0B 4LLMA 2XG5A 4JW3A 4YXKL 4ONFH 3N50A 2GI0A 2R29A 4YMPA 2P49B 2YXMA 3HKFA 3MV01 3C09C 3QJZA 1I9JH 4X0NA 1A65A 2B59A 3QGVA 2PW1B 1HXMB 3OB0H 3ZPDA 2BSEA 4HALA 4BFRA 3V2AR 1L9QA 3OZ9L 2JH2A 4IMLA 1ODUA 7FABH 2VH5L 5IEHB 1JRHH 3EH5B 3NP3A 3OLEA 3OGOE 5T1JA 3QXUA 4PRPB 5DQJA 3FFDA 3LZQA 5I30H 4YDJA 4GBXC 3U1SH 1CFQA 1LE9B 1G5AA 4YHIA 4CJ0A 1JFQH 3GXDA 4IGBA 1Y18A 3DBXA 2BZDA 1KJ2L 4J1UA 1S5IL 5ITFB 4C4KO 3KXFD 4ENED 2VCOA 2XQBH 4KZEL 2GSGB 1CBVL 3VA2C 5M94B 4JANB 5MP6L 5FLVA 1PLGH 1G9MH 1CR9L 3RVVD 4QF1B 1OVZA 2I9LB 3IWUA 5IOPA 3V4PL 4CU6A 5DMYA 2FJSA 3N1QC 1A6WH 2HMID 3LNFA 4PJ7A 3M88A 4TUOB 5GJTH 3MJ9L 3ARBC 2VLJE 4L8CA 4UAOC 4JGNA 4KHXH 2X2IA 2XVGA 3VFPA 1X5GA 1WIOA 2GHZA 2XPZA 3QAZC 5DJAB 1D9KC 3QO1A 1RUMH 1ZXKA 3ETBJ 4Q89A 1XTLA 5HPMA 1OTSC 4H0HB 4HU2A 3TBTB 5D6DA 3LB6D 3HI6H 1NCCL 5AVXB 3OKMB 2YD1A 3O4LA 4NT6B 4K7FA 4EBQL 2VTFA 5C0EB 2ICEC 2ED9A 4M7JL 4OQTL 5C2UB 2ZUTA 1HCZA 3FT0A 3VAEA 4XNYL 1OAJA 1CGUA 5E6UB 2IOMA 4ANVA 4OD3H 2KQMA 3PREA 3M07A 4MJ5B 4P4KD 5HHNA 2J8OA 1FVDB 1UT1A 2VWEE 3LIUA 4WO0A 2HH0L 2NW3A 5EC1A 5CZVL 3C6LB 3PJLA 4NKQB 4UBDC 1I1AA 3JWOC 2HG0A 3AM8C 3MRLA 3O81A 2DKMA 4O51B 5EU6E 4QUOA 1UEYA 5T5FL 3BSGA 4MKTA 3SQBA 3CU1A 3I6KB 4JFEA 2ZXDA 2CGYA 5F88B 3ZKMC 3HAEB 4LLYA 1YHPA 5DSCA 2X4SA 2AABL 3IFPA 4AIOA 4MA3B 1BEYH 4M61A 3MA7A 3EJUA 4ZUTB 4UU9A 4IMLB 4NKOA 3T4YB 3U1PA 2PYFA 4PGEA 1ETB1 2EKSA 1J9SA 2APWA 2NYZA 3RAJH 1F3RB 5CJQH 2FB4H 4XC1H 1XR9A 1X5YA 4E0RB 1KYUA 3CFNA 3LS4L 3GIZL 3STBA 1VERA 2RJMA 4L4VD 1KT2A 5BZWA 4MMZB 4OZFH 1WS7A 3BZEB 1PTZA 1RJCA 3ZTCC 5J13B 2LGNA 4F2MB 3FUHA 4Y4FD 1LGVA 3LPWA 5CINL 1X5MA 1DEEB 3GYRA 3MLUL 3BH9A 3IDIB 2AQ1A 3EO0B 3S5LA 3HI1B 4MQSB 2APSA 3MYJA 2QSVA 5HYJB 5EB9A 1BVKA 2LE9A 3AXLA 2AK4E 3WJJC 3K1DA 1OOAA 1T4WA 5CUSH 1NCAH 3QB7C 2YA1A 3V52H 1A7PL 5AW3B 1J48A 3VGEA 2ZUQB 4DGVH 5J8OA 2WZPD 1U3HA 1JK9A 3QJXA 3RHWK 5C0CB 2VIRB 3OL2A 4PWJA 2HSIA 2OSLA 2CGZA 3DGGA 2WC7A 2DQ6A 2X6VA 1TEGA 2PWEA 1K72A 5DJXA 4YPJA 1DQIA 3ZQ9A 5AB9A 3OJMB 2X4RA 3ZE1E 2CALA 4IHOB 1KXVC 3RNKB 4RIRA 5DQ9B 5C0JA 5MEQB 4LRNL 1FYTD 1JGLL 3QJSB 3APDA 3U2SA 3OR6A 2HRPL 2VLKB 4F5CA 1TXKA 3VXMA 3NGBB 3FAXA 3WENA 1DQJA 3NCFB 4JFHD 3UZQA 3ZQWA 3QXDA 3WGVB 3CHQA 4CMMA 3V55A 5E0FA 5F7DB 2VDNB 1CFSB 1RIVH 3VM5A 3SZ6A 2K1MA 3CU7A 1HHGB 3MRLB 3N55A 4UQ3B 4H1LA 1AGCB 2AQ3A 4BE5A 2KQNA 1XCTB 4OLWL 5C9KA 3IRZA 4JFEB 1WHPA 4M03A 2KERA 4NPYA 4PMFA 2A99A 2VZUA 5DRWB 3AREC 4UQDA 1NSNL 1PZSA 3ARSA 1U8JB 2ESVE 5E2UL 1AYRA 4PGEB 4LEOB 3OWEA 2AJVL 1C5DB 1T7ZA 3N04A 5C7ZA 1XXFC 1V8HA 3OAUH 2H6OA 4EEEA 4JM4H 4Z1PA 2X6MA 1GHFH 2P7TB 3VXUE 5E9DB 2DQJH 1KYOK 4W9KC 3CZNA 2PWDA 5TDOA 1GL4B 3U36B 3VXRE 2HT4D 3FDWA 1KDIA 3KD4A 4FXKC 5ANME 3L4VA 5B7MA 5IBLC 1LL1A 5AFAA 1KTBA 1PEZA 3BE1H 4OB5L 4FDWA 4OIIL 3FU7B 3QG6A 2VXTL 4J12A 4MXWL 1FGVH 3FFCE 5ELIA 3IAGC 4GKZB 1OKEA 4GRLA 4UB0L 4O9HH 2GY5A 5TGBA 1OT2A 2AEOA 2QQNH 1MFVA 2ZXWB 4RGNC 3SD5A 3U0PA 1O6VA 4IRZH 1L6XA 1Z9MA 1GGYA 2V2TB 4NCC2 5D71H 4JO5A 4U3CA 1HYSC 5E2TH 4AEIL 3MBEC 2AXFA 3LH2H 5F9AC 2EEDA 3RWGA 1JI1A 5CF3A 1EEYB 4FFWD 4HJIA 1G6VK 3G6AB 2D7MA 1O7VA 2ED7A 4ZZKA 4WV1C 4Y1AE 1REIA 1U8LA 2WHVA 1ETZA 2BSTB 1JMXA 1F4YL 2Y2TA 4WQOA 4JR9L 1NBYA 4MA1B 3IS0X 3FQ2A 3PL6C 3STZB 4AC4A 1MZYA 4AEEA 3NZ8A 2QFPA 1FH2A 4XPGL 3ZMNA 1EHLL 3WY3A 2MSPA 2D7OA 4TUKL 3LQMA 4E9WA 3V9FA 3VWKC 5JHDE 3Q6FB 5HI3C 4FZEH 2XV2A 1LO5A 3GMNB 2ZF9A 3UAFA 2OMXA 5I1EL 3OQRA 2GTWA 3ARPA 1D5IH 2A0LC 2B9BA 2E9BA 3RKDD 5KSUB 5JHLA 1OOWA 3R18A 2QSCL 4C83B 1JS4A 1M7DA 1QWHA 1URLA 3NJJA 2DZEA 3IJEA 1OCRB 3PP4H 4ONFL 1CK0H 1KTJA 1IVTA 4AYFB 5BV7L 3TBSA 4QHKJ 3R1GH 5I1JH 5D70L 3ULVD 4N5UA 4N68A 4OU3A 3RU8H 4Z7WA 5CD3A 5FB8A 2Y7NA 7FABL 3R0NA 1I85A 4AE0A 4PUBL 5I1DA 3PYCA 1FE8H 2BWQA 5I66B 3ZHLA 4OCRH 5DO2D 5JO5A 2G3NA 4QRFA 2AJYH 5I30L 1G9NH 1P69B 4D9QD 4OD1L 2VUKA 3IPEA 4NKDB 2X4UB 4G3YH 4NO0A 4I9XA 1GMEA 2BNQB 3S35H 3IBEA 4JCWA 5BW7A 2P8MB 1S9YA 5IBUB 3CLWA 4JFWA 5LUMA 5AVRB 4P2RE 1GY1A 1IFHH 2E75C 1NC2A 1SDDA 1YZZA 1FL3A 2X7LB 2Z4TA 3CIAA 4NP4H 4R2GB 4FNSA 5A2AA 2WXMA 4IU3B 2YLKA 3THML 1TJIH 2BIQA 2O5YL 5FO8A 4LIQE 5EOTA 1QO3B 1SGKA 3QG6B 4PD4K 2PXYB 1A3RH 5GS1A 4PJGF 4LAJH 1X4XA 1ZLWK 2QPEB 1HXKA 2ZQKA 3IDYC 5GJTL 4A7UA 4YSCA 4PW4A 5FCSH 5I1CL 1EAPA 5C0AB 2G2PA 1VB9A 5KSAD 1OO2A 3LD8C 3AS2A 1AZCA 4B9GA 5CEXB 2JXMB 1U91A 4CKVX 1RUML 3CZFB 5AYUH 4PJHE 1UWFA 1RJLB 2XTJE 2EP6A 3UTZA 2E56A 3HI6L 1RFDL 1RY7B 2CBPA 4EUPB 4ZX6A 3S8FB 4Z18A 5IW6A 4DWHA 3AMLA 2IG2H 2IF7A 4HETA 4CL7A 1WICA 3NVQA 4KO9A 3VI3F 4WHYG 1E6JH 2AK1H 4N9GA 2HJLA 3DX6B 4MAZA 4W9JC 3NJVA 1Z2KA 4QMEA 4U33A 3TO4D 1DSFH 1GH7A 1GS7A 4PTUA 4OIFA 4QYOB 5E4EB 2JLPA 1KULA 5GRVL 5EBLB 5E6YA 4F2FA 1J5CA 2DOCA 3I6GB 4PS4L 6TAAA 2X05A 5CKGA 4OJFH 1QRNB 1FO0A 1Q8MA 1PDKB 3V10A 2E9GA 4E9VA 5KBLA 1LEGA 4ZO7A 1M7XA 1NPUA 3Q6GL 1QVOB 2ZCZA 1EDQA 5A6MA 4L8DA 1CE1H 1IBBA 1X9RA 3BVUA 3NJHA 3RWIB 4DGYH 4Z7NF 1JD7A 1I1FA 2A6JB 3C6SB 1HXYA 3TN0D 2QSQA 4PJ8D 1XIWB 1Q0EA 3UZVB 4A2LA 4DN3H 1W6LA 5DHYA 1V3LA 3IAPA 1JJUA 1KSRA 5GGSY 4PY8J 1LWRA 4HEME 2VR6A 4MXVF 5IHBA 3ECUA 3PWNA 3TVMD 4LPYA 3KDMB 3PWUB 5C08D 3P9MB 3CMOH 3C5ZC 2FB4L 3S8WA 2E5EA 3TJEH 2DQEH 2YMXH 3AFLA 4Q4EA 3FT4B 3GMLB 1IQDA 5L2KA 1INDH 4PRHA 1JWSA 5IP4A 5BRZE 4FI7A 1J0JA 3D08A 1T21B 3VCLB 1EFXB 3WXWH 2X44D 4U1HB 4G70B 3MJ7A 4JHWH 1FL3B 1GGIH 3CZKA 2FBOJ 5I9QC 5JNYA 2WBJA 2MKWA 1OGAB 2VZOA 4LFHG 4YX2H 4OD2A 1JYXA 2Q86A 4BGDA 1AXTL 4P3CH 2BP0B 1U8MB 3PQYA 1CICA 1AKJA 2R1XA 1D5XB 5H2BA 3DV6B 3EHBB 3SBWA 3X14A 2J1YA 4HOZA 3KMDA 3TPUA 5CO1A 2ZWLT 4X2UA 3MBWB 2COVD 1TTCA 1XX9C 3KLKA 2FWSA 2DIJA 4WWPA 2ATKA 4UZSA 1PZ2A 1YNTA 4DGVL 2DQDH 4LQFH 5FECA 4G7VH 4WUUB 4X7SH 1S8DA 3CXDL 5IVXF 1I8LC 4HK0B 4JY6B 1H15B 5AB2A 1BQ5A 1CDUA 1QZ1A 2JKNA 3QC6X 5EWIL 2Y5TA 4ZK8A 2PTUA 2CQVA 5HXMA 1NFKA 4BQBA 1NOFA 1FNGB 3UROR 1J9TA 1M2VA 3EIFA 3IU4H 4P8QA 4X6CE 5CLZA 2BSCA 4MMYB 4U6YA 1QFUL 3AWFA 4PLKC 4F8QA 1ZDSA 5E6IA 2Y06L 2PP9A 4R4NC 4UOQA 3QUZD 4WSKA 1JGEA 3FFOA 2OFQA 4U3SA 5E8OB 1FN4A 2H32A 5AKTA 2WD0A 4ODHH 2NCMA 3VB9A 4L8DB 4CDHA 4KNQA 3QEQD 2YPVA 3OSKA 4YAQA 1GC1C 1IAKA 2ADGA 5GZND 2R1WA 3ZHNA 2WXJA 2JCCB 2MQGA 5FW6A 3EFFB 1OGTB 4XCFH 4XVSH 1S78D 3H3BC 1XQ4A 3IDXL 5FF6A 3F5WA 4JZNA 5FM5O 1JV2B 2D31B 4PWIA 2WQRA 2GFBB 1S7TB 3OAUL 3ZDZB 3MRMB 1E3FA 4FQQA 3VSQA 1RZFH 1E2ZA 4LRIA 1VFUA 2NY4B 3OC8A 3KJ4C 2ITDA 4HQQH 4AWJC 1CG9B 1IQDB 3MCG1 5I1AB 1GC1L 2CLVA 1F3DJ 3JTSA 1IGML 3EYSH 3BLPX 4KJYA 4IRJC 3FU9A 3POCA 4LO9A 3QH3B 3CFEB 3VXOB 4P4RB 1KCWA 3DX4A 2QJDA 3FO2B 3SE6A 2QKIC 5DHEA 3RJDA 4MNQA 4HUKB 3OVUB 3KPQA 4W9IC 4NN6C 1OCWL 4UQBA 4KAQH 4PGJA 2NYYD 5DJ8A 1FSKC 2OULB 3HC0A 1WAPA 2YEZB 4U1IA 1FORL 3IKCA 3LXAA 3CPLB 4CMHB 2PO6C 2ZOWA 1AKJB 2AS5M 1PX8A 1FGVL 1QNZH 1MCCA 2F61A 3O6FC 3QJTB 3F6LA 3IJHB 1BAFL 3O3EA 4RGMB 5DJ0A 2V5TA 2OI9B 4NB7A 2QQNL 1CFNA 2WNKA 3L7EB 4P5SA 1JZ2A 1JGUH 5K39B 1ORQB 1T83C 1TVHB 5EPMA 2ZE0A 2NLJA 5JUEH 2NW2A 1GZHA 2VXUH 5D71L 5E2TL 1S3RA 4LLAA 4TV3A 3D51A 3HJEA 1QBLH 4PP2B 5B7FA 1YN6A 2JJWA 4D9RE 4GW1B 3DSNA 4HKXA 4XXCA 1A02N 3T2OA 1BZ9A 1S7SB 2IMNA 1AQKH 3P0YL 4J27A 1ESOA 2Q3XA 3DUSB 3NJKA 5E1IA 4RNRB 3RX7A 3Q13A 4HXAL 3K2IA 5EEWA 3K6SB 1UH3A 2FJFB 4LOUD 4AIZA 1WSST 3ULUF 1T1WB 3M8OL 4FFYA 2OAAA 4BFGA 3MRIA 5A6LA 1YECH 2H8PB 1CYGA 4U6YB 3KH3A 3UGUA 5KS9A 1KJVB 4AG4H 3Q5TA 3QQ4A 2DBLH 2ZCHL 4KKBC 4UQ2B 3VDAA 2OZ4H 3SGJA 4G8GE 5KVDL 3ZLQC 3BWAB 9PCYA 3S3CB 4OLYL 3RTQA 5DMKB 3NPZB 1D5IL 43CAA 3VQMA 4TVPL 4PVMA 2CDFB 4G6FD 4Y9EA 1SJVA 1HHIA 2QGEA 3WNNA 1AS8A 1YC8A 4ZFOL 5BVPH 2XQYA 2J5WA 1G9NC 2JKWA 3PP4L 4YC2C 2EQDA 3V0EA 4MDIA 1WTGT 5I6MA 1LWJA 2GB2A 3NZHL 4L5FH 1F90H 1V10A 4Y16C 5HYEA 2E7DA 3R1GL 1RH8A 3GMQA 2CA3A 1BFTA 4C56D 3PJSB 4DJMA 5LDSA 5F3HA 3VXQB 2J6WA 4M7LT 1FNHA 4WDIB 1N8OE 4YSAA 4JFDA 4MWFA 1L3WA 4S1DC 1G7LB 1XWVA 1PF3A 2MTAA 3MFFB 5EZIL 3SBQA 2ZKWA 1YLBB 1CS6A 2AJYL 2Z9TA 1U33A 1CE6B 2ZUVA 3DGCR 4L4TA 2IDQA 2J25A 3PWPD 4RDBA 2ED6A 2LLGA 1NCJA 2RALA 3P4NB 4M8QB 3TFKC 4KVCL 4LXFA 3EOTL 1UADC 4R5TA 2PYEA 3LN5A 3S0PA 2X87A 3SDCA 4PRDB 3JV0A 1I7UB 2W1NA 1MN4A 1QFWH 2BOLA 3EYOB 3TASA 4NQSB 5DUBA 4GG6F 5MHSE 1TJIL 5DK3A 2ZCLH 5J5EA 1ZGLM 4LSVH 1HESA 4HUVA 4ZW5A 4IEFA 4LBEA 1M3IA 4WHTB 4D8PB 4N1HB 1I9EA 1HHJB 1OP3K 1WT5A 3IGLA 4UOZA 4JJOA 4KJQC 1LM8V 4QRQB 3HHMA 1NGPH 2GI7A 4CUCA 5D7LA 4Z7VF 4AGNA 2NX5E 1AMYA 1QLRB 4OBRA 4NKMB 2HFEB 3F7VB 3GPSA 4E41E 3US1A 4KK6C 1G0XA 2AMUA 1KIUA 3NRFA 3MNWB 5L8KB 3UZEA 3MMEB 3GJFA 4MA8L 3WIIH 3B9DA 2PR4L 4EI0A 3VM7A 4HWZA 4JPIA 1SF5A 1KN4L 1E6JL 2WAQA 3OZKA 1E4WH 3KPRE 1TTFA 5IVZB 4AH2B 5ABZA 1MRFH 3NABH 2P43B 3Q1SH 5DJYB 5LNDA 3FO9B 3EH3B 5AOKA 4EJ1C 1R47A 3P77B 4YUEH 1SBBA 4UINL 1A6AB 4LDLB 4MD4A 1N59B 3RNQB 3SDYH 4TSBH 3VXNA 2EUXA 5DD3H 2G75A 1PG7H 4LARH 4ODVL 1E67A 2WUCH 3NIGE 4KUZL 3HB3D 4XBEL 5DVLA 3UCQA 3TEYA 1ZA3B 4PGZA 3MV9D 4FG6D 5H94B 4B6ZA 4D94A 3PF2A 3S3DB 1XBRA 5CHNB 4OCSL 1I7RB 3DX0A 5HGHB 5EOCL 5L8JB 5ESVA 4FFTA 2XZZA 1A6VH 4Y1TA 5J6HA 4XB8A 5F3HB 3EAKA 3KYOB 4JQIL 3MN8A 4P5KB 2NR6D 2R23B 4EZJA 3C60A 4FC3E 5KOVC 1KJMB 2NXYC 1KIPB 2A74A 4A7GF 5C1MB 2ZX7A 2NUPA 1DQTA 2VDRH 3OGCA 3CMOL 2BS8A 3NN8A 4C4KT 3TJEL 4BFIA 4Z76B 2VDMB 2VDKH 2YMXL 4IGBD 5ANHA 2VERN 5EU5B 2F19L 2EDXA 5ICUA 4G7YH 4TLKA 3NCYP 3QXVA 4WY7H 4KC3B 3QZWA 5TDNA 3RP1A 1DQDH 2WXHA 4X80L 3TF4A 4JM2B 1J5IA 1AGFA 3LZNA 5AKVA 1EO5A 5AAWA 2D4DA 4B3VA 4D7BA 1GGIL 3MBXH 2YJLA 1L6PA 4XCEB 3O45A 5FO7B 4W9EC 3ZZ1A 4ZMXA 4W93A 4AMKH 5KSBE 2Y6SD 3HZVB 4BSVA 4YX2L 3BLBA 4R97C 5K93A 4P3CL 2NT1A 3RWCB 4G83A 1DQMH 2CO6B 4EN3D 2FR4B 5LGKA 4WFGD 1JPSH 1Z0MA 1WITA 1N0XL 3AGWA 1OP9A 3EBGA 4KMTH 5FLUA 2QV2A 3WN5C 5F7EH 1BSIA 4J3OF 4KKRA 5FW7A 3O4OC 4A6YH 4JNXA 4LQFL 3LZPA 1BMZA 1HU8A 4YHMH 5A16A 3FH5A 3QIUA 3TTSA 3BUIA 3O4LD 4AJYV 2WY3B 1JZDC 2ZWNA 4HD9A 4KQ3H 3IXAB 4EF3A 2WGXA 4FMVA 4JPIB 4MVBC 2GAZB 2WSKA 4YK4C 1KBVA 4DGIH 3QCUH 4HHGA 1KTKE 4V2CB 4XMWA 5D5MA 4FNTA 3IU4L 2MFNA 4UT6L 5TJWK 1TJGH 3FQRB 5HI5D 3KL3A 1FFNA 3ULUL 1IEBA 3MLWH 1WFMA 4JDZA 3L1OL 4W4OC 2AANA 2ZUYA 2EH8H 3I74A 2P5PA 2ZAGA 4QHPA 2XLLA 3VW3L 1MCOH 1ZHLB 5D7IE 4BH7B 2X4NB 2P5WE 3ZE2E 4OUUA 2F18A 4F7EA 3SDXA 1T7VA 4HF5H 5TPWH 4ODHL 1UUNA 1VSCA 1Q9OA 4Z95L 3EDEA 2M83A 5EEVA 4Q97A 2RH0A 2EXSA 1DTUA 1KXQE 4G43A 4XCFL 1CGWA 5FCUH 5GXBB 3KR3L 5ACMA 3SJVB 3VXSA 1F2QA 1U2CA 3BRDA 1B0RA 4GT7A 1PZUB 4KJWD 2DM2A 4X6DA 2WXRA 3RWDB 4Z77B 5C09B 3LRSB 4LPXA 1U3YA 1LE5B 4HQQL 3VACA 1U58A 3I6LE 4Q52A 1UYWH 3HLAA 3U25A 4ABQA 1FAIL 3DYPA 2VR7A 4RZCB 3NK3A 5TDNB 1P1VA 2NSXA 1CGSL 5CZXC 2JKTM 2BC4B 4JKWA 3GS0A 2Y69B 3O45B 2G30A 3R7RA 1D2OA 1L5GA 2FQFA 1XZ0B 1MHPH 3SO3B 2X2JA 1LNUA 3GNMH 3H42L 2HG5A 4P9HH 3LEXA 3MRBA 1QNIA 1QNZL 1WWCA 4HUXA 5DVNA 5AVWB 2L4OA 2ODHA 4ZFFB 2AHIA 4IJTA 4XOCA 4BZYA 2D0GA 4YSPA 4R0LC 1FZJA 1GSMA 1JGUL 2A9DA 5FYKU 3UO1H 4CVZB 1ITBB 3G08B 5C3IA 4G7RB 1DUZA 1DVZA 2QV4A 1A5FH 3HAEH 3ECQA 4HWBA 1T20A 2CHNA 5D1ZC 3DSFH 1EPFA 3SDDC 2HX8A 3FXIC 2VQUA 4CVUA 4ZMTA 3V6BR 1QFOA 35C8H 4TTDD 1AQKL 5CEYA 3TEWA 1VAHA 5EU6D 3ILQD 3MRNA 1J8HE 2H3XC 4LKCA 2I07A 2XTLA 3T2PA 2D9CA 5EO9B 2QT6A 1EIBA 4KUCD 5JZ7D 2IO5A 3CLFL 4ZUVA 4Z3HA 3ARDD 4WGWB 4NFDA 2E27L 2JLLA 4ANUA 1PIGA 1WUNT 2DN7A 1EWHA 4J3WA 5D1QC 2DBLL 5CCKH 3MREB 2OZ4L 1PFOA 4Y9GA 3X1FA 3ZYZA 1PY0A 3PV6A 2DM7A 4PLJD 3EJSA 1U4EA 1KIQB 3FU0A 5CBEA 2ZONA 3E3QE 5B38A 5TF0A 2WTOA 4YNYB 1MHCB 3D3VE 5BVPL 1KTLA 4RGNE 4M5YH 5DWUH 2CGRL 3N43B 3NA4A 1ET8A 2A77L 4LU5H 4UTCA 5EUOF 2NNAB 3KBEA 2X70A 1C16B 4F9PC 1ZJBA 3AQXA 4GJTB 1MXDA 4P9MH 4PGDA 1FFTB 1PMYA 1F11B 2XXCB 5DJZA 4YBQC 1DFBL 4A2FA 3HE7C 1EXUA 2ZZUT 3FRPG 2DJSA 3CCHA 4NQXA 5KANI 1E9OB 4ODUB 4YDLC 3AAZA 3D0LA 1RLBA 3HLAB 4PJDF 2GEEA 5JPMB 2FO4B 4FQ1L 2A9MH 5H4YA 5T1KB 3RIAF 3LVTA 4MA7L 3IDMB 3RUGF 3FSVA 3GI9L 3MODH 5D7SL 1F58L 4MJ4A 2HYMA 1TLKA 1DQKA 1XGQB 3TWCL 1BMGA 3GSQA 4UF7C 3S35X 3MV7E 2DQUH 4GRLD 3G9VA 1I3UA 2XPYA 4J3OC 5D6CA 4G9FA 3O3DB 3RFZC 1UT9A 3DVNB 1S9XB 2X2HA 3BAKA 3DOHA 1V27A 4CGTA 5KANG 2BVTA 2C7FA 4OCWH 3ZKXC 5C0DB 2P46B 4UQIM 5KJ4A 4X98A 3QPQC 4QAMB 4HWNA 2WK2A 2V2XB 5B8CB 2H2PD 4G1MB 4Z7OF 4JG0L 5KSVA 3VG0H 1OAXL 3FUDA 3B7UX 1G87A 2CLRA 1H0DB 4Z7QB 3MLXH 4DCQA 1NBZB 5EH1A 3QIBB 1S7VB 5EA0L 5KW9L 2VN6A 4WTZG 3WIIL 4P2YA 1F02I 3QJHB 4PWKA 5IFHH 3WJMA 4B9CA 5KN5B 2E7HA 3WUWB 4DSYA 5LNEA 1VENA 4X8CA 1RZIA 5EORH 2EE3A 3FCSA 4MHHG 5A7EA 1L9NA 3L2LA 3F3HA 3NZUA 3H7BA 2VJXA 1OM3L 1MNUL 5HHMD 2OMUA 5FDYA 4BZ1H 5K5YA 1KTLB 2OQJA 5D2LA 5EOQL 2VDLL 4FABH 2XN9B 4NWUH 4EVNA 2WJ5A 2WGNB 2X70B 3MLRL 3TTYA 1KPUB 2WINA 1JGVL 3BISA 2NY0D 3GIVA 3UO8B 1LEIA 4JO1H 1G4MA 3SPVB 1CD0A 5DD6A 3KPOB 4Q6KA 3NK4A 2DWDB 1M42A 4NO0D 4XGZA 1URZA 3TN0B 3PDGA 4Y5XB 1ACZA 1T6VN 3OV6A 3D0LB 4PJXF 4G71B 4Y19A 3BUYB 4Z7UB 5AQ0A 5FGRA 4FYSA 2Z35B 2OJEA 1SVBA 1EGJH 4BSWA 2ZP8A 3WDJA 4GOSA 5CJBA 1FRGL 4NBXB 5F72S 1NPNA 2DTSA 2BVUA 4HBQA 1NLBL 1XCQA 4N2LA 2FHCA 2ADIB 5I5IA 2VMCA 2R4RH 2MCMA 3WIFA 1RZ8B 5EBWB 4IU2B 1MWAB 2EXYD 2TSBA 1EVTC 1HL9A 3UL4A 1R5VB 4IBYA 3DROA 3EH1A 2XETA 1X4YA 4L8SC 4F91B 5DYOA 4B50A 5F7EL 1UH4A 1HDMA 4ANWA 1SOQA 2ZUXA 4X98B 5D7JA 1E6OH 2CUIA 4V1DB 3GHBH 1NAMA 5SWQA 5DHVH 1BVOA 3KNBA 4KKCC 3BEWA 1IC0A 4JHBA 3T6XA 5BUPA 4K55A 1I82A 4YHML 4A2DA 1T1ZA 3BPCB 1TCRA 1IGFL 2ZJSL 2HLFD 2XJKA 2ZICA 3ESNA 1BFSA 1NMCC 3ECBB 2X1XR 4S1SL 4CU7A 2EDKA 1C08A 4K71C 2A1WH 4KQ3L 4YPGB 3PGDA 2IAMA 4K5NA 5TFSL 2XKUA 3WJMB 5IVNA 5D9SA 3IGFA 1KN2H 5FYLD 3CQPA 4C59B 1G7IA 5BQ7A 3HHSB 3IYLW 5JDSA 3KJ6L 1F1AA 4EIZC 2FWUA 1OP5H 4GG8A 4QTHA 1CIUA 2G9HA 4BJLA 1MFBH 1QPKA 4PJCF 4XRCB 3K71B 1JZJA 3H3PH 4HJEA 1ND0A 2HLAA 2EIEA 1IGTA 3HN5A 3UG5A 3BPLC 4QRSA 4TSCL 1A7OH 4FXGB 4O02A 3V5DA 1AH1A 2G3MA 3U6XS 5D2LB 3LZOA 1ZGLB 3HBZA 2BNRE 4U0QB 2F7PA 4GKSB 4P2RD 2Y7OA 1KEGH 3JYCA 3QUZB 1KGCE 5ISZA 3G5VB 3R4DA 4RAUB 4EI6A 2DICA 5FCUL 4MD5A 2F7OA 4TQ8A 3JTTA 4HJTA 3HS0B 4K0OA 1JN6B 1JNNH 3CC1A 1JRHI 3IJ7A 2A2QT 3T1WA 1TFHA 1ZTXH 4N0FB 5L2KD 3GTTA 2XICA 4PRHD 4FERA 1ZGLP 1XGRA 1W9XA 1MCWM 1UYWL 1AHMA 1UQSA 2JB5L 3E8UH 1INEH 2VN4A 2JTDA 1BXXA 3G3LA 4RMRA 5I6PA 4EUPH 3SSGA 2QADC 3PDDA 2WBJD 1FPTH 2JCWA 2FJGA 2RB8A 1OSEA 1NLDL 4Q9RL 2XTJD 4A38A 2V33A 2YSTA 4NYLB 2VXQH 1N68A 3QUYB 3HJ0A 1CICD 4WKZA 2ZAIA 5E8EA 2KPWA 1UOLA 2FWOB 3GNML 3TC9A 4XBPB 1AC0A 3FYEB 4AZUA 3BYYA 4ETQA 5HYSB 4GXVH 5DZPA 2F15A 1Q0YL 2X9XA 4GW5A 1BG1A 2W95A 4M7KH 4F9LA 3CTTA 5B1CA 1HINH 3L1FA 4JO2H 3D7PA 1OB1B 2C5DC 5D7JB 4NNYB 3T4AB 4YSDA 5FHBL 1YEIL 4PJIB 5EC2A 3JWDC 3BZDA 2AQPA 3UC0L 1MRCL 3W39B 1TCRB 1FNSL 1M1XB 4J3UA 4PJ5A 1T0NB 1C08B 4AYDC 3X3GL 4MJIB 4ZX4A 1MVUB 1VKXB 1Q9KB 5T3ZH 4YLCA 4YHNA 2VR4A 1TJHH 1QUNB 2YGVA 3O2DL 2ZOLA 1E4XL 2XZAH 4R4FL 4L29A 4QRPE 5JDSB 2FT8A 4LP8A 2XWJB 3JWDL 5F3FA 3QUMH 1RUQH 4PJGE 1Z3GL 4YVUA 1GIGH 5E6ID 5DEGA 4OM1H 3W57A 1WRFA 1DL7H 3FT3B 3QQ3B 4HUUB 1MCIA 4JN1L 4LPVA 1HE8A 3CFJA 4LCCB 1CLYL 5CBAA 1QBBA 4H26A 3ZT7A 3T0VA 4UTAL 1LMKA 3BH8B 2YUVA 5F1IB 2V5RA 4LU5L 5ENWB 5DC0A 1OF2B 4ZO6A 5J7CC 3WTXA 4NZJA 5IMMB 1BF5A 3F6JA 4MQ7B 1NANH 4MBRA 2WP3O 4LK4A 4M62L 2AAAA 1BREA 3U2JA 2A83B 2GJ6A 2RMNA 1MAJA 1QMUA 4P46B 4P9ML 4B60A 5KJ7E 1AQHA 3TIDA 1LK2A 4U4BA 3ZHFA 4HS6B 5EEXA 5HYFA 1BBDL 4IS6B 5D4HA 5BMFH 1YUKB 4TVPE 4Z0XB 1UCBH 1JF1B 3EBHA 2H4EA 5KJRL 3FQUA 5CEZD 4WEMB 2R4SL 4BFBD 3REWB 1OK8A 1XMEB 4MNQD 5IMOA 2ICES 2HWZH 1BPLB 3A4AA 4IRSD 4F7MB 1O7DC 2CKNA 3QIWA 1GOFA 3K72A 2X41A 4XP6L 3S5YA 4NZTL 3A67H 2FYVA 3SGDH 4Z7NE 1JPGA 3NSXA 4LSTH 4DN4L 1X4ZA 4LNRB 3CX5K 1J1PL 3TLRA 3K5SA 3GT6A 5E8EB 2OP4L 2VITA 2MEJB 4QRBA 1OHQA 3FU8A 5D2NA 1O75A 2NXZD 2R0WH 5I6OA 4Q6IC 2GJZA 4G59C 3TBVB 1NMAH 4AENB 3QI9D 4LLUB 3UIYA 2AFNA 5AVSB 1II4E 3DWTA 3OKOA 4E42A 5E24E 1NOLA 4ZTOH 5HHOB 4N22A 3QDME 4OZFG 3GSVB 4UNIA 1W2KT 2X6CA 4G5ZL 4P59H 5F3BB 5IB4B 1EK3A 1MRDL 2IBZY 1I7TB 1D6VH 1M71B 3T65A 2BVQA 3GMRB 3K46A 4K94H 1XH1A 2BOBB 3U0TB 4RISH 1TJMA 4OUOA 1OTUD 4EZKA 2HVKB 4JFYB 1GJUA 2JVUA 3Q7JA 1O7SA 1YO4A 5AB1A 4HLEA 2VAJA 4JAMB 5LVEA 1XH3A 3BP4A 2RAMA 1KTDA 2VDOB 3AADB 5DFAA 5ERWA 4F33A 3PP3K 1DJIA 4HPOL 4OZHA 3MLTA 2AXHA 32C2B 2AVFA 3CFJB 3LZRA 4IIQC 3WEXA 4D3CL 1UENA 1LK3H 2BFVH 4XZUB 4LQ1A 3KHQA 2J4WL 4X9GA 1SF3A 4HIJA 1FA4A 5IVXE 2D2CC 2ZP9A 5G2NA 4E9LA 1U93B 5LJYH 3JVGC 2EYSA 5GRUL 1TOXA 2J44A 5B1BB 3A6CL 1XDTT 5C0GA 4HS3A 4X8GA 1RZJH 3SYOA 3ME0B 3RWJA 2FBRA 4DZ8B 4JFDD 3HB3B 1LK2B 3MV9B 1DVYA 3UTQB 3C5JB 3IU3A 4BUHA 4L4TD 4P2OA 1LO2H 1UWXK 2C1OB 1TYJA 2X3AA 3DMMC 4KFZC 5KVMC 2IDTA 2W60A 2FL5A 3W5MA 1V7MH 1A4KA 1OHZA 4Y4HA 4AYGA 4G72B 5DVPA 3SDCD 1VJSA 2R2HA 1VZIA 3FHEA 5ABDE 1H6TA 4J2QA 4PB9L 4XCYB 1T3FB 2G60L 2QR0A 3UGXA 4DW2L 3FB6B 2UWEB 2ADFL 2BHUA 5DS8B 4YFEA 1QR1A 2FDBP 3PWLA 4CC1A 5I6XB 3BVDB 4BBWA 1YY8A 1UA6H 2OMZA 4ZAKB 3SKJL 2ZOKA 2EDHA 3QNXA 2WV3A 1WE5A 1CZ8L 3UEQA 1FNFA 2W0FA 2AXJA 3HC2A 3KPPA 3RE0A 1TVDA 3SDAC 1IJNA 3U9PH 5D7LD 3FTVA 5IW1B 3POHA 1LMIA 1WF5A 1E6OL 3EXJA 4NC1C 1GAFH 3GHBL 4EN3B 4HJJH 5F6IC 1CTNA 1SRDA 2Z4QB 2KMWA 4Y5VB 2YBRB 5T5NF 1FAKT 3QJFB 1MDTA 2HT3D 2FX9H 3Q0HA 5HHPA 4FNPA 1JCKA 5FK9B 3D39B 5L4MA 5DD1H 1ZLVK 2IBZX 5ALBH 3WXVH 1KN2L 3D1MC 1SVZA 3H2WA 4KVPA 4Y1SA 3A3YB 2NY3B 3K2UL 4Q9CA 5KYXB 4M9PA 2LT9A 1I8MA 4WGKA 3BEVB 2AQ2A 4Y88A 4ZTEA 1ED3A 4JPVH 5DFVD 1Q94B 4N6QA 4N8VA 3BUQA 2ZYSA 2Z7ZA 4H40A 2J88H 4PJFF 5DMGD 2XA8H 5KYWA 4X6BB 2PNDA 4F7PA 4UM9A 1LDPH 5I28A 4HPYH 1J0KA 4X4XA 1WVZA 3T8MA 1W16A 5GRXG 1UD5A 3O9WA 1FV1A 2DEXX 3PABB 1NEUA 3ZGIA 2PWGA 3N91A 3PPEA 3HN3A 2EYSB 4JJ5A 4QPEA 3BJ91 3U9UB 1U36A 4O2EA 6FABH 5B1JA 2HKHH 4F27A 3AT8A 4YFLF 2GSIA 4R3SB 4KQ4H 3C60D 2KDGA 3H9YA 1CYXA 1QR4A 4RMUA 1DVUA 5DO8A 1OAYL 1JAEA 3BOVA 3IRCA 4YBLB 4P2QA 1RK1B 1ZT1B 4YR6A 1GGCL 3P4MB 3APNA 2ZYIA 2F0CA 2BINA 5LBSL 2WCPA 3RJOA 5TE7H 1INEL 3NJGA 3O3BA 1BXVA 1FLRH 3I9AA 5DK0B 2R2HB 4ZFZA 3ZXAC 2XYCA 2R9HD 1FPTL 5DZNA 2OL3L 4WIQA 4TNFA 5AB0A 1NEZG 3L5IA 3NCCB 1N6VA 2VLJB 2VXQL 4KXCA 3G5ZA 2VGLM 1TR7A 1MI5E 2M2DA 4G7SB 3D87B 4JPWL 4WW2F 2EIZB 5AKRA 1AZNA 3KPRD 1KBKA 3KS0H 3QHFL 4PB0L 3WYRA 3QUXC 1HINL 1AO7E 1J0ZA 2R0ZL 4JO2L 1S9KC 3VE0B 2FZ3A 3CG8A 3QIUD 1A47A 3LHPH 4ZD3L 2C9SA 3SZKC 1T2QL 3SKNA 4ZODA 4KI1A 3FOMB 3QQDB 5LBGA 2HKFL 3RBGA 3HKZA 3NIDF 1NL0H 5ESAB 3SKMB 3OPUA 3DIFA 3NUKA 4JFQA 4MS6A 5T3ZL 3QDGA 4JFFE 4GG6E 5G5DA 4TNWF 2DYRB 5B3NA 1KCSL 3N1PC 2XZAL 3ZTJH 3UAAA 1BAGA 5EU6B 1TPXC 3IAQA 4NZUL 3QUML 1QHQA 4WI2A 4HZLA 3E38A 3K6IA 3BAYA 5F7YC 1KNOB 5A3ID 2DIEA 2H0FA 3RGVC 3NCBB 1PNCA 3UERA 4M02A 4QXGH 1F1GA 4QHLA 3B7SA 2GUOB 3S48A 1MFEH 3UMNA 4ZS7L 4Z7VE 3KPSE 4WU5A 4Y2OA 2R15A 3ARDB 4LL4A 3O9WB 3P54A 3BAWA 2IV8A 5K59F 4UTBL 2WCGA 3ZR5A 1MUJA 2NY1B 1DUYA 2X4OA 4O2EB 5D4JA 1EHXA 4ZDHA 5BXFA 3VXSD 5AWNH 4X83A 1MJ8H 2R56H 4L3EA 4YS4A 1JNJA 4WLCA 4KZDH 3ECWA 1SOXA 4JVUA 2HTKD 3VD7A 4BK5C 2W65A 4Y2DA 4L1BA 4G11A 2OMVA 3FCTB 3L45A 3V7AE 1P7QA 2KHAA 3SOTA 4DERA 1WUZA 1UCBL 3GDBA 1OW0C 1Q90A 3BCFA 2AP2A 1NFDF 4WKXA 4IBVA 4L9LA 3CSTA 2HXAA 4S0TD 3KEHA 1VFMA 2UXFA 4L5FE 3L95B 4XP1H 3UTPE 1B4RA 3CVHL 4PEEA 4XN4A 4MJ6A 2WQVA 1ZHBB 2X4PA 3BIAX 2IBBA 2AK4B 3JT2A 4HMEA 4L1DA 4U6HA 2X09A 3IWVA 1NDGB 1L0YA 1QA9B 2IOOA 4ICWA 4DVRH 1NUNB 1PEWA 4R5VA 2QVTA 4CW1B 4UAHA 3OXRA 3QXTA 2FD6H 3TBWA 2FQGA 4WO4B 4NI6A 3WGUB 5KZCD 1SHMA 4BWTA 4HK3N 1ZIAA 5MENA 4YHLH 5HHQA 4NUMA 4RRPA 5EZJB 1U8NA 3HRZB 4K94C 2EILB 3OKDA 4HIXH 4XPAL 4ZTOL 1BF8A 5C0RL 3ZE1B 3BMWA 3GJEB 1JZFA 1R24A 1AHWC 3WKNA 1IM3D 2AITA 2P5WD 4J3VA 4H20L 2HX7A 1BVLA 3TBYB 1JNLL 3VYNA 2I9TB 1D6EB 4HIIB 1H9VA 4QR7A 3OKEA 1RAMA 3QUHA 1HHHB 1PSKL 3H54A 4GFTB 5I76A 4XZ4A 4H8HA 2UVEA 3WO4C 4AKOA 5J0BA 2IDFA 5TF1H 5FGSA 5C97A 3BW9B 1I8AA 4K94L 5IK3A 2X1WL 1HSBB 4O4YL 3VWJA 1MCHA 2P44B 5DZAA 1A7RL 3MV8A 3UBXA 4U6VH 4PIRF 4X9FA 3AG3B 5DRXA 3F65A 3QDHA 1G7HA 2BY1A 4HV8A 1RZJC 4WNSA 3EGSB 4DETA 1D7BA 1F6FB 3MR9A 5JIPA 3L3GA 3SE4C 5EDSA 1QPXA 1EJ8A 3CX5J 4L0ZA 3I6LD 1IBYA 2ESVB 2BFVL 3OKYA 1UTDA 1K9TA 5DMIH 2D3NA 2YN5A 3P1VA 1IZKA 5KVFH 1GZPA 5HVHB 2VDPB 2PPCA 3P11L 3I02A 4M6NH 2R2EB 4UM8B 4XMXA 2GT9A 3VXUB 1RZJL 1UM4H 2I60H 3TCTA 5IV2B 3S4SA 3MKGA 4LVNC 1K5NA 4AVIA 3TT1H 5JLZA 3VXRB 3GBML 1EUTA 4PVBA 2XTSA 3GHEH 1TQVA 3QARA 3T3MB 4DAGL 1R0AH 1BZQK 1CXFA 5ANMB 4MB5A 3LDBC 3TNNB 1YEKH 4NRXA 1MLCA 4G9DA 1UXWA 3ABMB 3GK8H 4I0PC 2Y3AA 1YC7A 3DXAE 4WNQB 4HH8A 1H3PL 2GABA 3FFCB 5DLLA 2IGTA 1G43A 4WW2C 4M7ZB 3KPLA 4GMTH 3OPZH 1FDLH 3VRJA 4G9FD 3M6DA 2MOQA 4NNXA 1I8UA 1RURH 4LHUG 4OFVA 3PXJA 3D4ZA 4PJEA 3TBWB 5T1DH 4DF9A 3G04B 4K3GA 4ELMF 1YPZF 2AEPL 2O6FA 4KBPA 2G5BA 3FJTA 5EZLA 2OTUB 4Y1AB 1XGTB 5E8DL 2X1QA 1R5WB 1S3KL 2IPTH 1A14H 2VW6A 1UZ6F 3M7OA 1NGYA 1U2YA 4J3SA 1KMGA 2BJML 1GAFL 1K2DA 2QPDB 3NJIA 1JPTL 3T71A 2WVTA 5CLTA 3KG5A 5HYQB 2FBJH 1ZV5A 5C0IA 4PWGA 1MCPL 1W72B 1PS3A 5GSRA 5HJGA 5JHDB 3TEXA 1SJHB 4RGND 3U4KA 5HJBA 3RFRA 5C8JA 2UZIH 5L9DL 4HIHB 3MBED 2VSDA 2NY2B 4HCRA 1OAKH 4QNPE 4PY7A 3UBXI 3ULVH 2HCZX 3VB8A 2QGBA 3R06A 5D1ZI 1VGKB 3FQTA 3IF1A 5CU5A 4ENEC 5J9PA 4AY0A 5F9WC 2ZSVB 2BDNH 1L9OA 3E2HC 3PL6D 4GUQA 1AQ8A 5I0VA 3INOA 3K0YA 4NPKA 5DZOA 2J8UF 4X5WB 3S37L 3S36L 2C3XA 1GZPB 3K74B 2HMIC 6FABL 2XVLA 3I02B 4PRBA 2VUOA 4ZYKB 3E9UA 5EIIG 4AYSA 1QBML 4XC3L 5I18H 3QRFM 1AIFB 2D73A 2QQQA 5I8EB 3MJWA 1TZGH 1C1EL 3A4FA 3U6RA 1CDBA 4EDWL 4Y19D 3S4SG 2Y36H 2HUEA 3LB6C 5AW6B 3MUGB 4YN3A 1SQ2N 3D85D 3V7AG 2EIBA 1EUUA 4U7MA 5AVUB 5TE7L 4LL1A 1MJ7L 1N12A 1X9QA 4QHMA 2IH1A 1DANU 3V5HB 2CXGA 3E6FA 1CLOL 3ZDXF 3U79A 1RHHB 3IXTB 4OCXL 4JN2B 4P4KC 3QEUB 2BVOA 4TNVF 5FOBB 1R46A 2C3VB 1EMTH 3H9HB 3U30B 4JMNA 1DN2A 4BWWA 1PD0A 2CJUL 1JPEA 2ZUWA 5EUOE 3VD5A 5GGRA 2G2RB 2LTQC 4PJEB 1OSZB 3L13A 1ZSHA 2D03H 3EFOA 4AIXA 1GR7A 4AI7A 4EOWL 3D0VB 5ICXA 5ACLA 1MFDH 3AWGA 4PJHB 2G5BB 2XTJB 3WSQH 4BKSC 4AQAA 4BKTC 5TE6H 5IQOA 1IGYB 1NICA 3WTTA 1RERA 2OMNA 3LHPL 4PJDE 5ICYA 2EDNA 5DDHA 6PCYA 1S7XB 1TT6A 1QSEE 5LG6A 3ESOA 5DD5H 1VEMA 1IAOB 1UJ3A 3DJ9A 5L6YH 3NCEB 3RUGE 3L4UA 2IAMD 3O8XA 1CDGA 5ACZA 1CT8A 4JDTH 4QHNB 1IQWH 4IBQA 1RP8A 3RGBA 4G80A 4UDTB 1JHKL 4JG5A 2IADA 4C55A 3GSWA 3V0GA 4FP8L 3GSXB 4C54A 1NC4A 4AQEA 3WU1A 3TZVA 3L3OB 3JWNH 4Y4FC 1XGZA 3C9NA 3GBLA 4QRRA 3D33A 3WFEH 3UYRL 2EO1A 2MCAA 3ZO0A 2Y7MA 1DYZA 4QXGL 1Y6KR 2ITFA 3Q06A 4OT1L 1QFHA 4YL4A 4B5ZA 3H6JA 4J3OG 1PX3A 1N18A 1F6AA 3NH7H 4AJ0A 3TIEB 3L3DA 4Z7OE 2GIXA 1D5ZA 4LF3A 5LKNA 1DDTA 4FEMA 4HHAB 4UMGA 3BD5A 5IHUH 4Q9QH 1A6TA 3EYUL 1G1CA 5ISZD 1E30A 2NY7L 3KGUA 4K2UL 1JNHA 2FSEA 2IH3A 2WQAA 3N85L 4F8OA 3NA9H 2H3KA 1XVSA 3FCBA 1CQYA 1LP9F 3BVXA 4HT1L 4KZDL 3MA9L 1I9RL 1S5HB 1WAEA 5BRZB 1RZ7L 2XNAA 3TA3A 3CHRA 3TEZA 5IJDC 1SFHA 4QGYA 4B96A 2CDGB 2V5MA 5FGBA 2ZSWA 3T2NL 1BOYA 1FG9C 2WSDA 3L9EA 2C9RA 5J12C 1KCKA 5D96B 1T89C 4BDVB 4HGWB 5JHMA 2WLHA 4OZIA 1XFPA 5IWLC 5L88H 1SDYA 4OLZL 3HG1A 5DZLA 1IM9B 4OLVH 2CHWA 3DPDA 2FUQA 4TVSa 5BRQA 2ALWA 3D0AA 1FZKA 5EBMA 3GZPA 3DK2A 4HZ1A 4ZMQA 5FYJH 4RVBA 2YD3A 1J5DA 4OZGF 2YKLL 4IRSB 3DVGB 2C1PB 1UXLA 5D1XA 4Y5YC 2VQ1B 3BWUC 4LPCA 4ELKB 4G6JH 4YHLL 2NQ3A 4UUJA 1FVCB 4PJXE 5ICYB 4D0BA 3X11B 5EG6C 3HZMB 2WNXA 5CN3A 1IE5A 3UPAA 2G4EA 1HEZB 4PJ5D 2J5LC 4JFXB 1JYVA 2Z91B 5K69A 5BOPA 3PAYA 2DQGL 3JUZA 2ERJB 4X6CB 3GB7A 1F2XK 5DT1L 4DEUA 1OE1A 3RZCA 1AXSB 1VCBC 4HOMA 3C8DA 4RLDA 4MCYA 1CT8B 2MKLC 3LXCA 5HGDB 4HH9B 1BM3L 2QTVA 3F12B 4LDOB 3U6XA 1VRSA 2FJHB 4NZRL 1O7DE 3H53A 2WBKA 4QOKA 3V4VB 1FI8C 2AZAA 1OTTD 2HT4C 4OKVA 2ADJA 4JFSA 1XF4A 2R2BA 3F85A 5D72H 3UJTH 1QRKA 5CIPA 2O93L 5CD5D 3LEYL 2P8PA 4AK1A 4J4PC 4FA7B 1HKFA 4PBXA 2OYMA 2KC0A 1VADB 2CDEB 3KWUA 2BHZA 1TVBA 2WP3T 4P57A 3OR7A 5E5UB 1FVEB 1AGDA 1MFAH 3BKCH 3GFUA 5I6LA 4ONGH 1BX2B 1ZT4A 4A68A 3X17A 4HJGA 1TTBA 3D2UB 2CKBB 3II3A 1AZRA 2IH3B 4XXWA 1GCFA 2GJ6D 5E2VH 1XB6A 1P9MC 2BIMA 1UWGH 2J8HA 2I60L 3WY1A 1A21A 4XPTL 4FFWC 4PV9B 4APQB 1N3NB 3GHEL 4MRBA 1WG3A 3WD5L 3ALWA 2HFFB 1BF2A 1EXGA 3CH1A 4DUXA 3FT2B 4NS0A 3RPKA 3L3IB 2GYSA 2QPSA 4LCWD 4LDCA 4Q4IA 4TOYH 4PJCE 1VGEH 2XWDA 2AF2A 5DI8B 1QW9A 3T04D 4F8PA 1BEXA 2H7WA 4KHTL 2Y7LA 4RWYL 1P5VA 2ZXEB 5BUGA 4OGXL 1YNLH 4UIKH 1NMBH 4FQHB 5HY9A 5EUKA 2AKRA 3LTVA 3Q2NA 4HLZH 4NZDA 2CBOA 4HBCH 1P7BA 3NAAH 5LWYH 1XBDA 4NNPL 4ODXA 5MEOB 4NJAH 3TS8A 1D5MB 3U2IA 3RKDC 1YEFH 4IRJD 1QG3A 4GRMA 2ZWZA 4NHUA 5CLYA 1A7NL 4KPHH 3BAJA 2EC9T 1NTDA 4RMBA 3LKOA 3GSNL 2BH0A 1A14L 4JZOB 4GBXA 4PV8B 4XPBL 3RDTB 2P1YA 3QULB 1AGBB 1NAKH 4K3JH 2VRKA 3T0AA 2B1OA 4H0GA 3RILA 1ROCA 3GEWB 3ULVC 5FA4B 1WTLA 4LCYA 2D3LA 2XUWA 2V7HB 3O6FD 1NCBH 1QQDB 5F9DC 4GUPA 4L3CA 2FLBT 3AB0C 2XOTA 3HG4A 2NUTA 3BGFB 2XA3A 1PLCA 3GDCA 4G8GB 2VQ4A 2UZIL 4DVBB 1G6RH 2K3TA 1IKFH 3U7AA 4WWID 2EABA 1E4XI 1NEPA 4AL8C 3QA3B 2X42A 5GS2D 1KB5B 1P7KA 3NPSC 1YMME 4N9OB 2AGJL 4OKVB 4TSAH 1J7VR 4D0DA 5E4IA 1MJJB 5BO1L 4HUMB 4AGLA 2NY6B 4E5XA 2KDYA 1Q72L 3FQXB 3BHBA 5TQ0H 4M1CD 2LAGB 1OANA 1NCDH 4FQXC 4ZPTA 4EI5B 4AL8L 1U6AH 2CCLA 3IRPX 5DA4A 2UZYB 5EN2A 3P9LA 4QHUB 2GPZA 4NQDA 2BFGA 4NJ9H 1IEAA 5KSAC 4BKLA 1SY6A 3ARFB 3S37X 2X4QB 2DWTA 2OCCB 2JMRA 3ATEA 1SXCA 2WKOF 3B9KA 3WNIA 2R7EA 4JRFA 4Y4HD 4YDKH 3ML8A 4ZUUB 5I2IA 2V7NB 5IR1B 3QORD 1UVQB 1PPIA 3QRGH 2CO7B 2NSMA 4D9LL 4BM7A 1N0LB 3KHOA 3MGTB 2FX8L 2MOVA 3B8YA 4P5TA 3ZK0A 5F7NC 5GRVK 3EG9B 3HE6D 1JPST 1OEZW 2R39A 4OFQA 3NCMA 2FK9A 4PU2A 4JRYE 3TO4C 2B1HL 5D7KD 4ZUWA 1YYCA 2XWBA 3C09B 3HMWH 4P3DB 5EUKB 3UTTA 2Y07L 5DRNB 1ONQB 2MNWA 1KJ2B 1AY1H 4JVWA 3C5SB 4OM0L 2NX5B 1RZKC 1F1DA 3B83A 3AY2A 3GMPB 3O0RH 2Z64C 4I85A 4F7CB 1MG2C 2C7UA 3UBGA 4Z3GA 3LEVL 1KIRB 2O6DA 4FQPA 4FZ8H 4E41B 1RZGA 3AS0A 1AP2B 4WTZA 3KPMA 5AVZB 2FYYA 4GBXB 4PRIE 5JQ6H 3V4PB 2KLSA 4PJ8C 5I23A 2F68X 1E2VA 1B0GB 3T0DA 4N2EA 4BV1A 3KPRB 5L6YL 4OW6A 3DURA 4JRWA 1VCAA 1RZKL 3HR5A 4RQQA 3TVMC 1CFTA 1KF9B 3IGAB 1EHNA 3VD3A 4FE9A 1R3IH 1SEQL 2R29H 3ARGD 2CO3A 1G7PB 3RVUD 3I3EA 2HJKA 2CBMA 5J6SA 5IKCA 1K4DA 2F1AA 4I89A 5A2BA 1TZIA 1KELH 1JTPA 4JFPA 4PJAA 5KAQF 1KEMH 3NIGB 4L23A 3WS3B 3OSVA 2O6CA 2YAFA 2V0AA 3RDJA 4UM9D 3W2DL 2Q6WB 5IG7A 1RJYA 3ARBB 3UG3A 4UAOB 3EADA 1MIML 3MRHB 3QAZB 1D9KB 3LKRA 1U3JA 3R8QA 1A7BA 3GO1L 3EO1A 3FRPB 3CD4A 3EFDH 4AZ8B 4HWEH 2UX6A 5T3ZE 4QCIA 2CH8A 2XFXB 1LJMA 1Z0NA 2FTAA 5C0FB 1JGDA 1FCCA 1U21A 2ICEB 5L2JB 4M6OL 4P2QD 1EJOL 2ZOOA 4E9QA 1NGQH 4UILL 4N8CH 5LGJB 4FFZA 5GGSA 3VI4F 5FYKL 5DJ6B 2QDVA 3IFNL 1W0VB 1SHSA 1BDYA 2H1PL 4FHBD 4K7PH 5KSBB 1CGXA 4M6MH 1Q9LB 2JIXA 3BJLA 2X9ZA 3BYTA 2BSSB 4HWUA 3RVXC 5L88L 1M05A 2YD5A 5GIRA 1J8KA 2UXVA 4URTB 3T0EA 5L7XH 2YPLE 4FI8A 5HVGB 1E4KA 3O6LH 1N2RB 4TYUA 2R69L 4UCFA 3LN4B 4LKXA 3ETBF 4NXSA 4I3GA 1QI3A 5GZOA 3EW3B 1DJYA 2FATL 3OHXC 5EF1A 3NFNB 1Y0LB 5KYYA 3DJRA 2GCYB 3KPMB 5FWQA 4EDXB 3UTSA 2XBTA 3EOBB 4YHPB 5KWYC 1SJEA 4RFNC 1FFPB 1N8ZA 4IKNA 3QR1A 2YPKA 5GZNC 5KZCB 4NO3B 1ZPLA 2H26B 4HG4K 1S78C 2ENSA 2WMPA 3HOGA 4L3FA 4NENA 2ZNXA 3KVQA 1NIFA 3K2KA 3L17A 4R9HA 2QMJA 3QDGD 3UJIL 4M8UA 4EXPX 2V9RA 1DVQA 2BIIA 2AERT 2FT6A 1B4JH 2ID5A 1IM3B 1A1NA 5D7IB 2P5WB 1K8DB 4LESA 3ZE2B 2D7NA 3GXPA 4DHLA 2AC0A 3KYNA 3ULUD 5FGCE 1NGZA 1P84J 3MRFB 4G8EA 4WI6A 3L8QA 3N40P 2LQRA 1S2EA 3UJTL 3MLVL 2EKJA 3CV5A 5LCVH 1UB6A 3L1GA 3T8XB 4R7VA 3S97C 3SE3C 1S7UA 2NYYC 3N42F 2P5EE 4MVBD 3T4AC 3BGMA 2BERA 4U1LB 1QKZL 4W6YB 3OLIA 2X4TA 4N2NA 3N0PB 1CFMA 3OQ3B 4ONGL 3W11D 1L4IA 3FB5B 1OWRM 1HQRA 4GIOA 4L3ED 1A2YA 2DI9A 1YUHB 4CVXA 1T0OA 5E2VL 3QWOB 4PJ7F 6CGTA 5HDQH 4Y2DD 5I19H 3KH4A 4L0PB 1CURA 1YEDA 1P7QD 3L4XA 4JO8A 3BRFA 1E9QA 1MI5D 2ZXCA 2Q8BH 4GSDL 4QY8A 4XMPH 5CWSA 1PKQA 3HG0A 1I1YA 3HVDA 4PJFE 1D5RA 4FXTA 1AO7D 2XWZA 5F8RC 1CI5A 1CFVH 4R7DB 4TOYL 4LOUC 4DP4X 3W0WA 4GKNB 15C8L 1YVLA 1P5UA 4MMXC 3QPXH 1LO0L 1YNLL 4UIKL 1T5XB 2WJ7A 3AREB 4YHOH 1X5XA 4HX1B 2YXFA 3QFJE 4YIQA 4GW4A 4ZS6C 1GGTA 1AHKA 2YFOA 2FIRT 3N9GH 4NJAL 4KXAA 3IJSB 4YEEA 5F0JB 2VE6B 4NUQA 2ZG1A 5DFWH 2OR9L 2CD0A 3G5YB 5GQBA 5SX4I 1ZD6A 4ZTPL 4KPHL 1MQ8A 4R96A 3RL2B 3E6HA 1UKTA 2GBVA 4LSSH 3QYCA 4JE0A 1WFTA 2QLVB 2X10A 3TP4A 1AD0B 1J8HB 3C8KB 4K3JL 1A9BA 3B2UD 4KRPD 3H55A 4A7SA 2FECL 4HIEB 4FXKB 4H1LH 3QPKA 4QXTA 1HOCB 1KYDA 1EAQA 1VPOH 1V54B 4CAGA 2WIIB 1ZWIA 2K6WA 1JHLH 3Q01A 1I4FB 1JPFB 4RGOL 4OI8A 2I85A 3MV8D 1G6RL 5ADOH 3I6SA 1RMFL 5AVTB 4BCYA 4GAGH 3FTYA 4NI3A 5DJDA 4YGVA 5EO1A 7PCYA 4G8EB 3D3VB 4GSXA 4JO3H 4U49A 4RGNB 4TSAL 3WEBA 3OAYH 2L7QA 4OAWB 4AGOA 4L18A 1BWWA 3MBEB 4N8PA 5CR8A 1DSYA 4Y8AA 2R59A 4IBSA 3L54A 4JFZH 2HVBA 2XT1B 5DC4B 1MFMA 3KYMB 2O61A 3CSYB 1KBPA 2F53E 4TM9A 3LKSB 2X6BA 2X4TB 3KL5A 3QZLA 5I1HH 4WV1B 5DJCA 3S34L 1YEGL 1KB9J 4OJEH 1X7SA 3UTPD 2IALB 2OBGA 1A2YB 2BIPA 2CBQA 1GS8A 3NIDE 3PL6B 3H9SA 4WWKA 4LLDB 1IC7H 4NJ9L 3BQUA 5E99H 1NANI 3ZSTA 3X13A 5C0BA 3VWKB 2Q7NA 4AQ8A 5I75C 2Y24A 3JV5A 4K23L 2JFCA 3B1TA 4G42B 2MPAH 5J3HD 3W0WB 4U2YA 2FGWL 3MV7B 4FA8A 4QRTB 3AU1B 1YMHA 1YN7A 3G6JA 3B7TA 1T7XA 3KXFE 4UWQB 3WDIA 3UPRB 5K59E 1LTXA 5T33L 3TU6A 4OSUL 2D4FA 3D85B 2EIMB 1NIDA 3HMWL 3MCKB 3CVBA 4BSJA 1C8QA 3SGDI 4KUCF 1MFCL 4K3EH 4JY5L 1UB5B 4M5TA 1AY1L 2OMWB 4KRLB 1IRAY 4ZUSB 5I71C 5AOIA 2EADA 2UY7A 1WCQA 4FLHA 4P2CG 4JRXA 5T3XL 2XWTB 3QUKB 4IKKA 3EO9H 2WOYA 5BVJA 4KK8D 4DP9X 4I77L 5K9JL 3QEHA 1S7QA 4B5EA 1NFDE 2P47B 3V6ZA 2VDPH 5JHLH 1QLFB 4NC0B 3DX9A 2I27N 4MDJA 3L6FA 1FZMB 4CN4A 1SYSA 1I3GL 2OS7A 2SEBA 2OX5A 2FT7A 3ZTNL 4OLXH 3QZMA 2F74B 3OJVC 3GZKA 3WG7B 5KVEL 1JHTA 2TSAA 2W9EL 4IGBC 4NQVA 4PJ6A 4JFVA 4W4NA 1USZA 2OK0L 4U1SA 2Z7UA 1RZPA 5GRYA 3S3JA 3B1UA 1M7UA 3DTXA 3IDYB 4MAYA 4AKPA 1KEML 4ZNCD 5DK2A 4DO4A 2FAUA 1UZ8B 2JNZA 2Y6SC 3LD8B 2QQKH 3H4HA 1XHHA 5C7XL 5TE4H 1SN5A 4F8TA 4TQPA 1RV6X 4EZMA 1U30A 5F96H 3BXNA 2GTZA 3EFDL 4YSRA 4XO5A 5FDWA 3DXAD 2A6KA 3WO3B 1XF2A 2DYPB 1I8KA 1XGUB 2UZXA 3M7FB 3HLKA 3UJJH 4N2AA 4ZXBA 3P3RA 4MD0A 5C3LD 3FC8A 3VXPA 5ADPL 2XZQH 1Q1PA 2G0KA 3PP3H 4AMWA 4YFLI 2PCFA 4HUWB 3Q8EA 2YC1A 3GUTB 4DKTA 1E40A 1YYLL 4L4VE 1CBJA 2DY2A 2J1WA 2ZOUA 5FO9A 1T03H 3I9IA 5A2JH 4GNKB 4P23A 3G6JB 3WIHH 4FG4A 3LQZA 5ID1A 5CM1A 2V2WA 2BXYA 3H3KA 5HI5C 5DR5L 1BXAA 1I1AC 1OAUH 4G5AA 4OZ4A 1RIUH 4OZFB 4TRPH 4XXDA 5DLML 2WLLB 2H2SD 3DJZA 3GKWH 2X1PA 4KRMB 3IDNA 5IMKA 5FYLH 5I0XA 1DJSA 3C5ZB 4UOW1 3W81A 3MRKB 5C07A 2DLFH 1HNYA 5EF2A 4NDMB 3WMSA 1E0OB 1PLBA 5F1NB 3BH4A 1HH9A 3MV11 2F54A 1IBFA 2VDNL 3KVPA 1L7IH 3V6ZB 2ZP0T 3O8XD 3X12A 1YQVH 3W82A 3D69B 4Q0XH 4IRZA 4Z7WF 4KJWC 3LNGA 4U3XA 5I9QB 1GS6X 2IXQA 4LHJB 3RLSA 4MCZB 3GXTA 3MC0A 2K6YA 4N2GA 5DA0B 2RFXA 1FYTE 3D25B 4FQLL 1NC4D 4M5ZH 5I74C 1R3HA 4NZ8A 3STLA 3TZVD 4U1SB 1LYQA 4JFHE 3IFOA 4QRRD 5FAAA 1QPPA 4N0RA 3KCPB 3UG4A 4ELME 3D2TA 1QUPA 1U9KA 2YOAA 3D30A 1KFAH 2GY7B 4B0MM 1NDMB 1KPRA 2BNRB 1DO5A 3IN2A 4YQXH 3HNVH 1F0LA 1UZ6E 4PBWD 4HZAA 5F6HI 4DIXA 3S98A 1R3LB 3LIZA 3P30L 1K8IA 2DJMA 3QCVH 3VGDA 1JDCA 1U8HB 1ZLVH 1W8NA 5B39B 4RSVA 2DLTA 5FKAA 1U3HC 1ILSA 4HUNB 1GZQB 4I5BA 4L37A 1GCYA 1DJHA 1PU0A 4M8RA 4NQCA 5HDQL 1C8PA 3TA3D 1DEDA 4WTWA 1OCOB 4TS6A 4FOMA 3VXPB 4HG4J 3VFSA 2Z93B 5AYQA 4YDNA 5AD0B 2NY5H 2Q8BL 4TTDC 1J10A 4JREC 4R4BA 4FA6A 3ILQC 5FR3A 2EVJA 5BJTA 2DQCH 2C3WA 2NMSA 3DRTA 1A3LL 5CGTA 2UV3A 3TF7C 1S7RB 1G7QB 3HG1D 2I5YL 4H2AA 5JZ7C 4TUJA 1U92B 5IFAL 4FQCH 1IGCL 4FNUA 4KH2A 4Y4KA 1CD1A 1E9PA 3GTVA 2FX7H 4U05A 5IIEB 1SOSA 4QXUL 1J9CT 1HOEA 1HC1A 3BP5A 4FTVA 3RJQB 3RVWD 1TG8A 5D1XD 4DP0X 1MEXH 5E5LA 3N9GL 3ULSB 1JWMA 4WU7A 4G8IB 4PLJC 4ZMLA 1BYPA 2XXGA 1AR1D 5E5MB 1XSKA 4OV5B 4XP5H 3KJ4B 5TK2A 1EO8H 2EDFA 5IHZB 3AXIA 3B7RL 2ZYHA 3GM0A 4NN5C 1MQKH 4IRJB 1TU2A 3PIQA 1YPZA 3RZCD 4A2HA 1KJ3H 5FUOL 12E8L 2QKIB 1C12A 5JORA 4QRPB 4AV5A 1ZEAL 3CK0H 3ZDXE 1VPOL 1IT9H 4PJGB 3WL9A 4NN6B 2YPVH 2V3DA 1BOGB 1K6QH 3DRQB 3DO7A 1FSKB 2XRAL 4QOKD 3ZDYF 1NCOA 3IETA 4YE4H 5TQ2L 5ADOL 2PO6B 3HN8A 4J6RL 2WYHA 4YDIH 3O6FB 4GAGL 3NRPA 5IHHA 2VDQH 1QTPA 3RHWF 4NQEA 4LCUA 2NQCA 3KLSA 2OXHA 4Z9KB 4D0CB 2CCWA 2PTTB 4M4RB 2W9DL 3IMSA 3MOBH 4P0DA 1CDJA 3ISWA 3K91A 4CN1A 4JFZL 4GXUM 3WE1A 5E8NB 4GRLC 2GEQA 3IJYA 3VI3B 1YEJH 3HNSH 5AW4B 1T7YA 3K80A 4ZSOE 5JW3H 3ULVE 1GTFA 2VMJA 3CSGA 3K81A 2ITCA 4WI0A 4X4YA 3BP6B 4ZFOB 5K9OA 2FQDA 2CIKB 2H2PC 2J8UA 4JFOB 1FIGH 2VRAA 4FKKA 3PV7A 1P6AB 1YNTF 2H47C 1BBJA 5E1AB 1YNKH 3J7HA 2K9UA 2YD9A 5INDB 1NEZB 3ESVF 1SYVA 3BVVA 1B4LA 1TETH 2J1ZA 5IQ9A 4OGQC 2XG4B 4Z7NB 1P1ZA 4DO5A 3KDPB 2HX9A 4X7TA 2NTFB 1I7ZB 5BS0E 3U0WH 5E5RB 4ZMPA 4HKZA 3VXTB 3CFDA 5INCB 3FTZA 4YC2B 3WFBH 4RBPK 1AD9B 3QORB 4Y16B 3OX8B 1DBML 4HFUL 3FQ4A 3V4VH 3EH4B 5HVHC 3QSKB 4UYQA 5HGAA 4XWOD 3QDMB 1MLBA 1FUNA 2YGNA 1LP9E 1I9IH 2ZYRA 5F1KC 4B9KC 1JXJA 1ADQA 4AQ1C 2VXSL 4KROD 1DLHB 5E95B 1F3JB 4Z6AT 4MB4A 3K6OA 1DJXA 3ZZQA 2IQAA 5I16A 3GSNA 4DKEH 1I85C 2NY0C 5JHLL 3MRDA 2CKBH 4GO8A 5I1LB 3OKLA 3I84A 4QWWD 1BQHG 2G5RA 1IEHA 1A4JB 1PD1A 3EYFB 3LS5H 4JPKH 5DUPH 1ZS8A 1JZ8A 2GBAA 3ABKB 2MCG1 2EXWD 4OLXL 3HEIB 3LXBA 5D93C 2CMRL 3GKZA 3HZKB 5BW7C 3HCVB 3LXUX 1GMIA 4OZGE 1INQB 1QACA 1RUKH 3LKQA 3EGDA 2DQHH 5MERA 1X5JA 2A9AA 4FS0A 4NQTA 3VFGL 4DZBA 4N2DA 5I17A 5G4OA 3L08A 3WN5A 5IVXB 3LKPA 1J1OH 1BW8A 1KYFA 3MCLL 4X0KA 2HT2D 5GS1C 4ZW6A 4WHCA 2Q7YB 2QQKL 5GGVH 5IM7B 1E27A 2VLME 2YR3A 5CJXA 2EXYC 2PPEA 2ZWKA 3D07A 4F1ZA 2R27A 2Q8AH 2YAPA 4B3EA 5TH2B 2OV0A 1KV3A 4X4ME 3ILPA 3A4DA 4NQDD 5J1AA 5B21A 5SWSA 4WW1A 3A24A 2AI0L 5E6SB 1D5BA 1DVFA 2DWSA 2J6EH 3PWJA 3V79C 5K9OB 4JKPH 2VL5A 3ZN6A 1ZANL 2H9GB 3B9KD 1TO4A 5DC2A 5TK4A 2P8LA 1VFBA 2XZQL 2VR8A 5C08E 4LLWB 4K5PA 2VYRE 5DZJA 5EU4B 2HLFC 1CLZH 1Q0XH 4LHUA 4P5TD 3HVNA 5GGTL 1HI6A 2P9RA 3WY2A 3G6DL 3ZIYA 3GSRA 4WVRA 3TH2T 2VLLB 3SE8H 5LXGH 4LPUA 5CJOL 3EYVB 5JPNA 3K2MC 1JZEA 1JMZA 2JKJA 3UTTD 1R5IA 1RVFH 1RK0A 1KB3A 1XR8B 2EE0A 1MHEA 4RAVB 2R8SH 1OAUL 4N0UA 2IFFL 4HSCX 1RIUL 1AMXA 3N1MC 2A9NH 4W9FC 1OSPH 5JOPD 4ZNEA 3SYQA 4XN1A 3AT0A 3F2LA 5FYKE 3NYKA 2E7MA 4JHAH 3O3AA 2NXYB 4RETB 5I8CB 5IF0B 1DQVA 1GSKA 3J27A 2O5NA 5GRJL 2IGLA 4LSRH 4LVHC 5A7BA 5C6TH 3IFLL 4F58H 1TSRA 3VI3E 5I16B 3AJ7A 3FQNB 5HVFB 3FRUB 3AS3A 4GAYA 2HPOA 4WWNA 1SUJA 1BG9A 1FO0L 1FNEA 1HSAA 3BSZA 3RWFB 4DK6A 4NSKA 3PGCA 1UACL 2GHWB 4Q0XL 4UZGA 3T08A 4XMLL 2XZCL 1KWGA 1QSFA 2WLJA 1FLTX 1JVLA 3B37A 3V6FB 4R97B 1BJMA 1U8KA 2WO3B 3IJ8A 2ICWJ 4LP5A 4XNMA 3OD3A 2GBTA 1JK8A 3RIAK 1Z9LA 2HKAA 2RQ8A 3WN5B 2VH5H 2WBJC 5FM8A 4MNGE 3L4CA 1B2YA 4I3SL 2XBDA 3L9BA 2ED8A 5EIIA 3O4OB 4CA4A 4CADB 3CN0A 2ICWB 4MYPA 1A1MB 1CICC 4O58H 2WLIA 3SBWC 1W80A 2NY5C 1T1XA 3NMEA 3QCVL 1NCWL 3QEQE 2J21A 1KJ2H 2CPCA 3DDFA 4XB7A 4PS8A 3ZUCA 5J1AB 3FUJA 4J39A 2Y1VA 4WW1B 4HEPA 4XMVA 4JRYD 4KZEH 4YK4B 1CBVH 5MP6H 1DP0A 1HZHL 2X38A 2EDQA 4X5XB 1CO1A 4QRAA 2VLRA 1NBQA 1A7QL 4MX7B 4ZX5A 2P80A 2J1XA 1X7QA 3BVTA 3V4PH 2EVHA 5D1QA 1AE6L 3EUDA 2JIXD 4LVEA 4AYMC 1YAIA 4LHUB 3L3OC 1HI6B 2DQCL 3Q1EA 1XGYH 1XGPA 1Z5YD 1ZT7B 3BP7B 5IOKA 5EO0B 3QWQB 3ILDA 4QGTA 2VABB 1AVAA 4FKEA 2LLNA 4FQCL 4WNJA 2DIBA 3L7FB 4C47A 2Z92A 4MASA 5LAXA 2WIMA 3KPTA 5E6IC 3EOAB 4K8RD 1NCCH 1AO7B 1P6FA 5GZOD 3CDZB 4XCNB 3MRPB 2MQ0A