4HIPA

Crystal structure of the pseudomonas aeruginosa azurin, h126no yoh109
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQFMFFCTFPGHSALMGTLHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 31
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hipA00
7PCYA 2FT7A 2CCWA 1CC3A 2PPEA 3QPKA 1KDIA 4P5SA 3ZDWA 3EH3B 2VM3A 2GSMB 2EILB 3AW5A 3CVDA 3EF4A 4UAHA 4A2HA 1SDDA 1PZCA 3NJMA 2GB2A 1QHQA 4KO7A 1J9TA 1N70A 2E86A 1FWXA 2H5UA 8PAZA 3NJNA 5AZUA 1NPNA 4E9VA 4EF3A 2CUAA 1AS8A 2HZHA 2PCFA 4DP0X 5I5MA 2CJ3A 1XB6A 1L9RA 3PLYA 4YSTA 1NIDA 4KO6A 5D4HA 1MG2C 1DYZA 3AG4B 3DTUB 1V54B 5B1AB 2CALA 3FPXA 4GXFA 4AKOA 1L9TA 2FT6A 1JOIA 1AG0A 2BHFA 1M56B 1PZAA 3X1GA 5FC9A 1GS8A 4FA7B 2IWKA 3X1FA 5E9NA 1JZFA 4BDVB 4F2EA 3ABGA 5D4IA 2OV0A 2FQEA 5PAZA 2DY2A 2J57A 1KYAA 3NJJA 3UADA 3PAVA 3H4FA 1JZEA 2WO3B 4K9JA 4WTQA 3U25A 2FQDA 3KW7A 3EHBB 4YSAA 3OD3A 4KO9A 1EHKB 2QDVA 4DP2X 2MTAA 2N0MA 3H56A 3FQ2A 1IKOP 4A2GA 2R7EB 4A2FA 2A3TA 2HXAA 4HHWA 3DIVA 3FSZA 2NRDA 1CYXA 1WA1X 2PLTA 1JXFA 3UABA 1ID2A 2Q9OA 3NT0A 2B3IA 1ZV2A 5I28A 2HLEB 2AZUA 4FAAB 1SF3A 3CZUB 3X1NA 1JERA 2Y69B 2PP8A 3FQ1A 4QLWA 1SNRA 2AFNA 5A7EA 6PCYA 1W6WA 3QJRB 1OV8A 4Q8BA 3ABMB 1ILUA 2PP7A 3AY2A 1ASOA 1XB8A 1KV7A 3SQRA 2VW4A 1OCRB 3DKHA 2UXFA 1OF0A 5I6NA 3ERXA 3TA4D 3FQYA 2XU9A 3GXUB 5I26A 4E9XA 1IUZA 1IC0A 1M57B 4JKNA 4BWTA 1ET7A 2IWFA 4JHUA 5AFAA 1E5ZA 2YXVA 1X9UA 2B08A 3T9WA 4WKXA 1AACA 3FU7B 5B1BB 2RACA 2EIJB 3OMNB 5PCYA 1PLAA 2XX1A 1ZPUA 1MG3C 2IWEA 1NPJA 2IAAC 1TU2A 3OMIB 4YVUA 4PCYA 1L9QA 1I53A 1NZRA 3SBQA 3PXLA 3WI9A 2FWLB 1BEXA 2FTAA 4G7SB 5I6KA 3NSCA 4YSDA 2DYRB 1YLBB 1AANA 1E30A 2LLNA 4CSPA 3NJFA 1E5YA 3PCYA 2H3XC 3FU7A 1BQRA 1AOZA 1HAWA 1ETJA 1GS7A 1SDDB 2VW7A 3CG8A 4X4KA 2J56A 1E67A 1WS8A 3CDZA 1KCBA 3FSWA 4A2DA 1AG6A 2XLLA 3QQXA 1L9PA 4M3HA 2VW6A 1BQKA 3NSFA 2XYBA 4E9WA 1VLXA 4ENZA 1L9OA 4W9ZA 4PAZA 3G5WA 3S3BB 3T71A 2YAEA 3UGEA 1KGYE 4TXVB 1ZDSA 1FA4A 4YSCA 1A8ZA 1GR7A 3WNJA 1M9WA 1AAJA 3T6XA 5B1KA 2ZONA 4BXSV 2XV3A 4DP8X 1F56A 1BAWA 4HHGA 1PAZA 4A67A 3AG3B 1X9RA 2YARA 3ZBMA 1NWOA 3FYIB 3NJGA 2JFCA 3ABLB 4KO5A 4G71B 2JKWA 1RCYA 5I6PA 3QJQB 6PAZA 4YSQA 1URIA 4DP7X 3T6VA 1J5DA 2HX7A 3AG1B 1HAUA 3S8FB 3ZX1A 1QNIA 2UXVA 1KBVA 1E65A 5B1JC 2I7OA 3L45A 2AANA 5TK4A 2YAPA 2DYSB 3KW8A 3TBBA 1ET5A 1BXVA 1ZIAA 3HEIB 3NJHA 4G7RB 2P80A 3CVCA 1W6LA 4KNSA 2HX9A 4KNTA 5ANHA 5LDUA 4G7QB 2X87A 3ASOB 2QDWA 1QLEB 2VN3A 1J9SA 2PPDA 2OJ1A 3BQVA 1J9QA 3NP3A 1ASPA 1OE1A 3BVDB 3IE9A 1BXUA 1AZRA 1AS6A 4L0PB 4BDVA 1NDTA 3H4HA 4DP6X 2VSKB 3C75A 2XV0A 2BZ7A 1CURA 4NB7A 4MFHA 3NJIA 1PNDA 3UAAA 1OCCB 3TBCA 3AZUA 3IN0A 1R1CA 4AZUA 1SF5A 1V55B 5TK2A 1KCWA 2IH8A 1TEGA 3TU6A 4UANA 1ET8A 1SJMA 2YAFA 4A2EA 3OMAB 4YVNA 5I6MA 3QJUB 4DP9X 2BZCA 2YXWA 3S3CB 2YAOA 4G72B 2PCYA 2DWSA 3X2QB 5I6LA 1SFDA 1BQ5A 2DV6A 2X88A 1W8EA 3WKQA 4E9YA 1EZLA 1J9RA 3MBWB 4YSPA 2ZXWB 1AQ8A 4DP4X 2AZAA 3MX0B 5AKRA 3WKPA 3FYEB 4DP5X 1KDJA 2IDFA 2OCCB 1A4AA 1NIEA 4DPBX 3S3DB 3T6WA 2BWIA 2W88A 1AZUA 2Y1AA 1A4CA 1PZBA 2VM4A 4GP8B 2XV2A 2UX6A 1PLCA 3RYMA 3FSAA 1ILSA 4N4YB 1A3ZA 1JVOA 3WNIA 2YAHA 2BP0B 4JHVA 3GYRA 5B7EA 1GW0A 3X1EA 1GY1A 2GHZA 4G70B 1JVLA 1JXDA 1ZIBA 2UX7A 1AS7A 2PPFA 5IY5B 1ASQA 3X1BA 1UATA 4HAKA 2XWZA 2EIMB 2HX8A 1AZBA 2GIMA 4YSEA 1JXGA 1JZHA 2IDSA 2IH9A 2BW4A 1PF3A 1OE3A 2UXGA 2CAKA 2FJSA 2PPAA 2TSAA 2ZOOA 3NJLA 4GY4A 4YSRA 5B7MA 4BWUA 4A66A 2IDQA 3EH4B 2QT6A 3NSYA 4KOBA 4GP4B 1FFTB 3PPSA 2XXGA 4NERA 2HRHA 1GSKA 1OCZB 1PY0A 2BP8B 2WO2B 2XX0A 2R7EA 3IEAA 3WIAA 1PMYA 1T5KA 1AIZA 4E9TA 3D12B 2GC4C 1MZYA 3ASNB 1SFHA 1JZJA 9PCYA 1NIBA 1RKRA 1IBZA 3PAUA 3QJTB 1GS6X 4AKQA 3FS9A 3NYKA 1AZNA 3ABKB 4HCIA 4E9QA 3SBPA 1CUOA 4YSUA 3S8GB 4DP1X 1NIFA 4GYBA 1L9SA 1SHWA 4KOCA 1BYOA 2CBPA 2BP8A 1A4BA 1ADWA 3NSDA 3TASA 1DZ0A 3FT0A 1N68A 1NTDA 5F7AA 1GY2A 2QPEB 4ZK8A 4W1TA 2BWDA 3WG7B 2GC7C 2J55A 4M4RB 5F7BA 3OM3B 4F2FA 1MDAA 3NP4A 3N55A 1CYWA 4BWWA 4BXVA 1SHXA 2I85A 1A65A 1AZCA 1OE2A 2VMJA 1ZDQA 3QJSB 1MZZA 1RZQA 5I6OA 4E9SA 2FQGA 3NJKA 2IDUA 4NAJA 2IDTA 4HIPA 4Q89A 4HALA 2P80D 2W8CA 3FSVA 3QJVB 5D4JA 4E9RA 1JZIA 3FU9A 5B3SB 1JZGA 2YQBA 1BYPA 3SBRA 1PLBA 3FU8A 3GDCA 3IBOA 2BP0A 4P5RA 1OCOB 3HB3B 1HFUA 5B7FA 1RZPA 2YAQA 4HCFA 2FNWA 1NINA 5B1JA 4DPCX 3V9EA 3CDZB 4YSOA 4GP5B 1IBYA 3OQRA 4RH4A 2XXFA 2TSBA 3AG2B 3EH5B 4AI7A 4KNUA 2HRGA 1NWPA 2DWTA 2FQFA 2J5WA 3JTBA 1WA0X 4YSSA 2EIKB 1TEFA 2FT8A 2YAMA 1BXAA 2VSMB 5I5JA 5I5IA 3PAZA 2WSDA 1V10A 1AR1B 2PPCA 2GBAA 3FPYA 3N2JA 4QKTA 2GI0A 2Q5BA 2JXMA 5EHFA 4AKPA 3UAEA 1XB3A 1J5CA 4CSZA 1PCSA 1B3IA 3CVBA 2PP9A 1WS7A 1GYCA 2BO0A 4HCGA 7PAZA 1XMEB 1WA2X 2BW5A 1OOWA 2EINB 2MRYA 1TKWA 4AX3A 1NICA 4DPAX 1NIAA 2QPDB 2ZWNA 2XUWA 4HZ1A 3V9CA 3ZIYA 3UACA 1WAEA 2I7SA 3T6ZA 4UF7C 4A68A 2H47C 3JT2A 4F7KA 1PNCA 1KBWA 2XVBA 3IN2A 2AVFA 4YL4A 4BK5C 2UXTA 4N8UA
chains in the Genus database with same CATH superfamily
1DANT 5E8EB 4IS6A 5IKCB 1C5BH 4AVKA 1CC3A 3WJLC 4I48B 4M5TA 5DK0B 1OQOA 2JI1A 4XH2A 1UD8A 2ZWKA 4Z7VB 1BQUA 1ZE3H 5JHLH 2W9EH 4LGRB 4RMVA 2IFGA 3K4AA 3SKUD 4Z6AT 2C3HA 2C7UB 3PWNB 4LOFA 5IT2H 4OZFG 3OPZL 2Z34A 4XCCH 3WTTA 2Q76B 3AY4A 3QZOA 4BZYA 4HIXL 2PW2A 3E0GA 4FQ2L 2VITA 3ZT7A 4G2AA 3U48A 4Z9KB 4BKTC 2AJXL 5AAWC 2AEOA 5FM8A 2CJ3A 1FJ1A 3PLYA 4V2CB 2LTQB 3LZQA 3HFMH 4E9LA 4LKCA 2W5PA 4LCCC 1NGXA 4P46A 1MXGA 3X12A 5HDWA 4FI8A 4Y2OB 3U1PA 1H8OA 3FQTB 3CZLA 4O4YH 1WE5A 3H9ZA 3GSOA 5FX3A 2ZUUA 4FA7B 4LL9A 3QIWB 1S3RA 2OMYB 4PRIE 3X1FA 1MIEL 1U92A 2RD0A 5I1HH 2Z64C 4D0CA 4YLCA 4C55A 1GAFL 4X80H 1V3JA 2VQ1A 3BWZA 3DRQB 2OTUB 3D06A 2DWDA 1I9IL 3QT2A 5D5MB 3UGUA 1SOQA 4K9JA 2FQDA 2F54B 4B97A 4HBCL 1ZVSB 1CQKA 2ZUSA 1PD0A 1RJYA 5D72L 1II4E 1RIUL 3LXUX 4MNQA 3TPKA 1B2YA 5L88H 4HDIB 1NAMB 3NZHH 1U21A 2OMTB 2OYLA 3CPLA 3ZTEA 1AE6H 2WLIB 1JZ5A 1IGFL 5GSRA 1G7MB 2BVTA 3D0AA 2BFVH 3QIWC 4BFEA 4V1DE 3KCPA 3K1DA 3G5VA 3B4NA 1CE6B 4LAQL 3CZJA 5KSAD 2IOOA 2NR6D 35C8H 3A23A 4YUEH 4LQFL 3AMKA 1TQUA 2WPGA 2C9QA 5IG7B 2PN5A 2HFGL 5SWSD 3F8UB 4PJ6A 1PDKA 3P2TA 1MJUH 2FBRA 4IHBA 1T21B 3FQYA 4X7DC 1HZKA 2WKOF 4XPAL 3TH4T 5E1QA 4K3DL 5HHME 1E42A 1Z5LB 3A4AA 4EUPG 4XN4A 3C5XA 4U3XA 1ET7A 3FTXA 3KHQA 5E6SB 1AOHA 1JWUB 2FL5A 4F20A 3DBXB 2I26N 3GMLB 4WWKD 3V4VL 1RUQL 3E6FA 4KX8A 3WENA 1PCXA 2YS4A 2BNUB 3K74B 2YA1A 1OF2B 1U8LA 1Y6NR 5LN4A 2UV3A 1O6SB 4X50A 3N41B 2DQGH 2VDKB 3K6SA 3VWKC 2FVNA 2HVKA 3S96B 1Q1JL 1KV3A 3N40F 4EBQL 1F42A 5SWSB 3H0TB 5BQ7B 4NQCB 1G6VK 4P59H 5G5DB 5CGBA 5GIRA 1BEXA 5I6KA 3WD5L 1YMME 4U6XB 2DYRB 2YA0A 4NQED 4OZHE 5DJDB 1NJ9A 5ISZE 1NMAL 2A9NL 4XCFL 3KDMB 2QEJA 2G9HB 4GS7C 1YECL 1ZVYA 3QWQB 4PJDB 4RFEA 1N5YH 4OF5A 1AGEB 3KXFB 1D6EA 3QXDB 1LO5A 1KTCA 1BFVH 5LB1A 2YGNA 4KZDH 5DFAA 3STLA 3FAXA 1DVSA 2HKHH 3GMQA 3KL5A 1I7RA 25C8L 3MNDA 4GRLB 2VRAA 4R2GB 1KCRH 3DV6A 3MUGA 4HWBH 1L4IA 2JVUA 1KWGA 2R2HB 4BSWA 4MBOA 2N4IA 3ATDA 1CICD 4BIKA 4UB0L 4G7YH 1VKXB 3IJHA 4JUSA 1A5FL 3LKPB 1Q9OB 2ZONA 3G08B 5D7KE 3MBEC 1T0MB 4O58H 3FQRB 1NLDL 2GYSA 2P26A 1AGBA 2GG1A 4HJGA 4BH8A 5GS0H 1JGEB 4ZS7H 5MEQA 2WXJA 4NJAH 2C9AA 2Y7QA 5E4OA 3ZBMA 3RVWC 3UBFA 3S35L 4N2HA 2B5IB 43C9B 3WHXA 3NCEB 2ISDA 4NKQB 2IO5A 4XAWH 2B59B 4KVPA 3G6JB 3Q8AA 4ES8A 4ZI8A 2R0WL 4J2QA 4UI2A 3RGVB 4PJEA 3Q6FA 1I85A 4LASL 5CHNB 2AJZA 3FFCB 5DK3A 2AANA 2AXGA 5ISZD 4HV8A 3P77B 1EVTC 1ZIAA 1OPGL 3HEIB 3NJHA 4H88L 4HDIA 3QZMA 3ARTA 1A6PA 1RIUH 4Y19E 1NKRA 1A3QA 3LPWA 1IFGA 1A6AA 3OAUL 4AL8H 1Q72L 3QCUL 3QHTC 3H9SA 1T20B 2APSA 5C97A 2IXQB 1IFRA 1LK2A 4ZMZA 4YE4H 2J1ZA 4O2FA 1ODUA 3H4HA 4FQJL 4MAYC 3QEQE 2OZ4H 4QOKB 4U7SA 3GMMB 5H8DA 4IBWA 2WSKA 3F65A 4FQPA 5FFOA 5CJ5A 1YNTF 1AHKA 1JK8B 1R5VA 3UTQB 1EFQA 3BCFA 3VI4F 2X05A 1OANA 3SDCD 2RB8A 1AZVA 3QG7L 1QUNB 5HI4D 4JFQA 2XWJA 4A2EA 1I1AC 1PZ5B 3ZDYB 4Y5XB 3AS1A 3BI9X 2A0LD 1RJCA 1GPOH 3KYOB 3P4LA 1T3FB 4KMTH 3WTXA 5C09D 2NY3C 1HH9B 3A6CL 1SYVB 2ZXAA 4KKCD 2E9IA 1N7MH 5IESL 3C8KB 1NJ9B 3PQYE 2ZOLB 3A22A 3MACH 1MDTA 1QSFE 2D7NA 5AYUH 1ECZA 4HCRA 1NC4A 3QXAA 5CCKH 2VXVL 5BVPL 3D39A 4ADIA 3HMXH 4ZAKB 4I85A 1U91A 2C3VB 1OLLA 4G8FA 1Z9OA 4PLKC 2XTJB 5EFIB 4F5CE 4JG9A 2Z4QA 1NMCB 4L3EE 3DX7A 4M6MH 4FCAA 1EHXA 3NIFB 2JQAA 2D31B 3C6SB 3P0GB 1BYNA 2WBJB 4GLRH 2A4EA 5HBBA 2D9QB 2UVEA 2Y7LA 4JPQA 4X8CA 4F8LA 1MJ7L 3TNNB 2E8ZA 2DL2A 2DWEA 2BP0B 4YXLH 5HVHB 3BQUC 4P9ML 3W9EA 2Y1YA 3AAZB 4GNKB 3VFTA 3N85L 3O45B 2FSDA 2XWBB 3X1EA 1VCAA 4QHNB 3MLVH 3CFIC 3X3FH 2G75B 3I3DA 1P0SE 2X4PA 5DD6B 2GUOB 5EOQL 5H4ZA 1W0WA 4XX1G 2A74B 2VDLB 4X0KB 1QKZH 3X1BA 5H37G 2JCCA 1Y18B 5IQ7H 1ZD6A 3KEHA 1RY7B 43C9A 5K59F 5EEUA 3TS8A 4NT6A 5GRYA 2J25A 2CM6A 2YMTA 2E27H 4WFGD 5BV7L 1CD1B 1OE3A 4Z7UA 5KYUA 4JFDD 1M1SA 2YEZA 5T1KA 4KROB 4XGZB 2PABA 2GAZA 3CVHL 3X13A 2BHUA 2WUCH 5KBLA 2EE3A 4M61A 3SJVE 3T08A 5DHYA 3QUHA 1FNLA 1G7PA 4QAMB 2FX8L 1IZKA 3GDBA 4PGCB 2EEXA 3O3BB 4JB9H 1HVXA 3L54A 1ORSA 3IEAA 1EDYA 2XVGA 1THAA 2FGWH 4ZUSA 3ASNB 3N0PB 1DFBH 4TNVF 4ZX5A 3J8F7 3MV9E 2Q7AA 3QZBA 3AXIA 5C09B 1CGSL 1FYTE 1QQDB 3BZ5A 1EDQA 3ZDXE 2AQRA 4XN9A 2PWFA 1S5IH 2CGZA 3P11H 2A9MH 1A7OH 6FABL 1KB9K 3DUUA 2J1WA 4IM8A 2X2UA 5FYJE 3WCYA 1RZ7L 2HT3C 5B3JF 3VYNA 4R8WL 2YZ8A 4IK7A 4W9DC 3FTVA 3R7QA 4DEWA 2Q3ZA 4DZ8A 5TDOB 4IRZL 1B0RB 1YNTB 5C0ND 4KTGA 1E4XH 2RTTA 3CSYA 5A7BA 5LBVA 3OM3B 2PTUA 4F2FA 1SN0A 5FHBL 3MLZH 1MFAL 1GMIA 4WUUE 3DETC 1OAJA 3QWRA 5IBTH 3HN8A 3GMNB 1SHXA 4DVBB 4ERSL 3RDTB 5HYQA 2HFFA 5AEAA 4K15A 4TUJB 3AREA 4ZZFA 3VXMB 4RETB 4JQVA 3H9SE 5T1DH 4YDJB 3T1WA 3UZQB 1WIPA 2HH0H 4XRCA 2J3SA 4LOUC 1MFEL 4XMUA 2BSTB 4XMPL 5GS1B 2QFRA 2WZ0A 4X8JB 5A2FA 1OD9A 2YRPA 3S37H 3FJTA 2D7TH 3ULVL 4YE4L 3E6HA 1WITA 5AVWB 4U49A 1I7UA 4Z77B 1ETZA 5D7IE 1TZIA 2MSPA 1TETH 3S4SA 5IFAH 3P9MA 2BP0A 4NFCA 3D33A 2X2HA 3EDFA 1OCOB 5B7FA 1JAEA 3H1ZA 4Y9GA 4P9HC 1KY7A 3KCWA 4XBEL 3RWEA 3CLEL 1NGQL 3KWWB 2NY4B 3UBXB 3MLSL 3RWDB 2EYTB 4KH2A 5D7SH 3IJEB 1SEQL 3HJEA 3RI5F 5LAXA 2EIKB 4G8GA 1PW3A 5HGDB 1BXAA 5KYWA 1S3KH 2IH3A 3N1MC 2KZ1B 3FT3A 1SEBB 1Z5YD 1ZOXA 4MKMA 4PLOB 2VDRB 4YX2L 1EAPB 2VYRE 2G75A 3KYNA 2H26B 1LILA 4JFDB 1HHGA 3RWIB 4GQ9L 2DQ6A 4XTRD 5E1AB 1XB3A 1QHOA 3L9YA 3LNHA 2KPNA 3RTQD 5EBWB 4HCGA 4WFEE 4JHWH 7PAZA 5IOKA 1WA2X 2NX5B 1P4BH 1KCLA 1TKWA 4Y5VB 1WUZA 4N2CA 1VZGA 4WWKC 3WNPA 4AQEA 3BFWA 1JGVL 2CG9X 2ZX5A 1HU8A 2F68X 3DURA 4MD0A 5F0LB 4BFNA 1WAEA 1MCEA 1JMXA 2MQ0A 1L3WA 4C54A 4KK6D 4U1MA 3US0A 2VKWA 4P4RA 2XVBA 2FE0A 2VDQL 1D7BA 3HE6D 1N9PA 4CMMB 1IQWH 2SEBA 5JXAH 2MFNA 3HE6A 2HJKB 3V6OE 1S7QA 3KPQA 1U8KB 4XNUH 2BRQA 1JSYA 1RSFA 2CUIA 4FTDA 1KBGL 2WC7A 3RGVC 2YD5A 3WKNA 3N40P 1LO4L 1SYSB 5JORA 1NMAH 2A9NH 4S2SA 4XE5B 1QHQA 1GGIH 1DSYA 3V7MA 5EBGA 5ID0A 2D3LA 1SDYA 3PL6B 5GGSB 4G82A 2F7PA 3DIFA 3ECBB 4JZNB 2Y7SA 3TJEL 1NPNA 2BSBA 2GJPA 3DUUB 1AS8A 1G7IB 4XP5L 4JHWL 2IPTH 3CN2A 1MJJB 4RAVA 2WQSA 3OHMB 4QNPF 4TSBL 3QEGH 5F7WC 1L9RA 4WKZB 1B0RA 5IK3B 1R5IB 1T0OA 5F7KC 5DJZA 3ZHFA 4PJGE 4HIIB 2NTFA 3V95A 3MRHB 2W38A 3H9SD 4M7JH 1PLGL 1IAKB 1U3ZA 3O9WB 4E41B 4DGVL 2P46B 1FVCA 1JL8A 1HILA 3ARQA 4KVNL 3UTTE 5I1LA 3QRGL 2EDHA 4ZO9A 3GZPA 1UKSA 1P4IL 4JM2F 2HPTA 4HUVB 4OB5L 3X11A 4IOSD 3OGCB 4FI6A 4N20A 1EO8H 4TUOA 3UTSA 4BDVB 4HOMA 4M6OL 3DX8B 5IW6B 4QT5A 2OV0A 4XGZA 5KSUB 2X4SA 3WAKA 3U0WH 4Z7NF 3QDGE 2P9RA 5DT1H 4Z7OB 2NXZC 1SY6A 4OJFH 2OSXA 4UMGA 5CJXA 5BXFB 2G2NA 4KK6C 2EIBA 1HINL 4JRYB 3BPLB 4A2GA 3MBWA 3S4SB 1JN6B 2ENSA 1IC7L 4NYLA 3V5DA 3IF1B 3UMTA 3UABA 4JGMA 4ZUSB 3HKFA 5I28A 1OPGH 1P9MA 4JUTA 7TAAA 2J1XA 1YN6A 3CZUB 4OGAD 4ZXBB 4NQSB 4QLWA 1EEUA 1BVOA 4MAZA 4TL5A 1AD0B 4HJ0D 5B3JE 4AVHA 5E0FA 3EGSB 1NEZB 4NHCH 1EXHA 2NMSA 4OGYH 1IBGH 2X4OA 3FQWA 4PRBB 1FAIL 1MHHA 4N26A 5TE7L 3RKPA 3PV6A 2D3NA 4M03A 3FT3B 1RVFH 3P40A 5BZWA 1XF1A 1QSEB 1NCOA 2VDLH 4HUXA 5BMFL 4H8WH 4DGUA 1HJCA 2AJYH 2CDEA 2VLRD 2VQTA 2OYKA 4PJHA 3LXAA 1WFUA 3Q9QA 4P3DB 1XL4A 4RCAA 4WQOA 3GKWL 3VG9B 3WXWL 4G6JL 2IF7A 4DT2A 4NI3A 3MRDB 4XB3A 4TNWF 1RZIB 3P1VA 2OLDA 4UQDA 1I8AA 1G5GA 3SZ6A 4U1SB 3C8KA 4CVXA 1OHZA 2YSTA 4WU7A 1UM5L 1TVDA 3L7FA 4Y16B 1A3LL 2E6QA 3BH4A 2GJRA 1DQTA 4LHJB 7FABL 2JQMA 4KKBD 4XRCB 5TFSL 1OL0A 5HGAA 4Z7AA 4UT7H 3OJDA 4AGLA 3W3BA 1V7NH 2DLEA 2W9DH 1WPCA 3MJGX 2GT9B 4XCCL 4XN5A 3RFZB 4KXCA 2WJ5A 2C7FA 4BFIA 4UZGA 1NDGB 3SGKC 4D8PB 1JXKA 3DX7B 2B16A 2LLNA 1QP1A 3GBML 3H2PA 5D7LA 1MCSA 3CD4A 4KQ4H 4N9OB 4HF5H 2Y0SA 4M4PA 2J4WL 4JDTH 4PS8A 3Q5OA 3TEYA 2DQJH 1SHSA 5MEND 3SDDD 5F70A 2R2EB 1OSZB 2DKUA 3EYOA 1UTDA 4JFWA 1VJSA 2MKWA 2ZKXA 3WEXA 4PRPE 5IQ7L 2VUOA 3VD4A 3QJZA 1UM6L 3RX7A 4WNSA 1NFDB 2IBZX 4NZ8A 2Z7ZA 4AWJC 4BSVB 5MEPA 2BCMA 4RGMC 5C07A 4OCMC 4LCIH 3NCXA 4IK6A 1U8MB 4JREC 1KNOB 3HRZA 3MREA 4CN6A 5L0QC 5SWZB 4PJBB 1UXMA 5GPRA 2LTQC 4BQBA 4Z7UB 1A0QL 3LH2H 3OLIA 3D48R 4NQXA 2PR9A 3GSUB 5C70A 2J72A 3VVWA 2JKLA 2MCPH 1NWOA 4OZGB 2JFCA 4YXKL 3OPUA 2HH0L 4M00A 2R29H 1OP5K 2HTLD 3U82B 2OFQA 1MI5B 2QBWA 4WO4B 1ORSB 4AYSA 4I89A 4P5TB 3VWKA 3ZKSD 4U7MA 4B9GA 2ILLA 3SN6N 4NBXB 5FHBH 5C0EB 2OMZA 4R2GC 4UQ3A 3KW8A 4IMKA 3L5WA 3GI9H 4KKRA 3UP1A 5KBNC 3HN3A 3QDME 2Z8SA 4NJ9H 4PMFA 2A73A 4XNMB 4F58H 3QI9C 5E5LA 1UKQA 1N0XH 2O6PA 5E95B 2CMRL 4BZ1L 1DVQA 4KK9D 4WGVB 2HT3D 5FOJA 3K6FA 4ELME 4Y2LA 3RAJH 5F7NC 4B41A 1YNTA 2WQ8A 3N44F 4HAFA 1TZ8A 4LEXL 3GHBH 4TLKA 2WXQA 2XV0A 3QFJA 3SDAA 4YFEA 1BWWA 4KTEL 1DBMH 4NO2A 4M8QB 1CLVA 3UXFA 1PNDA 1Q9WB 4YDMA 5E2UL 2AXHA 2RQEA 3S36L 4I4WB 3V55A 1NUFA 2CDEB 2H41A 1BZ9B 2XN0A 4HPOH 4DVBA 4FA8A 1UACL 1ET8A 1NGXB 4P46B 1F4HA 5C7ZA 1OP3H 5CGTA 2PR4L 3QJXA 5GRUL 1I9JH 1AHWB 4ZRGA 1T66C 3KR3H 3B2MA 4WGWB 2YUZA 3WMPA 3GKZA 5AYTA 4N68A 2AAVA 4JGUA 4CADA 1I3GH 3F7RA 3HC0A 4XNQA 2LU4A 4CBPA 3QW9A 3IPBA 5K33A 4YSPA 1QSVA 4GIAA 2N7SA 1GCYA 3HAEG 3SGEH 5IQMA 1TVBA 5C0BE 1HL8A 1HKLL 5AKRA 3LEXB 2DQTL 2BOBB 4EOWH 5A2CA 2OM5A 3MCLH 3A6BL 3BP4B 3GIZL 4PY7A 3NABL 3UJTL 2WMPB 1XO8A 3S3DB 1DHKA 5B39B 4GKSA 5JW4Q 4MB1A 3U4KA 4WHYG 4BA8A 4IS6B 4XBGB 1OTSC 5LNDA 5IG7A 4YR6B 4YMPA 4HEMA 4YHYC 1CFQA 2H2SD 3SDCC 3PDDA 3O2WH 4H1LG 5FKAA 4JX0A 4FRWA 2MCG1 2G2RB 5CEXB 3SE9H 3D85B 5DHVB 3UAJD 2EDLA 1B6DA 5HSFA 2ZUXA 1JPST 2YPKB 2CRZA 3WJMA 2APTA 2EIZB 1SQ2N 4PJAA 3BVWA 1AMXA 4PRBA 5FF6B 1S8DB 4ZSOA 1OF2A 1U8LB 4IYKA 3PWJB 4Z3GA 4KJPC 2ITCA 2OBGA 2P8MB 2R15A 1N8OE 1XGRA 3CK0H 3CXHJ 3EFDH 3BPNC 2VH5L 2IDSA 3CX5J 2V2TB 5T5FA 3VGDA 2QGBA 5CP7B 2ZOOA 4FFYA 1NOAA 5CXPA 1TVHA 4UM8B 4LDOB 1F4YL 1SMAA 4WDIB 2IAMC 2VXUL 5CLYA 5FYJL 3E1ZA 4AM0Q 4CMHB 1XZ0B 3BFOA 1FCGA 1P2CB 1E28A 2ZJSL 4KGLA 1LO3H 3SPVB 4KK5D 2Q87A 2BP8B 5F3BA 5AW5B 3KDMA 1PMYA 5L2KB 3SE4C 5HGAB 5DQDH 3KLQA 2UZYB 5BS0E 2ATPA 4YLBA 1DUYB 2CSPA 5MERA 1M71A 4NQCE 2DIAA 4APXB 5AKTA 5F7YC 1EA9C 2PCPA 5DJ0B 4CW1B 5T5FL 3MMEB 5F1NA 3PAUA 1ANUA 3OKLB 1OCWH 2JMRA 1JV5B 2F0CA 5HDRA 2XFXB 4R5XA 3SPIA 4G7VL 1U8OB 2Z7UA 1NGZB 3NTCH 3QZWB 4LCVA 1PIGA 2VDKH 2CBPA 3FQNA 5JPMB 2WAQA 1D6VH 1JRHL 1LO5B 2WCSA 3B2XA 4J3OC 1PYWB 3MKGA 4P46D 3UOAB 4ABUA 2ZYIA 2JJTA 5DJZB 1AD9B 4IDJL 2XQYA 3DV4B 2EJ1A 1G4MA 5K1VA 1MFBH 2GJ6B 3VE0B 3UTOA 4I7ZC 4BWWA 4MBRA 4LQFH 4XXDB 5IEKB 5DO2C 1DQDH 1P7QB 1RZJC 3KPRE 4FGMA 4U0RC 4Y1AE 1DVFC 1UVQB 3F12A 3FN0H 2UVFA 1SBBA 5EZIH 2PTVA 4DFIA 4EE2A 2ADFL 2FQGA 5ID1B 1GZHC 2DQEL 5CSGA 3F7KA 5HHVH 3TC9A 2UZXB 4XB8A 4CN4A 5LWYH 5DXWA 3RHWK 1QBMH 1T22B 5B39A 4LLWB 1VADB 2WBKA 4OD2A 2PMZA 3TZVA 5DMYA 3MCYA 4L4JA 1KACB 3LXCA 4JDZB 5C0AB 3SOBH 1BZ8A 4KXZH 3S5LG 4N0CD 4PW3A 3SBRA 3GXIA 1FZMB 4YBHA 4AYMC 4ZFFA 1D9KA 2D7TL 4LCCB 4WNQB 5BMFH 4WEEA 3VFGL 1HHJB 2QKIA 4HCFA 4MMXA 5EG6C 5I75B 1OCWL 1ULVA 4MXWL 4PREA 4QGYA 4KKLC 3VH8B 1AZZC 3CDZB 2FIKB 2WVVA 4JFPB 4FFTA 3P77A 4XBGA 5DRNB 3B9EA 3P2DA 1V7ML 4J4PD 1FVEA 2BXYA 5HYJB 1S9WA 5DA0B 5BUPA 2YD0A 2FEJA 3ARBC 3EJJX 3OXRA 4PTUB 1USQA 2OK0L 1ZLVH 4G9DA 4FL4C 3UAJA 3DHMA 5BRZD 2XWTA 2PKDA 2XN2A 3ISRA 1S46A 3HJ0A 4CC4A 3DYOA 2R9HD 4H8VA 2IQ9H 4HKBA 1ERNA 4X5RA 5INCB 4N1HB 4S1RL 4A6YL 4DGWC 1T2QL 3P3SA 4KRMB 4HEME 3WS6A 3BO8A 1NFIA 4M56A 4AX3A 1O7SA 2Y9RT 3IJHB 4EDWH 1EHLL 4L5FL 1J0KA 1N3NA 4MCYB 3V4PL 1NCDH 2NX5D 4G8IB 4UF7C 1KLFB 4KTYA 1WAAE 1UD6A 4PJ7E 4F7KA 3FUJA 5M95B 4AXWB 5D6DA 4GRWF 4Y2DB 4Q6IB 2DLGA 3BCDA 1TXKA 2FATL 2ZSVA 3L13A 1KJMB 2R0KL 5TF0A 4Z1PA 4G8GD 4JCLA 1FL6B 4YQXL 4M3KB 3L1EA 4N8VA 1LHZA 1R46A 4OLWH 2GSMB 2BSED 3D39B 3ETBF 2EILB 3RUGB 1W9XA 4PCSA 1RSYA 2VMFA 5CILL 4JPIA 3RWHB 1DBKH 1RLWA 5D1XD 2WXNA 3K2IA 4UUJA 2WAHA 4NP4L 4P06A 1N70A 4P2OB 4YUEL 3KNBB 5D1XA 1X5XA 3NIFE 2DRUA 3LKSA 1DQLL 1NBVH 4LPWA 3REVB 3SGJC 2HZHA 2HWZL 4KU1A 4N5ED 4S1RH 4DAGL 1DR9A 4UT7L 1W16A 5FA3A 2M1KA 4FLSA 2GJZB 3OTTA 3TF7C 2HN7B 1HQRB 2P7TA 4L0YA 1OTUD 5I66A 1XX9C 1YJDC 5MHSE 1E4WL 1DVFB 1QI5A 1C8PA 4G3YH 2D0GA 2ED7A 3KGTA 1HQ4B 3QDJA 4J3TA 5B1AB 3G7TA 2L7QA 5AVXB 4ZMOA 3IJYB 1B90A 1DJZA 5IGXL 1P7KA 3VQLA 3WMQA 1BVKA 5LQBH 3V4UL 4XCYA 3QFJD 3ZE1E 4MGXA 4F37F 3DXAB 5CD3A 1V7MH 4NN7C 2MNJB 4WW2C 1U3NA 4YPGB 5AB0A 2BNQA 4F93B 5I1KH 1QHPA 4Y9FA 2XRAL 5LUMA 1FDLH 1TCMA 5E6IA 4DN4L 3IDYC 3K5RA 1K5NA 4N2OA 4UT9H 2XG5B 3BVUA 1NMBH 1QPPA 3HA0A 3CDCA 1G7HB 3B7SA 4JR9L 1HZLA 3W39B 3GTNA 5L7XL 3WY4A 4E68A 3U46A 2OMZB 1N0XL 4ZFFB 1HH6B 4HHWA 5MEOA 1E2VA 3MACL 2QZQA 4HIEA 3K46A 3FB8B 1FNSH 3NT0A 2AABL 4I1RA 3VRLF 2V7HB 2IBZY 1DANU 3M07A 4GSDL 4U1JA 3FU6A 4QRUB 4QRBA 1OV8A 4E36A 1FYTB 1CFVL 2O5XL 2PP7A 4RWYL 4Z78A 1IBBA 2V17H 5C07E 4K2UH 2P42B 4F7PB 4CU7A 1XEDA 4MHHG 4U6VH 4GOSA 3GMNA 5HGGS 5HYQB 5J7CC 2D4FA 1PD1A 3KPSB 4Z0XB 1KPUA 4JMNA 3VXPA 2JELL 2OMWA 2BVOB 4FMKA 4E9XA 4JKNA 3AAZA 3MOQA 5JIKA 3CFQA 3RQ3A 3UIYA 1KPVA 4G5AA 3DX6B 3P4OB 1UCTA 4H8PA 2BSTA 5LG6A 1TJMA 1NA8A 4MJIE 3CH1B 3MC0A 5FYLE 4UB0H 4WUUB 4Y88A 2ZXBA 4QYAA 1CF8H 2AQQA 3BWAA 5HVWA 4YHNA 4KFZC 4H25B 3EFFB 1K6QL 2P5EA 1MHEA 3F2LA 2EDJA 3K71A 2PWEA 3QXVA 3ZTNL 3GRWA 4YK4C 3IGLA 1T83C 1J18A 4Y4KC 2R0ZL 1M7IA 4AXWA 2YN5A 1R3KB 4C58B 3U0TA 1TU2A 5DEJA 4BZ2A 3PWPE 3SBQA 1OAQL 1NCIA 3MRKA 5ALBL 1XIWB 3G9AB 2YGQA 1UZ6E 4U2ZA 4NUQA 3W1ZA 1LDSA 1HXMA 4XPFL 1QA9B 4M43L 1CGXA 2VDML 3FU7A 5LKNA 4WW2A 2YJQA 4M5ZL 2OSLB 3ZYJA 3FH8A 2P8PA 2YD6A 4N0UA 4Z7NE 2BJML 4X4KA 3WIIH 1T1WA 1WS8A 2WLMA 3KLLA 2QSTA 1UB5B 2FYVA 3GUFA 4H1LH 4HWBA 4ZS7L 3IDMA 1OM3L 3U9UB 5JXEA 3M1BA 3FUHA 1NM4A 5IHZA 1BM7A 4YHPB 4GMSH 4JRWA 3T77A 3X17A 4DKFL 1WFOA 4NZUH 1Y1UA 3HC3H 5DD0L 4RQQB 3ZE2F 1MJ8H 4D7BA 5KVGH 1SY6L 4NHUA 4U33A 1YNKH 4PLJC 4XVTL 4MXQC 1JDDA 3K2MC 4PRHB 5DZNA 2R1YB 3R1GH 4YFLF 5K9OB 4ZAKC 1L7IL 2DZEA 1T6BX 4Y5YB 4OZFA 4CL7A 1QWUA 4JFDA 3C8DA 3UPCA 3BAEL 1SMDA 4ZW7A 3TT1L 1BVKB 1F56A 4GO9A 5C0GB 3MLUH 3MODH 4FE9A 3V6ZA 1PAZA 3MR9B 3OMZA 5FUZH 2YARA 3NH7H 5IF0B 3WE6A 1LO0L 2HTLC 4O51A 3NJGA 5HI4C 1UA3A 5HHVL 1RVFL 4XC3H 2VSDA 5CBEA 4Z23A 1S7UB 1XXDC 1IEBB 2E4FA 2G60L 4LLVA 4KUCF 4DP7X 2P28B 1FZJA 1AY1H 4NWTH 2XTSA 1QFHA 2Y6SC 1S6NA 3GRBA 3PWLA 3QJHA 4N0UE 1TO4A 5IB2B 2SEBB 1LNUA 4LP8A 3TYFA 3QISA 4PGJA 5A2BA 2ZYRA 4OZIA 4PRPA 2B1HL 2VGLM 3FQ4A 3CVCA 4JN2A 5I18H 4QRTA 3VWJB 3RUGA 5J8OA 2PUQT 5E4AA 4J3UA 4P9MH 4JFFD 2IADA 1CGVA 5KBPA 1HSBB 1J9QA 3T6QC 5I1GL 3EO0B 2AJYL 2EABA 1TQTA 2Y22A 3DX6A 3QWOB 3GSRA 4XP6H 5C6PB 1EV2E 1NDTA 4PJFA 3UJIH 4V1DD 3LNFA 2RCSH 3Q8EA 4ICXA 3KPSA 1LD9B 3PDGA 4KHXH 2YD8A 1OCCB 5A2KH 5IIEA 3CFJB 1QSED 4WUKH 3P3YA 2GFBA 5TK2A 4TTDD 3P4NA 1NBYB 4YVNA 1N64H 5KVDL 2Q6WB 3CSBA 4ISVB 5IHWA 1TSHA 2ENQA 2YAOA 2XDHA 4DVRH 4S0TD 5IW3A 1A1MB 4D9LH 1G9NL 4IU2A 5F1KC 4YHKH 1M2VA 3QG6A 1BQ5A 2A99A 3S6CA 2CK0H 4HUWB 3VXRB 2ZSWA 4WIQA 4KRPD 1E4KC 3CXHK 2Y3NA 5C3LD 1HCVA 2QQKL 1XD0A 3BMWA 4UQIM 5FPIA 4IGBC 4ANKA 4XR8C 2FLRT 1YNLL 1BLIA 3WUWB 1U8JA 1FVDB 1INDH 4X6DA 5DFWH 1YY8B 4ZXBA 2Y6TE 5DRXB 5B22A 5JQHC 3MPCA 5EEVA 3EDDA 1JXJA 4TTGA 3ZUCA 3DSNA 3MRJA 1IGYA 3GRWH 2FO8A 3RL2A 4FG6C 3Q06A 1JN6A 4XN1A 3ARFB 2VRQA 2NY2B 5ECJE 5F44A 4JCWA 2DWDB 2AQ3A 5FB8A 4IIQA 3LN5B 3BAIA 4L8BA 2BOLA 3APNA 3GYRA 3KLHC 3FO1A 2E8YA 3OKYA 4PRNA 3VMNA 3BH8A 1ONQA 4J8RB 1JVLA 2BDNH 2UX7A 1S7VA 3GXPA 4H88H 4KRNA 3CXFA 4NQCD 4YE0A 1Z9SB 3VFWB 2C3GA 4NKMB 5J5EA 4GEJA 3IFOB 1SDAB 1X7QA 1DJHA 2LU3A 4NQDE 2EXTA 4FQHB 4UQ2B 1K72A 1QBAA 3TEXA 5BRZE 1A7RH 1UKTA 5GGUA 3MLXH 1IZJA 4MJ5B 1PF3A 4FF9A 3U9PL 2GY5A 2TSAA 4R6UA 5C86A 4QRPE 5JUEL 3TVMA 2EXWC 1N2RA 1UGNA 3EDJA 4TTDC 5EOCL 3ME0B 3D34A 3S35H 2DMCA 3HBQA 3PPSA 5AL0A 4HUUA 5CINL 4I1PA 4F5CA 2NR6C 4ODUA 4LGSB 1KJMA 3U4EB 5JIIA 3QIBA 2VXSH 4XCEA 1RU9H 5E1HB 4JM4H 4XCNA 3O4OC 2XA8L 4RGNB 5EO1B 4N87A 1TCRA 3I6LD 1NLBL 1FV1A 1P5UA 3APCA 5FS5A 3TIDB 1HEHC 3H2WA 4EUPH 3L95A 4I3GA 3S96A 1W2KT 2CA4A 3FRPA 2R1WB 2C4XA 4W4NA 1JVKA 3RE0A 3VFPB 2GW5A 1EJ6A 2XWRA 2W65A 2HUHA 4KGJA 3ZDXF 3W56A 1DJSA 1TTBA 1NQBA 2C1OA 5EH1A 5D4QA 3NSDA 4NN5B 2GTZA 3GXMA 3LRMA 3MQIA 4UTBL 4YHPA 5GRXG 3GSNB 2DJUA 4YL9A 4S10A 5IB1B 4XMWA 1IGCH 4JFZH 1DJIA 1R34A 4NQXB 1Z2KA 3FB7B 4PJAE 3CFKB 2AMGA 4OGYL 1IQDA 5AOKA 3HBZA 4LPVA 2R0LL 3D1MC 3EG9A 5ACMA 3VGHA 4WUKL 4HU8A 4LCYB 2V9QA 5HHMB 4NQVB 3MRCA 3VWJD 4ISVA 4MYPA 3RVTC 3WS3B 4L1TA 4G6FD 2A77H 4E9SA 4PJHB 3FBQA 4AW7A 1H3GA 4Z7UE 3DVGA 3N9GH 4HIPA 3V6ZB 3T3ME 1UXWB 5H94A 1A7NH 1MQKL 3ARSA 4GG6A 4HKZB 4ZX3A 1QFWI 4OZGE 5A6IA 3G08A 1KXVC 3QVAA 3MLPA 1BYPA 3U46B 1UQSB 4HBQA 1KTDB 4NCDA 4GFXA 3B56A 5E03A 1QSFD 1E27A 1SPDA 4QRFA 2WQVA 1RZPA 3DX3A 5IV2A 1F41A 1BIIB 3OKNB 4X8GA 1XF3B 1MY5A 4K2UL 1DO6A 2B1AL 1X5IA 2Z31A 5ESVA 3TT3L 1SXSA 1ZT7A 3QDMB 5KVEH 3NIGE 2L7UA 1MCQA 2C5DC 2OZNA 2N1TE 1L6PA 4AC2A 1G7QB 3NCYS 1PKQA 3V9FA 5HPOA 1OGAE 3TWYA 5I5JA 1DVYA 1MFBL 4AIXA 2ICEB 2WSDA 4H1LB 3MRLB 5IHBA 3ULSA 3GSNL 3U7YH 4XOCA 3BUPA 1T4KB 1ZWIA 2AV1B 3R06A 1MCJA 3JTTB 4FXKB 5AOMA 5IB4A 3WIFA 4BFOA 4F1ZA 1WEJH 5JMOC 4UU9B 4TULL 4RFOH 5FV2A 2R2HA 3CH1A 1J12A 2JJTC 3IDXL 4G8EB 3RDJA 5IIEB 3QBTB 3QS3A 3KJ4B 1WZAA 1BZ9A 1ADQL 1UENA 2YPLE 3UO1L 3F7VA 4AQOA 3FTGA 1P1ZB 1YC7A 5D71H 9CGTA 1H19A 2VLRE 3LZFL 2QHRH 5E2TL 3V8OA 3VX0A 4ETQA 3V7AG 1VIWA 3OR6B 4F3FB 4DKFH 3KS0J 3EFOA 3WDHA 1XSJA 3PHOA 1QFUH 4Q0XH 3X14A 5E2WH 5K69A 1KLGA 3RBGA 1VFUA 3L3IB 4NNXA 3TJHD 1QBLH 2CU9A 3VVVA 2HG0A 2F54D 2NT1A 4IKIA 5C0BB 2BOBA 1J5IA 4JJ5A 2VDLL 1AXSA 3N41F 3O3AB 3PP4L 1FLTX 3POCA 4J3BA 4K3EH 1KJVB 2XZCL 5FCUL 4TPRH 1WBZB 3UROR 4N5EC 4DQOH 4NI6A 2H5UA 4ZFOB 3B9AA 3S2AA 1ZHNB 3GINA 1KB5L 1Z0NA 2J21A 3BH9B 2ITCB 3FFOA 4GG6F 4UILH 4HLZH 3ASWA 3PGCB 3RIAF 2QLVB 4LCYA 5E9DB 1UXSA 5KTEL 1IVTA 3A4FA 5DK0A 1ETB1 3AG4B 5EU6A 4ZW8A 4EVNB 1KIPB 4X6EA 4FABL 1R4XA 3SYAA 1A25A 1I7RB 1FFPB 1NEPA 4UV4L 3FK3A 4MA7H 1JD9A 3BXNA 4HKZA 3S36H 3QQNA 2B14A 4UQ2A 3W9EB 4TKWA 4Y19A 1KBKA 4N22A 2X5PA 5JQ6L 1JZFA 3FT4B 2CJUH 3EYVB 5B3NA 1JIBA 2QV2A 2COQA 4N25A 2KUTA 4JRXB 4PJEE 4L8SB 3BUBA 1L6ZA 1AGBB 3KDPB 3U25A 4L23A 2YBRA 5D2LF 1CCZA 1AYOA 3Q5TA 3BPOC 4NN6C 1H9VA 5DMKB 2R4SH 3BE1L 3LZNA 4UT6A 4HIJB 2R56H 1RURL 2QHLA 4F15B 5F9JA 4BA0A 1JV2B 4NUJA 4UDUA 3GI9L 2EDQA 3GS7A 4R90L 4WFGE 2FLMA 3G5XA 1TMCB 3KL3A 3QDJD 4A6YA 4IRJA 2F53E 2F08A 4FAAB 1SF3A 3KMDA 3LCYA 4GIPD 3FQ1A 5EZLA 6PCYA 1J8KA 2AGJL 3QULA 3KLHD 3LKNA 1BLNB 5KWYC 1QFPA 43CAB 3HG5A 2FB4L 3MLZL 3S8WA 1KXQE 2CIIA 4I9XA 4N8PA 1RP9A 2G5BA 3QORB 1AO7A 2W0FA 3DARA 2HFTA 2NY7H 1XF2A 4NO5A 2CHZA 4G43B 5DJYB 4BWTA 1WGVA 3LH2L 2DM3A 4F15C 1U6AL 3BZFA 4OUOA 1E50A 3DC0A 1N12A 4O4YL 5H37A 4WKXA 5JXED 1ND0B 2PXYD 5J13B 2B9BA 4OZHB 3KCPB 3DK2A 2RACA 4HEPA 4JY5H 3BN9C 3L9RA 3VFUB 3VXSB 2YGOA 3L5XL 2XN9B 4X7CC 3A4EA 1NFKA 2R9HC 2WP3T 2IMMA 3FUDA 3GRGA 4ZFZA 3A47A 3N06B 3TP4A 1J1XH 1UWYA 5F97E 3UO1H 2JCWA 5IJDC 2WLNA 3FN0L 4LKXB 1HI6B 4X98A 2IAAC 4WY7L 4LARL 4PJ9B 3QO1A 5E70A 4POUB 4S1SL 2DQUL 1QFWH 3VGAB 1XCQA 3WUWA 1XR9B 2WZPA 4KZDL 3TH2T 1BMGA 1L9NA 5BUGA 1JNLH 1FVEB 5ACZA 3RGVD 1IBDA 2OR9H 5AW9B 5DS2A 3OVUB 4D8OA 2FIRT 3PCYA 3EBHA 3HG3A 1L6XA 3OF6D 3GS0A 4ONFL 2XACC 2ZXQA 1OAUH 3NSJA 3OF6A 2J56A 4LLYA 3OB0K 3SDDA 3QUMA 4I2XB 5F9OL 3C6LC 4LSVH 2WN2A 3WFEH 1YUHA 5I19L 1R19A 4Z7QB 4CMHC 1A3LH 2WTRA 2XYBA 1YO4A 3IDGB 3TX4A 3T4YB 4AIEA 2AK1H 3ROLA 4Y5XC 1GH7A 5IQLA 3L5XH 4GG8A 1YAZA 4NRZB 3MBXH 2OA9A 4I1NB 4HULB 4LKCB 5JR1H 3HC3L 1K4DA 1UZ8B 5DD0H 4YSCA 5LXGL 1I9RH 2YPVH 5CZXD 1M9WA 3ZJAA 3T6XA 4R7NB 5FHAL 5FDWA 1CGWA 4BXSV 2Z92A 1WICA 4G8IA 4JRXA 3WFEL 5DUML 4JPSA 1PZSA 1XT5A 1BJ8A 4EIBA 2VZTA 1IC4L 3IGUA 1X9RA 4MS8C 4RGOL 1JYNA 4PIRF 2G30A 1JPGB 3CDFA 4NO0B 3CZEA 5FYJH 5BOJA 3FYIB 3DTXA 4AYID 4J3SA 2LLGA 5I1JH 1UVQA 3HPLA 1MFCL 4QJ4B 1ICTA 2BCKB 2HFGH 3QJQB 1RUPL 1PG7H 2DTSA 5MHSD 35C8L 5GS1A 4HJEA 1F58L 1PU0A 2YUXA 5F1OB 2C3XA 4PSRA 3ZX1A 1KBVA 4EI6A 3ZQWA 4RNRA 5HHQB 2DQMA 4ZOEA 5K9KA 3LKNB 3VH8G 2ATKA 4XMXA 3S3SA 3WXVH 1XGUA 3KWWA 2EDOA 2E7LA 1RURH 5DHVH 2ZT9C 4KNSA 3VFPA 3ASOB 5CD5D 4U6YB 3WNLA 2E6PA 1E9OB 1BD2E 2R23A 3OB8A 4OFPA 5EZOL 1WLHA 2EDFA 3HNSH 5FCSH 1BXUA 4P2OA 1BF8A 4LOUD 4PJXA 1OTSD 4JCMA 3C2SA 1AVAA 4AG4H 2UUDK 4QEGA 4B9CA 3DXAD 5EN2A 5AD0B 1KT2B 3INUH 1WO2A 1U8HA 4OKDA 1GZPB 3VRJA 2QVTA 5FA4B 1YPZB 1TEGA 2XWTB 4H0LC 4LAJH 3CZKA 3ZQXA 1DCEA 3D9AH 5D1QB 3JTSB 1LEKA 1UFUA 3PY9A 4DGIL 5KZCD 2ZNXA 2A2QT 3QJUB 1JFHA 4JFDE 4W68A 3S3CB 3IPEA 1MKFA 4L3EB 3O4LB 3VFNA 1SFDA 5T33H 1CR9L 1U8IA 3HUJB 3ZR5A 1INEL 2KBGA 2NX5E 1ACYH 4ZFZB 4OUUA 3T8VA 4KC3B 2EIEA 1X5YA 3QEHB 3WKPA 1CJYA 3ZLQC 1F02I 4PVLA 4MQXD 2XRAH 2C9VA 5CWSA 4PJ8C 5EA0H 5FO8B 1TLMA 4IBVA 3EOBB 4FLHA 3GMOA 3ESNA 5I71B 3G6DL 4JQIL 1A6TB 4NJAL 4XNAA 3L2LA 4MA3B 1BJ1J 3VQ2C 1A3RH 1F8TL 4LLYB 5GS1C 1ILSA 2NCEA 5C0DA 1D6EB 1GGCL 3HTLX 4Z3FA 4U05A 4OQTH 2Q86A 3FUFA 1RZKH 3O2DH 3WLBB 1CBVL 3LS5L 1A4KB 1CPUA 5K9JH 1G7IA 2RBLA 4PBDA 2CIIB 1HSAA 3V5HA 3GZKA 1RJLA 4NFDA 2DH3A 2ZKMX 3DUSA 4YSEA 1FFRA 1TT6A 4TSBH 1OGSA 1XCWA 1J48A 4G11A 2NY5H 1XCTA 3MV7E 2VR4A 2WNXA 2CUHA 4YXKH 3MLYH 1ND0A 2OTPA 2NPLX 4DEPC 1FFTB 3QQDA 4ATWA 3EGXB 4QRRB 2HFEB 1IC4H 3IDNB 5D2LA 1SLWA 3PP3K 3MV9A 1WCQA 2ED9A 5GHWH 1DVUA 2WXFA 5J3HC 2GITA 1U3HB 4AK2A 4QHUA 3ARZA 1HIML 3EYUH 4FTVE 5L8LB 3JYCA 1H3WM 1PBYA 5DD1L 3KWTA 5C0RH 3ARED 4U1MB 3MBXL 5KVDE 3TJHC 1E4JA 3CU1A 1G7HA 2X4RA 3OXSA 5DD3L 1JFQH 3D09A 3UJIL 2QQNL 3MV7D 1T2QH 2ICWI 1JJUA 2W07A 4KI5F 5GGQL 3BVNA 3OSKA 4P49A 4XWOD 3OKMB 1HNFA 3BH9A 3MJWA 3UC0L 3UERA 3WFBH 4F7EA 2VXQL 4PGCA 4K8RL 4OFIA 3BT2H 1A9EA 1X5GA 4FULA 2KKQA 1AI1H 4KBPA 4YO0B 4YHMH 1NGPH 5DD5H 4TOYH 3HI1B 1HHIA 4D9RE 4O00A 2P52A 4N2LA 1MCCA 2V17L 3BPOB 4PJ8B 4DSYA 2PR4H 1QACA 1G7JB 3ZVVA 3RIFF 4OCWH 1T7XA 3P0YH 5L4FA 1PVHA 4Y5YA 5BRPA 5C9KA 1I82A 4XWGH 1X4ZA 3VRIB 4UOZA 1C08A 5E00A 5EO0A 1U92B 5C0GA 2C26A 3HZYB 4ONHB 4KJYB 1BZ7B 1W0VA 2VXQA 2WINB 5MEPB 1JWSB 3OJDB 2EDTA 4FZEH 1R3JA 1T2JA 1J88A 4GIOA 5I1LB 2P80D 5FFLA 1FG9C 1R33A 1ZVNA 4KXDA 1A22B 4OFQA 2XXMB 1VEPA 3HRZB 4LL4A 4EMZA 4WU7B 3RA7L 1QLFB 5C08E 5FOBB 2ZX8A 1J0JA 2X3AA 3FFDB 3IU3B 3NZ8B 1AR1C 4NGHH 3DPDA 3JSSA 4PRAA 3SY0A 1IEAB 5ACLA 1AIFA 1C5CH 3S3PA 1PKOA 4NO3A 1OK8A 3HB3B 3I6KB 3SKOA 1D2PA 1X7SA 3BHBA 4FQLL 3T4AC 3GB7A 3V9EA 2WLIA 3GSXB 2XA8H 2WTOA 2FB4H 3KGRA 1TOXA 4XOBA 1JGUL 2NR6A 1N10A 1IM3B 5C71A 1FL5B 4KNUA 5BRQA 1KLUA 5IM7B 5ICZB 5DQDL 5SWSA 3AMLA 3JTBA 3DUSB 4K71B 4X6DF 1KGCD 3MDJA 1GKEA 2R23B 4PP1C 5JTWA 5ANME 1G87A 3V0JA 4FQXA 1M7XA 4FFZL 1O75A 5GRVK 4Y5VC 1XCTB 2I24N 4NX0A 5JYLA 5C2UB 3QB7C 4HMCA 2FSEA 4MAYA 4PJ8D 5IZ7A 2PTTB 3ETTA 1BHGA 1LMIA 3P0VL 3SCMC 1LEIB 4L4TD 1U8HB 2XIIA 4AENB 1S9YB 3GMLA 1EHAA 1A6ZB 5FGRA 4Q9QH 1XMEB 5DJ8A 1UCBL 2CM5A 2XTJC 1YDPA 5E5MB 1BQHB 3LIZA 2QPDB 2ZP8A 3KJ6L 4GRWE 4YHOL 3IB4A 4B3EA 3VG0L 3FO2B 1CGSH 2HVKB 3T6ZA 3II1A 3VFVA 4A68A 1U2YA 3K4ZA 5F96H 1RK1B 4KY2A 3D85D 1HYSC 4NFBA 4BFGA 3L17A 5F0JB 3ROOA 3AWEA 1NCJA 1HHGB 4ONGH 1UWXK 3RWIA 2VZ1A 4M7LL 4R96B 3CSFA 4RZKA 2WOYA 5EIIB 1OAUL 1U3HD 3RWCA 3BSHA 1KTJA 3I85A 2JF1A 4P5SA 3EH3B 2YOCA 4FJZA 4Y5YC 5F88B 1Z66A 4PJGB 4HP5A 4NRXB 1IAIM 5FYLL 1I8MA 2J5LB 3IMWA 3VWKB 1KBPA 1WVZA 1FNAA 4OGQC 2P5WB 3QXDA 1F00I 1FWXA 2F54E 4CNIA 1KWKA 2HTKC 2NZ1A 2WXMA 4E9VA 5C0IB 2WBWB 1YUHB 3JT0A 1Z9SA 3RJQB 5CD5C 4D8PA 2WYIA 3G6JA 4IRSB 3KYKL 3U36A 2OJZL 4S1DC 3QUYD 1JE6A 3ZTCC 4G6AD 1Y1DA 4HFUL 1Q0EA 2AJZB 1FG2A 4R4BA 3NZHL 1DQQB 1C08B 4FD0A 3LS4L 4OCXH 3BH8B 4GXFA 2HTKD 5JW5B 5KAQF 3VXQB 3CFBB 2VDOL 5B1CA 1KXQA 2X9WA 4HJSA 5IOPB 3WEXB 1ZS2A 5F7EH 1PGRB 5JIHA 4Y0GA 4L18A 4BZ1A 1JYVA 1QRKA 1RPKA 3X1GA 1SVZA 5C1MB 2CKBH 2IAMB 4HMDA 4IQHA 4M7KL 3IMBA 2QHRL 4U31A 1FL3B 4GAYA 1GYUA 4WFHE 2YA2A 1U8CB 4PV9B 2J8HA 4HPHA 1KYAA 1JGIA 3SGEI 2X6CA 4R5VA 1YEDB 3UADA 2DL9A 5IEHA 5CCGE 1IL1B 3W9DA 1X6LA 3LNDA 2AK4E 1ZA3B 3IJSB 5F7DB 2AJSH 4L0ZA 2GITB 4YZFF 2Y6SD 4OKVB 3K6IA 3DIDA 3MNVA 4ODSH 4Y5XA 2YPLA 3H55A 4TUKH 1CYXA 1QSEE 1VCBC 1WA1X 4JM2B 2VDNL 3IFPB 1CLCA 3LB6D 2Q9OA 3C09C 4NN5C 4ALAH 3QUMH 4YZFE 2OMBA 1PY4A 1RULL 1OAZH 2Y69B 5A3IC 4IBQA 1TJHH 4F1SA 1C5DB 1T4WA 4GH7B 3QJRB 4NPJA 4QAWA 2GCYB 2WNGA 1RLBA 4IEFB 4H4NA 1CYGA 1R0AL 3ILPB 3PQYA 1CGYA 3LQMA 3VXNA 1ZT4B 3K91A 4ZQKB 5GGRA 5HI5D 1BEYH 5FB8B 5BXFA 1SLXA 1QATA 3FH7A 3HFFA 3PRZA 4NXSA 2EVIA 4JFXB 3H9HB 4E42B 3KXFE 4HQQL 5HI5C 5CR8A 1OGTB 3RWJA 4I48A 4HG4J 4JHUA 3GD1C 5DVKA 1MIML 3T9WA 4NP9A 2A9CA 2EDEA 4NEHB 4PJAB 1KYOK 4W9KC 3N50A 3OX8B 5KYNA 4PJEF 1EMTH 1AD0A 5DJAA 2ALAA 2V2XB 2HT2D 2QADB 1OM9A 1Q9WA 1WJ3A 4WWOA 3BKJH 2EDYA 4XN7A 5I18L 3DMMC 2KLSA 2MOQA 5CSBA 1GIGL 5KAQG 5GGUB 1H9DA 4UYQA 1FFNB 5F3FA 3L3OA 1OGAA 3AM8C 5CP7A 1MG3C 1QFOA 4LEBA 4A55A 1QSZA 4JRYD 4RISH 3MX0A 4XP5H 3ESVF 1RUKL 3ISYA 3ARVA 1GJWA 4JJHA 3ATBA 4MVBC 2O61B 4JG0H 4LLAA 2FK9A 1I1FA 4RMWA 2JCCE 2WD0A 2NUTA 1PQZB 3EOBA 4OJCA 1VFOA 2WBXA 3OHXC 2WLKA 4BUGA 5FYKU 3RX5A 3W0WB 3U30B 1DQQA 1SLUA 3IMSA 4P59L 2WYTA 3RU8L 2GI7A 5EU4A 5I1IL 4HX1A 2EACA 2WTPA 2YOAA 2HVBA 4RAUB 3RTQA 1FH2A 2RALA 5FO9A 3O9WD 1W8OA 4QO1A 4XPHL 1WTLA 3K72A 4HCRL 2HB0A 2VQ1B 3DRQA 3NSFA 4LCCA 4X6CB 5GGTL 3ZTNH 1SLVA 3MGOB 5EORH 1EJOH 4NQTA 4HEPG 3MO1A 3V7AE 2A5UA 3MROB 4X5QA 4HJIA 1DVZA 4EIGB 4TVPL 1FA4A 1KJ2A 1B2WL 1NKGA 2R2BB 3QUYA 3B6SA 5MI0C 5DHXB 5SWSE 3SE9L 2ZZUT 1P1ZA 4G6JH 4J12A 4MX7B 1AP2B 3PGFL 4OLXL 5AYQA 4QRAA 1A6ZA 1G84A 4ZUTB 3TBWA 4MAUH 2EDNA 2VJ8A 3BT0A 3DDFA 4QRRA 1T5XB 2HFEA 1TYRA 4KO5A 4X9FA 1B4TA 4BSJA 1CDIA 2F2HA 3TA3D 1WV7T 4TN9A 5LXVA 1AXSB 2XVLA 1O5PA 4JG0L 1A7PH 1DQDL 4GW5B 4MQSB 2Q20A 2BFVL 4YXHL 2DEWX 5F21B 4FADA 3OG4B 3WFCL 3OJMB 1KLGB 3QUXD 2Q7YB 2ZPKL 1TTUA 4P4KD 5TDNB 4F91B 5ISZA 3WV0A 2PO6D 3KGUA 3B34A 5KVFE 2PYED 2EH8L 2XZZA 5DU7A 3QYMA 1U41A 4JGJA 5FO2A 2ZWYA 4IGBA 3H8NA 4NQSA 2RA1A 2IGFH 3GSVA 2PO6C 4I8DA 2O4EA 3GUTA 1I1CA 4KRLB 2PCPB 3VH8A 5KS9E 3EYFB 3DO4A 3EGSA 4EVNA 3DJSA 4K94H 4O2CA 4W9HC 1GTFA 1HC1A 3R0NA 5BQ7A 5I0DA 1UB6B 5IVXB 1MIEH 1ORQA 3TO4C 1PG7W 5IFHH 3NJIA 2AW2A 5EU3A 5DMGD 1QSEA 3AZUA 1BEYL 5KOMC 3MJ8A 1SF5A 2ARJQ 2XOTA 2KQNA 1V55B 3UIZA 3ZRFC 1NFIB 1SM3H 3LN4B 4F7MA 5KJRL 2R0LH 1E3ZA 2YAFA 5BQDA 1IX2A 2A6DA 3RWDA 3LV3A 1F90L 4WI3A 2VR3A 5LG1A 3CBJB 3RWFB 2DWSA 2X6BA 1R24A 3W0WD 3FFCE 3QUML 4G8GB 2X1PA 2EC9T 5SX4H 4KK8C 5C0FA 4PBVC 3QDJB 3FUIA 1JWMB 3VI3B 1DQLH 1NBVL 5I8EB 2WXGA 3MX0B 1P4LA 4DP5X 6FABH 5EBWA 1KDJA 2LOEA 2JTDA 1VRSA 5A16A 2WB7A 1CF1A 4BFIB 1OSPL 1EO8L 3T6WA 4LCWD 2X9XA 1ZA3A 3SCMB 4PJIA 2XV2A 1RMFH 1ZV5A 4WEBH 4Y8AA 4X9BA 4QR7A 3BSZL 4JO3H 1JVOA 4GRMA 3WY1A 4MZ3A 4K94C 2IALA 2ICWB 1EGJH 1GW0A 1U8QB 1X4XA 2K6WA 1FHNA 4RAUA 3CQPA 3D2UB 3PHQA 1L9MA 3TGXA 3DJTA 4X6CA 1A1OB 3NDZE 3P9LB 1NCDL 3HZMA 4L4TE 3GJFB 3LKRA 2CWRA 1ZT4A 5GGRB 2MJWA 4XN2A 2EZ0C 4OZHA 3WN5A 2XQBH 1A14H 3F84A 4IHOB 3QYCA 4S2SB 2HJLA 3QUZD 4PJAF 1X5KA 5L6YH 4QXTB 4FFWD 4NO5B 3QJFB 3MV8B 1IAIL 1M3JA 3D0LB 1TJXA 2ZE0A 2V5TA 3A24A 4MD0B 4G59C 4XMKL 4X6FA 2BY0A 2IDQA 3FO9B 1S9KC 5CEZL 4ODWB 1XCXA 4AUUA 4D7PA 5CILH 4G5ZL 4RZCB 3GC3A 4HKBB 5I2IA 2CLZB 5IHLB 5JQIB 5J1TC 2JTYA 1RERA 2A4CA 5FAAA 2X6UA 2N01B 3PJNA 2BVPA 4O2FB 4YPGA 1BG1A 4Q0XL 4JPVL 1FFNA 3NEXA 1FFOB 4NIYE 5SX5K 4BQ8A 4ONGL 3RPIB 4ACPA 1CICC 1R5VB 2WM0A 4MVBD 4LSTL 3V0WL 5I76B 3TN0B 1PZ2A 2UZIH 9PCYA 1AKJB 1AXTH 1RKRA 1F11A 4Y4FD 4UQ3B 5B21A 3ZGIA 5T3ZE 3UZEC 4EIZC 1M1XA 5JORB 3W37A 2Y72A 5IQ9A 5ITFA 4QRUA 4HIJA 2CJSA 1INDL 4NZUL 1KBBA 3KPRB 3T4YA 2B0SH 5F9WB 4DKAA 3U1SL 1FORL 3JV6B 4F7PA 2DYPA 5JHBA 1L9SA 2DLFH 4AVIA 1JTPA 4MNQE 4NQDA 1MY7A 1TLKA 3CVIL 5FLVA 2BP8A 5F9AC 3SE8L 1MH5B 2WWMD 3QUMB 4I2XA 1KJ3H 4JRXD 1Q94B 1F6LL 5L9DL 3CU7A 2A6DB 5AZEL 1SJXA 4FG4A 3O81A 3T04D 1FG2B 4X7SL 2VOTA 1WUNT 3QULB 1DUYA 3TF4A 4PG2C 1T04A 4Z7QE 2VJ0A 2DDQL 2GK0B 4L9LB 4F92B 4HD5A 4JO5A 4K9EL 5DWUH 1CFTA 4B9KC 1U95B 3MCKA 3VCLA 3QG7H 4J3OD 3WL9A 4OIBA 3DRTB 1J1PL 1Q9OA 3N04A 3W5MA 4ZMAT 3I2CH 3DMMD 3UTSB 4X4XB 1D5IL 3ETBJ 5MEQB 5CLZA 1WD8A 1GVIA 3STZB 3C5ZA 3IYLW 4F9LC 3L9RB 1JUFA 4MWFB 1HNYA 3FU9A 4G7VH 2GBVA 4RMUA 1JNNL 2IC2A 2W9LA 4CUCA 2BC4A 2CGRH 3HNVL 1GC1H 4N1CA 1Y18A 5C9JB 1M7IB 4RAHA 3HG1B 4BE5A 2NSXA 3F12B 2P43B 1Q90A 1XZWA 1XR8B 4GRLD 2EO1A 1ZS8B 5DZJA 4PJIB 3RHWF 1IBYA 4RH4A 5BO1L 1DFBL 1WC7A 1LMKA 2E56A 3AG2B 3BP5B 3QHFH 4OZFH 2GCYA 1QASA 2DWTA 3ILQD 2NXZB 4K9EH 5AG9A 3SZKC 5KW9L 1NEZA 5IBTL 2XN1A 2JKNA 5IMKA 3K2UL 3IFNH 3L4YA 5LJYH 5SWQA 1AR1B 3L16A 2GQHA 1E4XL 2FAUA 2PPCA 3FPYA 4JFXA 3HZMB 4UTBH 3ZE2B 2FX7L 4GBXB 4MMZA 5GQBA 1KCUL 1G9ML 5JZ7C 3N44B 1NGWA 4IHOA 5F71A 5E8NA 3ESMA 3WO4C 3HS0A 2Y23A 3WEAA 4Y2DC 1BZDA 4PRHE 3QWOA 3ALPA 1RIVH 2EVHA 5D7IB 4ZMYA 5IUCA 5L6YL 1MRDL 4TPRL 3WY3A 1IMHC 1F45A 1GAFH 2XUWA 4X80L 2H32B 4GI8A 4XAKE 2IGLA 5CSZA 1F3DH 2X4TB 1DN0B 1SY6H 4NQEB 1SRDA 2JB5L 3AT0A 1P5VB 5TPWH 3FFCD 2FD6H 4F57L 2AVFA 3BN9D 3SPVA 3GJFH 1TZHB 2QZ5A 1JPGA 4MLIA 4LHUD 4JO2L 2PW1B 4BINA 1CBJA 4GKZA 1JWMA 2ROXA 5EF3A 5KSAC 3RPIA 5BOZG 3BKYL 1EUTA 5CINH 1FI8C 1MFVA 1Z9MA 3HE7B 4LF3B 5DHMC 3LOWA 1UYWH 4YHLL 4AYGA 5I5RA 4BCYA 5I8OL 1AQKH 5C0DB 1EZUA 4A2HA 4NOBA 4JQXA 5HYJD 2I9LB 2VXUH 3QJHB 5LGJA 4W81A 2VC2L 5F6IC 4AUJA 2NY5L 1HKLH 1OAQH 2OYPA 2CUAA 3JV6A 3KWVA 3EDEA 3MXWH 2NNCA 4WO4A 4FP8L 1BJMA 2BVUA 2KH2B 3O41A 1V05A 4RBPK 4KTDH 2DYPD 4O9HH 3IJ7A 1Q94A 2XC8A 1J8HD 3IKCA 4YX2H 4UV7L 3BC9A 3TNMB 1V54B 1KG0A 3ARYA 2X4PB 3FRPG 5DD6A 1D5BA 2R8SH 1JOIA 2APFA 1JNJA 1P7HL 5D7IF 3ZXAC 4CJ0A 4HJ1A 1UT9A 2J44A 4L5FE 1U8NA 5EC2B 1H8NA 2FATH 2IIJA 3QNYA 4LSUH 2L7EA 4HSCX 5BO1H 3T2NL 2EDWA 2VLKB 5D7JA 4JKWA 4MQ7B 2LAGB 4KK9C 1BFSA 3EJQA 1P69B 1UG9A 4X6FB 3EO1B 1AJ7H 5PAZA 4P23D 3GF8A 3DI2B 3I02A 4FQJH 2Z91B 3F7LA 5AW0B 1D5XA 2WO3B 2P1YA 4K94L 3M8OL 4Y4HA 3EXLA 3OKEB 4IU2B 3MCLL 1XXFC 5BZXA 2NY0C 4L1LA 4RIRA 3MFGB 3NFPB 4QTHA 4YSAA 1EHKB 4JG5A 4G9FA 4J7RA 4LLMB 2N0MA 3S9DB 2ZF8A 4Z7WB 3DYMA 4X9YA 4UOQA 1JBJA 4LDCA 2BSDA 1FNSL 3A6CH 1L5GA 3LNIA 1LWHA 1H6TA 1F18A 1FO0B 5JPMC 4P4KC 2PWDA 1FE8H 3QXUA 3FTSA 3ARBA 4F33B 1URLA 2YD4A 2QPSA 4LPCA 5EDSA 3AY2A 1N0LB 3CSPA 3SDAD 1JZ4A 4LPXA 1WZKA 4M8RA 1BAGA 3ORJA 3KYMA 1ZGLM 3CIQA 3OJVC 2QR0B 4YNYA 2ZOUA 5SWQB 4M1DL 4PB9L 4LU5H 1RK7A 3BWUC 1AO7D 5IB5A 4NGHL 1T04B 5GS0L 1QNZH 2ZOTA 1W0VB 2WINA 4V1DB 5CF3A 4G42B 1YEHL 1CFQB 3BAEH 2MPAH 5D2NC 3VA2C 1S5IL 3P11L 3PABA 1CFMA 1MCFA 3OR7A 4W9FC 4YWGH 1L7IH 2ZAHA 5T1MA 1FNGB 3GPSA 4MHHI 3ULUD 2XG4B 3KPMA 4JO1H 1VZHA 1GZHA 1KYDA 3C12A 5DZOA 1R5WA 3W2DH 5HYFA 3BAKA 3ZT5A 4Z7WF 4DAGH 1VF5C 3LEXA 3TYGL 3EOTH 1ESOA 1J8HB 1YJDL 5T5NG 3DGGB 2N56A 1X44A 4E2OA 1XVSA 1RUPH 1YLBB 5E4EC 1J0HA 1N6UA 3L48A 5AW8B 1F4XH 5DO8A 2WUCL 2W81C 3BEVA 4EN3A 3NA4A 1GYVA 3BIKA 5GJSH 2E3VA 4L8DB 1JF1B 1YQVL 2PF6A 4W70A 4MAYD 5KZCB 3KBEA 2Y3AA 2IFFL 2NSQA 2P45B 3GXNA 3HMWL 2MWCA 2WKLA 2PTTA 3HC2A 5E8PA 1OT4A 1JFQL 1YMMB 1W8NA 5B8CA 1EEZB 1COBA 3QUKB 4HCRH 2F6AA 1GR7A 4DW2L 3EXJA 1CTMA 1BF5A 5DWPA 1J1OL 5F1IA 4ELKB 1I1YB 2L04A 2W92A 2G4GA 3SO3B 1U6AH 2YQ3A 1IGTA 2LT9A 2GSIB 4JKKA 4XODA 3RPBA 2O5ZL 3Q6GL 4Q6IC 1HDMA 1XTMA 3DNKA 1DEDA 5DA4A 5T5NF 4XPFH 4M93B 4K3DH 2F53D 2EKSB 3DHUA 4Z7VE 5E7FA 5I6PA 1TENA 5ETUB 2J5LC 5AB1A 2O72A 3ZK0A 1JZDC 2JB6B 3CHPA 3H7BB 4RWYH 1J5DA 2HX7A 4S1SH 3DMMA 3K0WA 4N2DA 4DTGH 3D3VD 4C4UA 2DDQH 3PHAA 4JY6B 5BNXD 3D3VA 4Q52A 5TK4A 4BYHA 1RIHH 4GBXC 4LPUA 2OMXB 5KSVB 2IPKB 4WJKB 2NXZD 2FR4A 5KSBA 3D25B 3UTPD 2R4SL 3MRDA 1Z3RA 3NUKA 2DLIA 1KY6A 2OULB 3CUPA 1WAAF 4NUMA 5EUKA 4FNLH 2BVEA 4N0FA 3G6JE 4LSPH 5SWZE 3ZMEA 1Q9LB 3ZGHA 4FYTA 2P5WE 3V6OC 4PJCF 3SO5A 4Z78B 3MMEA 1WFNA 2BZDA 3L3HA 4DP6X 3EBGA 1PKQE 1IAOA 2D9CA 2J8OA 2XTLA 1ZT7B 2BZ7A 1T0PB 3OWRA 2JKTM 2FWOA 4P3CL 3MRMA 2NNAA 1TQVA 2NY4D 3F05A 5EZIL 4AZUA 2NZ9C 4CRPA 1KUMA 1CFTB 3EBAA 1NDGA 2J6EA 4OFDA 4JN2B 1OTTD 3QZLA 3TESA 3WL9B 3LJ3A 1OB1A 3DROB 2YRBA 5LQBL 4IBYA 1TQBB 4M7JL 4Z3JA 4LRNL 5DLLA 1CD8A 3X2QB 3WYRA 5KVEE 3QEQB 1DL7L 1SXNA 1KB5A 3ZKMC 4ZO7A 3DJZA 1W8EA 1XGPA 3T2OA 4K7PL 2DTML 2WLHA 2CCVA 2YPLB 3UC0H 3CTTA 4I0KA 4LLQA 2OXGA 4UT9L 3DLQR 1QTSA 4LLDA 5KSUA 4K7PX 2YD7A 4PRDB 3WS3A 4HAGA 4RMRA 2IDFA 4DUVA 3ZDYE 3D8MA 1IL1A 1HHJA 2QKIB 2H3NB 4MMXB 3IS0X 1GJUA 2V5SA 3O3DB 2BDNL 3R4RA 4GP8B 2WOBA 3PQYB 3VXNB 3RRQA 5TF1L 3GHEL 3FRUB 3GSQA 3ZYZA 3HZVA 3MV11 4L29B 4Y1AA 3RZCD 2F54A 1AQDA 4Y1AD 3EJUA 5B7EA 3ZSSA 3VNZA 3WNOA 1GY1A 2EC8A 3L6FA 2TRHA 2C4FU 1ZIBA 1WFMA 1GOFA 3P69A 4A7VA 5A43C 1FFPA 3H3PL 1RIVL 3RFZC 3FXIC 2DI9A 5I17A 3OXRB 2LV4A 3B43A 4PTUA 1OGAD 1JZHA 1SXZA 2C9SA 4PG9B 2KL6A 3GLDA 3L5WB 3V0HA 4AQ1B 3VW3L 5CJBA 2QQKH 5E08L 5AOIA 3ES6A 3QQ3A 4FMFA 4YSRA 1TJGL 3MUZ1 2GSIA 1FIGH 2OP4L 4DF9A 3DA0A 5H35A 1QR1B 1XH3A 3UPRA 1QPKA 1ODAA 5GGTA 3SBWC 5CUSH 2DMHA 4E41D 4HPYL 3HBGA 4EZJA 2RGSA 1ONQB 4R7LA 4XHJC 1OCZB 3EBIA 4KMTL 1FC1A 4OQTL 5DMKA 1GZQB 2WO2B 5EZPA 4PJDE 4AYEC 4GW4A 3RTLA 3D12B 5CLWA 2AITA 4Y1SA 4D9RD 3THMH 1N8ZA 3HI5L 4IJ3B 2VN7A 3GMPB 1E8YA 4HJ0C 3IJSA 3JV4B 3NABH 3UJTH 4WFFE 3VM5A 1FC2D 4AT6B 1JPTH 1UCBH 3IDYB 4F2MA 1GOHA 2NUPA 4NSKA 4EN3B 5E6IB 3LRSA 2ODHA 4JHAH 2IFFH 4LGPB 3II2A 1BYOA 2VDOB 4R4ND 4DZBA 1E9PA 4K7PH 2Q2EB 5JXEC 1P6AB 2PNDA 3FC8A 4NC1C 3DROA 4ZK8A 1EANA 3UDWA 1BMWA 2B59A 5AL8A 4BHUA 5J6HA 3WKML 2VJXA 4OAWA 4N2AA 4NC0B 1F4WH 1XIWD 2X4UB 3NFSL 3V5KB 3VMPA 3RG1C 2XN9A 3DTDA 2P8LA 3ARDC 5KVFH 5GGSA 3G04B 5HHOA 3S0PA 1JHLH 1MREL 1R75A 1S5HB 1IGFH 1YYML 2X3CA 4OLUH 3NOIA 1FUNA 3T1FA 2ZKHL 2NW2B 2WXLA 4UM9B 4AG4L 4H8QA 4HUWA 2BNRE 4R8WH 2R59A 2H8PA 1FNEB 3JVFC 1O6SA 5I30L 5D4JA 1A9BA 3HI6L 4WUUD 3TT1H 3MLTB 1AQHA 2AQPA 2FJGA 2IQAA 3OC5A 4U1GB 1VFBB 4HK0A 3VI3F 1OGAB 3NTCL 3FU8A 3LZPA 4HH9A 4IGBB 4X98B 1I1AD 1HFUA 4JO4H 3GSVB 2ZNWA 2DQCL 1RIHL 4YHNB 1USZA 5GZNC 2V2WA 3PREA 4HWBL 4NKIH 4GP5B 4OZIF 1CT8B 4L9DA 5KVGE 5KANI 4AI7A 1O7DC 4FQXC 2ZWZA 5H94B 1IIIA 4JN1L 3EYUL 1KEMH 5K1NA 2VZUA 4FKKA 4P5KA 4XVUC 3RZCB 2F5AH 4GG8B 3P3UA 5AVVB 1VSCA 5J1AA 5L0QB 4EN3D 4KXZI 1YECH 3AQDA 4Z0XA 3ES6B 4RFNB 2QTVA 3N3EA 5FDWB 4R26H 2JXMA 3T09A 2BLFA 2XPYA 5JNYA 4Z76B 1DLHA 1F4YH 1JG9A 3HRZC 1B3IA 4Y8DC 2BSCA 2H2PC 2NY0D 3BKCH 2DQIH 5DJ0A 5HGBB 2KYIA 1B0GA 2Q3XA 3BSZA 4JL1A 4A7QA 1IGIH 3LN4A 4F7MB 3GJEB 4KI1A 4APQD 4FCHA 2XG4A 3HS0C 2GEQA 3CJJA 4HS3A 2H47C 2UZPA 4NHUB 5L2JA 1PSKL 3DYPA 4YL4A 5KYXA 4F8QA 4PR5A 3D30A 1B9ZA 2FT7A 4NIKB 1AGFB 4GW4B 3QORD 1PIFA 1PLGH 2NOYA 1J11A 2FX8H 1TTRA 4I9WD 4M1GH 1X3DA 4ZFQA 4FHJA 3OKDA 4OJAA 2BIPA 2BMKB 1T6VN 3D2TA 1EO5A 1M4KA 8PAZA 3FF8A 4QPEA 4WSKA 1IEHA 2NY3D 3BKCL 2FNBA 4F7EB 1CFBA 1C12B 4FEMA 4Z95L 4AQZA 5BZDA 5AVTB 4BZ2L 1XGTB 2YGVA 5T1KD 1T1WB 4FFZH 5DTFB 4HGMA 3VWJC 3GIVA 5D7JC 2OK0H 1NAKL 2YGPA 4BFJA 1LEGA 1IBHA 3FO9A 4XP1L 5MENE 1FNEA 2V4LA 2ZYSA 1GOGA 2K3HA 3I9IA 3DK0A 1M42A 2DAVA 4ZFOA 3UTQA 1A6UH 3QJFA 5TPWL 2JH2A 3FCBA 4L05A 3ILQC 3C6LB 1QUNA 3BQUD 3RUGE 3P3RA 1ZHBB 1YPZE 3DJRA 4KQ3H 4NNPL 3VDAA 3QRFM 2FQEA 2WXIA 4XZUB 4ZUWA 4DK5A 5INDB 4EDXB 1VA9A 4LVOB 4XO5A 4LLVB 2Y06L 3L5IA 4U1LA 1B4LA 2ZCHL 4E41E 4QF1B 3RVVD 3EAKA 2Z35A 1LP9E 3EHBB 2FWUA 3MVSA 4MJIB 1EO7A 5FO8A 2X1OA 4NDMA 3L4VA 3B83A 4HSQA 2AHIA 5CGMA 4A2FA 2YPLD 1KB9J 3B8YA 2V9UA 3GSNH 4OZIB 5H37H 2R1XA 3IKKA 2MPVA 1ZV2A 2X89A 1JERA 3HS9A 4K7FB 4PN6A 3PWLB 5LLIC 2DJ4A 2ZSWB 3LN9A 5CAYB 3BW9A 4OLYL 1PEZA 2X4QB 1MXDA 5HI3D 1LE5A 2AQTA 3ABMB 1N59B 3I3BA 3KZ8A 3DX1A 5HXMA 4YZWA 3VXSE 4NP4H 3UTTA 4A7GA 5ESQA 5D1ZI 5HYSG 3RX8A 5I6XB 3CFEB 2FBJH 3IM1A 4F24A 1KIRA 3NH7L 4P5TA 4X2UA 3GJEA 4LEXH 3VXME 1M05B 4MMYB 1U8QA 5G5DA 4UDUB 5EF1A 3IGKA 1D6VL 1U58B 2WNKA 2CDGB 2VKXA 2F8IA 4YBQD 5FO7A 2YXVA 4LBEB 3ELAT 3MRGB 3C5ZD 2P48B 4NC2B 4Q9RH 4IIQB 4I77L 3C60D 2EXWD 2JKIS 2X4UA 3MYJA 3VU2A 4UNTA 2EIJB 4R7DA 1W72B 2MQCA 4P5MB 4ZUUA 2VLJE 3P73B 4X4MA 3VXRA 4HS3B 1IGMH 1HHIB 4APQA 4QWWC 3PXJA 1WBYB 2NLJA 5D7KD 4K5MA 4NCC2 1WT5C 2NY1C 4JFFE 3EFOB 2BOCB 2RFXB 2ORBH 3DV6B 5JOEA 4RZCA 2OCFD 5DJCA 3NACL 5DI8B 1ZLUK 2UWEF 2YUVA 4HK3N 3VXMA 1MCHA 2ZJSH 4B0MB 3NVQA 1P7KB 3I9PA 1U3HA 1QRNB 4ANVA 1MEXL 1BFTA 3L7EB 2Z8VC 3BIBX 3VXSA 4FTVB 1E2WA 3CDZA 1NL0L 2H3KA 2IBGA 5AB2A 1AG6A 4XNQB 5DSCA 5DC2A 4ZOCA 1ZHNA 4PV1C 3QQXA 3VFRA 3Q2WA 3HI1A 1WCBA 2AI0H 1N6QH 2ZUTA 8FABA