4HIPA

Crystal structure of the pseudomonas aeruginosa azurin, h126no yoh109
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQFMFFCTFPGHSALMGTLHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 31
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hipA00
3KW8A 2BP0A 3UABA 1XB6A 2YAQA 1SDDB 3AZUA 3FYIB 2J56A 3FU8A 3RYMA 2QT6A 2P80A 4CSZA 2PP7A 4HCGA 3V9CA 1SFHA 1AS6A 3NJGA 4L0PB 3FU9A 1L9RA 5D4IA 4G70B 1XB3A 4A67A 1NIAA 1BQKA 2TSAA 3IN2A 4YSDA 3FQYA 2HZHA 1OE1A 3PXLA 2PCFA 1W8EA 1PNCA 1GYCA 2TSBA 1NIBA 2BP0B 9PCYA 1ILUA 4BDVA 1GS7A 4RH4A 1SDDA 1ZV2A 2P80D 4G7QB 1PMYA 2Q5BA 3NJJA 1NZRA 4YSTA 2WO3B 1A4AA 1JVOA 1PLAA 2IDFA 1AG0A 1V10A 2J55A 2IDSA 4F2EA 4WTQA 2JKWA 1ZDSA 1KBVA 4YSPA 2NRDA 3D12B 3NSFA 4BWTA 3ASNB 3CDZB 1ADWA 2CCWA 2BWIA 1L9SA 3JTBA 2XUWA 3OMNB 3T6WA 3SBRA 1TEFA 3FSAA 3C75A 1V55B 4HHGA 4E9VA 3S3CB 2UXFA 2EIKB 4DP1X 4DP2X 1RKRA 4UAHA 3OM3B 3H4HA 3FS9A 1JXGA 3CDZA 2Y69B 3WI9A 2FTAA 2I7SA 5B1JC 3ABGA 3PCYA 4G72B 5I5IA 2YAHA 2OV0A 3X1GA 3NP4A 1L9QA 1NPJA 2AFNA 1V54B 4DPCX 4UANA 4HIPA 1PLBA 4NAJA 4E9XA 1ZPUA 2B3IA 5I6KA 2GC4C 4GP8B 1KYAA 3CG8A 2XX1A 4JHVA 1XB8A 1PCSA 4BWUA 3NJNA 2CALA 1JZFA 4DP5X 2IH8A 2BWDA 3DTUB 1AANA 2FT7A 2XV2A 2BZ7A 1CURA 3HB3B 1M57B 1JZJA 3OD3A 1KGYE 4E9WA 4MFHA 2XWZA 1OE2A 1BXUA 2BW5A 3HEIB 3IN0A 3OMIB 2XV3A 5F7AA 4JKNA 1KDIA 1ET7A 5B1BB 3FSZA 2VW6A 4KNTA 1AS8A 3ZBMA 1E65A 4BWWA 2BP8B 1IUZA 4P5RA 2VSKB 4FAAB 3FPYA 3FQ1A 1M56B 2HXAA 1TEGA 1SJMA 2GIMA 2H5UA 4W9ZA 4F2FA 1BXVA 2FQDA 1MZYA 1AZRA 1PNDA 2DWTA 3ASOB 1JZHA 1WA2X 2Y1AA 3WKQA 1MG2C 1QNIA 1WAEA 3U25A 3S3DB 1CYXA 5D4HA 4E9SA 3G5WA 2CBPA 2IAAC 3QQXA 5I6OA 4AKPA 3QJUB 2VW4A 3H56A 5D4JA 2BP8A 3T6ZA 1M9WA 1KCWA 3DKHA 2FWLB 3PPSA 3CZUB 4A2HA 2GSMB 3NT0A 1QHQA 1IKOP 3T6XA 3T6VA 3OQRA 3FYEB 5ANHA 3EH3B 1SHWA 2IWFA 2B08A 4X4KA 3H4FA 5AKRA 3NP3A 5PCYA 4A2FA 2YXWA 1NTDA 2FJSA 2Q9OA 1AZNA 7PCYA 1PLCA 1JZGA 1SHXA 1GR7A 1ZIAA 1BYOA 4DP4X 3PAZA 1A4CA 3X1FA 5B7MA 4GYBA 2UXGA 2IDQA 1ZDQA 4A66A 2GHZA 3TBBA 3CVDA 4GP4B 1KBWA 2DY2A 3CVBA 3NJIA 2AZUA 4AZUA 3NJKA 5I26A 5I6MA 2EILB 3MBWB 5TK4A 4YSSA 2WO2B 1OCOB 1SNRA 1UATA 2ZOOA 1X9UA 1J9SA 1IBYA 1NIFA 1J5DA 2EINB 2E86A 3FQ2A 1JERA 4G7SB 3UAEA 4E9RA 2PPFA 3IBOA 1AIZA 3ZIYA 4CSPA 2XXFA 4KO9A 2PPAA 4DP6X 2HX7A 3ZX1A 2YAEA 3SQRA 3WNJA 1KV7A 3SBQA 1ASOA 4YL4A 3GDCA 3X1EA 2UXTA 4A2GA 1SF3A 2FQEA 2EIMB 1OOWA 3TASA 1GS8A 1OE3A 3EH5B 4AKQA 1AOZA 1WS7A 2H47C 4QLWA 5B1AB 1HAUA 2BHFA 3AG3B 3FSVA 2X87A 3QJVB 1BXAA 4YSOA 3WG7B 1N68A 1DYZA 1NIEA 2EIJB 1AZBA 3UGEA 4E9TA 2FNWA 2CJ3A 1CUOA 5B1JA 1GSKA 1BQ5A 4YSAA 3EF4A 1NPNA 2I85A 4YSEA 3NSDA 4KO7A 1FFTB 4A2EA 2XV0A 3BQVA 3QJRB 4QKTA 1NINA 2GB2A 4NB7A 2BW4A 1OCZB 2FT8A 1OF0A 4DP0X 1NWPA 5A7EA 2IDTA 4BXVA 4K9JA 2VMJA 1A3ZA 1E67A 2QDVA 4YSCA 1HAWA 1ID2A 1KDJA 3NYKA 4DPBX 2GBAA 5B7FA 3NJHA 4Q8BA 1ASQA 2YQBA 3IE9A 2AVFA 2W88A 1GY2A 4BDVB 1EHKB 1A65A 2BO0A 1JVLA 3TBCA 1L9OA 1RZQA 1RCYA 1AAJA 1ZIBA 4DP8X 2WSDA 2DWSA 2ZWNA 1ETJA 1DZ0A 4DPAX 3NJMA 2QDWA 1WA1X 1ILSA 2A3TA 6PCYA 3X1BA 1E5ZA 2OCCB 4YVUA 2X88A 1OV8A 3AW5A 8PAZA 1W6WA 3QPKA 1BAWA 4HCIA 1BQRA 3N2JA 4DP7X 4EF3A 1J9QA 2HRHA 2PPEA 3FPXA 1KCBA 1GS6X 1W6LA 2H3XC 2JFCA 1R1CA 2R7EA 2PCYA 3FT0A 3ERXA 1SF5A 3UACA 5TK2A 1E5YA 5I6LA 4E9YA 2ZXWB 4W1TA 5I6NA 4HCFA 1A8ZA 2QPDB 3EHBB 2PP9A 5IY5B 3NSYA 3N55A 1FA4A 2XLLA 2YAMA 2VM3A 1XMEB 3NSCA 3X2QB 1IC0A 2J57A 4YSUA 4F7KA 3X1NA 4M4RB 3T71A 6PAZA 3QJQB 1SFDA 1J9TA 1MG3C 1N70A 4ENZA 1GY1A 3ABMB 1TU2A 4KOBA 3AG4B 4FA7B 2YAPA 3PAUA 5B1KA 1B3IA 2YAOA 1J5CA 1URIA 7PAZA 1AQ8A 4BXSV 2BZCA 4TXVB 3T9WA 5F7BA 1FWXA 4UF7C 1BYPA 1JOIA 1AZCA 3SBPA 2W8CA 4N8UA 4M3HA 3QJTB 5I6PA 2XYBA 3AY2A 2HLEB 1CYWA 3MX0B 1MDAA 3TA4D 3S3BB 3AG2B 1PZAA 1AR1B 1I53A 1NIDA 2VM4A 2MTAA 3ABLB 4P5SA 3WIAA 1PZBA 2JXMA 3IEAA 2FQGA 1A4BA 3EH4B 5I5JA 1MZZA 4BK5C 2J5WA 2HX9A 1PAZA 2DYRB 2UX6A 2XXGA 3QJSB 4AKOA 3UAAA 4KO5A 4A2DA 2AZAA 2XU9A 1J9RA 3PLYA 3S8GB 3TU6A 4AX3A 4HZ1A 1QLEB 1PY0A 2VSMB 2GI0A 5LDUA 1AS7A 4AI7A 4HAKA 5PAZA 2DYSB 3FSWA 1HFUA 1PZCA 2IWEA 2PLTA 2N0MA 1F56A 2GC7C 5I5MA 1AACA 1PF3A 2MRYA 5I28A 3S8FB 3GYRA 2CAKA 1JXFA 3ABKB 4KO6A 1BEXA 3L45A 1JZIA 4KOCA 2YAFA 3FU7A 4GXFA 2IH9A 2HX8A 4HHWA 4YSRA 2AANA 1E30A 4A68A 1VLXA 2YARA 3DIVA 1EZLA 3NJLA 3UADA 1RZPA 1L9TA 4ZK8A 2FT6A 2LLNA 5B3SB 4G71B 1ASPA 5FC9A 2I7OA 4DP9X 2XVBA 3JT2A 4Q89A 5AFAA 1YLBB 4GP5B 5AZUA 3WKPA 1T5KA 4N4YB 2UX7A 2QPEB 4PCYA 3CVCA 3GXUB 3V9EA 2RACA 2PPCA 1IBZA 1OCCB 2YXVA 4HALA 1WS8A 1AZUA 2CUAA 3OMAB 4E9QA 5B7EA 3NJFA 1OCRB 3ZDWA 4G7RB 1NDTA 4JHUA 1JXDA 2OJ1A 4KNSA 1NICA 5EHFA 4YVNA 1NWOA 1ET5A 1GW0A 1L9PA 2R7EB 1AG6A 1CC3A 2UXVA 3BVDB 2FQFA 2DV6A 2IWKA 4YSQA 4NERA 3PAVA 3AG1B 2VN3A 1JZEA 1ET8A 2HRGA 2IDUA 4PAZA 3WNIA 2XX0A 3KW7A 1WA0X 1X9RA 3FU7B 4KNUA 5E9NA 1TKWA 2ZONA 2PP8A 2VW7A 2PPDA 4GY4A 4WKXA
chains in the Genus database with same CATH superfamily
2X1XR 1YMME 2PYED 1UJ3C 2WBJA 4HX1B 3SDCB 1AGEA 3DOSA 5E6ZA 1EFQA 1KCRH 3MACL 2VYRE 4KQ4H 4YQXL 5LG6A 2PP7A 4EI5D 3CK0H 3ME0A 5F9AC 2QBWA 1LVEA 1N12A 4I5BA 1L9RA 3WD5L 4H0GA 4G42B 2TSAA 1CLYL 4MJIE 1ZLVK 5TF1L 2HFTA 5FHAL 4MCYA 2FSEB 4NXSA 4XO8A 1PW3A 3TIEB 1EEYA 3WGVB 1PZ2A 4UTAA 3MX0A 1J05B 3JTTB 4LHUB 4JKMA 3WY1A 4GUPA 2NT1A 4RH4A 4WI9A 5E9DB 3TCLA 1INQB 3FT2B 3JV4B 5C0JA 1A14H 3GNMH 3AXLA 1KJ2B 3OPUA 4J3OG 1PLAA 3QB7C 4JPSA 2OX5B 1PIFA 3IJYB 4ES9A 4Z7VE 2OMWB 4G9DB 3TBYB 1PBYA 3G6JE 3NA4A 1THCA 4LSQL 5C2BH 4U1JA 2DM3A 1FYHB 4PJ9A 5T8IA 1Y6MR 4NKQB 5LWYL 2Z9TA 1MREL 4ZMVA 3IETB 3OMNB 1XR8A 5AKTA 3SBRA 4G5ZL 5GIRB 3LZFH 4X6BB 5BRZB 3MJGX 5GS2H 1T89A 1CFBA 1HL5A 1HU8A 2Y9RT 3QZWG 2DLTA 1T89C 2P45B 3G6JA 6CGTA 3NIFF 3KH3A 3P9MB 1N0XH 5F2FA 1GZHA 3LRSB 3N5AA 3EO1A 2LE9A 3QDMB 3WJJA 4NLAA 2I7SA 1VFUA 5FA3B 4I77H 4JPWL 4YDLB 4PJFF 5HYEA 1AHKA 2V5MA 1K2DA 4LPTA 1ETZA 4DPCX 5IV2B 4PTTA 3OAYH 3WJMA 1DBML 4QLRA 2D4DA 1JGVH 3IGUA 2DQMA 1OWRM 1U41A 3M1OA 2CRMA 1U2CA 1JBJA 3CAFA 3PGDB 3RVTC 1I4FB 2X6CA 1SOKA 3QORD 2F58H 1UXSB 3T6QC 4HYTB 2X4OB 4K55A 5AUMA 2J8UA 1KYAA 1JGUL 3B5GA 3VGDA 4ZXBA 1A6VL 3UO1H 3QYMA 1CMOA 4XMPL 4B9PA 2YMXL 2CALA 4NHCH 1F00I 3DUUA 3ENEA 4K3EL 4E5XA 3BPLC 3HR6A 3WEBA 4IHBA 3PF2A 4NQVA 4D0BB 2FUQA 4Y0GA 1JTTA 1I9JL 3HB3B 3R0NA 3P69A 3QW9A 3IF1A 4LARL 4DSYA 4ZTOL 4TVPH 2DLIA 4FF9A 3IB4A 2IPUK 2WM0A 5E2WL 4UNVA 4PRAA 2IH3B 2OCFD 1VEMA 4U2YA 5J6GB 1S7TA 3PXJA 5E56A 4POYA 2D73A 4P5TD 4K9EH 4UT7L 5TDPA 2YMTA 1NCNA 5JO5A 4JUSA 1NLDH 5IJCC 1AS8A 1NCIA 4M03A 3VRLF 3D69A 5AW1B 1ZGLM 5KTEL 2H0EA 4PWJA 2HXAA 1PL3A 3MGAA 4NZFA 1GOGA 1EFXD 4N0FA 3EYQC 3HN5A 5F9DC 4X6EA 2VAAB 4N1CA 1FGNL 1JDCA 1JZHA 2ZCLH 5DYFA 3HKFA 3OLDA 3MRBB 5DJAA 5EORL 1KYFA 3G9VA 4LLAA 4DF9A 2FH8A 1JNHA 2G60H 1GPOH 2UY6A 1K6QH 3WMSA 5D1ZC 5BNXD 3VU1A 3LYRA 4UTBA 4G1EA 3H2QA 4BFEA 3QEUB 3STBA 1AY1H 5HPOA 3ET9F 2BVPB 2FWLB 2I9LB 5AW6B 3SGKA 4UB0L 2O6CA 3GFUA 1AGFB 4F24A 2WXIA 3P4MB 3PQYE 4KHXL 3DOIA 4D8PA 4L8DB 2F54D 3MLPA 1OK8A 4PPTA 1I3RA 1UACH 4P4KB 1UWXH 1HWHB 2V4LA 5LCVH 3ZKND 4CVZA 3BN9D 4H20H 3HUJF 3UP1A 4M7ZB 3KLAB 1LO2H 3SPVB 2EH7L 1FVDA 3UZQA 4H1LB 1HDMB 1JZGA 4GRMB 3GSXA 1V05A 1ZIAA 4ZT1A 2X12A 3MMEA 3E80A 2JB6B 1U8LA 2F6AA 4PJDA 6FABH 3LV3A 4GYBA 2UXGA 4KAQL 1F11B 3BPNC 2XG5B 4WO4B 2K1MA 4CADB 5BXFA 3CVBA 2YUVA 3DRTB 4N9GB 1FDLH 1QRKA 3WXWH 3QQ9C 4YFLI 4JFZH 4CN1A 1DR9A 1UCBL 4N8CH 3TTYA 3TPUB 1XF2A 4FHKA 5C0AB 4N2GA 2UWEA 3FQ2A 5E8OA 2GCYA 1ACCA 2MKLC 1KPUA 3GMRA 4IIZA 3HZKB 5C0GA 5I0WA 5ADOH 1N8OE 2A73A 2X7LA 3EYVA 5D7LA 4HCRA 2FUTA 5DYOA 2PPAA 3L1FA 1RUMH 3Q9PA 3ZX1A 2YAEA 3GQFA 3BLKA 2QGDA 3O8XB 4FG4A 3NPZB 4RWYL 4QHNB 4AQ1C 1ASOA 5IKCA 3V0FA 4A2GA 2WB7A 4OLUH 2X4NB 3OKLA 2FQEA 2E46A 5GGVL 4ZG1A 1TSRA 4MD0A 1X5MA 1LYQA 1GS8A 2I9LA 4ZDHA 3VA2C 1YMHB 1OTUC 2CNYA 5EEZA 1OAYH 4HFUL 5B1AB 5H8DA 4ERSL 3N40P 4PI0A 2IAND 3C6SB 2YUWA 2DQIL 2AAAA 3H3PL 3T0AA 1CGTA 2BSTA 4XAKE 3L5XH 5DC4B 2CJ3A 5B1JA 5GRVL 3SDCA 3IGAB 1Q0YL 4XHQA 1OXYA 4MAYA 2OL3H 1EA9C 4QRTB 5DRWB 1RU9H 5HGAB 3ESPA 2NY4B 3FHQA 3F7YA 2HSIA 2IV8A 4BFFA 1OQXA 2MOVA 3IAGC 5AWNH 1BLNA 4NQDE 2CU9A 3QPXL 3ZE1B 2C9PA 4NRXA 4QO1B 4KI5D 1OF0A 4C4BA 5IWLA 3W81A 2VXUH 3QUYB 5FKAB 4PJCA 4J3VA 5AYUH 3S34L 4YXHL 2XWCA 3VE0A 3C6EA 1YEJH 3IMRA 2W88A 5SWZA 4XCCL 3TIDA 3BZ4B 4HUXA 4AYMC 1R3LB 5HHME 2NY4C 3TBCA 4OT1L 2EE6A 2NCEA 5D2NE 2FX8L 1UADC 5JQIB 1NAMH 4QJ5B 4DP8X 3MLUL 4ZOAA 2VLKD 3LEVH 4OCRH 1N18A 2EDDA 2W9EL 3N85H 1WA1X 2F54E 3MU3A 6PCYA 2FD6H 3RVVC 3WXVH 5HHQB 2OTUA 5KN5A 1MNUL 2WN2A 4BZ1H 3FB8B 5LBSL 5E1QA 4LPVA 2WV3A 3BO8A 4AGQA 2AJXH 1U8CA 3H9HB 2B4CC 1TCRB 3DHMA 4Z3JA 4AH2A 4OLZL 1OIOA 4UOW0 1I1YB 2JFCA 2JKIS 4MD4A 5AOMA 5ECGA 3ZMRA 1ZANH 2JKRM 1RZFL 5JPMC 3T0VA 4MX7A 2ZOTA 5F21B 4YH6A 3WJMB 4OQTL 1RFDH 3ZTCC 5B8CB 1WD9A 2VR9A 3UDWC 3X14A 2WBWB 5E0QA 3VJ6B 4JE4B 2HMID 1SVZA 4GKZA 1A5FH 3B7SA 5CO1A 2QELA 4MCNA 1YEKH 5HPMB 4JFED 4F7KA 1WYJA 2V2TB 4RMVA 4JKPH 2W0KA 2H8PB 3OKNB 4WGKA 3GBNL 3FRUB 2NNAB 5DRNB 1PZDA 5GGTH 3HFFA 5J11C 4N2KA 3MGTA 4RRPG 5D8JL 3B2VH 3DDGA 5DD5H 4N9GA 4ZUTA 1SRDA 1A6WH 4RGMC 4B5EA 4M43L 5IGXL 5DMYA 1O6SB 4IRZH 5D7LD 3ZTJH 4KTYA 5DDHA 3SJVA 1KY6A 3MZGB 3RWJA 4GBXA 4NBYB 1H3XA 2WHVA 5E99L 5JOPE 1MOEA 3OTTA 1KPRA 4DW2H 3EBGA 1JZ8A 1NOLA 5I6PA 3SY0A 2HLEB 2NY3B 3JVGA 3JWNC 2GJPA 1TSHA 1FYTE 4YHOH 2GUOA 1HHGB 1IIIA 3VI3A 2G5RA 3LRMA 5CFHA 8FABA 3EKCA 2Z35B 4BH8B 4P5SA 4UQEA 1BJ1J 5ERWA 1MI5B 5DJYA 4MDIB 2DBJA 4RCAA 5ECJE 1M42A 3ETBF 3K0WA 4HDIB 3HE7A 3ZQ9A 4PVNA 2YPLA 1JPFA 2D3JA 1LEKA 2YEZB 1T83A 3AREB 4UZGA 2ICWA 4KUZH 2RCSH 5I74C 1CVSC 4FFWD 2BSTB 3ATFA 4BKLA 1UKQA 3IJEA 4N2LA 5GRUL 4QRPB 4DEUA 3F6JA 4ZFOA 5I71B 2BIQA 1F02I 3MXWH 5GGTA 2DQUH 4OI7A 4QRPD 5J13B 1XEDA 3DVGA 3OKMA 1TJXA 3FO2A 3LKQB 5ALCL 2HN7A 2VTFA 4LL4A 1LMKA 3Q1EA 3NG5A 3ARDA 3CZNA 2R4RL 5FGSA 4ONOA 1VADB 4KZDL 2Y1YA 1BVZA 1WZ1H 1KXTA 4JHZA 4KTDH 4P2RE 5E2UL 1RSFA 4JZJA 2OMZA 1MRDH 4ADIA 4CSSA 5FDYA 3U82B 3P77A 3NJLA 5CS7A 2DQFA 3OQ3B 1ASPA 1AQHA 2W65A 2HP4A 4YEFA 3QI9C 1XF2B 4ZMOA 1P4BH 5IHUH 3O0RL 4F57H 3OXRB 4XMWA 5HJBA 4N4YB 1UB5A 2VXVL 5BQ7A 1T03H 1UXMA 2WZ5A 2HKFL 4PCYA 3S97C 3C5SB 3GEWB 1IBGH 4JREC 5JR1H 3VSQA 4KJYA 2E9IA 2TRHA 3Q5OA 4XHJC 3RDTA 3IDNB 1B0WA 3K8LA 2GEEA 1EEUA 1Z9MA 3S88L 3GI8L 3O9WA 4IJ3C 4ADGA 4QPEA 3VXSE 4YGVB 2PCFB 4NQTA 3KPMB 1Z9SB 4UYQA 2DQDL 3QUXB 3TF7C 4AIEA 1LO5A 1FSKC 5J1SC 4KNSA 4YN3A 3U48A 2EDMA 4AH2B 3GDBA 2VUYA 3QWOA 1L9PA 3BEWB 3HB3D 1SYVB 3QCUH 4PJEA 1NGQH 4UMGA 4HT1L 4QGTA 3MROB 1VPOH 4KKLC 2ODIA 2FO4B 3KH4A 4G8AC 3BW9A 3CFMA 2BSBA 2BVPA 2VXTL 4HUUB 4WK0B 1JPTL 5GGQL 1YN7B 4KI5C 3Q0HA 3VFPB 1SHSA 5CBEB 3DJ9A 4H5SA 4V1DA 4MD5A 4E36A 3CFIC 5IEKB 2VRQA 3UABA 5L2KE 3LH9A 2XJLA 1CE6A 4G80B 4UOZA 1Z3GH 3CN3A 3C09B 2A5UA 4L1LA 2X3AA 1IGYA 5EDSA 5GS0C 2IADB 2CH8A 5SV4A 4HWBH 3BVUA 2HB0A 3ARGC 3CFDA 2EH8H 1YECH 4HS8H 1NCDH 4WVRA 5GRJH 3KDMA 4QOKA 3W9EA 3ULUL 4LVOC 3VFVB 4AVHA 1QHPA 3KR3L 1EGJA 4P99A 3FFDB 4PBDA 1TCMA 4P3DA 2P24A 4IRSC 3K5SA 1SDDA 1BAFH 1VFAA 1IO4C 3U6XS 4Y5XA 3O9WB 4Q7DA 4WFGD 4N2HA 5KBKA 3B3BA 3EOAB 4R9HA 1ZJBA 4PJBB 1TJGL 3LQAL 4U1NA 3QWOB 4YSPA 1IAMA 3BWUF 1ZHLA 3AREC 1FLRL 1P5UA 4OBSA 5EU7C 3L5WB 4U1GC 2X44D 1TJIL 1D6VL 4B9FA 4OLVL 1CE1H 2UZYA 1XSOA 4Y2DC 2NZ9C 2AJYL 4AG4L 3HE7B 1CG9B 5B38B 3HZ3A 4KZ0A 1A6UH 3KCWA 5GJSH 3MLWH 1DJWA 2GJZA 4RDQF 1S9YB 5MERB 2V3FA 3K81A 3Q5YA 3MJ8B 2A2QT 4P9HH 4ODBD 1SY6H 3QZNA 5EZOL 3WI9A 3QSKB 3ZHFA 2CKNA 2VJ8A 4NKOB 5JLZA 4IIQC 4UUJA 3MRPA 2EDNA 1OLLA 5I1CL 1MUJA 1PVHA 1IC4L 1X7SA 2XKUA 4LQFH 2APBA 1EQWA 5D7JB 1BJ1H 3VXPA 4PLNC 4ZW5A 3D07A 3BGMB 1TZIB 3LZPA 2VRAA 1KTBA 5CGYC 4FXTA 4L2YA 1SUHA 1WHOA 2GTWB 2X4UB 5GSRA 1E5CA 1WWWX 4YNYA 3BYYA 1QTPA 3K6FA 2C26A 5DZJA 1IEAB 1RHHA 5JW4N 1DDHB 1L7TL 1K9TA 1U36A 4PY7B 2CIIB 1XVSA 4LEOB 1M05B 3UYRL 5DHXB 3UC2A 4XTRD 4GKSB 1HCFX 3GWJA 3JWOH 5D7SH 3ZTDC 3QRLA 3E9UA 3BP7A 4UZUA 1DQLL 5DHVH 5ENWB 2WC7A 3MLTA 5IB4B 4PLKC 4I3RL 3MRKA 4XMKH 1SOQA 2V9TA 2AEPL 1AGBA 4WUUE 2MPAH 3SE3C 2AEWA 4Z3GA 3N40F 4K07A 2AK1L 4QRRE 1XF5A 3HE7D 4AVIA 1I8UA 5HYQB 1EHLH 3UOAB 4ISVB 2LV4A 4L8BA 2APVA 2RTTA 3U7WH 3ZRSA 4R4FL 1WWCA 1NC2A 3K72B 1P4UA 2NYZA 1LE5B 4HDIA 5IEHA 1F6AB 3VRIB 5ABDE 1FH2A 3MUY1 4TYUA 1AJ7L 1WAEA 5A2AA 2HWZL 3L4UA 4HKJA 5HSFA 4TSAH 5ID0A 1JNJA 5CIPH 4Y4KC 3NA9H 2CO1A 1B0IA 4AKPA 4Q58C 1J88A 2O6DA 4PRIE 2XN2A 3EJSA 4TTDC 4DO5A 1AKJB 3V4VL 2WBXA 2JVUA 1ODAA 3DTXA 3TN0B 3VXUB 1O5DT 1HQRA 1ZMYA 4MAZA 1CLZL 2X2UA 1XT5A 3PUUA 4N2NA 3R8QA 4TULL 4YMPA 2ZXEB 1DDHA 4R7LA 4M5YH 2OJZL 3K91A 3OQRA 1HEJC 3EH3B 4IOSD 4O02H 3BFWA 3PIQA 1FNSH 4GBXD 1IBDA 3ARYA 1BXXA 2EUVA 4FNLL 3GIZL 2WNGA 3OJMB 5FKPB 4TF4A 2NY5H 3QUYC 2CIKB 3CPUA 3HC4H 4XB7A 2LTQC 4QRQB 1E2WA 1B4LA 1P4IH 4XNYL 5T5FH 1Q0XL 2VM9A 1GR7A 1UM4H 2OXGB 4GIAA 4IGBD 2OMWA 1NSNL 2IALB 3BD4A 4G9DA 2ATPB 4JDEB 3EG9B 4NP9A 3OLGA 3DSFL 3MFGB 4YHYB 1JRHL 2VC2H 2VABA 3GTNA 2D03L 3HG4A 3CUPA 4FXKB 3F01A 4QY8B 3U30C 2XQYG 4MMXB 4M8QB 3MBWB 2Y6SC 4J23A 3ULSA 1S9XB 2ZOOA 1KBKA 4BCYA 4PRNA 1QWHA 2R2HB 4FKKA 1YN6A 2VLRB 2ZQKA 3FT9A 3BD3A 2ZUXA 2YEVB 3BWAB 3CQQA 3WFHA 3OX8A 4KO9A 1V3MA 2AEOA 3KPMA 3CBJB 4KKLD 4FZ8H 4UTBH 4ICXA 3D39E 4Q14A 2O72A 5JHMA 2XFXA 5FO9B 2WYTA 2JKSA 2PR4H 4YL4A 4KY1L 4ZFZA 3V0VB 4G3YH 5HD8D 1CIUA 4FFZH 4IOFD 1OE3A 1FHNA 3FRPA 4P2YA 2W07B 3TASA 3TGXA 4K71C 2P8PB 1FJ1B 4JFUA 1PZ5A 5E6YA 2XBDA 3AUWB 4Z7UB 3X3GH 3AJ7A 4PJIF 1MEXL 3QG7L 2WTRB 4WEBL 3L9BA 1Z0NA 3G6JF 4MJ6B 4OZ4A 1TZAA 3WMPA 4WKZB 1B88A 3CC1A 1DEDA 3IDMB 3Q1SH 5IVZB 1RZ8A 1W8NA 2EDOA 5DFAA 4QRQA 3Q44A 4I0CC 2F2HA 3MNWA 2BX5A 3DMMC 2R4SL 1C7TA 3QQ4B 4IBWA 1X5AA 3LH2L 3A5VA 2YN5A 3CX2A 1E8YA 4BELD 1DVQA 1Q1JH 2APWA 1ITCA 3HNVL 4QKTA 2QQLL 3UJTH 1V5JA 3DX6B 3U2SB 2Z31D 2OK0L 3MLXL 2X05A 2Q76B 4WUKL 4N0YL 4WI4A 4XWGH 2QL1A 5C0BD 2VITA 4CU7A 5KYYA 4JHWL 4XCYA 5ID1A 3CSYA 4KY2A 5T1MB 3OKKB 1J12A 5D71H 4U1KB 3IDXL 5I18L 2MEJB 1KLUA 1MCNA 3NSJA 4UQ3A 1HAWA 1UWGL 2XYCA 4XNMA 2JKTM 1AMXA 3HMXH 4FX5A 3QNXA 4HOWA 4DZBB 4Q8BA 2YQBA 1MLCA 4QTIL 4TNWF 5FK9A 5HHPA 4WGWB 3IS0X 3LS4H 2NYYD 5ALBH 3MCYA 2HFEB 4BUHA 4GQ9H 4DKAA 4NJ9L 2DL9A 4POZC 4X4MA 2HTKD 1ILSA 1CXEA 2BDNH 3VFUB 5I1AA 2IWGA 3SN6N 3RILA 4X7SL 1DQML 1HXMA 3SYAA 4BGLA 3D4CA 2I26N 3O6KL 3HPLA 3R4RA 5BOJA 1VZGA 5FA3A 3D05A 4U1SB 4LLQB 1W6LA 1FL6A 1R1CA 2R7EA 1WPCA 2EYRB 4XN4A 3ERXA 5FYKH 2ITCB 1QSEB 3CFTA 3H55A 4NUJA 1I3VA 2D9QB 4L3FA 3BFQG 3H2PA 5GZOD 4W1TA 4JO2H 3VFPA 1OM9A 2X2JA 4TRPH 1BQLH 3EUUA 4OCYL 4P8QA 2WKLA 5EOCH 3RG1C 1FA4A 2JK5B 3OJ2C 5KJ4A 4YHYC 3LHPH 4GO6B 3V7MA 1NCTA 5BW7C 1CDBA 2RJMA 2X89D 3PQYB 3QAZC 4JO1L 4NIYE 4B9KC 4XCNA 4XPAL 1A7NL 1HIMH 3OKOB 3TPUA 4EDWH 3O2VH 4YE4L 4UTAH 3L2NA 1AI1H 3BVXA 4ODUA 2B0SH 1KCKA 1ZEAL 3C8KA 4UIKL 3IFPA 3W1ZA 4PW9A 3WIHH 4A1RA 4U0QB 4AGMA 3EUDA 4UIMB 3IT8D 2VMDA 2ZOKA 1NMBL 1Z0MA 2Y7SA 3BWUC 2LT9A 4A7GA 3E0GA 4PJGA 2CDEB 4Y7OC 1G6RH 4UM8A 4FG2A 5F3FA 3VXOA 4G1MA 3MA7B 4NO5B 5I8EB 2FWSA 1A6ZA 3GK8H 3LNIA 5CWSB 2RB8A 2J2ZB 4W9IC 3ZOAA 4BH7A 4D0CA 1ZHLB 3AADB 1J0KA 3I85A 4BBWA 5C92A 2GK2A 1A1NB 1HSAA 4YO0A 1NANH 3V0EA 1AR1B 4WFFE 2JB5L 1AP2A 4HMCA 4NP4H 3CU7A 2JXMA 3GZQA 3O3DB 1DSYA 1EEZB 5AL8A 1ZVSB 4N24A 1E4KC 2WNXA 1XGPB 3RWHB 2UX6A 2WTRA 3QJSB 1LILA 2NR6A 3MLZH 3RIAK 4U1JB 2F08A 4HEPA 4M7LH 1WAAA 4M5ZL 2VUKA 4RZKA 1S8DA 4O51A 1SVCP 1LO3L 3PJNA 2J5LC 4HKXA 2F74B 1PKQB 2PWGA 2R1YB 1I1AC 1ANUA 1F56A 3I3DA 5CLZA 3PREA 4S10A 2YPVL 3NSXA 3B1TA 4ALAL 2QZ5A 4QRRB 1F4XH 4IBUA 2YEQA 1L6ZA 3VFSA 4KO6A 2BNUB 2C1PA 2CK0H 4MQ7A 3T2PA 3T4AA 2SODB 4GQPH 2VIRA 2JKNA 1MLBB 3TVMA 1JCVA 2R15A 2ZCKH 2ATPA 3NCCB 3MKKA 3CVIH 4JZOA 1M1SA 3D6GA 5J56B 2FJGB 4GPVA 3GSNB 5IJBC 1RZ7L 3MV01 1MXGA 4KQ3H 4M48H 3RB7A 1FO0A 2G0LA 3HS0A 5HHQA 1SBSH 1TZHA 1HESA 4TLUA 4AXWA 2NQCA 2QSQA 4FNPA 3WKPA 4ELME 4PJCF 2JNZA 2XV6B 3MYJA 3EBHA 3CDYA 2X6AA 4LB8A 2OL3B 3LRGA 5D2LB 2R69L 3STZA 1IQWL 2CHWA 2O5XL 3AROA 5B38G 4F5CE 1OP5K 2WKOA 4PLJC 4Y2NA 3HC3H 2GJ6B 4XVSL 3Q2NA 5AG9A 1G1KA 3VYNA 1QQDA 2EDRA 4URKA 1R3HB 4YLQT 1PSKH 2JCCA 2CR6A 1IAOA 3TZVD 5EBLB 1NFIB 4G6FD 5EA0H 5L4FA 4JGNA 4GUPB 4PYGA 4UMSA 2ADJB 3MUGB 5E8NA 2R7EB 3BMWA 3B1UA 2EYRA 2YSSA 2MQGA 2FQFA 3VD9A 4BHUA 4P49A 2ZXBA 3MRGB 4FJ6A 2VXSL 4WFGE 5C0RH 2ZCKL 1OAKH 2R69A 4HUVA 2XWJB 1A4JB 4HBCH 4MQXD 3FRUA 5C8JB 4OZHE 3VGHA 5E9NA 2ZONA 4Q74A 4XPHH 4IRSB 3FUNA 1HT6A 4WAFA 5KEZA 2YPVH 3BZFA 3F3HA 2C7FA 5AVQB 4WSJA 4ZMNA 2CRZA 2J56A 1GYUA 1WBYB 4MA8L 3UTQA 4YBLB 1SFHA 2XOTA 5EEXA 1I3GH 3HR5A 3PP4H 4M1GH 4APXA 5J89A 1XZWA 4YSDA 4JPIA 3L8QA 1WWBX 3LIZH 1XHHA 4OUUB 2PYFA 1F3DH 1ICTA 4U7SA 4NKMB 4HF5H 5I1EH 2RAMA 4BA0A 2TSBA 3ARGA 5K5YA 2HTKC 1UM6L 2VDQH 2IXQB 4HJIA 4OSUL 1KB9J 1E9QB 5D1ZI 1WCBA 1XSKA 4B7IA 1UCTA 1T1ZB 1ZV2A 3KYNA 3ZKSD 5F7DB 5SWQA 5DVKA 7FABH 3R06A 4YSTA 1OK0A 4UOQA 1XV8A 2ZXDA 4BQBA 4XX1G 3RQ3A 5KN5B 5EBLA 3LY6A 1KTLB 3U9UA 1BZ9B 1EJOH 3A24A 2BOBA 4HJSA 3GK8L 4MJ2A 2J8OA 4OM0H 4XXDA 1WFUA 4AQAA 4N2OA 3VMNA 4GRWB 4U1LA 3MXVH 1P6FA 2VLJA 1XD0A 5CZKA 3I50L 2O61A 2VDRL 3VI3F 4NQVB 5L6YL 1CT8B 2Q3XA 3C75A 1V55B 4H1LH 3LKQA 2UWEB 4DP1X 1NC2D 2EIKB 2F19L 4DP2X 3BN3B 5F3HA 1ETB1 5J3HD 2P8PA 4NKDB 1FZOA 3H4HA 4KKAC 3QHZL 5GS2D 4UIKH 5B8CA 4IMKC 2XXMB 4H8WL 4JZJB 1ZXQA 3ULVC 2X4QB 4ZOEA 2ED8A 4IKLA 2Y4SA 1OGTB 1IJNA 5F9JB 1SEBA 2V2TA 2R59A 4Z3HA 4AQ8A 2DEWX 4HSQA 2H8PA 4WTZG 3RWDA 3WCYA 1INDL 2B4CH 2F61A 1DUZB 1S7SB 2C1PB 2G2PA 2B3IA 3QHFH 5C07B 3G08B 5CCKL 2EVHA 4NRZB 1QFWH 2GC4C 4NO0A 3FB7A 3WFDH 4DO6A 2ADIB 1BF2A 2DMHA 4J28A 4N0UA 2EIZB 3B56A 2WWMD 2QR0A 4H8VA 2HYMA 4N2AA 2FZ3A 4BWUA 1KCSH 3JV6A 4A55A 1UWYA 3QEUA 3OXSA 1RLBA 2R27A 4QAWA 4EO5A 1YEFH 1FNGA 1NAMA 3VI3E 3LRHA 5DK0B 4MS8C 1DVZA 2KZBA 4HOZA 5I71C 2E9WA 4WI7A 1IEBA 1QSVA 3LQAC 1DN0B 3KPRB 3EJYD 4P4KC 4W68A 5ISZD 2VB5A 2JI2A 3RIFF 1ZA6A 3BXNB 3KM2A 3HLAB 4I3GA 1HH6A 1GW6A 4YO0B 4C58B 1D2PA 4PJ7E 4QHKI 5ALBL 5GGSY 4QRPE 5FO7A 1GGIL 1W8OA 5A2CA 1TDQA 4JFHD 1RUQH 4NWUL 1E9OB 1BZEA 1UOLA 3N1PC 3ESOA 3O6LH 3UAJC 2E7CA 2PTVA 4WK4B 3FBQA 4ZPVB 2ZYSA 4XRCA 5TFSH 1UWGH 3HE7C 3CIQA 3VDAA 2Y1AA 4PWFA 4OI8A 3GXMA 1JHKL 4KJQC 2DTSA 3UCRA 4JFYA 2R9HC 2XXCB 3WJLC 3VFWB 1VKXA 3VMPA 1I7ZA 5D1XE 1NFDF 3H85A 4DOHE 1TKWB 1L9NA 4NO0B 1KCWA 3V6BR 1Q1JL 3HNVH 4E41D 3SDXA 3VXTB 3FCSB 3D4ZA 4OFPA 1BIHA 4ELDA 3MODL 3MOBH 2R4SH 5T3XL 5FGCE 1KLGB 2K4WA 1F41A 4ATWA 3TL5A 2DMKA 5IKCB 3Q1SL 5D1XA 5E70A 3VWJB 2K3TA 2X4NA 1XGZA 1QO3B 5SWSD 5HYIA 4QXVA 1NUNB 2FJSA 5LAXA 4JPIB 3DETD 3QG7H 4ZMXA 1KBGH 1D9KD 3KS0H 4D2NA 2MPVA 1QEWA 2DBLL 2XT1B 3NACL 2FIKA 4GLRI 1RI8A 5GSVA 1ZDQA 1Y0LB 1GA2A 4JFDB 1KGUA 1RZIA 1HWGB 2AXGB 4OAWB 2PR4L 1N64H 4CC4C 3O3AA 3RU8L 4X6CB 4DFHA 3TZVC 1U3ZA 4I85A 2FHFA 3CZFA 5EO1B 1ZLUK 2DL2A 5K9OA 4WY7L 2V33A 4JFDE 1NBZA 3H9SA 3BKCH 4G7SB 3FQTB 4WI8A 2ZD0A 3IBOA 3NVQA 4D0CB 3GRBA 2WCPA 4KJWD 3WY4A 2FWUA 3E6HA 1JE6A 3I6KB 3N1MC 2ZSVB 5C0BE 3FB6B 1M4KA 1CXKA 1NMCC 5DHEA 2I5YL 3ARFA 3UBFA 3KBHE 2JXMB 4I87A 3GHEH 4K4KA 3QUML 4UUJB 4XCEB 4YHZH 2WOBA 2AEQL 2VC2L 4HULB 2HJKA 2WZ0A 3AS2A 4NHUA 4Q6IB 2X1QA 1UM4L 3DBSA 4IEFB 1TTRA 2PW1B 3TNNA 4JFFB 3VI4B 2AGJL 3H2WA 1XL4A 1H19A 5E2VL 1D7CA 2AJUH 2YIHA 4XC3H 5KUMA 3PDOA 2R0WH 2WVUA 3W56A 1A4KB 2J4WL 1IV8A 2IQAA 4FP8L 4Y19E 4TULH 3OWEA 3CIAA 1CDUA 1AGBB 3FHAA 2ESVE 2MMXA 5JXAH 4DEPC 4NB7A 3MNVB 3O3AB 2XRAH 2BK8A 2CDFA 2C1OB 3II1A 4EN2A 2IDTA 4J3OF 2P4AB 3D5OF 3GHEL 4HJ1A 4WWID 2WVVA 1IRAY 2GJJA 2QDVA 3T8VA 4YSCA 1DBBH 3IDJB 3GEFA 2FX7H 3QEGH 4HPYL 2LVCA 3FQXA 3V6ZB 2P28B 4BDVB 3CPLA 2DMGA 4OJCA 1A65A 3W0WA 2PF6A 4R4FH 5DC9B 4ZSOE 3SDYH 4AV4A 3V4UH 1TQSA 3BKCL 4L37B 3OKNA 3I9GH 1EHLL 1T2QH 4BZ2A 4YFDB 3B2UD 5DZLA 5J06A 1AE6L 2OCCB 4TVPD 3FONB 4C4UA 3R1GL 4Z6AT 1WUZA 3CJJA 2D0FA 3DX2A 4FQXB 5G4NA 2IJ0C 2XPZA 4XMKL 4ZW7A 1NCHA 3ZDYB 1CCZA 2WQAA 1GGBL 1DQLH 4JRFA 1XCWA 4YLCA 1O7DE 2PPEA 5FWQA 1GS6X 2AV7A 3SE9H 3UYRH 1RPUA 1HINH 4DGVL 1L6XA 5AYQA 1L7TH 2IQAB 2E3VA 3TO2A 4AW4A 2PKDA 3CVHB 5IROA 5KSVB 4YGVA 4RGOL 3VH8G 3RWDB 2ZX8A 5IY5B 2GUOB 5EDXA 2FSDA 5I6XB 1AGFA 1FZMB 1JN6A 1S3KL 3WEMA 2F8IA 4RESB 3HAEG 3OF6D 4OJAA 2CIIA 4LEOA 3HAEH 2J57A 3PL6A 4ODVL 2MH4A 2DYPA 1II4E 2KLSA 2ZJSH 3QXAA 1L5GB 4W6WB 1Q9WA 1SN5A 1GY1A 2JMRA 4X5WA 5EZJB 1S7WA 1ED3B 2YFNA 1SHMA 4KOBA 3AG4B 1HINL 4B5ZA 1HYRC 5DRZB 2E76C 1HCYA 3DC0A 4N0RA 2NT0A 1W91A 2CBOA 3P4OA 2WBKA 3PWUB 3ZTNL 2IMNA 4L37A 4TTDD 3BP6A 3W82A 5DO2C 5B3JE 4HFWB 3HZMA 4IDLA 2BZCA 1G1OA 4WI0B 5I1IL 3HHSA 3R1GH 1CE1L 1FWXA 1W72B 4MZRA 2XWDA 3QH3B 5TDNB 2Y2TA 1S6NA 2ZTBA 1MRFH 3MV11 4OZIF 5FYKU 1J0YA 3GPSA 2EVIA 2PWDA 5JPMB 2QJDA 1RZKH 3VRIA 3ARBA 2IEPA 5FHBH 2CCVA 1DVXA 4PRHD 1CICB 2W60B 5DK2B 1EDYA 3JWOC 2EEFA 1VENA 3QG6A 4Y19B 3QFJA 3B8YA 2YD6A 3IU3A 5D1ZA 1SVBA 1OALA 2DIAA 1YEFL 4JM2A 3DO7B 1FBIH 1BAFL 4HJ0D 1DBJL 2NY6B 4KKCC 5JXEA 4G7VH 2E7LC 5TQ0L 3CX5K 4EVNB 4PJBA 3RIAF 4BK5C 1LK3L 5L9DL 4F80A 1H3TA 5DA4A 3D06A 3WE6A 4FJYA 3FT1A 5KSAD 4BFIA 3MRNB 2E75C 4U7KA 1NCDL 4JBSA 4B3VA 5F1OB 2VSMB 4M1CD 1RK7A 1EAJA 3MLYL 1CWVA 4D9RD 2J1YA 2GC7C 3MA9H 2J4WH 2MRYA 3MVSA 2HLAB 4DK6A 1NGZA 2ICWJ 4A7QA 5KS9A 3QZWB 3D39D 1P7QD 4L29B 1KN4H 4XC3L 4H8WH 3VXRA 1JZIA 3EG9A 1P6WA 5I0DA 5MEND 2LOEA 2IH9A 3BPCA 4TQ8A 5ESVB 4HJEA 2P48B 2XCMC 1ND0B 3B34A 5A1AA 3WNPA 3HVNA 2YJQA 5BMFH 3FUDA 5CJXA 1FPTL 3RZCD 4L8SC 4O4YL 4ZK8A 2Q8AL 1XCTB 4X7CC 2AEQH 1FFPB 3SDCD 4MQTB 3CZFB 5EO1A 1H8NA 5EPMA 1NBZB 3QCTL 4M3KB 2APSA 4YHML 3GI8H 3S88H 5BZWB 1MCEA 2QPEB 3BSGA 3RI5F 3KDPB 3DMMD 3ZL4L 5LJYH 5GGSB 4HEPG 3ROOB 3GTVA 3RTQD 1YQ2A 4ZNCD 1JPSH 4UT9H 3JSSA 5FV2A 1AZUA 3D4YA 1G9ML 1JHLH 3R19A 3A21A 4BIKA 5IB2B 5MHSE 1RUKL 5JIMA 3WTXA 3IFLH 3Q3GB 1UM6H 1EAQA 4FG6C 3KPTA 3O0RH 2OI9C 4X7TA 5HVWA 3FXIC 2OJ1A 4F2MA 4XP9L 5CU5A 5EUOB 3TWCL 1HNYA 3E9TA 4HIEA 1YY9D 3GTTA 3S2CA 3JUZA 4WU5A 1I3GL 3AAZA 3DX1A 4JFYB 1I1CA 3NACH 1GC1C 3IXTB 1KBGL 2X6BA 4MA8H 3CU1A 1U8QB 2AI0H 3QNYB 2HRGA 3PV6B 4JDVA 2N7SA 4WQOA 2YOAA 4U1NB 4YHLH 3FU7B 3FTUA 1OEZW 3G6JB 2NY6C 1X5XA 3NIGB 5F3BB 1VESA 3I3EA 1KTDB 5ESQA 1QZ1A 4XP5L 1PKOA 2VITB 5KYYB 1EXHA 2DQUL 4JG1L 2QT6A 1QLEH 3B9KA 5GRUH 1TMCB 2V5YA 2H32B 4NNXB 1USZA 3F65A 2VDPH 3SDDC 2G3ZA 1NIAA 1KOAA 5I1GH 1I7RB 1H5BB 1N4XH 2IAMC 4W9GC 3FQYA 4WF7A 1WVZA 4QUOA 2XTLA 1I4FA 1OOAA 4MJ5B 3NFPA 2YUZA 5L2KB 1SXNA 4BDVA 4HQQH 2B5IC 2F8OA 3K6DA 1KJMB 4K3DL 1IQWH 1UZ8B 3D9AL 1ZSHA 3G6DH 1S7XB 4C56E 4FMVA 1G43A 2ICEC 4WFED 1IKNC 1JGEA 3FB5A 5E6IB 2A6JA 5C6PB 4FE9A 5E99H 1YPZF 1UB6B 3AS3A 3IFNL 4N1EA 4BJLA 4IRZL 5DD3L 1ZLWH 3C6LA 3BGAA 1C8QA 4NQDD 1Z32X 4LAQH 3Q6FB 5IMKB 1GOFA 1N7MH 4G8EB 5DD6B 4OVVA 3VFSB 3CCHB 5E2JA 2B77A 2YBRA 4FLOA 3FOMB 3SD5A 4ISVA 3L4YA 3L1OH 1UOKA 3GRWH 3WFDL 4ALAH 4P5TC 5DF0A 4A6YH 5IHZA 2A0LD 1K85A 4KTEL 1Q9KB 4HIQA 2OM5A 4BCXA 1M2VB 1T20A 1YEKL 3HZVB 4I3SH 4CC1A 3QHFL 1JFQH 3RL2B 3LDBB 1DFXA 2BXZA 1M9SA 2C9QA 2QSCH 1U3JA 4XMXA 1LO3H 4YZFF 2OZ4A 4KQ0A 3K2MC 1M71A 2BJMH 3ARTA 1Q94A 3QI9A 1CR9L 1J8HA 1DUYB 2DB8A 2JCWA 4HH8A 4ONHA 4OQTH 5DRXB 3B7YA 2R0ZL 1VERA 4ZFOL 1FFRA 3ECBB 4P04A 1FORL 1JYWA 2KDYA 4JHVA 4KXBA 1X44A 2GQHA 3KPLB 1MXDA 4ZPTB 3NJNA 2VT0A 2JB5H 1MFBL 5CCHE 1S5IL 1AXSA 1F8TH 4U6HA 3P2DA 4FYTA 1M57B 4U6YB 3IK2A 2Z8RA 2VDRH 1KELH 4E41E 4ZFGH 5IQOA 2IIJA 5C70A 3TBTB 1NH6A 4K5MA 2XV3A 1OSEA 3H9ZA 4UQ2A 5T1KB 4JS7A 1TQTA 1UM5L 4X6DE 4XCYB 1IZJA 4YAQA 3VNZA 1EJOL 2NY0B 1A1OB 2BP8B 1PG7L 1H6UA 4JO5A 3GJEB 4NQDA 2D8KA 1NUDA 1VGKA 1XD1A 3GHPA 4N2IA 4FNTA 1EO5A 1F8TL 5C8JA 4EE2A 4JO8A 2QQNH 1KPUB 1B4TA 1USQA 2E4TA 3KCPB 4U6XB 2DDQH 4QDGA 3WE6B 2VDLB 2XWTA 4GXUN 3DECA 1P1ZA 2ZWLT 2EADA 4PRPB 2R0ZH 1A7NH 4R0LA 3VG0L 3OV6A 4YXLH 3MGOA 2AQQA 3KPSE 2NNFA 3SKUD 3UAJD 1RU9L 2OL3L 3DPBA 4XNQA 1DJIA 5ESQB 4X6EB 4ZO7A 5EU4A 4PMFA 4AQZA 5ANHA 1O6TA 3ZN6A 1FZJB 3L1OL 1J11A 4UV7L 4XPHL 4OVUA 4MNGA 5C08E 1IGCH 1O9ZA 1BPVA 3LSOB 2VERA 3FRPB 3VWKB 1MIML 2DQIH 2X42A 4IK7A 1G1YA 1CIDA 3PHAA 3HVDA 4KXCA 1T1XA 3X1FA 3GBDA 4HLJA 2C9UA 4JFFE 1DQMH 1CS6A 2YQ2A 2WZPD 2GHZA 5HYJD 4M61A 2OL3A 4OD3L 3M17A 3F7KA 3FQ4A 4LLDB 4EDXB 2AZUA 2BDNL 4QF1A 2RFXA 2Z92B 2GIYA 5F89B 4DVRL 1PDKB 5F7LB 4P4KA 3ZDZF 3L7FA 3BGFB 1XAUA 4WFHD 1VGKB 1I8LC 3ZDXF 4FXGB 4K9EC 3S35L 3UAEA 2Z93A 1AIZA 1IL1A 4FL4C 5DJ0A 1RJYB 2F8VA 3HMXL 4DK3A 2HX7A 4KH2A 3NCBB 4DVRH 1DCEA 4N8CL 2K6YA 1D6EB 5I18H 2G3XA 3TA3D 1KIQB 3X1EA 3VUAA 1A3LH 4BFNA 4OV5A 4XBPB 5I1GL 1O7SA 3OSVA 1OOWA 1XZ0B 3HE6C 3LVEA 3OZLA 4YLBA 1E40A 2Y7OA 4HGKC 1X3DA 1BXAA 1D5MB 2KZWA 5E8PA 1LE9B 2ZX6A 3N0AA 2KZKA 1Z66A 4KKBD 3WIIL 1QI4A 1M7IA 1UACL 2VQ1B 3UGEA 4CVXA 1V3KA 2D3VA 2G2RB 5L7XH 5I23A 1J8SA 1CUOA 3VFTB 3LQMA 1D7BA 4YSEA 1F13A 1M53A 4GRWE 4PJCE 2OR8A 2V2XB 2PO6C 2ZCHH 1FNGB 1UXSA 4RWHA 3U9PL 2G5UA 1MEXH 4WEBH 1KJVB 5E4IA 1B3JA 4J12A 4XI5C 3ABZA 4ZD3H 1NFDA 3W0WD 1S7QA 2PWFA 3ARGB 2VQUA 4MNHA 4I1RA 5J1AB 3VXSD 4RLDA 3BHBA 5CJOL 4X4ME 2VLRD 2FL5A 1OTTC 2ROYA 3NCJL 4FI6A 2V9UA 1AD0A 3EYOA 4MAUH 4Z18A 3G5XA 5EN2A 2QQNL 4YDVB 4Z7OF 4QT5A 3TBTA 4JRXE 1SMDA 2X6UA 1CGWA 2XC8A 2R2BA 1WBZB 4LBAA 3VWKC 1FAIL 1XF5B 1RZQA 1RCYA 1AAJA 2NR6C 1HZKA 3ZL4H 2FJGA 1WEJL 5HYQA 1XIWC 1JGEB 5CZRA 2DKSA 4YHMH 3S5LA 5MI0B 1TVBB 4PJEF 4KK8C 2VAAA 3FTSA 2WLNA 3IFPB 1U3HC 3G6AB 3L5JA 3ZZQA 4NKDA 5IG7A 4OZIE 3B7TA 5D1QA 4J3UA 1T7VA 1TO4A 2FAUA 4O4YH 5HGDA 3F83A 4GRWF 2E7DA 1WFNA 2JJTC 4LMQE 1CQKA 3C60C 3L17A 3KYOA 4PJAB 3VI3B 1ZLSL 2RGSA 3WIHL 2R8SH 3RGBA 3DI2B 2O5YH 4XN9A 2H1PH 3T8XB 4AEEA 3B2UC 1JGUH 2WTPA 3TFKD 4YE4H 3GIZH 1OL0A 4EDWL 4OCNC 4XPAH 3VGBA 2KUTA 3C60B 1UVQA 3L4TA 4QHUB 2D31A 1WGVA 4WJKB 3LHPL 3NSYA 5E8NB 1DBMH 4ONHB 5EOCL 1PZ3A 5L4IA 3ZHKA 4RFNC 1IC0A 4HW6A 3H6JA 4KTEH 4PGZA 5FIEA 3P0VH 4ZFOB 4A6YL 3WIFA 1MH5B 1X5LA 2GHWB 2X0VA 1LK3H 3L9EA 3WKML 3D39A 1DEEA 3QJZA 2DD8H 3LV3B 3PAUA 4PJEE 3ARDB 3PHSA 1NJ9A 3QIBD 3RIFK 2I32A 3SODB 3U36B 4ELMB 3T3MB 1FBIL 3GMPA 1OGAD 2Y25A 7PAZA 3IFNH 4M9OA 4M8RA 3U1PA 3SGJA 5JW3H 1KEGL 1I8LA 5FHBL 4MCZB 5HJ3A 3WJJC 1X7QB 4V1DE 1AZVA 5LWYH 1QATA 4IIQB 4OD2B 1TQUA 2R2HA 3O6MH 3MOQA 5C0CA 4EKXA 4LSQH 2D2OA 4PREA 4ZUWA 2PUQT 2X7LB 5HJDA 4JFOA 3U4KA 2NNCA 5ANMA 3VDBA 3D4GA 2XN0A 2LU4A 1PZAA 3AG2B 3LN4B 1I53A 1NIDA 1GCFA 3H9YA 1U21A 1ONQB 1IGFL 2HJFA 3GLDA 3QUKB 1S78C 5TGBA 3ZQXA 1PZBA 3P4NA 4HUNB 5KYUB 3D2UA 1NKRA 3NIGF 3RBGA 4BSWA 5J1TC 3ZE2F 4BUGA 3AABA 1WWAX 1ZS8B 3LXBA 4AKOA 4KO5A 1CLYH 2CJTA 4XWGL 3L6FA 4P2RA 1YNTF 2ZJSL 2VDPL 5EU5B 4GIOA 5D2LA 1OVZA 4YK4C 4HBQA 3CK0L 4Z7VF 3E3QE 2QQLH 3UJTL 3WTTA 2Q86A 3IDMA 3MACH 3BEWA 4BHUI 1R3HA 1A7QL 3L4CA 4LDOB 3RNKB 4N0CD 5DHDA 1NM4A 3U36A 3MV7D 3N06B 5EZOH 4ELMA 2QTVA 4P2QD 1O9WA 2AANA 1UH4A 3GSXB 2X4QA 3ISYA 4K3GA 4CBZA 5E1AB 3X3GL 3SE8H 4G6KH 3UADA 1GGBH 5D7KD 3HB3C 1CD1A 1JHTA 1L9TA 3AU0A 5DQDL 3RFRA 3IDIB 2I7OA 4UAOC 3ZL1A 1S7SA 2WGNB 4G3YL 3IJ8A 3IKCB 4W9HC 3FQNB 3ZE0B 4PJFE 1D6VH 4XE5B 3MRLA 2XPYA 1AHWA 3WO3B 1YLBB 2ZP0T 3LNHA 5ICUA 2JH2A 2QLVB 3DDFA 4GQRA 1TJGH 1WLHA 3CH1A 2VDNH 3ZE0E 1RUKH 4M7LT 2A73B 3EYVB 3P77B 2WXFA 4D94A 2P24B 5D96B 2ZYHA 5IJKA 2OA9A 5KS9F 4C83B 3HN8A 3MRCA 4PJBE 4CC0A 2DTMH 4KXZH 4ZS6C 4PJFB 4P2RB 5IIEB 3D18B 1JXDA 5EHFA 5CLXA 3VSTA 2MQ3A 1WGOA 4HP5A 3T8XA 4TUOB 2J1XA 3R8BB 5F93C 5BMFL 4NCDA 4CJ1A 2IWKA 1QFUL 4XNYH 5T5FL 2VH5L 1OLZA 3FT4B 2ZIDA 3CMGA 1Q9OA 1UWXK 5IB3B 4TQIA 1S7WB 3FAWA 5K93A 1LO0L 1HOCA 4DUVA 4FNLH 4NQXA 3JWDL 4AYFA 1KN4L 3S3SA 4HOXA 1JPTH 1OTTD 2AJUL 3WUWG 5HYJB 2VXTH 2YGNA 3TEZA 1M7DA 1CFTA 3T3PB 3REWA 2OMNA 1UUSA 4IK6A 5FYJE 3ZE0F 4PJEB 2V5RA 3QCUL 1XGQA 1A9EA 1EJ8A 5HJGA 3T0EC 2H2SD 1BQKA 3QXUA 2KKQA 1KYOK 1QSFE 1UXWA 2NY6D 4PRIA 3UFIA 1BQHG 2DQDH 1MWOA 4KKNA 4QT5B 5DK2A 5TQ0H 2V17L 5DEZA 2DTML 4UQDA 1KNOA 1NIBA 3D2TA 1AHWC 4GAAA 1DBJH 1K8DB 4Y16C 3TN0D 3VXUD 3IDNA 4PY7A 4G7QB 4N6RB 3GPEA 4BRJA 1A7OH 2W38A 3THMH 3W3BA 5FGBC 1KPRB 4Z7AA 3GGWB 3MJ7B 3HN3A 1EZVX 3DGGB 1C08B 2IAMD 2X4TB 5ENWA 5AG8A 3MRKB 5JOEA 1E27A 3LPWA 4DNLA 3D12B 5INDA 5DMGC 2P1YA 4LIQH 1MRFL 2HJFB 4Y5VC 2CCWA 2XWBB 4AOFA 4BM7A 2MPAL 4U31A 1CFMA 4Z23A 3K2IA 1M2OA 2X1OA 2XWEA 2Y36L 1IE4A 4FTDA 5GHWH 4PJAA 3H9SB 3V0HA 2UXFA 3FULA 3RVUC 4V33A 4UAHA 3RWIA 2FEEI 5DO2D 5MEOB 4MX7B 1Q0EA 1LEIB 5E2UH 1R5VB 2F54A 2A6IB 3VD2A 4ADJA 2Z34A 5ESVA 3GHBL 4R5VA 3J8F7 2GT9B 3FO2B 3MOBL 2OV0A 2DW5A 4DVBB 7CGTA 4RGND 5BZDA 5AB0A 2DH3A 2ERJB 1TQCC 1G7PA 4PJAE 1L5GA 2LHAA 2ZNWA 2Y7QA 5D2LE 4F7CA 2DWYA 4E9XA 4LGSB 4F7PB 4AVKA 3PDDA 2GJZB 3NZSA 5I1CH 2VZSA 2ZXGA 5FX3A 1GZQB 3DA0A 5T3ZD 3NZ8B 5GS3A 5DA0B 3GHBH 4KRMB 4M7ZC 1INEH 4XOCA 4Z7OE 1CD1B 1EPFA 1JHTB 3O8XD 5DEGA 3GBEA 2I07A 3KJ6H 1E6JL 3R0MA 4UAOB 4UM9A 4R7VA 3MBEA 3MLWL 1R24A 3EOAA 3VB9A 1A6UL 5EO0B 3PGFH 3UZVA 2A6DB 4LT7A 3RI5K 4OZIB 1IGIH 1FV1A 4N8PA 3KXFE 4XN8A 1TJIH 1CGYA 3H7BA 5AW5B 3BQUA 2HA1A 3TV3L 4AZ8A 1MCBA 2LU7A 3EFFA 3KPQA 1X4XA 1MCCA 4KNTA 4K23H 4PMEA 5A6MA 4WW2A 1OZUA 3FFCA 4JB9H 3DX0A 4FC3E 4XN1A 4QHLB 1A7OL 3THML 1K5NB 1NPUA 4M43H 5DD5L 4EUPH 3SYOA 1B2YA 1DBBL 2GSIA 2EAEA 4HPYH 5DZPA 1MVUB 3HC2A 1KCLA 3ETBJ 1JK8A 4D9QE 3PWNB 1U93A 3AB0B 3MO1A 4NDMA 4PG2C 5I30L 1KSRA 3GMLB 4JKPL 3DO3A 5AVYB 4HUUA 1QFWL 3EFOB 2MQCA 1W0WA 3ZYZA 4BQ8A 2F68X 2LFEA 3VB8A 1XH1A 4HWBL 4I4WB 3NZ8A 1J8HE 1L3WA 4I48A 3O6FD 3O3EB 2BY2A 3NT0A 5CIPA 1M7DB 2CDGA 1LQBC 1X5ZA 4HUCA 5FB8A 2WXNA 2E47A 2FX9L 3BPLB 3MLRL 3K6SB 3JWDH 3LZOA 1JGDB 1XAKA 3DUSA 4P46A 4I7ZC 1LO0H 3VTTA 2O5YL 2YXWA 2AGJH 2R8SL 1VIWA 3JQOB 2VH5H 4HT1H 1BYOA 1A4CA 2G30A 2K45A 4Z9KB 2F5AL 4ZFFA 3WO4C 4PRDA 3I50H 1N0LB 5LBSH 4WO4D 3SCMC 5B1CA 2EXYC 2FD6L 3WXVL 4HK3J 2I5YH 3B3IA 1JVKA 4ZS6D 5JORB 2WO2B 5JHDA 4LCCA 4FMKA 3SE3A 3LQZB 5E9DE 4AUUA 2ARWA 4HIJB 2JJUA 2B16A 4PJ5B 4XMTA 2BSSA 2H6PB 1MHHA 3ZE2E 4JO3L 2VDNL 1X5JA 1XH3B 5AYUL 4MAUL 3RU8H 3S34H 4DETA 2VXUL 3P4NB 5KYUA 1QR1A 3M7FB 3NCJH 5HGBA 3BQUD 3KJ4B 4FCAA 5CAYB 2WZAA 8CGTA 3QPXH 5DQDH 4YUEL 1WS7A 3IJHA 4QLWA 3L9YA 1S2EA 4P57B 2OMVB 1CDJA 2JJSA 5D93B 3T8MA 1VGEH 5CEZH 1C8PA 3U9PH 3WG7B 2IANB 1B4JH 3FQRB 3MR9B 1UUNA 3JWNG 4KTDL 3T0ED 1CFNB 3SB3A 1MI5E 2N3JA 5HHXL 1CFTB 4J39A 5L7XL 1NUFA 3EF4A 3KYMB 4NUGL 2X3BA 3EGXB 3A3YB 1MSPA 4KO7A 1CD9B 4FLQA 3H3PH 2WXOA 2DJSA 3MRNA 3BKML 3C5JB 4WJG3 3KAAA 2FRGP 4OV6F 5DUJA 4ACPA 3ULVL 1M05A 1TO5A 4WKZA 2CUIA 4ODWB 4CL7A 4K94C 4WFEE 3ESNA 5J12B 3V0AC 3BUYB 1A3LL 1NWPA 3C87A 5A7EA 4BV1A 4RWYH 2OTUB 4J4PD 5IB1B 4HIJA 3NJHA 2FJHA 3O6LL 4G6FB 3S5YA 3CFBA 5ADOL 1JN6B 4X5RA 1N59B 2DJ4A 2X09A 4N2BA 5HHOA 2PO6B 2MFNA 1JSYA 1L9OA 3S35H 4RMWA 4RQQA 3D0LA 2IOOA 3EO0B 4X6DB 3PFQA 5KWYC 1IKNA 2QDWA 5DVOA 1A8JH 3CFJB 3AACA 2X10A 5CHNB 1KEGH 2WCSA 4QEGA 5JW3L 5B38A 1C12B 4KAQH 3UPRB 4OGYL 1TQCB 3TT3H 3VWKD 3L2MA 5FECA 3QPKA 4HCIA 1FL5A 4GW4A 2IV9A 1XIWD 4HPOL 3BRFA 1DJHA 1LWJA 1MIMH 4AENA 2H3XC 5GRVK 2XBTA 1NCUA 5GGTL 1XGUB 3GBNH 1XCQA 1F4XL 4NSKA 3O3EA 5CIPB 3SGEI 4MMXC 5DZOA 1F3DJ 4HLZG 3BT0A 3B2MA 4HK0B 1JZ2A 4UB0H 2GEQA 1HS6A 5EBGA 4MHHG 1INDH 1NFDE 2ZG1A 4FFWC 4RBPH 1J7VR 4HAGA 4YXLL 3T71A 1NDGA 1K6QL 3EJQA 3TFKC 3VG0H 2I69A 3MLZL 5EORH 4H40A 3TEWA 2H1PL 3CTTA 3FN0H 3KMDA 1ZLSH 5F3BA 4FXKA 1J0IA 2E8YA 2OP4L 1FGNH 3SDAC 1KGCD 1IGTA 4RQQB 1P4LB 3N91A 3V6OE 2HRPL 5LGKA 1AQ8A 1BMGA 1PG7H 2WAQA 3SDXF 4QOKD 1YDPA 1I1AD 3LQZA 3MXVL 2NCMA 1DJXA 1AZCA 1UM5H 2CO6B 3VRLE 1F3JB 4V11A 2IG2H 4M3HA 3LEVL 3QDJA 3QUGA 5CGTA 3TH3T 4MTMA 4HKBB 1NAML 2ZP8A 3RZCA 1G6RL 4UIMA 5BRQA 2GJRA 4EI5B 2FLBT 5E9DA 2WYZA 2ZUQB 4XCCH 3PE9A 4G9FD 4BFBD 1MFBH 2CJSA 1SN2A 2OP4H 4QRSA 5DHVB 4L4VA 3QR2A 4OSUH 4XHJD 4JZJC 3BKJH 1DVFA 3BVVA 1ZEAH 4XMPH 3ULAB 4IKIA 3VXOB 2ZG2A 1A6VH 3UTTE 3UO1L 1S7XA 5HYJE 2QPUA 2CE6A 1H8SA 1WHPA 2XXGA 4BZ1A 2P7TB 4PR5A 1FORH 4PWKA 3LKPB 3UAAA 2YBGA 3ZQWA 1HIML 5IBUG 4ES8A 2WKGA 1U8JB 2ED9A 1HL8A 2HT4D 4ZD3L 4NPYB 3UTZA 1AS7A 5EIIA 4FFTA 4DVBA 5F7FA 2Q8BL 3QO1B 3O4OC 2ZCHL 3GM0A 4TRPL 4R7DB 1PF3A 3T3MF 1JYVA 2CO2A 4KX7A 5LGJB 1WH0A 4JPWH 3GRWL 3GYRA 5CFAA 4GT0A 2FJFA 4YDVA 3H53A 3I6GA 4BEIA 5FYKL 4AYGA 2HVBA 5AW8B 1P4LA 4A68A 3WO4B 2YARA 4MSWA 2P5EB 4GQZA 4HPOH 1QI5A 4GI8A 1S8DB 4YDJB 2KS0A 1GGUA 1CGXA 3W5MA 2DLGA 5EIQA 4OGYH 3TT3L 5B3SB 2YXFA 2N7BA 5F88A 2CO6A 1ESOA 1KIRB 4ZMYA 3CFBB 1RK0B 2YK1H 1HEZB 3GSQA 1SDYA 3T77A 2EE0A 5HHNB 2DICA 4YBLC 1KV3A 5F1IB 4XVSH 4GQ9L 1IM3B 2AK4A 3VRJA 4OFYD 3AMLA 2N01B 5DUML 5F7UA 2R69H 3F8UB 1A14L 1HL9A 4X9IA 2ZWKA 4PP1D 5HHOE 1JMZA 3U2JA 4U1HA 2LQRA 5B7EA 4QHPA 4MJID 3RGVC 4FQXA 3WXWL 5D71L 3PU7A 4OD3H 5DHYB 5C0CD 1ET5A 3G5YB 1ZHNB 4TTGA 5DUBB 1U93B 5AOKA 3MLXH 3RHWK 1KJMA 2UXVA 4UNIA 2XPGA 4N85A 3FQRA 2ZNXA 2R1XB 3L3OC 1XF1A 4KQ4L 2EDKA 2Q3ZA 3BKMH 5HGHB 1B0RA 3UDWA 3KDMB 4QOKB 3W9EB 3KPRD 5DVPA 5GRYA 4AQOA 1IGCL 3HBGA 4NUGH 2VIRB 2E9JA 3RGVB 3B6SA 5HHXH 5BUAA 3CDZA 2BVQB 2DQ6A 2OKMA 2F53B 4BFJA 3QVAA 1JYNA 2IPKA 3GXIA 3MRBA 5DJAB 1PG7W 4FTVB 5CLYA 3U79A 2YAQA 4UILL 4WW2C 4KMLB 2DQCL 1B4JL 1HKLH 2AI0L 2M26A 1RPQA 4XVUD 4AIZB 5CEZL 4KJPD 5IW3A 4OUOA 3BEVB 1J48A 1X4ZA 3UZEA 1J5OH 3NJGA 1IM9A 3WTYA 4PJCB 4YUEH 3UEQA 4A67A 2NLJB 4WTWA 1TNMA 1KF9B 2RALA 2YA0A 3C60D 1EANA 4M00A 3TWCH 4KY1H 1WAPA 4YZWA 4L4TB 3V9FA 2ADIA 1MCDA 3S4SA 4BKSC 1E28B 4AQEA 4XP6H 2N4IA 1SJHB 2YA1A 4A7SA 4G1MB 4NO5A 4EN3D 1LP9A 3L3DA 2WD0A 1G9MH 1HXYA 4X0KA 1EMTH 1TT6A 3MRMB 1MELA 4OF6A 4ZNEA 1T6WA 3DIFA 1T04A 3ARVA 5EC2B 3MMEB 4KDTA 4GIPD 1WFOA 4RFOH 1EAPA 1T3FB 1PD6A 2BS71 4QXGL 3AQZA 3IMTA 2GYSA 3EGSB 4YSOA 4ZW8A 2OFQA 1L9SA 1I1AB 1HX0A 1MF2H 5F7KC 3ZXAC 2C5DC 5AVSB 2CO3A 1DVFB 4TVPL 3DSFH 4M8UA 2F5AH 4TL4A 4NM8H 4QGYA 3BAJA 4PJ8C 2Z4TA 1RXLA 4L9LC 2P52A 2YMXH 3ARPA 3IFOB 3HC4L 3CFEB 2B0SL 1GYVA 3FS9A 4O51B 1E3FA 2NY5L 1GVIA 4XRCB 3D8MA 2W95A 4QMEA 1MHEA 2OJZH 4I18A 3QS2A 1CR9H 3MA9L 4JO1H 4P23A 2R2CA 4PV8A 3V0IA 5LXVA 3HHRB 1T22A 3ULVE 2QSCL 4JL1A 2RD0A 3RVUD 5EF2A 4NN7B 1JFQL 1QRND 1BQLL 2VZOA 4OCYH 1TYRA 1AGCB 4MSWB 1HNGA 1U42A 1ACZA 1BZOA 4AQ1A 4V2CB 3HRZC 2F1BA 4PQXA 1N0XL 4PRPA 4ZW6A 1TYEB 4PJBF 1AJ7H 5C0CE 2VMFA 3R06B 4G7VL 5FWRA 4MZ3A 3MRHA 2J12B 1VFBA 1JWUB 3RVXC 4MVBD 3ILQC 1TF4A 3DK0A 2WXLA 2VR5A 3RX5A 2KH2B 3DV4B 1J8HD 4PREB 4X7SH 5DCCA 4NX0A 3U7WL 3G9AB 1HHHB 3UTPE 4KV5F 1K4CB 3BD5A 4D8PB 2Y5TB 5ID0B 2F7RA 3QC6X 3TV3H 1UASA 3V4PA 5J6HA 3BZDA 5D6DA 2NX5A 4QHMA 1GKEA 4HIIB 3B9EA 1E65A 3G6DL 1JUFA 1IGIL 1FVDB 2C4FU 3FJTA 2VSKB 3UZQB 3QUZA 4K3DH 5ITFB 5BO0D 4HWUA 4PJGE 5FM5O 2EXTA 3PGFL 4JFTA 4WNQA 1SJMA 3QO0B 3RJOA 3UROR 1A66A 2ADJA 4HQQL 4X7TB 1SMOA 1AZRA 3WTUA 3JWOL 5D7SL 3T65B 1M3JA 4R2GC 1MG2C 1J9CT 1E6JH 1PTZA 5C0BB 4Y2DB 1CYXA 5E5RB 2CBPA 1INEL 2IAAC 3O45B 4ZODA 5E5MA 3MRGA 4PHZA 5TF1H 1N4XL 1A1MA 2FH6A 3IMBA 3Q05A 1UA7A 1ULVA 1E8ZA 4WUKH 2ESVB 4WWNA 2OK0H 1CI3M 3MAWA 3T6ZA 2EDXA 1A0QH 1E50A 5E9DD 3X12A 1QLEL 5AENA 3PL6D 3TYGH 2IPKB 4QXUH 1SJEA 3CHRA 4HWEH 1XR9B 3VFVA 3LRLA 2NPLX 4JFEE 3UJIL 2BHZA 3PY9A 3PHQB 3D30A 2PETA 2J21A 5TJWK 2CGYA 4GRWH 1NGYB 1C5CH 5AKRA 4L1TA 1IM9B 2E7MA 5PCYA 4DGVH 4PP2A 4WHTB 1D2OA 2VL5A 4A2FA 3ZW3A 4CVUA 5IROD 4LF3B 4XPFL 4LVOB 2BCKA 3IKCA 3CXHJ 1PLCA 3RL1A 4NZJA 1URLA 3HUJE 3PAZA 3RVWD 3RLSA 5KZCB 2Y36H 5GHWL 4HK3N 4AXWB 3EOBB 2WWNA 1AQDB 3L5WA 5E0FA 3G5ZB 4Q6KA 4F8QA 4LIQL 5DZNA 4ZUVB 5K39A 4IM8A 4BSJA 1T2QL 2DQHL 4F20A 3LQAH 1LK2A 4FZ8L 4UTBL 1UATA 2UUDH 2KLTA 5GRZA 1NIFA 3BDYL 3IJ7A 3BAKA 3E2HB 1JHLL 3DHJA 3OKDA 5A2FA 3V4UL 3Q43A 4E9RA 2QADD 4PJXB 4XXCA 5IM7B 4UT9L 1JPSL 1KXHA 3DX4A 3BVTA 3E6FA 2CPCA 4IU3B 3L9RB 2LABA 5E1IA 2HLFC 4OZHA 5JYMA 4ZUSA 3QCTH 3UX9B 1UB6A 2H2SC 3KR3H 4NQQA 2MSPA 5LUMA 3D33A 4LSTH 1P9MA 3OC8A 3QQ4A 1F3RB 3QUXC 4X6BA 2NUPB 1SF3A 2G9HA 4XXWC 2APFA 3ULUH 4WGVB 2Q8AH 4N28A 3U1SL 5GRJL 1HOCB 1FPTH 5JXAL 2H47C 3NZUA 1HAUA 4OKDA 1Q0XH 4ODSL 3RPBA 2DKUA 1B0GB 4KJPC 3IYLW 4PVLA 4PN6A 1MVYA 1NIEA 1Z3GL 1QD0A 1T22B 4WIQA 3EDDA 3PJSB 4JZNB 5I17B 2ZPKH 3LKRA 1R19A 1TTBA 3UTSA 5BS0B 5LGJA 1A02N 1VCBC 5DQ9B 3ATBA 4M5YL 4PVMA 3BEVA 3AM8C 4R90L 2WSPA 4HGWA 3UZVB 4F7MB 2FEEL 3MLYH 4TLKA 4EN3C 2RH0A 4NFDA 2NY1C 4Z7WB 1NGQL 1LXMA 2E7HA 4ZTPH 4ZNEE 3GSWA 2W0FA 4HCRL 1P1VA 2HPTA 5JQ6H 3TURA 2ETWA 1F4HA 5A16B 2FT8A 2M8XA 1CTOA 1JIBA 1O9VA 4Z3FA 4X4XA 4W9CC 4XNDA 2HN7B 2OMYB 3QUMH 3DHUA 4FXKC 2HWZH 2EYSB 2J8UE 2AXJA 4QHKJ 3GC3A 5CILH 3IPBA 2W92A 5IB2A 4PRPE 4QI3A 3VXRD 3NYKA 4CC4A 1THAA 1YA5A 1LD9A 2GBAA 3FC8A 4NPJA 1GY2A 4IU3A 4U7MA 3ZSTA 3UG3A 5F1IA 4X9GA 4LHUA 2VDKB 1IM3A 1BFSA 1RIUH 2PR9A 5D7IB 1RZKL 4WY7H 3WN6A 1QBMH 5CMAA 3QUZB 2IF7A 1NCJA 2ITCA 4J4PC 4NQCD 4F57L 4KROC 4RRPA 2BM3A 5F9WB 3SKMB 3A47A 4YOKA 4AITA 2X88A 1MAJA 2VXQA 5I1IH 5L2JB 3M1BA 5JHDD 5IMLB 2PYEA 2FYVA 1DJSA 1NEZA 4G6KL 5SX4H 3N2JA 1OD9A 3ZTNH 4JDZA 3F12B 4J27A 1KCBA 3E38A 1P1ZB 3BUDA 1U3HB 1RD6A 4Z95H 1KWGA 5A2JH 5ICZB 2AP2A 1AR1D 4OI9A 2B9BA 5F8RC 1WZ1L 3UMNA 1MCPH 1NC4A 3AY4C 4DERA 2O26U 1TFHA 1CLCA 3ILPB 3GM8A 4MB3A 4I0KA 1A7QH 3R7QA 3B6SB 4I88A 3HI1B 4XNUH 1BLIA 1HSBA 4PRDB 4F9LC 2NZIA 4JPQA 4LQFL 4O9HL 4RGMB 5E6IC 1MCOL 4RGOH 1SFDA 1U95B 3KNBB 4HJ0C 4JVUA 4LBEB 4X83A 3U46A 3BW9B 3TO2B 4PLOB 2HT3D 2NX5E 5B1KA 2HVKA 5HGGS 4L29A 2JLPA 4KWUA 5TDOA 4KFMA 5KSAC 1IGFH 2WLJA 2GABA 3F7VB 4QRPA 3VD3A 4NWUH 1BHGA 3GSVA 4XOEA 1E4WH 1UZGA 3K8MA 4YHOL 1AIFA 1HXYB 2FYYA 1AE6H 1FLRH 4DW2L 4BRVA 2YPLD 2AMUA 4E68A 5JYLA 4JM4H 3O6ML 3NOIA 5BS0E 2NXZB 3I9GL 5ICYA 5IFAL 4OJYA 4QYAA 2XYBA 5C0IA 4GS7C 1E9OA 3NQKA 2YFOA 1COBA 4I9WE 4AM0A 4R96A 2HFGL 3SPCA 4G82A 3SJVE 1HQ4A 2ZXQA 4AGPA 1U30A 3V0WL 2ZG3A 1KB9K 2Q2LA 3AT8A 4WV1A 3HHMA 1KCSL 3MRFA 4ODHH 1C5DB 4N1HB 5F6IB 1JJUA 2DD8L 4U3HA 1MZZA 2BNRA 4XBGA 3WKMH 4R7NA 4EI0A 1B0GA 5I1LA 3ZRCC 2XRAL 3TX4A 3KPPA 4PRPD 3CMOH 5D93C 3VXRE 3P0VL 1YMMD 2C3WA 4IMKA 4N26A 4K5OA 4WRLA 4P4RA 5E8PB 4B0MM 4ZUTB 3Q9QA 5DWPA 3SBWA 5L8KB 1KT2B 3FSWA 3B9DA 1Z9LA 1PZCA 3E3QC 3C6LD 4I0PA 4MXQD 1MW0A 4FP8H 4OM1L 2F8XC 1ROWA 3BGFC 3BPOB 3W39A 5I1DB 4YHNA 5KVDL 2JSFA 5DEJA 3ABKB 4LLUA 2V37A 2VLME 1ZANL 4PW4A 4CN6A 2M2DA 2CHXA 3F7YB 3QHZH 1E30A 1BQSA 1RJCA 3P4MA 4DH2A 3DIVA 4U1MA 2WOYA 2F19H 4NOBA 3QAZB 4Y16B 4R7XA 1FIGL 1WG3A 5L6YH 2Y7QB 1WF5A 3G5ZA 5CKGA 4F7PA 4WUUD 5K39B 4BZ1L 3Q8FA 4HGMA 4YHZL 4Q89A 2HLFD 4FYQA 2K70A 5AFAA 3F7QA 1MI5D 5F7EL 3O11A 4OM0L 4LSRL 1BZDA 2BSSB 3QT2A 2IFGA 3FSOA 3KS0J 1WEJH 1IBZA 3BVWA 5FECB 1FAIH 1GZPB 4NN7C 2YXVA 3WBDA 5JZ7D 2AJVL 3P1VA 3I6KA 5B3NA 4MJJA 1WS8A 4X80L 4GI6A 3MRIB 5DJCA 5FS5A 2EKSA 2P8LA 3QIUB 4ZBJA 4Y1AA 3WN5B 5IHUL 4J3TA 2UZXA 3V4LA 1T0NB 4A39A 2QPFA 5CJOH 1ZXKA 1GW0A 1PY4A 2GTZA 3CFUA 3H7BB 3PP4L 2DRUA 4LCWA 5A2BA 1D5BB 2DBLH 1MQ8A 2EC8A 4ETQB 2ZP9A 2O5NA 2ESVA 3WS3B 1ZV9A 3MJ7A 2AW2A 5GIRA 1MJJB 4PTUA 1ET8A 5DEFB 2LLGA 3HE6A 3OG6B 4PVBA 4KNUA 1KTKE 4OUUA 4LLVB 5J3HC 1SJEB 2R4RH 2VE6A 4OIAA 3TVMD 3LXAA 1EAOA 1QUNB 3WIIH 1JD7A 3ARRA 2X0UA 3OKEA 3I6SA 3FYIB 3CSYB 3MXWL 3MNVA 4IDJH 1KEML 5T1MA 4UM8B 4ATTA 4HFUH 5A16A 1NCOA 3CHXA 3QGVA 4TPRL 1U8NA 3NJXA 4X50A 1YY8B 3LKOB 5EPMB 2R1WB 5EA0L 1JHKH 3LOWA 1UEYA 4HKBA 3Q7JA 1L3NA 2K0RA 3PG2A 3AS1A 5D1XD 5L0QB 5AVZB 1CT8A 3L3HA 1PMYA 2A0LC 4AIXA 3AGVA 1IEHA 1NZRA 4LLYB 3MJ9A 1GGIH 5AAMA 2D7QA 1WISA 3RJQB 1T1WB 4WLCA 1BWMA 4LVEA 1WRFA 4HXBL 1AXSB 2QVFB 3O6FB 1U6AH 3ZUCA 1ZVYA 2NRDA 3ZO0A 1LO4L 1M3IA 1UCBH 5L2JA 2ZCZA 2QGEA 4URTB 5HDWA 3JTBA 4G59C 2P3YA 3K80A 4HV8A 2YD5A 4NS0A 5BV7H 1RJLB 4NQSB 4AC2A 1RZ7H 4LSSH 5DVLA 5JHDB 3D2UB 4DWHA 3IJ9A 3VXQB 1V8HA 4LDEB 3SDAD 3BSZL 1KFGA 4KDWA 3CVIL 5FUOH 2ADGB 3I3BA 3BWAA 2VO8A 5H35B 3BJLA 4H20L 3FF7A 1ZS2A 4LU5H 2OSLB 5LCVL 3HS9A 5DJDA 1VAHA 2WINA 2UV3A 1UH2A 4UV7H 5CJ8A 4DPRA 5FO9A 1MAML 4KRPB 3A4DA 4QXWA 2R9HD 4AW7A 4OFKA 2ZKMX 1NCBH 4PJ8D 2NY3C 4NAJA 2YQ3A 5DK0A 5ABZA 5I6KA 5FYKD 4ELKA 4FLHA 2J20A 5D2LF 4M7LL 1G94A 4FQQA 1E3ZA 4L3EB 3JYBA 2J8UF 3FZUC 3MV7E 4Y16A 5M95B 2V3EA 4N2CA 1MFCH 2DDQL 1EJ6A 3K0YA 2QFPA 3Q13A 1YCSA 1W0WB 4KKPA 4OLZH 1FFPA 1AC6A 2WXRA 5GGRY 3RDTC 4F27A 2YXMA 1MW3A 4OJEH 1I85A 4IOSA 3T09A 4ZPVA 1IM9D 2HJLA 3BP5B 3HEIB 2EIEA 4I2XA 2DJMA 3MV7A 1ZT1B 3OGCA 1BQHB 2X5PA 1YUHA 4F15B 1ZOXA 1H0DA 2HT2C 1KDIA 3BH9A 1PIGA 2WIIA 5IQNA 3ILQD 2RQEA 3LJ3A 1KELL 4ZFGL 1VB9A 5D7JA 1ZTXE 1S46A 1BOGA 7FABL 1JWMA 5FDWB 2HTLD 1S5IH 3L5HA 4JCWA 4XN7A 4W9ZA 3IE4A 4U0RB 2VDQL 4YZFE 2OZNA 3WHE1 1QNIA 4KJWC 5EZLB 1GGTA 4X9FA 1AI1L 3S3DB 3VVWA 3U4AA 1RJYA 1R3KA 3LIZL 3O2VL 4UTAL 5KBMA 3ULSB 1PG7X 3QO1A 4FD0A 2X9YA 1GSMA 3VI4F 4M1GL 1JD9A 1IKFL 2X70A 4L3CB 1TJMA 3MROA 5AQ0A 2BP8A 4D0DB 2NSMA 4TKWA 2BJML 4PEEA 4LCWE 1GC1H 3CZUB 4A2HA 2FNBA 5IP4A 1YN7A 4I3SL 3T6XA 2MOQA 4LOVA 2H3NA 4CVWA 3KCPA 1SHWA 1UT9A 3GMQA 1FRGL 1ES0A 1HN1A 3DX3A 3NFSH 3L5XL 5JHAA 4H2CA 2Q6WB 1N7ML 3NUKA 1OAKL 1Z9NA 4E2OA 2R1WA 2X4PA 4LAQL 4XOBA 4B9ZA 2HVKB 4RFEB 1FCCA 1OAYL 2Y22A 2M1KA 5E8EB 5DD3H 4ANWA 2CM5A 4F33A 2BVOB 2XETA 3JUYA 1ORSA 2OMZB 5GS0D 1HTYA 2V7HB 1T5XB 1O7DC 3PQYA 4CAGA 3H6AA 4U05A 1T2XA 1N2RB 5I26A 1GXEA