4HIPA

Crystal structure of the pseudomonas aeruginosa azurin, h126no yoh109
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
127
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNFVLSTAADMQGVVTDGMASGLDKDFLKPDDSRVIAQTKLIGSGEKDSVTFDVSKLKEGEQFMFFCTFPGHSALMGTLHLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Electron Flow through Nitrotyrosinate in Pseudomonas aeruginosa Azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 31
structure length 127
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4hipA00
4GXFA 5I5MA 1BQ5A 1OCOB 2BP0A 2PP7A 3L45A 4ENZA 3ABGA 2VW6A 1MZYA 2Y1AA 5FC9A 1XB3A 1KYAA 2CALA 1ET8A 2YAPA 3S3CB 1FA4A 1E65A 4A2HA 3S8GB 2HX9A 1OE1A 2J55A 2XXFA 1QHQA 2FJSA 2HRHA 2Q9OA 2IWKA 2J56A 4DP8X 1SFDA 4G71B 3OQRA 3T6ZA 3V9EA 1KDIA 2VM3A 3X1EA 2A3TA 3QJVB 4YSQA 2EINB 2FQEA 2X87A 2XLLA 4AKPA 2PCYA 2GB2A 3GXUB 4JHUA 3NJFA 2DYRB 4BXVA 4E9XA 1M56B 1JZHA 3IBOA 2R7EA 3X1NA 4KNSA 1PZCA 4E9TA 4W1TA 1HAUA 3NSCA 5I6KA 2YQBA 3IN2A 5I5JA 2CJ3A 2Q5BA 5I28A 3CG8A 1PCSA 3NJKA 3WKQA 1J9RA 1V54B 3NJMA 4DPAX 4YSPA 4UF7C 2JKWA 3IE9A 1GY2A 3NSFA 1IC0A 4GY4A 3FSWA 3OMNB 1KGYE 3FPYA 1F56A 2IDUA 3FU7A 4A2DA 2I7SA 1L9OA 3TASA 1MG3C 2BO0A 2ZXWB 1JVOA 3WKPA 1PAZA 1PNDA 1JXGA 1PZBA 4FA7B 1BEXA 1ZDSA 1ZIBA 3WG7B 4N8UA 5D4JA 2DYSB 3NT0A 2AVFA 3QJUB 3PLYA 3HB3B 1UATA 4AKQA 2HZHA 1L9RA 1NWPA 1JZJA 5AKRA 1JERA 4A66A 3X1FA 4M3HA 4BK5C 4CSPA 2VN3A 2XXGA 3AY2A 2BP8B 1ASOA 2LLNA 1ID2A 3TU6A 3PPSA 1WS8A 4G7RB 3CVDA 1OV8A 1AS7A 4Q8BA 1A65A 3TBBA 1XB6A 3S3DB 4HZ1A 3ZIYA 2FQFA 3BVDB 3ABLB 1E5YA 2VSMB 2XX0A 4KNUA 2XV2A 3PAVA 2FTAA 3NJIA 4YSUA 3WNIA 1OCCB 1PY0A 2FNWA 2FWLB 4KO5A 4GP4B 2BZ7A 3QPKA 1SF3A 2PPFA 4YSOA 2GC7C 1NPNA 2B3IA 2CCWA 2XYBA 3FQ1A 3UADA 2IDSA 1X9UA 4NB7A 2B08A 5LDUA 3C75A 5TK4A 5B1AB 1NDTA 2FT7A 5PAZA 2AZAA 2IDQA 3GYRA 4TXVB 3H56A 4AKOA 3QJTB 2QT6A 3PCYA 2YAMA 3S8FB 4E9RA 1AG0A 1KV7A 2YAEA 1GSKA 4E9SA 1XB8A 3FU8A 3DIVA 4YSAA 3D12B 5B7EA 1NIFA 2YXWA 1L9SA 3T9WA 1ET5A 5B7MA 1SJMA 3FS9A 3ABMB 4PCYA 1BXAA 3T6VA 1RCYA 4BWUA 4JKNA 4MFHA 1J9TA 1A4CA 1T5KA 1AZRA 4DP2X 3JTBA 2MTAA 4HHGA 2DV6A 2XVBA 1GY1A 5B7FA 1BYPA 1ILSA 4AZUA 2H5UA 3NJNA 3NP3A 4ZK8A 1BQRA 1AZCA 1IBZA 2XWZA 4RH4A 4KNTA 2HLEB 1L9PA 7PCYA 1EHKB 1AZBA 2WO2B 2BP8A 5B1KA 4E9YA 1ILUA 5I6NA 3OM3B 4W9ZA 2PPEA 5AFAA 3EF4A 1WAEA 1W8EA 1NZRA 1A3ZA 1JZIA 2EIMB 3WNJA 3FYIB 1PLBA 1CYXA 1AR1B 2BWIA 3NSDA 4GP5B 2UXTA 1L9QA 4UAHA 4HCFA 3RYMA 5B1BB 3CDZB 1NIEA 3AG3B 1TEGA 4HHWA 3JT2A 4FAAB 1AIZA 4WKXA 3FU9A 3H4HA 1SHWA 3NSYA 1JZGA 3H4FA 4YSDA 5PCYA 1AANA 3HEIB 2IH8A 2IWEA 1AZUA 1N70A 2PPDA 5I6LA 3ZX1A 3OMIB 1JXDA 1PZAA 1KBWA 1WA2X 2ZONA 4DP4X 3PXLA 2QPDB 1W6WA 2VW4A 4P5RA 1L9TA 1J5DA 2QDWA 1MZZA 4Q89A 4UANA 2OV0A 1NPJA 4BDVB 4CSZA 4BXSV 1SDDA 3ERXA 2PPCA 3MBWB 3X1BA 2DY2A 2BP0B 4JHVA 1ASPA 4KO6A 3IN0A 1ETJA 3FPXA 3KW8A 5F7AA 2GBAA 1NIDA 2BWDA 1JZFA 2VM4A 4G70B 1I53A 4G7QB 2YAOA 4AI7A 4DP5X 3WI9A 1A8ZA 1IBYA 2BZCA 3SBQA 9PCYA 1GS7A 2RACA 3DTUB 1W6LA 1J9SA 2TSBA 3UACA 1AS6A 1BAWA 4K9JA 1B3IA 1CUOA 1OCZB 3T6XA 4DP6X 2HX7A 3TBCA 1CYWA 2Y69B 2PPAA 1JZEA 2QPEB 3S3BB 4YSEA 1PF3A 4G72B 2R7EB 2I85A 4YSCA 1A4AA 1OF0A 3X1GA 4A2EA 2YAFA 2XX1A 1TKWA 2XU9A 1NICA 2FQDA 2BHFA 2CAKA 1AG6A 2N0MA 5D4IA 3SBRA 3UAEA 2AANA 2HRGA 3OD3A 2FQGA 1V55B 2NRDA 2XV3A 2XUWA 5B1JC 2I7OA 3PAUA 2W8CA 2HXAA 2IDFA 2W88A 1YLBB 3SQRA 3EH3B 3CVCA 3FU7B 4KOCA 3DKHA 1AZNA 2OCCB 3QJQB 3FSAA 4WTQA 2EIJB 2E86A 5I6MA 2JFCA 1AQ8A 2MRYA 2WSDA 2GHZA 2CBPA 2WO3B 4HCIA 1PLCA 5I6OA 1GS8A 1KCBA 1XMEB 3UAAA 1SF5A 2EIKB 3FT0A 4DP1X 1SFHA 3T6WA 2EILB 3N55A 1KDJA 2YAQA 4BDVA 1AS8A 3BQVA 3QJRB 4A68A 5I5IA 2UXGA 4BWTA 3NJLA 3CZUB 2UX7A 2P80D 6PAZA 1KBVA 4QLWA 4GP8B 2UX6A 1TU2A 1OCRB 2BW4A 1ADWA 4KOBA 4NAJA 2FT8A 4E9VA 1ET7A 4YVNA 7PAZA 2IAAC 2YXVA 3NJHA 2UXVA 4A2FA 4YVUA 2YAHA 3AG4B 1GS6X 2JXMA 3EH4B 5TK2A 2IH9A 4HCGA 2J5WA 5D4HA 6PCYA 3ASNB 1BXVA 1RKRA 2GSMB 4EF3A 1FFTB 1M57B 3ASOB 4GYBA 2PP9A 2ZOOA 2XV0A 3AG1B 4E9WA 2DWSA 4PAZA 2YARA 3NYKA 4M4RB 3EH5B 4YSRA 5B3SB 1RZQA 1DYZA 3GDCA 5B1JA 1ZPUA 1M9WA 3QQXA 1OE2A 2GIMA 2IWFA 3FQYA 5ANHA 2H3XC 4DP0X 4E9QA 1BXUA 5A7EA 1MDAA 1RZPA 3G5WA 3N2JA 1SHXA 3ZDWA 1J5CA 1ZDQA 2OJ1A 3FSZA 2QDVA 4X4KA 1QNIA 4YL4A 3MX0B 3AZUA 1ZV2A 2PCFA 4F7KA 4AX3A 3QJSB 1AOZA 3ZBMA 3FSVA 3NJGA 5AZUA 1NIBA 1WA0X 3T71A 1NINA 4L0PB 4F2FA 3UABA 2H47C 4P5SA 1R1CA 1N68A 1GYCA 1QLEB 1NWOA 1X9RA 4BWWA 3V9CA 1PNCA 4DPCX 3UGEA 4DP9X 1GW0A 5E9NA 1E5ZA 3OMAB 4HAKA 5EHFA 3ABKB 1KCWA 1E67A 3NP4A 3AG2B 4KO9A 4KO7A 1V10A 1FWXA 2FT6A 2VMJA 5I6PA 1IKOP 1AACA 2PP8A 2DWTA 3SBPA 4NERA 3IEAA 1WA1X 2CUAA 2TSAA 4HALA 2GI0A 3CVBA 2HX8A 1JXFA 1JOIA 1NTDA 1MG2C 1A4BA 1JVLA 3PAZA 1OOWA 1ASQA 1J9QA 1TEFA 2UXFA 4HIPA 1EZLA 1GR7A 4A67A 1AAJA 3EHBB 4DPBX 3CDZA 1E30A 1CURA 1CC3A 1HFUA 3AW5A 1PLAA 2VSKB 2PLTA 1WS7A 8PAZA 1BYOA 2IDTA 2X88A 2BW5A 3KW7A 4YSSA 5IY5B 1DZ0A 2AZUA 3FQ2A 5F7BA 3WIAA 4DP7X 2GC4C 1ZIAA 1PMYA 1OE3A 1NIAA 2AFNA 1VLXA 5I26A 3NJJA 3U25A 2J57A 4YSTA 4QKTA 1SNRA 1IUZA 2P80A 2VW7A 4G7SB 1SDDB 2ZWNA 1URIA 1HAWA 4F2EA 3X2QB 4A2GA 3FYEB 3TA4D 4N4YB 1BQKA
chains in the Genus database with same CATH superfamily
2O5XL 4CADB 1BQSA 2ZUQB 4ENZA 3MX0A 1TVDA 4CN1A 1NDMA 4EI0A 1MCLA 4LLMB 1SDYA 2NXZB 2RR3A 5FM4A 5AW2B 4U3CA 3GZQA 3PABA 4HEMA 2YAPA 3BRDA 4MRCA 1FCCA 2XWBB 4J6RH 4NPKA 5C0FB 7TAAA 4CC4C 3F7KA 1HWHB 3EFOA 5B39B 4P4RB 3WXVH 1BJ1H 1T1WB 2CM5A 5H37H 4DN4L 1JGIA 2HRHA 3QXUA 4FE9A 3EJJX 2AAVA 2P5EB 3QQ9D 5EO9A 1MWAA 1QBML 1CPUA 1D5MA 1A1OA 5LCVL 4QRQA 1CFTA 1BZ9B 4XN7A 1Q9LB 4GB9A 2EINB 3QK0A 3AQXA 4GAJL 3VQ1C 1NGWB 4JDTH 5HYEA 3V79C 3VFTA 3A6OA 3FH7A 4UM8B 4D0BA 3K6FA 3PFUA 3WHXB 3IFLL 2Y4SA 4NQVB 5EIIG 4RRPM 4W1TA 5F1IB 1JHTA 5I6KA 4XCFH 4GSRA 1P1ZB 1W0VB 1NH6A 2Q5BA 3WN5C 2G2RB 1WK0A 2DQIL 2FIRT 5L4FA 2YMXH 3LKPA 3LHAA 4DN4H 1YEKL 2X1WL 4LESA 3W1ZA 1H9VA 2ZF8A 5DJZA 3FSWA 4ZMPA 2ADJA 2AI0L 2O61B 1XF5A 3TASA 3APFA 4YN3A 2G2PA 3AU0A 4NNYB 1OP3H 1ZDSA 4N8UA 1R4XA 1CFSA 2I9LA 2DYSB 3IFLH 1U3JA 3I50H 4TSBH 2D2CC 4N0RA 4EE2A 2AXGA 2BFGA 2ZOKB 1DDHA 2NY6C 5D7JD 4AK2A 4OV5B 1NWPA 1OWWA 5FO9B 4LDOB 3H9SB 1FAIL 2DQIH 3TV8A 2GEQA 2VN3A 3SDAA 5A2CA 3EOTL 3UTQA 1WBXB 1E9OA 2ODHA 4TSCH 4RSYA 1ZLWH 2NY4C 1CXKA 4P5MA 2AI0H 4JPIB 3S37L 4BQ6A 4XMZA 3MRGB 5IB4B 2VLJA 2FQFA 4FNQA 4JFDD 1E2WA 3WGVB 5FGSA 2XV2A 4OKDA 4MB4A 1GPOL 5DJ6A 4PJDE 3U7WH 4ZMZA 2J4WH 1LO4H 4FYTA 3GSRB 4ZRGA 5GISL 4R97B 2G9KA 4H20H 4YSOA 5CEZL 4Y8DC 4QIRA 5GIRA 4V1DD 3HE6A 3HPJB 2YBGA 3P30H 1C5CH 3DO4A 5TE6L 1QSFE 2Z31C 9CGTA 3L3DB 4NI3A 3DC0A 3HN5A 4KRMB 5DVNA 1IVTA 2ZUVA 4I77L 4CL7A 3BIKB 3QRGL 2D7TH 4HJEA 4XX1E 4L23A 4Y5YB 3S5ZA 2FK9A 3HLAB 3AT8A 3FU8A 1KXVC 1TZGH 5DK2A 5CCKL 1GPOH 1UB6B 2PYEE 1KBBA 3FHAA 1E5AA 4U2ZA 4M9OA 3SYQA 2F74A 4GSDH 3KLAA 5GISH 1VENA 1PDKB 2IXQA 3V4PL 5L8JB 2PCFB 5ESVB 3BH9A 4HEPA 2Z8WC 2A77L 4XP5H 1UKSA 1H19A 4RWYL 4M8UA 1CE6A 2AQPA 4OKVA 3ZHFA 2ZCLH 2VH5L 4XGZA 2FLRT 2VLRA 4B9YA 1LE9A 1CD0A 3Q1SH 1IV8A 4I2XB 3UTTB 1LQSR 4YDNA 5F7HA 3FL7A 5ACLA 4WW1A 1JPGA 4U6XA 2R0ZL 3W3BA 4QYAA 1EHKB 5DC2A 3MRBB 3RZCC 3WEOA 1TJIH 3NIFE 1BV8A 1MCJA 1YNKL 4Y2DD 3TX4A 3ATFA 1KZYA 2LGNA 1UM5L 1F18A 3VXPA 5IOPA 1MCHA 3K4DA 4PV9A 1ERNA 2XVLA 3PE9A 4PGCB 1YC7A 4PGBA 3SE8H 4OSUL 5HHOD 1H15B 5BQ7B 1NBZB 3X12B 4GH7B 3MR9B 3JTSB 1P9MC 4NZDA 3IF1B 1RQ5A 4XTRC 5CNHA 3O6FC 4HSCX 2DQUL 3LIZA 1K2DB 5KBMA 2V2XB 3VH8B 3DGDA 4B9JA 4F7MA 4LSRH 4MJID 4Z3TA 2AK4B 3HG3A 4PJFB 4WNJA 1KFAL 5CD5D 2ZSWA 4LSSL 2R2CA 1TENA 2VRAA 5T5FH 4QXVA 4UNIA 1AIZA 5ID1A 2R0ZH 1JFQL 4FX5A 1TZIA 3B7UX 3MOBL 3PF2A 1T0MB 1BX2A 2X4QB 1YNKH 2D3LA 4P2CG 2EJ1A 4B9ZA 3CVIH 4LEOB 3BN3B 5DHMC 5G4OA 4DEPC 4XNUH 2WBXA 1YYMH 4LLDB 1S7XA 3CFMA 3DVIA 1NUFA 5IROA 3PXLA 2QPDB 1I1AB 4ZPTA 3VMNA 2DQUH 4Y19D 4LNRB 4ZW8A 2Q3XA 1NPJA 4FFTA 4BCZA 3US0A 4BXSV 4M1CD 4L9LA 3KPNB 4IKKA 1F11B 4Y9EA 5EBMA 3T65B 5DD6A 5A2LH 4NOBA 3UJTL 1HQ4B 3CMOL 3MJ9H 5JQ6L 5F8RC 4RX4A 4FZ8L 4F2ME 1R24A 3DV6A 1ETJA 2QELA 4PVBA 1HL9A 3LS5L 4X7SH 3AADB 3TBWB 2Q0ZX 4G70B 3DX2A 1DL7L 3LEYL 4OGYH 3ZT7A 4PJ7F 2CKBB 3QQ3B 2E56A 3VAEA 3U4KA 2Q8BL 2OMXB 3ZK0A 3QORC 1VCBC 3MACH 4LLWA 4M62L 5KZCB 2WO4A 1OAQH 4AZ8B 2V9RA 4TL5A 2J5LB 3SD5A 4HD5A 2NY2B 2Y23A 4PD4K 4PR5B 1D2OA 1LDPL 2F5BL 2R1YB 1BZDA 3GXNA 2QPEB 1E3XA 3QUZC 2VIRB 3RL2B 1YN7A 3UJTH 4WV1B 4ZYKA 5IFJA 3K0WA 3Q5YA 1XF2B 4YSCA 2QVFB 1LEKA 3VFPA 1T2QL 2BMKB 2JKXA 1TZOA 4LL1A 4N2DA 1NEUA 1X7QA 2XU9A 4U49A 1DL7H 4B6ZA 3Q6GL 1EGJL 1O0VA 1PS3A 2GABA 5JOFA 4PJCE 1ZXQA 2BIHA 1WFTA 2NRDA 4HAFA 3MRCA 2BIIA 2J25A 4UT7H 2WYTA 2YOCA 2BPBA 4TUJA 3FFCA 1Y6NR 4Y4KB 4ZO7A 1SEQL 4YMPA 4H8PA 4L2LA 1A3QA 2CLZA 4PGZA 1FE8H 5K9OB 3CVCA 4U6YA 5BVJA 2FL5A 3FSAA 2F5BH 3ALXA 4UTAA 3UAJA 4RFNC 4NRZB 5C07A 5D71L 4NO5A 2KKQA 2QPUA 1I8UA 4ZUUB 5F7LB 4CGUB 1Z1WA 4OZHA 2DLTA 4MMXC 1DBJL 1SOQA 2VMDA 2YXMA 2K4WA 1KBKA 2R2HA 4N0UE 2FO1A 3QULB 2P26A 1EGJH 4OUOA 1IL1B 4Z7OE 5FYLD 1MQKL 1UASA 1G94A 3BESR 1T83C 3BQVA 5DJAB 4M3JA 1AGEB 3QXAA 2H26A 3QO0B 3SOBH 5SWZD 2PN5A 5E2VL 2XQBL 3SKOA 2VDKB 4IGBA 2V7HB 2W9EH 5CP3H 5C8JA 2D7PA 4K23H 3FQNA 5DRZA 2W9LA 2F61A 4BZYA 5DS2A 4WWKB 1OT2A 3UPCA 3OB8A 2F0CA 3F2LA 1MY7A 1MPAL 4LLVA 1U8PB 4APXA 3SE3A 1MJ8H 3MRFB 4XBPB 1DBJH 3V7MA 3N42F 4OLYH 2JXMA 1YHPA 1WFUA 2X53A 2DQJL 1AD9A 5HHVL 5C2BL 2X38A 4JFXB 1NKRA 1FGNH 4LCIH 3BQUC 1K4CB 4FABL 5HI3C 2EDJA 1BXVA 3EIFA 1KB9J 4LCUA 3MLWH 2OQJB 3UYPA 3WOVA 1A0QH 2ZOOA 3RGVC 2IPUG 2FO4B 5KSBB 4H2CA 3TO4A 2AJVL 2OTUB 1WQVT 5ACZB 2RMNA 1U8HB 1HOCB 5ICXB 3UC0L 4QYOA 2DI7A 3BWUF 1C12B 1BGXL 3QS2A 1VA9A 2H3XC 1UVQA 4DP0X 1G6RB 4LQFH 3OTTA 4LKXA 1BXUA 3MV9D 4BGDA 5C2BH 4LEXH 2OZ4L 5EPMB 5I9QB 4BRJA 1HZHL 3BZ5A 4N1HB 4HH9A 2LTQC 1MCWW 1HHKB 4ZZFA 3MLRL 2VNCA 3NUKA 4NM4L 4I18C 3VGAB 3EJPA 3MJ7B 5L8LB 3OJVC 2AJ3B 3X3GH 3T2LA 1YY9C 3L13A 4LHUG 1QP1A 4UQ9A 4F2FA 3N41B 4YHYB 2QV4A 1KGCE 1DHKA 1UFGA 3U0PA 4DK6A 4HUNB 5D7IF 2GIYA 5IQ9B 2H47C 2YUZA 4P06A 3HR6A 3FT2A 5DD0H 5FLVA 2FEJA 1ACCA 1N68A 1UXSA 1G6VK 2E74C 3RU8L 1BGXH 3LN9A 3GMPA 3ZKMD 1UT1A 3AT9A 2GSGB 3M8OH 3RWGA 4KTYA 5C6TL 2V9UA 1AXIB 4JY5L 4MQTB 3MXWL 4HWUA 4AMXA 2O72A 3AG2B 1U36A 5D7EA 2F58L 1SM3L 3BHBA 3MJ6A 5T1MB 2FIKA 4LK4A 2FT6A 3E8UH 2W38A 4Y9FA 2V5SA 1IKOP 1D5ZB 4X7EC 4K5LA 2UY7A 3ZRSA 5F9WB 1F2XK 2Z9TA 3P4OB 1JWUB 4PH8A 2OW7A 4WWOA 1XX9C 2UZYA 4ZFGL 3GSQB 3FO0L 2UXFA 2PNDA 2X6UA 1CI3M 4NHUB 1AQHA 1QSED 1T21A 3ARFB 3EHBB 2XETA 2ZX7A 4KTDL 4ZAKD 2B20A 3RU8H 5ERWB 3HZVA 1HFUA 4DW2H 1DN0A 4E0RB 3NA4A 5AVVB 1YAIA 3ZL1A 1PX4A 3LDBB 3N1PC 3QEHA 2ZPKL 5C6TH 4PJAF 3RUGB 5IY5B 2BVTA 4JY5H 3VXRE 1BFOB 3MXWH 3TIEA 4IIQB 3ESOA 4DP7X 2A9MH 1T7XA 2Y7QB 5HHMD 4JGMA 2XWJA 5KBNC 5DFVC 2X28A 2MQGA 5IVZA 1BVKA 3RTQA 1GMEA 3D87B 3QCUH 5EUOB 4DGIL 2NY0C 4E41D 5E95B 1N8ZA 4KK9D 4G7SB 2R1XA 4ZFGH 2CIIA 2ZWNA 2VQTA 3EYVA 4MB1A 4UT9A 3CXFA 3QQ4A 4ABVA 1VADA 3UCRA 2D4DA 4DKDC 5L0QC 3S8GB 4JQIA 2Q6WB 5I5MA 1HNFA 1UD2A 3HHSA 1MVUA 2N1KA 4BKLB 5CJ5A 3QEQD 1I8LC 2FUTA 1EZVX 2B1HL 1D7DA 2CALA 2ZPKH 4LEEA 4XZ4A 5T1KD 5E5MA 2O26U 3SCMD 4ALAC 2CRIA 1YMME 4G6FB 1DUZA 1WEJH 1RURL 3O11B 4N9GB 2NYZA 3BGMB 2DYPB 3VI3E 3U6RB 2IALA 4JJOA 5DGQA 3ILQD 2J8UA 5DS8B 3KDPB 1YVLA 4G71B 2OMVA 2GBUA 3QXDB 5KVGE 2R1WB 1KCUH 1ZK5A 2FDBP 2X3CA 4U1SB 3ECVA 3OF6A 5MENA 5TF1L 1WD9A 4C56E 4NOFA 1M2VB 4ZFQA 3SGKC 4YHNB 5HGBA 3LKNA 3RX9A 4BXVA 1JZ6A 1X4ZA 2FBOJ 4L1DA 3VXOA 3DO7B 4I8DA 4MJ6B 3S37X 2JB6A 3NFNA 4DFHA 2HPTA 4Y9GA 5KYUB 2VUKA 3BVNB 4P99A 4YHKL 3VTAA 5B3JF 3B2MA 1Q38A 3P11H 4UV7H 3NH7L 3VWKD 4H25B 2VO5A 1JGDA 3B6SB 4PYGA 5AYUH 5CZXC 3W9DA 4JE4B 4Y9BA 2VDRB 4KK6D 4WEUD 4GY4A 1R3IH 4HUMB 4NO0B 4IKIA 1N64L 4YGAB 4MCNA 1UA6H 1EDHA 2A6DB 2V3EA 2Y5TB 4AM0Q 3C2SA 3IDGB 5HYFA 3F12A 4IJTA 4OLWH 3GZPA 4PTTB 5C0BA 3IJYA 4NZ8A 3WS3B 1EFXB 4JPVL 3WFEH 1XCQB 1T1XB 3ELQA 2Y7NA 4HKZB 2ZCKH 1FZOA 3GWJA 3RDTB 3SDDB 1FG2A 4DAGH 3TZVA 4Y16B 1XIWA 4YHKH 5C3IA 3IDMB 1JZJA 2A74A 1PY9A 2XIBA 3AACA 1IBBA 5T5FA 1U91B 2Z35B 4HS6A 5I1AA 4U4BA 3ZDZE 4TN9A 4PJ8A 5BRZB 1VFMA 4NDMB 1S46A 4F2MB 1HYRC 2LOEA 3TV3L 4WDIA 1IEBA 3QUXD 1XDTT 4OI9A 3NFPA 4FQ2H 4HZ1A 1OTUC 1A4KA 4Y5VC 5I1EH 4AH2A 4WI3A 3R18A 4OUUB 3REVA 1INQA 2LV4A 1JUFB 2ZNWA 4AT6B 3KPTA 2I25N 4IS6A 3T4AC 3VRLF 4QOKD 1U8OB 4OB5L 1QPXA 4IKNA 5E8OA 3L4UA 1NDTA 2ZXDA 4NKQB 2UZXB 4NBYB 4R96B 5DFAA 3B3BA 3ZL4L 1D9KA 1F41A 1L3NA 4CSSA 4FZEL 1F58H 2QT6A 3V4VA 3QWRD 1NEZB 3WJJC 3GUFA 3MRDB 4F8PA 2N0KA 5LWYL 3ULVE 3FQUA 1A6UH 3BUYB 3L9YA 5IMMB 2BS71 3KYKL 5IKCB 2LU5A 3BUDA 2A0LD 1NMCC 5D1ZC 1K6QH 4PHXA 1QFWH 5DWUH 1EMTL 1JPSH 1J9TA 1M71B 4Z0XB 3C6SA 5IQLA 3QH3A 2LU3A 2J6EL 3WNNA 4RWHA 1I82A 3BP4A 2VLJE 1IBGH 1OAZL 4IU3A 1KJ2B 4JCMA 4K5OA 2X4NB 4LIQE 2BSEA 3QG7L 4P2OD 1HHJA 4IU2A 3WEXB 1H6EA 3B37A 1A6VH 2XZZA 1G7HB 2YKKA 4AZUA 1MFEL 3UH8A 1IGCL 5IMOA 1I8AA 1AZCA 1LK3H 1AGCA 1JPST 1OB1B 1PIGA 2HKAA 1F8TL 2XN9A 5EA0L 4AVIA 3KYKH 2AERT 3C60D 4EZJA 1OSPL 2J72A 2QSCL 4OZFB 4W9ZA 2H3NA 4EN3B 2GCYA 1JYVA 3H2QA 4Q97A 1CGSH 3QDJB 4NKOB 5T5NF 3IU3B 5KBKA 3CHRA 2QJDA 1TPXC 2Y6TE 3QUYB 4KKBC 4PVNA 1OAZH 1Y18B 2CJTA 3MLTB 4MX7A 4PJFF 2YD9A 4HPYL 5DI8A 3VRJA 3OGCB 3QG7H 4PCKA 5ALBL 1H8NA 1LHZA 4F7CB 1QLFA 2Y72A 1P4IH 3HAEH 3MLVH 4MDJB 2VXQH 2D7MA 1VGKA 2PTUA 1T80A 4UOJA 5EA0H 4Z76A 1MHPH 5CP3A 3RVXD 2GK0B 5I0DA 4UNTA 2IH8A 1WWWX 5IM7A 2HWZH 4NKMB 1IGIL 5M94B 1A14L 3ZX1A 1EAOA 1H5BC 2H7WA 2J1ZA 3C87A 2HT4D 3ECUA 4Q2ZA 3VU2A 2XKNB 2GITA 1L6ZA 4NWTL 5C0RL 1Y7VA 2F68X 4IDLA 3SKNA 4LCCB 3HB3C 3P54A 5BXFA 1CBVL 3PP3K 3IXTB 3SGDH 3ILPB 2A83B 2YA0A 4JFFD 4YS4A 1OLZA 3UBXB 4OT1L 5IIEB 2EYTA 4NZTL 4PGEB 2YSSB 2X41A 4XT1C 4YLQT 4B60A 1OAXH 3MNZB 5EUKB 2DQ6A 5E4AA 5IMKA 4JZNB 5FDWA 4HOZA 3FTXA 4P23D 2VC2B 4G7QB 1IGIH 1FP5A 1A8ZA 3UG4A 5DC4B 2R69L 2Z7YA 1ZLDA 3K72A 3C8HA 2IEPA 1RJZB 2NQCA 5EC2B 4ODUB 4JPSA 4CGTA 2HX7A 1NJ9A 4I0PA 2Y69B 4NKIL 2EDKA 1P7HL 1E5UI 1IO4C 1P5UA 1ZHBA 5JUEH 3HG1B 4XE5B 4HMCA 3RBSA 1TSHA 3NESA 1UZ8A 3K1DA 1KJ3L 2AV1B 1VPOL 4OQ1A 5GGUA 5EZOL 4JFEA 4R4BA 2XX1A 4DJMA 5LNDA 2VMFA 3LXCA 4AIZB 1XD0A 3R0MA 3UAEA 1U93A 2YZ8A 4OFPA 3S4SA 3VMPA 4N8VA 1E28A 5AENA 4XCCH 2FQGA 1T7YA 4NYLA 1G7JA 1QPPA 1Q94A 2ICWB 3LXAA 4HFWA 4TNFA 2HXAA 4JPKL 4LSQH 3CN3A 3F7YB 4EO5A 4DH2A 2NY1C 4OJAA 1IM9B 1UGNA 3U0TB 3QPXL 5D1QD 4NKIH 5I6MA 4GG6F 4LP8A 3VXRB 2JFCA 4UOW1 4E2OA 1O6SA 3NMEA 2Y0SA 5E5RB 3D0VA 4MA7H 5FA4B 1JDCA 5JIKA 2DBJA 4HV8A 4JFZL 1FHNA 1KCBA 4YHOH 1SF5A 4O2CA 3G04A 1S7SA 1Y1UA 4YDJB 3EYOA 4F20A 4QRFA 4XVOA 1CCZA 2X0VA 4ICWA 3CC5B 3HMXA 2ADIA 1AS8A 5GRVK 1B0GB 5B22A 5EU3A 4R5VA 3CFIC 3TFBA 4NZUH 4F8NA 1RUAL 3EYSH 2ITCB 2R83A 3K8MA 4U1IA 4EI6A 2WXRA 3MNVB 1WH0A 4LLQB 5T8IA 1TQSA 3L48A 2E5EA 1A3LL 4JM4H 3ESUF 3IRPX 4P3CL 3UBHA 1I3UA 1RK1A 1X3DA 1CFQA 4X7TB 2FT8A 5CLYA 4KHTL 3KHOA 3TBYB 2IAAC 1S4IA 3NBNA 4PP2A 5I0XA 1TEYA 3FF7A 4WNQA 5LO7A 3KPMB 5TK2A 3NZ8A 1FDLL 4GAAA 1AHWC 1IVLA 3AQZA 2DICA 3FFDA 1T04B 5LQBH 3HG4A 3TIDA 4O5LL 5F7DB 1E4KA 4ZUWA 1RUPL 4P2RA 1NM4A 2OK0L 2AJXL 1ZEAL 5KSBF 3WS6C 5BV7H 5C07E 1HQRB 3TEYA 5IB5B 1TJGH 3ENEA 2YBRA 3ARTA 2QVKA 1A3LH 5AL8A 4KRPD 2B9BA 5IQMA 4X8GA 4OZHE 3S5LA 1CL7H 3CPUA 1RZQA 2XWDA 3MRQB 3GDCA 4KHTH 1FPTH 5EF3A 3EG9B 3STLA 3H0TA 4EI5C 1E8ZA 1OCWL 4N8CL 1I9IL 1O7SA 4KKAD 4YZWA 1S7UB 5FM8A 5JOPE 1KPUA 4M6MH 1HIMH 1TQTA 3N2JA 1F3JB 5AOZA 1J5CA 4WW2C 3HI1B 5HHQA 4E68A 1FNFA 1UQSB 3MX0B 4XCYA 4M56A 4U1JB 1XQ4A 4W9EC 2OK0H 2J43A 1S7TB 1N2RA 3CFBA 4B9FA 2B7DT 3N41F 3PABB 1JK8B 3PDDA 4HXBH 4JRXD 2H1LM 5ABAA 3MKGA 4FC3E 1G9NH 4WUUD 5IG7B 3MBED 4JZJC 4ZNEA 4PYHA 3TTYA 5EO9B 4K2UL 3MGOA 4KJQC 1OCWH 4R8WL 2K4AA 3ZDZB 5L7XH 3KE0A 3VB9A 4WEMB 3ULUD 4FRWA 2HTLD 3D4ZA 4M29A 4FXKB 3S2AA 3NP4A 1J1PL 1A64A 2PYED 4AK1A 4ESKA 5CXPA 1E42A 2A6IA 3U7YL 3GTVA 1A1MB 2K1MA 4M9PA 3ZE0E 4JM2D 2UZIL 3W5NA 1JF6A 4GIPD 4IHOA 1TR7A 2NMSA 4GIOA 3MXVH 4N2HA 2C9SA 3CLWA 2IG2H 4WHYH 3T0EA 3GSXA 4QRPB 1GTNA 2DKSA 1ZLEA 3HUJB 2OSWA 5CWSB 5LLIC 2CBMA 1VFAA 5DHDA 5KVFH 5JPNA 3U1QA 3R8BB 1QO3B 3CDZA 4GI8A 4RRPG 4F91B 5F93C 5KUMA 1DJGA 3RUGF 4JRLA 4Y1TA 1RHHB 1IKFH 1IC7H 4QHLA 2D9QB 3FULA 1PGRB 1T66D 1JBJA 4KI5D 3VSQA 4FFVD 1J8HA 5EUOF 3N1GC 2CK0H 1E8YA 2AFNA 4NN5B 1JMXA 3SQBA 5KBLA 3FONB 3EZJB 5I19L 4X5QA 4WNSA 3DGGA 4UU9A 5AWNH 5DEJA 2HKFL 3PREA 1CICC 1FN4B 4XWOD 4XO9A 1SBSL 4HIXL 4AVHA 4FQJL 4N4YB 1UWGL 5C9JB 1JDDA 1BQ5A 1OCOB 2BP0A 5BZDB 4NZJA 3ABGA 1J5IA 1SZNA 3AC0A 2NDGA 3S34H 1VZIA 2Y1AA 3BSZL 3FB5A 3QNZA 4G9FB 5FC9A 3L3IA 2WLKA 3HC0A 4DQOH 1JGLL 3PWNB 3QIUA 2CKNA 3K7UA 4LSVH 5FHAH 4M7ZB 1JD9A 3T2QA 1VJSA 1U3HA 4J3SA 2HX9A 4X6CE 4BA8A 1EFQA 5DVLA 2H32A 1FZJA 2OMUB 3I6GB 1Z66A 3K8LA 5EULV 3UTPD 2VQ1B 2DQHH 4ADIA 1IKNA 3L4WA 2AXFB 3D85A 4DTGL 5I19H 2L0DA 3WTXA 1LMIA 2HKFH 4XMKL 5BUPA 4Y0GA 1G0YR 1MJUL 4NUGH 1YECH 2E6QA 1JV5B 2I5YL 3CSYB 1D6VH 3UC2A 5F6HJ 3WY3A 1UWGH 1FO0B 1XCWA 3VUAA 4KNSA 2EKSB 2FWUA 2E7CA 4MHHG 3O9WA 1HAUA 5ETUB 1JWSA 3FC8A 5E2TL 1ML0A 3IJ8A 2E9IA 4P57A 5ABDE 5E56A 4HLJA 5TE4L 4Q0XH 4LLYB 4FTVB 4HIEA 3CXDL 2JKWA 1U33A 1M1SA 3DECA 4DTGH 2C7UB 3W11D 1BWMA 2VLME 1HEHC 2GTZA 1QVOB 1AKPA 1MJUH 4TPRH 3VDAA 5I66A 1PNDA 4ALAH 1JXGA 3RY6C 3GJFH 5CCGE 2DL2A 4KQ0A 2NUTB 5JPMB 4NFBA 5I6XB 3T8XA 5CGYC 4YO0B 1KYUA 1QTPA 5I1LA 1IT9H 1ZLUH 3VE0A 4YQXL 1FH5L 1IC1A 2J8UE 1XL6A 1QKZH 3CX5K 2PO6A 3HAEA 2WINA 3EUUA 1G9HA 5TE4H 4FNUA 5C0GB 3FF8A 2Y9RT 2IF7A 1KTDB 1ID2A 2IBZX 2NSXA 2BOBB 3VGFA 2X44D 5AW7B 5C0ND 1DO6A 1WAAA 3HE7B 2XVKA 3LEVH 3BPCA 2BVYA 3FRPB 3IS1X 3K2IA 2XJKA 1A65A 2IVFC 1X44A 3LNGA 4JQVC 2XWTA 4Q8BA 1MELA 2QADB 1H0DB 3LNEA 4GSXA 1ORSB 4LZKA 1XGPB 5IT2H 2P1YA 3BVDB 2Q7YA 3ABLB 1N5AB 5BZXA 3VFMA 3D6GA 2IH3B 3BEWA 1LK2A 4X0KA 4AQOA 1S3KH 3MV7B 5SWSA 1ZA3B 1NFAA 5TD4A 4V33A 1X6LA 3LHPL 1X5HA 3E2HC 3U30C 4FI7A 4A39A 2BVQB 5KW9H 1OCCB 3PGFH 3GSVA 1TTCA 1ZXKA 4HGWB 4P3WA 1TXKA 1BF5A 3DIFB 1JNNH 3HC3L 3QVAA 4JFYA 3UADA 3QNXA 4F3FA 2OTPA 4AVKA 3U1SH 3QCTH 3N85L 5SX4H 3C75A 5E8PA 4XAWL 5CEXA 4XP9L 2DM2A 5C0BE 4R0LB 4YPJA 2ZUYA 5D72H 1CR9H 1MRDL 2ID5A 2X5PA 4B9IA 5SX4I 4UINL 4Y2LA 3S2CA 1KOAA 2F7RA 5J6HB 4TRPH 3OPZL 4FCAA 1J5OL 1QWNA 1A1NA 1V7NH 5F7EL 5J3HD 3DIVA 4R5XA 4RA3A 5HYSA 1FLTX 2RQ8A 2AQTA 4YHPB 4CVXB 2YXWA 4N2KA 2WXFA 2VQ4A 4PCYA 3T6VA 1RCYA 5IQ7H 2RALA 5GGRY 4IW4C 1A4CA 5IMLB 3PV6A 4YDIL 3VFOB 4J39A 3BWZA 1PJ9A 1SN0A 4ZXBD 2G60L 2V5RA 3IDIB 3G7TA 4F9PC 3US1A 4A7GF 3BAIA 1BP3B 3RWJA 1XAUA 1MRDH 3TNMA 2VZ1A 4UINH 4Y8AA 3SDCC 3MCLL 4O02B 4DUWA 4BK5A 2DDQH 3OAYK 2OSLA 4L0YA 2YPVH 3FQRB 3KWWA 3RX5A 1SLWA 1WWCA 2E7HA 3I02A 4NC1C 2ATPA 4YGVB 3MRLA 3QRBA 1V5JA 4GO9A 5IGXL 4EZLA 3LKQA 4XAKE 1LEKB 1YEIL 1RP9A 3UG5A 5E6RB 3WNJA 12E8L 3GSNB 3C9NA 2EVHA 2ICEC 2WAQA 4TLKA 4JKPH 3VJ6B 2NUPA 2UXTA 1L9QA 1MFMA 4GUOA 4BZ2A 1WHOA 4EIBA 2WN2A 4ZFOB 1FYTA 3CAFA 5KYYA 4JE0A 4PP1C 5E08L 2QTEA 1A25A 1TEGA 1ZVSA 1URLA 3MCLH 4ODHL 5CSZA 4POYA 5LHDA 3K6IA 3MUY1 1WZ1L 1P6FA 1SHWA 2H8PA 3FT4A 4WWPA 1L4IA 5F89B 3NACL 4UDTB 2YPKA 5EO0A 5GS1C 5IGXH 5ICUA 3PP4H 2WSKA 1KT2B 1N70A 1RZKC 2X3AA 3A6CH 4OZHB 1YEIH 3TT1H 5CFHA 1L5GB 4ZUSB 12E8H 1QX1A 2ZONA 4S0TD 3TCXA 5CLZA 5MEQB 3FH5A 1DBAL 3VXMD 2ORBL 1IJNA 3FUEA 4FLOA 3DX8A 2ILLA 3KPSA 2Y22A 4ZSOA 3D25A 2E7LA 4LBAA 2P8PA 2XN9E 3VFSB 3QXAB 2H26B 3O8XC 4HKXB 3M17B 4ODHH 4Q9BA 3X1BA 4WI0A 3OKOB 1WC7B 4XBGA 2JF1A 2R4RL 3OKDB 3RGBA 2FWOA 3ZO9A 4B41A 2PW1A 1E40A 5GRYA 5BOPA 4HCRL 5I5RA 3F7LA 4MAZA 5DZOA 4X8CA 3FU6A 1JGUH 4AI7A 4APXB 4RDQF 4TOYH 3DSNB 2EIZB 4WI9A 4F7TB 3QIBA 4XHJD 2VLKE 2P5PA 2ZOWA 3ZW3A 1EJOL 1PZDA 1TFPA 2P7TA 3CQPA 1N6QH 4ONGL 3OG6B 3DDGA 1FFPA 4YXLL 1JZEA 4LCUB 4HKJB 4M48L 4Z7WA 4C4KO 1KN2H 4G9DB 4OD1L 3VO0A 4KKZA 5HTSA 3HZMA 2BP3A 4GAGH 3L3JA 2A6JA 4OCXL 5CJOL 2C1OB 3C6LC 3J8F7 1W2KT 3G5VB 3HCVB 3K6OA 5E70A 2CRYA 5E6IC 3LZRA 1JZ4A 1GAFH 1DBKH 1HXYB 5GGRB 5JW4R 4J3WA 5TFSL 3II1A 2XTJC 2HJFA 3WIFB 1NCNA 1E6JL 3KM1A 1WISA 2VR6A 3EJUA 4NUQA 1EJOH 4OF3A 4K7PH 4P2QD 5C08D 5E4EB 3IETA 3TBVB 3LPFA 2KLRA 2OCCB 1P1VA 3QR1A 4YXLH 1PD0A 2GBTA 4TQPA 5ELIA 5KEZA 3T1WA 1KB5L 5GPRA 5H4ZA 2WO3B 1I75A 2MIZA 4HCIA 1GS8A 4U6VL 5F3FA 1TYRA 1S5HB 3GO1H 1WSST 3FT2B 4Z0BL 5D7LA 3O4LA 1S7VA 1W0WA 3N55A 1KDJA 2FX9H 3ASWA 3SKMB 3US9A 2YLHA 1E2ZA 2B59A 3DGCR 3SHSA 4L3ED 1UXWB 3K3QA 2H0EA 3D51A 4GBXA 3NCFB 4JFTA 3B1TA 2DMGA 4PRBA 5B4MD 3CWGA 5KOMC 3AXLB 1J0YA 5C2UB 1NGZA 3WIHL 4RFEA 4JFEE 4WI6A 1KB5H 4S2SA 2JQMA 2G4EA 1DFBL 1A6WL 3KEDA 4X6CB 2VAAB 2WLZA 4EKXA 3KLSA 3OHXB 4HUXB 4JBSA 3PJNA 5AZEL 3THML 4NUJB 2CXKA 4NNXB 4XX5A 1JRHH 3GZOA 4MCYA 4PJ5A 4K9EH 3JV0A 4LKCB 4JRYA 5F3HB 3HW7A 5JYLA 2J1WA 3T0AA 1RUQL 5C0EA 2WY3B 1D5IH 1T21B 1CD1A 1DJSA 4FMFA 2VXSL 1HXKA 1JRHI 3GSUB 1WE5A 2VERA 3FUJA 2ROXA 4AYMC 2PXYB 5I8KH 1F4WH 1LEIB 2LQRA 4JK0D 2F53B 1KUMA 4TS6A 5T3XE 3NYKA 3PIQA 4H44C 5L2JB 4XXWA 5D96C 1OHQA 4L8SA 1DFBH 4GFXA 3HI6L 5DD5L 5ISZA 3AMKA 1JHKL 5HVFB 4B9GA 3L9RA 1YNLH 4U3XA 1CFMA 5AVQB 2M8XA 1H3GA 1WZAA 3FB7A 1XFPA 1B2WL 1RIVL 3O3AB 3DHUA 2NX5E 4MYPA 5E1AA 3U2JA 5ADOL 3BPNB 1I7ZA 2VXSH 3BMWA 3CV5A 4ODTL 2O30A 3F3HA 5DC9B 4I3SL 3PDOB 3QAZB 4F8LA 5E5MB 4DUVA 4U6HB 1L9NA 5EF1A 4MCMA 5TQ0H 2P5WB 4EDXB 1P2CB 4UQIM 5LGYA 1UACH 3GMNB 1ETB1 2KL6A 4HXAL 3AWFA 2AC0A 5AKSA 5DLLA 4ZUVB 5C0DB 2IALB 5H94A 3ULSB 4X6EA 2YGVA 5J0BA 4QY8B 4HVBA 5TDPB 3UO1L 4KVCL 1JHKH 4BWWA 4GSUA 7CGTA 1BIIA 3M1OA 4HAKA 2DQFB 1DUYA 4U3SA 3V0IA 4P2RE 1RIVH 4KO9A 3LKNB 4GAYA 5E8EB 3I75A 2FYYA 3TH3T 4GXVL 4NFCA 3SDAD 4A55A 2JB6B 5E00B 4N2NA 3OAZK 1P69B 3HUJF 3L08A 3CVBA 5C0JB 1PX3A 3D18B 4TSAL 4PJBA 2LLGA 2YD3A 4HXAH 3V8CA 2EVJA 2VLJD 3PWVB 1FQ9C 4OLZH 5KYWA 5IVNA 1EXUB 3HBPA 3T77B 1E30A 3CZGA 1FL6A 3DJTA 3KGSA 4HJ0C 4I13B 2VSKB 3GRGA 2JJWA 4L4JA 1NAKL 4XWGL 2AABL 4UTBL 2EVIA 2Y5EA 3C5XA 1RL1A 4FFZH 3HE6D 4L37B 4AQEA 2FGWL 4LSPH 1YSOA 1BOYA 1D5RA 3H3PL 4FG2A 4Q6IB 2D9CA 4ZMVA 4HGKC 4YE4L 2J57A 3FTSA 3LRHA 1AQDA 1MFBL 5FKPA 4TSAH 2BS8A 4ZNEE 4XNXH 4GO6B 5I1AB 1URIA 1AXTL 4K8RD 2OPCA 1QR1A 3HFML 2Z64C 2LAGB 3LKSA 3PL6A 1OZTG 1DQMH 3MBWA 1ULVA 4HWNA 3GKWL 5FUOH 4LSUH 1SYSA 5E2WL 2K6YA 1IAIM 2EC8A 3AQYA 4D8PA 2ZUQC 4TV3A 4W9LC 4HIHA 1IEBB 3B9KA 5TGBB 3VM7A 1BW8A 4UTBH 2Q76A 3NFPB 3S3CB 2DQMA 2ITDB 3DV4B 4DETA 4R7XA 3O3DA 3MFGB 3T0EE 1KSRA 3VFVB 1N3NB 1GSMA 2FGWH 4HHAB 2FX7L 5TH2A 2ZXBA 4ZAKC 1IM3A 2V5YA 3H3PH 4BD4A 2Y24A 3IGFA 3ZDXE 1SXZA 2VLRD 1C7TA 1MFBH 3GLZA 2CHXA 5EU6E 3RY4A 1T03L 1E4WL 1Q0YH 3PNRB 3O0LA 2VM3A 1HH6A 4HZLB 4X42A 5LBSL 1G0DA 2ZG1A 4E9XA 4LSTL 3MA9L 1KCKA 5D6DC 1J8HE 2I07B 4NQEE 2OS7A 5BRPA 4MSWB 3ARBC 5JHLA 4MNQD 1KTKE 1I4FA 5JHBA 5L2KA 3ZMEA 4G6AD 3WAKA 4E42B 2JQAA 4Y5XC 1BXXA 3WO3B 3SIKA 5JHDB 5MP6L 1OD9A 3BN9D 2FRGP 4HWBH 1FJ1A 3U2SA 4GMTH 4K3GA 2ZWYA 1BD2A 1E4XI 3MOAH 1NKGA 1TG8A 2XKUA 4NO3A 4YAQA 3Q9PA 2IDUA 5IHWA 4OH2A 3SCMC 1S7WB 3JUZA 1NCCH 5LBSH 2BO0A 1WCBB 3GMRB 3I3EA 1OZUA 3BP4B 5KVDL 4IYKA 3QUML 3WG7B 4MLIA 4LSTH 2P4AB 2PF6A 1OK8A 3ILQC 5J57B 2BY1A 4XNYH 4MD4A 1DVFA 1JGVL 1OVZA 3L9BA 3TVMD 4FQPA 4U2YA 2VZTA 1PJWA 1TO4A 5DMIH 5DO2D 5KSAB 2K45A 4GKSA 1BQLL 4CSPA 1THCA 5IROD 1J05A 3U9WA 1OP9A 2GBVA 3TU6A 4X0NA 1SBBA 5EOTB 3ZOAA 4G3YL 4EIUA 4G6JL 1MH5A 1QHPA 4KV5F 4YC2B 4JY6B 1QWHA 1UWXH 1YY8A 3BKJL 3MMEA 4FG6D 3V6BR 4FA8A 2Y07H 1HU8A 4JDVB 4GQ9H 4YOKA 4ZFZB 4RX4D 5C09E 3FN0H 3E9TA 2VL4A 2VDLL 2VLKB 3QS3A 3HNTL 3KXFA 1JGVH 2GT9A 3EGDA 3QZWA 4KO5A 3KPOA 3V6ZA 1U8KB 4Q9RH 4MS8C 3V6FA 4ES8A 3FCBA 1BQLH 4BUGA 2XN0A 4FI6A 2JCCA 2I27N 2JJSC 3D9AL 2CZNA 1XL4A 3LNHA 4FQ1L 1D6EA 5ANMB 3Q3GA 4G3YH 3B7RL 5J56B 1JZ3A 5CU9A 2R8SH 4K71B 4G6JH 3LJ3A 4AKOA 4Z7VA 1I8IB 4M4RA 2WKLA 3UOAB 3OB0H 3I6KB 5ID0A 5FO8A 4JZOB 3SKNB 1K5NA 4TM9A 1UB5A 3T1FB 2BCMA 5DTFB 2XWXA 1ORQA 4Q74A 2PCPA 3D39A 1XBDA 3V6OA 2IMNA 2EUZA 2PTTA 3FFCD 3M1BB 2AQQA 4PJ6A 5EOQH 4TTDC 1ZGLB 2Z91B 3LIUA 1SVZA 5EEXA 4FQ1H 1ED3B 1AO7D 1GKEA 1N9PA 2JIXB 1E6OH 2KZWA 4QRTA 1T22B 1T0OA 2MTAA 3O2DA 4QRRE 5J11B 3U4EA 4HHGA 4XH2B 3UAJD 4TQEL 5SWSE 1RFDL 4GQRA 4U1HA 2FJGA 5EV7A 2CMRH 1PYWB 2I60H 3K72B 3DI3B 4JFPB 2AJYL 2NTFA 3RJQB 1AKJB 1MRFH 3UO8B 3S48A 3P02A 1ONQA 3KGUA 5I30L 2D8KA 4ELDA 2WO2B 4FQXC 4CMMA 3MBXH 2EDDA 3MCKA 2Q20A 4R6UA 3CZNA 4Y2OB 3KS0H 3KWXA 4DZBA 2CRMA 5JOPD 5CD3B 4M1GL 3UBFA 1NZRA 1XGUB 5C92A 2O5YH 5DUML 1KEML 4KMQA 7FABL 2FGZA 4K55A 1T5WB 4IGBD 2N3JA 1PLBA 1U93B 2ZD0A 1GGCL 2Z7WA 1IFRA 2F7IA 3IRCA 2A0LC 3ZE1E 1QWUA 2BSSB 3BIAX 2X6VA 2W65B 2CUMA 4ERSH 3L3KA 4UMSA 1JN6A 3IFNL 2QHRL 3KR3L 1CWVA 2DIJA 3SGEI 5I30H 4HC1H 4ZI8A 5E9DB 3J2PA 1F4HA 4WENB 4K94C 2CXGA 2VSCA 4LAQL 4YNYA 2DD8L 1KF9B 2IWEA 1AZUA 4S1DD 1LMKA 3SDYL 2XN2A 1L7TL 1MAMH 2D31B 7FABH 1XR8B 2PWGA 3KHQA 2OX5A 4YDVB 1OAYL 3RVWD 1GGCH 2P52A 4AGPA 4P5RA 4Q89A 2GFBA 3Q1EA 5DURB 1I1AC 1S6NA 3JWNC 1KCSH 4J3VA 3B9VA 4X4ZA 1A6AA 2VQUA 1VERA 5D6CB 2NX5B 4EI6B 5LCVA 2C3VA 3W5MA 1RZKL 4RMSA 3FPXA 5CUSL 2O6DA 1RK1B 3G08A 4B27A 1X4YA 4EVNB 4H1LA 3BO8B 2D73A 3VA2C 4Z3FA 3JWDH 2ZX9A 4LAQH 1JWMB 1ETZB 4H26B 5AB2A 4DP5X 2AEOA 3SGJA 4WNQB 4X5LA 3QQDB 3UIYA 2TSBA 1FYTE 1E9QA 2QGBA 5EFIA 2NY7H 1TTUA 2JK5A 3MN8A 3OQ3B 1KPVB 1UH2A 2VR9A 2O4EA 4MGXA 3T6XA 5A3ID 1B6UA 2M83A 2HN7A 5E99L 2YSTA 4J28A 1QASA 2HT4C 4GRLA 4YHZH 2P5ED 4IJ3B 5CUSH 5GGVY 3TXAA 2OULB 3VCLB 3FO2A 2BHFA 2G75B 2YC1A 4GJTB 3C5ZB 3L3OB 5I15H 3RVUC 3ARQA 3STLB 1DR9A 2B1AL 3WFHB 2HRPL 1QYGL 4N2CA 3N1QC 4JCWA 5IBUG 3HS9A 3AMLA 2J1KA 3KPSE 4ZSOE 3ZZ1A 2W07A 4PCTA 1B90A 5GS0D 4KOCA 3VSUA 3DKHA 3UJJL 5HHQB 4KVNH 3DTXB 4YLBA 3V55A 4CC1A 4OIIH 5E99H 4P23C 4A1RA 1N2RB 3L3GB 2IANA 3CFBB 3V4UH 4OQTL 1YYLL 3L5XL 4P46A 1II4E 3D30A 2Y36L 3U46B 2WWOA 4ZMLA 1XMEB 3DOSA 3U9UB 4G8IB 1CI5A 4R2GB 3O3BA 1WHPA 1OGTA 1UZGA 5M95B 2IAMC 3DVNA 2AJZA 3MGOB 3BZEA 5B39G 3QJRB 3RTQD 3V5HA 2N1TE 3CFEB 3M07A 4PRPB 1ADQL 3NIGE 4KRLB 4TUUA 2J8HA 4HJIA 1INEL 1OO2A 1FFRA 5IVOA 3R7RA 3W0WB 3ROOA 3L6FB 3OAUH 3CUPA 4Z7WE 2Y6SD 4EBQL 3UJJH 1WT5C 4JCLA 4NEHB 1JTPA 4W93A 1TU2A 5I8OH 3DHMA 4D9LH 1ZTXH 1VCAA 3BP7B 4FFZA 3U4BL 3U83A 2VLMD 1N0XL 4YVNA 2NYYC 5EZPA 3L5XH 1NCDL 2CIKB 2CQVA 2UYLA 3DK2A 1MIMH 5T33L 4U31A 4ZQKB 4C4UA 1ZRUA 2XTLA 1UJ3A 1TETL 2CO6B 3BZ4A 1D5BA 1VFAB 3EH4B 4H0IA 1T6BX 3FTGA 5FW7A 5EU6B 4L1SA 1BBDL 1NSNH 5FYKE 3CSPA 2L3BA 4GIAA 4AC4A 1U8JB 2VDML 1T7WA 1QZ1A 3V4PA 4BFRA 4XZUB 5D2NA 2WQUA 2ESVA 4PY8I 5TDOA 4NQEB 3RWEB 3U4BH 3WMQA 1O5DT 4AQAA 2VISB 1J0IA 2XIIA 3WN5B 4TVPL 5A40E 5MEND 1RU9L 1C8QA 4NN7C 1DYZA 5CMAB 5EDXA 1AY1L 4ZQTA 2SEBB 1RZGB 4UU9B 5D7KD 5D7LE 3O4LE 3NA9L 4H2AA 5KVFE 5T33H 1ZLSL 3VYNA 1WGVA 1YO4A 3G6AB 1Q0XL 4CU8A 2APXA 3QJOA 2OL3L 3D69A 1BBDH 2TRYA 5D1XD 5FCUL 3N43B 3QDMB 5CN3A 1DCEA 4R9HA 5I9QC 2B4CC 4MA1C 4N6RB 5DJCB 4AX3A 2VDMH 3T8MA 5BS0A 4LL9A 3NTCH 1AGDA 4APQA 1HXMA 1GZPA 2NY6B 4QRSA 3VGAC 1U92A 4OFVA 5D55A 3B2UC 4AV0A 1S3RA 3EGSA 4KY1H 2HMID 5DJYA 2IADA 5C0BD 4P5SA 3D3VA 4AGNA 1AY1H 4HWBA 4PV1C 1MSPA 2L8AA 4K4KA 4JRYE 3T0BA 4ETQB 4PI2A 2FLMA 5AAWA 1EPFA 1KTLA 1ZLSH 5D2LA 3V9CA 1EANA 2NY4B 4MB5A 1E5ZA 1Q0XH 4FOMA 3OMAB 3Q44A 4HYTB 3WENA 1K72A 4A6YL 1CLOL 1XIWD 2WCSA 2YJQA 3KJ6L 4LHUB 2H3KA 3RP1A 4KUCF 4TNWF 5GHWL 3UTTD 3WJLC 5I16B 4WU7B 2LVEA 4UNUA 3OG4B 5DVOA 2BHYA 5I6PA 2PKDA 5DK0B 3ISWA 5FYLH 2A6KA 1CD9B 1WA1X 2IFFL 2CLVB 4W9GC 5C09B 5EZIL 2NLJA 3GUTA 2HX8A 1YEDB 1AD0A 5ISZE 1X5MA 3MUGA 1D5XA 2YQ3A 2QQKL 3S96A 4Z78A 1T0NB 3C8KA 3PHOA 4J5VA 1IU1A 3NZSA 4JREC 3QFGA 2VRKA 2Z31B 1Q8MA 4QRUB 35C8L 2HLAB 1R47A 3ARFC 3EHBC 3PS6A 2PLTA 3JYCA 4EUPH 1HL8A 4A6YH 1XSIA 4MVBD 1CLOH 3S9DB 3KJ6H 5EIIA 5DD3L 2VO8A 3BD4A 3QXWA 4IMLA 2XWCA 3JTTB 4IIQC 1G7PA 5E8DH 3M7OA 5IW6A 1U4EA 2XSKA 4KMLB 4OAWA 4ACPA 4XAKD 2IFFH 4LPVA 1CGVA 4ODVL 4RDBA 1KYOJ 5EZIH 2VB5A 3BWAA 3BXNA 5FYJE 5AAMC 2YPLB 1JNJA 4CW1A 5AOLA 4Z7UB 5IHBA 5A6IA 3G6JA 3PU7A 4FQHB 3K4AA 4Z3IA 2KZBA 2BSRA 4JM2C 4RFOL 1PZ5A 35C8H 1BZOA 4B9KC 5B38G 3B9AA 4UIKL 4X6BB 1YN6B 4Q9QL 3BVUA 3WKMH 5IF0B 1EVTC 5DD3H 5JMRA 4LF3B 2A73A 4PGJA 4QRRB 1NAMH 3MREA 3GRWH 4N2AA 5K9QI 3E8VA 4PJBE 3QIWC 4AGOA 4OZGA 2Z93B 1WFMA 3FTZA 3T0VA 4ZJ9A 2V5TA 4JL1A 2BSED 3VH8G 1AGFB 2E46A 2ICWJ 3FT1A 4FFYA 4FFVC 4U1NB 5I0VA 5E8PB 4NCC2 5D8JH 5KBDA 3GD1C 5J8OA 4R7DA 3WD5L 4F37K 3DLQR 3O6FB 1EJ6A 2NY2D 1UCBL 3MRPA 3X13B 1TQBB 2ZNXA 3OPUA 4J2XA 2VXTH 3NSCA 2YUVA 1HCYA 3T3PE 4C47A 4A37A 2B8OT 4BFNA 4KAQL 4CN6A 4LVNC 1QTSA 2XWRA 3VG0L 4X5XB 5FEBA 3RBGA 3PJLA 4XPHL 3ARGA 4D9QD 3NJMA 2LHAA 3DYMA 2GUOA 5HHNB 2H6PB 3JWNG 4IRJA 4O4YH 4JKWA 2H2SC 2NNRA 4C58B 2HVKB 2OR7A 2I7SA 1BM7A 3KYMA 2C1PA 4RA0C 4YLCA 3MLXL 4MJ2A 4DEPB 5D7JA 1E9PB 4ZX3A 1HHHA 3KAAA 3KWTA 2LU4A 2JKRM 2AXHA 3PQYA 4WFGE 4Y4KD 1JYXA 1KN4H 2JI1A 4XNQB 1R6VA 1FLRL 4KJYA 4AYEC 3L4TA 5FK9B 3RWJB 1BA9A 1R3JB 2GEEA 4OY9A 3FQWB 2OXGA 4N3TA 1WVZA 4NNPH 1SJVA 2FVNA 3SDDC 3WLBA 5L4IA 1ZHLB 2OR8A 1BIHA 4A66A 3BPOC 1RZ8B 3T2NL 4JO5A 3SD2A 2QLYA 5EU4A 1WBZB 4XPHH 4M5ZL 4XOCA 2FBRA 2VDOL 3AY2A 3S88L 3I02B 1ASOA 2GAZB 5IB1A 4JFDA 1XZ0B 3QISA 5FM5M 1N5YL 3U82B 2NYKA 3CZLA 4UNVA 4NQSA 4MYWB 1B4JL 2BVOA 3GHPA 2CU9A 4DSYA 4JN2A 3QORB 1E5YA 3BSGA 4DK5A 4AG4H 5L2KE 4H7VA 1IGFL 3VRIB 4OBSA 1A9BB 5KANI 4ANVA 1W15A 1SMAA 2WWMD 5KYYB 5JORB 3MNMA 4WIQA 2CJUL 2J2ZA 3T2NH 1MREL 2NY3C 3MV8A 1UM6L 5D5MA 3QRFM 4KDVA 3VFRA 3WNKA 4PUBH 4N0FA 3ZYOA 3GTTA 3P3TA 4N87A 2VDOH 3RQ3A 1JD7A 1JK9B 2OZ4A 2VGLM 1EO7A 3T3ME 5EBGA 1N12A 1DN2A 3Q48A 4I0PD 1A6ZB 1AIFA 1B4JH 1FIGL 3MRKB 4NSKA 5DD1L 5CKAA 4KXZH 2ZYSA 4UT6L 1IGFH 3P0GB 3NZUA 2Q86B 3ROLB 4X4XA 1FNSL 3V9FA 2ZOTA 2P8PB 1ACYL 5C0NC 3F85A 1QFHA 4HWZB 1X5JA 1JNLH 4S1SH 3ZLQC 2BZDA 2CJUH 4KXZI 4RFNB 2APVA 4BWUA 2WNGA 3F8UB 3ML8A 1EXHA 1T5KA 4MD5A 4NM8L 3N9GL 4MMXB 4BCYA 4ZODA 5J6GB 1DVZA 2BSTB 3BDYL 2EUVA 5IHHA 1B0RA 1IEAB 5DYOB 3B2PA 4Y2DA 2D0HA 3GSOB 3KXFE 2VITA 3FO9A 4GKNA 4NPYB 1MF2H 4L29B 1RSFA 4ZUTA 1B2YA 1URZA 5GGTA 4RH4A 5T3XD 3IVKB 4MA8H 4HJGA 1IGJB 4UT6H 5HSFA 2IMMA 1L9PA 2XQYG 2DWEB 3NIGB 3BT2L 4PRHA 1FFPB 2BINA 3EFFA 2XPZA 5I6NA 2JCCE 2V7NB 1WZKA 2V2TA 2PPEA 1FAKT 1BBJA 4X8JB 3FCGA 3DX7A 4LPYA 4MCZB 4HT1H 3E38A 5IWLC 1GYWA 4W70A 2X2JA 4HETA 2GVYA 2R0KL 4L5FL 3EYUL 4X98A 4Z7VE 3AROA 3KPRD 2ADFL 4P04A 1R3HA 3QUYC 2MEJB 1HDMA 5BMFH 2ARJA 4X7FC 5JYMA 1IILE 2AEQH 4XB8A 4XPAH 3VWJA 3BQUB 3P0YL 1ZT1A 3LQZA 4G7YH 2X4PA 1Q1JH 3IETB 3ME0B 2HAZA 4AITA 3RGVB 3MGTB 3BT2H 5I1KH 4XNZC 3V6OE 1F3RB 4DVBA 1AANA 5EEYA 1NGYA 2VXVH 2F8VA 4KHXL 2OMYA 4OGAD 1U4FA 5FECA 4BQCA 5INDA 4BSVB 3KPQB 1UJTA 2PPDA 3I6LD 4P2RD 3RWDA 3OXRA 1K8DA 3JZ7A 2R0KH 2X3BA 4L5FH 2VLLA 5HJGA 3V5DA 4X6DE 4DP4X 3NQKA 2QSTA 4M1DH 4WU5B 3QA3A 4XPTL 1J5DA 4P9MH 1MZZA 4XNBA 4YEFA 1JGEB 1GHFH 4NHCH 4DGWC 3SE9L 3V5KA 3RNKB 2O6CA 1XGQB 1YEJL 4K94L 4JHVA 1MHHB 4GBXB 3SDXA 4KO6A 3NCJH 4I18B 4DNLA 5DEGA 4YUEL 3NEEA 2WXKA 1AC0A 5BJTB 5CBAA 1TJHH 3HHRB 3JV6A 3LMJL 5KYNA 3UG3A 3D34A 3AU1A 2AEPH 1XH1A 4KHXH 2ALWA 1U58B 2I9TA 3AREA 4FMKA 2Q10A 4JPQA 3BI9X 2F7PA 3QHTC 1A7OL 3LS4L 2DM3A 2E59A 2WN3A 5GJSL 5DJ2B 2B5IC 3P77B 1I3VA 3X11A 3PXJA 5C0EB 4XPTH 1CD1B 1N8OE 2BNRA 4FI8A 4UDUB 5CBEA 2CBOA 3TCTA 3Q6FA 4CBPA 4K94H 5I1JH 5I17B 4G72B 4JEGB 4UBDD 3BVXA 2GJRA 3KVPA 2MHAB 2TAAA 5ILTH 2CKBL 4YUEH 2Z8RA 2EDOA 3A0OA 3UZEA 4WGWB 2W81C 1QRNA 3CN0A 4Z5RB 5IFHL 1Z32X 4NJAH 3CBKB 3JWNH 1HH9B 1DE4B 5B1JC 1REIA 4PREA 4FXGA 2WD0A 1ZA6B 5GSRB 4JY4B 1I7UB 5CU5A 3VDBA 3T0ED 1UM4L 2BSDA 3AAZA 5GJSH 4DVRL 4F7PA 4ZO8A 2W88A 2X6CA 2DTMH 3IXAB 4CSTA 5H2BA 4NKDA 4XN1A 3L1EA 2YGNA 3AXHA 4MAUL 4IBTA 3UP6A 1VESA 2Y2WA 3GIVB 1PFCA 1QBLH 2VR3A 3QEUA 2NNFA 5BPPA 3E3QE 4XHJC 5SV4A 2QR0A 1BZEA 1DQQA 2APTA 2NY0B 2Z7ZA 3QHFL 5B8CC 3FO1B 4J4PC 4M5SA 5SWZA 3GSWB 4TUOB 2L04A 4KKRA 1OP5K 3MRHB 2OI9B 1WTGT 1J8HD 4HIJB 3B7YA 3DYOA 4RISL 1A7NH 4QDGA 3VXUA 1C9SA 4N1CA 3HVDA 2GK2A 5K1VA 5L0QB 4A68A 3FUIA 4L1HA 3KDMA 3O2WH 1OXYA 1S78D 2E9WA 3CZFB 1KBVA 3ECBB 4K3DL 3I75B 4ZMQA 1ODAA 3JV5A 5I1IL 3FOMA 1SOXA 2MFNA 4QF1B 1PAMA 3NCYS 25C8H 3GJFB 2X4OB 4XN8A 4YX2L 3MRIA 4WJ5A 4OFQA 5GJTH 1TJMA 1VEMA 4LCYB 2CDFA 5CSGA 3OKYA 4C4KT 4C83A 3WFDL 1HI6A 5EG6C 3QHFH 4A2FA 4WSKA 4HBCL 2YAHA 4EPSA 3FQTB 3QIUD 5KYWB 5DC0A 1U3HD 5I73C 2ED8A 2FYVA 1XGRA 1FL6B 1HVXA 1KY7A 2VDKL 1XD1A 2B16A 2DPKA 3DUSB 3OC8A 4P5TA 1G7IB 3K4ZA 3NPZB 4NQTA 1X5FA 2M1KA 2MMXA 5F88A 3J7HA 2XY2A 4AM0B 4AQ1C 3MZTA 3O6KH 3D85D 4OU3A 4UILH 5CLTA 5E2UL 4K3DH 2IANE 4JHBA 3KD4A 1FSKC 3NJXA 2Q2EB 2YARA 3C2AH 3CH1A 2J6EA 4HIIA 2CHDA 2IH1A 4YX2H 4XCEA 2OM5A 3DRTB 3TGXA 3EGXA 3WFDH 1IAKA 4JHAL 2YMTA 4KH9A 1MFDL 3LV3A 3FB6A 3BZFB 2RCSH 1EZSA 1I7RB 2VDNH 3CVHH 3O9WD 4E9QA 3N43F 1DJWA 4HPOL 1CFVL 5SV3A 5B4MC 3U6XS 1H6FA 4HF5H 5AG8A 3PL6B 4F93B 5IR1A 3VXSA 32C2A 4X4KA 3SE4C 4DOHB 1BREA 3KL5A 2MOVA 4XHQA 4P2AA 5CFAA 2E8ZA 2FEDC 3ZHLA 1IAOB 3V0DA 5K9JL 1ZHKB 3F6JA 3DYPA 4PGDA 3BKYH 3FN3A 4BYHA 3EO1A 4UQ3B 3E7JA 1OF2B 2YN3A 3TF7C 4XXDA 5HGAB 4BZ1L 2XI9A 1HINL 1ZT4B 1TZ8A 4JN1L 5DSCB 4UB0L 4R4FL 2NW3A 1MNUH 5IEKB 2MCMA 1G6RL 4J3TA 1R1CA 1ZHNA 2VDQH 4XP6L 1CXIA 1NWOA 5L88L 3HR5A 3E6HA 1EH9A 2B4CL 4DPCX 3RZCA 4DP9X 2EUXA 5A2BA 4EEEA 4Y1AA 4QXGL 2ZAIA 4YWGH 4RGOH 4BRVA 2PO6D 5EF0A 1LWJA 5D2NE 2ESVE 5K9JH 5FO2A 2EXYC 1QUNA 1P9MA 4K7PY 4QD2E 3U36A 1QSEA 1VKXA 5E5UB 4UOQA 3ZN6A 1I4FB 2ZXAA 1KLUA 1VRSA 4NZRH 4L8CA 2NW2A 4ZD3L 5JMOC 4NO2A 3T4AB 4Z7AA 4O51B 1P7KB 2H41A 3EBHA 3GNML 1NEZG 3BEVB 3LH2L 3OXSA 3OR6A 4P3DA 1SDAB 5DDHA 3V0VB 3EO0A 1KELL 4XP6H 3U2SB 2JJVA 5DQJB 5L88H 4YAQB 2B4CH 3ES6B 4JGUA 4L4VB 3DI2B 1WUZA 4Z7NE 3ARZA 2BDNH 4E41A 1C8PA 4RESB 2QZQA 5BS0E 1GYVA 3RI5F 1OE3A 3VVWA 3FB8A 2OSYA 1KFGA 1M7UA 1SXAA 1A9VA 1PG7L 5JDSB 1KXTB 1DVFB 5L9DH 4KKLD 5CINH 1CQKA 3GS7A 2WKOF 3D3VE 4Z7UF 4YSTA 4PJEA 1D7FA 3ULVC 2EH7L 5D1ZB 4ZD3H 2WQWA 5HPMA 4UQCA 3EZ8A 5A2KH 1YPZA 4GKSB 2R69A 2VTFA 4U1GB 4I4WA 5D2LE 4GQPH 1I3GL 1BSIA 1QBBA 1BWWA 2LLLA 2DLFH 2G5RA 3QNYB 3HC4L 4J8RA 3RPIB 4HIQA 2D7QA 5J9PA 5GRXG 5A16B 1U8QA 3TLRA 2R2EA 1YY8B 3MMEB 1WF5A 3BKCL 1FA4A 4A2HA 2R0LH 1ROCA 3PP3H 1VSCA 1IARB 1PG7H 5LN4A 1LO0L 2A4CA 4PRDA 3WTYA 1PLGL 3G5YA 3L7EB 1FV1A 3CPLB 3K6SA 4GXUM 1G1KA 1BJ1J 3BUIA 1XMWA 4FQLH 3SKJL 3CHOA 4YL9A 3RFZA 5F9OL 3HE6C 2PMZA 3GXUB 3SEPA 4QXUL 3HC4H 1TPXB 3Q3GB 4YHLL 5IESH 1TKWB 5JIIA 3W9EB 5DUJA 4G6ML 5CJQH 5JXAL 5EZLB 2ZYRA 5F71A 4HMDA 2XZAL 1IQDB 3WUWG 5ID0B 5HY9B 5KYXB 2HVJB 3MA7A 2YRLA 5FO8B 4G80B 5KVEL 3ULUH 2K0RA 4ONFL 1PCSA 4R7NA 1UOWA 1A9EB 1MLCA 3OKNB 2DAVA 1HSAB 4M7LH 3G6JE 2ZJSL 4JDZB 3NSFA 3J27A 1H8LA 5LXGH 1CXEA 3IFOB 3ZMRA 3CN1A 1F56A 1ZGLM 2DTSA 5BOZG 4D0DA 4DHLA 1FYTD 1GL4B 3ELAT 3PDGA 1MG3C 2JJTA 3F7VB 1AQKL 1EAPA 4BCXA 3CGTA 4FHKA 3SDYH 5AG9A 3UBXG 2RFXB 4M7KH 1BEXA 4P4KA 2G0LA 2H1XA 4QRTB 4ODXB 2A1WH 4P5KA 1DSFL 3HZYA 2CDEA 2D03L 4M5YH 3SJVB 4W9FC 4R83A 3U4EB 1IM9D 4U1HB 4PRNA 4X6DB 2FJGB 3HB3B 3UPAA 1R0AH 1UUNA 2OXHA 2XZAH 2KC0A 3N1MC 4J3OD 4OLXL 4OZGE 3CQFA 4QT5A 5A2JH 2FR4B 1SQ2N 1ONQB 1DQVA 4CNIB 3CQQA 3QUXA 4RSVA 3MKKA 4XMPH 4CMMB 3QDAA 5AKTA 3MRJA 2DQTH 5I1HL 1AYOA 3WJMB 1UXLA 3UZQA 3PHQB 2X4RB 4JANA 4JRWA 3LSOA 4JFQB 3KPSD 1G7QA 4AOFA 2ZCHL 1RI8A 1R3LA 2F2HA 5AW4B 1AQMA 1XB6A 1AQKH 3AUVA 1CF8L 4QOKA 4WO4D 5CILH 1KIPB 3K6DA 1CGWA 4HKBA 5H35A 4KPHH 2FHFA 3ZTNH 3TCLA 2EDNA 3NJIA 4YSUA 1CO1A 4EXKA 2XG4A 1UZ6F 5DRXA 4BK8A 1T0PB 2VR5A 3D4YA 1LD9B 1VZGA 4KX7A 1NM9A 4XBEH 4OI7A 3QWRA 1DBML 1JNHA 4L8BA 3HG2A 5GSVB 2AZAA 2OMTB 1G7MA 4PIBA 1IAIL 3PQYE 1KB5B 1KNOA 1KACB 1KIRB 1FRGH 2WXIA 3CLEH 4TXVB 5DO2C 2DN7A 3EJYD 4LGRB 3PG2A 3WNMA 3KL0A 1OQXA 1Q72L 2P42B 5IROC 1IGTA 1MCEA 3WFCH 4LCVA 3GMMA 4YSAA 1TJXA 3DETC 1GIGH 2ZE0A 4M6OL 1A6AB 4NC2B 1S9WB 5F1NA 5K59E 1L9SA 4L9LC 3H3BC 2BRRL 3GI8H 1BXAA 1CZ8H 2BVUA 2YEVB 4JFDE 4P2OA 2UZPA 3F83A 2F8XC 3TN0B 4KUZH 4DGYL 5FYKD 4FNLL 1DBMH 2WVSA 1T6VN 4J27A 3ZIMA 1P7QA 5F0LB 4HWEL 3ZE2E 4PJIA 4QHPA 5ESQA 3RIFF 4DO6A 4AEHL 2AS5M 2NXYD 1MCFA 4E5XG 1OAUL 2DV6A 4ZDHB 1SY6H 1KYDA 4RMTA 3NJNA 2FSEB 4ZPVB 1Q72H 3O6ML 4W6WB 2KZKA 4UV4L 4XO4A 3H6AA 2JK5B 3U79A 4KNTA 1UEYA 3LPWA 4IOFD 1CBJA 2YD2A 1AZBA 3MV8E 4KDWA 4M6OH 5D5ME 3GS4A 4L8DB 2JCWA 3MFFB 4JLRA 3DJRA 3OM3B 1EJ8A 1DDTA 3TESA 1B3JA 3W39A 4L3CA 3MQIA 1BLNA 5J1AA 4DGYH 2DBLL 2VUYA 4DESA 2FX8H 2XPGA 1HSBB 3FYIB 1EO8L 2CGZA 4PJ9D 4X9HA 2XNAA 4N25A 1K3ZA 1NLDH 1AHWB 1Z9OA 3BX7C 1IAMA 4IEFA 4KU1A 2V17L 1EHXA 1MKFA 1U0QA 4Q58C 2E7MA 4WUKL 1O6VA 1RZIA 4YDKL 4A38A 2V5MA 4PJ5D 1JZGA 3UFIA 4X5WA 1JXJA 3WN6A 4JRYD 5PCYA 2BNUA 4KJPD 3F58L 2HG5B 1LM8V 1TVBB 4EDWL 5ITBH 4O58L 3HPLB 3HS8A 3BC9A 2EQDA 3LX9A 4JG9A 2EDYA 4ZS6D 1JJUA 1LWRA 3BSZA 4GEJA 2DBLH 3V7AE 2RHEA 4EI5B 4KKPA 1WWAX 2FEEI 3O3BB 4WI4A 5FOBA 2YRBA 4UANA 4OCRH 4RIRB 2GKIA 2UWEA 3V5HB 3LZFL 2DQEL 2V17H 4FHBD 4M61A 4JG0L 2EVFA 4UUJB 3IPBA 2YD8A 1H6UA 4MXQD 5GZNA 3U0WL 5FV1L 1T3FA 4YDKH 1OGAA 2MCPH 4BFOA 5F7AA 4RMQA 4MJIE 2ED7A 1SHMA 1QFOA 4O58H 3LZOA 4R4ND 1I53A 3C09B 4A7VA 2E7DA 2YAOA 1V7ML 2BZCA 4JZJB 5D9SA 1WD8A 3VX0A 1YMHA 3EJSA 3BZ4B 2GJ6D 3RJDA 1KLGA 1EA9C 1M53A 2FWSA 1YUHA 3BD3A 1V3JA 3BAWA 3BLBA 4IRZA 1VACA 3D0LB 3JBG7 2JI2A 2Z65C 1RERA 5HDRA 3SGKA 4G1EA 3NN8B 1U8NA 2UVFA 4MXVF 1I7TA 4Z95L 2R7EB 4NQCB 1GVIA 4GG8B 1BLIA 1ZTXE 4OLVH 5HGHA 4Z77A 3FUNA 2ESVB 3RVWC 4HQQL 1E27B 2AJSL 3TO4C 1Z5HA 3WMSA 1NMAL 2AANA 1NUGA 3VXNA 3PJSA 2XUWA 5D1QA 5EZJA 3RTLA 4AQ8A 4KZ0A 5T1LD 4N0YL 1SYVB 4YHIA 5DZLA 1U95A 3FTWA 1AR1D 2YD4A 3FU7B 4I87A 5E4EC 1UT2A 3BD5A 3VGGA 4WTQA 4Z7NB 2XXCB 3SDXE 5KG9A 2H0FA 1TQUA 3GHBL 5GZOA 3TJEH 1WZLA 2WSDA 5DRNA 1HXMB 2ZCZA 3K2MC 2WLNA 4JUTA 4FTVD 3VFGL 3L16A 2WXGA 4IDJL 3EO9L 4HQQH 5JR1L 1R5WA 1BG9A 4OZIF 1O9ZA 2IADB 2OKMA 3LRLA 2YEZB 4FL4B 5DHYA 1CICB 3LOWA 1QFWM 5D7HA 4ACTA 1X5ZA 1WBYA 5AUMA 3HRZA 3GMOA 1MUJA 2RQEA 2OR9L 5GS3A 2BNRE 1FZKB 1UD5A 4QNPF 3D2UB 2HJLB 1QSVA 3EJZC 2WQXA 6PAZA 5I16A 1G9EA 2J6WA 3GHBH 5AB1A 4Y5VA 2A6KB 3CK0H 3WTSA 2WVTA 1GGBL 1EXGA 1MXGA 3NJHA 4JO2H 3I9AA 1PKQB 3HE7D 4DEWA 5JR1H 3B8SA 4PWKA 3D0AA 4RNRA 2V2WA 2FHCA 3DBXA 4JDEA 4AENB 5IHUL 2QADD 4HCGA 1J1XL 4BKSC 3MYJA 2GSIB 5IQNA 4P9HL 1IM3D 2P24B 2AEIT 3D52A 1L9MA 4ZX4A 1FZMA 2P8MA 1U8MB 3RIAF 3NGBC 3KJ4C 4OD3H 4IMLB 3NIDF 4HEPG 5FYLE 4XPFL 4RAUA 2IGTA 4OAWB 5SWZE 1RIUL 3DOHA 1W72H 3RTQC 2EACA 2IWFA 4FG4A 1UHVA 5ANHA 3VXUE 5KVGL 2DH2A 1ROWA 4CW1B 1A22B 2Y6SC 3LKOA 1U8LA 1KIQA 4WGVB 4D9RE 2FH6A 4GT0A 4TULL 1PZ5B 4JRXA 3QC6X 1QNIA 4YL4A 1YZZA 1CLZH 1JS4A 3BPNC 4X6FA 4F92B 1S9XA 4WUUA 3MBEA 3ZBMA 1RK0B 2OYKA 1EHLL 1BD2D 3FT9A 1NINA 3QSKB 4JHWH 4L0PB 4R26L 1DQJA 2L7EA 1VGEL 3V0WL 4LRIC 3UTSA 3F6LA 4PG2C 2GTWB 2HA1A 5DJXB 2C9XA 5J12C 4LFHD 4ZX5A 5DU7A 2K9UA 2QKIB 2OSXA 1F6AB 2MQCA 4ICXA 2CGRL 2BP5M 2XFXA 3L1OH 4QHUB 1A2YA 4FEIA 2CPCA 1I9EA 4OBRA 1H3XA 1G7LB 1R5IB 3MV9E 1JPTH 4Z7QB 3S97C 1Z5LA 3E2HB 3U30B 1JOIA 2FUQA 4MQ7A 4R26H 4PVLA 3DX9B 5TDNB 1OP3K 5MEOB 3QWOB 1M7DB 4EXPX 3AS2A 4ZFFB 5AAPA 4WWID 4LCWA 1YEGL 1IC4L 3B2VL 1T20A 2V9QA 5GS2D 2ZKYA 2CHZA 1F1GA 2Z92B 3KXFD 4W68A 4F58L 8PAZA 2C1PB 3N04A 5CO1A 5SX5K 4GINA 3TC9A 4N8PA 1YEFL 2C3XA 3LZLA 5D7JB 3FQ4A 4WY7H 4JG1L 3TBTA 1HT6A 2JELH 1NQBA 2HMIC 5I1DB 4HMEA 4MNGB 2WP3O 1NIAA 1QRKA 1H5BA 2CBQA 3D06A 3LYRA 4PY7B 1HEJC 3NJJA 3MNWB 1ZLWK 4KMTL 1NBVH 1ZS8B 3HZKA 4RMBA 1QLRB 1LP9A 3TZVC 3BDBA 3IJ7A 1IUZA 2VW7A 4P07A 1ZLVK 5HHPB 4NQDB 5IP4A 4FQIH 3DX1A 4KY2A 2AKRA 1MWAH 3D07A 1BQHA 1NGQL 4KWUA 3R1GL 1XTMA 1A7QH 1XH0A 1S9YA 5IB1B 4Y1AE 3QDGA 5AVUB 3B2VH 4GXFA 4PJ8C 8FABB 4KZEL 1RUML 2OJZH 2VW6A 2R56H 1MZYA 1KENL 2VSDA 3D39D 1ZE3C 3E6FB 4JG1H 4TUKL 3ZE2B 3ULVL 1QSEE 2J55A 4V1DB 3SDCB 2C9PA 2FJFA 1NBYB 1HX0A 3DPBA 4KMTH 5HJDA 4YDLC 3VFNB 2WTPA 2OMZB 2J2ZB 3KLLA 4GKZB 4I48A 5I8CA 2W0FB 1WRFA 4JVWA 4MVBC 4UQBA 1J8SA 1FIEA 2ZIDA 3ZZLA 1SLUA 5IEHA 2FQEA 4AKPA 3VW3L 3IJHA 3VI4A 5DF0A 4E41E 4LIQL 4X80H 3HRPA 2WCPA 3X1NA 3QCVL 4WHDA 2XG5A 4OIFA 4PS4L 4PJHA 1D9KC 1KGUA 1KENH 5JLZA 3QUGA 3CZJA 1TVHB 3GBML 5T1JA 4NSKB 1KTRL 3APCA 4OF0A 4TUKH 3J07A 3ULVH 2X70B 1TF4A 4PJEE 4N2MA 4LSDA 4BH8B 3QEQE 1N7MH 3K6NA 1V54B 5HGDA 4BIKA 1YPZE 3WNOA 4LQ1A 4TNWK 1BYNA 3P4NB 4JJ5B 2EXTA 4FLQA 3T0XA 3FPYA 5HHXH 2GHWB 2XZQL 4OV6F 4NENA 1NCGA 2F18A 4NT6A 2XN1A 5LGHH 3HJEA 4X99A 1P84J 1PZBA 1LP9F 2B0SL 3S36L 4HAGA 1I8KA 4CC0A 4LLUB 4ODSH 3L81A 2H6UA 1Y0LB 4CMHB 4PS4H 4UAOC 4AKQA 2VITB 5ENWB 3IMRA 3BW9A 4CVZA 3INOA 3GB7A 4N24A 3FMGL 5HHOB 5GQBA 4BSWA 3CE1A 3K71A 3O2VL 5KSAC 5B3NA 3EFFB 1M1XA 4S1QL 3IDJA 3GXIA 4JVPA 1RZJH 2XZQH 4MJIB 4PJGE 4UM9A 3RAJL 5C0IA 3AWGA 5L4JA 1M6OA 4ZTOH 3ZIYA 3RNQB 2CLRB 4X98B 1R5VB 4K8RH 5LBVA 1J48A 2R59A 3C12A 1ZANL 5DQ9A 1UWYA 5J1TC 5FUZH 2OBGA 3HI5L 1KBGH 2WQRA 4QHKI 1JF5A 3VFUA 1O9WA 5H37G 2HJKA 1G0XA 1V05A 3O2VH 4I3RH 2CHWA 5LDUA 2F8OA 5EWIL 5PAZA 1BOGA 3C6LB 3TT3H 4Y19B 2WXPA 3AM8A 4YFLI 4S1QH 5E6IB 5IJDC 1FF5A 3RAJH 2ZYHA 3LIZL 5GRZA 4PB9H 4K71C 5TQ2L 3TA3A 3WE6A 2YAEA 4HDIA 4TVUA 2XTJB 4NI6A 3T4YB 4GRLD 2PXYD 3HKFA 5ICZA 1XB8A 3C08H 1TT6A 5CJXA 2R23A 4ZS7H 3L17A 4EOWL 5CZVL 4X2UA 2HT3D 4G42B 5B7EA 4ZXBA 1NFDA 4H5SB 1B6DA 4WW2A 3DJZA 3KPLA 4WFHD 1CFNB 4I88A 1RMFL 1OEZW 5FKAA 3GTNA 2EIDA 1HL4A 2GYSA 5DEGB 1J1OH 2BRQA 2FHBA 3WTVA 2R0WL 4JAMB 4QTH