3CVBA

Regulation of protein function: crystal packing interfaces and conformational dimerization
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
b'ETFTVKMGADSGLFQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin
molecule tags Electron transport
source organism Phormidium laminosum
publication title Regulation of protein function: crystal packing interfaces and conformational dimerization.
pubmed doi rcsb
total genus 23
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3cvbA00
4JKNA 1JXDA 3CDZB 2YQBA 2EIMB 2PPDA 4HCFA 2YAQA 4A2HA 1MG2C 1UATA 3WKQA 4CSPA 3OMIB 1KBVA 1KDJA 3UACA 1BXAA 2YXVA 4YSTA 1PZCA 1ZDQA 2BW4A 2P80D 3BVDB 3SBPA 1MZZA 1L9OA 3ASNB 4ENZA 3WNJA 3S8GB 6PCYA 8PAZA 1L9QA 2I85A 4X4KA 1CURA 1ZV2A 3OMAB 4EF3A 1ID2A 3CVDA 3AW5A 5I6LA 2OJ1A 2UXFA 3PAZA 4A2DA 3ERXA 2XV2A 1E65A 4A2FA 4DP0X 3OD3A 3IN2A 1JZGA 3EH4B 5I26A 1AOZA 5FC9A 3QJQB 1NTDA 4KOCA 5B1AB 4A67A 4KNSA 1ZIAA 2GC7C 2N0MA 2R7EB 1ET8A 1M9WA 4UF7C 1PZAA 5LDUA 3TA4D 1ADWA 4YSOA 3DIVA 5B1BB 3TBCA 1PF3A 2FNWA 1IBZA 1CYWA 1J9QA 1GY1A 4Q8BA 3PLYA 4TXVB 3X1EA 1PLBA 2BP0B 2IDQA 7PCYA 4DP5X 1MDAA 1ILSA 3WNIA 3IN0A 2FT8A 3OM3B 3WIAA 3GDCA 4QKTA 3RYMA 3WG7B 4YSRA 3H56A 2GSMB 4BWTA 5PCYA 1GY2A 2B08A 3CDZA 5I6PA 3V9EA 4YSSA 3FPXA 1PY0A 4KO6A 4JHUA 2TSBA 2CAKA 3NSDA 3JTBA 5TK2A 1OF0A 1NZRA 4FA7B 2WO3B 2PCYA 1AZRA 1HAUA 3N55A 2W88A 2CJ3A 4DPAX 1SDDA 2W8CA 1BQ5A 1ASOA 1GS7A 1ZIBA 3FSWA 4G7RB 3UAAA 2AANA 3X1NA 4YSQA 3OMNB 3NSFA 3BQVA 1XB3A 4DP1X 5I6KA 3FSVA 2YAHA 1DZ0A 4N4YB 4HHWA 2XV3A 4HIPA 5D4HA 4KO5A 1OE1A 2IDTA 1I53A 1SHWA 5B7MA 4DPBX 4HALA 4KO7A 4GY4A 1A8ZA 1J9SA 3NP4A 2J57A 4K9JA 4A2GA 2BP8B 3IEAA 3PPSA 2BP0A 1VLXA 1AS7A 5I5IA 3MX0B 5B7EA 3NYKA 2ZXWB 1NPJA 3FS9A 3FU9A 2VMJA 1NWPA 2LLNA 2CALA 4A68A 3S3DB 4UANA 1WA2X 2FJSA 2X87A 3HEIB 4KO9A 4AKOA 4BXSV 4DP9X 1SJMA 1OCZB 4NAJA 1AZCA 1FFTB 1JZFA 1AZBA 1TU2A 2PPFA 2UX7A 1AIZA 2PPEA 3H4FA 1EZLA 2DWSA 1GYCA 2BW5A 1V54B 2XUWA 3ZX1A 1ASQA 3FQYA 3AG2B 1GW0A 4G7SB 1OE2A 2QDWA 1ILUA 2AFNA 4PAZA 2GIMA 4PCYA 3GYRA 3V9CA 1NIAA 1QHQA 4W9ZA 1AZUA 4BDVB 2RACA 1OCCB 4NERA 2BO0A 1NINA 3AG3B 1J9TA 3GXUB 1TEGA 3L45A 4A2EA 2H47C 5PAZA 3IE9A 3TASA 4E9WA 1AAJA 1BXVA 5F7BA 1X9RA 1N68A 2VM4A 4G72B 3SQRA 4DP6X 2EIKB 4HAKA 2PLTA 1PNCA 3NSCA 2DWTA 2XV0A 3U25A 1A65A 1JZEA 2AVFA 2EINB 4M4RB 4E9SA 1N70A 3AZUA 1PAZA 2FQEA 3QJSB 6PAZA 4F7KA 1L9PA 2WO2B 1CYXA 1ETJA 5D4JA 1IBYA 1NIDA 4GP4B 3NJHA 2BWIA 2JKWA 4AX3A 1SHXA 4AI7A 1E30A 1FWXA 1J9RA 2IWEA 1CC3A 4M3HA 3PXLA 4UAHA 1BEXA 2QPDB 4E9XA 1OCRB 2J56A 2HRHA 3CVCA 4BXVA 3NJLA 1MG3C 4HCGA 4AZUA 2IDFA 1PCSA 5I6OA 3EHBB 5EHFA 3T6ZA 1XMEB 3NJIA 2FQFA 1GSKA 5B7FA 1NWOA 4E9VA 1T5KA 5B3SB 2EIJB 2IAAC 1BQRA 2FTAA 2VW7A 5TK4A 2IH8A 7PAZA 2PPAA 4P5RA 3NP3A 1X9UA 1B3IA 1WA1X 2QPEB 3NJKA 1L9TA 2GI0A 2TSAA 2JFCA 2ZONA 2Y1AA 3EH3B 3FYEB 1OV8A 3JT2A 3T6WA 2XVBA 2IDSA 4DP7X 4YSEA 4G71B 3TU6A 5AFAA 2GC4C 3FT0A 1PMYA 1AANA 1TKWA 2IWKA 1AS6A 3KW8A 4A66A 2H3XC 9PCYA 4CSZA 3QQXA 1SFHA 1XB8A 1JZIA 2BWDA 2ZOOA 3SBRA 1TEFA 2X88A 2YAFA 1JZHA 5ANHA 4YSDA 1JXFA 2IDUA 3ABKB 3PAUA 1NIEA 1SF3A 3T6VA 5I5MA 1GS8A 1JZJA 5B1JC 1KGYE 3ABGA 2DYSB 2J55A 2AZUA 4QLWA 4YVNA 1R1CA 2YARA 5I6NA 2GBAA 4BWUA 2HX9A 1W6LA 2ZWNA 5F7AA 1GS6X 3QJRB 5AZUA 2FQGA 1CUOA 2Q9OA 4MFHA 4W1TA 1ZDSA 2YAMA 1OCOB 1PZBA 1E5YA 2JXMA 3FSAA 1ASPA 2GB2A 1SFDA 2VSMB 2WSDA 2FT6A 3MBWB 3FSZA 5D4IA 1PLCA 1E5ZA 3PAVA 4N8UA 3X1FA 1RZPA 2IH9A 2CBPA 4G7QB 1EHKB 4YL4A 3S3CB 1KDIA 1AACA 1ET5A 2BHFA 3T9WA 2PP7A 1NIFA 3NJMA 4DP2X 1BQKA 1J5DA 1URIA 1XB6A 3FYIB 3OQRA 3KW7A 3NJFA 1IUZA 1RCYA 4DP4X 3D12B 4L0PB 1AR1B 2OCCB 3QJTB 3DTUB 1BXUA 3NJNA 3S3BB 3QJUB 1A3ZA 4YSCA 2Q5BA 3FPYA 4E9RA 1AG0A 4BWWA 3SBQA 3AY2A 4GP8B 3FQ2A 1V55B 4KNUA 2XYBA 4HCIA 4WKXA 1SNRA 2EILB 1KV7A 1NICA 3HB3B 1OE3A 2CUAA 4DPCX 4P5SA 1NIBA 2Y69B 4F2EA 2BP8A 2YAPA 3QJVB 1WAEA 1F56A 2XX0A 3UGEA 5AKRA 2H5UA 4GXFA 4GYBA 1WA0X 1SDDB 4YSAA 1BYPA 2FT7A 3ABLB 2DYRB 2VW4A 2BZ7A 2YXWA 3CZUB 2IWFA 1E67A 1QNIA 2PP8A 1A4CA 2MRYA 3NJGA 3UAEA 1JXGA 1M57B 2UXGA 4G70B 2HX8A 4ZK8A 3IBOA 3EH5B 2BZCA 2XLLA 3ASOB 4KOBA 3ZIYA 1PLAA 2PP9A 3WKPA 1SF5A 5A7EA 4HZ1A 1KCWA 1KYAA 3N2JA 1JERA 3G5WA 2I7SA 2DY2A 2UXTA 1WS7A 1RZQA 4E9QA 1BYOA 1PNDA 3WI9A 4BDVA 4YVUA 2YAEA 2R7EA 1ET7A 2A3TA 3PCYA 2MTAA 1HAWA 1KCBA 3QPKA 3NT0A 3FU7A 5IY5B 1JOIA 2HXAA 1QLEB 1AS8A 5I6MA 2B3IA 3FU7B 4JHVA 1L9SA 4HHGA 4GP5B 1GR7A 2XWZA 4DP8X 4RH4A 1IKOP 2DV6A 2OV0A 1NDTA 2PCFA 2UXVA 2VW6A 4AKPA 3UABA 3ABMB 4YSUA 2CCWA 2XXFA 2HRGA 4KNTA 2HLEB 4AKQA 3H4HA 5B1JA 1HFUA 3ZDWA 1RKRA 4E9TA 1ZPUA 2J5WA 2VSKB 2XXGA 1L9RA 3T71A 3S8FB 3CVBA 3AG1B 3X1GA 2VN3A 1YLBB 3DKHA 3FU8A 4NB7A 2UX6A 2PPCA 3X2QB 1FA4A 1OOWA 1KBWA 4BK5C 2AZAA 2QT6A 3T6XA 2FQDA 3EF4A 3FQ1A 2YAOA 3X1BA 1W8EA 1M56B 2I7OA 5I28A 5I5JA 1NPNA 1A4AA 2QDVA 1JVOA 2E86A 1WS8A 1AZNA 1DYZA 2XU9A 1W6WA 1J5CA 1BAWA 3AG4B 3NSYA 2HZHA 2NRDA 1JVLA 2GHZA 3C75A 5B1KA 1A4BA 3UADA 4FAAB 2HX7A 3TBBA 1AG6A 2FWLB 1V10A 3NJJA 5E9NA 1IC0A 4Q89A 2P80A 4YSPA 3ZBMA 2XX1A 4WTQA 2VM3A 1MZYA 3CG8A 4E9YA 4F2FA 1AQ8A
chains in the Genus database with same CATH superfamily
1M1SA 3RVUD 1KN4L 2XJLA 3V2AR 3MRDB 1MG2C 1R34A 3OMIB 4LU5L 3IMVA 5DFAA 4JRXB 4WO0A 5LGHL 2Y6TE 1CDHA 3MUGA 3MO1B 1PG7H 2I85A 3GS0A 2WINB 1ID2A 2KLSA 4E5XB 3BLPX 3TT3H 1UUSA 1TR7A 1HWWA 4M5SA 3CFQA 4P23C 4WUUE 5AW9B 2OMYA 3ZKSD 2GABA 3PDGA 4G8IB 5FHAL 5H94A 5BMFL 3I6KB 5TQ2H 3N41B 3LY6A 3CFUA 1RH8A 1FFNB 4UMSA 2FX7H 5BZZA 4JRXA 3VWKC 4PJGB 4X80L 3BZFB 4WK0B 2IXQB 2ADFH 3QG7H 2AK4E 1OPGH 4HC1A 4ENEC 4FKEA 2IDQA 4N2AA 2E7HA 5K33A 3TBYA 1XSIA 3A67H 3RYMA 4O2EA 3KPRA 4HGKC 5DJZA 2J21A 4OZHF 5BS0B 3L13A 2NY6C 5H2BB 1VADB 5DHDA 5IT2H 3FPXA 2D03H 3UTZB 5EOCJ 1KUMA 5HY9A 5HHPB 2JKIS 5IEHB 3QS3A 4Q6IA 1MRDL 1F13A 3REWB 1KCRH 4EOWH 1E6OH 4HUWA 2XIBA 3OKLB 5I66A 4FF9A 2WO3B 4R96B 5J56B 3BP4A 2VKWA 3WV0A 4WV1C 4LKXB 3QQ4B 4QHMB 4XMPL 5SX5H 5FKPB 1G6RH 3G5YA 3IDJA 4YR6B 5KSUB 3HG1D 1F2XK 4PV8B 3TCLB 2J20A 3NSFA 4KMLB 4ACPA 4KQ3H 1ZT1A 4QHNB 2IQ9H 4K9EL 2B7DT 4KO5A 3QA3B 4XPFL 4YH6A 5D7IE 3RGHA 4H8UA 2O26U 1TVBB 5ANMB 4U1LA 1EHLL 4EBQH 1QVOA 3R0NA 2VLME 3DETD 4W9GC 2DH2A 3D85B 1G94A 2E9JA 3IMUA 1UA3A 4PJ7E 2VC2B 3NFNA 1D7FA 4XZ4A 2Y7LA 3ZE2F 4OBRA 3OBAA 3RVVC 2UWEE 4AKOA 1RPKA 3WEXA 5EIIG 4PMFA 4N0UB 4BH8A 4AYGA 4A7GF 2PO6C 4NJ9H 3GBMH 5IW6A 5A7BA 1AZBA 4IU3A 4DH2A 2IIJA 3BHBB 2W9EL 1H3VA 3QUMA 3RNKA 1EVUA 2PPEA 5F3FA 3EDJA 5IGXL 2LW3A 3H1ZA 3BKYH 2X1XR 1BEYL 3MV7B 4QAMB 5T1LA 4NQXA 4TSAH 5CHNB 1XGQB 4WFGE 2YGVA 1WTGT 5A6MA 4RISL 4HUVA 5KVMC 1Y1DA 2XTJC 2HPOA 3DJ9A 4ZUVB 4MJIA 4UQDA 5CINH 5H37H 5FV1L 5D1XD 4LHQB 2WJ5A 4P3DB 2YSSB 3ZE1B 2VWEC 4RX4A 1G84A 3BQUD 1OP5H 2BSRA 4GS7C 3NABH 3QZLA 3AM8A 4XC1L 1HTYA 1ZY9A 2W0KA 2XG4A 1OY3B 4HKXB 2PTTA 2YWYA 3DV6B 1MCWM 4FMKA 5FECB 1N68A 1MY7A 1UA6L 5SX5K 3LZFL 2IC2A 1YAZA 4YXLH 2VWEE 4G2AA 4GG6A 3IPEA 3N40P 3ZE1F 3EOAA 4FLHA 2FL5B 1OLZA 1XSJA 4HXBH 4LSRH 1TTFA 5A2BA 4NZRH 5CP3A 2MHAB 3CSYB 2OR7A 2O93L 1LE9A 1CT8A 1DCLA 1WIUA 1SJXA 2XQBH 2V9UA 3K6OA 1KYOK 4R26H 3NDYE 4BZ1A 4MA3B 2G4EA 1SN2A 3AAZA 5LBGA 3S88H 1EWHA 5IROC 2QQQA 4Z8FL 2BVPA 1OALA 1B4RA 5M7QA 3K72B 4ONFH 1WT5C 5AOKA 5BQ7B 2E9BA 1SHSA 4HFWB 4DZBA 5JHLL 4XMLH 4HCGA 4S0TD 3ULSA 4PUBL 1A6AB 1EGJA 1FPTL 1UACH 2D9CA 3I84A 1YNLH 4Y4FA 5CJQH 3U79A 3H2QA 4KDTC 4G9FA 3ZDZE 2JCWA 2QADC 3CTTA 1Y07A 2IAAC 1X5GA 2O6PA 2VZOA 3O0RH 5K9OB 4J3TA 2GK0A 3T8MA 3N44F 1IAMA 2B2XL 3V5DA 3ZTNH 2ZNWA 4GSXA 4MA7H 1X9UA 2EE0A 4G43A 4Z7NE 4HG4K 4TUKL 4QY8A 2V6HA 4X4XB 1MFDL 3VX1A 3OR7A 4XP9L 1DJXA 4WHDA 5C86A 2QFRA 5HYJB 1J12A 2VC2H 3L2LA 3GGWB 4DHLA 4F7TB 3A6CL 3LMJL 4Q4IA 3THMH 4V2BA 3ZSTA 4UT9L 4AV4A 4HUKB 3WMSA 1I8UA 4U1JA 1O9ZA 2Y7NA 1DBML 3CN2A 3US9A 4P57A 3OX8A 3BUQA 4ZS7H 2EDMA 2H8PB 1KELH 3FCTA 3NCFB 2AV1A 2DBJA 4OLXL 4ZUUA 3NZ8A 2H26B 1XGUB 4QRQA 2EUZA 4ODUA 1A9BB 2CO3A 4H26B 3O6ML 2R0LH 3HE7A 4TUJA 3SEPA 4CKVX 4Y88A 3VXUE 3SE8L 1U3HB 1GPOH 2O6CA 3AT0A 4GSUA 4XXDA 5FUZH 2FSEB 4C4BA 5F44A 4YVNA 3PHQA 2CG9X 5CR8A 1HSAB 3QNXB 5E2WH 4Z7VA 5F7AA 3SYAA 4R83A 3GO1H 2Z35B 4H8WC 5AZ2L 1OWRM 5FA4A 3HR6A 2ZCHL 3WY4A 2VQUA 3ES6B 4ZSOA 2GSGA 2Z92B 3KPRE 2QKIA 5SWZE 1A6AA 2FK9A 2GB2A 3BD3A 3CUPB 4FHJA 4HIXH 4WK4B 5CJ5A 1RIHH 4UI2A 5GXBB 1HZHL 3QG6B 2EUXA 4LP4A 4L9LB 1YEKL 1NBVH 2X1PA 1E5ZA 1G7MB 2KZ1B 1HILA 2WIIA 5GGQH 4ZBJA 1SJEA 3H55A 3HMWL 4ZPVA 4WUKH 3WGUB 5JXEA 4G6AD 4AGLA 3DGDA 1FO0A 2EACA 4O2FA 4MZRA 5H4ZA 2HRLA 1MCPL 5I75B 1JK9B 1BQKA 2WPGA 3FYIB 2A0LC 1A7NL 1LEIA 3KPMB 2BCMA 2XTJB 2WOBA 1HL9A 5DGQA 1YN7B 4CA4A 3OKKB 2G30A 3GJFK 1OTUD 1A6TA 1L7IL 4A6YA 2P5WE 1BMGA 3D3VB 4H0HB 3WE1A 1CDYA 3Q8BA 1LGVA 3DWTA 2CO2A 4KNUA 4PTTA 1UXLA 4O9HH 1SNRA 3NRQA 2A38A 4BA8A 1OANA 2EILB 4JPWH 2F53A 5AQ0A 3WU1A 3DX9A 4LQFL 3ILPA 1ZV9A 3MV9E 4YHKH 3U82B 4XI5D 5ALBL 1TETH 3O3EB 3M17A 1KIQA 4XCNA 4BFGA 2D8KA 1YN6A 4LL9A 1PJ9A 5FYJE 1I8MA 3GXMA 1NCBL 4HX1A 3GZKA 4GQQA 4LT7A 2X4SA 1HIMH 4PVNA 5HDWA 3NIGE 4NUMA 2DYRB 3FQWB 2BCKB 2IWFA 1NANI 5DUBB 1RUAH 4J3VA 4AGQA 2Y25A 3ESVF 4KFZC 4JVWA 5AW8B 1ROWA 2F8VA 1Z2KA 2HCZX 1U3NA 3TYFA 2WXJA 3EJYC 5E8PA 2AMGA 4WWID 1EMTL 1A7OH 1XIWA 1NPUA 4YGAB 2GT9A 2O4EA 3ZE0F 2CLVA 3MRIA 5D1XE 5GRJL 3UTTD 3SOBH 1UB5A 3KGUA 2DMGA 4MZ3A 1XVSA 4MA1B 4PJHE 1XIWD 4ZDHA 2VLJD 1JK8A 4PGDB 5IF0B 3B3IA 1SY6H 3DYPA 3T09A 1X9QA 5I0XA 1TQVA 3NQKA 4BFJA 2DM2A 3WJMB 3IK2A 1JOIA 4PS8A 5JA9A 4PJDE 3GBNL 2JKTM 4JHVA 2ZICA 2ICWA 4XBGA 1DSWA 4FCHA 4IKIA 5D2LF 3RWIA 1A6TB 3QRGL 1IZJA 4RA0C 3RA7L 5HHVL 4LO9A 4RH4A 2BSSB 4AKPA 3OZKA 2VW6A 4RLDA 3BVWA 3X12A 4XP1H 1R3KA 5TF0A 3UYOD 2OMBA 4P46D 4XWGH 1N6VA 4MX7A 1CCZA 1F58H 3CSPA 3LKNB 3D39B 4AQAA 3N1GC 2JCCA 3GNML 3KLLA 3QZWB 1WF5A 3PWVA 1L9RA 2IXQA 3LEVL 5KOVC 2NY2C 3SGKA 1VRSA 1S3KL 4Y4KB 3LPOA 4L23A 2X1OA 5DJYB 1T5WA 1MFEL 1Y0LA 2ED8A 4I18C 4JDEB 1FCCA 1J0KA 2MCPH 4AMKH 1DJSA 1FNGA 1TFPA 1DBBH 2W0LA 1KPVA 4WF7A 4XBEL 2PYEE 1X5LA 1FL3A 4AEIL 4BZ2L 1H3XA 5H94B 3X1BA 2G2RA 2JTYA 3N91A 4ILDA 1UD8A 2AQNA 3RWDA 5BRPA 2UYLB 2GJZB 1K6QH 1WS8A 2O6DA 3C8KA 3NIFE 3CIQA 1SJEB 4ZPVB 2YIHA 3RY6A 4I77L 4Z7UE 2Q3ZA 3S35L 3PV7A 3ZT5A 5FYJH 2NRDA 5TE7H 1FAIL 1JVLA 1RSYA 4K3EH 2CUHA 4Q52A 1I8IB 3HNVL 4XVOA 4EVNB 4HISA 3EJUA 3X14A 1LE5B 3QP3A 3B1TA 5JHMA 1RIUL 1F4XH 1ODUA 1NKGA 3V6ZA 4ORGA 4N22A 3G08A 2LLLA 3V0VB 1TYRA 3WFEL 5AG9A 2V2TA 3AMLA 5JDSA 4U1IA 2YKLH 3GSNL 5EBGA 1OZUA 2EE2A 1PZ3A 3GSOA 2JWYA 3VXPA 1UD6A 4JFUA 1SOQA 4JFWA 1ZVSA 3GI9L 5I6LA 1ES0B 4K8RC 4IRSC 1CN4A 1MELA 3L3KA 3MRNB 3QXDA 5DC0A 4MS8C 3VXMA 2X1QA 1PS3A 1YAIA 3U4AA 3OD3A 3IN2A 1JZGA 3EH4B 3MLXH 5JW5A 4LL1A 3RHWF 1GRWA 4B0MM 4E41E 2EH7L 5I26A 3LEXB 3QJQB 4AK1A 4XNXL 1C1EH 3LN5B 4WWPA 2GC7C 1ET8A 2E7LC 2IGTA 3FRUA 4FFTA 5LDUA 2ICEB 4J23A 3RIAK 1INDL 1ND0B 5DI8B 5EU7C 4E9LA 3X3GL 3O2DL 5HJ3B 4LVHC 1LJMA 3E3QC 3SD2A 5EOQL 1QPXA 1FNAA 4Y16C 5K39A 1WFTA 3WNIA 5DFTA 1GZHC 3TJPA 4I1NB 4TL5A 1OW0C 1T83A 1TZIB 4MNGE 4PJFB 3WG7B 3ZGIA 4D8OA 2WLHA 3H56A 3I50L 2WZAA 4JRXE 1EGJH 2J4WH 3V7AE 1QFUH 1ICTA 5F9WB 4HULB 3UTQA 3ZN6A 5JUEH 4HOWA 4GAGH 3QI9B 4XX1G 5LG6A 3T0DA 4WEMB 4JBSA 1H0DA 1MY5A 1FVDA 1TQUA 1QLEL 1VPOL 2JKXA 3JTBA 1GJUA 4PJXB 1D2PA 1KB5H 3LDBC 3MLYH 5ALCH 1INDH 1XR9B 2WZ6A 1NZRA 2NY5C 3V5KB 3ES6A 2A77L 5K1VA 1JGLH 4Z76A 2Z92A 3N55A 4RSYA 3X3FH 4DGUA 5C7XH 3OZ9L 1HCVA 5E51A 2H2SD 5LVEA 1QLEH 1KGCD 1OXYA 2AHIA 1A4JA 4X4MA 3ZE2E 1NC2D 5E23A 1M3JA 2AJSL 1QFUL 4K5MA 4QRRB 1RZ7H 4NUPA 5JPMA 3KYNB 4P9MH 4KZCA 1B4JH 4Y4KA 4JGMA 1I9RH 3AXIA 1OT4A 3BOVA 3B7SA 1YC7A 4JQVC 4Z7QB 3H9SE 4LP8A 1RPQA 4YXKL 1Y7VA 1HXYB 4OZFH 1N6QL 3NEOA 3O2DH 3WIHL 3LNGA 3RVVD 1XF4B 1DLHA 2C9AA 4KY1H 3BVVA 1WA2X 4BXSV 4PJ9C 2OTUA 5AVYB 3DBXA 4CBPA 3DRQB 2W9DH 3WJMA 5I19L 2VDML 4K3GA 2GFBA 1OP3H 5FK9B 4XBGB 3WHE0 1COBA 2AJXH 4QY8B 3BQUA 4LF3B 5BZXA 3RUGB 2R56L 2XXCB 4I1RA 5HYSA 1OE2A 3L17A 5D1XA 2VLLA 4NRZB 4Q74A 2IGLA 1KB3A 3L7FA 4WW2A 5GGSY 4FNLL 4ZUTB 4N8CL 4OZHE 2O6EA 4XI5C 3VD3A 5CLTA 3A0OA 3GKWH 1S3KH 3MLTB 1QLRA 2AXJA 1CB4A 3F12A 3TN0C 3MJ7B 4BE6A 3WNKA 3IXAA 3F05A 3H0TA 1BFVL 1AAJA 4PJXA 4DEPB 3ZTJG 5CZVH 1JZ5A 1ZTXE 1V27A 1CF8L 3OV6A 3FQ4A 3WY1A 2ZTBA 2ETWA 1PNCA 3F6JA 4ZT1A 3O41B 1HNFA 2E8ZA 3Q9PA 4N1CA 1BG9A 1YYMH 5D2NC 2AAAA 4YBQD 4HETA 4WW2B 4OLUH 4YO0A 5AG8A 2I27N 1Z7JA 4TQEL 5ELIA 4AQEA 3GBNH 4F7KA 2HLAB 5D4JA 4NO2B 5D2NA 5KVDH 3OGCA 1VJSA 4H8WH 2BWIA 5A2AA 4ODVH 3RB7A 5JR1L 5DFWH 1H3GA 2BY2A 1BDYA 3PXLA 4EKJA 1M1XA 2W60A 5BJTA 4KJQC 4PGBB 2J56A 3FO0L 4UTAH 4YIQA 3FUKA 4RGND 3GFUA 3QUYC 3LEVH 3VQ1C 1AKPA 2X9WA 5EHFA 4XVUC 3GGWA 4OCNC 4JVUA 5I30L 2F7OA 1L9NA 1UFUA 1CICA 4OCXH 2BX5A 3QUZA 2EYSA 1WICA 4UB0H 3FMGH 2VABA 3BI9X 2ITCB 1MWAH 5E5MB 3U4EA 1Z3GH 4J12A 4MZIA 3NP3A 3NZUA 4M1GH 4HMEA 1C7TA 1L5GB 3ZDXE 3ECBB 3KM1A 3T8XA 2GTQA 5A2IH 4M43L 1CGWA 1M05B 3MLSH 4PB0H 4JHBA 2FO1A 2PW2B 4XPBH 3WDJA 4N2LA 3BPNC 3P3SA 5CKGA 2DQDH 1G9EA 3C08H 3FC8A 3KPRD 3BPLC 5DWUL 4XXCC 3SE3C 2EYTA 1E9OA 1OAUL 4UTBH 1YPZF 4GO8A 4JFHD 1IGYA 3B9VA 5DQJA 1MCFA 5DD5L 1N8ZA 1KJMA 1OAQL 4UB0L 2UUDH 3IWUA 3OB0K 1A7OL 5AB1A 5F6HI 2D2CC 4JPVL 5C0JB 1F8TH 2N7SA 4XTRD 5IQMA 5DUPL 5M95B 2WVVB 3HS9A 1S9XA 2Z0UA 1MWAB 2BDNL 3B2VL 5KUMA 3DVGA 4G3YL 1P69B 2XZCL 5I8EA 3L3HB 3O45A 3PAUA 2FATL 3IJYA 3O2VL 4RFEA 1MDTA 2CDEA 4Y5YB 1CG9B 2WLNA 3MFGB 3VG9C 1T80A 3ABGA 1A7NH 32C2A 3ZUCA 4BSJA 4M4PA 2DQDL 2O5ZH 1KCSL 3CXFA 4NKOA 3ZKNC 4FYSA 4L0YA 3GPSA 4ODVL 1WZLA 5JR1H 4F7EA 1BZOA 3T3MB 3GIZL 4GRMA 4ZMAT 4IRSD 4G6FB 3RY6C 3F64A 2WXHA 1NBVL 3VH8G 3ILPB 2KL6A 4K5OA 1N5AA 3DSNA 4APQC 1IO4C 1SVZA 2DRUA 1U4EA 5MEQB 4KKAD 3SCMC 5C0BE 3ARGB 5HHXH 4BYHA 5F1IB 5L8LB 4ATWA 1RK7A 2FJHB 4LLVA 3ZHNA 2ARJB 2ZCHH 5HHPA 4ICWA 4N8UA 2JJSA 3X1FA 5IWLA 4LHJB 1OAKH 2CBPA 3VGFA 4J8QA 3CXDL 5I8KL 4GSDH 1R75A 4PJEB 4RGOL 2CO1A 2NW2A 4LKCB 4XNQA 5DRZB 4ZSOE 1XR8A 4WGWB 1A3QA 3TWYA 1KTDB 3BWAA 1XB6A 3GRWL 4LSVL 1USZA 2IADA 3PHOB 1RCYA 3O4LE 5LDSA 3LRHA 1QFWH 1YQ2A 4ESKA 1FRGL 2E9IA 5HDBB 5T3ZE 4FCAA 5IB1A 2CLRA 1CDIA 3L5XH 4TLUA 5LGKA 3M45A 2LABA 3D2UD 5F9JA 3HMWH 5JORA 2X40A 1KWKA 4KNQA 2DWDB 4FQHB 3W11C 2PABA 4OV6F 1P53A 2OYKA 4AC2A 4DGVH 4Y2OA 1VB9A 4GW1A 1QLFA 3WHE1 1D7BA 1MKFA 1R33A 4MJHA 4WI2A 3GHBH 3BSZH 4X9IA 1YYML 2F7PA 4JPQA 4TNEA 1NICA 3I02A 2ADGB 2VN5A 2X4RB 3Q8EA 1H8OA 3I2CH 1QVOB 3W9EA 1MJ8H 3EJCA 3SKOA 1NMAL 7TAAA 2WVVA 4LRNL 4CC0A 1GOFA 2VC2L 5AKRA 5CZVL 2H5UA 5DA4A 3DVIA 2BY1A 3TVMB 1ZT7A 4QXGL 2KERA 3WFBH 1TPXC 2DWDA 3D33A 4KKPA 4CMMB 4NO3B 5E6SB 3W81A 2Y2WA 1BPLB 4DO6A 4G7YL 4B0MB 3SE4A 3H6AA 5FF6A 2X6VA 3BUIA 2H32B 4D9QE 3LV3B 5BV7L 4KXZH 3VWJD 2HX8A 3QEUB 2OM5A 4JN2A 4LVNB 4NQEE 4DN3L 2NX5A 4OLXH 2YEVB 5DZ9A 4BSWB 1XGTB 5KS9B 4MJJA 5I17B 3KJ4B 1M2VA 3WKPA 3QEQE 5IHHA 2CUMA 5J12C 2R2CA 3V4UL 3QJHB 4B9ZA 4MJIB 5IIEA 2DTMH 4PJCE 4ZPTA 4IJ3C 4X6BA 3L3DA 1JV2B 5EC1B 3O8XC 4LSTL 4Y5VA 2WLJA 2EDRA 3FONA 4RAUA 3LEYL 2D7QA 4G6ML 4L8CA 5E1HB 5LCVL 3P77A 3W2DH 2VLRD 4QNPE 2H2PD 1CL7H 1U36A 5LNEA 5INDB 2UVFA 2W60B 1T4KB 1HVXA 1L9SA 3FO2B 4YIQB 4H1LB 4N0CD 3SOTA 2MKWA 2F58L 3QZNA 1BF5A 5FCUL 1LO5B 2P9RA 4X7TB 1I85C 2EZ0D 4EZLA 3CUPA 3O0RL 4LPYA 2V2WA 2VM9A 3HPJA 4L5FL 5IV2B 1KJ2H 2WZPD 1RV6X 1QRKA 2CU9A 3LZFH 1DP0A 5CBEA 1RULH 4GSQA 2MCAA 2YD9A 2IPUK 1GYUA 3X3GH 2C1OB 3HBZA 3MACL 1KBKA 3NABL 1J05A 3QDAA 3NCYP 2PPCA 2X70A 3L9RA 3QB7C 5JXEC 2J73A 2EE9A 1U8NB 3SKOB 5GZOC 5ALCL 4P9HL 2AEQL 4KH2A 3EGDA 1DVUA 2A6JB 4ODTL 3DPDA 2Q7NA 2WBJA 2FH8A 5CCKL 2I7OA 4Y2DA 8FABA 5HGBB 4X5XB 1BEYH 4IEFA 5BVJA 2XZZA 2DS4A 5D1ZI 3EO1B 4A7TA 4LSRL 1ZLVK 3ULVF 4QXTB 1NCTA 2IMMA 4UDTA 5C7ZA 2NZ9C 4KZDH 1OGTA 3VW3L 3SY0A 1XCQB 2NXYD 5DHEA 1T89A 2C4FU 3RFZB 3BSHA 3TFBA 5D5MB 2OL3L 2E76C 2OZNA 1YMME 2Q20A 3AB0C 4GQ9H 2FB4H 3QDMB 2ATPA 3BMVA 1GJIA 4MA8H 4PWJA 3RX9A 5AENA 1M7IB 3M8OL 3IDGB 1G6RA 1L9OA 2X0WA 4LASL 1SBBA 4ENZA 3N50A 3EGSB 2EDJA 3ULUE 1BYNA 1CURA 4RISH 1IC7L 4TULL 3QYMA 4HWUA 5IVXE 2A9DA 4HXAH 4UQ2B 4MCZB 3DMMB 2UXFA 5SX4H 2BMKB 5J7CC 1DQJA 3HZVB 2XV2A 1QFOA 3CH1A 3QGVA 3B7TA 5IR1A 4KROC 5IGXH 3IGUA 2XACC 1MCOL 4B5EA 4KOCA 2OL3B 2ALWA 2WYHA 4MDJB 4PWFA 5CZXD 3I6KA 4OQTA 2MCPL 4AMKL 1X6NA 5DT1H 2MFNA 2X2JA 1RJYA 3LHPH 3SHSA 3GJFA 4B53A 5J4MA 3E2HC 4HDIA 4MRBA 4N8VG 5TPWH 1PF3A 4JFTA 1JK8B 2FNWA 2AK4A 5L88H 2IPTL 2P8MA 2YMOA 4O02L 4PREA 4WI8A 4P06A 5EEZA 1IGFH 1OGAD 3SKNB 5HJDA 2NNAB 5DS8B 5IVXF 3HOGA 2EO9A 3BDXA 3S37H 1DQMH 2VUYA 4QHPA 4NPKA 4X6EB 3HN3A 3LPWA 4IK6A 4Z3IA 1L3WA 2IQ9L 3BEVA 1GCYA 3LKOB 4K9EH 1PY0A 5IK3A 4F7CB 1UVQA 4MSWB 3GJFB 1AXSB 2JF1A 3FTVA 3SE4C 2NNRA 3G5VB 4X80H 3AADB 4FI6A 3CFKA 5EZIH 4F2ME 3GC3A 4NIYE 3ZMNA 1BMZA 2V3DA 4RMTA 1U93B 4HOZA 2MPVA 4KI5C 3CE1A 2XTLA 4WAFA 4PSRA 5KVGE 3GSQA 2PW1A 2WXIA 3ZKXB 4Z7NF 5FM4A 1I8AA 1SDDA 2W8CA 2WWOA 3MU3A 1CGVA 1ZIBA 4ZUVA 1QTYT 3TBVB 4WWKC 5JO5B 1Q1JL 3Q48A 5C07B 3U46B 2VIRA 3MUHL 3A22A 3ARDA 4M7LL 3TZVD 4FRWA 4FS0A 1KTJA 1DZ0A 1EPFA 1H19A 3MFFB 3DI3B 2IO5A 5ACZB 4WW1B 1NFDE 1F6AA 3RILA 1UT1A 3QEUA 2VDNL 5DURD 4PR5A 4XXWC 3BUTA 4LIQE 4ODXA 2WAQA 4J1UB 2VZ1A 2ZXWB 3NDZE 1E2VA 5GGRA 5IHUH 1WBZA 1H9DA 4J8RA 1NCBH 2VMJA 4NT6A 3IS0X 3Q2CA 4FQPA 4L8BA 3E6FB 5EPMB 3RAJH 3U1SL 3VDBA 3UTSA 1E28A 5JPMC 4JKKA 3SZKC 2H6OA 2RQ8A 1VERA 5ID1B 3JWDC 4N2DA 5ALBH 2EXSA 3TBWA 1JZFA 4GW5A 4L3EA 1VEOA 2PPFA 3EZJB 4ZAKC 3UEZA 1I9IH 1S46A 3TH4T 3LXAA 4AT6A 3BJ91 5DD3L 5IUSA 1DJZA 2DKSA 3PIQA 2NNAA 4EI5B 4KK8C 3D4CA 1ADQA 4K07A 5I1LA 1ZMYA 3VNYA 3TT3L 3MV8B 1KTKE 5TE4H 1JGDA 5E4OA 4PJIA 4HG4J 1ZS8B 1ILUA 4KBPA 4I48A 4NBXB 2GIMA 3FH8A 2WNXA 3GMLA 3IMSA 4MASA 4PCYA 5F1OB 5FM8A 5HBBA 1FVCB 3KJ6H 4LU5H 2KZKA 3L6FB 2Y1YA 3F85A 4JRYD 4GUCA 2ODHA 3MRQB 4NQTA 1OCCB 2N3JA 3C8KB 5F9OL 4Q14A 2APBA 3KPOA 3OKNB 3U9PH 2L3BA 1QATA 1T0NB 4WUKL 3QUXA 3SY6A 3CVIL 4LLUB 1FP5A 2XG4B 3NGBB 4KUZL 3AJ7A 1XGYL 4NCC1 3FT4B 3AB0B 4HF5L 3LRKA 4IKLA 4XCNB 4WI5A 1A65A 4X6CE 1JZ4A 2BH0A 1XEDA 5F0LB 5BS0A 1E8XA 3A6BH 4BRVA 1D6EA 2Q76A 4GEJA 1I9JH 2B1HH 2V33A 3JSSA 1CYXA 1Y18A 4ZFGH 5JW4N 4U1HB 3ZSSA 2F54A 1T20B 1RU9H 2BVTA 2Y0SA 2BFVL 1UEMA 4AQOA 4PGJA 2K70A 2DIBA 3CXHJ 3L08A 4WEBL 1TO4A 3MRFA 3VI4A 5GS2H 2BVEA 1OCRB 2GCYB 3HHMA 5ESQB 4BXVA 3MJ9L 1KLUA 4NFDA 3CBRA 1T21B 2WQUA 1YN7A 5G5DA 1PCSA 1FYTE 2IAMC 1KOAA 1MWAA 3KL5A 3HS0C 2VR7A 1NEZG 4TNGA 5B7FA 4FQ1L 1P7QB 4E9VA 2EDXA 5DSCB 1P5VA 3IXTA 1U8CB 2LU3A 1UB5B 2NYZA 2Y7MA 1VFUA 1AXSA 4PHZA 5I1JL 4AIZA 3DNKA 4JL1A 3OR6A 3L5HA 3B2XA 4JQXC 5G2NA 5HYQA 5I0DA 4J3WA 4GMTL 3BUDA 1M71A 3B9KC 4NZDA 3MC0A 4AZ8A 3A6CH 3IU4H 3MDJA 1WAAF 2B20A 5FYKL 1EZUA 5I1GH 1G7IB 2EKSA 5ERWB 5B39A 3QAZC 1E4XH 4NC0B 4C55A 1CFNA 2DYPB 3TJHD 1PEWA 1OP5K 1ZGLB 2ZX5A 5F71A 3AQDA 3FFCA 4DUXA 2XN2A 3BAXA 1K72A 5L2KD 4U1JB 3WXWL 2IWKA 2DTSA 5TH2B 1A66A 1RSFA 2C7UA 3KVDD 2FD6H 4HCRL 3R06A 2YWZA 5E5LA 4PRHA 1QA9A 4HJJL 2FUTA 4FG4A 4U6XB 2FSDA 3QFJB 1ECZA 4A63A 2M2DA 4CW1A 1AO7A 1UACL 1Z9LA 4I0PC 4LCCA 1KENL 4CSSA 3TBTA 3CFDB 2ARJA 2IDUA 3ALPA 4IHOA 1N4XL 5C6TL 3LNEA 4GLRI 1QBLH 3G6JF 4UQIM 3HB3C 5AVZB 3SKUD 5GJSH 1TTAA 1Q90A 4QLWA 1AC6A 1NAML 1R1CA 1RJZA 3BC9A 4HWZA 4XPAH 1EO7A 2C9VA 2WTPA 2IGFH 3BP7A 1UWXH 1MFDH 2MWCA 1CFQA 1WISA 2HN7A 2F7IA 2ZKHL 2DWEA 4TUKH 4Y8DC 5I18H 4PJ5A 4Q0XL 2PW1B 4NZRL 5AD0A 3MREA 2XWJA 1QNZH 1UQSA 4XMKH 3QNFA 3CFBB 1VGKA 4JPKH 3LD8C 1JYWA 4PJAA 5GS2D 2VKXA 3CVHL 4UT6H 3UERA 5EFIA 3A23A 3ZTJH 1S7TB 1TJIH 4CJ1A 3MBEA 2WQAA 5EBWA 5EBMA 2HWZH 15C8H 4TUUA 3RNKB 3MPCA 2L7UA 2JI1A 1NBZB 1AACA 3HRZB 1DN0B 5BUAA 1H9VA 4X5LA 4XMLL 2LE9A 3KW7A 4FQCH 2NTFB 3FTUA 2OCCB 2FIKB 4XCCH 3IM1A 5ICYB 3NJNA 1OLLA 2J3SA 3INUH 1CXFA 3S3BB 3QIBB 4NKDA 4YX2H 3MRMA 2WVTA 2Q5BA 4PG2A 4OZGF 4M3JA 4XO4A 3UTTB 1FYTD 1G0XA 2JJVA 2VLKB 2EEDA 2QSVA 4MKMA 4N3TA 1H8NA 2Z4TA 3BKYL 4QHNA 2UY7B 5GGVH 5INCB 4HCIA 3RZCD 2XWCA 4BQCA 4EQ2A 3UBXB 1FJ1B 4PJAE 2LVEA 3BAIA 3I6SA 4AYEC 3O3EA 4XMKL 1DBKL 5AYTA 4NQQA 1W8OA 3LNFA 2F1AA 3U4EB 2FR4B 4R90H 3KBHE 4LL4A 4JG1H 1X5AA 4Z0XA 2UWEF 4EIGB 4H40A 1FNSL 5FGBA 3RE0A 3VDCA 4QCIB 4ZD3L 4ANVA 2M26A 1R3LB 3IFNH 2NY2B 3EAKA 3FJTA 5C0AD 1PKOA 2R4RL 3L1OL 3UTPD 3PWJB 1RJCA 1EHLH 5C09E 3HBPA 1JXGA 3DRQA 2HN7B 3PV6B 1CGYA 1MREH 4UZGA 4WRLA 3BWUF 4XXWA 2CIKA 2MCG1 1FF5A 2OR9L 4OCMC 3KPTA 3V52H 1G1OA 1KLGA 1J8HA 1O0VA 1DJYA 3GLAA 4PS7A 3TLRA 1ESOA 3F04A 4JN1L 4AIXA 2F61A 4N0FB 4BZYA 5JOPE 1PNDA 2GK0B 4WWKA 2R39A 2W95A 3EJZC 3L3OB 4BK4A 3G6DH 2J1WA 3DGCR 3Q5TA 4X8CA 4QRRA 3CZGA 5FYKH 1Z6JT 2Z35A 4I85A 4J3OG 1NSNH 2LVCA 2I07B 5ACMA 3V0HA 1H3UA 3TNNB 4W81A 5KVFH 2AKRA 3EXLA 5C9JB 4KC3B 4F92B 1NDMB 4GO9A 4NKDB 3UABA 1GL4B 2HTLC 2EDLA 1DHKA 2GY5A 2X4SB 3VNZA 3N41F 4P5MA 3LS5L 5FFOA 2ZWYA 3RIFF 4BHUA 4U2ZA 3EJPA 4Z3TA 4K0OA 2VR3A 3WTUA 4NQSA 1VIWA 5HYQB 1YLBB 3DKHA 2I69A 3WNOA 3D52A 3IMTA 1AY1H 4KROB 2YRBA 2NUTA 1BD2D 1IGJA 4OGQC 1AKJA 3IPFA 2V5RA 2DJMA 3TTSA 4HSQA 4UILL 3TESA 1GZPA 4BM7A 2VRAA 1ZT4B 5EO9A 3D3VA 5D7JD 2ZUXA 4Y5VC 5IJVB 3V8CA 3HW7A 1ERNA 3EYFB 5JHBA 3PWJA 1JNLH 3WN6A 4X6DB 2OTWB 1XD0A 2XU9A 3JZ7A 1DDHA 2E7BA 4KGLA 1P7KB 4IBYA 1IAIM 2VABB 3N6YA 4NN5B 4DKEL 1O7VA 3W5NA 4G8GA 4ADGA 4PRIE 3B2PA 4ZMTA 5KSBF 1IGML 4K5LA 2V7NA 4R4BA 1H6FA 3VI3B 1UWFA 3IU3A 1BOYA 4Z7UF 1CD0A 3K8MA 1C16B 3JUYA 2Q86B 1MZYA 4NN6B 4KKAC 2EIMB 4FNUA 2WIIB 3MRGA 5CBAA 3JBG7 3O4OB 5I1DA 1ZDQA 3E8VA 4MQTB 4PIBA 4QHKJ 5KYNA 3EYUL 2UY7A 3CZLA 1EUUA 4P4RA 1ZVSB 3WO4C 3IBEA 3SDXB 3V4VL 5BMFH 5BV7B 3FHQA 3NN8A 4HKJB 3IAQA 3GSOB 2B1AL 4ONHA 5LXVA 2R1YB 3ZKXC 3BIBX 3J7HA 4YZFE 4Z0BH 2PUQT 1JDDA 2ITDB 3SKNA 5CD5C 3DOHA 4GG8B 3HVDA 4ODSL 1RJLB 3MCLL 5C9JA 1NC2B 5KSVB 1SN0A 4YWGL 3FQTA 1GYWA 5DK0A 3IRPX 5F3BB 1F3DJ 5FC9A 3L54A 1RHHB 3L3IA 4KNSA 1WGOA 2XN0A 3SKMB 2FBOJ 2J8HA 1JPGA 4FQHA 2ZOTA 1NKRA 2I60L 4YSOA 4M7ZB 1AP2A 2GIXA 2GJ6D 4OV5B 2TAAA 1N8OE 1RZGB 3MLTA 4RRPG 1A7PH 4TXVB 1PLGH 4WNSA 1RY7B 1G7JA 4N85A 4PJDF 4DEUA 3F65A 2ERJB 1JPST 3W9DA 3N5AA 4OFYA 4OZHA 1CMOA 4H8HA 4ICXA 4J3SA 4NAQA 3TWCL 1RK1B 3JV0A 4YE4L 4ZX3A 2CR3A 5L9DH 1J8HB 2WLIA 2D3VA 1QEWB 1WK0A 2B08A 4KTEL 4XPTL 3A21A 4NT6B 2VN7A 2OTUB 1SLXA 1I85A 2PO6A 4FZEL 3W3BA 1CE6B 3ATEA 2JQZA 4QXVA 1Q94A 5AOJA 2QV4A 4UILH 1JGEA 4G5AA 2MSPA 2R2EB 1FIGH 3UBXG 1FDLH 4OGAD 4BUGA 1I1AB 5ADOL 1VAHA 2PCPA 3TM6A 5IZ7A 1EHAA 3O3BB 3RWGB 4UBDD 3DGGB 2CJ3A 2BSTB 2P24A 4XE5B 1ASOA 5LAXB 2F8XC 1GGCL 3K4DA 1P4LB 2AANA 4MD0B 3H9SA 3GMQB 3IJ7A 4RETB 1FNFA 1J0ZA 1IGIL 5EDXA 1I4FB 4PSPA 4XE0A 2AJUL 3MCKB 2XFGB 1IE5A 2OJZL 4AYBA 3C6SA 1UM6H 2I32A 3NEEA 1NGZA 3BH4A 2Q2LA 2CBMA 3E3QE 4NQDA 1PDKA 4YPGA 3ZMEA 2XWBA 1IGFL 3U2SA 5ICYA 2OW6A 4LAQH 4Z77A 5F1NB 3QVAA 4OB5L 1R24A 4WW2C 4XRCB 1DQVA 1KG0B 1JNJA 3RWCB 4J3XA 4HX1B 4AUUA 1S5HA 4O4YL 2QFPA 3S3DB 4UANA 2XIDA 4YFDB 3HKFA 3LD8B 1KY6A 4PIRF 1KF9B 5FYLL 5C09D 2EYTB 3HTLX 2DQIH 4OZFA 5E1AA 5K9QG 1ZRUA 2GSIA 5D1QD 3MBEC 3H4FA 5C08A 43C9A 4H20H 3K1DA 4R96A 1MI5A 4D0CA 4ACTA 3AT9A 1NGXA 1KTDA 3ZHKA 1KPVB 3HE7C 3IDMA 3VU1A 2WSPA 2Z7ZA 1DSFH 4Y1TA 1E5AA 2WWMD 1GW0A 1JPTL 2ISDA 4EN3C 4LF3A 5KN5A 3B9DA 2OMWB 1SJHB 3KZ8A 2J1KA 4WV1B 4NNXB 3GQFA 4MA8L 5F7KC 5E95B 3C5ZA 2J12B 5GIRA 3LXBA 2RR3A 5F0JB 3IFLL 3BVTA 5IESL 3BPCB 3CHSA 1AD0B 3WIFA 1YMHB 1HEJC 3MXWH 3V6FA 5DQ9A 5AW3B 3KG5A 3IDMB 4R90L 4DEWA 4HK0A 4P9HC 4AUJA 1Q9WB 2Q8AH 5F8RC 2ZCKH 5AKTA 3VW3H 4XZUB 4YK4C 3V0WH 2OMWA 4V11A 2EINB 1WCBB 3IETA 4DCQB 3QS2A 4S1SH 3OG6B 3AZUA 2FQEA 5KSAA 1FNEA 4NO2A 1UYWL 1K4DA 4MVBC 1FQ9C 4LDLB 1B0GA 4G8EA 4EIBA 1NIDA 3FN9A 2VDLH 4FKKA 5F6IC 1BVKB 1B0RB 1EFQA 2D3LA 2IANE 2WQ8A 3D85D 1FL5B 3ENEA 1QSEB 2APWA 4L37B 3TYFB 3VMNA 4X9YA 1OTTC 1E3XA 5K9JL 3KPLA 3G5XA 4E9XA 1VCBC 1XIWB 2FYVA 4EMZA 4GIOA 1LDPL 4WFFD 3GIVB 1Q9LB 2OZ4L 5I6OA 2EDBA 3EHBB 4N2NA 2F9BT 3T0BA 5C0DB 3OAYK 1XMEB 4ZO9A 4ZUWA 1UJ3C 4F37F 1SXSA 4BE5A 3E1ZA 2AQ3A 3J2PA 4HIJB 2UYLA 1DQQB 5DC2A 4JM0A 1NCUA 4K55A 4OLYH 1QSEA 3VWKD 1EJ8A 2PPAA 3BP5A 4BZ1H 3WLBB 2LHAA 5JPNA 3VXNB 2A9NH 5GJTL 3ARGC 4RWHA 4PG9A 2XY1A 4MCMA 4D0BB 4J1UA 2YQGA 1WFJA 3JT2A 1BAGA 4KJPD 3WD5L 2QSTA 2QVFB 3KLSA 4F91B 1OAZH 3EYFA 1QEXA 1QKZH 4P2OB 3HLAB 4G11A 3CSFA 2JLLA 1UM4H 3S34L 5ECJE 1G7HA 2VDMB 4TSBL 4XC3L 3V6FB 1KENH 3NG5A 1AGDA 4CC4A 5I2IB 4A66A 4WKZA 4DVBB 4CSZA 2ZE0A 4ODWB 2BWQA 4P99A 4UM8B 3FO1A 1S3RA 1JZHA 1HNGA 5HPOA 2FD6L 4HCRH 4Y4FB 4X7CC 1MXGA 5D6CA 5LAPA 3VYPA 4O2CB 4PRDB 4FFVC 2YBRB 1KGYE 3O9WB 4PYGA 3TA3D 1BFSA 2R29L 2DYSB 2Y7OA 1HINH 4M6AA 3QQDB 5FUOH 2R2HB 2W94A 1BZ9B 3RU8L 2X3CA 3JV6A 3UJIL 2GY7B 5IJDC 2EVFA 3ZVVA 4J4PA 1T04A 2XV6B 3SDYH 4OCWL 3N40F 3SQOH 4NUGL 2FEJA 2FIKA 1D9KD 4F15C 1UCTA 4Z7WA 4V1DB 2DI9A 4QNPF 2YAMA 3S5LA 5DS8A 3WJJA 1WAAA 3I2CL 2GI7A 1UZ6E 1SOSA 3L7EB 4TLTA 3DV4A 1YC8A 1EBPA 2A9CA 2CA3A 4MJ5B 1EFXD 1U58A 2E6QA 2AJZA 3R1GH 3N3EA 1AGEB 1TG8A 4IMKA 2VZSA 3LQZB 2DKMA 3D34A 3N43B 4FQ1H 1GZQB 1TQTA 2IH9A 1B0IA 1UADC 1N19A 3S3CB 3RWEB 4GW5B 4L3EB 4L4TD 3VRLE 1BVZA 1ET5A 4LSDA 4NQDB 2PP7A 3NA9L 4UTCA 4I4WA 1URIA 3W56A 4HBQA 4QOKB 4HJIA 5IVNA 5IHBA 2NXYC 2OMUB 4L0PB 3T2QA 3HUJB 2H26A 3OJ2C 4QOKE 1MF2L 3RBGA 4NQDE 1DQJB 5EBLB 1MIEL 1JNHB 3QDMD 4L3EE 3MRCA 1JL8A 4RGOH 5IJKA 3CXDH 1BOGA 2CHXA 3DX2A 5DJ6A 1LO3L 3SBQA 4EE2A 1ED3B 3EDKA 3OLDA 2ICEA 3KYKH 1JGUL 1KXVC 4WKXA 1AZVA 3IVKB 2NR6A 1F6AB 5IG7A 3VFRA 3B9KD 3P77B 1PX4A 4XC3H 2VISA 4ADIA 3GUFA 1NIBA 1LK2A 1UURA 1OQXA 3BEWA 1NFAA 4FQJL 1PX8A 1B6UA 3P9LB 4HZAA 1OAZL 1UGNA 4FC3E 1GZPB 4EIUA 3IDYB 5KSBE 2HKFL 4IKJA 3U4BL 1A7RH 3ABLB 5F9OH 2EXWD 4J27A 5HDOA 4U1NA 3CZUB 4IBLT 1VENA 2LU4A 2NMSA 4K2UL 4PJBA 1MCSA 4XP5L 2GTZB 5CSZB 3BEVB 3LKOA 5ITFB 2WUBL 3KVQA 2G9HA 4O2FB 1JZ6A 1F11A 4R5TA 4Z7WF 4P4KA 3IKCA 3ZYIA 4S2SB 5F21B 3ASOB 4ALAC 3GXIA 4KKLD 4I3RL 4HJEA 3QIWC 4HUUA 3DI2B 1CGXA 1NDMA 1AHWB 1OAQH 1T22B 2P5EB 5A7EA 1AD9A 5E9DD 2QKIB 5IROD 1A1NB 4RMSA 1HJBC 4X6CB 3RX7A 1MNNA 2L4OA 5C0CA 4ZZFA 4E9QA 3T3MF 3C60C 4ZUTA 5JMOC 4KXZI 4OF6A 2H0PA 1S7WA 1TTBA 2HA1A 5I5RA 4HDIB 4LGPB 3MLSL 2MOQA 4ONHB 5T5FL 1MAML 3IJEB 1T03H 3TH2T 1BIIA 25C8L 5IY5B 2HJKB 5D55A 4ZMWA 2ARJQ 2B3IA 2WP3O 3SBWC 4HHGA 2F19H 1ZK9A 2Z0BA 3VGGA 2WUCH 2YGOA 5D2LB 4P2OC 4UM9A 5KSUA 5FW6A 3JWDL 1BQHB 1BQUA 3PWNB 4WW2F 2V7HB 1C5CL 2OMXB 4FQXA 1HHGB 2QTEA 3MV8E 4JG5A 3SO5A 2DOCA 1HE7A 1TXKA 1URLA 2VAAB 4GKZA 1TPXB 2WKOA 4HBCL 3QFJD 4QRUB 4P2RA 1SZNA 3FSOA 4ODHH 3EO9H 2DQGL 4P59L 1XR8B 3GMRB 2B77A 4M7LT 1UFGA 4N6RB 4NB7A 1ZCRA 4WUUA 2YLHA 2P8LA 4BH7A 1KBWA 4WNJA 5B1CA 5TDOB 4MXVF 1A02N 4OCSL 3T0EE 3EF4A 3IJYB 2YAOA 4OCRH 5TDNA 2FEDC 4WCYL 1F90H 5CUSH 4P49A 3QZPA 1BW8A 1N59A 1QRND 4BBWA 2OXHA 1GIGH 2DQHH 3C6LC 4C4KT 5EORL 1T0PB 3MUJA 3F84A 3WFDH 3Q44A 4KUCF 1B2WL 1OT2A 2J2ZB 4GRMB 1BAWA 3CN1A 4DGIL 3NSYA 2WMPA 3ARRA 1A5FL 1U8LB 1IBBA 4FYTA 4DGYL 4IKNA 1C08A 4JO3H 2EAEA 4JFFD 3G3LA 5DMYA 4R4NC 3LIZL 1MRCH 5BQ7A 1I7TA 4M29A 4Q89A 5SWQB 4MXQC 5AW5B 3LSOB 3NAAL 2UZYB 3D6GA 4ZFZA 1RHHA 4DJMA 3GUTA 1RLBA 3DJZA 2M1KA 3BGMB 1FN4A 4I0PD 1TMQA 1IGTB 2H1LM 2VMEA 2YQBA 3LKPA 1UASA 3NAAH 2X4PA 1HHIA 3NCCB 4LIQH 1UATA 5EWIL 5EZLB 3BLKA 3BWSA 3PGCB 4WDIA 1X7QB 3LS4H 4PRNB 1ZD6A 2JKSA 1NBZA 4TQIA 3U7WH 4IMLB 1IKFH 1BZ7A 3CVDA 3FL7A 3FN3A 4GMSH 4QI3A 3GB7A 4JFXB 1HDMB 2GTWB 2XQ0A 1LK2B 5ACLA 4QTIL 4GUQA 4HJGA 1P5UA 4N5UA 5DTFA 1HH9A 5E2VH 1CLOL 1GKEA 3HRPA 1DEDA 3L7FB 1P1ZA 3SB3A 4G80B 4W9LC 1JFQL 4IOIB 2NT0A 2E6PA 3TN0A 3SPHA 2OMXA 4FQXB 3WTWA 1J18A 1M9WA 2NY3D 3NESA 5J11C 2B4CH 4I87A 1ADWA 1KBBA 4APXB 4GQ9L 3WIHH 3CHRA 4LDOB 1GY1A 4P59H 3VXRA 1KYUA 2DLFL 1PD0A 1KBGH 1GMEA 3O6FA 4MMYB 2ROYA 1B3JA 4FZ8L 5E2TL 1PZ2A 4ZO6A 3RBSA 1MDAA 4DP5X 3P9WB 2HFFB 3X11A 1AYRA 1I9RL 4OD2B 3GMNA 3RFZC 2W9LA 5KN5B 1F0LA 1RUKH 2LU5A 3EOBB 1A14H 4FQ2L 5I9QB 1UVQB 2AJSH 2BPBA 3V9EA 2ZWZA 2GEEA 1WBXB 2IALB 3ZKQD 2JELL 2F15A 3QXWA 4X4ME 4NM8L 5GZOD 3BO8B 1DVFA 1N18A 4OZFB 2E0PA 3CFTA 4P9HH 3O4LD 4WVRA 4YDLC 3UZEA 3LZQA 4NCC2 1YEHL 4PJ8A 4I3GA 4EN3A 3VI3E 2BNRA 5FYJU 3L4WA 4EVNA 4FN0A 3T4AC 1QSFD 2EDFA 4D94A 2HKAA 4MJIE 1A6ZB 4H0IA 1YMMB 3RZCB 4KITB 1L0YA 4RNRB 3S37X 5CAYB 3S3JA 3LAFA 2P52A 4U3HA 5IW1B 4OF5A 3IRCA 2APSA 3QEQB 4ODSH 5H37A 3LH9A 2C26A 4OH2A 4MD5A 4EXPX 3QYNA 1KEGL 3ARWA 3LPFA 2J6EL 4Y2OB 2DMKA 4O02B 1U3HC 1CT8B 5FCUH 2CNZA 4F5CA 3UTOA 4ES9A 5DURB 1QTPA 4ODXB 5CWSA 4L5FE 2WXPA 4DZ8A 3TS8A 3IEAA 4G6FD 5BNXD 4EIZC 3OMZA 3MX0B 5B7EA 4OY9A 1U8IB 3FCSA 3U0PB 5IQ9B 4WENB 4KHTH 1BGXL 5K1NA 1MUJA 4N90E 2CALA 2CXGA 3MQIA 5E6IB 3WJJC 3CFBA 3BAJA 1TUPA 4HUXB 3LPGA 4Y9EA 5HDLA 3UDWC 5FPIA 1UC6A 1G1YA 1MCDA 4NFBA 1IM9B 5B21A 5HP5A 3VFVA 1C8QA 4G6KL 5HJ3A 3F7RA 4AOFA 4ZNCD 2X4UA 4R4ND 2X05A 4JFSA 3PL6B 3VRJA 4H8QA 4U49A 3I9AA 2Y5TA 1QO3B 3RI5F 5CJOL 3MYZA 4GKSA 1DCEA 1C5BH 3W1ZA 1CD9B 2XBDA 4LOUC 4WI0A 4GB9A 3SDXE 9CGTA 3AY4C 4FNQA 4XB7A 1IEAB 4ZFOA 3GSNH 4NO0A 5K9OA 4J6RH 3CFNA 2MQ0A 5I1CL 2DKUA 4P8QA 3LNHA 3TC9A 5B38A 3QZWG 2K4WA 3WFBL 1NINA 1KPRB 3SDCC 3PWPE 3T1FA 3VWJC 4XCFH 1KN2H 3TO4B 2H47C 3IMBA 3F7LA 2WB1A 5D1QC 1RIUH 3BCFA 1FJ1A 4MAYD 2DQEL 4CAGA 4N2CA 2Z6FA 3NCWA 4DP6X 1PY9A 1WT5A 1Z9MA 2LGNA 4FQQA 4TTDD 1XH3A 3VXSA 4AGOA 4R8WH 3K72A 2QMJA 3MLRL 3PP3K 1P9MA 1P6WA 1AXTH 5C6WH 1Z32X 4X6CA 1LD9A 1DE4A 3V0EA 4Y2NA 4HPYH 1CFNB 5EC2B 2YGNA 2C9PA 4RVBA 4XNAA 4M93B 2WBKA 1KEML 3CU7A 5KS9E 2E7LA 1SMAA 3SDYL 4RGNB 3SQOL 3T3ME 5EU3B 5IFHH 2XFXB 4AX3A 4U1GB 3Q6FA 4MQXD 4XAKE 4PWKA 3CPLB 5DS2A 5HYSB 3OPZL 3IGLA 4XBMA 3CVCA 1FZJA 4LSVH 2QQLL 2J1YA 3D0VB 2I26N 3CLEH 3REVB 2CZNA 2JB5H 4OLVH 2ZX8A 3W0WD 3WTVA 3P0VH 2VXUL 3SQBB 5BCAA 1NWOA 5JDJA 2XETA 1KLFB 3DUSB 3UTTE 4LPWA 2OSLB 4LCUA 2IH8A 4XMZA 4CMHB 3TFKD 1UEYA 2IWGA 3UJTH 2VDOB 1I1AD 3VXPB 4NQXB 2F5AL 5CHNA 3S34H 1XCQA 3D9AH 4JFDE 3NJKA 3LRLA 3IGAB 4ZD3H 5F93C 3BGFB 3TPKA 3ZQ9A 3MRCB 5AWNH 1P1ZB 2XVBA 2G3XA 5E2UL 2R9HC 1U3HD 5HDBE 1QR1A 1XXFC 4ZFFB 5D2NB 3JVGC 4QT5B 5CEZE 3B7YA 4YDLB 2WYZA 4BZ1L 2FATH 3BP6B 3D18A 1JUFB 4PD4J 4YHOL 2IOMA 2NCMA 2QHLA 4MWFA 2AQPA 3RZCC 4D0CB 5ICZB 1IT9H 1TEFA 4KUCD 1IC5H 1MCBA 1NDGA 1JNNH 1XH3B 4NHCL 4PY7A 2YAFA 5DD0H 5KSVA 2DL9A 2PTVA 2VMFA 3F2LA 5ISZE 5C0BB 1RLWA 4ZQTA 5L4FA 3DX7A 2X4TA 1T66D 1B9ZA 1PEZA 3ZE0B 4NPYB 3C08L 5EO0A 3RRQA 5IKCB 3N85H 4PRBB 3BP6A 3CLFL 2EDTA 4NYLA 4BCZA 1A6WL 4M56A 2NZIA 1T4KA 2HX9A 2BHZA 2G3MA 4C57C 1SMDA 1JE6A 1IMHC 1AD0A 3WIFB 1CXKA 4M8QA 3DDFA 3Q06A 4J3OF 5EU6D 3PE9A 2V5TA 4YHKL 1QI3A 3O6LL 3U0TB 1RVFL 4H0GA 1YEFH 2BNQD 2C7FA 5GGRY 3CHPA 4O9HL 4U6HB 3OXRA 2KDYA 4GBXD 4RAVB 5D6DA 4BK8A 2NY3C 1JGIA 2YEQA 4APXA 2VLKE 2ZJSH 4LVEA 5TF1H 3ZTCC 2EDDA 4O58L 2DMBA 2EYSB 4KDVA 5I76A 1L7IH 3IFLH 4W9CC 5JIPA 4KJQD 3QIWB 4JHWL 4PP1C 1WFMA 2VN4A 4DP4X 3D12B 2CH8A 1WG3A 4YHZH 1ZK5A 1HESA 2CBOA 4XAKD 4F9PC 2DIJA 3L4YA 4KX7A 4NRYA 2YRZA 3MA7B 5C6TH 4TV3A 5HYIA 3U0PA 4OAWB 1BQHA 3RGVA 3EFOA 5DZOA 3WE6A 4PJHA 4JQVA 2CDGB 4KU1A 3BFWA 3GLZA 3RP1A 3CNKA 1UTDA 3L3IB 1E4KA 1RL1A 1IZKA 1U91B 3M88A 2FDBP 4JZOA 5DZJA 4ZW6A 4H20L 1HC1A 1RURH 4XN2A 2KI6A 5EEUA 4ONGL 2BHUA 1IQWL 2Z31C 3JWNC 4HH9B 1EDHA 1OKEA 1CXHA 4HAFA 3OWRA 2RFXB 3P4MA 2CIIB 2Z3FA 4W93A 4RNRA 1E4XI 3CBKB 2E4FA 2Z31A 4X4YA 4FP8H 1DQTA 2HFEB 5D96C 2EC9U 4X6EA 5GGVY 5ICXA 2CBQA 3VG0L 1V05A 2R0KL 5IB4A 1ZANL 5F9JB 3QXVA 2OFQA 3R8QA 1JF1A 1SQ2N 1E67A 1LLAA 4GMTH 4P5TB 1A4CA 2GJZA 5L2KE 1ID5I 1D3CA 1G7PB 3HNSH 4U31A 2WIMA 5I1JH 4ZK8A 4EJ1C 2G2PA 3IBOA 3MV7D 2BZCA 3NRPA 3ZIYA 2AJUH 4KVNH 3U36B 3FZUD 2R2EA 2JKNA 1YZZA 1KJ2B 4N25A 4F9PA 2VDOL 4CADB 3D69A 5I8OL 3U6RA 3MJ8B 3HJEA 4OM0H 3VXUA 2EVHA 1DBMH 2K3HA 2WCGA 3ESMA 4JQIA 4KMQA 3KAAA 4ETQB 3QIBC 4LLVB 4M4RA 3THML 5DC4B 3MRBA 4YVUA 5ADOH 5T1KA 1MFVA 5FYKE 1I3GL 1CBVH 2EXYC 1RJZB 3Q7JA 1R5WA 4JANA 4TVSa 4XP9H 1T3FA 2K7PA 2EVJA 4W4OC 4PJXE 2NY0D 4NQCA 5C0GB 4Z3FA 4HZLA 1W0VB 4Z7IA 4ZFGL 4R4BB 3CPLA 5D7EA 5A2JH 5DQDL 3VYNA 1G87A 4CN1A 3QEGH 4OZ4A 5KYUA 4CGTA 3MI6A 4GH7B 5EV7A 3DURA 3VRIB 4ZYKA 5CILH 4A6YB 1W80A 5C0AB 3QORD 5D9SA 1JWUB 3C5JA 2J88H 4YE4H 1IU1A 3C6LD 3TWCH 3FTZA 1T6VN 3MV01 3QUYA 4PJFF 4OD1H 4KUZH 2CCWA 4JDTL 2YRPA 3B7UX 4KNTA 5B1JA 3BDBA 5HI3C 3T4YB 4S1RL 4D3CL 1I82A 1THAA 2XWDA 2E3VA 5DZNA 3JWNE 4IM8A 1S7RA 2ESVD 2UX6A 3FQRA 4P23B 3VXME 3D4ZA 5JHLH 2ADJA 4NOFA 1G9ML 1OOWA 2ESVB 4E5XA 3EBIA 2NYYD 5JNYA 4BKLB 1FN4B 4YDVA 4IMKC 1KB5L 2PMZA 5I6XB 1A9EB 4M61A 1VZIA 4HAGA 4Y5YC 4P2RE 4YWGH 3WFHB 5L6YL 3MZGB 1L6XA 3MCLH 2G9KA 4AQ1B 1G9NL 3MRKA 3IXTB 3MV9A 3SGKC 1VACA 5LNDA 3QIBD 1WZMA 2BCKA 2R2HA 1H3PH 5KYWB 1EZVX 2ATKA 3QYCA 3C6SB 4OI8A 1S7RB 1USQA 3FQRB 4P23A 5GZNA 2V7NB 3BE1L 3V4PH 5EO1A 4BINA 4NLHA 1SLUA 2YEZA 2ZX7A 3KLKA 2F1BA 3ZE2B 1EJOH 4HEMA 4F2MB 4WI6A 1AQ8A 3CFCH 2VXQH 3P3TA 1IFGA 4JCWA 3CHQA 1WHOA 1X5ZA 1KBVA 4OGYH 1IGMH 2YPKA 3D7PA 5ISZA 1SDAB 1X7TA 3D06A 3HS0A 4PGEA 2WO4A 4OIAA 3B7RL 4Z7UB 4K15A 3QIWD 4RDQF 5DYOB 3D07A 2VJ0A 2N4IA 1WIPA 1HS6A 3LN9A 3PAZA 2E8YA 3FUEA 1YJDL 2CGRH 4DP0X 2WWKO 1VESA 5DJ0B 1BIHA 2BC4A 4IOSA 5INCA 5DMKA 3RKDC 4FXKB 1KGXA 4PB9H 3Q1SL 1M6UA 4B9JA 3HG1E 1T7VA 2OXGA 1DQQA 5FYKD 1P84J 5DF0A 4XB8A 3PLYA 3LN4A 4H44C 2GKIA 2FEEL 4HT1L 7PCYA 3D39E 1ILSA 4NOBA 1A47A 1NEZB 5C0JA 3LS5H 3HZKB 1MPAL 1MQ8A 5F7DB 1YEGL 4YSRA 1FVEB 3QDGB 2W91A 2DEXX 3FTGA 3S37L 3ZDXF 1INQB 4WTWA 1S5HB 1X5FA 4AVJA 2BRRH 1XEUA 3GSNA 1T0MA 3WY2A 4RZCB 4DK6A 3VD9A 1TZGL 1VSCA 4PJDB 4HT1H 2OULB 3N44B 2ZOKA 3OSKA 1GC1L 5E0QA 3FRPA 4AK2A 1I7ZA 3V4VB 1T1ZA 4MS6A 5EDSA 3I9GL 4WFEE 1JTOA 1IFRA 2HP4A 4UOQA 1ZHNB 1HAUA 3HUJF 5G5DB 1S7XB 3P73B 3QR2A 5IHWA 3FO1B 2Q2EB 4ZYKB 1C5DB 4DPAX 5BW7C 3AREA 1I8MB 4LVOB 3GMQA 4G7RB 2OYPA 4OKVA 3TJHC 1GC1H 1HWGB 1BFTA 2DQJH 5CEZH 1OW0A 1P6FA 1T83C 2FO8A 2GUOB 3MAWA 4AYSA 5GS0L 5D4HA 3BT2H 3DVFA 5E70A 1RZJH 1SXZA 4HEPA 1SEQH 2YPKB 4EUPB 1PD6A 3ARDC 1GJWA 5B7MA 3MXVL 1AR1D 1NH6A 4M7ZC 3EKCA 3VACA 1KIUA 3DO4A 3U7AA 3PPSA 1U2CA 2BNUB 3ESOA 2V5YA 4XO8A 3T3PE 2ERJC 3K2MC 1U93A 1XBDA 2FB4L 2NNFA 2HVJB 3DRTA 4J3OC 1LL1A 2X0UA 3CFCL 2VE6B 2X3BA 3VMPA 4S0HA 4GW4B 3ZTDC 1A3LH 4FTVA 4OFVA 1SY6L 1FUNA 2RCSL 2V7HA 3QIUB 1N10A 1INEL 2FX7L 5BO0D 1A2YB 1TKWB 5C0BD 1Q0XH 3HE6A 1HHIB 5EZLA 4DIXA 4POUB 4U1GC 4KVPA 3MV9B 3G5VA 5IF0A 5D70H 4QRPD 3WFCL 3MLVL 5CNHA 1AIZA 3CK0H 4JKPL 2E56A 4GOSA 1KT2B 2NUPB 3C60D 3M7FB 4GQPH 2YPLA 3KDMA 5F7DA 1I8IA 1I1YA 3M07A 3HZ3A 1AHWA 1T22A 1INQA 4U3XA 4TVPD 4WGVB 4JREB 2XQYA 4ZUSB 3QRFM 2FLMA 5EH1A 3OAZH 2NLJB 2VDRB 4ELMB 2V37A 2WZ0A 3GYRA 4YUEL 5LXGH 3HI1B 4XCCL 1HEHC 2Z8SA 5FA3A 2QBWA 2AEOA 2OXHB 1AZUA 3QDME 1G9MH 4HYTB 1BBJA 1HXMB 3ESPA 4CMHC 1N6UA 2CCVA 3KGTA 4PGZA 4XH2A 4MXWL 5GISL 1O6SB 3H7LA 3BGFC 2EIKB 3GMOB 4P2YA 2XWXA 1UZGA 4Y5XA 5IOPB 4JKWA 4ODUB 5D1XB 1JZEA 3P54A 3ME0A 2UY6A 2NSMA 3QK0A 5KJ7E 3KPRB 4RMRA 4DQOL 3TVMC 1T2QH 3P3YA 2XWTA 1ORQA 3VXSE 4K8RH 1Q94B 5J3HD 2ZUWA 3P4NB 5EUOF 1AFVL 3TO2B 4ELKB 4AI7A 5EOCL 3JVGA 1S9YA 1CBVL 2YUXA 4ZAKD 2PWDA 3BZDA 1ZTXL 3DURB 4LVNC 1UKTA 2IAMA 3ISYA 5F88A 3NJLA 2ZUQB 3NIGB 2DTML 3STZB 2IDFA 4I2XA 3TT1H 1FLTX 4LCWA 3EJJX 5EO9B 3PNWA 1ZXKA 1GSKA 4WO4D 3T3PF 1EFXB 1YEKH 3PYCA 4XMWA 4KZ0A 5FF6B 2QMKA 1RZGA 4FHKA 4KXAA 1BQRA 1DEEB 3R4DA 2FTAA 4JFYA 3PP3H 5EU4A 2Z8WC 1D9KB 1GGBH 2D7MA 3QEGL 5DQDH 1ZANH 4FFYA 2R0KH 2GI0A 3T2OA 4FG2A 4M61B 2WZ5A 3PXJA 4N2IA 3QUGA 5GS1A 2ZG3A 1KB5B 4ZSOB 1U21A 3T6WA 5I0WA 1LEGB 1U3ZA 2AJZB 1ONQB 4LRIA 4GRWB 1YMMD 4NFCA 4TNVK 3MR9A 4GUOA 1RUQH 4HJTA 1QTSA 1WFNA 3SSGA 3QUXC 4GKNB 4I0CC 1LO4L 5AFAA 4PJCB 2F6AA 1P7BA 3AM8C 4Y2DC 4MMXB 1G5GA 3GI8H 4APQD 2ORBL 3GHBL 2CM5A 1ZVYA 1MNUL 2VDOH 5I8OH 4L4VE 2BLFA 4HQQL 1KGCE 3CZJA 4FXGC 4TNVF 1MNUH 1IM9D 1J0JA 4HJ1A 3O3UN 4N0FA 4K94C 4OGZA 4C56B 3ZY7A 3QORB 2X6CA 1JZJA 4IS6B 4QJ3B 4RMBA 4F7PA 1NC4A 1ZTXH 5AW7B 5E6ID 5J1AB 4MMZA 2VUOA 2C1PB 2AZUA 4JHWH 3IDGA 5AVQB 4YE0A 3EOTL 4NZ8A 4PP1D 3TV3H 3U6XS 2IH1A 1W6LA 3P4NA 4J5VA 4GXVL 4PCSA 4PM1A 4Z78A 1PL3A 4Z7WE 2FQGA 3HMXA 3OC8A 1CUOA 2Q9OA 1LMKA 2A4CA 3BUYB 2B1HL 4W1TA 1MWOA 3LQMA 3NCEB 4OBSA 4OUUB 5I17A 1E5YA 1FNHA 3H54A 3AROA 3UBFA 2Z7YA 1ASPA 4R5XA 4RCAA 2XVGA 1RURL 2PCFB 5IMLB 4C56A 3EFDH 1GZQA 2YD1A 3P2TA 4NKQB 3NCXA 1EK3A 1RI8A 2VIRB 4DAGL 4N0UA 2RAMA 5CJQL 5F7HA 1NCHA 1KDIA 5D7LA 3CLFH 2JIXD 1F45A 1KCSH 2JB6B 3GLDA 3IF1A 3QQ3B 4EUPG 4Y16A 3ZDXB 1BZ7B 2Q3XA 3ZKND 1WH0A 4QOKA 5T3XE 4YUEH 1K2DA 5CIPB 1SEBB 4LESA 1GMIA 2Q0ZX 4B9KC 4G3YH 1A3ZA 5KG9B 4Z8FH 3MR9B 3RB5A 2Z93A 4I0PB 4QRAA 3RVXD 3UO1L 1ZGLM 4M7JH 4ANXA 3NACH 3UTSB 2V5SA 2AGJL 1QWUA 1KXVA 1OTTD 4HS3A 4N9GA 1YPZA 5HGDA 4ZXBA 2HT3D 2JV6A 4B5ZA 2ZSWB 4MDIB 2K3TA 3TO4A 3IF1B 4UTBL 1DBAH 1UD4A 1VEMA 2BMKA 1E8YA 5HHOB 1W9XA 1D5MA 4N1EA 4N0UE 4R6UA 3ZDZB 4AV5A 2UWEB 2VLMD 5IVZA 3D08A 4MXWH 5GISH 5F7NC 3VXTB 1A6WH 3ZHDA 3RAJL 2P5PA 4Q9QH 3WTXA 4NP9A 5JHDA 1JWUA 4LCCC 4KTDL 2K45A 2BZ7A 2MEJB 1YNTA 4OLZL 5LBSL 2XTJD 2CO7A 4QT5A 3GHEH 4PWGA 1A4KA 3GMRA 1SYSA 2NY4B 3TEWA 5CLYA 4X98B 2DI8A 1E3FA 5D5MA 3RWIB 2Y23A 3SGDH 4XGZA 4F7MB 2DL2A 1J0YA 4X6FA 2FRGP 3APDA 5KVEH 3S0PA 5TTRA 3DO3A 2BSEA 5AAMA 3I75A 2IBZY 5D70L 1M7DA 3D2UB 3GBML 4K4KA 5E4EB 3QNZA 4I88A 1N0XL 2HKHL 4AIOA 2ARWA 4AQ1A 1L7TH 4PJIF 4RGMB 1NFIB 4JY5H 2RCSH 1F3DH 4PBWD 5EIIB 4P48A 3RWFB 5CCJA 5E6YA 5LWYL 2NDGA 4FL4C 3T65B 1D5XA 3QPKA 3NT0A 3IGKA 4N8PA 3POHA 1A1OB 2NY1D 4RQQA 3FW6A 3UPRA 3C5SB 3K2UH 4QAWA 4BUQA 1BPVA 1MFCH 2ZAIA 3BPNB 2NLJA 3OLEA 5DRWB 2F0CA 2BXYA 4PJIB 3EH1A 3MBXL 1YEGH 1MHHA 5C6PB 1UB6B 4PJXF 1BVLB 2GITB 5CD3A 2P5ED 1CFVH 3H8NA 4XNZB 3MNWA 4HLZH 3STLA 4I9WE 2YD4A 4N90D 3OQ3B 4Y1AA 2IPTH 3MO1A 1TENA 2I9LB 1WZAA 4IRSB 4XCFL 3X1GA 1HHJA 3BXNA 4XMPH 3KPQA 3X2QB 3QR1A 4WSKA 4N8CH 3CFJA 1KLGB 5LAXA 4X99A 3I9GH 3T6XA 1JD9A 1M05A 3VRJB 4M1CD 4JCLA 1E4WL 5SWSD 3HCVB 2EVIA 4UBDC 4LP5A 4PP2B 3D87B 1NCDH 1U33A 1M56B 2QKIC 1SHMA 4URTB 5I28A 1TZGH 3SJVE 1M7UA 2E7MA 2G5BA 1EXUA 2J43A 1AE6L 5ENWA 5GPRA 3M1CA 1G43A 1R3JA 3WTSA 3Q43A 4D7BA 1XV8A 4LNRA 5L7XH 3HBGA 4ZMOA 2RQEA 3AVEA 1M2VB 2L7JA 5FGSA 1FBIL 5EUOA 3ULUC 4BSWA 2NY6D 4YSPA 4PCTA 4XPHH 2XRAL 1TFHA 4LOFA 3TBVA 1D6VH 3FTWA 2VXQL 3SGEI 5JIMA 1KN2L 1AKJB 1MH5B 3EDEA 3SDAC 4P2QD 4KHXH 2YAQA 1RZJC 4A2HA 4CDGC 3G04A 3INOA 3QZMA 1UZ8B 2G5RA 3HRZC 3NMEA 2P80D 4LOUD 1QFHA 1YPZB 1IV8A 4NKOB 5DVNA 4EI0A 3BRGC 2OCJA 3ASNB 3IT8D 4MRCA 2IF7A 2FJGA 4KKCC 3ARPA 4WDIB 3HZMB 3S8GB 4QOKD 2OMUA 3UG5A 4Y16D 3RUGE 4YJZL 3SJVA 1PKQB 4L4VA 2JIXA 3PDOA 5DA0B 3A4DA 5D7LD 2YPVL 1FH2A 4KQ0A 3UAJC 3EBHA 4CVZA 5CCKH 2M8XA 4HUNB 1ONQA 5L6YH 1OVZA 1FZOA 3RURA 3RWJA 3WNLA 1NTDA 3GSNB 3OKOB 2V3EA 1G6VK 2Z91B 4C56D 4DT2A 1QASA 1ZT1B 4PRID 3ZXAC 1IGYB 2MTPA 3TA4D 1IAIH 3OGOE 4F37K 5C0RL 1QW9A 1M3IA 1PU0A 3T1FB 5H4YA 1KT2A 4Q8BA 4PVMA 4PJGE 4I18A 3NA4A 1EJOL 2A1WL 2ZPKH 2BP0B 5FLVA 5I1AB 3N42F 3BDYH 3Q8FA 3BQUB 3Q2VA 5I74B 5T1JA 3SKJH 4UNVA 2CXKA 3EXJA 4QKTA 3V4PL 3MODH 4I9XA 1I8LA 4HW6A 1EEUA 4Q2ZA 4QRRE 3WENA 4BWTA 3C5XA 1F4WH 4PJ9B 3EYQC 5FDYA 3KBPA 4L1HA 2AQ1A 4D9QD 2JQAA 2YHGA 4ZPTB 1BM3H 5CGTA 2EEAA 1PKQE 1RZFH 4W6YB 5EOQH 1CGSL 4KV5E 4XN7A 1IM9A 4LLDB 4ANUA 3RTLA 1AVAA 1KIUB 3LZNA 4HU8A 2O5XL 4JY6A 3QZWA 4OM1H 4FA7B 4LNRB 1Z0NA 1T7WA 3R8BB 3D0LA 2J25A 1KZQA 3BVNB 3OXSA 4L1TA 2VDKH 4LSTH 3N0PB 3QUHA 4NI3A 2YA1A 5MEPA 1YEJH 3KYOB 5D7JC 3VFUB 4AV0A 5HDQL 4Z0XB 1ETZB 1AXIB 2VCOA 2AXFB 5DUML 3H6JA 4Y4HB 3NIFB 1KCVH 4S0SD 8CGTA 1FFNA 2WLYA 2PR9A 3DX7B 4HHWA 2XV3A 3RKDD 4HKZA 1A0QH 2WKOF 2J88L 4OIBA 2Z1KA 3IJEA 2YZ8A 1E5CA 4DPBX 4O02A 5DO2D 4OIIH 5CILL 3BKMH 4K9JA 3L9YA 4Y8AA 3QE5A 4BUHA 1CD1A 3SJVB 4KRPD 3WFEH 1OSPH 5DJXB 2IPUG 4YBQC 1JZDC 3MV8A 3H3PL 1U58B 4WO4A 1ZPLA 4JFDA 4H13C 1MRCL 5A2LH 3J07A 1KIPB 3EYOA 3VQLA 4OTXL 5TGBA 4DGYH 5IEKA 5AZEL 3T0EC 2X2HA 2OMVA 1U8CA 4NQED 4E41B 1VGEH 2IAMD 3CZKA 4A04A 1U6AL 3TX4A 3VFTB 5E2VL 4ZAKA 5KS9F 5IBLD 4ZS6D 2ZXQA 4JZJA 1L5GA 3T0EA 5SWSE 4MWFB 3I74A 3RTQD 4XN4A 2CRZA 2D4DA 2WCSA 1IKFL 1LO5A 3T77A 1GGIH 2NY2D 1MRFL 4L8BB 4O2CA 5DJAA 5EPMA 1IEAA 1JWMB 2AFNA 2V4LA 4OCSH 3VGDA 1SM3L 1WUZA 4WHYG 4OJFH 3IGFA 1JZ3A 4IDJH 3CX5K 4YHZL 3VFMA 1TYJA 2MH4A 5T3ZL 4GLRH 5IG7B 4CU8A 4PJBF 43CAB 4FA6A 1EEZA 2J1XA 2CD0A 4JB9H 5PAZA 4A2EA 1ACXA 2ZXGA 1X5KA 2OMNA 2RGSA 5GRVK 5FW7A 4ODBD 2AS5M 5T5NF 2VM4A 4HBCH 1XHHA 1F58L 4U7KA 4X7EC 1WHPA 4HAKA 5HGAB 2A6IA 5I15L 4JO3L 1HKLH 3NSCA 4LRIC 2DWTA 3FQXB 2HRPH 1OP3K 4J3BA 3TBTB 3DROA 5C07A 3GSQB 5LG1A 1AO7B 2DI7A 1P4IH 3ARFA 5TE6L 2XZAL 3QIUD 4AG4H 4WV1A 4I89A 4ZQKB 3S3SA 4K3DL 3WEXB 4KJWD 4S1DD 4AH2A 1MAMH 5CUSL 4I4WB 1EAPA 2JKWA 4IU3B 5DR5H 1HX0A 1DTUA 1N9PA 2B0SL 3QUKB 4LLAA 2A7BA 3L3JB 1J9RA 3BIKA 1TCRB 3ARQA 4N2GA 3UTPE 3F5WA 2P5WA 4AJWA 4WHTB 4NUJB 3Q0HA 3VSVA 3O2VH 1MG3C 2WXLA 3BKJH 4TUOA 3KJ4C 1BQLH 1QSVA 3HG2A 5C0BA 1F1DA 4GAYA 1A6VL 2YO3A 4URKA 1HJCA 3Q8AA 1JNNL 4NHCH 1H6EA 4IRJD 2BVYA 5FO8B 4ES8A 1RMFL 3BH9A 3MA9H 4NO0B 1OK8A 1I31A 3QJXA 2C8NA 2ZOUA 2EIJB 1ULVA 2Y7SA 3BVXA 3PGFL 4LHUA 4GSRA 1BWMA 2VB5A 3HFFA 4YHOH 2WGNB 2X70B 4RGMC 4R3SA 1OAUH 3DARA 3VWJB 1B0RA 1DN0A 4YFLI 2CIKB 1WA1X 2F19L 4JGUA 1K5WA 2E7DA 3UTSE 3ZHLA 4MAUH 1TVHB 5GGTH 4GRLD 4AGNA 2Y5QA 5T5FH 3WAJA 1T03L 3PDDA 3Q2WA 4XPBL 5J0BA 4PB0L 4IKKA 1FNEB 4TLKA