3CVBA

Regulation of protein function: crystal packing interfaces and conformational dimerization
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
ETFTVKMGADSGLFQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of protein function: crystal packing interfaces and conformational dimerization.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transport
molecule keywords Plastocyanin
total genus 23
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3cvbA00
2H5UA 2FTAA 2J55A 1NDTA 1HAUA 4KO6A 5AZUA 3UAEA 4E9WA 3KW7A 3FYIB 1J5CA 1I53A 2XX0A 1PNCA 3UACA 2GSMB 1RCYA 4F2FA 2EIKB 4BDVA 3NJNA 1R1CA 1SF5A 4N8UA 2XXFA 2YAMA 3HEIB 4GP8B 1AZCA 1CYWA 2VW6A 5AFAA 3PAVA 3JTBA 1GY1A 1GY2A 3WG7B 1BYOA 2FNWA 2GB2A 4YSPA 2EILB 4P5SA 5TK2A 2GI0A 5B7EA 8PAZA 7PAZA 3JT2A 1BXVA 2GHZA 3NT0A 2IWEA 4E9TA 1OCRB 3AW5A 1JXGA 5B1KA 3GXUB 3X1EA 4FAAB 4A2GA 1GW0A 3ZIYA 3PPSA 2PPEA 3FT0A 4TXVB 1OCCB 5I6NA 3ABKB 4W1TA 1SFHA 5B1BB 1YLBB 1NTDA 4DPCX 2FT6A 2N0MA 1QLEB 2PP8A 1XB3A 4L0PB 1FWXA 3DTUB 3NJFA 3FYEB 1PAZA 4G7QB 4YSQA 4P5RA 1W6LA 1XMEB 4G71B 6PCYA 1AS7A 3CVCA 2A3TA 3T6ZA 3CDZA 2DYRB 3IE9A 2I7SA 3NSDA 1N70A 2DY2A 1W8EA 2FQDA 3PCYA 1T5KA 2CALA 2VN3A 4HALA 1A3ZA 4DPAX 4E9VA 2XX1A 1V10A 1BYPA 2ZONA 2H47C 1IC0A 3S3DB 4YSSA 2BP0A 4A66A 5I5IA 1L9RA 5E9NA 1AZUA 3IBOA 1HAWA 5F7BA 4GYBA 4JKNA 3N55A 2GIMA 4FA7B 2XV0A 4N4YB 4A68A 2PLTA 3QPKA 3FSAA 1JERA 3C75A 1AG0A 5A7EA 2WO3B 4YSTA 1CURA 1KDIA 4AKOA 4NB7A 3U25A 4DPBX 3NJMA 2VMJA 1OCOB 3WKQA 1SJMA 2B3IA 3IN2A 1AZRA 1JZGA 3T6XA 1NICA 3AY2A 1DYZA 3ERXA 4DP9X 1BQRA 2PCFA 1ZV2A 1JZJA 1E67A 5B3SB 3CDZB 2P80D 4CSPA 1KDJA 2HRHA 3PXLA 1NZRA 3GYRA 1SF3A 1NINA 2BWIA 3OM3B 2YAPA 3TASA 1PF3A 2VM4A 3EH3B 1OF0A 2H3XC 2IH9A 4G7SB 3QQXA 3SBRA 4UAHA 5B1JC 2QDWA 2Q5BA 2BP8B 4BXSV 1GYCA 4HIPA 7PCYA 4BDVB 3FPYA 2YQBA 2ZWNA 3QJTB 2LLNA 1PLBA 1WA2X 2BW4A 2XXGA 3ZDWA 4KO5A 3WNJA 1UATA 4HCFA 5I5MA 1M9WA 1PY0A 3FS9A 2XUWA 3GDCA 3TU6A 4YSCA 1KCWA 3FQ2A 2DWTA 1NPJA 5B7MA 3X1BA 1MZYA 4W9ZA 2GC4C 1MDAA 2FQGA 4KNSA 4NAJA 2HRGA 3FU7B 4DP7X 2YXWA 5I6KA 3RYMA 3OMIB 4KOBA 1AOZA 4YSDA 4BWTA 4HCIA 4E9SA 3ASOB 1WS7A 1RZQA 1FA4A 4GY4A 1OCZB 1ZPUA 4KO7A 4ENZA 2DYSB 2OCCB 2GC7C 2AVFA 3AG1B 1AR1B 5PAZA 3NJIA 1JZIA 1A4CA 4DP1X 3H56A 3MX0B 2OV0A 4WKXA 1QNIA 1KCBA 1WA1X 1M57B 1L9PA 2XYBA 1PNDA 1OE1A 4HAKA 4QKTA 5I5JA 2XLLA 2FJSA 2UX6A 3PAZA 5D4HA 2BP8A 3DKHA 2FT8A 1A4BA 3S3CB 5I6PA 1PLAA 4JHVA 3T6WA 1AACA 3MBWB 3ZX1A 2QT6A 2IAAC 1URIA 1J9QA 2XV3A 1A8ZA 1XB8A 2RACA 1EZLA 3SBPA 2PCYA 2ZOOA 4Q8BA 4KO9A 3TA4D 4CSZA 1J9SA 1SDDA 3OQRA 4Q89A 3UAAA 2CUAA 3FU7A 1ET5A 3ABLB 3WNIA 2EIMB 2J56A 1N68A 1L9SA 3FPXA 3NP3A 2R7EA 2W8CA 4YVUA 3V9CA 2FWLB 4AKPA 3AG2B 4A2FA 3NJGA 1NIBA 2IWFA 5I6OA 1CUOA 2FQFA 2IDUA 3QJQB 2QDVA 2WO2B 4DP4X 2YXVA 1SHWA 5I6LA 3WIAA 5I6MA 4X4KA 2MTAA 3ASNB 3NYKA 1J5DA 3CVDA 1ILUA 2CJ3A 3X1GA 4QLWA 3EH4B 1SNRA 2IDQA 3H4FA 2IDFA 3OMNB 1IBZA 1ILSA 1ET8A 2VW7A 2ZXWB 2CBPA 5B7FA 1SHXA 1BEXA 3AG3B 3FSWA 2YAFA 4DP8X 4UF7C 2TSAA 5D4JA 2JKWA 2QPDB 1RZPA 2UXGA 1WS8A 5D4IA 1MG2C 3CZUB 1HFUA 1SDDB 3QJSB 1E30A 4GP4B 1B3IA 1ADWA 3N2JA 1X9RA 1E5YA 2J5WA 2W88A 1BXUA 1JVLA 2R7EB 2BW5A 4BWWA 3BQVA 5IY5B 1V54B 2Q9OA 2X87A 3IN0A 1JZEA 4E9YA 1NIEA 3V9EA 5I26A 4BXVA 4MFHA 1PLCA 1BQKA 1NWOA 2AZAA 1J9TA 1PMYA 3ABGA 1JZFA 1NIDA 2MRYA 2EINB 2PPFA 1NWPA 3TBBA 3S8FB 2XVBA 4BWUA 3X1FA 3UGEA 4YSRA 3HB3B 1PCSA 4HZ1A 1ZIAA 4AKQA 2AANA 4G7RB 4A2HA 3ABMB 2IH8A 4BK5C 2YAOA 4GXFA 2BO0A 3T9WA 1TEGA 2UXVA 1CC3A 1ZDQA 1L9OA 3CG8A 2I7OA 2XWZA 1AANA 2YAQA 1QHQA 4KNUA 4E9QA 4RH4A 4A67A 1ZIBA 4DP0X 4HCGA 2JXMA 1JOIA 1E65A 3FQ1A 1ET7A 3OMAB 2PP7A 2B08A 4K9JA 4DP5X 1GSKA 1A65A 1OV8A 5LDUA 1VLXA 2VSMB 4NERA 1PZBA 1X9UA 3NJKA 1ETJA 3X1NA 1OE3A 2AZUA 1IBYA 3FSVA 1AAJA 2BZCA 5AKRA 1CYXA 1BQ5A 1TU2A 2DV6A 2I85A 2PPAA 3NSFA 4YSUA 2YAHA 5ANHA 2YARA 3G5WA 3NSYA 4F7KA 2BZ7A 5TK4A 1JVOA 2BWDA 1ASPA 3EF4A 6PAZA 3WI9A 3OD3A 4PCYA 2BP0B 3TBCA 2HX8A 4YL4A 2QPEB 1GS7A 1L9TA 3EH5B 3PLYA 1TEFA 3FU8A 4A2DA 1V55B 5B1AB 1OE2A 1AQ8A 1KGYE 1ASQA 2NRDA 3EHBB 9PCYA 3QJUB 2VW4A 4AI7A 1DZ0A 1AG6A 1AZBA 1XB6A 4E9RA 2FQEA 1NIAA 1PZCA 5F7AA 2HZHA 2CCWA 1AIZA 1EHKB 1F56A 3BVDB 2XV2A 1JZHA 4G70B 3NJHA 2UXTA 2WSDA 2X88A 1KYAA 3WKPA 1JXDA 1KBVA 3NJLA 3CVBA 2YAEA 4GP5B 2UXFA 3AG4B 2EIJB 3UABA 3QJRB 5FC9A 4KNTA 1BXAA 2P80A 4ZK8A 3IEAA 3D12B 2TSBA 1AS8A 3DIVA 1MZZA 3FU9A 1IKOP 1GR7A 1AZNA 1JXFA 4JHUA 4M3HA 3NSCA 3ZBMA 1BAWA 2IWKA 2Y69B 4KOCA 1FFTB 2DWSA 1NIFA 4F2EA 3FSZA 3FQYA 1IUZA 2HX7A 2PPDA 4DP6X 2HLEB 2XU9A 4YSOA 2VSKB 2IDTA 3NJJA 1WA0X 3X2QB 5EHFA 1ZDSA 4WTQA 4DP2X 1PZAA 4YVNA 3S8GB 2FT7A 1E5ZA 4HHGA 4M4RB 1OOWA 3QJVB 1M56B 1ASOA 2BHFA 1MG3C 4UANA 4AZUA 1L9QA 1NPNA 3PAUA 3UADA 3L45A 4A2EA 2OJ1A 3SBQA 1KV7A 3H4HA 4YSAA 3S3BB 1GS8A 5B1JA 1TKWA 1A4AA 2VM3A 4AX3A 3T6VA 1WAEA 2HXAA 3NP4A 2UX7A 3KW8A 3SQRA 1SFDA 2GBAA 4G72B 4PAZA 1KBWA 1RKRA 4HHWA 3AZUA 5PCYA 2AFNA 2CAKA 2J57A 2E86A 4YSEA 1GS6X 1J9RA 5I28A 2HX9A 1W6WA 1AS6A 4E9XA 2PP9A 4EF3A 2IDSA 3T71A 1ID2A 2PPCA 2JFCA 2Y1AA
chains in the Genus database with same CATH superfamily
1JNNL 1I3UA 1U58A 2KQMA 4LSUH 1TO4A 3HI1B 2YBRB 2GTZA 2RCSH 3UBHA 1YECH 2DDQH 3QEHB 1BD2E 1OKEA 3DTDA 5K9QI 2OFQA 4X9HA 4YHKL 1N5YH 2PXYB 3CN2A 2WWNA 3ET9F 1C8PA 4Y1SA 5DEGA 3MJ9L 4F3FB 1KXVC 1SF5A 5E56A 4ZUTB 1Z3GH 4XVJH 2IALA 3LMJL 2G5BA 5T3ZD 2W65A 3AITA 4BFJA 4HWNA 3X11B 1SLUA 5GIRA 2B7DT 2AGJH 2R56H 1S3RA 5HI5D 1GY2A 1ACXA 1N64H 4P2RB 4TLSA 1WAAE 3WUZA 1ZGLM 2FIRT 3SGJA 4UU9A 1FO0H 1MCWW 5TQ2H 8PAZA 3HI5L 2A6JA 1FDLL 4FMKA 1T7YA 3BPLB 2R2EB 4I0PD 4ZMOA 3RZCB 1OW0A 1L0YA 5E6SB 4NC1E 3QFDB 4WQOA 4E36A 1TJGL 3CFNA 3VDCA 4KXCA 4NZTL 2NXYB 5LAXB 3WLWD 5K1VA 4FAAB 3WLWC 1DFXA 1I3GL 4WUUD 4NKIL 1A7NH 3V5DB 4Y4HD 15C8L 5JXAH 2NT0A 4L1HA 1WICA 4IMLA 4IBWA 4HYTB 4JFVA 1OP3K 4KQ3H 2X38A 4TQPA 2DF3A 4QNPF 1FNLA 6PCYA 2EYSA 1L9NA 1SVZA 3BX7C 1BEYL 2GW5A 2WZ6A 4FS0A 2DBLH 1NCBH 4KVNH 2AHIA 5KBNC 4PLJC 3MCKA 4CC1A 2XPZA 1KPVA 3LXBA 4MAUH 3MRFA 1FGNH 2B16A 3B56A 1V10A 4JO3H 3C6SA 4IGBB 4OFYA 1I8IA 4ADGA 3GHBL 1J87A 1NEPA 1L9RA 2BDNL 3ZDZF 1AZUA 4ZO9A 1IEHA 5CF3A 1B4JL 1RZIB 1PQZA 3VXTB 5H35B 4N4YB 3TP4A 2BXZA 1CGSH 2DEYX 1A5FH 4XPAH 4HG4K 4LCCC 2GITA 2HFGH 1ED3A 2FK9A 2GK0A 2KLSA 5D7SL 1AGDB 2YEZA 4ZQKB 2ATPB 1XGQA 3UIZA 2EUZA 5IP4A 4J4PD 2PYFA 5DC2A 3SJVA 3HMWH 4I9WD 5D7LB 5T1JA 5HJBA 4UIKH 4OM0H 4HU2A 4KMTH 3IN2A 5CD3B 1FVEB 5FGSA 3LRSB 3SY6A 2WLMA 1JFHA 3R0MA 3ZIMA 3QCVH 3QIWB 4JQVA 4HWZB 2QKIA 3T0WA 2WYTA 4D9QD 5I1DA 5C0GB 1P1ZB 3TA3C 3BZFA 1E67A 1S7QA 3TVMD 5K39A 1N59A 3IMTA 5CKGA 2AJSL 2E7LC 1IRAY 5AW5B 4LP5A 4X6EA 4TSBH 5F1NB 1J1PH 4QRPA 3ZR5A 4LOVA 4NLAA 5DJAA 3O3BA 1E6OH 5FW6A 1A5FL 4NRXA 1OF0A 4IRSA 3DDGA 4WI6A 4L4VD 4BHUA 4OSUL 5IMKB 2B9AA 3O41B 1GKEA 2AABH 4HOXA 1RLBA 1P6FA 2NY2D 4JFOB 3FPYA 1YYMH 3CPUA 4UBDD 4LO9A 1H5BB 3PDDA 1RLWA 2F53E 4XBGA 4MRCA 5I5MA 4TLUA 2X4SA 3U30B 2Y2YA 4YSCA 5T5NG 4ZMQA 4KKNA 1R3KA 4TL4A 3ROOB 1V7MH 5I1HH 5JUEL 2VUKA 4MJ4A 5C07E 2J1WA 1DBJL 2YXWA 1IJ9A 4L9DA 4MBRA 4YBHA 4HC1H 3RYMA 4E5XB 1ZJAA 2ITFA 1MY7A 3E6FB 4H26A 4KH2A 4GMTL 5KW9L 1WS7A 3LKQB 1VFBA 1E4JA 4B50A 1ZPUA 4L3CB 2W91A 4AT6B 2J8OA 2F8XC 1W0VB 5JPNC 1J10A 1IKNA 3GEWB 4NKDA 5DA4A 5FO2A 2XYBA 4JFZH 1J8SA 4QKTA 1MFBL 2XLLA 5CJ8A 5IGXL 5CN2A 1KTLB 1JGVH 4OGAC 4OGYL 4FZ8H 3UZQB 3R18A 2CPUA 3BOVA 3GEFA 3KYNB 3DC0A 5ESVB 5K9OB 4QJ5B 5F9JA 4PTUB 5DO2D 5TH2B 3P4OB 4YHMH 3UJJL 5J89A 1KPRB 3SQOH 5IJDC 3SBPA 4XWOD 5A2BA 5F6IB 4J39A 2JWYA 1IM3A 1ZGLA 5C0IA 1RFDL 3VFWA 4XTRC 3C09C 5C97A 2YSSA 3NABL 3G6DH 3FC8A 3GRGA 4L8BB 3VH8G 1EJ6A 5GGTL 4AKPA 5INDB 4F7PA 2BIPA 2I07B 3NZSA 4YFLF 5J3HD 3EH2A 2A4CA 5FO8A 5MP6L 1E4HA 1I7RB 3F05A 3L95A 1T22A 1ZVSA 2X4PB 1Y6MR 1OP5K 4HOWA 4HKZB 1DCLA 4BFKA 5E8EA 3VD9A 3P11H 4ZMNA 4QXVA 1ILUA 3OC5A 1HYSD 1BBJA 2VABA 4ZNCD 3HC3H 4AL8H 4KXZI 3UROR 3MNMA 1P6WA 2XI9A 4G7YL 1VPOL 3P2DA 1UXWB 2VDOH 4NM4H 4P2YA 1OAJA 3BEWB 1K72A 3KCPB 4YR6A 3S6CA 1C5CH 1WPCA 4RRPM 2JKWA 4F91B 5CINH 1YMMB 3O0RL 1RZPA 1HOEA 4PJ7B 1BOYA 1OK8A 3HCVB 4NZUH 2VDQB 1GZQA 3KNBA 3HRPA 3I6GA 2C3HA 3U46A 5AW7B 3ELAT 1WD8A 3NCYS 2MFNA 3QFGA 3LQZA 4U1NA 5FYLE 4JN2A 2ZOKA 3A67L 3PL6B 1EMTH 2XQYG 3BPOC 4TVSa 5IT2L 3OL2A 4Z3EA 3LDBC 5TDOB 4HMCA 4I2XA 5ACLA 3U0WH 5ITBL 1KIUA 2RGSA 5DJ8B 3RVTC 5L7XL 4YHPA 1MIML 1T83A 4P4RA 1U33A 2ITDB 3K2UL 3MBXL 1U3YA 3JTTA 1PMYA 3DUSA 3U9PL 4LEEA 3VI4E 3TBBA 1NWPA 4FKHA 1MFVA 3O3EB 3IMSA 2D7QA 2VAAB 2JXMB 3EDKA 1S5IL 2PMZA 2P44B 4MJ2A 2AEQL 2CGRL 3D08A 3F7KA 3T9WA 3FUNA 3DOHA 3OJ2C 2H2SD 3IDJB 1R17A 4LRNL 4IU2A 3RL2B 4F33A 3LH8A 2I7OA 4HJUA 3NSXA 3S4SG 1LLAA 5DHVB 3IJSA 1AANA 1QWUA 4KH9A 5E5RB 3KLAA 3HTLX 2BSTA 3QZBA 4MZ3A 5JLZB 4J3TA 2B1HH 3W5NA 3FT1A 4LL1A 4J23A 1TTRA 2X6UA 2Y7QB 4M8QA 3CPLA 3E1F1 5DFWH 5AW8B 5IF0B 4ERSH 4XPBH 3U0TB 4UNUA 1BZ8A 2JKLA 1IKFH 1KNOA 3QNXA 4K9EH 5EOTB 2ADGA 5F8QC 4CSSA 5CWSA 3FSVA 4ZTOH 2Y6SD 2QADD 5TDNB 3UOAB 1LEKB 1TU2A 3LEXB 2COQA 3VSTA 4QJ4B 4WFHE 3RB7A 4LPWA 4U6HA 1I8MB 1L4IA 1PEZA 4TQHA 3FU0A 5CZVH 2N56A 1Y0LA 3WFEH 5I1JL 4P3DB 3J8F7 4L2LA 3D09A 5TK4A 2CBQA 3BWAA 4DKFH 1PDKB 2R4SL 5I71C 1TJGH 2V7HB 3UAJC 1A0QH 3WSQH 3LKRB 2HJLA 3D07A 3DBSA 1B6DA 2BP0B 3HVNA 4UB0L 4Y7MA 1WHOA 1KG0B 3T8XA 3VB8A 4H0IA 1JV2B 1JHTB 2X6AA 3W81A 1HSBA 3HI5H 4A39A 4EUPG 2R0LL 4JDZA 5DMKB 5TTRA 1AQ8A 4H25A 3IT8D 1XL4A 4PB0L 1S7TA 4WI5A 2QMKA 1FFNB 4P9HH 3V6ZA 3QJUB 1DVXA 1WGVA 1H3GA 3NOIA 4BFBD 1AZBA 4XBEL 1J88A 3SKJH 1EEZB 1QVOB 3F83A 3CFMA 1NC4B 2ISDA 2OI9B 3GSQB 4LPYA 4MXQD 1A1MB 4PJGF 3ULUH 1KLGA 3HBQA 2PO6B 1ADQL 3BIBX 5HGDA 2WBJD 4TLKA 4YO0B 1KBVA 3KLHC 2ZUXA 4HKBA 5F88B 1UYWL 1IJNA 3EGDB 3BWSA 3U4AA 4KK8D 1QR4A 2Y25A 1CFBA 1LO3L 4ZK8A 1JWUA 1A47A 2XTLA 3S98A 2Z8SA 2QZQA 2EVGA 3ATDA 2ITCA 1F4YL 3CCHB 1MJUH 4JPWH 2CK0H 4WI0B 1VKXB 1KTBA 4NAMA 2J5LB 2F54B 4LLWB 3SOTA 4HUMB 4HSQA 3VFGH 4KZDH 2ZCKL 3QWOA 1NC2B 1EJOL 1RJLB 1J5HA 2LHAA 5JORA 4GOSA 4ES8A 5GGRY 3OC8A 5FX3A 4TRPL 4IDJL 3N1GC 4Y1AA 1UC6A 1NM9A 2EKSB 3QO0B 5IESH 1M05A 1E9PB 3EJRA 3KH3A 1XV8A 2GABA 4PGEB 5MI0C 4Q0XL 2CNZA 3C6LB 1N2RA 4YVNA 4WUUE 2HJKA 5AKSA 4U1GB 1UT2A 3M7FB 4ODXB 4R7VA 4JFQA 2R39A 4NI3A 3OKMB 1JZ4A 4L1TA 2YRBA 4WFED 2R27A 5BZZA 1FUNA 5F7DB 3MUY1 4IS6B 3MU3A 3QARA 4MWFB 1NGPH 1FZOA 4XP4L 1GS8A 1TVHB 1UD8A 1ACYH 4MD0B 5B1JA 3TO4D 1TENA 2ZYSA 2VM3A 4KU1A 3KEHA 4MQSB 1FNSH 3SCMA 4XCCL 2P24A 4PAZA 5GSRA 5AW1B 3BJ91 4GW5B 3WS3A 2OMYB 1NCIA 2WP3T 2CAKA 1AGEB 3QT2A 2P5EE 3R19A 4GLRH 1QUNB 4BSVB 4D9QE 2WMPA 1BG1A 1LE5B 2G0LA 1JV5A 1MQ8A 1U42A 4W9HC 3F7QA 1J8HB 1DBAL 2Y5QA 3DYPA 1CBVL 5AZUA 2XCMC 1GGCH 2WKLA 1JWSB 6FABL 3SDDB 4M4RA 1FBIL 4AGNA 1I53A 1YEFH 1FNFA 1PNCA 2XX0A 3DXAA 4H8HA 4KKAC 4BE6A 3U4BL 4BA0A 2AC0A 1ACYL 3HC4L 2EIKB 1MCOL 1O6SA 3QAZB 1IZKA 1R1CA 3A5VA 1RJYA 5LXVA 3EBAA 4PLNC 1BAGA 1AQDB 2AJ3B 2FBJH 4Z7WF 5T1KD 3ARFD 2EH7L 3KR3H 4JG1H 3U7YL 5GZNA 1WBZA 3VRJB 5IB2A 3MV11 1ZS8A 2E59A 1U8JB 2O6DA 1GAFL 1NCCL 2IANE 3FU6A 5AKTA 3TOPA 4ZTEA 3U7WH 1U6AL 3ESPA 2XWEA 4JFEA 4PIRF 2D9QB 3MJGX 3QI9B 4U0RB 1FCGA 4GUPB 1MCSA 4N2CA 4Q52A 3RI5K 4JQXC 4PJEE 3N1QC 1XD1A 4DTGL 1EBAA 4XC1H 2QKSA 3LKSB 3MV9D 2B0SL 3UZEC 4LNRB 1EBPA 2A9AA 2YQ3A 4MQ7B 3W0WB 1RD6A 4UM9B 4OB5H 2O6CA 3V0WL 1R5WA 2EQDA 3BVWA 2P7TA 4RETB 1IVLA 3VXRB 1YLBB 4JO3L 2JB6B 2XFGB 3D34A 5KBPA 1QLEB 2HTLC 1ETZA 3VCLB 4KHTH 3C5ZB 3FYEB 1A6WL 2A2QT 4J8RB 4A7SA 1XMEB 5ISZD 1N6UA 3VE0B 3CHOA 2BS8A 3FB6B 2X4QB 4NQDA 4Q6IB 3ZDYE 3VX1A 1IARB 3ZGHA 1YNKH 2GJ6D 3DGGA 2F54D 3BMWA 3IXAA 1VEPA 3BZEA 3SY0A 3CH8A 2CO2A 5B39B 4M7KL 1PG7L 1XO8A 2QR0B 4ZQTA 1H8LA 1MW0A 1BQLL 2EADA 2COVD 4HLZH 4RFEA 2AAVA 4YE4L 4NQCD 2V3EA 3AAZA 4BZ1A 5CJBA 3A22A 3MA9H 4WSJA 4FTVA 2BVTA 3MXVH 5D93B 4FCAA 1KB5B 2G2RA 3H8NA 5EU6A 2MQGA 4G80B 1XGPB 4UYQA 1U3HA 3L3OA 1TZAA 4CU6A 3QUYA 2WLYA 4JGJA 4Z0BL 1DLHA 4YFLI 1AIFB 1K8IB 2EH8H 4X9YA 2NY0C 4CDGC 5KVDL 3RX8A 3VQLA 2X2IA 1WAAF 3JYCA 4LE8A 4IYKA 2QELA 1TEYA 3DJZA 2DWEB 2HUEA 1HCYA 3SN6N 4Z18A 3MV01 4NKIH 3NFSH 4LGSB 5F7NC 2WUCH 2DMKA 2DQHL 3FN9A 3PE9A 5ETUB 4ZXBA 1ZPLA 4OUUB 2P26A 3FFCD 2W81C 3VVVA 3PXLA 4K23H 1NZRA 1FGNL 3S97C 3ISYA 1HS6A 5F44A 4FJYA 3RUGB 5CGYD 1HQ4B 3QO1B 2C9AA 4CBPA 3BGFC 2VM4A 3SBRA 4YGVB 4G9FD 3A4FA 2NY1D 3N40F 1CFTA 2MTPA 2W94A 3H9SA 2DKSA 5T3XD 3SCMD 5C0RL 1X4YA 4S1QL 5E7FA 1BGXH 4P4KC 5DMGC 1FRGL 4GAJH 3NQIA 3V0VB 2D7OA 1DEEB 2GG1A 5AVRB 1XL6A 4MMYA 4PCKA 3SO3C 2KDYA 2BS9A 3ILPB 2HLAB 1N0XL 1S7VB 3MUZ1 4L8SA 3FS9A 1NFDE 2XUWA 4PBXA 2VZ1A 5CUSL 5JIIA 3FQ4A 4HZLA 2BOCB 1W8NA 2D7PA 2ZOUA 1OAXL 4X99B 5B39G 4ONHA 5F2FA 4K71B 2VQ4A 3CXDL 4M6ML 3KVPA 3L4WA 3TF4A 4MLSA 4N0YL 2F9BT 3DI3B 4WHTB 3W0WE 3NIFE 4O9HH 3KPOA 3ZTNH 1J18A 1FFPB 2ZUVA 5E08L 5AL0A 2I24N 1BF2A 2GT9B 1UB5A 5KVEE 2G60L 1EO8H 4UQIM 1PZSA 1F1GA 1SN2A 3LNIA 3M1CA 4K7FA 1G7QA 1U36A 1XTMA 4WUKL 3U2SA 5F3HB 1FIGL 4JFDE 5T1MA 1KTRL 2YQGA 3UJTL 3AGWA 2A0LC 2WLLA 1L9PA 1MH5B 1NEZA 5KS9B 1ZA3B 1T2QL 1T4KB 4JPKH 3WMPA 1C1EL 1VZHA 4XCNA 3V9FA 3JUZA 1KZYA 4A2LA 4WK2B 3ZPDA 2EIEA 4GG8A 5IG7A 3Q2LA 3ZTNL 1MREL 3S4SA 1DBKH 2IADB 2WSKA 4GMSL 4Y4HB 3ASWA 1JD9A 1TJMA 4Q9QH 3VXSB 3EOYG 1IU1A 5BW7A 3VW3H 3RLSA 3CVHL 3QWRA 1N9PA 1LO5A 3IETB 3UAAA 2EVJA 4P04A 2MQCA 4HLJA 3ARDC 1LYQA 3NP3A 1JN6A 3MZGB 2XIIA 3L1EA 3V9CA 1GC1L 4EQ3A 3L54A 2YPVL 4B60A 4E41D 2IBBA 4BUGA 4ABWA 5I6OA 3DTXA 2NQDA 2PTVA 4PHXA 3ULVE 3P77B 4MCZB 2HLFD 5DEFB 1P4LB 2WO2B 3MFFA 4PJBF 2H0EA 5DD0L 1WAPA 3AY4C 3FUIA 5IIEB 1HINL 2LVEA 1YG9A 3NFPB 5CLYA 3W1ZA 5IEKB 5BOPA 1XFPA 1YN7A 4RMQA 3S5LG 1OWWA 3WFHB 1FORH 3F85A 5D7JB 3SOBH 3VXQA 3FUHA 5I0VA 4JW3A 1OGAA 5AWNH 3RGVC 1CE6B 1K4DA 2D7MA 2B4CH 3EJJX 3MUGA 4GJTB 3QDGE 1D5BB 3OLDA 1OT4A 5ITBH 2ZAHA 4IOIA 5JDJA 3QDHA 2BSDA 4A37A 3ZHNA 4YIQA 5J11C 2P5WB 3W57A 3BWZA 3KPSB 1KCUL 2RD0A 1UASA 3MA7A 2WYHA 2YEVB 1E30A 1MCWM 4KK9D 1N6VA 2WQVA 3RPKA 2F1BA 1ZANH 4NPKA 3FFDB 2H3NA 2KYIA 4Y5XB 1T1WB 5IKCB 1GCFA 4ZTPL 4Y4FD 2BOBB 3L08A 3FT9A 5CBEA 3ALPA 3H3PL 3G5XB 3IFPA 4OQTL 3VI3B 2BY0A 4AGOA 5I26A 3EJSA 3JWOH 3RWGB 4A7VA 5EBWB 4HV8A 4DCQA 1U2CA 2VQTA 5L2KB 4JKKA 4KK9C 3I9GL 3AU0A 4YSRA 4PGCB 3WJLC 2FGWH 3GRWA 4HZ1A 3EFOA 4AKQA 1QI4A 4OCNC 4G7RB 3QZNA 2IPTH 1RK0A 4P9ML 2FEEL 5CGTA 1TEGA 1JGLL 2WTRB 1P0SE 4OI9A 3ARGB 3CJJA 1NDMA 1Y07A 1FLRH 1HYSC 2JJSA 4Q2ZA 4PS4L 4PTTA 4FOMA 5I0ZA 2VXSL 1VACB 3PP4H 2XG4A 3OV6A 3ZQXA 3DMMD 4TUOA 4EXPX 3V10A 3ALXA 2P3YA 2V5SA 3S7GA 3CTTA 1ET7A 2BNUA 1MCDA 1MF2L 1TJXA 2XBDA 2MCMA 2D0FA 5A6IA 5IB3A 3RAJH 4OD1H 1MFAL 3CFKB 3NJKA 3FCTB 4YPGA 1AGFA 3ARDB 1SJVA 3TA3D 2ITEA 2I85A 3QUMA 3EYFB 1F58H 3UEQA 3WFCL 3BZDA 3PWUA 5EBLA 3RKDD 2WKGA 3WXVL 3RPBA 5SWZD 5BXFA 5B8CA 3L3GA 1EUTA 1MI5A 2MH4A 4I13B 4ZD3L 1X5GA 2BVOB 5E8NB 1MAML 3MGTA 2IFGA 4QF1A 4Y4FB 4G42A 4NIKB 3T6QC 3ULUL 5BO1L 5JHMA 1ZXQA 1X5HA 3MGAA 2H3KA 4K94H 1GS7A 4GNKB 4KKZA 2BVUA 1BZDA 4NUJA 1ES0B 2DW5A 2XACC 2JE8A 4X6CA 2UYLA 4DFIA 1FG2A 3AS3A 1AY1H 2JK5A 3KDMB 3MLYL 4MMZB 5IK3A 2AERT 2AVGA 3TJEH 5I24A 2OP4H 1EH9A 2AEPL 2JKIS 2CCWA 1EHKB 4CILA 3X14B 3KLQA 2BVPB 5TPWH 4WWKB 3NJHA 4Z7UE 1VCAA 5AOMA 2DWDB 5DZNA 4FQXD 4G6KL 3VFUA 1V7ML 1IGIH 4J6RL 1CQYA 3C12A 1XCXA 4K71C 4KJWC 1MJ7L 3TPKA 3CFTA 1A6WH 1CFNB 2UXFA 5FA3B 3O9WC 3BYYA 4IQHA 3T4YB 2IIJA 1F6AB 4ONGL 1CE1H 3B2UC 4DEPC 2VXQA 5FYJU 1LP9E 2EDYA 5CZXD 2HYMA 3ZOAA 1JXFA 2HT2D 2CO7A 2DIAA 4FG0A 3MNZB 3MRHA 3ZBMA 3JWNH 2NY2C 3L6FB 3H0TA 1G7MB 2OR9H 4HW6A 1JRHI 5F8RC 4AEFA 2AEQH 3GZKA 3QRBA 2XU9A 3T1WA 4GIAA 3UG5A 4HWBL 5KS9F 3ARFA 5LBSA 4ZFQA 5IOPA 3LKNA 3L3HA 4DP2X 4HUKB 7FABL 1LWRA 1LD9B 3S5LA 4HP5A 4P23D 3GI8H 2NY4B 4OJDH 2KUTA 1MG3C 4XB3A 2ICES 1NCAH 3UJIH 5EIIB 4JDEB 3UADA 1SY6A 2W80C 3H7BB 4P23B 4ZMLA 3CIAA 4N2MA 1I8AA 2K70A 3ZDZB 1D2OA 4FQQB 4E0RA 1A1NA 5GISH 1FL6A 4WNQB 1FYTB 4AZ8B 5KYYB 3IFOA 4W4OA 4M5SA 2FX9H 1ZT7A 3IDUA 4NQCE 3K71A 1BFOB 4GRWF 1OB1A 3JWNE 2HVJB 3KW8A 1OGAE 2CUMA 5KG9B 4HIXH 4H44C 3TNMB 3T2OA 2OYLA 4DN4L 1UXMA 4HS8L 5BJTA 4UTCA 2O5NA 1CGVA 3QWNA 2GHWB 5MENA 1CZ8L 3WY4A 5F93C 5FYJE 3V6OA 5JNYA 3LS5L 2GYSA 3L4XA 3NZ8B 4ELMB 3U6RA 4LCCB 3HG5A 1FV1B 2JCCB 4R7NB 1JDCA 4OFQA 3OKYA 4RMSA 1HEZB 3FCUB 2R2HB 3B9VA 3MKGA 3FN0L 1ZVNA 4CVXA 2VR3A 5D1QC 1UM4H 4KY2A 4XAWH 2ZG2A 1TLMA 2BRRH 1GIGL 1DUZA 1KEML 3Q7JA 4NQDE 3L48A 4XC3H 4AUUA 2ENSA 4JCLA 4P23C 5J06A 3RWFA 1YMHA 1YEEH 4ZFFB 2NY5C 4U1HA 2X2YA 1HI6B 3QUZC 5H37H 4JRYD 4ZRGA 2YRZA 1CLCA 5IWLC 3PAVA 3WN5B 3W37A 3IAQA 1NQBA 4ZMXA 3IDXL 5I16A 2WLJA 4ANWA 1NJ9B 3D3VD 3WXVH 3QCUL 2GHZA 1L6ZA 3TIEB 4AYFA 4J3OD 3K74B 3AW5A 5LGHH 1P4BH 1SXSA 2AQSA 4FKEA 4L23A 4FJ6A 3ZE2E 1F4WL 2E76C 4M43L 4JM2B 2FYVA 1NDGA 4WY7L 1RZFL 3CZFA 3L9BA 1EERB 4G9FE 1CFSB 1IL1A 2X09A 4WWOA 3FUFA 3VFTB 4W1TA 4I1RA 4EUPB 3BGMA 4B9JA 2OX5A 5HDBE 4FZ8L 4F9PC 3J7HA 2Q3ZA 2NXZD 4ODVL 2QQNH 3J07A 2JKJA 3EYSL 3ULVF 1EXGA 1G87A 2NLJA 3D5OF 4ZFZA 3DTUB 4X6BA 3S48A 4ALAL 2C3WA 2VLRD 3OXRB 4R26L 2HUHA 1SOXA 4KUCF 1CO1A 4LDOB 5EO0A 5F89B 4EOWL 1KF9B 4PJ5A 4BQBA 3WFBH 3CLEL 1W16A 4DOHB 3OKLB 2X2UA 2EVHA 1DR9A 2VN3A 3QQDA 1TQWA 2XX1A 3BP5A 3UO1H 4U4IA 1A25A 2FR4A 1LGVA 4JJ5B 2YFOA 4I3RH 3AGVA 4OD2B 4TKWA 3U6XA 2OMUA 3I02A 4PJXA 5JUEH 4N8VG 3ULVL 1MCRA 3C08L 1XGUA 3QZPA 4A68A 3VWJA 1UACH 3V7AG 5EUKA 3VGAC 5BMFH 1CDHA 1KFAL 2G75A 3HI6H 2X05A 3ZL2A 4NT6A 1HOCA 3QDGD 5L4MA 3PWVA 4R90L 4DKEL 3MRPB 1JK8A 3O4OB 1UZGA 2R51A 2IAMA 4YXLH 2NQ3A 3IJYA 4OGAD 5DRXA 2L7UA 4JRYE 5L8KB 5E6IA 1FYHB 3QSKB 4N0FA 5DJYA 1BQRA 1OAZH 5JW5A 5C0AE 3TX4A 1PTZA 3TL5A 1DQKA 1FNAA 2B1OA 2P80D 4KJYB 2HRHA 4X5LA 1FZMA 1D7CA 4TQEL 4MDIB 2A4ZA 4APQC 2HTLD 5D7IF 5EMYA 3PWPA 2BWIA 3OM3B 2YAPA 1JUFA 4XVTH 1GOGA 4X6FA 4Z7VF 2DJUA 5TGBA 3KM1A 2P8LA 5BVJB 1FI8C 2DLIA 3WS6A 2MHAA 1LO0H 4U1SA 4PJDE 4N0UE 1WCBB 4M6MH 3RBGA 2KPWA 3O8XB 4AQZA 2L0DA 4DK5A 4RAVA 1WUZA 1UATA 1QLRA 3MR9A 2UWEB 4TUJB 2AMGA 3FONA 4HGWB 3RDTC 1AO7D 5C0CB 2X4RB 1O6VA 5CLZA 1N4XL 2WVSA 4X4MA 2X5PA 4JM2F 1MEXH 3OMIB 1IFHH 5D1XD 3G6JB 3SYQA 4ELKB 3SPCA 4Y2DA 3VWKD 4NX0A 2E27H 4IMKA 1I7UA 1Q4NX 4W9KC 3BUDA 1QI3A 5M95B 5LCVL 1NCOA 5EEYA 1V27A 5HBBA 1A1OB 5EC1B 1W2KT 4Q9QL 2VLME 4J1UB 1JZIA 4BQ8A 2B5IC 4LOUC 1DSFL 3FO0H 1I8LA 2OV0A 4UM8A 5IJCC 2NZ9C 5F7LB 2BHZA 2WJ5A 3D9AH 5F21B 4LSQH 2OJZH 5GRWA 3CSYA 3VFSA 2Q2LA 4Q0XH 3BC9A 2VMCA 2XTJE 5FS5A 3NEXA 3VWKA 5I66A 3QNYB 2JKRM 4K07A 1YYML 2BP8A 4XR8C 1MRFL 1QTYT 4ZX5A 3LVEA 4RRPA 1E28B 3BKCH 1JZ5A 1UB6A 4NO5B 4AQOA 1BXXA 3WDIA 3D50A 5HHMD 5HJGA 1OAKH 4N0YH 4LDLB 5AOJA 5HTSA 2HJFB 4YDLC 2XPYA 5HGAB 1J8HE 4ZPTA 5GGUA 1NL0H 3EYSH 4PRHD 1FGVL 4HS8H 1ORSA 2W92A 2R7EA 2GQHA 1TETH 4LP4A 4U3SB 4X9FA 5DD6A 5KSVA 4JFFB 1VADB 5MHSE 2F7IA 4NS0A 2XZZA 3QC6X 4OH2A 2IWFA 3OX8B 4HISA 3QDAA 2JJSC 2VC2H 4MBOA 1UD4A 5TE7H 3FRUA 5KVDE 5DMIL 4YHYC 5FYKU 3MV8D 1NCDH 2IDUA 1CTNA 2CRYA 5DJ0A 5GSVB 4BK5A 3KBEA 5EUOE 3UBFA 5F3BB 2NW2A 1QBLL 2WUBH 3DX8A 1KCUH 2ED8A 5EZJB 4XX1G 1NKRA 5A16B 3DRTA 1J1PL 4Z3JA 3MV9A 1SNRA 3K6SA 2IH3B 3OKKA 4K3DH 4AMKH 3VH8A 4N8CL 4R4FH 3MOQA 2DM4A 4V11A 3T65B 3WN6A 1J8HD 5DHEA 43C9A 1YY9C 1AQMA 3GRWH 3D0LB 4W6XB 3T2NH 1MDTA 4GKLA 3UX9B 1KYOK 1TQCC 1UXSA 2EVFA 1NAML 1U95A 3CFDA 3II1A 1RPUA 4WGKA 5BV7C 4YZWA 1FHNA 3MOAL 5AW9B 2WB7A 4JFSA 3TV8A 1U8CA 4YDKH 5BV7B 3BIKB 4I9XA 4KKBC 4ELDA 1AE6H 1KMGA 1X5KA 2DMHA 2OL3L 5C6WH 3PREA 1XGTA 1U8PB 4UDUA 4NWTL 5E9DA 1E43A 5FO7B 2IF7A 5C08A 3ZE0E 5M94B 2W88A 1DDHB 4LPUA 1CL7H 5LXGL 3PP3H 4G8GB 1SDAB 1UWXK 2UWEE 3ECUA 4HC1L 2XN9A 5EU4B 1A21A 2UZIL 1BZ7A 2IXQB 1JYXA 1UA3A 4M56A 1N6QL 3ARTA 4AITA 3VU2A 2H6PB 1WTGT 4HOZA 5C08E 4EMZA 4MFHA 4B9FA 1G7LB 1GGBH 5D7LE 2P9RA 4QYOA 2LFEA 3C6LD 3RX5A 3QDMD 1I1AD 3R7RA 1K8DA 4C54A 1G84A 5HDOA 4PQXA 5TE4L 1IGCL 3DV6A 5CEYA 4M61A 5CJOL 1ZWIB 1OVZA 4N5EC 1I8KA 3VG9C 2VN5A 1J0KA 3NIDE 2X1WL 3PGCA 1YNKL 3CXFA 2DEXX 1R3HB 1CC3A 5HHNA 5CEXA 1H8NA 5AG8A 1ZDQA 4NRZA 4RFNC 7TAAA 2ED6A 5DFTA 3NJXA 4OCYH 3AMKA 5DUJA 5JW4Q 4U1IB 4NQSA 4XNQB 1F3JB 1OGTB 4L8CB 4HCGA 1T7WA 4JUTA 4YWGH 1IEBB 4NKMB 2OAAA 4PCTA 3BP7A 1JF1B 2EC9U 4K9JA 2Y9RT 2J6WA 5LKNA 3QZWA 1A65A 4L29B 1G4MA 1OAYL 3CZJA 3MLRH 3EG9B 4TYUA 5JO5A 2DMBA 4LSTH 3AQYA 4Y5VC 4W9IC 5BO1H 5E8OA 5KZCB 2ZCHH 3VTAA 1JPEA 5SWSE 4XODA 3MHZA 3GK8H 3K46A 3NG5A 5FUZH 5ICYA 3LNEA 4X80H 2JQZA 4M03A 3K6IA 5F0MB 1H6UA 4C4KO 5IW6B 4UZGA 4BE5A 5F9OH 4H2CA 4IDJH 4ZSOA 4JHAL 3NSYA 3WAJA 1KTDB 5LGHL 1ECYA 4XWOC 5LNGA 1K4CA 1CF1A 4ZODA 1HHGA 4IKKA 3GUTB 1Z5YD 2L04A 4AEHH 4NFDA 3DSNA 2UUDK 3L9RB 3FAWA 2BC4A 1VPOH 3I75B 1TEFA 1DVZA 4MD5A 2YK1H 4M5ZL 4HGMA 3EXJA 2ESVA 2ALWA 1QHOA 2R0KL 4GQ9H 3MCLH 3MUUA 1C16B 3OAUL 5GZNC 4ERSL 4IKNA 4P2QB 5FGCB 4BFOA 3V4VH 5D1ZA 5F7AA 4YQXL 2Q10A 4NQTA 3CBKB 4NZRL 2H2PD 3R7QA 1Z3GL 4XVJL 3SHSA 1UH4A 2AF2A 3ZTCC 3QUXC 2ZUTA 5MEND 2XQYA 3FCSA 1OP5H 2OXHA 3GBNL 3EJQA 3L3KA 1NCTA 2DD8L 1YEIH 4S1DD 4U7SA 5DZOA 1IGJA 2A9ML 3TESA 2CLRA 1JZDC 1CG9B 3S35X 2XKNB 4D0DA 4HK0B 1AI1L 5GZND 2B8OT 3H53A 3HKFA 4QRTA 4JHUA 4QUOA 3I6KA 4XO5A 4GEIA 3KYMA 4CN6A 5F96H 3GKWL 4PEEA 4PB0H 5DK2B 4XMLL 5I1JH 2DLEA 2IDTA 2V8LA 2WVVA 2F6AA 1JWMA 2A7BA 1VF5C 3AVEA 1FLTX 2ATKA 1MLCB 3RDTA 1Q9KB 4IDLA 5AAPA 1GYUA 1PZAA 2DJSA 3P3UA 2AGJL 3QPXL 3WEMA 3WMQA 1G6RH 2RCSL 3M07A 3QUKA 1ASOA 1CYGA 1AZZC 3IJ8A 1L9QA 1X5XA 1JNNH 2DQEL 3HBPA 3VI3E 3GO1L 3P9LA 4LCYB 4PLKC 1E9QB 3L17A 5KSBE 3BT2L 1FNGB 2ADYA 2WV3A 4XTRD 1R3JB 3MLPA 2H8PB 3DO7B 3SKJL 5FA4A 1KEGL 3FW6A 4FXLA 4GLRI 1YJDH 4P4KB 4K9EL 1P5VA 5C07B 3V6FB 3QB7C 2R1XB 1EV2E 3V0WH 3NP4A 1GAFH 3U7WL 4XN7A 3HR5B 4N2GA 2ZSVB 3SQRA 4M8RA 5EOCJ 3O2VL 1SFDA 4X7CC 1O5PA 1YVLA 4PBDA 5IMOA 5F9WC 1XF2A 1BYNA 3H2WA 1D7DA 1BMZA 4KROC 3LZFH 4JZNA 1LK2B 5I28A 4JFFE 4KK6D 1E4XI 5I17B 2XRAL 3NPSB 4UQ2A 1BREA 3ULVC 4HAGA 3WE6A 1WCQA 4G6AC 4NQXA 1TTUA 1ZAGA 2V33A 1YQVH 1SJXA 5DJZB 4MJJA 3BN3B 2NUPB 3NCJH 1BOGA 3OR7A 4KO6A 2F5BL 5IJKC 3BH9B 3CXHK 3II3A 1EAPB 3KYKH 5EV7A 3RVWD 4DEPB 1I7TB 3FO1B 4F7EB 2XG5B 4L3AA 2ARWA 3PWLB 4P46D 5F7WC 5ID0A 3WFDH 4N2FA 1NBVH 2R2EA 3TJEL 2ZXGA 2AXGA 4Y2OA 3OGCB 2EXTA 5C09B 4R7XA 5EN2A 2YAMA 4N0CD 1LO2H 3V79C 3ILDA 2DN7A 2X1PA 5DQ9B 5CILL 1RZGB 4I3SH 1LWJA 4GBXA 4JZOA 4BJLA 2EECA 1BYOA 1NGYB 3ELQA 4Y5YA 4JM4H 1HN1A 5KS9E 4Y9FA 1A4KB 1G6VK 2BSED 1F2XK 3CFCH 4LHUA 3HMWL 5DXWA 2IWEA 4XNBA 3VFPB 1MHHB 4CUCA 2WN2A 1DJYA 1MPAH 1GMIA 3BWUF 4ZFGH 4G59C 5IB4B 1ITCA 1UCBH 2HFGL 3PPSA 5I76B 1S9XB 2IPUG 4I8DA 4ZYKA 1FJ1A 2MSPA 2X41A 4KGLA 5IZ7A 2ZUUA 1M7DA 1INQB 2KQNA 4RMTA 2BS71 3EYUL 4MJIA 1B90A 1J1XL 2A38A 4H20L 1IGCH 3FT4B 3GMRA 4KXBA 2FT6A 2I26N 2N0MA 4OZGF 4Y2NA 4M5TA 1MCQA 1FWXA 3CMOH 2X53A 1DE4A 2UZXB 5HI5C 4G7QB 4YQXH 3STZB 4YSQA 2XPGB 5GHWL 4PJ6A 3CVHH 1PVHA 3FQWA 5DK0A 1SYVB 1TLKA 4WW2F 3BN9D 4W9CC 1CD9B 1GC1C 2Z65C 4PJDB 5EA0L 4OZIA 1A9VA 1LEGA 3AU1B 4GAJL 2AQTA 2ZPKL 2WUBL 3TBTB 2X70A 5J6HA 4LLQB 4A66A 5E9NA 3CUPB 5DJ2A 4BFIB 3SO3B 2I60L 1NCDL 3VXNB 5CJ5A 2WW8A 1PKQE 3LRSA 5C0BE 3LPGA 4L8SC 4TV3A 3FFOA 5LNEA 1J8RA 5B21A 4AYGA 3ATAA 1OLZA 1HXYA 1Z1WA 4LEBA 2YKKA 3MGOB 3TYFA 1NUFA 4R2GC 4XZ4A 3AT0A 4HPYH 4MZRA 1NBZA 1N59B 3QHFH 3TLRA 2J1XA 2E46A 1KC5L 3UTQA 4NWUL 5AB2A 4F7TB 2A9BA 4XOEA 4QRPB 2D8KA 4UT6L 1AKJB 4G6JL 5FGRA 4FNSA 1U3JA 4EOWH 4D8PA 1MN4A 4WI7A 5E4EC 3K5SA 5IB1B 2V2WB 2DH3A 4F8NA 2A9NH 1WLHA 1R3LB 1SEBB 4YUEH 3QIUA 2PCFA 4MD4A 2ICCA 5FM8A 1YZZA 1JZJA 3OB8A 1JGVL 2ROYA 5B3SB 4HBCL 2GBVA 2XBZA 3INUH 1O75A 3JZYA 5C07D 4ODVH 3HMXL 3FBQA 4GMTH 5JMOC 5ESAB 1SF3A 5D7IA 1X9LA 2AQRA 2DQFB 3QDJE 3S5YA 1NGWB 4G8EB 3H6JA 4GB9A 4N3TA 5I9QB 1WFNA 1JNLH 4I7ZC 4BXSV 3SYCA 5I8EA 3QXAA 1DJHA 3NK4A 3BRGC 4MJIE 1J05B 1Z32X 1PLBA 2XXGA 4H8WH 3UPRA 3ZDWA 3WNJA 4M7JH 5DLMH 4RGOH 5E5MA 2OXGB 3GJEB 2AJZA 2CHZA 2XWBA 3D0VB 4PP1D 1WF5A 3QJHA 3WTYA 3ARVA 5A2CA 4XRCA 4WW1B 1NPJA 3RGHA 1W0VA 4EVNA 1MZYA 1TZOA 4FG4A 2VDQL 4KUZL 2YN3A 3O9WD 2YXMA 1DN0A 2PYEA 2CH8A 2CDGA 4BZYA 4X5WB 4UOZA 3RWIA 2FWOA 2VRKA 1IVTA 1CK0L 1OP4A 5AB9A 3MXWH 3NFNA 5GGQH 5GGRA 1WWWX 4HUNB 1WH0A 3R1GL 5K93A 1YO4A 3DX3A 3HC3L 3JWOL 4P59L 4AK2A 3UTSB 1O7DC 4H1LA 1FVDB 4GIPD 5DD3H 4Z5RB 4DTGH 3FHQA 3BI9X 3H56A 3MX0B 1OZTG 3W11C 4L0YA 4X80L 3N3EA 1LDPL 1XF3A 3R8BB 3BYTA 5SX5K 5MP6H 2NR6A 4HUCA 1SJHB 4JKPL 3SGDI 2XZAH 2Y5TB 3GXTA 3QULB 4Q6KA 1FDLH 5C0IB 1A4BA 1P5UA 3S3CB 1G9NL 1QEWB 2CU9A 4ANUA 5LAPA 2R8SH 2R1YB 4Y5VA 3MBWB 3WFCH 4KTDH 1GGIH 2EYTB 1CDGA 2WVTA 2PR4H 4GKZA 2C3VB 5J12C 4X83A 4Z78A 1D6EA 5D2LA 1W72A 4ZW3A 4TF4A 3FU7A 1J9CT 4X0NA 4G3YL 3QH3B 5CU9A 3LYRA 3DJ9A 4N68A 5EZOH 4NPJA 2HFFA 1CXIA 3MRKB 4G8FA 3BZ4A 2OULB 3VD2A 1FNSL 2B15A 2DKMA 2GTWB 3ZDYF 1T21A 3APFA 1Q94B 4NHUA 3E6HA 2FQFA 1SJEB 2QTEA 4JN1L 2WXKA 5D5MF 4AE0A 2FJFA 3FFCE 3ARGD 2VR7A 3G5YA 3OG4B 3RUGF 1XZWA 2ZX9A 3SSGA 2W0KA 1E5AA 3MRLA 2L7QA 2YOAA 4QLWA 4NYLA 1TZIA 1YRKA 5CLWA 4U1NB 5KN5B 4O58L 3I9GH 2NTFB 3DOIA 3PHQA 4U2YA 3MRCB 2ZJSH 4R7DA 4N0UB 4RFNB 4PRPE 4ONGH 5BZXA 2C9PA 5LBVA 1SOSA 3QC5X 5T5FH 3EOBB 4Y1TA 5HPMA 1WS8A 3EHBD 1SDDB 4XXDB 3QZMA 1TCRB 1Z9NA 2C1OB 3TCXA 1XX9C 3PQYB 4K23L 2R56L 5JHLA 3WEXB 3QW9A 2CCVA 1N12A 2H26A 1HHKA 2CR0A 1CVSC 2VT0A 3QZLA 2Z93A 3TTYA 3AJ7A 3VSUA 3MCG1 3ZKMC 3VACA 5AQ0A 1ZLEA 3BGFB 1OLLA 1M7IA 4PG2A 3SPJA 1SGKA 1URLA 2F2HA 2WXQA 2OBGA 1MFAH 2XXMB 3CVHB 3FULA 3BDBA 1MJ8H 3LVTA 5D5MB 1WHPA 4AIZB 3T3PE 1QPKA 2QV2A 5DVKA 5K9QG 3OPZL 1S9WA 2F19H 4LBEA 5BZDA 4BWUA 3X1FA 3ZKNC 3ZE0F 1ZHNA 2WBJA 1WC7B 3M1BA 5GRZA 5DURD 2R69L 2V2XB 4UBDC 4D0CA 5J9PA 1BJ1J 1WIUA 3V5HB 2EDKA 3HNVL 4V2BA 1U8NB 3CFEA 1Q38A 3BD3A 4D94A 2W38A 2HG5B 4QTFA 4LBAA 2H9GB 4JY6A 4KVNL 2FYYB 2EEBA 3K1DA 5D93C 1ZCRA 5IJVB 4HS3A 5IV2B 2CJUL 4P5MB 2EO1A 5CWSB 4MMXC 4Y19B 4UB0H 5CZKA 1WZAA 2WXLA 4MMXB 4Z0XA 2XIBA 2JB5H 2XC8A 3B9DA 2AEWA 1B4LA 3K91A 3VFRB 4LEOA 5L9DH 4MGXA 3KE0A 2XIDA 4QXGL 5I18L 1PZBA 3MOAH 3QFJB 4E2OA 5HHQA 2ZCLL 3GIVA 1DLFL 1SRDA 2DICA 3MJ8B 3M8OL 4GRWH 4YLQT 4DGYH 1IAII 3AY4A 4LVHB 3VXRE 2E5EA 5A2IH 4WIQA 4MQXC 4Y9EA 3R06B 3TV3H 4DH2A 3E8UH 2V9QA 1KLUA 2C4XA 4JRLA 3V6ZB 3D51A 4HMEA 4HJJL 3CZGA 3UO8B 4R0LA 5MEOB 2AJVL 4KRPB 2DYPA 4DUXA 1MHCA 1IQWH 2VLJD 3C5SB 1BX2B 3OD3A 4K7PX 3IKCB 2XKUA 3DETD 4RFOL 1AGCA 4RWYL 3N44B 1L9TA 4HOMA 5HYJB 4WNJA 1IM9B 1G1KA 1E0OB 3FU8A 5JPNA 3MBEB 3P69A 2C7UA 3SZ6A 1T0MB 5CM1A 5T1LB 2OW6A 5DZPA 4G9FA 3QEUA 3GJFA 4I18C 2OMWB 3EW3B 1QFHA 1TPXC 2F74A 1AG6A 4JG0L 4QHMB 4AI7A 3BVTA 1NOAA 2PCXA 1X7SA 4JPVL 4Z77A 4G6MH 4BEIA 5LBGA 1ZANL 3SDAA 4J3WA 3FUJA 2Y7MA 3C9NA 3AXLB 3O9WB 3NIDF 4OLWL 3IGUA 4Q56A 5F1SA 4QRQA 1OSPH 1CI5A 1ZHBA 2WB1A 2D3JA 1QRNE 1NC2A 1DO5A 25C8L 1ZSDB 4Y8DC 4X8CA 1G9MH 1FAKT 2E6PA 3ZDXB 4BH7A 2Y72A 4FFZA 4PWHA 4AM0A 3TVMA 2FO1A 1FL3A 2RIKA 1E3XA 2Y06H 3IEAA 2Z6FA 3N50A 4PH8A 5HGBB 3T2LA 1HCFX 1EXHA 1IIIA 1UWFA 3F84A 3O11A 2A4EA 5E4EB 1HHHB 1Z9MA 4KKLD 3Q0HA 1JFQL 1A2YA 5DD1H 1C7TA 5DFVC 2PTUA 2UUDH 4AUJA 3B83A 2Y69B 1TT6A 2I9LA 2XSKA 1V8HA 4XCEB 3FOMA 4CDHA 1NLBL 3BKYL 4MDJB 3BPLC 3O0RH 4PMEA 4JPVH 2A73B 1TJIH 1B6UA 1BDYA 4D7PA 4FQ2H 4GKNB 2IPKB 3FQNB 3MRGA 1QKZL 4JFDB 4CW1B 1M7XA 3PNRB 1JGEA 4X7EC 5DJ6B 2BIQA 3QP3A 4K94L 32C2A 4KI5C 5I1IH 3CDGB 4S2SA 2BVQB 4R5VA 5FHAH 3ECBA 3WUWB 2R23A 4JM2C 3FH8A 3VWJC 4Y16A 3DVNA 2BJML 2H32B 2P5EB 3DROB 4DERA 1P2CB 4P9HC 1MW3A 1YN6B 3IS1X 3QDMA 3RWCA 4ZMYA 3B9KB 4EZMA 1TKWA 4H88L 4EDWH 1R24B 2PKDA 4O2FA 4YHOL 5EPMA 5EUOB 3WKNA 2G2NA 3RNQA 1JNLL 4NQQA 4I1NB 3RWJB 1GCYA 1KULA 1AKPA 2GBAA 4W68A 4A7QA 1OSEA 2PCPB 4X7DC 1FCCA 3RFZB 4HHWA 3HN5A 1RP9A 4Z8FL 4Y9BA 1WVZA 2AJXL 2GCYA 2BERA 3T3MF 3NCFB 3VM7A 3CK0H 1WFIA 2ICWB 1J9RA 1SXBA 3AC0A 1W6WA 4LHJB 4E9XA 3G6AB 2XOTA 5JIPA 2AS5M 3WJJA 2WQ8A 4FABL 2YSTA 5JDSA 3OKEA 6CGTA 3QJFA 4M48H 2DLTA 1BZ9A 1N5AA 1MVUB 3A6BH 3QIWC 4GKSB 4Z3HA 2JB5L 5KBMA 4TNGA 1T5WB 1XF4A 1NBQA 1RUML 1J5CA 3HG3A 4OGXL 5AVVB 4OZIE 2JI3A 3I84A 5DRZA 4LLMB 3NJNA 4NQVA 1CFMA 4JFED 2J1KA 1RJZA 4YXKH 2D03L 4MJ5A 2R4SH 3ETBJ 3DVGB 5BOJA 1CYWA 3CZKA 1H3UA 2VW6A 2EC9T 3TN0C 4C56D 4J2XA 3R1GH 1L7IH 4UQ3B 1O9ZA 1WFJA 3HBGA 5CZVL 4P5SA 5B3NA 3CK0L 4RESB 4TVUA 4EJ1C 2DIJA 4HFWB 4Z7OF 1YUHB 3QI9D 2IDCA 1NOFA 1EDQA 1AP2B 1T1XA 1UWGL 5FV1L 1CE1L 5BOZG 1UD5A 4X6CE 2RB8A 3TT3L 3I6SA 4JRXA 1GW0A 4RISH 4JNXA 3J27A 4I9WE 5I6NA 2J4WL 4JO4H 3F2LA 3D25A 1VGKB 1ORQB 3X17A 2OTUB 3PG2A 4P2QE 4UT9L 2A74A 3G6JF 5FGCE 4FEIA 2FLRT 3RGVD 1XB3A 1F42A 3SPGA 5B39A 3TN0D 4AWJC 4R2GB 4UTBL 3KL3A 2G9HA 4IU3B 5D7JD 5C9KA 4G71B 4RFEB 4YAQB 1H3TA 1A64A 2FO4A 3RTLA 1X6LA 3QUGA 3HBZA 4FTVB 1RUPH 3K8MA 1FH5L 2PW2B 4NO3B 2Q86B 3WY2A 2HLFC 4K55A 2IALB 3D4YA 1MFUA 3D18B 2XN1A 3HPLA 5KEZA 1BYPA 3DYOA 4XAWL 4OT1H 4FLRA 12E8L 4N1HB 4AJVA 4MNGA 3SKOA 2XBTA 2ENQA 5DR5L 4JVPA 3RTQD 1HAWA 5JW4R 2O5YH 3OKOB 4HWBH 3WEBA 1KXVA 1D9KB 4Z7QE 3GZQA 4AVIA 5GGVY 5HDWA 3OJVC 2P8MA 1FH2A 5I8OH 5IW3A 1MSPA 2VLLB 2NSXA 1A7BA 5FYLL 4YSTA 4ALAC 2EUWA 4NO2B 5FDWB 3FU5A 3B7RL 3MKKA 1T04A 5T3XE 5TFSH 4TSAH 2NY3D 3KVQA 1EO8L 3TO2A 4HJGA 4M43H 1RSYA 4FMVA 5DVMA 4JEGB 4UNIA 3X12A 3WNPA 4DO4A 3MDJA 5D1QB 4A7TA 3MV8E 3S37X 2DAVA 1OQXA 2YK1L 5BV7L 3B9KD 2VKXA 3ZTEA 3GYRA 3DARA 2BJMH 4JO2L 3WIIH 3DBXB 4NNPL 1EXUA 3VXOB 2CBMA 3M45A 4QT5B 1O7DE 4RZCA 1BLNB 2V17H 4JCMA 5T1KB 5AL8A 2NX5E 1GPOL 2QDWA 4ZUUB 3CMGA 5C0BA 4KZEL 4OY9A 3VI4B 3DX6B 4ONHB 4S10A 3K81A 5JR1H 1INDH 1LILA 3EOAB 4P5TB 1RI8A 3NBNA 4XOBA 2E4FA 1WA2X 4Z7WA 2BW4A 1BFSA 3GSNB 3HZVA 3P54A 4PGBB 1C9SA 2EJ1A 1RUKL 4J3OC 1PY0A 3OXSB 1RK7A 5CR1A 1OOAA 1KCWA 2ATPA 5E2VH 3FKUS 3THMH 3BEVB 2VWEE 3SDCD 4ZO8A 4DUVA 1QA9B 1XSKA 4GT7A 3L4VA 5F3HA 1NOLA 1XR9A 3ZGIA 3Q5YA 3G04B 4P3CH 4IIQA 2GJ6E 4LARH 2ARJA 2O4EA 2XZCL 1QTSA 1KB5H 1S2EA 1YDPB 3LY6A 3NPSC 4HCIA 4D0BA 3CFBB 3AFLA 1PZ2A 4S1SL 2KZWA 4GY4A 1J1OH 1OQOA 1NFIA 1UJ3A 2LQRA 4OCYL 4ENZA 1BFTA 1EHLH 2X44D 2R15A 4XHQA 4JFHE 4P57B 4MNQD 3IDMA 5FKPA 4DVBA 3NN8B 5L4FA 3LMJH 3RQ3A 3QDME 1QR1A 3JV4A 1M57B 2DQUH 2DWYA 4IRJA 5EZPA 1PYWB 2R9HC 5I5JA 4Z76B 2AP2A 3FT3B 4AEIL 3LHAA 4DZ8A 3IXTB 3ARED 4HIJA 2A5UA 2CO6B 3WIFB 4XCYB 3CHSA 4DKFL 5DS1A 4AXWB 4N20A 4ZMPA 1JNJA 5EORH 2NY0B 1JN6B 4IOFD 3WENA 1KJ2H 1ONQA 1X5JA 3NA4A 4WU7A 4EI5D 3BUYB 2IAAC 3WFZA 3TEXA 4WHCA 1CDYA 4FFYA 4GAYB 4DKDC 3P77A 2DKUA 1S7RB 4RMVA 3ZHFA 3WHXA 4LB8A 2WD0A 1CICB 5JOEA 4OZHA 2D73A 2RQEA 3O6LL 4OZGB 5BQ7A 4NWUH 2PXYC 3WGUB 4YDJA 2K4WA 5C71A 2GIXA 1J5OH 1CN4A 3SYAA 3NJGA 1O7SA 3O45A 4L3CA 3KG5A 3RIFK 3DOSB 5AOKA 1JYVA 4HIIB 2DLHA 1BQHB 4JG9A 5GJTH 3IDGA 4BFRA 4PREA 4FG2A 4IOIB 4GS7B 1KJ2B 1QTPA 3IU4H 3QUZB 1KJ2L 1BVOA 1Q8MA 4LASL 1S7SB 3GSOA 4ZD3H 4K7PH 4AYMC 3OSKA 2CCLA 5LCVH 2C5DC 1UADC 3GSWB 3OMNB 5DHVH 4ZOEA 5SWZA 4B9CA 4OKVB 4L3EE 2FSEB 3DV4B 1WFUA 4Q14A 4QHLA 2NNFA 1BEXA 5ESVA 3PL6C 4ODWA 1NAKL 2D4FA 3RJQB 2FL5A 4P9MH 5D4JA 4X6DA 3VXUA 1IEAA 1SPDA 2NX5B 4TVPE 3MLRL 1RZ8A 3W0WD 4D9RD 4K8RD 3TGXA 2AXHA 4CU7A 4LKCB 3B3IB 1C08A 3BPCA 3KPQB 3ROLA 1DSWA 2R0WL 3REVB 5AALA 5FCUH 2VXVL 4X5XA 2Z31D 5INDA 2BW5A 4BWWA 2NDFA 1R47A 3JTSB 3EFFA 1K5NB 3D33A 2ZICA 1OTUD 2X87A 1I7RA 3P4MB 2YHGA 4UUJB 1W8OA 1UZ8B 3PFQA 4OLVL 4C4BA 5KTEH 3T0AA 4XPBL 2AV1A 1VAHA 1B0GA 1J9TA 5L0QC 3EJZD 1FVCB 3CDYA 3NEOA 2V17L 3HZ3A 5AZEH 2VABB 4WW2B 4P2OD 2B1HL 4JREC 4WJ5B 5AW0B 2OMTA 2K8QA 4C47A 3S88L 4KX8A 4WGWB 4JK0D 5EF2A 2Q6WA 2BO0A 1P84K 3O6FD 2UXVA 4HHAB 1AOHA 1EVUA 4CADA 5GXBB 3ZN6A 3L4CA 3D06A 3BAKA 1HTYA 3A67H 3CFKA 2VO8A 5DUPH 1ZEAH 4LEXL 4UILL 1QUPA 1KBGH 3BUTA 2YXFA 3ARDA 4WKZB 3CC5B 4KAQL 5AZEL 1E4KA 3L3JB 2QEJA 4B7IA 4HPHA 4OLYH 5LNDA 5D72L 3UTZB 4U6XB 3FU3A 4IK7A 5AVYB 1L7TH 2ADJA 1AY1L 3ZDXE 3PJSA 3HNTH 5ANMB 3QXDA 3F00A 1ETA1 1KYOJ 4DETA 1OT2A 2Q7YA 3TO4C 3TONA 4N9GA 5A2JH 3L5WB 4MKTA 3TO4B 1TETL 2CGYA 2FECI 1TPXB 1UXLA 2ZG3A 3CN0A 3X1NA 4JQIL 4JLRB 4Y0GA 2J71A 3POCA 4HCRL 2CMRL 5CCHE 3WY1A 1FF5A 3CZLA 1JE6A 3EO1A 3MV7B 1A4JA 1YC7A 4K7PY 5HHPB 3FB8B 5FF6B 3TZVA 1BM3H 2M26A 5C9JA 3H9SE 2Y0SA 5KYUA 4IRJC 3FCGA 5I75B 1AHWC 3KYOA 3L9EA 4BKLB 1GXEA 1FL5B 4JG0H 1UOLA 4X6CB 1M1XB 2DM3A 2WWKT 3B8SA 4XP6H 9CGTA 3HNSH 1T5XB 3MAWA 4EKJA 5F1IA 1DQQA 2QPEB 2XV6B 3L7EA 4GAGH 4XB8A 4LSDA 2VDOB 2Y4SA 3O6FC 1WITA 5ERWA 1F0LA 3QRGL 4ICXA 4DO5A 5DYFA 5E8PA 5IW1B 5C0AA 3KLAB 4PJGE 2NRDA 2BIOA 3N41B 3MFGB 3OKNB 3TN0A 2M83A 3BUBA 1QFUL 2W9EL 1Z0MA 3HE7B 3ESOA 3QIBC 4M8QB 4LQFH 1T1ZA 2NYKA 4FNUA 4PBWD 3RHWF 3B37A 3O3DA 2X1XR 5E99L 3F58L 4R9HA 4N2KA 4OZ4A 4S11A 3U0TA 3GHEH 1WFOA 1P5UC 3FQUA 3DSFH 4NQEB 4QRBA 1V3LA 2JELH 1H15B 5GGSB 4LF3B 4KV5E 3SOBL 3IGAA 2JLPA 3BPOB 4F92B 1MNUL 1IB5A 3PABB 4X0KA 3H0TB 2BP3A 1G7MA 2OSLB 5CBAA 3E8UL 4RQQB 4JFUA 2JF1A 4NKOB 2VDMH 5JXEA 1CXFA 3VJ6B 4ZI8A 3MLTB 4MA8H 3PIQA 4UYPA 4IKLA 4QXTB 2JJWA 5CMAA 2B1AH 4NN7B 4L3FA 4ZUWA 1IBHA 1AE6L 2MPAL 2IWKA 2NY7L 2V3DA 4ZOBA 1FFTB 3FSZA 3H55A 4QXWA 3CDCA 4XBEH 2WBWB 4L4TD 5BRZD 1PY9A 3VQ2C 1IGTB 2YD9A 3E9UA 2WXNA 5D96C 1TTFA 3NJJA 5IBUB 3TJHD 4AEIH 3X3FH 3PQYE 3GB7B 1FYTE 1WA0X 1FL6B 4PJCF 3W39A 5J6GB 4AZ8A 2VJXA 4TVPH 5EDSA 5EHFA 3N85L 4AQ1C 1UOKA 4MJ6B 4DGVH 2Q0ZX 3TVMC 1AQKL 3CHQA 2SEBA 4AZUA 2UY6B 5T33L 1YEDA 1Q9OA 3WIHA 2VXUH 2Z4QA 3TCLA 4YO0A 3L5JA 2WXJA 2CIKA 3DX2A 4HS6A 1D5XA 1GOHA 2N59A 2PW1A 4JRXE 1QEXA 3CLFL 1QASA 3WS6C 4YSAA 1R6VA 3BP4A 2BXYA 3MROB 4QWWD 3S3BB 2BSSB 5CGBA 1F45A 1UQSB 2P42B 3FFCB 1OGPA 1P7QD 3ZT5A 3WOVA 1A22B 5GRJH 4APQA 5JIKA 2HSIA 3ARPA 1HX0A 2F54E 4B97A 1EIBA 3IRZA 2EICA 3PWJB 1MJJB 2E3VA 1DSYA 3MMEA 4FF9A 3HUJA 4OCSL 3QIUC 3RNKA 1DVTA 3AMLA 3EYVB 3GSVB 3IDIB 4CNIB 2ZIDA 1NGPL 1CFQB 3D3VE 3H2PA 3MN8A 2VAJA 4LDEB 4XC1L 5D1ZD 1M2VA 5JR1L 3N40P 4YE0A 4WWNA 1VCBC 4QHUA 1HAUA 1TVBA 1WZ1H 2HFTA 5FDYA 4JZJA 3GSUB 3UAEA 5C86A 4DW2L 4FXKB 4OF3A 5KSUA 4JDVA 3WJMB 1BFVH 1GTFA 1HSAA 3HG1B 1YNTB 2YPLA 3ES6B 4MCYB 4W6WB 2XWTA 1EPFA 4XNXH 4BDVA 2NYYC 3OZ9H 4FQIH 1DBJH 4NKQB 4M4PA 3CFQA 1JTPA 4U0QB 1B2WL 5GGVH 2EIZB 3DX7A 3OJDB 4L4VB 4ZUSA 1UH2A 2MIZA 4JGUA 3MLUL 3NRPA 4FFVC 4XP9H 1I8UA 2WPGA 4YSPA 1TFHA 1M71B 5E1GA 3IDNB 4M7JL 4HPOL 3O3AA 1OCRB 1Z9SB 4U3HA 4M7KH 3EGXA 5D7KD 1JPTL 5KSBA 1BEYH 3MLYH 2APXA 3MRRA 4KZCA 2UZYB 3F01A 4TXVB 4F7CA 1QABA 4PJEA 1G0XA 4FHJA 1WBXA 3BW9A 3QPQC 5B1BB 2GFBA 2X28A 4JZJC 3NZUA 3HMXH 2YFNA 4DPCX 3MJ9H 1K85A 3A4DA 3BP5B 4NZJA 1T89C 2FBJL 4OD3H 2IPUK 3SB3A 3MA9L 5AVXB 1IILE 2QSQA 3ARYA 3L5IA 1X5IA 2IH1A 1EFXD 3E0GA 3G5ZA 4R8WL 2QQKL 5D7HA 4R3SB 2VDRH 2W0FA 4M6OH 5J1AA 4UZUA 1A14H 2EE0A 3NSDA 4CMHC 4DPAX 4JO5A 4HALA 2NUTB 1TG8A 4TUUA 3VRJA 1RIUH 1FO0L 1GVIA 1YPZE 3HFML 1OHZA 2APWA 4PJHA 5CHNB 1XGYH 2IBGA 3RVXD 3W2DH 2IGTA 4HH9A 4BRVA 2H0PA 3QDGA 2P1YA 2Q3XA 2J6EA 4RISL 2NR6D 1NAKH 1CVRA 4JFXA 4PGDB 1A6UH 4UINL 5DJYB 5ECGA 5JW5B 3GMNA 2KC0A 4AV4A 4DGYL 1J5IA 1V3MA 4UM9A 1KDIA 5KJ4A 3W38A 4RRPG 1ZTXH 3Q3GA 2VUOA 3QUMH 5ESQB 5FK9B 2YD3A 4Y4KD 2BIIA 1E8ZA 1UM5L 5CJQL 5KYXA 1ZKAA 5HYSG 1E27B 1JZGA 3D4CA 1LXMA 5ICZB 1NICA 5DHYB 3AY2A 1NGXA 3HZYB 4LVNC 4DP9X 2JI2A 1OSZA 4IMKC 1S9VA 2R2BB 3P02A 3NDZE 1ZXKA 3HFMH 5E2UL 1WCBA 4NQDB 3K6NA 2CBOA 1IFHL 5I15H 3EYQC 3C60D 4H20H 5BS0B 1PKQB 4NUPA 4PRAA 2XYCA 3MR9B 4TUJA 2C3XA 2LLGA 2RFXA 4PJ7E 1X6NA 4MB3A 4FD0A 4PWGA 3S3SA 4WNSA 4F2MB 3IJHB 2X4TB 3NGBB 4F3FA 3KBFA 1SLVA 1A3RH 5CSZB 5EZLB 4ZNEA 4Y2DB 4FQJH 4M7LT 2OYKA 5I15L 4OIBA 1KB5A 1M9WA 2OW7A 3D2UD 3TU6A 3ISRA 5J56B 2NNXA 1G9NC 1U3HB 1K5WA 4W9ZA 4DEUA 2A6JB 1PAMA 2W60A 5GS0D 4FX5A 4PS7A 5HI4D 3QA3A 3BSHA 4P5KB 2F7RA 3WTUA 3QFDA 5KWYC 5AVTB 4YSDA 2M1KA 4A2MA 5I8OL 5AZ2L 1UEMA 4E9SA 1NH6A 2WP3O 3VWKB 3ZZSA 5C3LD 2QSVA 4UT9H 3C2AL 1QSFA 2BNRE 2GJZA 3ABZA 5D1XB 2HPTA 1IBGL 4PJ9A 5AVQB 3TBVA 1L0PA 2KZKA 4U7KA 3V4VA 2H1PH 3HS0B 4L3EB 5PAZA 2YKLH 2H45A 1NEUA 2OLDA 4R0LC 3SE3A 4ZMVA 1B2WH 1S9KC 3CNKA 3GPSA 1WA1X 1YCSA 3RDTD 1N3NA 5ADPL 1U8HA 1JZ6A 4DPRA 1QSFD 4N86A 3RGBA 3E1ZA 1XH3A 3SZKC 3J2PA 1MFCL 4OIIL 4YS4A 2Y1YA 2ZWKA 5HGAA 5A6MA 4CC4A 2L7EA 2H6UA 3BH4A 4Y4KC 2KERA 5GS0H 3C6EA 2VR5A 4K3HA 3AREB 1H8SA 3VXPA 5C8JA 3ZE1F 1ZLUH 4ZS6D 1MVYA 3BQUD 3N1FC 2WXFA 4KGJA 4S0SD 4Y9GA 4Q8BA 5EU3A 4HDIB 4Y88A 4BFEA 1SDYA 2UWEF 3GXDA 2HB0A 2EIMB 4PYGA 2ZSWA 4BQ6A 4QHKI 4LLYB 2P8PB 4XCFL 5CD5D 5IHZA 1EGJH 3ECQA 3RA7H 2GITB 1R4XA 1IQDA 4L18A 2EXWD 3D30A 1S9YA 4U6YB 3NIFB 5G4NA 3LD8C 1NM4A 4RAUA 3MRBA 4MA7H 5B4MD 4IGBD 4NNYA 3ARUA 1T2QH 2A99A 4JANB 1RVFL 4PVMA 4D3CL 1WUNT 1D5RA 4Y2DC 2WZ5A 3C08H 2QADB 3BPNC 1JGIA 3US9A 1WZ1L 5IFAL 5AAMA 4BQCA 1J5DA 5FM5M 4XH2A 3QIWA 5C0BD 2K7QA 4HWZA 3BH8A 3GSNL 1KJ3L 3AUVA 3WLBA 4GRMB 2ZX8A 4JDTL 1XMWA 2ADIA 2J2ZA 4I0PA 2Z31A 3M88A 5B7FA 4H7VA 4DKEH 3WTVA 4L4TA 5BRZA 4Z7VA 5E4IA 3MYZA 5D1XE 4GQQA 1OD9A 3FMGH 4HUXA 1MCIA 2GAZB 3V4PA 3O2DL 4WUUB 4IKIA 2D31B 4DN3L 4ADJA 3TFKD 3IETA 5KBKA 2YPVH 4O2CB 5IVZA 7CGTA 2KZBA 3QQ3A 1OT1A 1QSEA 3U4EB 1I1FB 1G7LA 2QSTA 5D9SB 2E75C 3Q43A 5GJTL 2DS4A 2QMJA 4FEMA 2AI0L 4GRLA 5BZDB 2ENYA 1C7SA 1BWWA 5I1AB 2XTJD 2WLHA 5CEYB 2QL1A 4FLHA 4QO1A 4HEPG 1MWOA 1R3KB 3ROOA 4O02A 2P5WD 3LNGA 2X89D 5CN3A 3PGCB 1ZVYA 2PTTA 5L6YL 2Z91B 4OGZA 3TF7C 1CS6A 2QVFB 3D85B 1SYSB 1X7QA 5F3FA 1JZ2A 2MRYA 4X4XA 4PJXF 3SE8H 1OF2A 1A3LL 4BFFA 3F64A 3WNKA 1KFGA 3ARSA 3PL6D 4MXWH 3T0ED 3CLFH 3GMPA 4EI5A 4YNYB 4AV5A 4X42A 5DS8A 3BP7B 5GHWH 4WHYH 4YEEA 1BVKB 5DJXB 3SDXA 4AENA 4HUUA 3LSOB 4UTAL 4Q6IC 4XI5C 2VM9A 2X7LB 2FIKB 4G82A 3QIUD 3EBHA 3ZRCC 5KJRL 4PJGB 4Z3TA 4KNUA 3U0WL 4GW4B 1J0JA 4PUBL 2Y6SC 4WLCA 4OQTH 5KUMA 4I48A 2VLKB 1UKSA 2D2CC 4PB9L 1GSKA 2J5LC 4DP5X 2E27L 4QEGA 8FABA 1OY3B 4ZJ9A 4UTAH 3B9KC 2K9FB 1IC5L 2H0JA 4N87A 2WLZA 1Q9WB 2J8UA 1IBYA 1PD6A 2OMVA 1Z0NA 4QY8A 4HH8A 1BQ5A 2PPAA 1FNEA 2LW3A 5H37G 3TT1H 1BPVA 1IBFA 2RA1A 3RJDA 4NP4H 4DCQB 3TFBA 2YA1A 2X4NA 5A6LA 1AXIB 1RZJL 1VDGA 3MNVB 2YPKA 4FFWD 3JSSA 1AC6A 4QOKA 2B2XH 5FO8B 5D6CB 5H8DA 3P0YL 1MREH 4LIQE 2WO4A 3T0EC 4KAQH 3U9UA 1JFQH 3CLWA 5DD1L 5IEHA 1K3ZA 1UJTA 2YOCA 1ZEAL 4GFXA 1MNNA 1NAMB 2AK4A 1OE2A 2WIIB 3LH2L 1DJWA 2OTWB 3MLZH 2XG4B 3G08B 3T2PA 5IQOA 4TUOB 1TYRA 5CINL 1D5IH 4BRJA 4FXKC 1CPUA 1AR1C 2CKBL 5BW7C 4YDVB 3KCPA 3M17B 1G9MC 1CF8H 3BVDB 1BVNT 2H41A 4OCRH 5E9AA 4PY7A 3SBWA 5HJ3B 3O2VH 4OU3A 1OIOA 3CLEH 5F6IC 5EO9B 5D7JC 5KOVC 1GGTA 3A6CL 1MY5A 2OZ4H 3VXMB 2ZOKB 1JGUL 2VH5L 4KNTA 1KYFA 3NK3A 3VFNB 3L3GB 2TSBA 1FHGA 7FABH 3JV5A 1QX1A 1QO3B 3UYPA 4F8TA 2GJPA 3WD5L 4Z7QF 5GS1A 3GMLA 4QF1B 4KX9A 4Y4FA 1KJVB 3KGUA 4WUKH 5C09E 2VXUL 4FQ1L 2BZDA 4A6YH 1F3DH 4PJ9D 4LCYA 1WP6A 1E9QA 1GH7A 5ES4B 3HG4A 3WDHA 5CIPA 4I4WB 3S2AA 1CR9H 3O3EA 3SE9H 1U4FA 5E2TL 4R96B 3VG0H 5FA4B 2BCKA 1LDPH 1N8OE 2ZX7A 1DBML 2A83A 4TTDD 5G5DB 2N1TE 1FH5H 3GMQB 4MAYA 4OIAA 1GA2A 3H2QA 3X14A 4EN3B 4OLWH 2W9DH 1G9NH 3RL1B 2OR7A 3GHBH 3E38A 2AJUL 3BFOA 4S1RH 1AD0A 5E94B 2YC1A 3MLXL 3GS7A 3OKDB 1KENH 4MA8L 3ZVVA 2FVNA 5I2IB 1KCSL 1VZGA 4M1GL 5DHDA 1GC1H 2NNAB 4F80A 1S7XA 4NQCB 3CGTA 4ETQB 1F4XL 1BOGB 1MAJA 3OR7B 3QG7H 3HAEG 3QNXB 5EOTA 1Y1DA 2ZTBA 3T77A 4YSEA 1MOEA 5ILTH 5HYSA 2AJVH 4XMXA 4N2OA 5HVGB 5K9JH 4W9DC 5JA9A 4NENA 2V4LA 3VXMD 3K6DA 2J55A 3GXIA 5GPRA 3X11A 1JNHB 2ICEC 2WWMC 3HB3D 3D2UB 1DQDH 4RMWA 4B53A 5ACZA 1C5DB 5I73B 3C2AH 1E5BA 1XEUA 1RCYA 2FX9L 5CP3A 4AJ0A 1LL1A 3PAYA 5D70H 3KJ4B 2DBLL 2DLGA 5IROC 4PWEA 2Z0UA 2OMZB 1ZY9A 2XZCH 1CL7I 1TTCA 4MSWB 1ZHKB 4UM9D 5E6ID 4F15C 2DJ4A 3VXUD 2G5RA 4KJQD 5I76A 5I71B 4QRPE 4IK6A 4Z7UA 2Y23A 3BKJH 3RKPA 1EHLL 2XTJB 1R9FA 1INQA 3JT2A 3RG1C 1KC5H 4QHNB 4E9TA 3LXUX 2EDJA 3QPQD 2AJXH 1A9EB 1MQKH 1JXGA 2J88H 4PV8A 5DRNB 1HHJB 1YEEL 2DQ6A 4POZD 4XP4H 3GXUB 2ZP8A 1HKLH 4QCIB 3ZIYA 3FXIC 2PPEA 3FT0A 1UENA 2H0FA 2Y2TA 2X9YA 4QRRD 1FZJB 2J72A 4E42B 3CCHA 2HKHL 1NTDA 4M93B 3DO3A 1VKXA 3LN4A 5T5FA 2JJTA 2JKSA 2QJDA 1I9IL 3P2BA 2A9CA 3BXNB 4ZMAT 2FD6H 2CDEA 3FHAA 3GLDA 4NBYB 5CJOH 1Q0XL 1AR1D 4ZDHA 4AOFA 1XZ0A 5EBMA 1UA6H 4JQXA 5SWSA 3QO0A 4XOCA 1ED3B 4LSPL 3KPLB 1AC0A 4XN2A 1ZV5A 4RGOL 3BAXA 3NIGF 4LKXA 4ZQKA 3WN5A 2OZ4L 2ZOWA 1XGQB 1BQUA 4G5ZL 4HK3N 4NNXA 4ORGB 4BKSC 5IFHH 5M7QA 1NJ9A 3AADB 4POUB 1W15A 3IJ9A 5E4AA 4GYBA 3OHXC 4ZW7A 1BIIA 3I3EA 5KBLA 5IVXE 1ZRUA 2FHCA 3HZMA 1QFOA 4HFUH 3ZZLA 1WD9A 3GGWA 3T0EB 4A04A 1V3KA 1DO6A 1BCIA 1E9OA 4KI1A 2ENPA 1SEBA 3F7LA 4XBMA 1IL1B 1CURA 4MASA 5ID1A 1MRDH 1KIRA 4NB7A 3DIDA 4BZ2L 2F8IA 3U25A 4DO6A 4NZFA 1UGKA 4X6EB 4ZFOA 4N0RA 3FBKA 1COBA 4NPYB 4QXUH 1WZKA 4NRXB 5DUBB 4ELMF 3EOTL 4IRSB 3RX7A 2DTML 1DYZA 4ODUB 1DBMH 2PWDA 3UAFA 3ULSB 4LSUL 3KPTA 3SQBA 5HHME 1J05A 2R0LH 1FBIH 4AVHA 3TURA 1VFAA 4LNVA 4Z7QB 5GJSL 2ED9A 5DTFA 2KLTA 3D0VA 3Q44A 2IAMC 4OW6A 4JPIA 1IO4C 1DL7H 3STBA 2GJ6A 4Y4HC 3DXAB 1DN0B 2EABA 3VU1A 4JKPH 4R4BB 3K2IA 4ZO6A 2LVCA 3IYLW 3QAZC 2ZOLA 4UAOB 5K1NA 5H94A 2EDMA 5KSAB 4HCFA 4F58L 5DZJA 4JR9H 1CLYL 3A6CH 4HIEB 1KN4H 2UY7B 3RGVA 4CAGA 4JMNA 1W9XA 1EX0A 1FG9C 4WDIB 3HHSB 4PVBA 3ZZ1A 1J86A 1KGWA 3HC0A 3MX0A 5E2UH 4PV1C 4KOBA 3BLBA 5FKAA 4M7LL 1QRNA 3GBLA 2DQHH 5F9DC 4LT7A 3UTPD 1HIML 1RZQA 1INEH 2BRRL 3LIZH 3KLSA 4MQ7A 4QHPA 5EWIH 5DSCB 1FA4A 4PRPB 3VMOA 1L7IL 1LE9B 4JJHA 2VL4A 5F1OB 4FQXC 4NHCL 1KIPA 4MA3B 5DT1L 1UM5H 5HD8C 2DQJL 2R1YA 4KKBD 4KX7A 1WG3A 2YN5A 2F1AA <