3CVBA

Regulation of protein function: crystal packing interfaces and conformational dimerization
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
ETFTVKMGADSGLFQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Regulation of protein function: crystal packing interfaces and conformational dimerization.
pubmed doi rcsb
source organism Phormidium laminosum
molecule tags Electron transport
molecule keywords Plastocyanin
total genus 23
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3cvbA00
1A8ZA 4HHGA 1JZJA 2XX0A 5B1AB 4KNUA 2EINB 2OCCB 4AZUA 2FQGA 3T6WA 3X1FA 1WAEA 1AOZA 3C75A 3DTUB 1IC0A 3N2JA 3X1BA 1FA4A 3NSDA 1MG3C 2VMJA 1AZUA 1BQRA 1ET8A 4E9SA 2GIMA 4GY4A 6PAZA 2I85A 4YSPA 3QJVB 2VN3A 3UAEA 4YSSA 2FT8A 4DP5X 3JT2A 3WI9A 3UAAA 3QJRB 1W6LA 2YAEA 4M4RB 4KO5A 1PNCA 4YVUA 1J9RA 1N68A 4NERA 2BZCA 1SHXA 2UX7A 4DP6X 3X1GA 2IDTA 1NINA 2BP8A 2HRGA 5AZUA 3IN0A 4E9QA 4TXVB 1N70A 4ENZA 7PCYA 5AFAA 1ADWA 2AVFA 4NB7A 4MFHA 4BWUA 1ID2A 4HZ1A 1NPJA 3UACA 2VSMB 4HCFA 1PLBA 1SFHA 3NJLA 2R7EB 1UATA 3FU8A 2RACA 1EZLA 2PPCA 2BW4A 2PLTA 1MZZA 3NP4A 3S3BB 2FQFA 1J9TA 3NSFA 4E9VA 3AG2B 5I6NA 1AIZA 1DYZA 1ASOA 1DZ0A 2IH8A 2YAFA 2EIMB 3WIAA 5I6OA 1WA1X 4ZK8A 1QNIA 1BQKA 3PAZA 2AZUA 4YSCA 2ZWNA 4GP4B 1OOWA 2NRDA 2QPDB 2WSDA 2CUAA 3T9WA 4G7RB 3WNIA 4CSZA 4DP1X 4UF7C 1JZHA 1B3IA 1ZIBA 2YAPA 1SF5A 1AS7A 1XB8A 4M3HA 5F7AA 5I5IA 1KDIA 1GYCA 1SHWA 2VM3A 3CZUB 3KW7A 3S8FB 2VW7A 3FU9A 4DP8X 3FU7B 4DP9X 1A3ZA 1SNRA 2PP7A 3FSZA 4G72B 1OCRB 2QT6A 1A4CA 5TK4A 3IE9A 1XB6A 5B3SB 1AQ8A 1JZGA 5FC9A 2WO2B 4X4KA 2AFNA 5B7EA 3S3CB 2W8CA 4JKNA 3NJHA 4YSEA 4BDVA 1JZEA 1JERA 5B1BB 4BK5C 1NTDA 1CYWA 2CCWA 2VSKB 3V9CA 4DP2X 3IBOA 2DV6A 1PZBA 1NIBA 2HX7A 3OMIB 4Q89A 3N55A 2HRHA 3ZBMA 1HAWA 3SBRA 2FQDA 4KNTA 2BWIA 2UXVA 1PCSA 1AR1B 4A68A 2MTAA 1NWPA 4F2EA 1J9QA 3ERXA 1J5DA 1E5YA 1E65A 1AG6A 3IEAA 1ZPUA 2ZXWB 1JXGA 2N0MA 2XYBA 1RCYA 4DPBX 2XXGA 3QJTB 5B7FA 3U25A 1GSKA 2TSBA 2UXFA 1HFUA 2GI0A 9PCYA 5I26A 1TEGA 2YXVA 4A2FA 1TEFA 2J5WA 3ABLB 4EF3A 4DPCX 1A65A 3EF4A 3NJJA 4DP7X 3CVDA 4YSUA 4BWTA 1HAUA 2GBAA 2YQBA 2WO3B 2HXAA 5I5MA 3HEIB 3AG1B 8PAZA 3X1NA 3FQYA 1AACA 1L9RA 1SDDB 2J57A 1CYXA 4WTQA 2P80A 3V9EA 1AS8A 4F2FA 1NIFA 2BP8B 3BVDB 3UADA 4L0PB 4A66A 4K9JA 2BP0B 3OM3B 5I28A 2CJ3A 1EHKB 4E9WA 2XX1A 4CSPA 3FQ2A 1ZV2A 1E5ZA 3QPKA 1J9SA 3D12B 1YLBB 2XUWA 2FTAA 2TSAA 2BW5A 4Q8BA 3T6VA 1WS8A 3HB3B 2IDQA 3EH4B 1BXVA 1AAJA 1T5KA 1KYAA 3MX0B 2VW6A 2PPFA 1AZRA 1WS7A 3NJIA 2PP9A 1IKOP 2YAHA 3DIVA 3WG7B 5E9NA 1XMEB 2IAAC 3ABMB 4KOCA 2FT7A 4RH4A 4PCYA 2DY2A 2OV0A 2B3IA 3PPSA 1KCBA 3ASOB 1AS6A 1A4AA 3T71A 1OE2A 1PZAA 2DWTA 3PLYA 5B1JC 1KCWA 3NJNA 1ILUA 2H5UA 3CVCA 2P80D 1JOIA 2CAKA 3NT0A 4G7SB 1L9PA 4GXFA 3ABKB 1X9UA 1XB3A 3TU6A 3PCYA 1ZDQA 4W1TA 4YSOA 3OD3A 1AZBA 7PAZA 3EH5B 2H47C 2YXWA 3AW5A 5B1JA 4AKQA 3ZIYA 1CC3A 1NICA 5D4IA 2AANA 2XV3A 1GW0A 1PMYA 4A67A 1IUZA 3QJSB 1CURA 2HZHA 3KW8A 2W88A 3BQVA 1PAZA 1NZRA 2BHFA 3FSWA 2I7SA 1ZIAA 3L45A 3PXLA 2XV0A 2A3TA 2JKWA 1KV7A 2E86A 5B7MA 1PZCA 1L9OA 2Q5BA 6PCYA 5IY5B 3UABA 2DWSA 1OCCB 2XWZA 4UAHA 3FPYA 1NDTA 1KDJA 4FA7B 1L9SA 2H3XC 4KO7A 3GDCA 4QKTA 4YVNA 4QLWA 1JVOA 1TU2A 2PP8A 2R7EA 2UX6A 2J55A 3CDZB 4G70B 2IWEA 4DPAX 4DP4X 5LDUA 2QDVA 3WKQA 4N8UA 4UANA 4HCGA 2FNWA 4HIPA 4YSQA 1E30A 4HCIA 3MBWB 3H4FA 4E9YA 5A7EA 3ZDWA 1RKRA 4YSDA 1GR7A 5D4HA 3NP3A 2XU9A 2JFCA 1M9WA 2YAMA 3TBCA 3QQXA 3ABGA 3QJQB 2BO0A 2Q9OA 1PF3A 2GC7C 1R1CA 4G7QB 3FYIB 2GB2A 2CBPA 3CVBA 3NJFA 2DYRB 1ILSA 2IDFA 3GXUB 2EILB 1MZYA 1OCOB 2YARA 3OMNB 2BWDA 1RZQA 5PAZA 2DYSB 2YAQA 3WKPA 4E9RA 3QJUB 1JVLA 3S8GB 1AZNA 1NWOA 1GS8A 3GYRA 3WNJA 1IBYA 4F7KA 2X87A 3JTBA 1MG2C 3TBBA 1URIA 2MRYA 2HLEB 5D4JA 4A2EA 3FSAA 2FJSA 4KO6A 3H4HA 1OE3A 2XXFA 2HX8A 2J56A 1OV8A 1KBVA 3X1EA 2PCYA 3IN2A 3AG4B 1V10A 4AKPA 1RZPA 1JXFA 4HHWA 5PCYA 3UGEA 2CALA 5TK2A 4GP8B 2UXGA 3EHBB 4YSAA 3FU7A 1NIEA 4P5SA 3NYKA 2LLNA 3PAVA 2VM4A 2FQEA 5I5JA 2AZAA 3EH3B 3PAUA 1NIAA 3NJGA 4E9XA 4NAJA 1BYOA 1BYPA 1SF3A 2OJ1A 1NIDA 1PLCA 3FYEB 3SBPA 4KO9A 1ASPA 3CDZA 1OE1A 5AKRA 1FFTB 4E9TA 2IWFA 3FT0A 1E67A 2UXTA 2IWKA 5I6LA 3NJMA 1BXAA 4YSTA 3AY2A 3ASNB 3TASA 1MDAA 1FWXA 1SDDA 4AI7A 1V55B 1PY0A 2GC4C 1ZDSA 2IDUA 1BEXA 1ETJA 3NSCA 1KGYE 2XVBA 3S3DB 4GYBA 1CUOA 1PNDA 1ASQA 2Y1AA 1W6WA 1SFDA 1X9RA 4A2HA 2EIJB 5I6KA 1F56A 1WA2X 3X2QB 2YAOA 2PPAA 1M56B 1A4BA 2X88A 4KOBA 1NPNA 1L9TA 1QHQA 5F7BA 4WKXA 3FPXA 2PPDA 3RYMA 2GSMB 4AKOA 1V54B 2IH9A 4YL4A 1AANA 1JZIA 4A2GA 2IDSA 1OCZB 1M57B 1AG0A 1QLEB 3AG3B 3OQRA 3G5WA 3FQ1A 2FWLB 4A2DA 1BXUA 2EIKB 2PPEA 3ZX1A 3T6XA 4JHUA 5EHFA 2JXMA 2PCFA 4GP5B 3SBQA 4P5RA 3H56A 3NSYA 2ZONA 1I53A 3DKHA 4PAZA 1GS6X 1IBZA 3AZUA 4KNSA 5ANHA 1BAWA 4BXSV 1GS7A 1VLXA 3FS9A 2QDWA 1BQ5A 5I6MA 3NJKA 1L9QA 4BWWA 1TKWA 3SQRA 2BP0A 3T6ZA 3CG8A 4HALA 5I6PA 2VW4A 4BXVA 2I7OA 2BZ7A 1OF0A 4BDVB 4JHVA 2XLLA 1WA0X 5B1KA 2ZOOA 1PLAA 1ET7A 1GY2A 2HX9A 1J5CA 4G71B 4FAAB 3OMAB 4W9ZA 4YSRA 3TA4D 4HAKA 1W8EA 2B08A 4DP0X 1GY1A 4AX3A 3FSVA 1KBWA 2GHZA 1AZCA 1SJMA 2QPEB 2FT6A 1JZFA 2XV2A 1ET5A 2Y69B 1JXDA 4N4YB
chains in the Genus database with same CATH superfamily
1CF1A 1AD9A 2WUCH 4WCYH 2OTUB 3UTSA 2FQGA 2JK5A 1OALA 1GYWA 4OJAA 2HYMA 1IAIM 2CHWA 1NBQA 1QFPA 2VDLL 2DMGA 2J8HA 1A8JH 3W9EA 3GSWA 4X5WB 1LEKA 5I1CL 2GIMA 4JKKA 3GZKA 2WQAA 1T4WA 3L3DB 2CR6A 4PWGA 4NT6B 5I0VA 4PW9A 2ZZUT 5EWIH 3VFGL 2NTFB 3GJEB 3OC8A 4M48H 2XIIA 3QHZH 3IJ9A 1CD9B 4NUGL 1CFSB 3BC9A 4IRSA 4L9LC 4UTAL 2Z0UA 3RWGB 3L4TA 2WBJC 2WXLA 2DQUL 4FQQA 5SX5H 4XI5D 3TA3D 4YO0B 2FSDA 3ARFC 3F5WB 1XV8A 3WY3A 1C08B 4P5KB 1IIIA 2YBRB 5JHDA 1KN4H 1Z5LB 1YECL 3DETC 4JHAL 4MA8L 4QT5A 4AMKH 1BM3H 2ZWSA 4NO5A 4PREA 2A9ML 5JDSB 1AOHA 1YEJH 5FCUL 2OX5B 1FNEA 3MAWA 2DDQL 2F1BA 2HFTA 2CO2A 1NPJA 4KI5E 3RZCC 2BSSA 3WAKA 1UEYA 1VPOH 1F0LA 2DI8A 4NUPA 1GGUA 1J8HE 3Q2LA 1UATA 1CLOH 4ZD3H 5K9QI 4U1LB 3A22A 4GXUN 3G6AB 3VXMB 1PZ5A 4UU9B 1PEWA 1MJUL 1UA7A 3OJVC 3NOIA 4OR1A 3S36X 3TBSA 5I6NA 2EUXA 3HN3A 4LLWB 2MKLC 1OGTB 3ARXA 5T8IA 5I6OA 1FIGL 1FO0A 1TF4A 2NZ9D 3WNKA 2QR0B 4JFEB 1OOWA 2NRDA 2V7HA 1GRWA 4Z95L 4G1MB 4G7RB 4B41A 4KZCA 2H2PC 1BF8A 3P77A 4DP1X 5LLIC 1HESA 1RMFL 5A2AA 5FXCH 1JZHA 4X6DF 1NANH 5GGTH 1UD5A 4WHTB 1VAHA 3VFMA 2GEQA 2KDGA 2C4XA 3Q9PA 4RMTA 3DX8B 3GBEA 1I1YB 2APXA 4G9DB 5LN8A 2YGQA 3K7UA 4EDXB 3X17A 1JPSL 2MCPH 6CGTA 3D51A 2FBRA 5HVFB 1A4CA 4KZDL 3VDBA 4TKWA 1IM9D 1HHIB 1HILA 4JE4B 4UQIM 1HJCA 1ZGLA 1AQ8A 4RA3A 2AAAA 2LT9A 2WXFA 2XOTA 3EO1B 2VCOA 5H37A 5DMIL 4KKCD 3TH4T 1P5UA 1OAYH 3IXTA 5EFIB 4QYOB 3AQXA 3IBOA 4A7GF 2V2WB 5IVZB 3IXAA 3HBZA 1HWGB 4MJ5A 2NXYC 1YRKA 1A4KA 1SHSA 1KEML 4GRMB 3TIDA 4R2GD 4B95C 5D1XB 2VT0A 3VFWB 4X4ME 1PCSA 3WHE1 1XR8B 2W60B 3CC5B 4WTZG 2CR0A 5E00A 3TO4B 3VA6A 4NPYA 3CWGA 4RMQA 5IG7A 1KCRL 3S97C 4FNLH 3CMGA 3U2SB 1J5DA 1UEMA 2WJ7A 4FXLA 3QI9D 1ZT1A 3V7AE 1ZPUA 3IMRA 2MSPA 5E2VH 1DCEA 1JXGA 5MP6L 5IB3A 5CZKA 4MJIE 5EZOL 1B0GA 3BPCB 1F45A 4U1GB 4DPBX 3BFOA 3BWUF 4NRZB 1D5IL 1FNHA 5CGYC 1UOKA 5C7ZA 3N85L 4AEIL 3H7BA 3QUMB 4M9PA 4OQTH 4HKBA 3ULUF 5I1LA 4JGNA 3GIZH 2OL3B 4PRHA 4BZ2L 3IDGA 4IHOB 4Z7AA 1BBDL 4JM2D 2R2BA 1BZ8A 1U8QB 1H3UA 2A73A 3GMPB 4NO3A 2PETA 4RDQF 5ID1B 2P5PA 5I8EA 4B0MM 8PAZA 4WFHE 1UADC 2G4EA 1B0WA 2DQFB 3ARBA 1E9QA 3CK0L 3T4AC 3GI9H 2BFVL 3L5JA 1W9XA 2WHVA 4NCC2 5D8JL 1KB5A 3BPNC 3PFQA 2JV6A 3O0RL 4X7SH 2W9LA 1XCTB 3OM3B 3OKYA 3VRJA 5EIQA 2DBJA 3L1FA 1PEZA 4R7DA 1WIUA 2BIIA 4YR6A 4HD5A 5HHVH 1IL1A 1JNHB 4E5XB 3KXFB 3ARBC 5C1MB 2HJFA 4NNXB 5C3LD 4GFXA 4AYMC 3B2VH 4DWHA 2JELL 2OXHB 3EH4B 5FO7B 5IJCC 2AXFA 3A4FA 4X7TA 4RBPK 1WWWX 2VERA 3CZFA 2VE6B 4F58L 1I8AA 5AKVA 3SJVA 1NFDA 2BHYA 1N4XL 3NJIA 1U8CB 2NMSA 3Q8CA 4DKAA 4NC1C 3X3GL 4FG0A 3QIBD 1M71B 4KKAC 3AXLB 4QHUA 4N1HB 5EULV 4PJDA 5FYLE 2DLEA 2JTYA 3UG4A 1SY6H 2OTUA 1FHNA 3OZKA 2RH0A 1MAML 1ZWIA 2BC4B 2QLYA 3BLKA 4L2YA 3W0WA 3OB0K 3T71A 2NNCA 3P0YH 2Q1EA 1WZLA 2AV7A 4WHYH 3RU8L 5HHMB 1R3IH 2ZAIA 4N5EC 3D85A 2IOMA 4O2CB 3S36L 2VLKE 4K3DL 1G4RA 5DJ0B 1OAYL 3BJLA 2Z91B 5CZRA 4LLVA 1JNNL 3TU6A 4AQ8C 1IAOA 2F18A 3PCYA 4W1TA 5DMIH 1CICA 2E7HA 3MRGB 3OD3A 4XR8C 3VG9B 2PWFA 2EDXA 1UXSA 5TE7L 4YN3A 4CW1A 5I1AB 1NICA 3B2XA 4CDGC 3Q43A 5DMKA 3MR9B 2G3MA 2ED7A 4I3RL 2HZHA 3LS4H 1JGDB 5KVDH 2VC2H 2CU9A 2Y7LA 3QNFA 3SQOL 5D1QC 4JX0A 2BHFA 3TEZA 1B0RA 2G3ZA 3L7FB 3V0EA 2C34A 2X4TA 2JKWA 3ARFD 1W15A 2BVOA 1T4KA 1XZ0B 3CNKA 1KGIA 1PZUB 1RIUL 4MZ3A 1BP3B 5IY5B 4WV1B 1LEGA 2FUTA 3O6KL 3W2DH 3VXRE 4TLUA 1NUGA 4LSSL 1G9NL 1MY7A 2H3XC 3TPUA 1OT4A 4LHUB 1JVOA 1OB0A 2ZX9A 2J55A 3CLEL 5KVDE 2J44A 5LDUA 1CBJA 3FQUB 3OHXB 3U46A 1EHAA 2WZ6A 2BMKB 1LTXA 1XGPA 5IMOA 4XOBA 1BA9A 3QPQC 3NFNB 4NHCL 2EADA 1FORH 4PHZA 1H8NA 2E8ZA 4YSDA 1XGZA 3SE4A 2G60L 4ZTPL 5KW9L 5GS0D 3VRIB 4HS6A 3ABGA 1U58B 1COBA 1PF3A 5JDSA 4HHAB 2L7UA 2GB2A 1J1PH 3GTTA 2QSTA 3LKNB 3BUIA 4KX7A 3VMPA 1JF1B 3U0TA 1TFPA 2SEBA 5C07B 3UTPE 7FABL 1K8DA 1U3HA 2GJPA 4FQ1H 5HHOD 2DYSB 4V1DE 1NGWA 3ARYA 1F6AA 1RHFA 3GMNB 5AL0A 2WZPA 4XBEH 1G7IA 4GIAA 3T77B 3SYPA 1QVOA 5D7LD 3NRPA 3K46A 3VM5A 3S8GB 5FKPA 1NCWL 3GTVA 5F1IB 1U8NA 4GKNA 4BA8A 1OAQL 4MWFA 3K6FA 3WENA 4AEIH 1YEWA 4JRXB 4D9RE 4ZFFA 3HFMH 1TETH 1K5NB 1F4YH 2YHGA 3LDBB 4W9FC 5C0AD 5A7BA 4PD4J 4ODWB 1E27B 5CD3A 4PRDB 4QNPE 5K9JH 2G9KA 2QSVA 3V4PB 4HWUA 1CE6B 4PJIE 4XMZA 1TITA 3WFCL 4K7FB 3CE1A 2OJZL 1MRDH 2I5YL 3G6DL 1MFAH 3N44F 2OI9C 4EIZC 3B5GA 1M05B 5F7YC 2X4RA 4HUVA 1MFDL 2XTJC 4POZD 2AZAA 2YD2A 3TN0D 5KN5B 3BSZA 5T5NF 2VISB 4LSQL 3LRMA 3ZTJH 1JMXA 5D7LB 2XFXB 3MJ7B 2AEPL 5DYOB 1UURA 4HFUL 1HU8A 1IGIL 1LNUA 3AJ7A 4PSPA 3EJYD 1DL7H 3O3BB 5JZ7C 1R3HB 1JWMB 4YHOH 2ZNXA 3L3GA 5TDOB 4N2LA 3Q1SL 3DUSB 4GRWE 4YSTA 4IOSA 1S9KC 1QBMH 2G0LA 3GZPA 2V9TA 1JXKA 2SODB 4B9JA 3W9DB 3RVTD 3GXPA 2FH8A 2G60H 2V6HA 2KC0A 4S1DD 5F0MB 1DHKA 2XVBA 4KUZH 4LCWE 4JW3A 4MMYA 4UUJB 3MTRA 5IQNA 4JQXC 4HEPA 1WT5C 4S0HA 3QO1B 2IANE 3P9MB 4X6FB 5JIHA 3D34A 1UM5L 4P5TC 2GIXA 1D5IH 1JHKL 3FHAA 4X6BA 3FDWA 3W39B 1DUZA 5DJZA 3UCRA 3S3PA 2PPAA 4N90E 4CVUA 4AEFA 4PRNB 1LO3H 3QULA 4WKXA 3CDGB 3CN1A 4BQ6A 4KTGA 2RJMA 1XGRB 2XRAH 4OLYH 1CR9L 3ZTNH 4YL4A 5E6UB 3SKOB 3VFUA 4NNYB 3Q3GA 2UZIL 4PRAA 1EA9C 2ZYRA 3G5ZB 3L5IA 3O2WH 1MJUH 5HDBB 1UM4H 1IEBB 4I3RH 3K0YA 4HUCA 5DHVB 1MHPL 4GO9A 3MLYL 2UZPA 3ARZA 1GAFH 3LZFH 4XMUA 5EA0H 3AAZB 5EBMA 3GZQA 1RFDL 1LEIB 1IBZA 1SLVA 4ZDHA 3SGEI 5C3TA 4Z3GA 1BQ5A 1WCQA 2BY1A 4HJGB 3UPRB 1T5WB 1H3GA 1EQWA 3BP7B 1ZSDB 4XN4A 1D7BA 5GHWL 4P59H 2PCPB 2BZ7A 2NR6C 5EBLA 2X0WA 1I7UB 3DO3A 1WA0X 2NW3B 5D7JB 4Q6YA 1P4LA 4YHIB 3QAQA 2HTLC 2HX9A 4M7LH 3AT0A 1NFIB 4XAWL 2A2QT 5LG1A 3UAJD 1UH4A 2GJ6E 5IBUG 4YSRA 3BE1L 2JF1A 5BMFL 1W72A 3X3GH 1RULH 1N6VA 5LQBL 2C7UA 4H0HB 1JRHI 3WN5C 2JKRM 3G9AB 2W0FB 1KENH 5E6IA 3WKNA 2GHZA 2NDGA 2I60L 3KWVA 1UXLA 5HDLA 1B88A 1K8IA 3CZFB 5SWSA 5I1GL 5J1AB 3PGDA 4G8AC 5DO8A 1MJ7L 5B1AB 5E9AA 5EUOB 5I6XC 1CFTB 5DC4B 4DERA 3TIEA 2IALB 2HKAA 5D93C 5GGUA 5LXVA 2AJUH 5E6IC 2X05A 3C6SA 6PAZA 1VHPA 2VN4A 2P45B 4NQEA 2LTQB 4LCCA 2O5XH 2VDQH 4GRWF 2PYFA 2ZOKA 4QTFA 4MAUH 1MW2A 1QW9A 3WI9A 1DO6A 2ETWA 3VFRB 4KKBC 2WVVB 2ERJC 3AS1A 3CFKA 5GS1C 3BP6B 4Z78A 4CGUB 3IPBA 4JANA 1N68A 1JG9A 3L4ZA 3KYKH 4Z7QF 4Z76A 2AITA 2ZUSA 1F1DA 5HI4C 4UOW1 4DETA 2JLLA 3ARDB 3UAJC 4C56A 4ZMQA 1U95A 2IGTA 3L3HA 5MEOA 4G42B 1Q0XL 1X4ZA 1T0NA 2MQGA 4Z7QB 4MX7B 4YDVB 4EPSA 2BWQA 2O6EA 4PY8J 5H4ZA 5IB2B 1KBBA 4LK4A 1RZ7H 3D06A 3AS0A 3I6LE 4HS6B 4OZHA 4WUUB 3VGHA 4I3SL 2VWEC 4M5YL 5C09A 2CO6A 4W9CC 3T08A 2QLVB 1IJNA 1ID2A 1AKJA 3L5HA 4FTVD 1XCXA 5AD0B 2ZXCA 4F7PA 3B2MA 3FFDB 4GUCA 5EIIG 2G5BA 4PP2B 3C60C 5HHPA 3RHWF 4NPYB 1AE6L 2RACA 4L4VE 4XCFL 2WINA 2A0LC 3MX0A 2A83A 4RFEA 5EU7C 1D9KB 3EGXA 5FHAL 4PRPA 1KULA 2Z35B 4UUJA 4CMHC 3GB7B 5GRUH 2P26A 4LLUB 2Z8RA 3EYUH 4PI2A 4WFED 3AG2B 5T3XD 3ZT6A 4EZLA 1T6BX 4LQ1A 1DVUA 5DJAA 4F9LC 1ASOA 1DZ0A 2IH8A 5E0FA 3RGHA 2WXNA 1A3QA 2B59B 2OA9A 5CGMA 3OPUA 3O6LH 1LD9B 3SGDH 2ZWNA 4Q4IA 1FYTA 5AYQA 3T3ME 3BVXA 4JL2A 1JPEA 1CIDA 1NSNH 3FZUD 5AOMA 4OZ4B 5FWRA 3UYOD 5DYOA 1MI5E 4JPKL 4QXTB 1DBKH 1NC4B 3TV3L 1KXVA 1MW3A 3BP7A 4HP5A 4DCQA 5FW8A 1AI1H 3PNWB 3ATDA 4G8EB 1DQQB 2X9ZA 4JO4H 3KLAB 4N0RA 4NZRH 1LDPL 4HUVB 4JPWL 4JFUA 4NP9A 4PRBA 4QHNA 5F3BA 3WFCH 3EJTA 3ZT5A 4XNYH 4FXKB 1N12A 2VMDA 2JXMB 3H9SE 2XA8H 3FJTA 3MXVL 4LCIL 3TBTB 4HUKB 3QZLA 5HGDA 1G0DA 5E4AA 4JPQA 3B7UX 5GGRA 4XPGH 5JZ7D 1MCFA 5TK4A 2MCMA 1AO7A 1WQVT 5CIPB 3QQ4A 5I19L 1M7DB 3NQKA 4LRIC 1EZVX 1A7QH 1Q0YH 3UYRL 2QKSA 3LYRA 3F7VB 4LIQL 1W80A 4PB0L 3D0LA 4IBTA 3DRQB 4ZZFA 3FTVA 5B1BB 3F05A 2GCYB 1CXIA 5C0GA 2OMVB 3FH5A 3ZE1B 5DLML 3HB3D 4XPFL 4CGTA 3ZBMA 3ARSA 3GS4A 2VYRE 3RP1A 3SBRA 1PD1A 3SJVD 2DQDH 1U8OA 4N8VG 4O58L 5BNXD 4ZS7H 1I3RA 3P4NB 1A47A 4L0ZA 4B9YA 3P3YA 1QNZH 5I8CB 4QJ4B 3N1MC 4BSWA 2MCG1 1JN6A 4LCYA 3GQFA 1XHHA 4GSQA 4N1CA 4A1RA 4D0BB 1G7HB 4DO5A 1F2QA 4LSRH 5L88H 2V3FA 4TL5A 1BECA 4YZFF 9PCYA 1HX0A 3HZVB 3IFNH 3K4ZA 4RCAA 3ZZSA 4UQEA 2FZ3B 4EF3A 1FN4B 3JUZA 3FRUA 4PRPD 3S3JA 3EGSA 4PJEE 1AD9B 1SVZA 4JDVA 1GHFL 1U93B 3EYQD 1SHMA 5E8PB 1FPTH 2B15A 4G43A 1B4LA 1D2PA 1A6AB 1EZVY 2E4FA 4XNUL 5EG6C 4J6IA 4ALAL 1E3ZA 3WMPA 3ZE1F 5GS0C 2R15A 5DZJA 1TO5A 3CN0A 4IYKA 1BZ9B 4WDIA 1RQ5A 2OFQA 1DVXA 5I28A 3BH9B 4P59L 1D9KC 5AVQB 3S37H 2VDMB 2AK4E 1J0JA 3LXBA 5GZOA 4N6QA 1ODAA 5ALCH 1JHLL 5DGQA 3FO0H 1L3NA 3QCTH 3OF6D 5A6IA 1O9WA 5KN5A 4UM9B 4G1EA 4R3SB 3S5LB 3HOGA 4WWOA 1JD7A 2E75C 2IDQA 3L6FB 1MRFH 2XG4A 4JY5H 3BP5B 1D9KA 3ZL1A 4HQQH 5J3HC 4N2MA 5CSGA 5DJCB 1T03H 2CM5A 4A2LA 1KT2A 1GGIH 2J1WA 5T5FL 2ED9A 4HPHA 2AEOA 4B9KC 4B7IA 4L1DA 1UXMA 4XCEA 4BRJA 1HZHH 3FQWB 4FI6A 3FO2A 4PCYA 5IOPB 3WXVL 2R1XB 3BAEL 4ETQB 4XMPL 4QMEA 4QHUB 1KPUB 4WF7A 3TFBA 1AS6A 1H3VA 3D7PA 5IIEB 2BSCA 4TULH 3BUYA 3SE8H 3BT0A 4N87A 5GS1B 3P2TA 4NO0A 3DX9A 5DQDH 5L2KE 3S96A 2GUOB 2JKTM 3TO2A 3BE1H 4FJ6A 1K5NA 5BMFH 2C3WA 5CD5D 2VLKA 1UKTA 5F9JB 4RBPH 1IGCH 3WE6A 1HE7A 3P9LB 4JZOB 4S1SH 4HGMA 4MMXB 3U0WL 1YYML 3CFKB 4UZGA 3SEPA 3MKKA 4JFEA 4HDIA 4LQFL 1GW0A 4M00A 4CAGA 3LN4B 5E56A 1D7CA 1URLA 2BXZA 4XRCA 5T5NG 3ULVC 2D7QA 4S1RL 1JGDA 4FQCL 1FLTX 5GRVK 1C12A 4ZYKB 3TS8A 2AXJA 2MOGA 1BGXL 3IDIB 1P4BL 3L9RB 3MACH 3NFNA 4FQ2H 4LVNB 2V2XB 5F7EL 5GS3A 4DN3H 1YA5A 1KTCA 2A99A 2CBOA 4G8IB 1T2QL 3WIHA 3CXFA 2YKLL 2GBVA 2ZSVB 2DQ6A 3CDZB 5EORH 2IWEA 1MFCH 2A73B 5F7LB 2QDVA 1A6VH 3CFNA 3ETBJ 1FO0H 2HVJB 3BZEA 1BD2E 4HCGA 1J48A 4I88A 5DD5L 5KYYB 2WCGA 1IGFH 1LILA 3NIDB 3X14A 3V4VB 3OR7B 1RI8A 2XU9A 4BSVA 3ILPB 4ZMXA 3QUYB 4HK0A 5J56B 4N9OB 4ZFGL 4NEHB 2Q3ZA 4GKOA 2Q9OA 2W91A 4J3WA 3AUWB 3ZRFC 5DHDA 3ARTA 1AGEA 3KM1A 2DQDL 4O58H 4UIKH 3AADB 3OKNA 3STLB 5IVOA 3L7FA 3HE6A 2QL1A 1ZXQA 1MCSA 2ZJSH 2DM2A 4JQIL 4NQQA 4ZFFB 2HT3C 5A2KH 1IQWL 1SN0A 3V5KA 3LZOA 2CGYA 1IKNA 4P9HL 4S2SA 3KYAA 5FO7A 2NNFA 4GG8A 3O4OB 2Q8BL 1JGUL 4HIEB 2VQ1A 3QUXB 3RFRA 3E38A 3FUFA 3VU2A 5ENWA 1B6DA 4JM2A 1FNAA 4OLEA 1QA9B 4PS4L 3H6JA 3NVQA 1H3TA 3QIBB 1GTNA 5D70L 4IRJA 3W11D 3VXNB 3PP4L 3C8DA 3HMWL 1LWHA 2ZUTA 3T0AA 4PCKA 1RZJH 4ONGL 5GRJL 3GDBA 5TK2A 5BS0A 2C3GA 2R4RL 3KPPB 3FU7A 2LLNA 4NKDB 1AXSA 1WK0A 4PCSA 2H32A 4YE4L 3GZOA 4ABQA 3CXDL 1JZDC 3QS2A 4F7CB 3TZVB 3VGAB 2H7WA 2EIBA 1GYUA 2DWEB 2X1WL 3NG5A 4PJCE 4X8GA 5KYXA 4JK0D 5DS8A 1PLCA 2WXKA 1O7DC 4GLRI 1GZHA 1F3JA 4F80A 4NFBA 3QSKB 4UBDC 4EBQL 5E9DA 4H2AA 4CN4A 3FUDA 4Y7MA 1S7UB 4UT7L 3TN0C 2QJDA 3GSVA 1CE1L 1NGPH 2B16A 4X9YA 1T21A 1BWWA 4ZS6D 5IG7B 3ASNB 2KLSA 1F4AA 3HMXL 4MMXA 3WHXA 3BWZA 4PLKC 3RIKA 2K45A 1V55B 2EIDA 3PY9A 2YSSB 5CEZE 2Y36H 4U6YB 1BEXA 2NY4C 4RGMB 5INCA 4E2OA 1RPUA 1NGXA 4X99A 3UC0L 4N2GA 1DEEA 3LKQA 1CUOA 2GUOA 2WWKO 5D9SB 3TO2B 2W95A 2Y1AA 2NXZB 2Y1YA 3WN6A 4DKEH 5IEHA 2H6OA 4PRAB 1ND0B 3QFJB 4R4FH 1X6LA 3ME0B 4OLUH 1XH3B 1QYGL 3G6JF 5F7BA 3SO3C 3QG7L 4I0PD 1YEGL 3IB4A 2EC9U 4Y5YA 1QFWL 3V0IA 2ZSWB 4TVPH 5BS0D 5C07D 5D7IB 4UM8A 2CCVA 2EIKB 4DGYH 4S0SD 3ZGHA 3ARRA 4TLSA 1ML0A 1KEGL 2E6QA 2E27L 5ELIA 5GS2H 2EDLA 3GLZA 1WTGT 4R3SA 2A6IA 3HW7A 2AQ1A 3S5LA 3TBTA 4B97A 5ANME 3KPMB 5F72S 1BAWA 3BGFB 1BZ7A 3CX2A 1YPZF 1K5WA 4MKTA 3V6ZB 3GJFB 1RIVH 2HJFB 3ESVF 4NIYE 3DGGA 3SQRA 4BJLA 1BFOB 4G1EB 1I1FB 3MCLH 1GYVA 5CP7B 4AMWA 3ALXA 2HUEA 1N10A 4NUMA 4F8OA 5HVHB 4ETYA 3PJSA 1T1YB 2Z8SA 4LRNH 5CJQH 3NTCH 3OPZL 1GPOL 1MCKA 4BFIA 4DFHA 4R26L 1U9KA 3WJMA 1NC2A 3FU5A 4MVBD 4I4WB 3BGAA 3L1OL 1A9BA 4KNQA 1TOXA 1VB9A 2XN0A 5KUKA 4Z3JA 1S2EA 3PDGA 1KBWA 2Y22A 1NUNB 3C8HA 3VXOA 5IGXH 1ED3A 3RY6A 1EJOL 2XG4B 4FQLH 5IJBC 3TCXA 4PYGA 1A8ZA 5C0DB 2DJ4A 3OGCA 4XX1E 3GMRA 3NCXA 4NC2B 3U9WA 1TIUA 2V0AA 3CFEB 1G6RH 4HJ0C 5DDHA 2ZSVA 1IC0A 3N2JA 3NCYP 3FXIC 4IW4C 1Y1DA 2H26B 1MG3C 1ZTXE 1DBAL 5JOEA 1I7UA 4XTRD 3VFPB 1J8KA 5CM1A 1RFDH 1NM9A 3ECQA 4J3OH 1SVBA 3K2KA 1NEZB 3BP4A 3QCUH 4U6TA 5T3ZD 4XRCB 5FO9A 2A9BA 4KGLA 1I1RA 1UVQB 1AMYA 3WJJA 4Y4KB 3IPEA 5FM5M 4BH7B 4U1LA 3B9KC 4C55A 4JLRA 5IP4A 1M7IA 4ZMVA 4S1RH 3TBSB 1WD8A 1YDPB 2BZCA 1CWVA 2YMXL 3E2HC 4FYRA 4I0PC 4M02A 2HWZH 4B60A 1GOGA 2J5LB 2QFRA 4Z7VE 1EX0A 2WKGA 3SDAD 4IDJL 1U8IA 4X6EB 3SKMB 3T65A 1R3LA 1FNFA 2GCYA 1MCCA 1KGCE 3HAEG 2IALA 4GG6F 4NQDD 1V7NH 5AFAA 2ZCZA 3NEXA 2AVFA 4F93B 5AW3B 3FOMA 3S2AA 3QG7H 4FXKC 2GJRA 3UACA 4KKNA 4WFFD 3L81A 1RUMH 3CV5A 3VD3A 2KI6A 4BQ8A 1QHOA 1L3WA 1RZJL 1E4WH 2WBXA 1IBHA 2CJUH 1QBML 2LHAA 3OV6A 3DSNA 4G9DA 4UDTA 4XMPH 1EZLA 1JV2A 2AERT 3L13A 1J5OL 4F57L 3GFUA 4FHKA 4DIXA 1MW0A 1NC4A 1T89C 1TR7A 3Q8FA 5EO0B 3CFDA 3SE3C 5HY9B 32C2B 4JRXE 2EIMB 4UB0H 2FE0A 1DQQA 2D3LA 2WIIA 2Q8BH 3TPKA 2RMNA 1S5HA 2B59A 3GLAA 5IV2B 1RERA 5BJTA 3CH1A 3GGWB 3GSXB 1LO0H 3FNKA 2RFXB 3HRZC 3GUTA 3W9EB 3U36B 2YPLB 4AV4A 1PS3A 2V5SA 2GTWB 3FONB 3ARWA 2HN7B 3F2LA 5I5IA 4FKEA 3KW7A 4JFDE 1FGNL 1T04B 4PGBB 3P3SA 2WXRA 3FU7B 4F92B 1CFQB 3FSZA 1I31A 4RWYL 2ZKMX 5ITFB 3WJMB 4FMVA 4GKZA 1DLFL 2VDNH 1WIOA 4UIMB 2EO1A 1HSBA 4OJCA 4X6CA 2I24N 4FQHB 3QDHA 3OC5A 2UWEE 3FB6A 1B0GB 3BPCA 3V4VH 2YKLH 2JKLA 1FRGL 2YUVA 2RCSH 1H8OA 4AMXA 5ABZA 2DQEH 4LKCA 3WNMA 4PS4H 4WRLA 3SDDA 1Z66A 4PJAA 3ZIMA 4XC1H 1QUNA 1CXEA 1OEZW 2HRHA 2F61A 3S7GA 3LV3B 3T09A 3M1BB 1FVCA 2OR8A 3DSFL 4DGYL 3G04A 2YSSA 4UM8B 2AQTA 4AXWA 43CAA 5C0FB 4LSUH 1PLGH 4GRLD 2CK2A 3E8VA 1FAIL 3JTSB 1KB5B 3OLEA 1E65A 5D2NA 3N06B 1S7UA 1CXHA 3VXUD 2EVFA 1T0MA 3KR3L 2H32H 5KVGH 1RCYA 4GSXA 4UV4L 3QIWB 2AC0A 2YZ8A 2ZPKH 2GI0A 2K6ZA 1MWAH 4F3FB 2YXVA 4OLVL 2H0FA 4KK8D 5M95B 4TUOB 3T0EA 3L5XL 4LEXL 3SQBA 1HN1A 2HKHH 2N0KA 2Y24A 4DQAA 4LOEA 3IDMB 3F83A 2WXIA 3VH8A 3UYRH 3VX1A 3IF1B 2IANB 2Y07H 2HXAA 4HX1A 3HMXH 1A9BB 1W8NA 3MLYH 1T4KB 4J3SA 3UYPA 1CK0L 2HVKB 5F0LB 1GSMA 1I7RA 2C3XA 4FZEL 3SZ6A 1ETZB 2XA8L 3BVDB 4FYQA 5CINH 1KWGA 5KTEH 2YD3A 1BREA 2AEWA 1AGDB 1IGYB 2Z3FA 5GSVA 5JDJA 1QASA 4AGNA 1KY6A 3K6DA 3QDJA 4XNZB 1YNTB 1JPFB 1BD2A 1RUQL 3HCVB 1O6SB 4PJGB 4BGLA 2XUWA 3HBQA 1JZ4A 3CBJB 1IAOB 5DMJB 1JZ6A 3KMDA 4XNMA 3BCFA 1L9MA 1NJ9A 1XWVA 2NT1A 4LCWD 4PJ7F 1BXVA 1ACZA 3DSNB 15C8H 3P2BA 4QYOA 2BNQA 4HBCH 1KPUA 4KUZL 1JF1A 5E2UL 5TH2A 4AQ1C 2BRRH 2E46A 3UTZA 3B43A 4QRRB 4ACPA 4JDEA 2AS5M 3OB8A 1N0XL 2DYPA 1G6VK 1UCTA 4KOCA 1TVHB 3CZKA 4TSCH 1WBYA 3DX2A 3OLIA 5TE4H 3EH2A 3VQ1C 5FX3A 5I2IA 4OJYA 4C56D 3KPOB 2VZUA 4L23A 4YMPA 1PZAA 1KCWA 1BVLB 2BY2A 5CKGA 1II4E 3SKMA 3T65B 1XF4B 2WLHA 1RZFH 3GLEA 2DS4A 1RPKA 4I2XB 5FGBC 3RX8A 5TF1L 2AEPH 3DUUB 3C8KB 4W9KC 2F8OA 2BMKA 1ZDQA 1FRGH 3O0LA 4PVMA 1VGKA 1M7IB 2DQJH 4OSUL 5IROD 2KL6A 4JHBA 3ULUD 4ZOBA 3AW5A 2GQHA 1T04A 4X7DC 2QKIB 3ZL2A 3TYGL 4AKQA 3L9RA 5KS9F 1SYSB 4I1NB 3QUZA 4F9PC 4HLEA 3G6DH 1TYEB 1YJDC 2FL5A 3QDAA 2C1PB 3WGUB 4EI0A 1VA9A 1OPOA 2GI7A 3I6GB 1TZGH 3MV7B 1ZIAA 3MNWA 4XZUB 5DS2A 2OYLA 1HWWA 4KKLC 3VFPA 3BW9B 3DUSA 4G6FB 4TNVK 3PS6A 1R3JB 3F7RA 4OD2B 4PTUA 5AUMA 3X14B 5DTFB 3US0A 3W11C 2PR9A 4DH2A 3FRUB 5AOJA 2I9TB 1RUPL 3A4DA 1QP1A 4G70B 3EXJA 4UANA 1A64A 1JGVL 2CKBA 2OQJA 5T1MA 2QZ5A 3ZRCC 4MBOA 1BLNA 1G7PB 3ZDZE 4E9YA 1CGTA 43C9A 1FCGA 3AREA 5GRWA 1GMIA 3IETA 5AALA 3NP3A 3KWTA 4QRSB 2CO7A 3F7VA 5HJBA 3ZOAA 3VD1A 1YEKL 4L1BA 4IMKA 2DQUH 4G7QB 2XN2A 1DBBL 2WXPA 4CA4A 1JYWA 4FXGA 4HJUA 4KDTA 4WVRA 1J5OH 1NFDB 3HI1B 4M5TA 2XJKA 4AGOA 4MA1C 5EN2B 4EVNA 2WXJA 3RL2B 5EIIA 4HKZB 2ZT9C 5AW8B 3MJ8B 1T1XB 1K3IA 1JZ5A 2XXCB 3L3IA 4PJEA 5JQ6H 2R56H 3V0AC 2NNRA 5T33H 1B2WL 1EHXA 4KDTC 3DOIA 1BJ1H 1PZ2A 3U6XA 1BLIA 2NX5B 4MXWH 3HR6A 3RBGA 3O9WD 4OFYD 1KNOA 1U3HB 4M8UA 4O5LH 1URIA 3L95A 1B6UA 1XR9B 4NWTH 4ODVH 3QXUA 5DK0B 3FQWA 5IOPA 2JB5H 4YHKH 3T2LA 4RVBA 2MNUA 2FHFA 2WLIA 2UXGA 3D3VD 4TUJB 1AHMA 4Z3IA 1E90A 1CK0H 1UQSA 2NUPA 4UTBA 3LKOB 4P2QB 4L1HA 3MOQA 3O11B 1DLHA 4GJTB 4NJAL 4UQ2B 5ETUB 1G1OA 5DQJA 3QORD 1FUNA 5TE7H 3TA3A 4DZBB 4HKXB 4JFXA 3JVFC 3WUWA 3IDYB 1BQHA 5FB8B 1IO4C 1QRNE 5IHWA 2ZXEB 3RWHA 2X4NB 3BIKB 2ODHA 3SPGA 3U7AA 3L3OC 1T22B 4NRXA 1KGUA 5EU5A 4JQIH 1IKNC 3JTSA 3BRFA 4KROB 3NDZE 2JCCB 1FYTD 1FZMB 1WGVA 2D3VA 2G9HA 4PJGF 5I6LA 2X4SA 2NDFA 5ECGA 4LDEB 4GG6A 5IGXL 4HG4J 5I1JL 3O6LL 4XAKE 1FAIH 2BIQA 3B9KB 4FFWC 4IKLA 2Y07L 3H9SA 3QO0A 5SWZB 4GBXA 2GC4C 2YOCA 1MCOL 5DURD 5BRZB 3BKJL 1J1XH 4NJ9H 3ZPDA 4J3UA 4UTAA 5LCVA 5C0RL 4NDMB 1PNDA 3E8UH 3P69A 9CGTA 3NTCL 1TJHH 1O5PA 2MJWA 2KZBA 3QWQB 1TDQA 4P46A 4H4NA 2V8MA 3HC0A 3BAJA 2YAOA 1M56B 2X88A 4TSBH 3EOAA 3QORA 3VG0L 1OCWH 4HCRA 2J43A 4I8DA 4JO2L 4GW1A 4JFED 4KJQC 5B8CA 4LSQH 5I8OH 1N59B 1P7KB 4X9HA 3D3VA 4Y2DA 4DGVL 3HC2A 3O4LE 2EXYD 1HCVA 3EUUA 3OAUL 4OFVA 3SCMD 4P46C 4KRPC 3ZR5A 1ZA6B 3DJ9A 3JZ7A 1GZHC 3C5JB 5CEXB 3QJOA 5H94B 5DRZB 4JG0L 1Q0XH 4ZMZA 2ROYA 4DQOH 3FQRA 2VITA 4JL1A 4L48A 5FF6B 3QUXA 3MREB 3B34A 4G2AA 2AMUA 4U7MA 2VQ1B 1DJWA 1LP9B 3QDJB 3RRQA 1GS7A 3E3QE 1JPFA 1ID5I 2QDWA 3AWGA 1E4HA 3L1EA 4JFFA 1ZLWH 5I6MA 2DZEA 3GM8A 4L5FE 3PUUA 2VR6A 3VRJB 1U2CA 3FN0L 3OKLB 3L3OB 1LO0L 5C09E 5D7JA 3B1UA 1T1XA 2ZCKH 3LIZA 1FO0B 3RIFK 1IL1B 5CJXA 1K4CA 4BUQA 4OTXL 2DEWX 3IT8D 2JH2A 3N0AA 5F88A 1ZRUA 5FO8B 2X4PA 1RZJC 4MYWB 4YXHL 5IHUL 3L48A 3FHEA 4G71B 3VDCA 2ZSWA 4C8XA 1Z5YD 1SYSA 1S7WA 2OMXB 1HHIA 1HILB 2F1AA 3F85A 4KY1H 2DWDA 4PLOB 4RWYH 5JPMA 4LLUA 4AVIA 1FF5A 5F1OB 4FZ8H 2JKJA 1T03L 4PSRA 2VLJA 3K2MC 1R24A 2VR5A 3IJHB 4BCZA 3C8KA 1JZFA 5KANI 3DX8A 5GJTL 3OG6B 1EZUA 2DWEA 3CPLA 3ZR6A 1XF4A 1N64H 5DTFA 2XX0A 2WZPD 3K6NA 2PO6D 1QO3A 2C4FT 4JPKH 1RUML 3LKOA 4P2QA 4UV4H 4XP6H 2CKBH 2XZCH 4PREB 5CUSL 2WTOA 4M93C 4K7PY 3UC2A 1BQRA 3WN5B 4APQA 3V6OC 5FCSH 1QTPA 2ARWA 3SKJL 3NPZB 4K7PH 1KLUA 2QPFA 4Y2DD 3VMNA 1JV5B 4K5OA 4NN5C 4NQED 2CBMA 4TQEL 3G6JA 4X8XA 2VDPL 1PIGA 1NCNA 1O6TA 5JIMA 1KCLA 2XPGA 3H0TA 4NQVA 1U92B 3TBVA 1QSFD 3UIZA 2A83B 4Z76B 1WGOA 4YVUA 1UVQA 3G6AA 4K5LA 4PQXA 1WITA 4JM2B 2XZAL 3LPWA 4GI6A 1NAML 3CQPA 4DZBA 3VFWA 1JZ2A 5HSFA 1F90L 4JFDA 4DEPC 4H8WL 3DA0A 3EFOA 2XPZA 1QRND 5AD0A 5I1HH 1MCJA 3QR0A 4P2RD 5C0AE 1IKFH 3KPLA 2OL3A 3X11A 2HFFA 4M8QB 2J73A 2HFGL 1XD0A 3LEVH 3QHFH 5KJ4A 4H5SA 1HINH 5DYFA 3PWNA 1S8DA 2PW2B 4OM1H 2YD5A 4BWUA 1YJDH 3D4CA 3UZVA 4M1DL 4IGBB 5T5FA 3FRPA 4RMUA 1BOYA 1W0VA 3MKGA 3LJ3A 2PXYC 2VSMB 4HCFA 4P5TA 5FECB 1FIGH 1OTTD 5AYUL 5AB2A 2FX7H 3QRBA 1QNZL 2DOCA 5I74B 4Z7WB 3K6OA 4L8DB 3S37X 2E7DA 3WD5H 3KDMA 4HLZG 4LBEB 5CFAA 4LSTH 2AKRB 2EDNA 1PJ9A 5IVXB 1E6JL 2GABA 3MROB 2D4DA 2J12B 3JV4A 2WY3B 3QUGA 1KBPA 3UZEC 3PJSB 1BQKA 5T3XH 3WJJC 3WXWH 4W9DC 4OZ4A 4KH9A 4L8BA 4LLQA 3V4PL 4RSVA 3DVGA 1V3LA 1WBXB 2JELH 3EYSH 3VCLA 5EOCH 2OSLA 4XO3A 2F8VA 2DIBA 3WTSA 3GSNB 5DJAB 4G9FD 4MWFB 3S34L 2IANA 3QEQB 4F7EA 1WAPA 5DRNA 4V33A 4L4JA 4Y5XA 1AS7A 1F1AA 1J1PL 5F6IC 1ZS2A 1J9CT 4OGXL 1N0XH 1YNTF 1ADQH 2VW7A 4KITB 1BQHB 5FB8A 2YGVA 3LY6A 5DUPH 1JK8A 2BVPB 2E27H 4KPHH 1OCRB 5GSRB 1WZAA 1ORSB 4U3XA 4Y9FA 5MHSE 3IDGB 2FB4H 1KIPB 4LCUA 4NQXB 4BM7A 1EVTC 4K9EH 1MOEA 3W1ZA 5E51A 2EC9T 2OPCA 1R3KB 2AFNA 4R8WL 1I8LC 4GAFB 5AVTB 4PGCB 3EBIA 3KEDA 4GRWB 3ZW3A 3T8XB 3F6LA 4BDVA 1UH2A 3NCMA 4IDJH 5EMYA 1NGYB 3DMMA 4MX7A 1QQDB 4YDVA 2CO1A 2F68X 3ESNA 2O1AA 3WV0A 3MOBL 4J6RL 4XE0A 4ZO9A 4DP2X 4P2OD 5I8CA 3RVXD 5E6ID 1HIML 2ARJQ 2EDHA 5AKTA 3TNMA 5B39A 3ZY7A 3Q05A 3OMIB 1U8OB 3OG4B 1MNNA 1XR8A 4PVBA 2FQDA 1ITCA 2E74C 3AM8C 5KSBF 1AP2A 1HSAA 5D6CB 2WK2A 5JR1L 3T2NH 3HRZA 5C0GB 4E41E 1LK2B 3U4AA 3BUDA 2Q87A 1MH5B 5GS1A 2X9YA 1IT9H 1MCPL 3P40A 4NKQB 4KKPA 4XNAA 5DK2A 4H25B 5EU4B 3MRFB 3IAQA 2NY7H 4D2NA 2VUYA 4YDJA 12E8L 1YNLL 4NC0B 2W9DL 1CDUA 1TQBC 2XJLA 3AB0B 3NRFA 4YLQT 4LBAA 3DIDA 4FNTA 2NR6D 3RVXC 3QRLA 3K0WA 4LHUA 2B0SL 4DPCX 3P4MB 4DP7X 3PG2A 3BP5A 5ANMA 2O26U 2P5WA 2L0DA 3L2LA 3TT3L 2WO3B 2WN3A 1HTYA 4JRXD 1TJXA 2P8PB 3KLAA 4X0KB 1YNTA 3ZMEA 2EYSB 1S5HB 4RISL 1NIFA 2H41A 1DQKA 5BCAA 4N28A 2A7BA 5JOFB 4CW1B 1F1GA 3WE1A 1BFOA 4ZX3A 1SXSA 3RHWK 1GZPA 5D7IE 1YAZA 5CN3A 1MVUA 4LVEA 1SXNA 4BFBD 4KQ0A 3QPKA 3WMQA 2R69L 4NOFA 4MXQD 5EZLA 3ZE1E 4CVZB 5KSVA 1VJSA 4S2SB 4N24A 1S3RA 3N41B 2R2HB 5FM5O 2APBA 4N0FB 3FTUA 1M53A 2IJ0C 2HJLB 2IPKA 4JG0H 2I5YH 4QI3A 4TQPA 4FNUA 4FFZH 4KTEH 3U1PA 3QIUB 4P4RA 2PPFA 2YPVA 3HPJA 3REWB 3N42B 4JJ5B 4L5FL 3S0PA 1JPST 2VDKB 1KJ2L 1WS7A 4X8JB 2CZNA 1BZOA 1ESOA 1OAJA 4N90D 4ODWA 2DY2A 1F4XL 4KTDL 5GJTH 3RPIB 1Q9KA 5KS9B 1YEIH 1QO3B 5K59E 3KL0A 4IBQA 3ARFA 2NTSP 2X5PA 4ZSOA 3WDJA 1TQWA 2IBZY 3WKMH 5FGRA 4DVBA 5E9DE 2DL9A 2K6YA 3ZDXF 1N4XH 1QSEB 4NP4L 2CAKA 1XEDA 3EJYC 4KAQL 4UI2A 1I85A 2IV8A 4NQVB 3V55A 3FQXA 4M1DH 4PFEA 3M1BA 1IT9L 1MCPH 1JPGA 3V6BR 4YSOA 5T1KB 1K4DA 2JNZA 2H47C 3DK0A 3LPFA 1ZLVH 4N22A 4EEEA 3W0WE 1U42A 2XPGB 2ZE0A 2H9GB 5I1JH 3BIAX 2AANA 3RNKB 3CSFA 4PV8A 5IJKC 3T3PB 3KGUA 1B0RB 3VXUB 4HUXB 4F2ME 4MCYB 1GTFA 2XZAH 1JXJA 2H6PA 3MLTA 3EJQA 1E8ZA 5JO5B 1ZVSA 3LHPL 4UT9A 4BFGA 3P9LA 3PXJA 1NFDE 4I89A 4Q2ZA 2VH5L 3RIAF 5HDBE 3IVKB 4LVHC 4XGZA 3KWWA 4YVNA 2D2CC 1EO8H 1V7NL 2I9LB 3ELQA 4IBZA 1CFQA 4R8WH 4S1SL 3LN5B 4Y9GA 4ODTH 3M8OH 3ZKMD 5E6RB 5BVJA 1W2KT 2R69A 3IF1A 3C5SB 3LZNA 1E30A 3CJJA 1SLUA 2CIKA 5TE6L 5MERB 3GHEH 5GRJH 3FMGL 3QGVA 4M7KH 3D0VB 1X5ZA 1ADQL 5GJSL 4CU7A 2GSIA 5IW6A 4LLDA 2J8UF 4Z7NE 4K55A 3CVBA 3ISYA 2VRKA 4GMSH 3DVGB 2C9QA 5IB5A 3MRBA 4JRYB 2GJ6B 3PNRB 3EW3B 5ENWB 4HEMA 2Q6WA 3L95B 4OLZL 3WKPA 4J2QA 1BCIA 4AG4H 3VXSA 3CVHA 3GIVB 3QAZC 2X12A 2Q76B 3QJUB 4L4VB 1QPPA 5F93C 4FEIA 3UBXG 3V4PH 1XT5A 1UD3A 1VACB 4TTDC 2OMUA 2A4CA 4XH2B 5F89B 4E42B 2CKBL 3GTNA 5F3FA 4AT6B 3TBBA 3QQDB 2X6BA 1HIMH 1S7TB 3DXAB 3P0YL 4YK4C 3SOBL 4JO1H 5ALCL 1OLZA 4A2EA 1ROCA 2FJSA 5FYKU 4L05A 3DMMD 2J3SA 1OE3A 1G94A 4QHKI 1URZA 4TRPH 5HI4D 4Z3EA 5HYEA 2DM3A 5IVNA 3BHBB 1X5KA 3LZPA 1N7ML 3SKUD 4YSAA 3US1A 1QPKA 5G55A 1ZSHA 3RWHB 4EI5C 4KKBD 3QEQD 3QULB 4P5SA 3QDMB 1FQ9C 4FTVE 2QV2A 3ULSA 2FB4L 4OIIH 3C60B 4AIOA 3QCVL 1NBYB 2VLJD 4LPTA 1DVFB 1TETL 1CZ8L 3SDCC 1NBVH 2AW2A 4PY7B 5KVFH 3A67L 3QO1A 1TJIL 4JFDB 1ED3B 1XGUA 2KKQA 4ELME 2QQQA 2ITDB 4AENA 3W0WD 3CX5J 3GXMA 4IRZA 3H7BB 3QUMA 5FDYA 4EKXA 4KHTH 4IKIA 1OE1A 4BD4A 5IUCA 3TH3T 3O2DA 5EOCJ 4YJZL 2QFPA 4ZUVB 3TM6A 4Z23A 3QDGA 3UZQB 3ZSSA 1F02I 2VN7A 3MODH 2VN6A 1JGUH 1YHPA 5D1ZB 3H55A 2W9EL 3WOVA 5AEAA 5T33L 4JRLA 2DWYA 1ES0A 4FABL 3NZ8A 3QQ3A 2OCJA 2WLLA 2WTPA 4KJQD 5KW9H 1FDLH 3T4AA 1ETJA 4UT6H 2XQYA 5ITBH 1KTDB 4PWHA 5DJ0A 2Z91A 1U0QA 1YY8B 3HZMA 4U1JA 2UZYB 4OQTL 4MCNA 1E5AA 3I3DA 1FP5A 5HI5C 4NT6A 5GIRB 4B27A 4NM8L 1OXYA 3MLVH 4PW4A 5AB9A 1TSHA 2IDCA 3P30L 2CGRL 2LLGA 3IDJA 3KPNB 3MRIB 5I2IB 1UT1A 2EUZA 3FFOA 5DD5H 2AJYL 3MZGB 5I66B 1Z3RA 1PKQE 2R4SH 1OCZB 3V7MA 4FRWA 4PJFB 5D1ZD 2VKWA 2BJML 2GPZA 4W9GC 1H8LA 4A2DA 3WU1A 4TVPD 4IRJB 1YEEH 3T6XA 2XWJA 4PJ9B 5I1HL 3HG1D 1L9NA 1YQVH 1F4WH 3H56A 3F58L 1OY3B 4HJGA 2OXHA 5D4QA 4Z8FL 5KBMA 2PYEE 1VLXA 4OLYL 1S9WB 4ZXBC 1DBAH 2E8YA 4PD4K 4PJGA 3JSSA 1OP5H 3S37L 1I8KA 1WEJL 2B20A 2YRZA 1F6AB 4MNQE 3WEBA 1JYVA 5D2LB 3GS7A 2IADB 4K5NA 4RESB 3PDOB 4ZMWA 4NZFA 2OMTA 3IJ8A 3O8XD 3HE6D 4ALAH 4XPGL 3LKNA 4XNUH 1M1XB 2GITB 4MD4A 4F5CE 2ZP9A 2F53E 3NJVA 2Z93B 1N19A 2R4SL 1LYQA 4DEUA 3N43B 4HS3B 1WFIA 3N40F 3QC5X 4FXTA 2EECA 2EICA 1MFEL 1TZOA 4HGKC 2EVJA 3KPRB 1AE6H 2YLHA 1RK0B 1HXMA 1LDSA 4QHLB 2J1ZA 4OZIA 1T5XB 4NQCA 1HCFX 4L1SA 1KCSH 2QVIA 3BAWA 4P9ML 3TPUB 3ULSB 3VTAA 3X1FA 4CN1A 1TU2B 2EAEA 5J12C 3UBXB 3OKDB 2L7JA 3E8UL 3NSDA 4ZQKB 4UWQB 5IB3B 1FYHB 1U3ZA 3FCBA 1F42A 3D48R 3VXUA 3FB8A 1KJMA 4HWZB 3QUXC 4GY4A 5BZWB 3SYOA 3SDCD 2F1EA 3UTSE 3DO7A 1G6RB 5J8OA 3V4PA 2C9AA 5I0ZA 1AO7E 1TJGL 3O8XB 5CFHA 1KGJA 4BFFA 4J3OD 1CGSH 3MODL 3N9GL 3BISA 1J9RA 4HDIB 3QFDB 4FG6C 3MRGA 1LQSR 4A63A 1HXKA 4HZAA 2BNRE 1EJFA 3DVFA 1NINA 2CA4A 1WFNA 5IQMA 3BAIA 2RCSL 2FJGB 5K9KB 1P5UB 3GD1C 2HPTA 3H8NA 2Z7WA 3AC0A 4XP5L 4J12A 2UVEA 3AU0A 4EOWH 1ADWA 1B4JH 3PHQB 5GGRB 1H6EA 3U0TB 3WFBH 4U0RB 3MPCA 1WAAA 4J3VA 1PG7H 1S9VA 2Y2YA 3QXDB 2O6PA 3ILQD 3BOVA 4YQXH 1M6UA 2VRAA 2I9LA 4PRBB 3NACH 1J8SA 3SJVB 3RA7H 3V6OA 3C5SA 4OZFA 4PRPE 3JVGC 2J25A 5IMOB 2BNQD 2LV4A 1OTUD 3RBSA 4LLAA 5C0IA 3CVHB 4L4VA 2FEDD 4WO4A 3UOAB 1JZ7A 3GSXA 2K1MA 4HYTB 1FFOB 2X6UA 2OP4L 4M3KB 4FQJL 1TUPA 2DI7A 2HVKA 2X9WA 3PAZA 3WEMA 5IV2A 2Q8AL 5DO2C 3NMEA 1ZHBB 2E4TA 5JPNB 1UWYA 5I18H 1RK1B 2CUAA 3HRPA 4BFEA 2CE6A 4V1DD 4FL4C 2MHAB 1SDAB 3VH8B 4MJ6A 4ZUVA 4OCMC 3QDGB 3EDEA 3UZQA 3FQXB 4F57H 1ZY9A 1ZIBA 5L2KB 1QUNB 1SF5A 2C9XA 1D5MA 4FNPA 4KJWC 2ZG2A 5DHVA 3CZUB 1K4DB 3T8MA 4B9GA 5CSZA 4IIQA 4ONGH 1KZQA 2XBTA 4DP9X 2F9BT 3A24A 1YEEL 2X2JA 1Z9SB 3C2AH 2W38A 4UTCA 3IFPA 4K94C 4DGIH 1G7HA 3B83A 4LAQH 3MV8E 4M29A 3TVMC 4BE6A 4XHJC 1L0XA 4FQIL 3NJHA 5EH1A 3L3KB 3MRDA 2CGRH 2HJLA 2IPKB 3HG4A 4JR9H 1NTDA 2QV4A 1QZNA 2VSKB 3GEWB 2BHZA 1JHKH 1VADB 3QXAA 3BDBA 4Q9RH 4ZNEA 1UASA 4H0IA 2UZXB 4Y4HD 4OCYH 3N0PB 4NZ8A 1HOEA 3P11L 4FTVA 4AL8L 4Y1AE 2R56L 5D1QB 3KLHC 2WMPB 4QLRA 4WNJA 5IFJB 1BFSA 1BX2B 3ISWA 2VDQL 3RWIB 4HUNB 4ORZC 3AT9A 1LO2H 2ARJA 3O3BA 5EU7E 3MRPA 2AV7B 5E99H 2NCMA 3TIEB 5IB5B 2OCFD 4MNHA 2J7LA 4L9LB 4AUUA 4CUCA 3OKKA 2P5WB 2VO8A 4L29A 4ICWA 4QKXB 2PO6A 5ACLA 4A6YH 1QKZL 4X0KA 3U30B 1NQBA 4W9HC 2HKFL 2FBJL 4BINA 2PW1B 4LBEA 3WEXB 3LZQA 1U93A 1X5FA 4WIQA 3CH1B 3GGWA 5KBKA 2EE0A 2FYYA 1NMAH 1MJJB 4JPVH 3MLWL 4PWJA 4YAQB 2V2TA 5DWPA 1AACA 1CS6A 3ECBA 1E27A 3WTTA 1O6SA 4PLNC 4TPRH 4L8BB 1LK2A 5EBLB 5E6ZA 2XBDA 3B9DA 1UTDA 3A5VA 1N3NB 1IC4L 3LN9A 4N8CH 4IBUA 3MOAH 2YPKA 1QBLL 2NPLX 4IU3A 4JVWA 4E9WA 3ZRSA 4G8GA 4LESA 1WFUA 1RIVL 4HK3J 1E50A 2WYTA 2VKXA 3MV9A 3VTTA 5HP5A 3KD4A 1QSFE 2NY6B 2BOCB 4JFZL 4UMGA 3Q0HA 4FQXA 2VQ4A 1PSKH 4P4KC 3V0WH 3QYNA 1SXAA 4MASA 5H37H 1A7QL 1VGKB 1J8HB 1A2YB 1O7SA 2CLZA 5LNEA 4ADGA 5FW6A 5EZOH 3FB7A 3F7YA 5EZIH 3MRQA 3ZZLA 3U0PA 4H44C 5F70A 4PRPB 3P3RA 1Q4NX 1SGKA 5DJXA 4WW2C 5I1KL 1BVLA 3COOA 3KJ4C 4KV5E 3MNMA 3CZLA 2PP9A 3LZRA 5F6IB 2NQCA 1KXQA 5J89A 1O75A 1E6JH 4ZQKA 2VSDA 1CG9B 2W65A 1SRDA 1KYUA 3A6BH 2OV0A 5IW1A 4J28A 3TT1H 3RWDA 5GGTA 5MENE 4YUEH 4P2OC 2O5YL 5AVXB 3SIKA 2VIRB 3NJNA 2OR9H 2LVEA 4OZHB 5L4FA 1DANT 3HC4H 1JOIA 1MRCL 4PGZA 2WVUA 2QADB 4AIZB 5KVEE 1OCWL 4JO2H 1X9UA 3IWVA 1ZTMA 3OPZH 4AW4A 2W92A 4U1GC 3RUGB 2E9BA 1IE4A 4Y0GA 3EH5B 1OAUL 4OLXH 1D5BB 3ES6A 4N2IA 1W91A 3H9SD 1CFSA 3Q5TA 3FTGB 4XWGL 5GZNA 4IRSB 3V6FB 2APTA 1RU9H 3MI6A 4A67A 3O6KH 3I74A 3WO3B 4CADB 4ODUB 5MEQB 1DEDA 2ZXAA 3KW8A 3FU6A 4P5MA 5C0RH 2W88A 4N3TA 1NZRA 2XTJB 3VFSA 5F9AC 4OCSH 4MZ2A 1HNFA 4LOUD 2OZNA 3UJTL 1DQJA 4AY0A 6PCYA 4UNTA 5IHHA 4PLKD 2NQDA 4L3CB 4NHCH 5JHDD 5LGKA 1UWFA 3PWJA 2NYYD 4UQ9A 3QJZA 4IBYA 4FA7B 5FM8A 1FJ1A 4G59C 2VQTA 4QKTA 4ZDHB 5I73C 2ERJB 4GRWH 4UZSA 1OGPA 1I7ZB 1ZE3C 3MUZ1 3QW9A 4N0UB 1W0VB 2XN9D 5ANMB 3LEYL 3R06A 3FH8A 1AXSB 4RMRA 3MBWB 3WUZA 1MRCH 2VLRE 2CQVA 4PG2C 3DARA 4OLVH 4ZUSB 5I8KL 5ECJE 2QPSA 5A3IC 4ZUWB 5CS7A 5F7KC 1RVFH 2H0EA 1XIWC 2DQHH 1J10A 3MLUL 3OJ2C 3GXTA 5B8CB 1W72B 1NC2D 1IVTA 1M7XA 1CDJA 3GJFA 2JQZA 3MLTB 1W0YT 1A1NA 4GRLA 3CFCH 1YY8A 5ACZA 1QLRA 5CP7A 2P5WE 3SCMB 1T7VA 3CXHK 1OL0A 4E9RA 2W0LA 3AB0C 3APDA 3MGAA 2PUQT 5T3ZE 1EEZA 4MRCA 1AHWC 5FF6A 4K8RL 3EGXB 1SYVB 3GBML 4GI8A 1NWOA 4X42A 5T3XE 3TVMB 1R3IL 3B3BA 4JFZH 3WIFB 3CSYB 2R1YA 3JV6A 4FFYH 5DGRA 4PJ8D 3VXRA 4ALAC 1EJOH 3R7RA 5BZWA 3RFZC 4URKA 3X1EA 4OD1H 2EIZA 5D7IF 4LOFA 1ONQA 2ALWA 4HHWA 5EU3B 2LGNA 5PCYA 5JXAL 3VYPA 1JTOA 3O4LB 1MCBA 3C08H 4Y16D 1FORL 1XH3A 5GGRY 3E9UA 4Q6KA 4RX4A 5J6SA 2H26A 2F5BL 3GPEA 4G3YL 5ITFA 1ETA1 4FCHA 3ARDA 2X2IA 5DEFB 4X5QA 4YC2B 3ZMRA 1TZAA 4JB9H 3HMWH 4DNLA 4S0TD 1KFAH 2GG1A 4PLJD 4P2CG 4M1CC 2HFEA 1DJSA 1BBJB 1B4JL 1X5YA 4Y4KA 1BVOA 2OMXA 5IMLA 2F2HA 5JPMB 2G9HB 4E9TA 3CHRA 2P1YA 2WNXA 1JGLH 1GAFL 3LZFL 3G5XA 5EA0L 5LHDA 1NDGB 4W4OA 4PJ8B 1TTCA 3NN8A 3CC5A 4MNHB 1BXAA 1I1FA 3QA3B 3ZQWA 3WXWL 1Q9WA 5F6HJ 1LO2L 1FWXA 3ECBB 1FFRA 1T1YA 1UZ6F 1G7MB 2AK1L 4N2NA 4XVUD 4ODUA 3VRLE 3P9WB 4F37K 3GK8L 2OK0L 4UIKL 4OLUL 2VXSL 4ZS6C 3O6FA 1SFDA 3FUHA 1DTUA 4UT7H 3UPCA 3RUGE 1P5UC 2O6DA 4GQ9L 1E4WL 1FBIL 2DMKA 3X2QB 4S11A 1C1EL 3UTTA 4WKZA 5E23A 1NPNA 3T5WA 4UMSA 2FJHB 4PVNA 4CDHA 5I71B 1WICA 3ESPA 1C5BH 3QARA 4YBLB 2M1KA 1FC2D 3IDJB 3KPNA 3MRIA 4AITA 4ERSH 3KYOB 1P9MC 4LB8A 3KYNB 1ZHKB 4YE4H 1EFXA 4HH9A 1NKRA 2L7EA 5E1AA 3HC0B 1FC1A 4FDWA 2F53B 2OI9B 1R0AH 3EF7A 2PCFA 3G08A 5CJQL 1U8NB 5BRZE 1T0NB 2Y1VA 1J0ZA 4UBDD 2X10A 2DMHA 4OGYL 2OAAA 5IFHL 2GK0B 3KWUA 4JZJC 4KVPA 2ZX5A 2VC2L 1LQBC 4U4IA 5GGTL 1S6NA 1UKSA 1K8DB 1WO2A 3C5ZB 3UERA 3CG8A 3TNNB 2GSGB 5IEKA 4TQEH 4X5RA 3KS0J 5K9OA 2D9QB 2JQMA 2QBWA 3BEVB 5ICXA 3D39E 3LQAC 3N1PC 1UGNA 2AXGB 3AFLA 4MJIA 2X4NA 3BIKA 2CCLA 2VXQA 4XCYA 1NCBH 4ONOA 2HT2D 3EKCA 4IOFD 4W9ZA 2AABH 3VXMA 5DJDB 1GY1A 4DKFH 1M6OB 3GMMA 4NQCB 5C0CA 1CFNA 2EDOA 5E9DD 4AYDC 3BD4A 4Y9CA 4IKJA 4PY7A 2F7IA 3ALWA 3CPLB 2HJKA 4AJ0A 2BVYA 4WSJA 4HPOL 3VH8G 3KPSD 3LIZH 2BLFA 2WUBH 1OANA 2X2YA 3HKFA 4HS3A 4DVBB 2IGFL 3B2PA 3LH2H 1TENA 1AYOA 4L37A 2YWYA 4KNUA 2R0ZL 2RIKA 5EOCL 5AVSB 4XNXL 5E5UB 1UOLA 2K4AA 5AKSA 3TO4D 2VMJA 3GBMH 3UC0H 5TDOA 4A2MA 3M17A 2BFGA 4WEUD 5ESQA 3UFIA 3BKJH 5DEJA 1MHEA 1MFCL 4XBEL 4LGSB 3PL6C 2GYSA 1U2YA 4HIIB 2FT8A 3DHMA 2WWMD 3MV8A 4YSSA 3UJIL 4AM0B 1YECH 5E2JA 2OW6A 3B7RL 2BCMA 4PJAF 4AL8H 4HJEA 2PKDA 5K9KA 1BFTA 3MBEC 3TBYB 3AGWA 1V5JA 3CN4A 4PJAB 4P07A 1MUJB 4J1UB 2G2NA 4XXDB 4EBQH 4NERA 4GT7A 3BWSA 4F7CA 3GRGA 1BPVA 4YHYC 3QEHA 2YGPA 2CO4A 3KG5A 2BSTB 2AXHA 2R39A 3FQRB 4M5SA 5DMYA 4FLHA 5BVPH 4YDZA 1A6VL 4XC1L 4N0YL 4MDJA 5D2LF 3PF2A 3APMA 5I66A 7PCYA 3Q3GB 1BAFL 3OHXC 2YD9A 5J9PB 2DQTL 2VZTA 3ZKQD 3QDMD 3OKNB 1QFUH 2E5EA 3EO9L 1KBGH 3ZHFA 1NKGA 5GGSY 4HAFA 4YBLC 2B9AA 3Q8BA 1KCUL 2EZ0C 4NRYA 2JVUA 4WW2F 4ODXB 2VXVH 4L8SC 4X98B 5DWUH 2AV1B 3VVWA 4DOHE 2D7TL 4Q6IB 4LCWB 4YHLH 4JO4L 4HIEA 2FQFA 3V0GA 1H5BB 1IILE 4YHOL 4I18C 3LXUX 1DBKL 1IGML 5FDWB 1SN2A 2H3KA 2LAGB 4KK5D 5F7UA 3DO4A 3J7HA 3KJ6H 3S2CA 4EO5A 5IMKA 3F12B 3P4OA 3GM0A 1QW8A 2YFOA 4XVTL 3HC4L 2ZWKA 3KLLA 1D2OA 3CFIC 1H6TA 1OWWA 1GJUA 2VZOA 1DUYA 1FBIH 3WNIA 4F8PA 1XF2A 4OFPA 1AY1H 5GGQH 4JFHD 4N86A 1AGFA 1KYFA 1AXTL 5IOKA 5IQOA 3WCYA 1B3IA 2YAPA 3K6SA 1FCCA 1GJIA 1DBBH 3TL5A 2BNRA 1HZHL 1SHWA 2WB1A 3TJEH 5KTEL 3I9IA 3KPOA 2WTRB 4O2EA 2EEFA 2IAMC 4ISVA 4LAQL 4NIKB 1OZUA 3I2CL 3QE5A 3MV11 5GZOD 5C86A 4DK3A 4EQ2A 3MJ9H 2X4RB 3WFBL 5KSUB 3US9A 1X5AA 2XCMC 4M8VA 3CFQA 4JDEB 2PR4L 2NUPB 4EUPA 3B2VL 2XTJE 5G4NA 3S3CB 2I69A 3V0WL 3LQZA 5EU3A 4ZW3A 2YBRA 1ZLDA 2EYRB 1RH8A 1RZGA 3EYQC 4XXCC 3FB7B 2BH0A 4NM8H 5GZND 3OSKA 2YA1A 1RSFA 4QRQB 4WENB 1I7ZA 3BVNA 4NQCE 5E70A 1F18A 5BUGA 4NHUB 3MHZA 5FA3A 1NSNL 5HYJA 5D1XD 3MUHL 4LHUD 2OR7A 1IM3D 2MQCA 2Q8AH 4JRFA 3H3KA 3GSNH 5EZJB 3QHZL 5IBLC 4Z7OF 1IARB 4UILL 1S9YA 3D4GA 1FDLL 4QRRD 4MAUL 3P4LA 4H26A 4NFCA 1NGZA 1IZKA 1SMAA 3Q06A 2FR4B 2B8OT 2Y7MA 1I7RB 1YMHB 3OF6A 4FABH 3STLA 1BBDH 4QGYA 3IEAA 4B6ZA 3PUCA 2WOYA 2DQIH 5GSVB 4QRTA 2YLKA 3EBGA 3PHQA 3MRKB 4ZFOL 3I6KB 4Q9QL 1KBKA 3ESMA 3QJTB 4JFQA 2YD7A 1YEKH 2G2RB 1UUNA 1GSKA 1Z0MA 4E9LA 1EWHA 4MNQA 4WI7A 2WINB 3T0ED 2VL4A 3WXVH 4LP5A 4D9LL 2E76C 1A65A 1UJ3A 4HIXL 4AJVA 4QHLA 1T66D 2P5EE 4TSAL 1MCOH 1Q0YL 2MH4A 5AL8A 2BNUB 2PYEB 4Z7VB 3E80A 1KB9J 5FAAA 1SDDB 1MRFL 1LD9A 4HPOH 1RUKL 3MACL 3RDTC 4DN3L 3WD5L 3RZWA 3D30A 3M7OA 2V5YA 2EYTB 2ADFH 3WFDH 1WT5A 1FGNH 2VUOA 5T1LA 4C4KT 1E0OB 3SSGA 2WSPA 2PCPA 1YC7A 5IEKB 3PWVA 1J9SA 4JHWH 4LRNL 4Y4FA 4OH2A 1E4XI 1OSZB 2TSAA 4LGPB 2KLTA 3JYBA 4M56A 3LH8A 4HG4K 1AAJA 5I1CH 3CZJA 4MNGB 3HNSL 2FJUB 1A4JA 2OSYA 2VABB 3TGXA 1AZRA 4EE2A 3UH8A 1B4TA 2EC8A 3MV8D 1XVSA 2OX5A 5DQ9B 1OK0A 4JM4L 3ESOA 2OLDA 3VQLA 1P6AB 2AJXL 1DN0B 1KCBA 1U95B 3L3HB 2WLIB 5MEOB 4IBVA 4EQ3A 1S46A 4MS6A 3REWA 2DWTA 3QDGE 2ESVE 2VDPB 1CTOA 3UBFA 1NCJA 3M46A 5D9SA 5BQDA 2X89D 2ICWI 3DXAA 1BEYL 5HHXL 4PJHF 4K73A 3GRWA 4HSQA 5HYJD 3O6FB 4LSVL 5D1XA 2YGNA 4XAWH 4P3CL 3IS0X 5GRVL 1NAKL 4MLSA 1QABA 3PU7A 3VX0A 3VI4B 2J72A 4FG4A 3VFMB 2F08A 2VL5B 3QWRA 3AWEA 1N26A 1TPXC 3GJFK 3B3IB 3L4VA 3TLRA 2H1PH 3IGAB 2WQRA 2ENJA 1J05B 3BQVA 1HKFA 4H1LH 1CT8A 1L9OA 2Q5BA 5KYWA 1N67A 4WW2A 4PV8B 2XFXA 3L1GA 2HFEB 3ETTA 4PJBB 3WEXA 4PIBA 4OTXH 5CEZD 2UX6A 1ETB1 2UZIH 1M3JA 2A9MH 4JDVB 4NRYB 3ZUNC 4DPAX 5HGDB 4XPBL 4POYA 4AIZA 3C2SA 4B9FA 4XVJH 5EU6A 3II2A 5DUML 1AKJD 1MIMH 4M6NH 3QDJE 5D1QE 2OJZH 1AQMA 2IV9A 4JQVC 3FKUS 2JKXA 2J4WL 4HLJA 3VFOA 2YPLA 3QUHA 2G2RA 3U9PL 1DJGA 5F44A 5DJ6B 4XPAL 4K4KA 4F3FA 2ZP8A 4J3OC 5EBGA 5DZPA 2LFGA 2KHAA 4P5MB 3RB7A 2IDFA 5JQHC 1EAJA 5E1IA 2WQSA 1MCNA 4AC4A 4J7RA 4WK4B 4JKMA 3Q1EA 4KVCL 4TNWK 4QDGA 5E2WL 4J3OF 4GMTH 1JCVA 4RMBA 2DQJL 2EXWC 3FT3A 1NEUA 1A2YA 3T0EE 1JV2B 1QSVA 3MRJB 5EU6E 4OUOA 1U8KB 2EEBA 4A6YL 3TTYA 1F86A 2Z8VC 4MJ6B 4LO9A 2XN9B 3CU1A 4WU5A 3SKOA 3BPOB 1QSEA 4J3OG 1MIEH 5IHZB 2FX8L 3CSGA 5B3JF 4YWGL 5L9DL 1TPXB 1PZSA 1FH5L 1SLXA 1Z0NA 2E59A 3C60A 2K3HA 2WLJA 1XF5A 1LL1A 4XPHH 3OAZK 5EEYA 5D2NE 3AG4B 3JTTA 2XI9A 5HGHA 2X4QA 2EYTA 2CALA 2IQAB 2IOIA 5E8OA 3T4YA 3N1FC 3ARGA 4PMFA 4HAGA 15C8L 2CR3A 4KJPC 5GGSB 1OKEA 5D2NC 2YIHA 1YDPA 3HAEH 4E9XA 1NIAA 3H1ZA 1RVFL 3NGBC 1GVIA 3IDNA 4U1KA 3GSUA 1BYOA 3ZYIA 5A1AA 1G7LA 1SBSH 4JN2A 4M4PA 1OD9A 4JREC 4TRPL 4HMCA 2OMTB 4IU2B 4NZRL 2CGZA 2C9RA 1AXTH 3W9DA 5AKRA 4UTBL 1DQTA 1N3NA 2NOYA 2VERN 1A9VA 4MBRA 1BOGA 2UWEA 4AK1A 4MDIA 2C7UB 2VR3A 4NSKA 3ZKMC 2UXTA 4P5TD 4X6CE 2XWTB 3HR5A 4AQAB 4QRTB 3MCYA 5I24A 4WFFE 5EF0A 1BIHA 4EXKA 2VAAA 4KJPD 3L2NA 2PWEA 1EHLL 4I77L 1SDDA 1S7XA 2RQEA 2X1OA 2GSIB 3L7EB 4R7XA 2XWBA 2AEIT 3RI5K 5IW6B 1KGXA 1QZ1A 1FSKC 4U1MB 1E8XA 4ZJ9A 4Q6IA 3MREA 4MCZA 5CJOL 2K8MA 5E5RB 2CH8A 4MQXD 4U33A 2ZUQC 2WIMA 5I0XA 2QGBA 4A2HA 2PO6B 1MWAL 3A4AA 3KYNA 2BDNL 2Z34A 5I1IL 4TUKL 2H45A 2P48B 2PABA 5FFGA 3FO2B 1R47A 1HJBC 1A4BA 4M62L 4LSVH 5DRXB 2AEQH 4OF6A 4JREB 4GI9A 2IH9A 2BK8A 1YPZB 5DJ2A 1FNEB 3BQUC 4OFYA 4F27A 4XPTL 1AG0A 1HC1A 3AG3B 1N64L 1BDYA 1GOHA 4P9HC 3RVUC 2OTWA 1TQCC 5FK9B 5HPMB 2WBKA 5ADOL 3QQ9D 5GGVY 5F9DC 3NSYA 1AQKH 5JXAH 2I9TA 2NYZA 4W4OC 3QIBC 1AGCA 2WZ5A 5DD6A 2IXQA 4IBWA 3D33A 3PP4H 4D9RD 3FCGA 4KY1L 1ZD6A 4YXKL 1A6ZA 3H0TB 4M93B 3B6SB 4XVSL 1L9QA 3VFNB 4RWHA 1ZGLB 4HOXA 5DRNB 1ZCRA 4Y1AD 5CCHE 3I6SA 4KZEH 4HXBH 5C6TL 2OYKA 2Z64C 1GGYA 3ZMNA 4LPVA 35C8H 2WUCL 2CO7B 2ZOOA 3CIAA 3BPOC 2JIXA 5I1DB 1KCKA 3UX9B 4PJFF 1IBGH 4RZKA 1DLFH 1W8EA 2K9FB 3OR6A 1BG1A 2HMID 5C0IB 4AX3A 4E41A 1CD0A 2HVJA 5DEFA 3BJ91 4MB5A 4A38A 4I2XA 5L2KD 5HD8C 1OAZH 2HP4A 3N44B 4IJ3B 2VLKD 2YA0A 1QYGH 4UCFA 2CDEA 1UOVA 3MRHA 2Y69B 3CHXA 3KCWA 4JY6A 4N4YB 5CMAB 3DX9B 3U79A 4HUWB 1KENL 3VXSD 3MUJA 1SXCA 4LP8A 4HKJB 4AZUA 4WW1A 5I8OL 4IMLA 2C7FA 4ANUA 3QJXA 4HIXH 4R26H 2DQMA 3KPQA 2RFXA 5DFVD 4YGAB 2IBGA 3BEVA 5DK0A 5BQ7A 2DKMA 3NIDF 5ACMA 1JFQH 2A38A 2YK1L 2E47A 1F13A 5IROA 8CGTA 2B1AH 1XSIA 4ZUTA 4UDUA 4FQPA 1MH5A 2YAEA 4M4RB 1P0SE 4IEFA 5C6WH 4GMSL 1DSWA 3O3AB 2IH1B 4AC2A 4Z0XB 1F8TH 2CBQA 2BNUA 3FQTB 1HI6A 4CC1A 4LU5H 3ARDD 1RJYA 2IAMD 3QPQD 4GOSA 4I77H 5HGBA 3D2UD 4U6VL 4C59B 2H6UA 2XIDA 3SODB 1R0AL 3S5ZA 3ENEA 1JYXA 1T1ZA 1V7MH 1WZ1L 4LPWA 3MU3A 3T8VA 3UZVB 2NXYD 4K7FA 4X4ZA 3ULVH 5DZVA 4MFHA 1NCDL 4KRLB 5H4YA 2EE9A 5H2BB 2HT3D 4JM2F 5C8JA 3NIGE 4Y19A 2Y06L 4X80H 1ZLUK 2BOBB 3NJLA 2R7EB 3LAFA 5CBAA 1E9PB 1RJLB 4FZEH 3UP6A 1UZ8B 3MRRB 5JIIA 2ZCHL 3UIYA 4ENED 5CZVL 3BPLC 3EDKA 2BSRB 2NY0C 3QWOA 5G4MA 4ES8A 3OBAA 4LHQB 2ZUXA 3HG0A 4KBPA 3V5KB 4AYGA 1Q94B 3TNMB 4OF7A 5B39B 2NNXA 4K71C 4PG9A 4PJXB 1T7XA 2GT9A 3DWTA 3NN8B 1XF5B 3JWNG 3U4KA 1P4IH 2R23A 3TEWA 1OTSD 1KEMH 3D1MC 4NKIL 1D5XA 5D7EA 1Y0LB 2A74B 1PSKL 3NCWA 4AJWA 4BELD 5EDXA 5CCGE 1E3FA 1C5DB 3OKLA 3UG3A 5KSUA 5FGSA 2J8UE 2DJUA 5LDSA 1PX3A 4HKXA 3X13B 4AGQA 1IC4H 1JGEA 5IM7A 3RVWC 3J07A 1UG9A 2PP7A 4G72B 1BYNA 2VDOB 2R0LH 4RGOL 4PRHB 3HMXA 5HDRA 1MRDL 5B4MD 1PFOA 4NYLB 2ZUQB 3N6YA 1FPTL 3G6JE 4WWKA 2XY1A 4RGND 5T1LD 5ID0B 4X4KA 1GHFH 5E4OA 4QXUL 3VGAC 3TZVC 5EPMB 1PVHA 2PWDA 1M4KA 3HVDA 5GS0H 3L6FA 4GSRA 1BAGA 1UKQA 2R51A 4JM2C 4DJMA 3WLWD 4HT1H 2JMRA 3BUPA 2CLVA 5E4EC 3QORC 4KC3B 3RNQB 3PV6B 1MUJA 4HV8A 5JW5A 4Q14A 4CL7A 4XMLL 1IGTA 3WGVB 1Z1WA 2HLAB 5IQ7L 5TGBB 4NUGH 2JCWA 4FYSA 5TF0A 4E5XA 3C5ZD 2LE9A 5D7HA 1X9LA 5A2CA 1W16A 3R19A <