2DWTA

Cu-containing nitrite reductase at ph 6.0 with bound nitrite
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
329
structure length
329
Chain Sequence
LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title pH Dependence of Copper Geometry, Reduction Potential, and Nitrite Affinity in Nitrite Reductase
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 85
structure length 329
sequence length 329
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwtA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwtA02
1PZBA 4NERA 2QDWA 3FYIB 3PLYA 1E5YA 4M3HA 1AR1B 2GC4C 3WKQA 1SFHA 1OCZB 3CG8A 2PCFA 1AS6A 2BWIA 3IBOA 4P5RA 4QLWA 2OCCB 2BWDA 3TA4D 1AS7A 1ASPA 3U25A 1E30A 1V54B 2UXFA 1PCSA 1I53A 1W8EA 2X88A 2XX0A 1CURA 4E9XA 1BQ5A 2WSDA 4YL4A 1JOIA 4RH4A 3PXLA 1ZIBA 4YSOA 3OQRA 1N70A 1SDDB 2FT7A 3QJSB 1KDIA 3SBQA 2XWZA 4A2FA 3MX0B 3OMAB 1KV7A 4YSEA 2VM4A 4E9YA 2MTAA 1L9PA 3EH5B 1YLBB 1URIA 2BW5A 8PAZA 3PAVA 1XB6A 6PCYA 1PLAA 3CDZB 2ZXWB 1BQRA 1R1CA 4G70B 2VMJA 4HHWA 5LDUA 1TEGA 1OF0A 5A7EA 6PAZA 4KO5A 1N68A 2H5UA 3AY2A 4BWWA 2PLTA 1NWOA 1SFDA 3G5WA 4W1TA 4A2DA 1PZCA 4AKQA 1GS8A 3X1NA 2HXAA 1L9QA 4ENZA 2N0MA 1IBZA 5FC9A 1NPJA 1SF3A 2P80D 3FQ2A 4NB7A 1A4AA 1AZUA 4E9TA 1NIAA 3OD3A 1GS6X 1GYCA 2W8CA 2DY2A 1W6LA 2IWFA 2UXTA 1WAEA 2FJSA 2IH8A 3T6ZA 3S3DB 1ADWA 5IY5B 4DP2X 2XU9A 2PPCA 2XXGA 2AFNA 4MFHA 3X1GA 2BP0A 2W88A 1V10A 3WG7B 1BEXA 2PPFA 2PP8A 3FSWA 2IWKA 3FPYA 2DWSA 3T9WA 1PNDA 2BP0B 2WO3B 3BQVA 3NP4A 1ID2A 4A2HA 2IWEA 2YAHA 2E86A 3MBWB 4DP5X 2GHZA 1TKWA 2TSAA 1BXAA 4TXVB 1KYAA 2YXWA 4DPBX 1IBYA 1NTDA 2B08A 2XV0A 5B3SB 1GS7A 5D4JA 1OCRB 4YSRA 1AG0A 1GR7A 1E67A 2X87A 1CC3A 1PAZA 3V9EA 4GP5B 1JXDA 2A3TA 2ZOOA 3AG4B 3PAUA 4YVUA 2UX6A 3CZUB 4ZK8A 3D12B 2GIMA 2IAAC 2CAKA 2JKWA 2J55A 1AZNA 1BQKA 4Q89A 2EILB 1FFTB 4GP4B 2JFCA 2FQEA 5D4IA 4GY4A 1NIBA 3PPSA 3HB3B 2R7EB 2VW7A 5TK2A 1NIDA 2J57A 2XX1A 1L9SA 4BK5C 1XB3A 4JHUA 2ZONA 2AZUA 3HEIB 3KW7A 5B7FA 1SJMA 3S3BB 5D4HA 2FQFA 1CYXA 3FQ1A 1JVOA 2HX7A 3H4FA 5E9NA 3NJKA 1W6WA 1ILSA 1NINA 1RKRA 1J9TA 5B7MA 1L9RA 4BWTA 3WI9A 4AI7A 1SHWA 2IDSA 1JVLA 1ET8A 4HIPA 1JZEA 2PPAA 4DPCX 4HCGA 1J5DA 1GY2A 1QHQA 4KNSA 3FSVA 2RACA 1JERA 2XV3A 3JTBA 1TU2A 4KO9A 1J9QA 1SNRA 2HX8A 3TBCA 4HCFA 5B7EA 5I6KA 2CUAA 4DP1X 1JZIA 2XLLA 4YSDA 3OMNB 1X9RA 2IH9A 2XYBA 3ABKB 2HRGA 3S3CB 2PPDA 1JXFA 1JZJA 3FT0A 1CYWA 3GXUB 2VN3A 5TK4A 1NZRA 1AIZA 1T5KA 3DKHA 1JZHA 1SHXA 4KO6A 1MDAA 2DYRB 1A4CA 2GB2A 1E5ZA 2CBPA 3S8FB 3QJRB 4PCYA 2I7SA 4UAHA 1VLXA 2Y69B 3QQXA 3SBPA 4UANA 1J5CA 1ASQA 1PMYA 1V55B 5I5IA 1J9SA 2WO2B 1JZGA 3NYKA 1M56B 2H3XC 2I85A 4DP6X 5AZUA 1BAWA 1PF3A 2GBAA 5AKRA 1ZIAA 2CCWA 2EIJB 5B1BB 1CUOA 4F2EA 4BWUA 3UAEA 4YSAA 1ZPUA 1XB8A 4E9VA 2YAEA 3T6VA 3NT0A 3UADA 2FQGA 1AQ8A 1A4BA 2IDQA 1PNCA 4YSPA 3NSFA 3TBBA 3IE9A 1M9WA 1ET7A 1GSKA 4YVNA 4A2GA 2IDUA 3TU6A 1NPNA 2IDTA 3ZIYA 1KCWA 1J9RA 2Y1AA 4HALA 5I5MA 4UF7C 1AAJA 4YSUA 3T71A 1L9TA 1ZV2A 1PLBA 4CSZA 5I6PA 5I6NA 3EH4B 4HAKA 2JXMA 1OV8A 3X1BA 3KW8A 4JHVA 1IC0A 3FU7A 1IUZA 9PCYA 1WS7A 1NDTA 3NP3A 2FT8A 3N2JA 4A67A 7PCYA 1A65A 2PP7A 1MG3C 1AOZA 5F7AA 4G72B 3ABLB 3ABMB 2H47C 4G71B 1KBWA 2CALA 1AZCA 3GYRA 3N55A 1AANA 1FWXA 5EHFA 3WNIA 2FQDA 3C75A 4GYBA 4KNUA 4L0PB 4DP8X 4K9JA 4DP0X 1NIFA 3BVDB 4E9RA 3X1EA 2J56A 2QPEB 3EF4A 2UX7A 4WKXA 3CVCA 3WKPA 2IDFA 3ASOB 4BDVA 3UAAA 3NJLA 2VSMB 5B1AB 1PZAA 4G7QB 5B1JA 3V9CA 3FU9A 1DZ0A 1BXVA 2HRHA 2BP8A 5I6OA 2QDVA 3AG2B 3PAZA 2QPDB 3ZDWA 3EHBB 1XMEB 2HZHA 1KCBA 2I7OA 4QKTA 3UACA 3X1FA 4EF3A 2J5WA 1B3IA 5B1KA 1OCOB 4YSQA 2PP9A 3NJHA 4KNTA 2XVBA 3QJQB 2BO0A 4FA7B 1HAUA 2GC7C 2NRDA 2OJ1A 4E9SA 1KBVA 2DV6A 4HCIA 1ET5A 3ZBMA 2EINB 4X4KA 1SF5A 3OMIB 3H56A 2YXVA 1E65A 4DP7X 1OE3A 3NSCA 4Q8BA 1AZBA 5PCYA 1SDDA 3FSAA 3IN2A 1A8ZA 2GI0A 3ZX1A 3CVDA 3NJIA 2XUWA 3IN0A 3DIVA 3AZUA 4DP4X 2FWLB 2YAMA 2OV0A 3FPXA 3GDCA 1KDJA 2LLNA 4KO7A 2YAOA 2XV2A 3AG1B 1F56A 2TSBA 1NICA 1JZFA 1OCCB 1WA2X 2AANA 3CDZA 3FS9A 4HHGA 4FAAB 3FYEB 1JXGA 2YQBA 4PAZA 1L9OA 3ERXA 5B1JC 4DPAX 1TEFA 4NAJA 2BZ7A 1DYZA 3T6WA 4JKNA 1ETJA 1NWPA 1QNIA 2Q5BA 4CSPA 4AX3A 1PLCA 3PCYA 3QJUB 4W9ZA 1OE1A 2YAFA 3X2QB 4BXSV 2FT6A 4YSTA 1GW0A 2PCYA 3RYMA 3TASA 1ZDSA 1ASOA 1ZDQA 3NJMA 4YSCA 2B3IA 3NSDA 3QPKA 4M4RB 4AKPA 1MZYA 4YSSA 3S8GB 3NJGA 2BHFA 1MZZA 3NJFA 2QT6A 4G7RB 3WNJA 2GSMB 5I6LA 1HFUA 3UGEA 3AG3B 2YAPA 4F7KA 2CJ3A 2P80A 3WIAA 2BW4A 3FQYA 1KGYE 1RZQA 5ANHA 2EIKB 7PAZA 1WS8A 3QJTB 2DYSB 2EIMB 2VW4A 4E9QA 4N4YB 3CVBA 1WA1X 2DWTA 2MRYA 3JT2A 1GY1A 3H4HA 4A2EA 1A3ZA 2VM3A 4A66A 1MG2C 4F2FA 2Q9OA 4KOBA 1EHKB 2BZCA 4E9WA 3SQRA 2FTAA 1AZRA 1WA0X 1UATA 1BYPA 5I6MA 1AACA 1M57B 1ILUA 1RCYA 3L45A 2ZWNA 3IEAA 3NJNA 4GXFA 3UABA 3NJJA 3FSZA 1BYOA 3FU7B 5F7BA 2HLEB 1PY0A 3ABGA 2VW6A 3AW5A 3EH3B 3QJVB 4N8UA 4P5SA 4WTQA 2XXFA 2AVFA 2PPEA 3DTUB 2AZAA 2HX9A 3NSYA 4KOCA 3ASNB 2YAQA 1FA4A 2UXGA 1X9UA 5AFAA 2YARA 5I5JA 1AS8A 1BXUA 1OOWA 1NIEA 4GP8B 1AG6A 1IKOP 1HAWA 1EZLA 2UXVA 1OE2A 2VSKB 3OM3B 3SBRA 2FNWA 2R7EA 4AZUA 4HZ1A 5I28A 4BDVB 4A68A 1RZPA 4DP9X 4AKOA 1QLEB 5I26A 3T6XA 4G7SB 3FU8A 4BXVA 5PAZA 2BP8B
chains in the Genus database with same CATH superfamily
1WFOA 2D4FA 1JWMB 2IANE 4MDIB 1OALA 2HJKB 5FCUH 1WZ1H 3U4BL 4Z23A 3IDJA 3ZO9A 4KQ4L 2W0KA 4AL8L 4P5RA 3MDJA 5FA4B 4ERSH 3QCVL 1LE9B 2BNQB 4FQ1H 3DTXA 5LQBL 2AHIA 1KBBA 1PKQB 2N3JA 1I1CA 1PKQE 1CT8A 1EMTH 2R56L 1TTRA 2WXGA 4RZKA 3QO0A 1W72L 3BSZA 4JG9A 4MB1A 3GBMH 3FKUS 3VXTA 1DEEB 2WSDA 3WE1A 3ZKXB 4DHLA 4Y2OB 1FAKT 1I8MB 2DBLH 35C8H 2LR4A 3MBEC 3TCLB 4HUXA 1I31A 2R69L 2NNAB 1BA9A 4Y4HD 1LQSR 4XC1H 3OMAB 2GY5A 4XNXL 4CADA 1D5XA 4DCQB 2FATH 1FVEB 2M2DA 4OCMC 3UYRH 3HCVB 5ILTL 3QUMB 3L95B 3QBTB 5FDWA 1GOFA 1KTDB 2Z0UA 1RZKC 2BH0A 4N8CL 2Z7ZA 4NC0B 1DEDA 1OCWH 1F5WA 2BS9A 5LBSL 4Y4HB 1DTUA 1T6VN 5DHDA 3DRQB 4HK0B 1FZMA 2XWEA 4OFIA 2K0RA 2A4CA 4G7VH 4XNAA 2QPSA 4HXBH 1DUZA 3AY2A 4M48L 4IJ3B 3EYVA 3FT4A 5DHVB 4A2DA 1E9PB 5DZAA 1PZCA 4AKQA 4Q97A 4NO2B 4W9IC 1B0GB 4MJHA 3PQYB 5FC9A 3PQYE 1CQKA 3MOAL 1QEWB 1MCLA 1QR1B 2R0LL 4O5LH 1L6ZA 1UD5A 5DI8B 1TZGH 1CXIA 5HVHB 1D6EA 2BY1A 1S7RB 3P30L 2DY2A 4FNTA 4KXBA 4LSTL 5CLWA 1ZTXL 1E28B 1HWHB 1WFMA 2QLYA 3BAYA 3OB0H 4YZWA 1KMGA 4XP6H 4WO4C 2X4SA 5CJ5A 4JFHE 2Y36H 3TJHD 2EDMA 3NCBB 3QHFL 2AQ3A 4XBGA 4FTDA 1GGBL 3SD2A 4MTMA 1II4E 2PPFA 3EGSA 1DBKL 3QWRA 4PGDA 2OJEA 1FH2A 2WO3B 3BQUA 1ZKAA 5DMGD 1HHHA 1CLYL 5E8DH 3SDCC 1IAMA 4YC2B 1TOXA 5CCJA 4K5PA 4LLDA 2O26U 3IB4A 1HL8A 4AZ8A 3ZJAA 4AYBA 4BUHA 5GGTL 3I85A 4JJ5B 4ZTOH 1NDGA 4J1UB 3SDYL 3HG5A 2DQHL 3PDGA 3QWOB 1IBYA 3VSVA 2VDRH 3MV7E 2F8OA 4GIOA 1SJHB 3WLBB 2NMSA 3U7YL 2AKRB 3PWNA 5FYJH 4BH7B 4G83A 3RWIB 1E67A 4K7FA 4EI5A 2AJUH 3ZDZF 4PJ5A 1L5GB 1ULVA 1REIA 2GKIA 2DF3A 4LDOB 2P8LB 1P9MA 3K1DA 5JXAH 3LN4A 2HFFA 2DD8H 4ZK8A 1MXDA 2YD0A 3D12B 1J88A 2XNAB 3AS3A 3BE1H 3SPGA 4Q14A 5KYUB 3B8SA 3ZE0B 2DM4A 4XPTH 4XGZA 1SEQH 2IEPA 1TJGH 3BUBA 5T5FA 2G3ZA 4MMYB 2VDKB 4JVWA 5HYSA 4IMKC 5KJRH 2VR4A 1TCRA 3CHQA 2JKTM 4PRPE 4HIQA 2ZXBA 3K81A 5E6IC 1CE6A 3SEPA 3VG9B 4ZS7H 4XXCA 5LDSA 4JQIL 2PF6A 2QADD 4OF7A 5DR5L 5E9NA 2Y22A 3QR2A 5B8CB 4Z7QF 5K33A 1J05A 5L4JA 4OM1H 1UA6L 5AVQB 1JTTA 1MFNA 1XH2A 4PBVC 5B7MA 3X14A 1W8OA 4GJTB 1UT2A 4JPIA 1CD9B 1LEGA 1CMOA 1NCNA 1E2ZA 3DK2A 5CMAB 5C09D 2QADB 4XN9A 1E6JL 4FFYH 4AYEC 2W9DH 2VE6B 4ODXA 1BV8A 2F1AA 4U33A 2R4RH 5AZ2H 5I73B 3ATEA 4PYGA 1W9XA 2V17L 1FL6A 5IM7B 1KB9J 2QQLH 5DD0H 5HPOA 3ULUD 1T22B 3CFBB 3SKMA 1NMAL 2ZCZA 3NFNB 3QCUH 4K4KA 5CINL 2EDWA 3O0RH 3Q8CA 2ICWA 1WP6A 3RTQC 1SM3H 3VFVA 3DHPA 5IZ7A 2BSBA 1YEHL 1KBPA 4IBVA 4H88L 4HA1A 3H7LA 3N1FC 2R15A 2EXYD 4P2OC 4DEWA 3MO1A 3QIBD 4G9FD 3ULUE 3BN3B 3MNZA 4MJ5B 1MFCH 1SLVA 3X11A 2PPDA 1MJJB 1L4IA 1R3JB 1SN5A 1XT5A 2VN3A 1IGCL 1M2OA 2ZSWB 3GXUB 4QJ3B 3WJLA 2E9GA 4LSSL 3FRPA 2VAAB 3UPAA 5I15H 5C70A 2CBPA 3QIBB 3OWRA 1QZNA 4G9FB 1CYGA 2ZUTA 4EIBA 4IMLA 4F7TB 5DK0A 2IOIA 3RL2A 2XTSA 3CFCL 4ORGB 4QF1B 1W80A 2F19H 1PMYA 3KNBB 3N5AA 5AAWC 5J57B 1MW3A 1DDTA 1ZK5A 2MCG1 3KYOB 4UIMB 2V8LA 2CU9A 3GXTA 2ID5A 3LIZL 3JWNG 2HPTA 5AZUA 4QXVA 2GBAA 4NQSA 1JTOA 1G5AA 5HGDA 4AOFA 4YSAA 5FGBC 1HOCA 3TVMD 2DLFL 2CRMA 4PREB 1VFAA 5J5EA 4I5BA 3C60D 2WKLA 1K2DB 1YEEH 1SYVA 1E2VA 3ATDA 3GKZA 4F5CE 4JO3L 2OXHA 2VN6A 1U2HA 1A7QH 4HP5A 4KFZC 1QO3A 5D70L 4PUBH 3LNFA 4GUOA 1RUMH 3ZIYA 4YHIA 3TVMB 3AC0A 3AB0C 1GC1C 4H8QA 3C60B 4QHLB 5J1AA 1LO3H 4XPFL 2XRAL 5ALCH 4YSUA 3CFKA 3KPOA 4NN6C 5DS8A 3ARED 2R39A 3VNZA 3VGAC 4B3VA 3DMMA 4PG2A 4Z3GA 3T0ED 1WWAX 4XMXA 3VI3B 5HYJA 3G6JA 1IC0A 5TE6L 1JCKA 5T33L 4HIJA 3G6AA 4LEEA 2NW2B 2DLEA 2UYLB 3UJJL 1CFQA 3FQWB 4AJWA 5JOPE 1XAUA 3ZE1E 3AREB 1TLMA 2VLKD 3VXOB 3EXJA 4HUWA 4PJDE 3T0EB 4YBQD 1N6VA 1U8PB 1WGOA 4J3OC 2VDLL 1HL9A 3N44B 3B5GA 4G71B 3MA9H 4P23A 2VRKA 5KVGL 4PJGF 1FNEB 5EHFA 3QQ3A 3C5ZD 5GS1A 4NKMA 1WT5A 5EC2B 1Q8MA 4MMZA 2J56A 4MAUL 3E6HB 1GOGA 4GB9A 1FFQA 2VLKB 4K94L 5C0NC 4BDVA 3WGVB 5B1JA 1IKNC 4RQQA 3V0JA 4PB0H 1PSKL 3Q8AA 3IETB 5CIPB 2X4PA 2AQ2A 5FB8A 3C5ZB 3FO9A 1KCVH 3VW3L 3TO4C 1CE1L 2ZKHH 3UX9B 1R24A 4QKTA 2A9MH 2Q8BH 4UINL 1C5BH 1OAQL 4ISVA 2F5AL 1BZ9B 4QHUB 5CWSA 5K39B 1J5IA 1X5FA 4HS8L 1IQWH 3K6IA 1ZWIB 1ZMYA 4XP5H 3BAEH 3OKDA 3VGFA 4E9SA 4LK4A 3M7FB 4JPVL 4OD3H 5EN2A 5KSBE 3W38A 2BVOA 3TNNB 1DQTA 1E7UA 5EUKA 5AVSB 3RJOA 2OSYA 3FQNB 4RDQG 5D7IE 5AW6B 3V52H 4FCHA 4Y16A 2EE3A 2X40A 3SDXE 4N6RA 3MJ6A 2ETWA 4AV4A 5FA3B 4LLMB 3VFWB 4HAGA 1F0LA 5T1DH 1AKJD 2DWDB 4FLRA 3T3PE 3VSUA 3OLGA 1YPZB 3BZ5A 4U3SA 2D4DA 4KJYB 4CW1A 1RIVL 4BSWA 3FFCD 1ZHLA 4N3TA 3JWNE 5T3XD 3V9FA 1LHZA 2IFGA 1FE8H 2QGBA 1V3MA 3ZOAA 2YQBA 2NXZD 5GRXG 3N9GL 1FO0A 2OMVB 1KBGH 1OAZL 1AKJB 1CN4A 4G43A 5HJBA 3DX1A 4KI5D 3AUWB 3PNWB 1T80A 3EIFA 2WC7A 1SPDA 1UM4L 3S35X 3MTXA 2DICA 3FFCB 1AR1C 1G43A 3S37L 3HIZA 3QFGA 3BUQA 4N26A 3SO3C 3CSBA 5F0LB 2CE6A 3AROA 2NXZB 2YLHA 3O2VL 5EU5A 3ARYA 3OJDB 4PY8I 3FTVA 1SOQA 1TQBB 4KZEL 2ESVE 2XIDA 1I8AA 3NJVA 3LKPB 1G6RH 3H3PL 3MTRA 3TIDA 4BFRA 5SX4H 3D0VB 5LGJB 5IHBA 1KLFB 3A23A 4PRDA 3QSKB 2QVFB 2BSRA 3QFDB 4RLDA 5BO0D 2H26A 4PLOB 3RB7A 3K80A 4NN5B 3U2SA 2H32B 3ZHKA 1RZQA 1JE6A 3CBKB 5ANHA 4XNMA 4AQ8C 4DGYH 1BJ8A 4O02L 1NAKH 5KSUB 4HIXH 2YPVL 1JNNH 4B9JA 2MQCA 1UUNA 3O11A 5CEYB 1A7NH 1CDGA 1INEL 3W5NA 3UBGA 4TL5A 4Y88A 1YEDA 3KPRA 1SXZA 4I18A 2PUQT 1D5ZA 3IKCA 3P40A 1RK0A 2VDOH 5E56A 4OU3A 3B5HA 2AXGA 1EJOH 4HMDA 2X2HA 5C08D 1RZJH 3B8YA 3L5IA 4NWUL 6FABL 1WV7T 1I85C 3QFJA 4P59H 2CIKB 4YX2H 1QKZL 2X3AA 1BYOA 3QDJA 5CSZB 4JPKH 1J0ZA 3RPBA 2JI1A 1HCYA 4KITB 5DJ6A 3AW5A 3ZKNC 1Z9NA 2OS7A 3DWTA 4J3OF 4N8UA 4P5SA 5K59E 3IJSB 4AYDC 1CLZH 2YUVA 5DT1H 3RPKA 5C08B 3A67H 2H1XA 4R2GC 1DBAL 3EOBA 4H2AA 4J5VA 4G8AC 3V6FA 4HD9A 1RZ7H 1U8IA 3GRWA 2WSKA 4E41D 3QUYC 3U48A 3US0A 3B9KC 4RETB 2HKFL 1XL4A 2K70A 4XMUA 1RVFL 3CZFA 1CDYA 3CLEH 1I7RB 2VSKB 3KCWA 4M7JL 4GQZA 4YE4L 4B95C 1ZAGA 4QHPA 4A68A 4KU1A 1NA8A 1P5VB 3ATFA 3NFSL 1V05A 3OKMA 2B7DT 3LRSA 1NCCH 2BSTA 4GRMA 4XH2B 1FLRH 5HYIA 2HH0L 1KC5L 1E4WH 2GITA 2X6UA 4E41B 3II3A 1ES0A 2VDMH 2MHAB 3B37A 2XQBL 1CGWA 1ONQB 2NY3D 1OSZB 3CG8A 2BWIA 2DIBA 5C0JA 3PHQB 1CR9H 1FG2B 1NFAA 1IAOA 3F01A 4HUUA 5TF0A 3WD5L 4H5SB 1BOGA 4PS4L 4JZJB 1EBAA 4PHXA 1QEXA 5HHOD 1FZJA 1BQ5A 3DO4A 5F44A 5EIIB 3GSNH 3HI1A 1WBXB 2E8YA 3KVPA 4N8PA 2NY3B 1XGZA 3DBSA 4NFDA 1KDIA 3MRMB 1E8ZA 2NYZA 4AE1A 5CS7A 1XGUA 1H0DB 2EDRA 5D2LA 1TJIH 2OMTB 1LO0L 2ODHA 4DGWC 4GKZA 1XF1A 3EH5B 5HHOB 5MERA 3A3YB 1JUFA 3ZE0F 3BFQG 4LCCA 4L5FE 1XX9C 4GKLA 5CM1A 3GXPA 2H0PA 1S2EA 4O2FB 3ECQA 1YC8A 3W11D 1UURA 4GKSA 1HHGB 2WB7A 2BIHA 4U1GB 5AWNH 3QNZB 5IMKA 4F93B 4LBEA 1ORQA 1IC4H 5DGRA 4Z7OE 2Y3NA 5A2FA 3I75B 2Y24A 3I9GH 3ALWA 3RFZA 4JRWA 4LASH 2BSSA 3RY6A 4YHKL 4ABVA 2YSTA 4TLSA 2Y2WA 4MXQC 4TSBL 5EO1B 1TTUA 2P80D 4HJUA 4HJEA 4JN1H 2PW2A 1A4AA 1UXMA 2OSLA 1J8SA 2WANA 1MFDH 4WU5A 2ODIA 1RSYA 2FJHB 1UB6A 3FTXA 5DUML 2UXTA 4R97B 3FH8A 3LEXA 4LHJB 4JKKA 4YO0A 2DQEH 3QGVA 3WHXB 3WNLA 1QRNA 3GIVA 3SGKA 5JXEC 3QUXD 4XN7A 4YR6A 5EEZA 4ZFGH 3L7FA 4LARH 3LEVH 4W68A 2B2XL 1R5WB 2UVEA 2W88A 3FUEA 1YEGH 3OGCA 4IOFC 3A6CH 1C5DB 3RWDB 2CO2A 3QORA 2NY6D 3REVA 3Q5YA 1UACL 2UZYB 5DJ8B 2I27N 2HN7A 1C1EL 2ZKWA 3D0LA 4HX1A 4KMLB 4DTGH 3QUXB 1CTOA 2B77A 4HKJA 4DP5X 1KTCA 2GHZA 3P9MB 4KX7A 3ULUF 3QZWG 1QFOA 4B9CA 5GS2H 1ZHBB 1PFOA 1NAMA 3JWNC 4P46D 3IJ7A 3VXUA 2NY6B 3OKEA 5CZXC 1FBIL 3V4VH 3D25B 3PREA 4OJEH 5FM8A 1U8QA 3L7EB 4GQ9L 3KLAB 5E51A 2GUOA 1F6AA 3QDAA 3QXDB 3VMNA 4LHQB 4GP5B 3J8F7 1MFBL 2F1EA 5BJTA 4MJ6B 5GZOC 4P46B 4P9MH 1H8LA 4YHZH 1Z0MA 4Y1AD 1U8JB 2WZPD 5DJDB 4MSWA 3HHSB 3MRIA 4HZLA 3GI9H 3U36B 1QTPA 3GO1L 3MZGB 4ZX4A 1T0NA 3B1TA 1A6VL 2VAJA 1TTAA 4YDJB 3BVUA 3VG0L 1XH3A 2FK9A 4OI8A 2W92A 4M5TA 3MJ7B 4Y1AB 3VFNB 5DVLA 1E4HA 1XGPB 1SQ2N 1S78C 1CL7L 2HCZX 3BP5A 1SMDA 3V5KB 2YD3A 3IDGA 4LPWA 4W4OC 1MHHA 4EUPH 5D4HA 5J89A 4GAGH 3FQ1A 5IB1A 4IBZA 1DQMH 4L37B 4PJCB 1ILSA 1JGVH 3PGFL 2AAAA 4P3WA 1JHLH 4ZO6A 4CGUB 1DBMH 5A6MA 4I3SL 3NFPA 2AJXH 3AAZB 1L9RA 2UV3A 4ZSOB 4ZSOE 5J12C 3VI3F 1BF8A 3QDGE 1UM6H 5CSBA 2DJUA 3ETBJ 3FTUA 2GTWA 1FRGL 1IARB 5GIRA 3MOBL 2HT4D 3LD8B 1PDKA 3NABL 2WLLB 3GMLB 4U49A 5FO8A 2IFFL 3ARBA 3FO1A 2HTKD 4KNSA 4RMVA 4X6CA 1CICA 1LK3H 2KS0A 4I13B 5C3LD 1M7DA 1MJUH 3RTLA 4Y5VB 3N44F 3O3AA 2BXYA 3ORJA 4PR5A 1TENA 3ZHLA 1SXCA 4D9RD 2OX5A 2VMEA 3RUGA 3MV9E 2ZCLL 5I6KA 1IGFL 1E4XH 3ZHDA 1Y1DA 4A7QA 2Y1VA 1B4JL 3LS5H 3QQ4B 4O9HL 3UTTE 3MRFA 5F1SA 4IRSD 2APSA 2X4OB 4Q6IB 1OM3H 4FZ8H 5CFHA 2I07B 1JZJA 1OGTB 3EBHA 4RAVA 3Q2WA 3CQQA 2OTUB 4D9RE 2EUWA 1AIZA 3ARTA 3DKHA 4J39A 2CLZA 5IG7B 2ITDB 4AMKH 2YD9A 1S7SB 1H15A 4XVSL 2X41A 4N90D 4IRSB 4F33B 1KENL 4QAMB 5JQHC 4M4RA 4KK6D 4CKVX 5I5IA 1CI5A 1IEAB 3P69A 4ODTH 1GAFH 3MJWA 3GSVA 3U1PA 3BN9D 2ZX7A 5HDOA 1W0VB 5AW8B 1U8MA 4IEFA 4B5EA 4G6AD 2HVJB 4FL4C 1KNOB 2V3EA 5D7KE 3PG2A 3SGJA 2FH6A 1JFQH 4R4FL 3NT0A 5I66B 3GB7A 1WEJH 3L4UA 2J71A 3VXPA 1RUPH 4N0YL 4JEGB 2XACC 2ENPA 1JNLL 5FYKD 4WDIA 1M9WA 1RJLA 2R0KL 1ET7A 5JW5A 4R0LA 1AI1H 4YVNA 3IJ8A 5TPWH 3KPSD 3OLEA 4MB3A 3RGVD 3BAWA 1BX2B 1L6PA 2VR6A 1H6EA 1LM8V 5MHSE 1HEJC 1JN6A 1X9QA 4X7EC 3OXRB 1NCHA 3WFCL 3GZPA 3HC3H 2WVVA 4FABH 4ZMPA 4QCIB 1NCDL 3QS3A 2X2UA 4Z95H 5H37A 4JO1H 3ARQA 4IRJC 1Q0EA 2AGJH 3K6DA 2Y07H 3EYSH 4G5ZL 5FYKE 1AQDB 3EO0B 3TZVD 2ZOKA 3UEZA 2JKJA 2JKNA 3H53A 3KPSB 3MFFB 4NQDE 3RGVB 4S1RL 4KMTL 2QSCL 1HSAB 1RH8A 1VADA 5SWZA 3SN6N 1FCGA 2XPYA 2DM3A 3KPPB 1CFVH 3ISYA 2FECL 1AOZA 4O2CA 5HTSA 3S96A 3WNOA 4KI5F 4C56A 5AUMA 1O7SA 1IL1B 5I2IB 3TZVB 3TTSA 2AC0A 4C83A 4AMXA 4XNUH 1BQHG 1ZTXE 1ZT1B 3NCWA 1UZGA 2XZQH 1NCGA 1PY4A 1FNHA 2PWGA 3VRIA 1GZQA 5C71A 5IQ7H 3LZOA 3DHMA 4NNYA 2K9UA 5ERWA 5FR3A 4M9PA 2IDFA 3UTZB 4W9DC 5IOPA 4AENB 4Q9CA 3ARRA 3SPHA 3GPEA 1HQ4B 1KJ3L 5A40E 3TH2T 1QFUL 1YY9C 5MI0C 4A7UA 4DETA 4BKLB 4JFFA 2EH7L 2YRPA 3T2QA 2RBLA 3UAJD 2UZXB 4OLXL 4F37F 4AQ1B 2DJMA 3TM6A 1KB3A 4FP8L 4F92B 3DO3A 3QJQB 2B1HL 5I18L 4KKRA 3IRCA 4TQIA 2ZP0T 1S7WA 3QR1A 2R8SH 3P3RA 3ILQC 3Q6GH 1JYXA 3H0TA 3EJTA 4HF5L 1ZS8B 2F54A 3K2MC 4JDTH 5EBWA 3VM5A 3T2PA 4BFJA 5I0ZA 1H3VA 3QUZC 1HYRC 2G2RB 3OB8A 2J1XA 3IMWA 1E4KC 4IDJH 4UT9H 3CZJA 5C9JA 1T7YA 2OYPA 2HJLA 4MNHB 1SDDA 2DKMA 4FGMA 2E4TA 3CDGA 1HJCA 3WSQL 1I7TA 4J6RL 1IJNA 3AZUA 4AMWA 5FLUA 4DP4X 4EO5A 3TBSB 3JVGC 3WL9B 5L8LB 5J1SC 2LLNA 3VWJA 1KACB 1VEMA 1YZZA 3NBNA 3UZQB 4GW4B 2OMUB 2GY7B 1F3JB 1WA2X 5LHDA 2ADIB 4RDQF 3ROOA 3QI9A 1X3DA 1EDYA 2ATPB 1FFRA 2ZXEB 4PGZA 3RI5F 3ATAA 2PYEA 4NGHH 4B27A 1FORL 4LSPH 4CNIA 1HXMB 4U1IA 1NLBL 4Z7AA 3HG1D 1UASA 2Q5BA 1FAIH 3IM1A 3C08L 4O58L 1EUTA 3DSFL 4W9ZA 4NRZB 3DROA 4FXGA 2VIRB 4ATTA 2QQQA 3WOVA 2FO8A 4Z7WA 4YSTA 2J6WA 5DHYA 1K6QH 4QRQA 1KTBA 3PHOB 1TJHL 2XKNB 4FTVA 1QFWH 4YUEH 3WUZA 3KDMB 4BEIA 3TNMB 5E2UL 5I0XA 1MVUA 3EJRA 2YUZA 2V33A 2EIZB 4H1LG 3HG1B 1J5OL 2BCKB 3PU7A 5F7DA 3BEWB 1DJHA 3K6OA 4PJAB 1BREA 1JPTL 4PJAE 4XO3A 4N9OB 1AMYA 4ZO8A 2F8IA 3JWDL 4IBLT 4QRPA 3VRJA 3P4NA 5J0BA 3SQBA 1KYOK 2WBXA 3D08A 2VSCA 1WFUA 1MCWW 1MHEB 4QTHA 3VAEA 5F7EH 5DRZB 4IU2B 2YRLA 2VW4A 2ISDA 4GSXA 3C2SA 2IPUK 2LTQC 4JRFA 5GGSY 2J6EA 2PN5A 3ARUA 1AZVA 1F4XL 2C4FU 2CHWA 4RWHA 1JWSB 2GTZB 5D7SL 5DQJA 5C1MB 3DUUA 3THML 4DN3L 4MS8C 2R59A 1AZRA 5HHXH 2FUTA 4NT6A 3TT1H 2VDPH 1AACA 1R0AL 1OF2B 3MACL 2K3TA 2V7HB 3DX7A 3VXRA 2XA8L 3BSZL 3PYCA 3LPPA 1AE6L 3TA3C 2AQSA 2OSXA 5GGRA 2C9XA 3KLSA 2KQMA 4R90H 2DQUH 4HQQL 4M1CC 3S37X 5B39B 2BC4B 4P2QA 4UUJA 2XPZA 5K9KA 5BRQA 3QJVB 4YHYC 3BDYH 1VAHA 4HIEB 1LDPL 3S4SB 4J4PD 4ZMTA 5C0RL 5JPNB 3TT3H 1WLHA 3S88L 1H3WM 1LO4L 4WEMB 2A6IB 1RLWA 4LLQA 3SDDA 4C4KO 4AL8C 2O5ZL 4OZHE 2Z7UA 1OSPH 2X1XR 1NANH 5J11B 1A6WH 4EPSA 1HZHH 2R7EA 4XNYH 4UU9A 3O3EA 3ZUNC 3KAAA 4C4UA 3VCLA 3PWVA 3BW9B 2D31A 4H26B 4GAYA 2D73A 1CGUA 2Y6SD 5EO0B 2EO7A 3OAUH 3PV6A 2WIMA 1TETL 2UY7B 1E5YA 2VMDA 2YA2A 5IW1A 2EVFA 4R96A 3GS7A 3P4MB 1QACA 3UJTL 1E7VA 1IZKA 4OKVB 2FO1A 3CTTA 5IB2B 1OARH 4PG9B 1IKFH 5IMOA 5CN3A 3RPIB 3TEXA 3WY2A 5GHWL 1JPFA 4UOW1 1JSYA 4ABQA 1HJBC 2CA4A 1DDHB 3D3VA 1NBZB 4V11A 2ZSVA 3QZMA 2MKLC 3FT2B 4XVJH 1HYSD 1ETZA 4IK7A 3W39B 1OB1A 3OQRA 4QDGA 1N70A 2X6CA 3QJSB 2OYKA 3PDOA 1YEFH 4YXHH 1JRHI 4I1PA 4FQQB 3K1KC 1SHSA 3GPSA 1KN4L 1KT2A 4XN5A 3BI9X 3MUGA 5JUEL 5LXGH 5I19L 5EOQL 5KVGE 2V3FA 4ZUVB 1MH5B 2QQNL 3EYOA 3KLKA 3OSKA 1PLAA 1RPKA 3MRGB 1H3PL 3O6KH 4RFNC 1R1CA 1JZDC 1RMFL 4LOEA 1UH4A 4BJLA 2H6PA 3PE9A 3ZYZA 1TEGA 4KVNH 4OF0A 4LOUC 2XWJA 4ONFL 6PAZA 1TVBB 1MPAH 5AVRB 4CVXA 4NLHA 1L7TH 1MVYA 2WSPA 1BFSA 5HHVL 1QASA 1JV5B 3MRDA 3X13A 1I8IA 4NQED 1UXSA 2JIXD 4IOSA 2FX8H 3L4ZA 4PJCF 2QELA 3P77A 2JELH 2BVYA 4OM0H 4HEPA 1P0SE 2JB6A 4MLIA 3EKCA 4F1ZA 2JLLA 1LO5A 2IADA 2V9QA 4N1CA 1E3FA 1SN0A 2JNZA 1GCFA 4Y5YA 4JGNA 2CPCA 2FJSA 1U41A 4NQEB 5T5FL 2JIXB 2BVPA 2ITFA 4K3JH 3LPWA 3VFGH 1O5PA 4QHMB 3D8MA 3ZHFA 2V2TA 3H54A 1IGYA 2ATAA 3BVWA 3DOIA 5I1DB 1P6AB 3KWVA 1KIUA 1T21B 1MRDL 1YCSA 3BKCH 1UGKA 3FPYA 5BVPH 5D4QA 2E7LC 1ZA6B 1ID2A 1K3IA 4LMQI 4J3VA 2NW3A 2VDNB 2YAHA 2E86A 4J6IA 4WO0A 2EE6A 3E6FB 3TCXA 3LKNA 4PWKA 4UNTA 1P2CB 1WD9A 4YHPA 1MUJB 1OZTG 4MMXB 1QSVA 1BVZA 4P5MA 4O51B 2XV0A 5B3SB 2CHNA 4QMEA 3DVNA 1LXMA 4YDNA 3V0FA 4X5WB 4YWGL 4BZ1H 4N2BA 4L9LB 1I9IH 3QEQD 3V6OE 5JHDD 1PAZA 5I1IL 4ELKA 1HHIA 2OM5A 2C3VA 2XV6B 4DVRL 2C34A 4YJZL 2F53E 3CH1B 3WTTA 3E1F1 5C0DA 2ZWYA 4OY9A 4XCYA 2CAKA 1P5UA 4PMFA 2ZICA 4OJFL 4XRCB 2IC2A 5DA4A 2JFCA 4LPVA 3KXFA 1ZV5A 1ZXKA 4OZFH 1YEIH 4I0PD 1AFVH 2Q6WA 5JHDB 3T4AA 3FO2A 1L0XA 4QXUH 5AW3B 2DQTL 4HHAA 1Q9LA 1ADQL 4H8WL 4XI5D 1U58B 2XJKA 3VXSD 3C5SA 2DI7A 1Q0YL 2OFQA 1SJMA 5HI3C 3ZDYB 5CLYA 4RVBA 1FNSL 1KJVA 3BKML 4I0PB 2FQFA 2FZ3B 2RGSA 3MLSH 4Q4EA 3NJKA 2H41A 5CP7A 1UC6A 2LVCA 4LESA 1Y6MR 2N7AA 4CN1A 4Z0BL 5GISL 3VXSB 1K72A 4OVUA 3TPUB 4NKOA 5FECA 2EAEA 3NQIA 1Q72L 1Y7VA 5IF0A 5ID0A 3KWXA 3O3BB 3IGKA 5FYLL 3I6LD 5K9OB 2NY0D 1NGWA 1KIQA 1IT9L 3FUFA 3BKJH 4K8RL 4J3TA 3UTSE 4AJYV 3MLVL 3L1OH 3WTWA 4R7LA 3DO7B 4YH6A 3VGDA 4TTGA 2X1WL 5GRUH 1MLBB 5ENWB 3F12B 5JPNC 4ZD3H 1KFGA 5F6IC 3UG4A 1JD7A 1KJ2A 2ARJA 2NY0B 2VLJD 3X12A 3L8QA 1B0RA 2VJXA 2XLLA 4FQCL 4FYTA 4KKCD 2D7OA 4YSDA 4YXKH 3H9SD 1EZSA 1HKFA 2C3HA 4L3FA 3RB5A 1F11A 3SQOH 1TXKA 2IH9A 1QFWM 2R29H 4PJXB 2VJ8A 1QYGH 4DVBA 3ZQXA 2VXSH 1FZKB 3ULAB 3CIAA 3SJVA 3DNKA 4JFYB 5MENA 3GI8L 5JOFB 4RA3A 2VLJB 3T0XA 1T5KA 2JJUA 4KO6A 2IV9A 5CJXC 3S3JA 2WCPA 4Y9CA 2ZUUA 4H44C 1PG7H 1T83C 4XPAL 3H9SB 1R3HA 3MV11 1TZIA 1QZ1A 4GG6E 1VLXA 4ZAKD 2VMFA 43C9A 1GW6A 1N7ML 3CPUA 3II1A 1J9SA 3QVAA 4FOMA 1EWHA 2WTRA 5IROD 1KXVC 4XO9A 1E27B 3QPQC 2BERA 4GSRA 3QCTH 3P4LA 5CILH 5L9DL 1U8CB 4JM4L 3H9ZA 2J8UA 4D0DB 4JO2L 1DVXA 1N8ZA 3SY0B 1XV8A 5JIPA 4QR7A 3S48A 3DOHA 4KHXH 5E94A 3CXDL 5HGBB 4E9VA 4WQOA 1U8LA 3FT3A 1Z2KA 2FQGA 1GZPB 4KAQH 4BSVA 2LLLA 5E5MB 4M6MH 2MQ0A 1GSKA 3FT1A 4MD0B 2YD1A 3WFBL 4FG0A 3WTVA 3JSSA 3UBXG 5JYLA 2JI2A 5JW4M 5LJYH 1VF5C 5IVXB 2EYRA 3A6BL 2XPGA 4UTAL 1G0DA 2IAMD 4DERA 3VGGA 5DVPA 4BK8A 1N9PA 2CO1A 5EZJB 1JJUA 2BRQA 2WXRA 5JHLH 5F9WC 4GW5B 4XE5B 4J27A 2DLHA 5ISZA 3F2LA 4HAKA 5BV7B 1F90H 4K94C 5AKTA 4GRWB 4GRWE 1K85A 1EDQA 2X4TA 1KPRA 4LEOA 3TYFA 4NQTA 3LJ3A 3U46B 2ENJA 1K8DB 2IAMB 4CJ1A 4KKBD 4K3DL 4GBXC 5F1IB 2VXQH 5CEXA 4MQ7A 2I5YL 5F0PB 2FGWL 3VFPA 4S1DC 4PJAF 1B3JA 3AQDA 2DMGA 1AZCA 3WN5C 5F89A 4GYBA 1DSWA 3HE7A 3CV5A 2F08A 2D3NA 1AJ7H 1CO1A 2NYYD 4TUJA 4Y9FA 5K9JH 1M1XA 1MWAH 3K7UA 4HJJL 4ECNA 2YMOA 4LF3A 3NJLA 4F57H 3WLWD 1WUZA 1VEOA 1VDGA 1OTUC 3DX8A 3ESOA 4G8EB 3ZL2A 1EGJH 1CF8L 1XSJA 2AK4A 4PP1D 4PRHE 3RA7H 2X89D 4WCYH 4LAJH 2OTWB 3CPLB 2A9NH 4N20A 5ESQB 3GSQA 1E0OB 1I9EA 4WY7L 1JCVA 1XMEB 3N3EA 1U30A 3P9LA 3IS0X 3QRGH 1MREL 5EA0L 2J5WA 5B1KA 3KJ6H 3VD5A 5DEZA 1VA9A 2WO4A 2WWOA 3QE5A 4HJ0C 4KXZH 4U6XA 4N8VA 4BINA 3QIUA 3ZU8A 2A6DA 3MRJB 1KXTA 4X9BA 4NQUA 1U92A 3DXAD 4JM2A 1NFKA 3ZHNA 2YPKA 1JDCA 5I1JL 2Q7YA 2D0FA 4NNXB 1JG9A 2MNWA 3FNKA 2GPZA 5DF0A 2Z31A 3OB0K 2HFGH 2F1BA 1XGQA 3BZFB 3N1PC 2V7NA 3O6FA 4N0UB 2OL3B 2CDEB 3SPVA 2Q86B 1IGJA 3BH9A 1MCNA 2IH3B 2W60B 1AGBA 4P4KA 5IBUG 1UOWA 3DXAB 4OZHF 3DIVA 4GS7C 4KK5C 1JV2A 1G9NH 2Q1EA 3QNXA 1TJMA 3FPXA 4KV5E 4WRLA 4D7PA 4JDZA 4X6DB 3LDBC 2DMKA 2KHAA 2XV2A 4YXLL 4PPTA 4OIIH 1CJYA 5E7FA 2ZWKA 2JK5B 4P5KB 1TEFA 1T4KB 3T3MB 4EDXA 3T3ME 3WV0A 4RMWA 4U1MB 1KN2L 2X4RA 4CSPA 1CVSC 5GZNA 2ICEC 5G55A 1KGWA 1P7QD 3CZKA 3WGUB 2NTSP 4KHTH 2ADFL 2FT6A 5CU9A 2MOGA 2KLTA 5F93C 2EDFA 3HKZA 4N2AA 1ZDSA 4CSTA 3GSUA 4XR8C 3U30C 3V0EA 2N7BA 3GHEL 4XO4A 4AKPA 3OKYA 2X70A 3DVIA 1NGQL 2V4LA 5BOJA 4NWTH 5DMIL 3GRWL 2LHAA 3FCTA 3MRQB 2XTJC 1P7QB 4WUUD 3WNJA 4R9HA 5MEPA 5L2KA 2MCPL 1X5KA 2CDGB 4WAFA 2VR3A 1RFDH 2GJJA 4JMNA 1QBBA 3WUWA 2F0CA 4OV5A 1WISA 2J5LB 2YC1A 2JTDA 1A7OL 3BVNA 1RUAH 1NFIB 2CJTA 3STLB 3V5HB 3CBJB 3OMZA 4WUUB 4MXVE 1NKOA 4LIQL 3H7BA 1F3DH 5C07A 5DEJA 1MOEA 4H7VA 1WFJA 3WU1A 4CDHA 4P05A 5KVDE 1A3ZA 3UPRB 1KCUH 4NQCA 3TFBA 1EHKB 3V5DB 1UB5A 2VLRA 3FBKA 3B7RL 4APXB 4EVNA 4TNVK 1KYDA 3OR7A 2YKKA 4NCDA 4PV8A 2Y06H 4LAQL 4FXTA 5E0FA 5EIVA 1FIEA 3OZ9H 5EFIA 1IAII 1L0YA 1I3RA 4TTDD 3STZB 3JTSB 1F8TL 3FXIC 1XGYL 3Q2NA 1Q9OA 2E9BA 2FJFB 5T33H 3LPFA 1CF1A 1ACZA 1N2RB 3GM8A 1NL0H 1P4IH 1TZHB 1J8HA 3MBEA 3NAAL 3WIHL 1J1XL 4LSUL 4XAKD 2KZBA 4PJEE 1ZY9A 2HFTA 1D5IH 2V5YA 5HHNA 5AOJA 3LAFA 4DW2H 3H55A 4XVUC 3VXNA 3HS8A 5E5LA 5C0FB 2IOOA 2H8PB 3NA9L 4FG6C 3HR6A 1Z3GH 4KDWA 4AYID 5I28A 2IVFC 3T04D 3RKDC 3C2AH 3ZT6A 2E5EA 5D1QA 1C12B 1IIKA 3FU8A 3NESA 1OAKL 1KCKA 5PAZA 4NERA 4S1SL 3G5VA 1PZUB 3BEVB 5J8OA 5FO7B 2BFVH 2J88L 5K9QG 1ZJBA 1E9OB 2LVEA 2VR5A 1MCRA 2EH8H 1IB5A 4MAZA 4OGQC 3RJDA 5DMKA 4C57C 1JGIA 3IDYB 2BY3A 4K7PH 1NEPA 4WTZA 3HMWH 3KJ4C 5DJAA 5F3FA 1N19A 2P4AB 4KJQC 1PCSA 1W8EA 1HQRB 1CURA 4E5XA 5C0CA 4ZMAT 3H3KA 3JTTA 4WO4A 3MCKB 3HOGA 4P0DA 3S36L 2FT7A 2ZUVA 3KPNB 3ZL1A 4WGWB 4QHKI 5EU6E 4B60A 4HK3J 2EEDA 3ILDA 1V7NL 5DJZB 3R0MA 1J9CT 2MTAA 1Z5YD 1BMGA 1IEBB 4APQA 4KTDL 4AV0A 1TMQA 3HLKA 4WHTB 1HXYA 4Q2ZA 4F20A 3UG3A 4HKXA 4X83A 5I1AB 3PAVA 1M1SA 4IBSA 3SDCA 1YSOA 3CDZB 1UJ3C 3EGXA 1U2CA 1RP8A 4XN4A 4LVHB 3FTYA 1QUNB 4RMBA 4HBCL 1NCBL 3ZDYF 3CFDB 3PWPE 3W9EB 2A1WL 1XR9A 4IU3A 5DDHA 2BSDA 1QLFA 3INUL 1GRWA 4MNGA 5JMRA 2NX5A 3APMA 4KQ3L 1U21A 3P3UA 2HTLC 3V4LA 3LQZB 4G7YL 4F8QA 2OLDA 2W0FB 5EBLA 1MW0A 4Z7UA 2FHBA 2FL5B 4XMKH 2OJZH 3JWOL 3PABB 2M26A 3QUKA 3CDYA 2X6BA 1CGVA 4P57B 3T65B 3HAEH 4LLVA 2EXSA 3EO1B 5AW1B 1GPOL 1UWEH 1AHWB 1VJSA 2E7BA 1ADWA 2Z4QB 1WIPA 3MJ9L 1T66D 3MMEA 5CEZH 2XU9A 3ML8A 5KAQG 1XGTA 1P4BL 2AFNA 2BP3A 2EEAA 4UTBH 4MFHA 4Q9BA 1LNUB 2BP0A 2NNCA 4TPRL 4IIQC 2NT0A 2XWBB 3EFOA 1AP2A 2OMZA 3DOSB 2ENYA 3T9WA 3D52A 1JK8A 1WE5A 2C7UA 1HHKA 4JKWA 4BA8A 2UWEE 5GGSB 1LEIA 4OZIB 1T5WB 4X8JA 4UQ3A 3V4UL 4GO6B 4PJXF 2MPVA 3UTQB 1BEYH 2RD0A 1EFXD 3AFLA 4NUGL 2YS4A 4S2SB 3RBGA 1BZEA 5DTFB 1H9VA 4ENEC 3MAWA 4PLJC 5FGRA 3AS2A 4YPGB 1LYQA 1WH0A 1YYLH 2GAZB 5C0BE 3WFHA 3WXVH 2A6KA 1G1CA 3VD1A 5L88L 3JBG7 2X6AA 2B9AA 4ODSH 4NC2B 1Z7JA 4ALAH 3FN0L 2W80C 3HB3D 4R26L 2AEOA 1KCRL 4M8QA 3OXSB 2ZOOA 4ZNEA 4G8IA 4YDIH 1EFXB 1ZHNB 3LTVA 2VDQL 4RGND 1IC1A 2PKDA 4ZQKA 5TDNA 3QDMA 3ZPDA 3QNYB 3GEFA 2A74B 4BFKA 1L7IL 3W5MA 1FL5A 1LD9A 1OP9A 2NY4C 2I9LB 3OC8A 5GGQL 3QQ9D 1QA9B 3DIDA 1OKEA 1T1YA 3RTQA 1HHJB 1KIPB 4Y19A 1OTTC 2QSVA 2F74B 4NBXB 1NM4A 3HB3B 4N5ED 3B9EA 2J57A 1K5WA 1MJ7L 2VZ3A 4M93B 5T5NF 1UUSA 2HVKB 3UO1L 4RGNB 4RGNE 3QHZL 3DDGA 4NZDA 2IDCA 4PS3A 4TVPD 3HEIB 2V5MA 4R4BB 4A1RA 2M8XA 3EYQC 4WFFD 3GXFA 1M71A 1BP3B 5F96L 2KT6A 4F8PA 2XCMC 3DETC 4HSCX 1CYXA 3K72A 1DBJL 4J3XA 2WXIA 3IDJB 4NRXA 4TQPA 5IHWA 2VLMD 1R47A 5IVXF 2IANA 4I85A 5FCSH 5JW4R 1FGNL 2YUWA 4Y4FC 5IEKA 3DTXB 4TVPE 3L3JA 1SXBA 5AAWA 5HHQA 5IVNA 4GRWF 4RAHA 4OF3A 4Q0XH 3TBVA 4N1EA 4CC4C 5IW6A 4U4IA 4MCNA 3IGAA 5EOCJ 4HUXB 3QZNA 3EDDA 2VN5A 4CADB 4M7LL 5F21B 1EVUA 2Y0SA 4QRSA 3RAJL 1LMKA 2XHNA 5FDWB 4LQ1A 4UIKL 2L7EA 2FBJH 4AJVA 2N1TE 4PLKC 2SEBA 1UFGA 3RKPA 4QNPF 3FRUA 3OMNB 1XF3A 1DJZA 1FZMB 2R1XA 3C8KA 4D9LH 5A2JH 1DUZB 3ESMA 3EYVB 2NY2C 3FT4B 4GG8A 2LV4A 2CD0A 1JYVA 5HI4D 1UG9A 3B3BA 1CDJA 1SY6L 1A9BA 4HLZG 2RIKA 3ARVA 3FW6A 2ZG1A 3QYMA 5KN5A 1XIWC 3EUDA 1D6EB 2H2PD 2YEQA 1U2YA 1QLEH 2VT0A 3FCUB 3WEAA 1ITBB 2WUBH 3N50A 3QWRD 3QARA 5TDPA 1N6QL 4Z8FL 3BQUD 2BHUA 4Z7VE 5FUOH 2X4SB 3CFEB 4ZMYA 4U6VL 1BJMA 3BIAX 1TO5A 5HJ3A 4XBGB 1ZPUA 1E6OH 5F7MC 1DQJA 2VN4A 1ZHKA 3EGSB 3FRPG 4PGDB 5F1OB 3O2WH 2OJEB 5MEOA 3ZDXE 4EI6A 3BQUB 2ICWI 1F2QA 2NSMA 3Q01A 1IKNA 1MN4A 3FT9A 2Y7MA 1HHHB 1HCFX 4Q9RH 4X6DF 3UIYA 3JV4B 4EI5D 4LLDB 4PJ5D 2B1AL 3MSPA 4OTXL 5HYFA 4AZ8B 3TO4A 1DSFH 2LLGA 1NOAA 1NDGB 2MJWA 3IBEA 4KJWC 1SXSA 3T3MF 5D6CA 3Q48A 4JL1A 3L5WA 1ZV2A 3GKWH 1WAAE 2ZYHA 3SKUD 4CSZA 4MD4A 3PWNB 3QUMH 5ID1A 2CBQA 2QR0A 5F9OL 4K7FB 1GJWA 4EI5B 4PJ5B 1SVBA 3I3BA 1BFTA 2VITA 3MV7A 3LN4B 1JF5A 5I1KL 2HFFB 5I71B 5C7ZA 4JFXA 1PX4A 5IHZA 4K2UL 3KLHC 4FFZL 4OLVH 1A6PA 3L54A 5AD0A 2IXQA 5DHVH 4AGMA 4YDLB 2Y7OA 1KBWA 2D9QB 2VISA 3HG2A 5T1MA 4OCYH 2E9IA 1FNAA 3HC0A 4LLAA 4OUUA 4A6YL 3EHBD 5HYSB 2Q3AA 3TJEL 3K4AA 3L17A 4QRUA 3QDHA 5HD8C 4WKXA 5KBNC 3HS9A 1QBML 2D03L 1PZAA 1CIUA 4G7QB 4MXVF 4QRTB 1UEYA 5I1CL 4XOBA 1DZ0A 2HKHH 1CE6B 2P44B 4X7DC 2ED7A 4UV7L 5DLML 2JJTC 3K6FA 2E6PA 3EHBB 2YFNA 2WXQA 5I75C 3BWSA 3O4LE 4OF8A 4JQVC 4LVOC 3RHWF 1P4LA 4IK6A 1PYWA 4KRPC 3AQXA 4ZUWA 3X14B 5IJKC 4JPIB 2GC7C 3FZUD 1LEGB 4WNQA 2AQQA 3CVHL 2I25N 1ET5A 3LVTA 2WWKO 4NOFA 1DQLH 4ODXB 1CBVH 4OF5A 3PFQA 1FL6B 1OE3A 4Z18A 4XAWL 3BYYA 1DQVA 3IN2A 3S5YA 3SKMB 4R5VA 1WD8A 2APXA 5JDJA 4WJG3 1VZGA 2J6EL 2ICWB 4AQ8A 2AW2A 5BZWB 4OD1L 3IN0A 1RIHH 1F00I 1B9KA 3F7VA 2N0KA 2OV0A 4NKQB 3MGTA 2YAOA 2FB4H 3MO1B 2JE8A 1AQKL 1COBA 1DLFL 3ZYJA 1UADC 4FX5A 4NJ9H 3DV4A 1RSFA 3MNZB 5JO5A 4PAZA 1J5CA 1AGEA 1QATA 4AE0A 3CFNA 4M6NH 4ZQTA 5KW9H 4HBQA 2JB5L 1BQLH 3JWDC 2P47B 4PSRA 4Y1TA 1JF6A 1L0PA 2Y6TE 2B0SL 3RX8A 1JPST 2A0LC 2G0LA 1PGRB 2KQNA 3FRPB 1EXGA 3PCYA 4W9LC 1I9JL 1I85A 1OE1A 4D2NA 2VDKH 2PCYA 4GT0A 5DK0B 2WCGA 1O7VA 4TSAL 5SX4I 4KVCL 3DX9A 1EFQA 2E7MA 4PJ6A 4I3RH 3RZCC 5E2VL 4S0HA 4QRBA 1AXTH 4DEPC 3QPXH 2WXPA 3WFEL 2QSQA 3EADA 4JL2A 1R5IA 3L5JA 2CDFA 2VTFA 2BS8A 5HGDB 1YECH 1M7UA 1HOCB 3FUNA 4LLYA 4KJPD 4X6EA 3QUYA 3CFUA 3B9KA 5FYLE 4GXVL 4I5BB 1FDLL 2GCYA 3O2DH 4GQQA 2OW6A 3WS3A 1SYVB 3V0GA 1IVLA 4F9LC 2PR9A 2JKIS 4JO8A 4GNKB 2OXHB 4WUKL 1LE5A 1WDAA 3RX7A 3GQFA 5DUPH 3NCCB 2A4EA 1GY1A 2IALA 1QO3B 2Y2YA 4N28A 1G9HA 1NC4D 5KYXB 2JJSC 3LKQA 4HMEA 3FU5A 4YHIB 4F5CA 2FX9H 1S7VA 1G1YA 3VACA 3LEYH 1WA0X 5GGRY 4RIRA 5J1AB 3CFKB 3KPOB 5DS8B 3VU1A 2X3BA 2YN5A 3DMMB 3RWJA 3QXUA 4PJ9C 2ZWNA 4L4VE 3QZOA 3BVTA 3G6JB 1NC4B 4P23D 5D2NE 5HYJE 4NI6A 4HIJB 3BAKA 3G6AB 3EFDL 4WENB 1BIHA 2Z65C 5GSRA 3TWYA 1RD6A 1M3IA 3HZVA 3SE9L 3ULVL 3UOAB 4Z77A 2C9AA 4C59B 2PPEA 3DTUB 3MRBB 3ULUH 3RJQB 1MSPA 2HX9A 3KM1A 4HUWB 5FV2A 3D85A 4QXGL 1QRKA 3ZVVA 3W81A 4HXAL 4P23B 5DO2D 5GRZA 2ZWSA 1IMHC 1MHPH 3ESUF 3QQ3B 4CILA 1NIEA 5GS1B 4WU7A 4NKMB 2FBOJ 4WJKB 4PJDA 1A5FL 4XWGH 4MMZB 4J28A 3FDWA 1PZSA 4WWPA 4BDVB 4DP9X 4RQQB 5EORL 3GC3A 5LNEA 2WXMA 5KBMA 1KEGL 3MCLH 2O6FA 1VGKA 3E2HB 3Q05A 5EU4A 2X4PB 4BXVA 4TRPL 5AYUH 5FB8B 3FO9B 4GI9A 2YZ8A 4K9EH 2VM9A 1R24B 3HG4A 4OZIF 3LQAL 4UM8A 1CZ8H 4Y16D 1NMBL 4XPGH 1NSNH 4ADGA 4M1DH 3C09B 5CWSB 4L4JA 3DECA 4NO3A 3U0WL 3GBDA 1ZT4A 3I2CL 3L4WA 1BVKB 4M02A 3D18A 3OKDB 3NTCL 2OK0L 5EN2B 1XO8A 1X5IA 2BVOB 4JR9L 2X1PA 3DUSA 4F8NA 5GRWA 3GNML 4Y16B 3T1WA 3CZEA 2P24A 5F3BA 4N6RB 2YD5A 5JXEA 2H0EA 5KSBA 3IJHB 3QJXA 3BPNC 3APDA 4IYKA 5E99L 4C8XA 4UT6L 5D7IA 3ASWA 4YHOL 1L9PA 2EC9U 4LQFH 3SDXA 1XBRA 1J12A 4U3SB 5KOMC 3CMGA 4JFEA 4CW1B 4BSWB 1EV2E 1ZHLB 8PAZA 4LPYA 5IGXL 1G9ML 3GS4A 3OZKA 1R3LA 2QVTA 3IGUA 4JHZA 1BQRA 1J1PH 4N0RA 3GMNB 1FO0B 1HZKA 4YDZA 5IHUH 4G43B 1TVHA 1OF0A 1GGIL 4UQAA 3K46A 4PJ8A 2MFNA 2DN7A 1IBZA 2N0MA 1QWNA 4NJAH 3UCRA 3UZVA 3HBZA 1EEYA 1PAMA 1BVLA 2ITEA 3NCYS 3VH8G 1AZUA 1NCWH 2NZ1A 5EU5B 1SDYA 3PXHA 3CBRA 5TE4H 1BM3L 5GZOA 2IWFA 3TIDB 4L29A 5AG8A 5F97E 5CIPH 3QZPA 3U2IA 5IB5A 5JPMC 2BSRB 2H26B 3S3DB 4JANA 4UOZA 2ESVA 4OCWH 2AABL 2VH5H 1DQIA 4KH2A 1WQVT 1MI5E 3U2SB 3S36X 1X4YA 4P2RA 4XNMB 2WUCH 4L3ED 4P9HH 3T2NH 2EXWC 1OOAA 1V10A 5ELIA 1QVOA 1BEXA 1HOEA 2OP4H 3VD4A 1EO8L 3O11B 3QFJD 2XVGA 5CZKA 1PL3A 2GG1A 3QDJD 1MIMH 4YBHA 5D7LA 1WO2A 4W4OA 2IMNA 1YEDB 3KPRB 3KPRE 3ZE2B 1AXSA 4I18B 3IKCB 1D5ZB 2AV1A 2E47A 4L3EB 5FX3A 1FZOA 5EN3A 3VFMA 4ACTA 4X9YA 1RK0B 3TS8A 2PR4H 2AXGB 1RZIA 3D9AL 3ZO0A 4JFUA 2L4OA 2FJGA 4PLNC 3QFJB 3EOAA 3QFJE 1MCOH 5D71H 2ZWZA 1KTLA 2Q7AA 2A77H 3QDJB 3QDJE 1F42A 2C1OA 4UQBA 2V2XA 2X87A 2KUTA 4H8WC 5DJ6B 1CC3A 1AY1L 1RZFH 2ZF8A 3FQUB 1YEJH 4DJMA 1SZNA 2VN7A 4MDRA 1YMMA 4YGVA 2FGZA 1SUHA 2ZX9A 4ANUA 3ZGIA 3EOBB 1IGIL 3V6FB 1U8IB 4HV8A 3NEXA 3SKOA 1YNLH 5BS0D 1PIFA 2YQ2A 3EGDA 5FW6A 3CZFB 2AS5M 2DEWX 4IRZA 4X9GA 5T3XH 2KMWA 4JG0H 2Z8VC 4NRYA 5I6XC 5T8IA 4ONHA 4O00A 3OKMB 5TQ0H 1E42A 3LRSB 4GRMB 2BSTB 1IFGA 5I9QB 2GITB 3BWAA 3KW7A 4K8RC 1NM9A 3MODL 1ES0B 2IG2H 5CCHE 4RAUA 4LIQE 1EEQA 3L1FA 4AYFA 1CDCA 1DFXA 1MY7A 5C0JB 3MLRH 3QA3A 3SPCA 4PP2B 4BGLA 2H32H 2R9HC 3EBIA 1IAOB 4JDEA 2FWUA 4YE0A 1WZ1L 4GMTH 2BSEA 4OI9A 3IMRA 1EZUA 2NUPA 5FCUL 4BFNA 5CSGA 1QMUA 3LNGA 1FZJB 5E8OA 3EH2A 3NIGE 4ERSL 2ZJSH 3DMMC 3HI1B 4FQ1L 4DPRA 2A83A 3AXLA 4AVHA 3IAQA 5D2NC 3T8VA 1EMTL 1MXGA 5M94B 3AABA 4UQ9A 4F8TA 3UCQA 4L2YA 2QV2A 3GBML 3ZKQD 1XGUB 2WOBA 5SV3A 5D2LB 4GAJH 3BO8A 4GKZB 1TU2A 2DBLL 2GABA 35C8L 5MERB 1JUFB 2ERJB 4PRBA 2YRZA 4LCCB 4PTUA 1SNRA 4XC1L 4FHJA 4I48A 2FATL 2VQTA 4GKSB 3VYNA 3UYRL 3V0VA 1NBVH 2C4XA 1AQHA 1EK3A 4P5TC 4OGYH 5IMKB 4BHUA 4LBEB 1ORQB 4AY0A 3U79A 1A0QH 5DD1H 2CO7A 3KCPA 4DUVA 4YGAB 1OCWL 3RFZB 1FFNB 5JZ7C 2BSSB 1A25A 4IRJA 4JFDE 5FAAA 4G7VL 1JZHA 2WN3A 1QRND 4KTYA 1A3RH 1BECA 4HXBL 2NY7H 5FWRA 3KG5A 3S8FB 2PW2B 1D5MA 1CFBA 1YN7A 4WU5B 1HL4A 1BHGA 4MYWB 4HWUA 4M3JA 4UANA 1UB6B 4I9WD 2QBWA 4JFSA 4NUMA 5CD5D 3LEXB 3QORD 2CCVA 1MCJA 4FFVC 4O5LL 3C8HA 3PL6C 1TQWA 4PWFA 4YO0B 1HEHC 1A6ZA 1TZGL 2B5IB 1QRNB 2OMBA 1QRNE 3GIVB 5J13B 3PWUA 2CCWA 4YR6B 4UT7H 3L7FB 4IKLA 5E8EA 1XXDC 4XP6L 4F9PA 4OQTH 3OGCB 3LZQA 2Y36L 4PJ7A 5B38B 4WI3A 3TN0A 3QORB 3VXUD 3QG6A 3REVB 3Q1SH 3TBBA 3BZDA 4GRLC 2HN7B 3D0LB 4HX1B 4NSKA 4G8GE 5IFAH 4HKJB 5D5MA 5CLTA 1KCWA 1XEUA 4NHUA 1U3JA 4WFED 4HALA 4EQ2A 1NAMB 4HKZA 4MB5A 5E8DL 3VXUB 4N2KA 3VXUE 3FTZA 1DQQA 3OKEB 3T71A 5LCVH 5TH2A 4E42A 3T6QC 4ZTOL 3APFA 3GT6A 5CLZA 1OV8A 1U8QB 1YNTA 3L4VA 4ELMA 2GUOB 3MLPA 2KDYA 2VDRL 1SBBA 1F6AB 1IUZA 1VZHA 3NVQA 1PEWA 2XZAH 4B7LA 4UNVA 1J11A 3EDKA 4L1TA 5BJTB 4DGIH 3QAZB 3QUZA 5FYJL 1WSST 5FM5O 1E4KA 2PP7A 2AJUL 1FH5H 4MSWB 1E3ZA 5JXAL 1GGTA 5C86A 2QQKH 4KKLD 2DD8L 3MRIB 1U8OA 4FF9A 4HZLB 4M56A 5FYJU 1T0NB 2K78A 4NFCA 3P9WB 4CA4A 3BE1L 3JVGA 4KK8D 1QSZA 4K71B 4TQ8A 1F86A 3B3IA 5B4MC 4XPTL 3KWTA 1B4LA 1LWHA 1D9KC 3M1OA 1SEQL 5DUBA 1TJGL 2WJ5A 4AYSA 1OGPA 3BP5B 2VERA 3IDGB 1BXVA 1MHHB 2HRHA 2XWXA 2ZZUT 3BIBX 4PJFA 3C6EA 1ICTA 3U1QA 5KJRL 5IB1B 4JRYE 4QYOA 4NUPA 4WFHD 2R2HA 3NOIA 2MOQA 4Z7NB 3BVVA 4Z7NE 2JQMA 3QIWC 4ZS7L 5E1AA 1MCBA 4ANWA 3ARBD 3NJHA 1AHKA 1CICD 1OXYA 3NFPB 4Y9GA 4FA7B 4YDVA 2XN1A 3LOWA 3OAZH 4MCZA 3G6JF 2OJ1A 1KEMH 4HCIA 2GTWB 4OM1L 4NZFA 3B34A 1X5AA 4DSYA 2HMIC 5GIRB 3K71A 4WFHE 3KDPB 1PDKB 1R6VA 4JB9H 4DO4A 3CN1A 4B53A 1RHHA 5FO8B 3NSCA 3QDGA 3ARBB 3FO1B 5F1NA 3EYUH 3NRFA 1ZEAH 2XG4A 1CICB 4FFYL 4X6CE 4X6CB 2LABA 2OMWA 1M7DB 1T20A 2W9DL 3ZX1A 2R1WA 2R4RL 4UB0H 4EKJA 3O3AB 5DEFA 4P99A 3T8MA 4PR5B 2QQLL 1J0JA 5DD0L 2OX5B 3RUGB 3WHE0 3RUGE 3QCUL 3U4EA 3FONA 3O0RL 5AENA 1UEMA 1SM3L 1FYHB 3SGEI 7FABH 5HGAA 5IBLD 2N1KA 3MRFB 2VO5A 5LGYA 3MVSA 2XN0A 4OB5H 3HMXA 5CGYC 3V4PA 4OZFA 4RAVB 3O9WA 1QI3A 2B4CH 2WV3A 4PYHA 3UTTA 3GJFA 1MFCL 1JPSH 3TA3A 2CLZB 3X2QB 4BXSV 3RWFA 2DQIH 5I9QC 3SYAA 1H15B 3NDYE 3GF8A 3Q6FA 1U8HB 3W0WA 4ZS6D 4M4RB 1JTPA 3TURA 5I15L 2BHFA 2EE0A 3GSVB 3QJHA 5EWIH 5B1CA 1BZ8A 2ITCB 4B9ZA 3VQMA 1U8MB 4IEFB 2F19L 5C0EA 3CDCA 3QZWA 4MVBC 1WUNT 1G0YR 2MTPA 3GB7B 2EDLA 2OZ4H 2VWEE 1KGYE 5F8RC 3QEUA 3VXPB 2IPUG 1F58H 1W72A 2HT2C 5E03A 1X4ZA 3TBYA 3PWJA 5C2UB 1X5HA 4R4ND 4WDIB 1RJLB 2NLJA 5JW5B 4R0LB 4K73A 4B9FA 2R69A 1G7JA 1YEEL 2I9TA 4YK4C 1JN6B 4PHZA 5SWZD 3WIIH 3ZZSA 3WTXA 1A7QL 3B43A 3CVIH 1B6DA 1KLGA 3L4TA 2WVVB 3GTVA 4PUBL 3SCMC 3U0TA 1J1OH 3S9DB 3JUZA 3HZMA 1RUML 2X0WA 3BH4A 4C56D 3DIFA 4PRIE 1G1KA 1BMWA 3BGFC 2QHRH 2ZOKB 4HIIA 3BJ91 4UCFA 1T04A 4KNQA 1WTLA 1LO3L 1SXNA 5ALCL 2WNGA 5LBSA 3S7GA 1VADB 3BUPA 2R29A 3D51A 3N1QC 4N2OA 4N2EA 5SWZB 1SHMA 1OT1A 1KLUA 3DPDA 1XCXA 1BQSA 2AVFA 1I75A 4G80A 4NQDA 3S96B 1DVTA 4LFHG 4PWGA 5AUMB 4C56B 4C56E 3K8KA 3CUPB 4C83B 1BBJA 2A2QT 4PB9H 4QJ4B 1X9UA 1OTSD 2YARA 5KVFE 3DVGA 3GSWA 3ZTNH 3GWJA 3VRIB 1GZQB 4B9IA 2UXVA 2WBJC 4ZODA 4NNYB 5ERWB 3PHAA 3MA9L 5A7BA 5E6RB 4HT1H 3SGKC 5LNGA 4HW6A 2WVTA 3IDMB 5IOPB 4HDIA 4FHBD 3ZYOA 1RU9H 2OI9B 2CA3A 4FQHA 5FO9A 2BNRE 1CI3M 4YDKH 2F54D 1TUPA 3HI6H 3BLBA 3D0AA 1GTFA 1UD4A 4JFFE 3GLAA 3ZRCC 1IE4A 2Q2LA 4QTIH 3BPCB 5DFVC 3T0DA 1KCVL 4N2HA 1JMXA 2ORBH 4H8UA 2ZKHL 2A9ML 1S7WB 2Q8BL 1JHTA 2X28A 4HC1H 5LGHH 1ITCA 1C5BL 1I53A 3H0TB 2F54B 5EBWB 3B9DA 2G9HA 4WK4B 1IQWL 1P4UA 3QUHA 4X7SH 4X9IA 5DD6A 4XP5L 3BAEL 5DZOA 3VWJD 1FN4A 4OLUH 4WK2B 5C9JB 3QC6X 2HJLB 4OD3L 1SDDB 3ISRA 4W6XB 1P1ZA 3QI9D 2WZ0A 5CGMA 3CDGB 3CN2A 3HJEA 3V52L 4ZFOL 3IDIA 2PYED 3VFTA 1I7TB 1SMAA 1VIWA 2DIAA 3O6MH 5EEXA 2Y5EA 4NBYB 5FYKH 4F24A 1EHLH 1GGCH 1HH9A 2O72A 3JWOC 2IPTH 3VWJB 4ZUTA 2E7LA 1LO2H 5T1DL 3LCYA 3ROOB 4LHUA 3QI9B 4FTVD 4OSUH 3NIDE 2WQ8A 3EG9A 5E5UB 2PYEB 4JHBA 3BLPX 4CNIB 4U1IB 2P43B 3P0GB 1D7DA 1FE8L 1XZ0A 1VERA 4UOW0 3DROB 4FXGB 5I8OH 2Q10A 1KBGL 3OPZH 3DX0A 1MWAA 4Z7WB 4PS8A 4L3CA 1PLGH 5DHYB 2WWMC 1N3NA 1YYCA 4FTVB 4QRPD 3X3FH 3RDJA 2JQZA 5AB1A 1MVUB 1GYCA 2K6YA 4JQIA 5F7DB 4WHCA 3D69A 1S7UA 2GEQA 4LPCA 1H5BC 4QRAA 2IH8A 3T6ZA 2XQ0A 3B2PA 4ATWA 4BFFA 1MFAH 5DHMC 4ZUSA 1G6RL 4QRPB 5H4YA 3VRJB 3P4NB 1EJ8A 2Z4TA 4HIHA 1IEHA 3SQBB 5D2LF 3I9AA 4QTHB 3CE1A 3CDFA 4HUKB 3VXRD 2OBGA 2NY1D 2VR8A 3AWEA 3MC0A 32C2A 5DO8A 4WEUD 4PRNA 4BFIA 4DGYL 1NAKL 4HEPG 5DQJB 4HIXL 3AQYA 3DUUB 1JNNL 1KV3A 4F1SA 2ZOUA 3QJZA 3BGMA 2E6JA 3PWLB 3MU3A 4NT6B 1JMZA 2W0PA 1A7NL 5IK3A 4ZW6A 4IHBA 2ZG3A 3L9EA 3VXRB 3DX7B 4R5TA 2NY1B 2B08A 2XDHA 2FIRT 2VZ1A 3SDDD 1BQHA 1MCDA 3FQRA 4ODBD 1Z5HA 2VDOL 1HH6A 2WPGA 1EJOL 1JF1A 4MQXC 4P2QE 3GSOA 4UUJB 1EZVY 1RZJL 5K9KB 4P59L 4XWOC 2WLYA 3LHPH 1VESA 5BZZA 3TJPA 5I5RA 4YX2L 3RZWA 1CGTA 2A3TA 3UTOA 4JPKL 3UERA 5KUKA 2QKIC 3OKKA 4GFXA 4LLQB 3SDDB 2C9UA 3VU2A 1YUKB 1SYSA 1S3KH 4RBPH 3RIFF 1NGYA 5DS1A 1CLZL 1J10A 5DT1L 3K0YA 4EZJA 5JORB 2D7MA 3A67L 1LP9E 4OIFA 1OWRM 3KLQA 5TK2A 2R7EB 2YD4A 3FTGA 4N86A 1NIDA 3O3EB 4UU9B 1L9SA 1RZ7L 3PWVB 3LIZA 2D31B 5EU7C 1K3ZA 4MB4A 4GAYB 2VWEC 3KR3H 4TNGA 3CLEL 3SPJA 5DC2A 2F18A 3D3VD 4X5QA 2O6CA 5IW1B 1NCCL 4R96B 4U05A 1FLRL 1A22B 4POZC 1CLOH 1E4WL 5CJXA 1FYTD 4EBQH 5AW4B 1JVKA 1T83A 2VDML 5IMOB 2Q76A 3F5WA 1SBSH 1JPFB 2IH1A 1MY5A 5FHAH 3CNKA 3SZKC 1GH7A 4PVNA 3D3VB 4TL4A 1CR9L 1KXVA 4JRXE 2ZSVB 4LRIC 2EC9T 1GYWA 1A1MA 5CCKH 3MRRA 5BZDA 2AEPH 1ETZB 3F62A 3VFOA 15C8H 4WV1A 1FYTB 2MEJB 3PDOB 3ULVE 4DPCX 2MQGA 3NPSC 3GFUA 3HC2A 3BD4A 3GSNL 1QPPA 2AXWA 2FYVA 2XZCH 1FFPA 1KT2B 1YVLA 5ABZA 3PF2A 3D09A 4NZUH 4L05A 3WO4B 4JFPA 1TJIL 4IOSD 1A4KA 4X99B 2GJPA 5BUGA 2H6PB 4ORZC 3DDFA 4G1MA 2XWJB 4H1LA 3H9HA 4CVXB 2PYFA 1A9VA 2J25A 5C9KA 1YYMH 5AWNL 3X13B 3MRDB 1I8IB 3RWCA 1IC4L 1UXSB 5TGBA 1NZRA 1EUUA 4Z7NF 1ED3A 2W65A 3I9GL 3P77B 1EQWA 3DLQR 2WZAA 5D1ZC 2GBTA 4LASL 5KJ4A 4NENB 1JK9A 2JB6B 2XFGB 3PNRB 3BP6A 4QAWA 4Y5YB 2ROYA 1TZ8A 4GBXA 3DVFA 3I84A 3O45A 4JN1L 3LQMA 1D6VH 1KGCD 2P5PA 5IKCA 5I17A 1QR4A 5CBAA 1MFDL 4DP6X 5IIEA 2BVPB 4MGXA 4UDUA 5AKRA 2QVKA 2DWEA 2EIJB 3WN5A 2V2TB 2OZNA 3BDXA 3UAEA 1IGYB 5J3HD 3CHXA 4X6CF 5ALBH 2DQEL 1KIUB 3CGTA 1RPUA 2VXTH 3QC5X 4LARL 2Z92B 3RUGF 5D96B 3LEVL 4DKEH 4ZFGL 2NW3B 3DGCR 1YEGL 4R7DB 4RESB 5DK3A 3A6CL 5ADPH 1BMZA 1EH9A 2Y7LA 1VZIA 5ITFA 3DHUA 4OFQA 4RFEA 4LVNB 4YHPB 1IAKA 3SB3A 4P5MB 1QWHA 1XF5A 2AQTA 2LU4A 2QVIA 4F15C 1F2XK 3KXFD 1VGEH 2D3JA 3KW8A 4GUCA 4B5ZA 3AS0A 3BFWA 3TEYA 3L3KA 4ELKB 1HHIB 9PCYA 3V4VL 2C3VB 3F7PC 4UOJA 4D8PA 2F58H 4AXWA 5C0DB 4IGBC 4CU6A 4XCYB 1MCHA 1YHPA 1P5UB 2P52A 2CUMA 2EACA 3TXAA 2WW8A 4JPSA 3KXFB 5GS0D 4HUMB 1URLA 2DJSA 3K3QA 4NYLA 2F53A 4P9ML 2ZCKH 2Q6WB 4YHZL 3T4AB 2DM2A 1B2WH 1WFIA 1Z9PA 1DQDH 1FFOA 1U36A 3FO2B 4WLCA 4N5UA 5E1HB 2DMBA 4E9RA 2VXUH 4HHAB 3HAEA 1JBJA 1Q9LB 3AVEA 3GI9L 2UX7A 1A1NB 4MHHI 3C5SB 1NFDB 3RVTD 4M29A 2ZUQC 1KJVB 4ZW7A 2BHZA 2L0DA 3I50H 5ECJE 4F7MA 2NR6A 2CXKA 2B3RA 2ICEA 4MASA 2CNZA 3BP4B 3HVNA 2XTLA 4L1LA 4O02A 5CP7B 2QVMA 3F7KA 1OCOB 2H45A 3FB5A 4GAGL 2PP9A 2APWA 4PI2A 2PXYC 1DQML 3G08A 3FULA 1G84A 5ADOH 4NKOB 5FECB 3KPLA 1X5YA 4ZFZA 4X5PA 1IFHH 1JGVL 1I1YB 2AP2A 5IF0B 4HWBH 1JHLL 4LPXA 5ID0B 1DBML 3RWGA 4JX0A 2VDNH 4X4KA 2AJXL 1NGWB 1KIQB 1NEZG 3LRLA 5JHBA 5GGUA 5D1XE 5IQLA 4JREB 2DTMH 3G5YB 1UM6L 4Q8BA 3MKGA 1S9KC 3LH2H 5INCA 2ATKA 5KTEH 4E0RA 1A8ZA 1TSRA 3MX0A 1TTFA 4U7MA 3K5RA 1OEZW 1RI8A 2IPKA 3UTSA 3SJVD 4YS4A 4X5XA 2YAMA 3TESA 1KJ2B 1LK3L 2ARJB 2VL5A 3X12B 1MJUL 3DI2B 1B0RB 1N64H 4OFYA 5L0QC 1F11B 1M4KA 3FH7A 2B14A 1JRHH 4X98A 1JNHB 3FOMA 3FYEB 1L9OA 3ZTDC 4DVBB 2IWGA 1C7SA 1E4XL 5KBKA 3O8XC 3T6WA 5ACLA 3LS5L 3SJVB 5IJCC 3ARZA 5MENE 4OGAC 2YRBA 1OM3L 4FZ8L 4J7RA 4TN9A 1R3HB 1ZE3C 1TZIB 2PTVA 3QXTA 2A9BA 3QQDB 4K55A 3V0HA 2OR8A 2P26A 3MJGX 43C9B 5FUCE 1K4DA 4AMKL 4YSSA 1T0MA 2WTRB 3HA0A 3N85H 4MA7H 1QSFE 4GG6A 2L8AA 5F7WC 3F7QA 4KY2A 2J8UB 1N8ZB 4ODTL 1LWJA 2E7DA 3Q2VA 1GAFL 1UQSA 5E94B 4BK4A 2CKBB 1U8LB 4JLRA 4OLWH 3APCA 4UM9D 2WBWB 4L9DA 2Z64C 4B9PA 1IC5H 3KWWA 3ULVC 4LT7A 4JBSA 5CF3A 3OL2A 3T8XB 1U8KA 2WLIA 3QT2A 1JFQL 3RIAF 3W9DA 4DN4H 3ZUCA 5ISZD 2WNKA 1WEJL 2Z93A 2HT3D 1RUPL 3C8DA 1VPOH 3SQRA 2EYRB 2XYCA 2XPGB 1F18A 3R0NA 4HEMA 2N56A 2DRUA 5EMYA 1QFHA 1AI1L 2CK2A 5TPWL 1ILUA 5CN2A 4BZ2H 4IBWA 1U93A 4FNRA 5D7JC 5ISZB 1DVSA 1Z9SA 4S1QH 3RVVD 3HC3L 4FABL 3NJJA 4Z7WF 1IM3A 1KPRB 2X4TB 4LEOB 1ZA3A 3FN9A 4Z95L 1R19A 5HDBE 3G6DH 5HDBB 2BNUA 4JO1L 4XOAA 3TYFB 2AGJL 2Y07L 3EYSL 2X4UA 2ENSA 1AGCA 1G5GA 3L4CA 2UUDH 1ESOA 2VCOA 5CEXB 4MQ7B 3LQAC 1TEYA 1Z9MA 4RCAA 3ES6A 3ELQA 2TAAA 2QFPA 3MRNA 4NN7B 4GO8A 4HZAA 1CFVL 2AK4D 1MLCA 1TO4A 5F89B 2PCPA 3UYPA 1CTMA 4TUJB 4U6HA 1M1XB 2EKSA 3CLFH 4BQBA 4WWKD 5L4FA 4XNUL 5TDOA 4LF3B 4X4YA 2XZQL 1I1FA 3BMWA 1UJ3A 1M42A 3DX8B 4G7SB 5JTWA 1B88A 4IJTA 3L4YA 4X6BA 5IQ7L 2AK4B 5AW7B 4NHCH 2LFEA 4YMPA 4JM2D 1KCLA 4ZTPH 3GSQB 3PJLA 1WGVA 3P9LB 3RVUC 1P7HL 3HJ0A 3FMGH 3T0AA 4BRJA 2XG5A 2Z31D 5IR1A 1V27A 1F13A 1AS6A 3IBOA 5C8JA 4FERA 3O6FD 4N8VB 4ZX6A 3H2PA 3QIUB 2A6DB 4FS0A 1KFAH 4GIPD 5CJ8A 2XKSA 1G9MC 4ZO7A 4RWYH 4P4KD 4JM2B 1I8MA 2ADJB 2YPKB 4KXCA 2V0AA 1MCCA 4FXKC 4OIBA 2Q7YB 3HHMA 1GMEA 2Z31B 1A64A 4XO5A 4DAGH 4IS6A 1XGQB 3O41B 2R8SL 3TYGH 1DVQA 3RNKA 3Q6GL 2JV6A 3FB6A 1N12A 2V7NB 3O6FB 3M46A 1BLIA 3SPVB 3VTMA 4JDTL 3PS6A 1IGJB 4YPJA 2B15A 5F88A 1KV7A 3BH9B 2D3VA 1AGBB 1QHOA 4P4KB 1KTDA 4TUOA 4IIQA 4IDJL 1M2VA 4UT9L 5L7XH 1JV2B 3QNXB 5GZND 3V8OA 5A6LA 5BV7H 2WYIA 2E46A 4JDZB 4FJYA 2LU5A 5BRZE 3D07A 3DRQA 1G7LB 2JH2A 2DEXX 3FAXA 2ZUYA 4CVZA 3A47A 5LN4A 3ARPA 3LXUX 5DHVA 4EDXB 2Q8AH 2H5UA 2X4RB 1XCTA 4E5XG 3DARA 2X10A 4AUUA 5L2KD 4NGHL 4LSPL 5BW7A 1NGZA 3EUUA 1FAIL 5AVTB 4NOBA 5AKSA 2GJ6E 1W16A 5HJGA 2X70B 4X8GA 1NIAA 1W15A 1IZJA 3AU0A 1QBLH 1K6QL 3FCTB 5C07D 1CTNA 1QFWL 2VLLA 2VZSA 4YUEL 5EEYA 5MEPB 3PUCA 5L2KB 3L2MA 2H0FA 4GKNA 4C58B 4CU7A 1UOLA 2WMPB 2H7WA 2VLRD 3O3UN 5B3JE 3BVXA 2V3DA 3R06B 3WUWB 4OV5B 2YC1B 1TR7A 3BVNB 5A2BA 5D1XC 3P0YH 1EJFA 1Q94A 2PP8A 2H1LM 1HE8A 5GGVH 5C07B 2L3BA 5C07E 2P5WE 1PNDA 3NRQA 4NQCB 4EN3C 2Y3AA 4NQCE 2V2WA 1FP5A 4U2ZA 4J3SA 1ZV9A 5F7EL 2IQ9H 1UB5B 2VLRB 1DR9A 4U7SA 2RFXA 2IF7A 4PV8B 3OR7B 3QWQB 4LLUA 1W91A 3MBED 2DI8A 5EFIB