2DWTA

Cu-containing nitrite reductase at ph 6.0 with bound nitrite
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
329
structure length
329
Chain Sequence
b'LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title pH Dependence of Copper Geometry, Reduction Potential, and Nitrite Affinity in Nitrite Reductase
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 85
structure length 329
sequence length 329
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwtA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwtA02
1J9TA 1NICA 4AKQA 2J57A 1JZEA 2XVBA 3IBOA 2QT6A 2VW6A 2W88A 3FPYA 2PP9A 1PF3A 4NB7A 3TU6A 2XX1A 1A4CA 2JKWA 1R1CA 3RYMA 1JZHA 4AKPA 1WA2X 1L9TA 1GR7A 2FT8A 3FPXA 4A2DA 1E30A 4GP5B 2XV2A 3NP4A 1VLXA 3H56A 4G70B 2BP0A 3UADA 3EF4A 3EHBB 1NWPA 1OV8A 2BWIA 3QJRB 3NJHA 2J56A 2Q9OA 4DP9X 1OCOB 1BEXA 2E86A 2PCYA 2H47C 1QHQA 3H4FA 2GC4C 3CVCA 1KV7A 3FQ2A 4PCYA 2OV0A 1GY1A 4P5SA 4KO5A 3FSVA 3CDZB 3OMNB 2DV6A 4KNSA 2IDQA 2XV0A 2P80A 1J9QA 1L9OA 1KCWA 2ZWNA 1ADWA 1TU2A 1PZAA 4HCGA 4WTQA 1NPNA 3IE9A 4E9TA 1W6WA 4YSPA 3KW7A 1AIZA 2QDWA 5PCYA 2TSBA 2PPEA 4KNUA 3T71A 1BQ5A 5F7BA 4M4RB 1J9SA 3UABA 1MG3C 2GI0A 1AG0A 1J5CA 2IH9A 2UX6A 3GXUB 5B1AB 3X1NA 1EZLA 2QPEB 3QPKA 2BO0A 3QJUB 3UAAA 1RZQA 3CVDA 5PAZA 2GBAA 2PP7A 5AZUA 4FA7B 3IEAA 3DKHA 4YSEA 1PLBA 4HIPA 3WG7B 4GP8B 2GC7C 5B7FA 1OOWA 4HCFA 5TK4A 2QPDB 2FNWA 2DWSA 1SDDB 1HAUA 4HHWA 2PLTA 2MTAA 1WA1X 1SNRA 2ZXWB 3HEIB 4HZ1A 4YSOA 4DP5X 1V55B 4BWWA 3ERXA 3NSYA 2IDSA 4AX3A 2YARA 2H3XC 1F56A 2VMJA 4JHVA 2HZHA 2HX9A 1GS7A 4G72B 1ZDQA 2PPFA 1OCZB 4ZK8A 4L0PB 1NZRA 5B7EA 2YAPA 1E5ZA 1ZIAA 2WO3B 2IWKA 1BYPA 1XB3A 4G7QB 1V54B 2J55A 4A67A 4A2FA 2YAFA 1ZV2A 5I6PA 4BXSV 6PCYA 1PCSA 4DPCX 1IBZA 3NJNA 1AACA 5I26A 2UXTA 1OCRB 4UANA 3GDCA 4G7SB 4KO9A 4WKXA 4Q8BA 3T9WA 4E9SA 1A65A 1BYOA 2Y69B 4DP1X 2B08A 1NINA 2CAKA 5B1JA 3WI9A 2YAEA 1KGYE 3WIAA 1JZIA 2CALA 2NRDA 1CURA 3PPSA 1PZBA 1AOZA 2N0MA 2BW5A 4HALA 3TBCA 3NP3A 2R7EA 3N2JA 3AZUA 4FAAB 3EH4B 3T6WA 4DP0X 4CSZA 5D4HA 7PAZA 1RZPA 3WKQA 1GS6X 4KO6A 2IDFA 1HFUA 5B7MA 3ZIYA 5A7EA 4JKNA 4KOCA 3OMIB 2IDTA 3ABMB 1OF0A 4YSDA 2XXGA 4DP4X 4YSQA 1URIA 3DTUB 1ET8A 2H5UA 1MDAA 2VM3A 2IH8A 2DWTA 3AG4B 2HX7A 3NJIA 3NJFA 1JXFA 1MZZA 4KOBA 4QLWA 3UACA 2X88A 1WS7A 1UATA 3EH3B 1NTDA 1YLBB 2P80D 3QJVB 1W8EA 2CJ3A 1NIEA 1GW0A 1BXVA 1GS8A 1ILUA 1JOIA 1AS6A 2MRYA 2I7OA 2UXFA 1IKOP 4F2EA 2YAOA 4YSUA 2YAQA 1EHKB 1PY0A 2VW4A 1JVLA 2BZCA 3D12B 2AFNA 3FU7B 5FC9A 1T5KA 3CDZA 2UXGA 1NDTA 5E9NA 1JZGA 1M9WA 5D4JA 2HX8A 3CZUB 4E9XA 1BAWA 4AKOA 1CYXA 4AI7A 1PNCA 2J5WA 2FT6A 1ILSA 7PCYA 4DP7X 2I7SA 1GSKA 2WSDA 1QLEB 4GY4A 4BDVB 4NAJA 2YXWA 1FWXA 1FFTB 4G71B 2OJ1A 4GP4B 3X1GA 2EINB 3S3BB 1ETJA 3ABKB 2FJSA 3NJKA 1ZPUA 4PAZA 2DYRB 4DP8X 8PAZA 3AG1B 1BXAA 1OE2A 4DPAX 1E67A 2XXFA 3BVDB 3C75A 3IN2A 4MFHA 2HLEB 3QJTB 2PPCA 4E9VA 3AG3B 1N68A 3NSDA 4EF3A 2BHFA 2X87A 1SDDA 3EH5B 2FQDA 1ZIBA 4A2HA 4ENZA 3X1BA 5I28A 3WNIA 3MX0B 3T6VA 1CUOA 3IN0A 1IUZA 1AZBA 1NIAA 3UGEA 2JXMA 2YXVA 3NJJA 2CBPA 4N4YB 2BP8B 4K9JA 5I6LA 5I5IA 2OCCB 1BXUA 3FSZA 4DP6X 5AKRA 3CG8A 3OD3A 4YSAA 2YAMA 2YQBA 1AANA 2FQEA 3L45A 2B3IA 1AZUA 1ET7A 4P5RA 1AG6A 3MBWB 1NPJA 4F7KA 3FYIB 2WO2B 2PPDA 1JZJA 2PP8A 4N8UA 1FA4A 1NIFA 1W6LA 4KO7A 3BQVA 1ASQA 4NERA 3G5WA 2IDUA 1XB8A 1KCBA 2Y1AA 4QKTA 3NT0A 1NWOA 1ID2A 3FQ1A 1E5YA 1AS7A 1L9PA 2EIMB 2BWDA 5F7AA 1I53A 3PLYA 2BW4A 1CYWA 1AQ8A 1J5DA 3T6XA 1BQRA 2BZ7A 1KDIA 3UAEA 4CSPA 3AW5A 4DPBX 1IC0A 4YL4A 1CC3A 2XU9A 1A4AA 5I6OA 2PCFA 1SHXA 3NJMA 3QJSB 5D4IA 3ZBMA 2FT7A 1JXDA 4GYBA 1XB6A 2DY2A 3V9CA 3T6ZA 3NYKA 1V10A 2FTAA 3PAUA 3OM3B 5EHFA 1ZDSA 4HHGA 2Q5BA 4JHUA 4KNTA 1J9RA 3KW8A 3OQRA 3NSCA 4A66A 1SHWA 1SF5A 3HB3B 1PLCA 3NJLA 4E9WA 2CCWA 1WA0X 1PAZA 1ASOA 2VM4A 2VN3A 2IWEA 1OCCB 2VW7A 2FQGA 2GSMB 2FWLB 3SBRA 2XLLA 2BP0B 3NJGA 2GB2A 4E9YA 3SBQA 4G7RB 4A2GA 1AAJA 1ET5A 3N55A 2FQFA 2IAAC 3PXLA 3PAZA 4M3HA 5I6MA 1AZCA 1L9SA 4BXVA 2AZAA 1B3IA 4X4KA 1PLAA 4TXVB 1WS8A 3TBBA 2AVFA 3PCYA 4BWTA 5B1KA 3FU7A 5IY5B 4RH4A 5I5MA 9PCYA 3QJQB 3JTBA 3X1FA 2LLNA 3U25A 1SF3A 1A3ZA 4UAHA 3WKPA 6PAZA 1JVOA 5AFAA 1DZ0A 3JT2A 1JERA 3X1EA 3X2QB 1L9QA 1KYAA 1KBVA 4DP2X 3FT0A 1OE1A 3S3DB 1PZCA 4YSCA 1M56B 1TEFA 2W8CA 5B1JC 1PNDA 2AZUA 2UXVA 1TEGA 2HRHA 3ZDWA 1N70A 3DIVA 3AG2B 4BDVA 1GYCA 3SQRA 4HCIA 2ZONA 1IBYA 1X9UA 4YVNA 5B1BB 1AZNA 1M57B 2PPAA 3S3CB 3FS9A 3FYEB 1AS8A 1X9RA 2RACA 5I6KA 2TSAA 4W9ZA 1GY2A 1XMEB 2EIKB 2GIMA 3NSFA 4BWUA 3FU8A 3FSAA 3PAVA 4YVUA 4E9RA 1NIDA 1BQKA 1KBWA 1A4BA 1DYZA 2IWFA 3ABLB 3TA4D 2JFCA 3FU9A 4YSTA 5I5JA 5B3SB 3S8GB 1E65A 1MZYA 4HAKA 1NIBA 3OMAB 4A68A 2XUWA 2VSMB 3GYRA 1AZRA 3ASOB 1QNIA 4Q89A 3V9EA 1AR1B 3S8FB 1ASPA 1MG2C 1SFHA 3SBPA 1SJMA 3WNJA 2XV3A 2BP8A 2UX7A 1JXGA 1TKWA 2DYSB 2QDVA 2HXAA 4UF7C 1KDJA 2XX0A 1A8ZA 4E9QA 1RKRA 4W1TA 1RCYA 1WAEA 4GXFA 2A3TA 3ABGA 2XYBA 3ASNB 5ANHA 2CUAA 1SFDA 2GHZA 1OE3A 2HRGA 4YSSA 4YSRA 3QQXA 4A2EA 5I6NA 4BK5C 3TASA 1JZFA 1HAWA 2I85A 5LDUA 2AANA 3H4HA 1L9RA 2XWZA 2EILB 2EIJB 2YAHA 3ZX1A 2R7EB 2VSKB 5TK2A 3FQYA 3AY2A 3FSWA 2ZOOA 1PMYA 3CVBA 4AZUA 4F2FA
chains in the Genus database with same CATH superfamily
4P2OD 4UIMA 1FNAA 2QQQA 3BGAA 4M02A 4DT2A 3T6QC 2J71A 3EYUL 2XSKA 2XX1A 1VFAB 2A4EA 5I1EL 1TSHA 1HCVA 3ILDA 3QWRD 4DQOH 1GC1C 3CZJA 1WZMA 1EVUA 1OP9A 4AQ1B 1K4CB 1WA2X 1ERNA 1YUHB 4P2RE 2X6MA 3OF6A 2ERJC 2BFVL 2FT8A 5AYQA 2HMID 1F4XH 2DJSA 1CXEA 2D0GA 1PTZA 5AD0B 2EEBA 4ZW3A 3BMVA 1WICA 1VACB 3VXMB 5DO2C 2XIDA 4OCYH 4OUUB 4OZFA 3MFGB 1MEXL 5D72L 3MR9A 1UURA 3MCKA 5GZNA 1IJ9A 4EIGB 5DC0A 1A0QH 2D3VA 2ESVA 4OZGF 5FFLA 1DVTA 1BG9A 2X4SB 1DVYA 3IDIB 4YR6B 5I6XB 1IAIM 1KCUH 2C3XA 4LVEA 3EFDH 1NFDA 1ZE3H 1FVDB 3OKYA 4OGQC 4X42A 1NPNA 1IM9B 4ZTPL 5LXGL 3P0VL 4JRXE 4KKAD 4E36A 5F9DC 2JCCE 4DFIA 1AIZA 2FATL 4KQ3H 1OAYH 4H25A 2F53B 4U1LB 3EYVA 3ARGC 3QIBC 4YE4H 5DMKA 5F0JB 5GGSY 4HS3B 4HUMB 3UABA 4L4JA 1MG3C 4MJ5B 5JOPE 5EOTB 3WFDH 1FAKT 1K5WA 1G1YA 1I3UA 4XWGL 3UJTL 4QXTA 5DQDH 3QAZC 2PXYA 2HJLB 1JZ5A 3TZVD 1J8HE 2AV7B 2H3NA 4FA7B 1FBIL 3IEAA 1HNGA 4IRSD 1PSKH 4ZOEA 4DGIH 3C5SB 4YPGB 2DICA 1LP9E 5CEXA 3LQZA 2VKXA 4X7DC 5E7FA 5IFAL 2ZKHL 5CIPA 5LGHL 2LFEA 5C0CE 4QHMA 4NM8L 5AB0A 3QXUA 5AW2B 3P11L 4U2ZA 2BOBA 3AMKA 4IRSA 1E4KC 3BP5A 5T1LD 1RHFA 1Y07A 3SDAC 4KKPA 1H6TA 1E6JH 3SKNA 1U6AH 3MNWA 4C83A 4PP2A 4BH7A 5GGRY 5E1AB 5F1SA 5I76A 1D9KB 2EDTA 1F56A 2UY7A 4OGXL 4WJ5A 5T1LA 2XZQL 4PLJD 1P1ZB 4DGYH 2PO6D 1QR1A 4GSRA 1HWGB 1OARL 4LDLB 1OT4A 1TQBC 1PQZB 5JIPA 4RWHA 2JB5H 3RIKA 1MWAA 2WO3B 4RDBA 3VWJD 5L7XL 1LGVA 5ITFB 2DEXX 3UYRH 2Q8AH 2PO6A 3A67L 5ADPH 4BFJA 1R3LB 2Z93B 2FGZA 4X5WA 3UBXB 4FABH 1JUFA 2VMDA 3SE6A 1P6FA 2W9EL 4LNRA 3VWJA 2Q1EA 4KHTL 3CXDH 3TVMD 1F4HA 4A7QA 5CLWA 3CZFB 1WFIA 3A6CH 1Q72L 3OPUA 4NUJA 4U1GB 4MBOA 5IW6B 5IGXH 5TE4L 1BLNA 4J6RL 4R4ND 4NP4L 2B08A 3P0GB 2VLRB 3N85H 3O3BA 4HWZA 2CPUA 1HVXA 3TVMA 4MD4A 2CIKB 4TVPE 3HW7A 5DQJA 5TPWL 1CD1A 5TF1H 4X6CE 5FOJA 3J7HA 3RP1A 3O2VL 1A1OB 2CHDA 2VWEC 3HZVB 2FX7H 2YD6A 5DYOB 1BF2A 2B2XH 5GRJH 4P4RA 3CFJA 5CSZB 5DURB 2Z0UA 4YHZH 2W81C 2X6UA 4WU5B 5HDQH 3FTSA 4OCXL 5EEVA 4LSPH 3MLPA 2KL6A 3BWSA 1XF3B 2XVGA 4H8WL 1YY8B 4UQ9A 4FQPA 3U0TA 5DJCA 4K15A 4ODUA 4URTB 2VZ3A 1TUPA 5DJ6A 1URLA 4WWID 4B41A 3RWDB 3SDXF 5AVSB 3F12A 5TQ0H 5FYLH 1FDLH 4HKBB 3FQWB 5I17A 4KRPC 3NJFA 3B3IA 3QPXL 3PFQA 4MD5A 1P84J 4GNKB 4KX8A 1DJGA 1MHCA 3HG2A 3CTTA 1RZ8B 2EYTA 1PG7X 1AIFB 4QRBA 4XNZC 3S5LG 1QSED 2AQSA 4P5TA 1T5XA 5DCCA 1CICD 3EBGA 4DSYA 1WCQA 5CZVH 4J2XA 1E5UI 1A7RL 3OWRA 3QB7C 4MAZA 5MENB 1XCTB 4B5ZA 1A7OL 3CSYA 1QSEA 4V1DB 4QJ3B 4MMZA 4NOBA 3S34H 1IB5A 2XFXB 4LASL 1BP3B 3IDGA 2P4AB 1T5KA 1ODUA 2F15A 3BFQG 4G6KH 4KPHL 4NKIL 4L23A 4WDIB 2FSDA 1QRNE 2ETWA 1IE5A 1BAWA 2BSRA 3D39D 4WKZB 5EUKB 1KUMA 1YPZF 4H20H 4KI5E 1R6VA 4U1JA 4GAGL 5EG6C 4YMPA 3GT6A 3D69A 3ARBB 5F6IC 5GGUA 4L37A 5KJRH 2EKSA 2K7PA 3OWEA 4NDMA 5GRYA 3RTQD 3RBGA 1KJ2L 3WUZA 3QIUB 3K6SA 2WSDA 1N6QL 3WJMB 4J39A 1NGPL 3UBGA 4PHXA 4K2UH 2HUEA 3JZ7A 4GQRA 5DEZA 3WTSA 1ZTXE 5CEZH 4MXWL 3K6FA 3LEXB 4K5PA 1EHAA 3RTQA 3ULUH 3TBYA 4BM7A 2FDBP 1U8OA 4PGCB 1JK9B 2HLEB 2HPTA 2FZ3A 3HZKB 4E9VA 2XJLA 5I2IA 1N68A 4J3OD 2DWEA 3EH5B 2DYPB 3S8WA 5I28A 1CFVL 1Y0LB 4PQXA 4OKDA 3CSBA 3GRBA 4UOW0 3T6VA 4P2OC 1E6OH 1CUOA 3GXTA 1HQRA 3VVVA 4L9DA 3ULVH 5TE7H 2DJMA 4FFZL 2JKSA 5G4NA 1U8CA 3N9GL 1E3XA 25C8H 2MKLC 4N8VA 3BOVA 4Y5YA 4WW2B 2WZPA 1UQSA 3LJ3A 5EBWB 3N3EA 1MQKH 4JG0H 4F33B 3BKMH 2O5YH 1FZKB 5HHNA 1OGAB 2I27N 2EECA 3ZO9A 1O5DT 4HU8A 4Q56A 2HMIC 5E2TH 5AWNH 3GXPA 1X6LA 4JM2D 2AI0L 4RISH 5DQ9B 3UTQA 1ZTXL 2OS7A 1XT5A 2JVUA 2GIXA 4JB9H 5C6TH 1JXKA 5JOFA 4J7RA 5DD1L 1LWHA 4QNPF 1FA4A 3ALXA 2UVFA 3VI4A 3UERA 2YMOA 2HVKA 1UADC 2IDUA 3IU4H 2XQ0A 2FLRT 4QKTA 2QFPA 1EFXA 2WLJA 3FU3A 3NABH 4RDQG 4YDJB 1B9KA 1T2XA 1U8MA 1N9PA 4JS7A 3IBEA 3PLYA 4QD2E 5IJDC 5IQNA 1CD8A 4G43B 1AQ8A 2HKHH 4CSPA 3GSNL 5T1MA 5BZDA 1B2WL 3INUH 4G11A 5DVNA 3RWEA 4KGLA 1A6WL 4LBEA 3NPZB 3C8DA 3GI8L 1BZQK 4L4TE 1KGCD 4F7PA 1JXDA 5GGVH 1QFWL 3VQMA 4KKAC 5HYSG 1QHPA 4FC3E 3SDDA 4DF9A 1A2YA 2AJZA 4MAYA 5IQ9A 3T6ZA 3WTYA 2FCBA 3GMOA 4NO5A 2PXYC 3FQ4A 2DQJL 4PU2A 4X8GA 3FO1B 4BQBA 2G9KA 4A66A 4JFHE 4R7DB 3U46B 1GGBH 1M7UA 2CCWA 2IEPA 43C9B 1I7TA 2KLSA 4PJHA 3J27A 3U7YL 4LHJB 4HFUL 2JI2A 3D5OF 4IRSC 5FYKH 4F7TB 5IG7A 1TJHL 1M71A 3O2DA 4TULL 5DTFA 2K8QA 1ZPLA 3AQXA 4LCVA 4E9YA 3LQAH 2WWMD 3K46A 2F19H 2ZYHA 2V9RA 2X6AA 3MDJA 5I6MA 3PAZA 1RUAL 4BJLA 3V7AG 1DJXA 3QUZB 1ZD6A 4MNQB 1UYWH 5EU6E 2X09A 5T3XE 3M1BA 3VWKD 4PLJC 1E5BA 2A5UA 2E6JA 2PO6C 3IDYC 3QUYD 4K7PX 1LK2B 3T5WA 4Z7VA 3ZGIA 5I5MA 1G6RH 3L1OL 1ZXKA 2QELA 3K0YA 3P4MA 1NGZA 2I69A 2NQDA 1UM5L 4Q9BA 1YYLL 4RDQF 3VRIA 3VWJC 3QEQD 3VWKA 1PD6A 5EC1B 1Q0XL 3QIWB 4NHUB 2X05A 3KJ4C 1IZJA 3WIHA 1IGTA 1S7SB 1RZKC 5FA3A 1AXSB 2O4EA 3FQXA 3IETA 1NLBL 1OB1A 2UXVA 4JM4L 3QORD 3QEQA 3QARA 3TVMC 3P0VH 1G87A 3QXAB 2VNCA 1TOXA 1A3RL 1U36A 4HCIA 1PYWA 4YVNA 5B1BB 4YHYB 2A0LD 4R4NC 2BRRL 4TNVF 3FS9A 4POUB 3S3CB 5DZ9A 3P3SA 1TZHA 1EQWA 1I8MB 2C8NA 3OAZH 4PWFA 4W9ZA 4M9PA 3UJTH 2IFGA 5LLIC 5C1MB 2H9GA 1N8ZB 4QLRA 3SJVB 3FSAA 5F0MB 4BV1A 1N10A 4FN0A 1FBIH 1Q94B 1A4BA 3CE1A 1EAOA 2K0RA 1ZT7B 4FKKA 5JW4M 5D1ZI 2KZKA 3WD5H 1JGLH 1MCEA 3CHPA 5IFAH 5LGHH 3TIEB 2XICA 5E51A 5EOCH 3Q3GA 3I50H 4RIRA 5B3SB 3P11H 2ZX8A 4QRRB 1OLZA 2XDHA 5GSRA 3FN9A 5CMAA 1SUJA 5LBVA 4Q89A 3DPBA 4I48A 4WU7B 4P2QD 3LH9A 4U3SB 1YRKA 3L9RB 1TNNA 4UZGA 4OCLC 4P5TC 4NLAA 1TENA 5HHXH 5HDLA 4KX7A 4WHTA 5IQOA 4LLDB 1BJ1H 3DBXA 1A8ZA 4E9QA 5BRZB 5AENA 3P3UA 4AIXA 1P7QB 1BVZA 4P2QA 1QABA 2A3TA 2XYBA 3I3DA 3CVHL 4FMFA 1OE3A 5EO0A 4MMZC 5L7XH 3R0NA 4WFFE 2LW3A 4YGVA 5BUGA 1CDHA 1YDPB 2D7TH 1YQVL 1F4YL 1MNUH 2FJFA 5H37A 3HS9A 4S1QL 2UWEF 4PW4A 3DXAD 1J1OL 3T3MB 4U1MA 4PJ5D 2EDFA 1KB5A 2W9EH 1N4XH 4UM8A 5MP6L 4KHTH 4NJAL 2VDQL 2VZTA 3U7WH 2VJXA 4M6NH 1F13A 5TE4H 3THML 1K2DA 4NP4H 3I02A 2NNAA 4BK8A 5A7BA 4Y0GA 4LFHG 2I24N 5GZOA 4E5XG 5D70L 4FQ2L 5EBMA 5KG9A 2VLJD 3QHFL 5TE6L 2IPKB 4YFLI 2D7PA 1V7MH 5DS1A 3ZHKA 1R1CA 3RTQC 1QSFD 4RMVA 3UXFA 3FUKA 3PAYA 1ND0B 3G5XA 4KTEL 2VLJA 2G0KA 4MNHA 1EHLL 3EF7A 3VFUB 4RAUA 1WFNA 3TBSB 5ADOL 1GR7A 4NWTH 1YNTF 1VFAA 3BP6B 3C5JA 4NO3A 1QWNA 4NUPA 1CU4H 2FD6H 5HI5D 2WMPB 5SWZE 1QSFA 2GJ6E 4EIZC 1Z7JA 4MS6A 5TH2A 4PI0A 4NX0A 3LZLA 2WKOF 4UOQA 4JFYB 2B5IC 2VR3A 3QPXH 1GYWA 3GSQB 4YE0A 4ZDHB 5IEHB 3H4FA 4Y5YC 2P5WD 4KAQH 4ZSOA 1QI3A 1JPTH 2ZXAA 4DIXA 1YPZE 1H3VA 1K8DB 2G5UA 4NZRL 3KAAA 3OMNB 4TVPH 2H2PC 4MASA 3MNVB 2YGQA 1VZGA 2P5WA 1A7RH 5FM5O 3P77B 4AUYA 1A7OH 1B4RA 2AQ3A 1R3IL 1HH9A 5BZZA 3L3GB 1IFGA 4Y19B 5LBGA 3EGDB 3V0WL 4WI0A 4KKBC 2Z6FA 2LTQB 3PNWB 4DZ8A 4NENA 2NYZA 4UOW1 1IM9A 2N4IA 1JFHA 5CN1A 3FRPB 5L2KD 5AOIA 1X5KA 4ONGL 5DRWB 4U1LA 3T8VA 4GAGH 2DQUH 2G0LA 2CG9X 4HS3A 2F54B 5AZUA 3NAAH 5EOTA 2W5PA 3KJ6H 5AVXB 5I73B 5L2KA 5LG6A 1U8QB 1KJ2H 2GBVA 3DJTA 4XBPA 2J88L 4MCYA 4A7SA 8CGTA 2MHAB 3PWNB 3UTSD 2EEAA 3VTMA 2BIPA 3SDDC 4MAYC 3BKCH 4NQEB 3C5SA 4YPGA 3Q2CA 2NMSA 4DO6A 4JFEB 1GOHA 4NQDB 3S3JA 1GCYA 4KJYB 2X1WL 3ZPDA 5IB3B 1H3PL 3UTSA 4R97B 1DUYB 2H0EA 1SGKA 4JLRB 1WEJL 1VSCA 5D7LE 3MRMB 4MDJB 2NUPB 5D7JD 2PPFA 2W9LA 2R0ZL 2RCSH 4X5LA 5AB2A 2XZZA 3OKLA 4XTRD 1D9KA 1BYPA 3OAZK 1P1ZA 3ARFD 3H9ZA 4FFZH 1G7LB 4G9FE 4LK4A 4O5LH 4PS7A 5D7JA 3E2HB 3S3PA 5CHNB 5HYJE 1I9RL 2XWJB 1GAFL 1SN0A 3A6BL 1KYUA 1LILA 2XOTA 3QDJE 5CP3H 5EH1A 3UX9B 1WZLA 1A9EB 2WWMC 3B8YA 2OMXA 1DDHA 3ARFA 3FMGL 4XPBH 5D6CB 5ITFA 5KEZA 2PW2A 2Z93A 2CDGA 4IEFA 3WMSA 4URKA 3D09A 4E9SA 3JVFC 1A65A 1QFWM 2AI0H 4WWKD 2DD8L 1XXFC 4V2BA 3GIVA 4AJYV 4OH2A 1KFAL 1QACA 2VUYA 3CZFA 4XPFH 5EIIA 3PXHA 2OXGB 3UZQB 4LPYA 1I8LA 3I9IA 5IW6A 2YZ8A 3VWKC 4OZ4B 3L4VA 2OXHA 2X4NA 4KFZC 4WWKA 1F97A 5KOMC 2JELL 3RJQB 1K8IB 4PW9A 4FAAB 1R5IB 2CIKA 1AJ7L 2AQNA 4KY1L 3UC0H 2F58L 3T04D 4XMKL 4AZ8A 1IVTA 1TETL 5ELIA 1A1OA 4BYHA 4M1GH 1JGEA 3GSNH 1I3GL 4HEME 4ODVL 2EICA 4HWNA 3TT1L 4BHUI 1ZCRA 5FYJD 1S9KC 2B1HH 4K9EH 3TYGL 2IDTA 2VLLB 3QUXD 2FX9H 3HG1B 3VFPA 2IALA 4RFEB 2A83B 1XF3A 4ATTA 5BS0D 1QFWH 1ET8A 1YY8A 1MDAA 2PYED 3VRJB 3C8KA 2ZUWA 4NS0A 2A0LC 3ZSSA 5CD3A 5IB1A 5F9JA 3RWDA 3B43A 1IBDA 3WN5A 1B0RB 1YC7A 4TVSa 4HKBA 4PW3A 2PYEA 2VXVL 5BJTA 5ISZD 4FTVD 2BVYA 2V4LA 4KKLD 1DBBL 2F6AA 4M7LT 1INEL 5CJQL 4X8CA 3K6NA 4NN5B 3TH3T 2CDFB 1RZ8A 1ORSB 1ILUA 2QL1A 3PWPD 3QJFB 4GO6B 3PDOB 4HF5L 5CUSL 2EXWD 1AIFA 2UXFA 3NMEA 3GBML 5GS0L 1CTMA 2VW4A 4NZTH 2BZCA 4JL2A 2YHGA 4XP1L 2JV6A 4OJEH 5JW5B 1T4WA 2J4WL 1XCTA 4B9ZA 5F7YC 1RUAH 3KPSE 1VGEH 4V1DA 3V55A 5E4IA 5E2VL 5GSVA 1QR4A 1U8IA 4IRZH 4WDIA 2VM9A 3FTZA 4U31A 4ODWB 3ZE0B 3DX6B 1H9VA 1S78C 5D55A 1HSBA 3P1VA 1PKOA 4HSAC 4WKZA 3IFPA 3MV8D 3UYPA 4G9DB 3ARBA 5F6HJ 5J1TC 2YPVH 4BQ6A 1E4WL 4NO0D 3NCJL 4X6FA 3IMTA 1WTLA 3QIUA 3MV8A 1C7SA 3BZ4B 4TOYH 4UQIM 2PWDA 1K3IA 1OKEA 4XXWC 5FKAA 3UZVB 4F7CA 5C70A 1L6XA 4DPAX 4NO0A 4IK7A 1QTYT 1G6RB 5DEGB 1OCWL 1GHFH 5F7EH 5GJSL 3SN6N 5GZOC 5CLXA 5GS2H 1C5CH 2BRRH 2FQDA 3QQNA 3TV8A 4JO3L 1N3NB 5KN5A 2BVPA 2XY1A 4PGCA 1JK9A 4FYRA 5LGJA 3IN0A 4KZEL 4PP1D 3HZKA 3ZRCC 4DKEH 5IMLB 3V7AE 4ZMOA 1GVIA 1ZA6B 3GSRB 3EXLA 4PS3A 2DYPA 5EZIL 3TP4A 1GJUA 3ASWA 2WB1A 1Y0LA 3L4YA 3T4YB 5T3XH 3H9YA 1HIMH 3HG4A 1N5AB 1QPPA 3BAYA 3SYPA 3N50A 2J1YA 4XVOA 4FOMA 5J6GB 2GBTA 4LQFL 1FG2A 1NKOA 5AUMA 1ZS2A 1YEWA 4H5SB 4P2RB 4BSJA 5F2FA 4AH2A 1CB4A 1HH6B 3WCYA 3RUGB 2UZYA 2YQBA 5HI5C 3ZO0A 2YA2A 3GLZA 4F33A 1AZUA 3QAQA 5CO1A 5ALBH 4AENB 4F57H 4RCAA 1PS3A 4ZO7A 3QUKB 4GSXA 1OGAA 1T83C 4B9YA 4R5TA 3IJYA 1E4XH 2ATKB 3U48A 2ZNXA 1FSKB 3BQVA 3OXSB 3O9WD 4XCFH 1FRGL 5DD6B 2F8OA 5C0DB 1A6VH 4FFTA 2AXFA 4B7LA 1MDTA 2EDBA 3MLUL 3QG7H 4Y5VA 3RZCD 4R8WL 3KPQB 1LO2H 3CPLA 2R1XB 4I88A 1UD5A 1F4YH 4YDJA 5SWSD 3D25B 3L3IB 2A6DA 3GMRA 3RZCA 1J1OH 3A4FA 4M1DH 4TRPH 1KPUB 4G43A 3NJMA 3QJSB 1LK3L 4WENB 2CGZA 5K39B 5EDXA 2JCCB 4QRUA 4G8GE 2FGWL 1W72L 3KVDD 1NAML 2N7AA 4N0YL 1SOXA 3BP4B 1JWMA 3FOLB 5AYUH 3SPVB 2WXRA 5E8DL 3THMH 1RU9H 3BWAB 1VKXB 1IRAY 2WD0A 5LQBL 4KKNA 2GCYA 5I74B 1D5BA 1CYGA 1CBJA 3HB3B 4BA8A 1DN0A 1J8HB 5D70H 4XN5A 2ZCKL 5TE6H 4B50A 1ZA3A 2Y72A 2VW7A 1LP9B 1M3JA 5DUJA 5LNDA 2IQ9L 4R7DA 4EIUA 3U46A 5C0CB 1E8WA 3ISWA 4KTEH 3DX9A 1ET5A 4M7LL 2P45B 1PFOA 3PXLA 4GAYA 4M3HA 3R8BB 1RZIA 4ZMQA 5HPMA 2P8LB 4LIQE 1WE5A 1AHWB 3VQLA 3GC3A 5K1JA 3RLSA 4PGBA 3DK2A 2WLHA 3LKNB 3VFMA 4MD0A 3JSSA 2PTUA 4U1SB 2VYRE 3VD0A 4GG6E 1ZT1A 2DQEH 5D7JC 1TU2B 2V7NB 3JTBA 2WPGA 3QUZA 3U25A 4OF7A 3D2UB 3BPCB 3KPNB 3F64A 4HIIA 4MNQA 4TNWF 1U8NB 3VD5A 4XTRC 2Z0BA 4AYFB 2OSLB 4NZRH 4OB5L 3ARFC 5C0NC 1SJHB 4R84A 1WK0A 3V0FA 3UBXI 1L9QA 2JH2A 3FT0A 2WZ0A 1U8LB 4EAEA 2JTYA 2V9TA 4W6XB 3OKMB 1T0MA 2HRHA 4PLOB 1YYMH 3RDTD 5JPMA 3OV6A 5A2JH 1J5HA 4EO5A 4EBQL 5HHQB 4WWKC 1AXSA 4CGUB 5DUPH 3I6LD 1QWUA 4JE4B 5F9OL 2B3RA 2C4FU 2RACA 3TO2B 4GI9A 3FO0H 2MSPA 3HHMA 1ADQA 4X6CB 4Y2DD 3KL3A 2EDOA 3L9EA 2NDFA 1I8MA 3EH2A 3QWOB 3PGCB 4EI5D 4Y2DA 5D7SL 1OM3H 2JFCA 4L4VD 5AW8B 5C0JA 2VITA 4WVRA 2VCOA 3DV4B 3L3DA 2RALA 2PCPB 5AKSA 4PIRF 5KJ7E 4EI5A 5B3NA 5HJ3A 3WN5C 1H3PH 1JD7A 3QC6X 4GO9A 4UTBL 4AQZA 1LD9A 3RGVB 1HHJB 3NFNB 1QO3B 5IR1A 4PJDF 4JG5A 4UF7C 1KJ2B 3CFEA 1KDJA 3GJEA 4NN6B 1NQBA 3EG9B 4OM1L 3A4EA 1S9YA 2NY5C 1D5IL 3L9RA 3LRHA 2JMRA 1IGFH 3KG5A 4KKLC 4LLDA 1XCXA 4YSRA 3BT2L 2AKRA 2CUIA 4WK2B 3FB5B 1O9VA 3JWOC 5BRZA 1HILA 1P7QA 5J13C 4PGDA 2EXWC 2EE2A 1INQB 2PR9A 4TTGA 1EMTL 2X4PB 1SEBA 2Y4SA 1KXVA 4FQ1L 2B1OA 4P57B 2YAHA 3SGEH 2VSKB 2SEBB 1QRNB 2CWRA 4LU5L 3NPSC 5C08D 3ZKMD 1YUKB 3TPUB 5L8KB 1AGEB 4Z7UF 3GUFA 2JIXB 4DH2A 4ETYA 4L8BB 2W88A 5C08A 1KJMB 1PF3A 1U2YA 2WOBA 4OLZL 5D96B 1AJ7H 2WW8A 4M5YL 2PF6A 4XVJH 1UXSA 3CD4A 4BGLA 5LCVH 2EE6A 1TETH 2YEVB 3ESPA 1UGKA 3ZLQC 3MOBL 1I3GH 4ODVH 4N2IA 3TT1H 2BOCB 1DBAL 3ZE1F 4XXCA 5T5FL 2CRZA 3U9PL 3VFUA 3ARVA 3BLKA 4AG4H 1MLBB 3VMPA 3F04A 4EDWL 5E2WH 2ZXDA 1U42A 2K6WA 5B38G 3MLWH 2V2TA 2AERT 2EADA 4Z7NE 4ZYKA 5CGYD 2H47C 3D85B 5ICXB 4FMVA 1OM9A 3QS3A 3VA2C 2Y7QB 2ENPA 3GSNB 4RETB 3KM1A 3U4EA 1KC5L 4YH6A 3GSQA 2DQGL 1INEH 2IJ0C 5FO8B 4KQ0A 3WFBL 4EN3A 4I0KA 4JW3A 2WXLA 1K8DA 2GTWA 3R1GL 1HDMB 3QUHA 5IBTL 3JWNG 1N6VA 1XGPA 4W4NA 3MNVA 1CQKA 1MJ8H 5PCYA 4WW1B 3P77A 4H40A 2PPEA 1BPLB 3GJFH 4LDCA 4ADIA 4I0PB 3MLYH 4N2OA 3VFVB 3WE6A 2XQBL 3WLBB 2GI0A 1LLAA 4YEEA 5KVFE 3L3GA 4A1RA 2X6CA 3EGDA 4Y5VC 2CJUL 3I3EA 3PJSB 5EN3A 4HDIA 1QI5A 1UD2A 1TIUA 2DB8A 3PNWA 3O9WC 2GBAA 5D8JL 3FUFA 3MLZH 3VRLF 3AM8C 1PLBA 3KGRA 1BLIA 2VDNL 1FFPB 1FH5H 5DRWA 3RZCC 2GC7C 2I26N 4NBYB 3UG4A 3UMTA 1BJ1J 5TK4A 1TPXB 2F54A 2FNWA 3MU3A 2DWSA 4I2XE 2DQHH 2FBOJ 2QQKH 3VG0H 4QF1A 4ZO6A 2CNZA 2E27H 1U8QA 1SYSA 1QD0A 1U8PA 1NBVH 4DP5X 2MHAA 3PWNA 3NG5A 1DEEB 3WIFB 2ZUVA 15C8L 2BMKA 3HG5A 1AR1D 4Z8FL 2ODIA 4JFEA 4NQDA 35C8H 3RY5A 3QZWB 2V2WB 1DUYA 3BDXA 4QHPA 3NEEA 4GAJL 4JLRA 3S6CA 3WHE1 4U6HB 5KVFL 2IWKA 1FE8L 1NMCC 4MDJA 2NUPA 1LWRA 3H9SD 4QRPD 3T0EE 4NIKB 3TFKD 2EYSB 1IKFL 4BXSV 2XNAA 6PCYA 1IBZA 1IQWH 2P5PA 1B88A 3K2UL 1MJJB 3EOBB 2F7OA 4PJIA 3U4AA 1G7LA 1QOKA 2WUBL 4NAMA 1CGSL 2VLMD 3KPPB 2K4WA 1ED3A 4QRPA 4R4FL 4JJOA 3MMEA 1I1AB 4CVUA 2ZOTA 8FABB 1XTLA 2C5DC 3FOMB 3V4PH 3QDGD 3SD5A 3IJ9A 5D6CA 4CBZA 3QUZC 2WSKA 5EU6B 4WCYH 1UM4H 1W0YT 4LCWD 1GZHA 3ECQA 3HNSL 1ZLSL 5BXFB 4AW4A 2GUYA 3QDGA 1KCRH 4TUKL 1WWCA 3DMMB 2VL5A 1HHHB 2DH2A 2WJ5A 4DP0X 1O7SA 2OL3H 4HA1A 3UZQA 4ABWA 1XF2B 1PLGL 2L0DA 4R8WH 4XVUD 5JPMC 4KO6A 4S11A 3ORJA 1K8IA 4ANXA 5TFSH 3DGGA 3VW3L 2ADJB 4CU7A 1G7QB 4FQIL 1J10A 1QASA 4NQCE 3Q13A 2DBLL 4JEGB 2BNQD 2LVEA 2FECL 4Q0XH 4CJ0A 4UMSA 5FLVA 4O2CB 5E8DH 4M29A 5EORH 3L6FA 4ANWA 1HYSD 4OFPA 2VUKA 4Z7WA 3RA7L 3SPCA 3VRJA 4XO8A 1SN5A 1YMMD 3N1FC 4Y2DC 3EO9H 5GISL 4GKZA 2K78A 3KGUA 3TCXA 2KBGA 5IJBC 1IGYB 1JOIA 4XX5A 4Z5RA 2J1KA 2QV4A 4EI5C 3NJVA 4L9LA 4BK5A 1H0DA 3PDOA 4XNXL 3HFMH 5E9NA 4G6JL 4FA6A 4OM0L 3MREB 1RUML 4K8RH 4HJIA 4Q4IA 3G6JE 5KSBE 1S7QB 1D5RA 1RP9A 3WTTA 3PPEA 5ICYA 1M7XA 5A2FA 2FL5A 5E4AA 3SE4C 1R5WA 3D48R 2BZDA 4ZX6A 5CN3A 5HGDB 2I7SA 3TNNA 2MIZA 1H6UA 3NIDE 3PRZA 5ACLA 1DJHA 1X7SA 3NZSA 2JWYA 4ODWA 1Z3RA 2PCXA 3TURA 2OJ1A 5I30L 1UEMA 1ACYH 3VXRD 3O6LH 4LVHC 4WI8A 3NJKA 4IBYA 5FF6B 1N0XL 4DP8X 4G9DA 2ZPKL 3AG1B 4JO4H 4CDGC 2D0HA 1E67A 2X4OA 4MFHA 4U3CA 1LNUB 4HS6B 1RIVH 4PMFA 1CL7H 2EO1A 3R7RA 2CJSA 3VXRA 5EZPA 2A6KB 3ZKND 4Z0XB 2V5SA 2WWOA 1SDDA 3BZ4A 2EC8A 3O2WH 3GJFK 3KYAA 4LIQH 4OCWH 1I85A 5BUAA 4Y16D 4YXLL 1T7ZA 2BFGA 5FUCE 3PF2A 5IHZA 4CVZA 5ANME 4XWOD 1T21B 5DC9B 1N3NA 4Q6IB 1KTCA 3EJPA 5F8RC 4Y16A 3TEYA 1VA9A 1NC4D 4XXCC 5D7SH 1JZ2A 5J06A 1UJTA 3GSRA 2ITDB 1G9NH 1KEGL 1E9QA 3SKJL 3RDJA 1KGJA 1PZDA 1FPTL 3UP6A 1MHEA 3L45A 1HT6A 1NC4A 2GJ6B 5J6GA 3TF4A 3H6JA 4P2RA 4EZJA 3L4WA 1DBJL 1JZJA 4BKSC 4ELDA 1IBBA 4JFQA 3K8LA 2VQ4A 2XTJD 5C0EB 2AJYL 3O3DB 5CGYC 3II3A 3L3OA 4NRYB 1ID2A 4EN3C 4FNSA 3QUKA 4OM1H 4NNPL 3VFWA 1YPZB 2VZOA 3FW6A 1JNJA 2WLLB 4AGPA 5IHBA 3ECUA 3IDUA 3OXSA 2ZCLL 4XX1G 1TSRA 1KDIA 3BT2H 1KN2H 3AW5A 5C0DA 5E5LA 5KAQG 4HEPG 1CC3A 1GGCH 3WNPA 4EPSA 1T5WB 3KPQA 1JPGA 4HIJA 5HDBF 2BCMA 3NFSH 2BY1A 3Q8BA 4FG4A 2R1XA 1F86A 2I9TB 3L7EB 3S88H 2ZG3A 1M6OA 3QE5A 3D25A 3L3IA 2NXYD 3RL1B 3QUML 3GSUB 1JCKA 4IOFC 1SVCP 4OGYH 3LIUA 4JRXA 5JOPD 5AW0B 3TEWA 3T4AA 4HBQA 1F3JB 3D3VE 4H1LG 3BP4A 5TDOA 4FCHA 1S5HB 4E9WA 3FOLA 1AC6A 5FO9B 3FB7B 5C0BD 1ASOA 3TCLB 3BWAA 4AK2A 1MPAL 5DJAA 4OSUL 2BLFA 5ESAB 3RY6A 4YX2H 2EC9U 2XG4B 3WDJA 4IBWA 2KH2B 4JQXA 4Z0BL 3S5LB 4QAWA 1CVSC 1R3KA 1CFNA 1YEGH 4OVUA 1DHKA 3J2PA 1KIQB 1L9SA 3D51A 4BXVA 5F9AC 4BFKA 1PLAA 1DBAH 5C0CA 3KHQA 4ZPVB 4PJ7F 5T5FH 4ERSH 5DEJA 1IT9L 5DMGD 1AR1C 4HMCA 2BWQA 3LZNA 5CLZA 2AF2A 3MGOB 5D7LB 1F42A 3FCUB 3BESR 4GEIA 2F5BL 5EU5B 3LKNA 4LKXB 4ODXB 5JDSA 3ZDYF 2A9DA 1JVOA 3VD9A 3MRRB 4MMXB 4G9FB 2G2NA 1KC5H 2DQGH 4XN4A 5DYFA 4AMKL 4DP2X 1J88A 2J1WA 2N0KA 3BPCA 3GEFA 3IXAB 3KPNA 3QDJB 2F7QA 2YS4A 3FQUB 1IVLA 3UCRA 1IQDA 3CZEA 4PJBF 4K7FB 4AYFA 4YZFE 5KAQF 1PNDA 4HAGA 5EWIH 2NR6D 2OTUB 3US0A 2XN9D 4BDVA 5F8QC 1GZHC 1U8LA 1ZHLB 5B39G 3V52L 3BAEL 5D1XD 5C7XL 3L95B 3LNFA 5AZ2L 1Z5LB 4JAMB 2EVFA 3NTCL 3TBVB 2CR3A 2NR6A 1JCVA 2CK2A 1P4BL 1ZVYA 5I6KA 2ORBL 5D5MF 5D2LF 1P5UB 2E59A 1M6UA 5HHQA 3QQ4B 5D1XA 2GIMA 3PP4L 2QTVA 3ETBJ 4LRNL 1KB3A 1EZSA 3QDHA 3TO2A 1QSVA 1T22B 4ETQA 4JG1H 4X6CA 1CGXA 3TA4D 1AGBB 1T1ZA 2GY5A 5DHXB 3GJFB 3QJOA 2QZQA 4F20A 5I0YA 4TSBH 4QHUB 4YSTA 3OLDA 5I1LB 3Q8CA 5T33L 5JHAA 1XH0A 1QBAA 1NIBA 2B0SH 1ORQA 4HUWB 3ILPB 4XCNA 2XUWA 4DK3A 3TEXA 2F61A 2G9HA 3DV4A 1JPFA 2PCPA 3NFPA 15C8H 4YHPB 3WO3B 1GXEA 4JRLA 4ZUUB 1CDUA 3JWNE 4MQSB 5CWSB 1FNGB 5DVPA 2KZBA 1Q1JH 2BIIA 4GT7A 2ENJA 4JRYD 4P99A 1HYSC 2HFFA 2FEEI 3LPFA 1DQVA 1KENL 4M7KL 4PJFB 3RGVA 2CUAA 4GAJH 3NFNA 1F8TH 1WJ3A 4FXLA 3RFZA 3KDMB 4MVBC 2X0WA 1KJ2A 5KSVB 3QQXA 4JRYA 4OVVA 4L9LC 4BK5C 1S7XB 3O3EB 3BYYA 4OBRA 3CFBB 1IKFH 1PFCA 1D7CA 1PY9A 3H4HA 4AVHA 2FR4A 3OKDA 5ENWA 2A9ML 2JQAA 4H7VA 3RWCB 1Q0YL 1FHGA 2FWOA 3KPSB 5GXBB 2EVHA 4OJYA 1I82A 5F7HA 4PRNB 1BWMA 1E2ZA 3RVVD 3OZLA 4P57A 5E9DD 3WELA 1NGQL 3OSVA 3D1MC 2FAUA 3CX5K 2DQDL 1JS4A 4Y5XA 3OKKA 3KLHD 2Y06L 4KKCD 1AGEA 4FFZA 3B2UD 1FZOB 1ZT4B 2YPLE 2IQAB 3NCBB 4LKCB 3F8UB 2AK4E 1S9VA 2I25N 2APXA 2V8MA 5CP3A 4ZAKB 4ZS7L 3V4PB 4BFNA 1AE6H 3IJSB 4N5ED 3TJEH 2K1MA 4JPIB 2H4EA 2FX8L 2DBLH 1I85C 1USQA 4Z95H 1PD1A 2XBDA 2YR3A 1TTFA 4PVLA 2BY3A 1LE9A 2YFNA 2BNRE 2BOCA 1R19A 1JP5A 3W2DL 3ZKNC 4AEFA 1OCOB 2OL3B 2E86A 2GC4C 3HVDA 1IIIA 4Y16C 3RA7H 5CZXC 5H2BB 3ZL4L 3MRLB 2LV4A 3ZDZF 4KVCL 3FUIA 5GISH 3M88A 4XWOC 2LHAA 5FUZH 4ZMPA 3QNYB 3D85A 3FUDA 1AGDB 5ICXA 1ADWA 5MI0B 5BQDA 2A74B 3T0VA 4DO5A 2D0FA 3VNZA 3GSNA 1CDCA 1PZAA 4XOCA 5CCKL 3OPZH 3K5SA 1HX0A 3FFCE 5FO8A 2WWKT 2ZX6A 4HD9A 4N8CL 2QDWA 3MNZB 3KXFD 4JQVA 5IESH 3RWFB 3IM1A 1KPVB 4X7SL 5HGBA 4OJDH 2XI9A 1HDMA 3L3OC 3C12A 3OJ2C 1MI5E 2ZWLT 4M6OL 3L4ZA 3DJZA 4GRWF 2XTJC 4I0PA 4LSQL 4ACTA 1AR2A 3VFVA 5FS5A 4B0MM 4IJTA 2DQTL 4PJEA 3R19A 4ZFFB 3JV6B 2RA1A 4D0BB 4ILDA 1CGTA 4QOKE 2ZUQC 3ALPA 3NCYP 4X50A 2NY1B 3EO0B 1DJIA 3FT1A 4ONHB 3QFJD 3W9EB 2CBTA 2VXTL 3T4AC 4WF7A 4G8GB 2C9PA 3U6RA 2YEZA 3MRFA 4LHUG 2P24A 5A2LH 1MRFL 5HGHB 1MAKA 1UA6L 4L4TA 4GXUN 3H0TB 1SZNA 3VH8G 3MLVH 4N1HB 1DEEA 1NZRA 3U0WL 3WIFA 4YXLH 3X14A 1OF2B 2I5YL 4XBGB 3APMA 3TO4D 3IWUA 4JQXC 2PN5A 5E5MB 4OJFL 4QXUL 4UQ2B 3AUWB 3PE9A 4QYOB 4OCRH 4U6HA 3Q06A 5I26A 2ED8A 2NW2A 4UANA 1QA9A 3SCMB 1KEGH 2ED9A 1T7XA 1CZ8L 2CO1A 2CLRB 2Y69B 2YRPA 2IPTH 1MJJA 3EOBA 5SV3A 1KGYE 2Y7OA 4HLEA 4OCSH 2GHWB 2CGRL 4ODTL 1QBML 3KPPA 3AUVA 5DMGC 4M62L 4Y9FA 2NRDA 1MFBH 2FO1A 1I1AA 2XWDA 8FABA 4GG6B 3RFRA 2APFA 2N0MA 4R0LB 2X0UA 2NY0B 1FQ9C 2WYIA 3HLAB 2AJYH 1X5IA 1TVBB 2LVCA 4OIIH 4UNTA 5EU6A 4JRWA 3T6WA 6FABL 4NNPH 4H8WC 2WV3A 1EAQA 1ZLVH 5HDRA 2Y3NA 5A2KH 4E5XB 4MQXD 1HFUA 3T2OA 2AQPA 2YJLA 3ZR5A 3M8OL 5A7EA 2CJTA 4MZ2A 4L8CB 1LXMA 2Q87A 5E56A 4L8DA 5GPRA 2NR6C 2F5AL 3RVTD 1WFJA 4HXBH 1SPDA 4M1CD 2ADJA 3EHBD 4FNQA 1G7QA 1MJ7L 1MZZA 5D1XC 2R2BB 2WTRA 2YLKA 1M3IA 4FLOA 5E8NA 3OKOA 3HN3A 3QJVB 2GK0B 3UPRA 1HS6A 1MCKA 4M8VA 4HJ1A 4RMQA 5F96H 2PR4H 4O2CA 4PV1C 3CVHA 1HOEA 2JKNA 1GS8A 2BSTB 4K5LA 1NCUA 2OMZB 5T1DH 2G3MA 2ICEB 3ZW3A 5HTSA 5EOQH 2E47A 3S37H 4KK8D 4UT9L 2V5MA 3GZKA 4R7XA 4AGNA 3QVAA 3OZKA 2LQRA 5IHUH 2VAJA 3CDZA 4HUUB 1WC7B 4XX1E 1LO0H 2ZTBA 3ARSA 3CDGB 5GGSB 3T8XB 3LHPL 5FGCE 1ZHNA 3V6ZB 2P1YA 9CGTA 5JYMA 1FL6B 4JVUA 3VG9B 4DKFH 4Y1AE 4PCSA 4X4YB 3RFZC 3AGVA 3NA9H 2J6WA 2DIAA 5AKVA 4JFOB 4NN6C 1WHOA 5IMOA 1K5NA 1S7QA 4P4KD 2LFGA 4WWNA 4S0SD 1Q38A 1UD6A 4YDIH 3EH1A 5D5ME 3BGMA 5D2LE 3ARWA 1RD6A 3FQRB 4MA1C 2Q6WA 4GKNA 3DSNB 1EXGA 5HGDA 4JHBA 2YD3A 5ESVB 4AMKH 3ARYA 5IVXE 2L4OA 2BERA 2Z8VC 3BRGC 3P69A 4X4ZA 3I9GH 1HZHH 1KYDA 1U8HB 1D6VL 1QW9A 2ZWYA 4TLSA 3BN3B 5LKNA 1Q9WB 2OMYB 3E8VA 5GGRB 4AYGA 4Y5XC 4WFEE 4JPWH 2IFFH 3LKQA 5AZ2H 5ICUA 3TONA 5BCAA 4PH8A 1NMBL 4KI5C 3RVVC 3DVNB 1LNUA 3BKJL 4HS6A 4WY7H 4HJJL 4ZO9A 3U4KA 1M7DB 4JHZA 4PJ8D 3SE3C 1QUNB 4Y4HD 4F15B 2A6KA 3ZL1A 4Z0XA 1UD3A 1DANT 1ZMYA 1U2HA 4N87A 3SDXA 4KKCC 3G6DL 3B2UC 5DJZB 4M7JH 2SODB 5F44A 4ZFQA 3Q6GH 5DLMH 2V9QA 1U33A 3O11B 4DEPB 2BP8B 3EJRA 4PJ8A 4M4PA 4HJEA 4JFZH 3EOAA 1DQQA 3LPOA 2HH0L 1KLFB 1AQDA 5SWZD 1D2PA 2NY4B 2ITDA 3P4OB 2VDOL 1RK7A 3VSVA 1P2CB 2K70A 5E8EB 1UT2A 3MLTB 1H15A 3BO8B 3PHOB 2IV9A 4TNWK 5SWZA 4Z7NB 4NERA 4C55A 1CLVA 1OAZH 1SEQH 2BIMA 2GJ6A 2FO4B 3D87B 4LNVA 4ZRGA 5J8OA 5BVPH 4HH9A 4M7KH 3PABA 4FADA 4LLUB 3DHPA 4AV4A 4E0RB 1YHPA 4GUOA 1WLHA 2IBZY 3QCUL 4NRYA 4AT6B 2F7RA 1Q90A 1QYGH 1TZGL 4JQVC 1YPZA 5CNHA 2WLLA 4I18B 1A7NL 2P49B 3FSOA 4K94H 3RURA 2PCFA 2BC4A 4J3BA 3W9DA 5CN2A 4OW6A 1V05A 2DY2A 3JZYA 1IO4C 1V10A 4DGVL 2W60B 5L0QC 3FU6A 1JZ6A 3ARRA 4XT1C 1T5WA 1EEQA 4LESA 2XA8L 4UT7L 3WUWB 3CLFL 3SGKA 3VXMD 4E41E 3PWVB 3EFFB 2I9TA 1P1VA 2PWEA 1QW8A 4OFYA 3LXAA 4N2CA 4N85A 5IUSA 3HBQA 1XGYL 4I1RA 1NCNA 1RUQL 3JWNH 3NJGA 3KH4A 3ATEA 3ZDZE 3G3LA 3LIZH 4TQEH 2CA3A 3FB7A 4TUJA 1MVUB 2DQCL 3TCLA 4FA8A 1ZLVK 5IHWA 4I2XB 4DN4L 1G1KA 2ZUYA 2C4XA 4JMXA 5L8LB 1IZKA 3O8XB 4FERA 3Q44A 3OHMB 4KXCA 3KPRD 1AZCA 4HUXB 2AZAA 3DX2A 4G5ZL 2BS9A 2XG4A 3V4VL 4HCRL 1SXCA 2FX8H 4M48H 3S5LA 5EF3A 3E1ZA 2WBKA 2GEQA 1TQCB 4J8RB 5IBUG 4XH2B 1BIHA 4O02L 4BFIB 3OR7B 2HCZX 3GZOA 4LRIC 3GLDA 1KCVL 4ZPVA 4XGZB 3TXAA 4XN9A 1QFOA 2CXGA 1NGWB 4HISA 3SYOA 2I60L 3ZL4H 3PQYD 1NBYB 3HZMA 1BZ7A 5D7LA 1ZHKA 1RULL 3JT2A 1RK0B 5HYJD 4GRWE 1CXFA 2DEYX 3T2NL 1A22B 1KBVA 1NM4A 3M1CA 4FQLL 3T0EB 5JQIB 2YMTA 5L8JB 1OE1A 4LKXA 2KQMA 3CZKA 4MCZA 4W68A 1QLFB 2IANE 2BP3A 3MRRA 4MMXA 4G9FA 2OJEB 4E68A 1KGWA 4FZEH 1TEGA 4HGWA 4OIBA 5HYJA 4M9OA 2D9CA 3FQUA 3I74A 4K7FA 4N68A 4DKTA 1A21A 1ZVSB 3GS4A 3US9A 3BZEB 2OTUA 3Q05A 1FAIH 3ZZLA 5IKCB 3D8MA 1G7HB 1ZHLA 3CDCA 2HT2C 5ABDE 3L95A 3FF8A 5GS0D 2ZX9A 4JAMA 3CX5J 1SYVA 4OLYL 3B1TA 4NKQB 4NFCA 1CVRA 4J3OG 1NCAL 2DQTH 2VXSL 2EIZA 4EZLA 2ZJSH 5DFTA 1PX8A 2E46A 1YO4A 3ZXAC 1SJEB 1T66D 1IGML 3MFFA 4PRIE 4ZUTB 5C9KA 5G5DA 4G6AD 3D05A 2ISDA 4P9HL 1T22A 4LSVH 4NQCB 3ASOB 1AGBA 1G4MA 3GJFA 2G3XA 2VXTH 1ASPA 4NGHH 4HEMA 3RVTC 5I1LA 2LGNA 4LSSH 1TKWA 4HUWA 4FNTA 3HI6L 2DM2A 3EHBC 1KT2A 4M1CC 4N22A 5F7LB 3SQBA 4CMHC 1OTSC 6TAAA 1S7TA 3FO9A 1WAEA 1J7VR 3MJGX 1E4HA 3PWUB 2W9DL 2C9VA 5FGRA 3AXIA 4OV5B 2Y36L 3FZUD 4TQ8A 1DLFH 4N5UA 4X98B 2YJQA 3D4YA 4PS8A 4OZHF 5CWSA 3TH2T 3S4SG 4EUPH 3EBIA 4HXAL 5JHLL 5HI4C 1EUTA 5CLYA 3BWZA 3CSFA 4W6YB 4ZX3A 3KDMA 2C9XA 4KK8C 1KPRA 3O4LD 5DVOA 5KSVA 4DUVA 1EJOL 4ZJ9A 5ESQB 2R7EB 1QPKA 1HKLL 2OMVB 1SJXA 2VMEA 3JTSB 5KSAD 4FRWA 5EBLB 1CZ8H 2E8ZA 3H1ZA 3RIAF 5JPNA 5D7KE 5KSBB 3G6JB 1R34A 1OHZA 4B0MB 3O4LA 1KB9K 3EYOA 4Z7AA 4J3TA 5MEOA 3E6HA 3KPSA 2XVBA 3G9VA 5I19L 3FPYA 1RUKL 4LLQB 2NY7H 3TU6A 4PRNA 4P4KC 1TTUA 1S7RB 3NIDB 5FB8B 4B27A 5HYSA 1I7RB 1W0WB 4J3OF 4X6DE 3P02A 2CH8A 2IQAA 4ZTEA 4GW5B 1G0YR 1ZEAL 1WFOA 3BSZL 1IARB 1NFAA 3H56A 4OTXH 4PJ6A 3ULSB 2BP0A 4ZAKA 1CFSB 4LHQB 2F5AH 3MA9H 4RRPG 3IJSA 4WHCA 5KYWB 1RK1A 4FQXD 3DROA 4D3CL 4JPIA 4MB4A 1XSKA 2Y1ZA 2FB4L 5DEFB 3CVCA 4P3DB 1DVUA 4HWBH 2DL9A 2WP3T 1KYFA 3QR2A 4PJ8C 5IV2A 4Y4HC 1WZKA 4JM2F 2HT4D 1MIML 1Y7VA 2OL3A 4UQEA 3H2QA 2CMRH 5D93B 1L9OA 1UB5B 2AEPH 5J6HB 2VMCA 4XPTH 5K9KA 3VX0A 4A7VA 2YPKB 4WRLA 1H3TA 1MF2L 3SKMA 1D5XA 2QADC 4GQQA 4PG9A 1AGDA 4I85A 4PJGB 2A74A 5IF0B 1MCSA 4QAMB 5E1GA 1W72A 1XH3A 1NAMA 2VDLL 1N64L 4ENED 4WIQA 1UA3A 3ZZSA 4C4KO 4W4OA 1IL1B 4BKLA 3GXUB 1PKQA 5B1AB 2DDQH 1OGSA 2QGEA 3F6IA 3RWFA 2BO0A 1DFBL 2UWEA 2DKMA 3V6FB 3GB7B 2QSQA 4ZQKA 2TRHA 3AQZA 3UTZB 1B4LA 1NANH 2IGLA 3MODH 2ZX5A 1ZANH 4U1NB 4AL8C 2IDCA 2JQMA 4J4PD 4NO2A 2WIMA 1IC4H 1TJGH 1FGVH 1OTUD 1AKJB 1XO8A 3LKSA 3QI9B 4PV9B 5T3ZD 2NY2D 3TYFB 4JREC 3SYCA 4M6ML 1C08A 2O5XH 3JV6A 3NSYA 4K07A 2J8OA 5E0QA 4B3EA 3QDAA 4GG8B 4MZIA 3VD7A 2CO6A 3HAEG 4M93B 4ONHA 3W9EA 2QKIB 2COVD 2BK8A 3PWLB 4G8GA 3D3VB 4O4YL 4OQTL 1MXGA 1FJ1B 2YAPA 3T1WA 1YNTA 1DLHB 1H8OA 3LNDA 4HJJH 1PBYA 5HGHA 3KMDA 3O6ML 4X0KA 2H2SD 7FABL 3H0TA 4JQIL 3SGEI 3TBTB 1RVFH 3EBAA 3WEXA 2JKIS 1OF2A 3IWVA 1UOWA 5KANG 1L7TL 4XMLH 2WKOA 4Y4FB 4BRVA 5E5MA 5H94B 1KBGL 4XOAA 1LEKB 4YXKL 4G7SB 2ENYA 4KO9A 3VJ6B 5BRPA 5MHSD 4JY6A 3L2MA 4KKQA 4OJCA 3GMMB 2FJHB 2Z1PA 4MWFB 4KUZL 3LZRA 4FI8A 5ID0B 3WSQH 4QHKI 3ETSA 4IHOA 3F6LA 4PLKD 5TGBA 4BSWA 1M9SA 1WQVT 1WV7T 4A37A 3SDCB 2O61A 1M7IA 2BIHA 3CHQA 1CF8L 5BOJA 2XN2A 1NUFA 1IKNA 2YRBA 5EZLB 1TVBA 3I75B 4J2QA 5B7MA 1A7BA 3FTUA 4WI3A 4YXHL 4RGMC 3K72B 1A7NH 1CE6B 1F4WH 1J1XL 1XGUB 1JV5B 4D7PA 2OMWA 4KQ4L 5DO8A 4E5XA 2PWHA 2VM3A 4N2GA 3MJ7A 3MV9D 4AYMC 4RESB 1QBBA 3HIZA 3MRDB 4QYAA 2XA8H 3EH3B 5I8OH 3STLA 1LE5B 5L9DL 1BF8A 4KU1A 3ZUNC 1MVFA 3DDFA 1MIEH 3PDDA 1LEIB 2ITCB 1QUPA 2K9FB 1BBJB 2DQIH 2V37A 1JF1A 5GS0C 1T3FA 3KYKL 2ZWKA 3KEDA 3FH8A 5DJ8A 5B38B 1U93B 2L7JA 4OCNC 1RUQH 1KIUA 5IEKB 4YJZL 2H3KA 3IJEA 2AABL 3DOSB 2DQCH 5IK3B 1GC1H 2XWTB 3ZTJG 2X6VA 4G6AC 2OMZA 3R06A 1MREH 4G1MA 3W81A 3PL6B 1VPOL 2A9AA 3UEZA 3PV7A 4WWPA 5I71C 4XP5H 3WS6A 5J11B 1M9WA 1SY6L 2BJMH 4G5ZH 3L5IA 2EH8L 4HCRH 3LS4H 2M8XA 4AI7A 3IGAA 1PNCA 5LG1A 1E4JA 4HUUA 3DSFH 1QVOB 1WC7A 5BV7L 4MAUL 3CDGA 4O02H 3B34A 3IMWA 2X70A 1KCVH 3E9UA 3V6ZA 3VDCA 3C08H 3F3HA 4NUMA 1FL6A 4FZ8H 4XN7A 1XGZA 1Z2KA 5I0VA 2OYPA 2OR7A 4GY4A 2Q7YB 4AMXA 1SXNA 2MCG1 3FZUC 1OWRM 2IBGA 3DBSA 3HRZB 1BVKB 4DZBA 1RIHH 1XH2A 2NX5B 5M7QA 3T2NH 4FQLH 3MRJB 4AQ8A 2GBUA 1ML0A 5JPNC 2FJSA 4XCYB 1Z5HA 5I18L 5BQ7B 2YKKA 5CD5D 3C75A 2DLFH 5T5FA 1IEAB 5ESVA 4AL8H 5ABZA 3F7KA 3KLKA 3FTYA 4HSQA 3X1BA 3NZUA 3WNIA 3TJPA 1QSEE 2HLAB 5F1KC 5AVRB 1Q9WA 1QZ1A 2OMYA 1IUZA 2DZEA 1SBSH 4ODSH 1GZPB 1IAOB 2DTSA 1MCRA 3NJJA 2OJZH 1JGUL 4LPCA 3LS5L 4OLYH 5TDPA 2AK4B 2ADGB 3FTGA 3DVNA 2A1WH 1JK8A 2AJSL 1ZGLB 3CGTA 1M7DA 4FFYH 3VU1A 1QUNA 5L4IA 3RWHA 2P52A 5J57B 1AOHA 1I9JH 1YA5A 2Z3FA 1IGMH 4ZAKC 3QRGL 3P3TA 4PS4H 2F18A 3H2WA 4GRWH 2YGVA 3GTNA 4R3SB 3D39E 3O11A 1VZIA 4JM0A 3HPJB 1TXKA 1KEML 4N0FA 3C87A 4HHAA 4GXUM 4UOZA 5I1JH 4FQXC 2G2RB 2EXYD 3G5WA 1KNOB 1KCBA 2CIIB 4LDOB 3NT0A 4RFNB 2OZ4H 1SLXA 2B77A 4C8XA 1WD9A 1A5FH 4BFRA 5E8EA 3MLTA 3PHOA 3UJIL 2Z7YA 4PRHD 1INDL 3RNQA 1JJUA 2Y36H 3GMQA 3IDJB 4RZCB 4W6WB 5DSCA 2FO4A 2HT4C 3V0GA 2J6EL 5MI0C 3FT2B 2MPAH 3TA3D 2A74C 3MTXA 4X9IA 4F7MB 5K9QG 3BVXA 4LLUA 1YNLL 5FYJU 2AV1A 4PRHA 4AE0A 3FFCB 4W4OC 2VXQL 5J9PB 4IHBA 2AQRA 3HC0A 4WTXA 3DURB 4ZMLA 2ZOKA 4UQAA 1M2OA 1HKLH 4ZW7A 4ZO8A 2V3DA 2OK0L 2EDXA 1BHGA 1HL4A 1ACXA 4WV1B 4XMPL 1MI5B 2WJ7A 1A7PL 3UCQA 4EUPB 3OVUB 1R17A 4PJ9B 5F0LB 1PAZA 3C5XA 3RX7A 1GJIA 3EYQD 1T0OA 4JKPL 4NZDA 5SWQB 2B15A 4K3EH 3AABA 4GFXA 4PMEA 4IQHA 1OD9A 4J4PC 3ECBB 3QXTA 3FK3A 1OTUC 3SZ6A 5C6WH 2N1TE 2CD0A 4NWUL 5EEZA 1F6AB 2NY1C 2ZP8A 3GTVA 3QJZA 4IU3A 3BSZH 2F08A 4GRLD 4I2XA 3GHEH 3O0LA 1YEJH 1NCBL 4ZX5A 3O8XA 3Q8EA 4ZW8A 3CBKB 3LAFA 3SO3B 2YO3A 2RH0A 3ZU8A 4JE0A 3TH4T 4ELMF 5I1KH 4DFHA 1DVFD 4G8FA 3KBEA 9PCYA 1O6SB 4CKVX 3IRCA 5E08H 2XQYG 4J8RA 1IFRA 4KTDH 4XH2A 4X9YA 2I9LB 3HE7D 4N6RB 3MRPB 5E6RB 5AFAA 3OKNB 1X3DA 3OR7A 2EH7L 4M43H 3OC5A 3X2QB 4XGZA 1JAEA 2RAMA 1CL7I 4S1SL 3AREB 5AAWA 1KGCE 3PFUA 1T2JA 4HOMA 3HE7A 4ZPTB 2AJ3B 2W8CA 3IFLH 1CDBA 3GSXB 3WFHB 2ARJQ 3W3BA 4MA7L 4R90L 2Q3ZA 3AG2B 3C6LB 4PIBA 1CG9B 5E2UL 4PJHE 3QXDB 4YN3A 1IBYA 5DDHA 1XR8A 1FNHA 1CIUA 2BDNH 4W70A 4LPXA 2OJEA 2P7TB 4GIOA 5CP7B 1KWKA 1NDMA 1QI4A 1S8DB 4RQQB 4Q4EA 1XSIA 4KRLB 1T7WA 3QISA 2BNUA 5JLZA 5AW1B 2CPCA 2XA3A 2ZOWA 3LEYL 4PLKC 1KB9J 2ATPB 4L3FA 4P5MB 1IKNC 3UZEA 5FK9A 5AW7B 1DE4B 4W9IC 1RZJL 3BLPX 4I4WA 4JY5H 4XP6H 1JZ4A 1G7HA 1P53A 3LMJH 3DDGA 2A9CA 1FYTD 4LCCC 3MRHB 3HJEA 2X6BA 2AQTA 3FU9A 5MERB 5KS9F 5T5NF 3D0LB 1MZYA 1IC1A 2N7BA 1R0AH 1NFIA 4F5CA 3V9EA 4ZUTA 4IOIB 4ELKB 5D9SB 4F80A 1DJWA 2WC7A 3DTDA 3NCYS 1AHKA 4N1CA 1R3HB 1HESA 3C60D 1JTOA 4HJGA 3KYMA 4OFDA 1JHTA 5DR5H 1A3LH 4O4YH 4OQTH 1WZ1L 1SFDA 3LKPA 3CFTA 1KELL 3A47A 3IDXL 5FO7A 4YSSA 2W65B 4GW4B 4A63A 3C60A 6CGTA 3HMXH 1C12A 2VN4A 3TASA 4DK6A 4OLWH 3PWUA 4KJWD 3FB6B 4PPTA 4RGNE 4DJMA 4FLRA 4LOUD 4IBVA 2HFGL 3GPSA 3MRGA 2H32A 5C0AE 3MUGB 1JIBA 2HFEB 3LXCA 5FGCB 4LGRB 1OT2A 2WXOA 5FO2A 1FL3B 4PV8B 5T1KD 4XMVA 12E8L 2E6PA 5ESQA 3L13A 3N1MC 1EEYB 3ZGHA 2YD5A 5EBLA 1T03L 4G42A 3D0VA 3G6JA 4UV7H 3NIGF 2KZ1B 2P5ED 2PP9A 2YOCA 5AALA 5T1KA 1QNZL 3SGDH 4AQ8C 3CWGA 4ZMVA 3IF1B 4PJXF 3F7YA 4YHLL 1J1PL 4U33A 3L17A 4N0UB 2YD4A 1L9TA 2WVVA 1QLEL 1S7RA 1YEIL 5IVXB 3GINA 3QH3B 4L5FH 4WZ9A 2EXSA 4YXHH 4P2QE 1BW8A 1W0WA 2IV8A 1DVXA 1YEHL 5AOLA 4EXPX 3L4CA 3CXFA 4KQ4H 5CD5C 4C56B 1P7KB 3HN8A 4HKJB 2J56A 3L3KB 2PYFB 4I3RL 3TGXA 3CVIH 3P0YL 4ALAL 1QKZL 4P05A 2VGLM 4N86A 3HNVL 5L9DH 4H8PA 2BVUA 1W0VA 1WBYA 3FQ2A 3LEVL 4J3UA 2H41A 4LCYB 4ZODA 2N59A 4D0DB 3FN0L 3GSVB 1NCWL 5CIPH 4F9PA 1CXIA 4QCIB 2DJ4A 3D18A 3DXAE 1QX1A 3NA4A 1X44A 4PVBA 4P3DA 4PJ5E 1HL9A 5ERWB 1XCQB 5ANMA 4ZBJA 4YDLB 3ECVA 4P3CH 1BAFL 1UB5A 3HA0A 4RFOH 4ZOAA 3A24A 3O0RL 4TQPA 2YPKA 1ETZB 1IU1A 1BSIA 3N42B 4X4XB 1PZSA 5K1VA 1V7NL 4X6BA 2WY3B 3QUMA 4HWEL 5IF0A 4OLXH 4ZTOH 1MWAH 2EXYC 4P9ML 3V5HB 5BV7H 1D2OA 3MBED 3OLEA 4ISVB 1EANA 5B39B 3MNDA 4XP4L 1T1XA 1FIEA 3C8HA 3P2BA 4YSEA 5E1HB 1OPGL 1F3DJ 2X3CA 4GP8B 4ZUWB 4DO4A 2AJUL 2ERJB 3MRIB 2R2HB 3V6FA 1EEUA 3MBEA 2E0PA 1WT5A 4HHWA 4HQQL 4O58L 4YHMH 4ECNA 1IEBB 2EDDA 1PD0A 3BWUF 4Z7UA 1E3ZA 2D03H 1ITBB 1TVDA 1SNRA 2XZCL 3CXHK 4DCQA 1RZKH 4ZSOE 5I18H 4XPHL 1UM6H 5F71A 4OAWB 4RSVA 4O02B 4QT5B 5C92A 4I77H 4NKOA 1AKJA 1JYNA 5MEPB 4OR1A 2WCSA 3GNMH 5EN2B 4XB8A 2P5WE 2HX9A 4NLHA 4E41B 4ZK8A 2EKJA 4LLYB 4BRJA 2V3FA 1OSZA 4QTHB 3EO1A 2BCKB 2VDRH 3MO1A 3NZ8B 5CGMA 3BX7C 4W9DC 5DZLA 3D3VA 3EYQC 4A2FA 2DTML 1FFQA 3DX8B 4MQ7B 1FJ1A 5I6PA 1DLHA 2Z31D 4TNGA 3RWIB 3WKNA 4LCUB 4XHJC 1IM3B 3TBTA 1THCA 2OMNA 3KCWA 3CMOL 4N0CD 3O8XC 1JGDB 1DUZB 5F89A 2XPGB 4J27A 2VXUH 4B60A 3VNYA 4Y4FA 2Y3AA 2D7NA 5L2KE 4LF3B 5H94A 2IGFL 4F3FB 1LEKA 4QR7A 1EGJL 3D4ZA 1OAKH 3DV6B 3FHAA 3WFEH 5HHOD 4GUPA 2H26A 4GS7B 1G5GA 3FRUB 4MJ6B 5IB4B 3TNMB 1Z1WA 2HKAA 5AAWC 3GM8A 1NMAH 3UTSE 3HE7C 2Y07H 3UJIH 1O9WA 2ADIA 3OB0H 4GRWB 2HPOA 4XBMA 4MDIB 4APQB 1I3VA 3MXWH 4DOHE 2IDFA 1WBZA 3SDAB 4QJ4B 1T89A 1XGRB 3MZGB 3K1DA 1KXTA 1QEWA 2IANB 4GW1B 3VD3A 3TT3L 4HSCX 3OHXC 4MLSA 2XFGB 3OMIB 5HYIA 1YNLH 3IGFA 4JFDE 4MJIE 2BIQA 2XXGA 4YSDA 8PAZA 5IQ7H 2IH8A 3QQDB 3F5WB 1PCXA 1TQBB 4IS6B 4PRBB 3CFQA 3F7VB 3UZEC 1CE6A 2X88A 2O5NA 1XGUA 1JV5A 4KXDA 1CPUA 5L88L 1GGIH 3OAUL 3MJWA 3ESUF 4Y1SA 1JRHH 2DQFA 5HHMD 4NPJA 2MCPL 1BXVA 4IMLA 1LE5A 3QXWA 4PREB 1LMKA 5E94B 2YAOA 1BOGA 3CCHB 5F1IB 4PRIB 5EUOE 5JW3H 3R7QA 2WYTA 2AMGA 4UIKL 1J05A 5B38A 3WAJA 2DMGA 5IEKA 4PM1A 4FQHA 3ISYA 4RMUA 2ZWZA 3LY6A 1V27A 1J0ZA 5I1DB 3E8UH 2KI6A 1BD2D 1J48A 4TSCL 5KZCD 2ARJB 3KD4A 4IJ3C 4AXWB 3QBTB 4XI5C 3C60C 1AMYA 5L2JB 3KWVA 4BH8B 3HS0B 3PV6B 1U8JB 5B21A 1QVOA 2D3NA 1KIPB 1WH0A 1JHKH 3DO7A 5FYJE 2EINB 3GGWA 3Q5YA 2IAMD 2WAQA 1RZFH 2Q7YA 1LDPL 4PAZA 5BS0E 4PRDB 4PB9L 1VB9A 1BVKA 2ZE0A 1T20B 1KCSH 2KQNA 5ILTL 1G7JB 4Q74A 4OD2A 1A1MB 3VVWA 5KS9E 4Q9QH 2PPCA 1Y6MR 1U3HA 2IAMA 4HPOH 3G08B 3KLAB 3W11D 4CW1B 1S7UB 2C9UA 4XCYA 3SE9L 4G6FD 4XNZB 5BQ7A 1BZ9A 5ISZE 4FTVE 3ZQWA 4POZD 1IAKB 2KLTA 3HC4L 1IEAA 4HS8L 1RJZA 1T1WA 3LTVA 3PUCA 5CSGA 3MCLL 3PWPE 3T65B 3FUNA 2YPLD 5C8JB 1TQTA 2FIKA 4PJAF 5JDJA 1RZJH 2HLAA 1OVZA 4FFVD 1XBRA 3VH8B 3HMWH 4X6DB 5A43C 1LO4H 3TPKA 4GMTL 4GI8A 4RRPM 1VERA 4F91B 2YPLA 2AK4A 2YAMA 1DVSA 1TMCB 1GKEA 1TZ8A 1WSST 2A9NL 3INOA 3VXNB 2VQ1B 2X7LB 5DJDB 4UM9B 2E74C 1MUJB 5F6IB 2XTLA 3K8MA 4IBZA 2WYZA 3CC5B 2BNRD 4YO0B 3REWA 4KO7A 1TT6A 4XMUA 4U6XB 1P4IH 1V5JA 4HZLB 5BO1H 3GIZH 2H6PB 4DERA 2XWCA 2V5RA 1DBKH 2R2EB 3QC5X 3O2DH 2BNRA 3JVGA 5F7AA 4XPGL 5EZOH 2E4FA 3IDXH 3ZIMA 3T6XA 3MBXL 1IC0A 2VLKD 4UIMB 4JFVA 3UJJL 4WUKH 5KYXA 2BY2A 1CDIA 2X89A 1AXIB 4PJCE 2VDPL 1YVLA 1CLZH 3OG6B 1XB6A 4Z7QF 4UINH 3FT2A 4YHOH 1X5ZA 4F7MA 2VLKA 4Z18A 4P2OB 1HU8A 4XVSL 3FFCA 4A39A 4ZUVB 3VDAA 4WTZG 3DURA 4R96A 2AEIT 2BRQA 2YGPA 3MBEC 3H7BA 1T03H 1OCCB 1WT5C 5I0XA 4WV1A 1JNHA 3GO1L 1MI5A 1UUSA 5D7IF 5C07D 4HT1L 4NQXA 2Z64C 2J8UF 1MCWW 2WBXA 1J1PH 1FZJB 1NEZG 3WEBA 1TZAA 5J5EA 4G5AA 2FQFA 3OB0K 1QLEH 5SWQA 3MR9B 5C07A 3MCKB 1H8SA 3F05A 3IDNA 4RLDA 5JXEA 2WHVA 2WQVA 5HGAA 3ECBA 3FT3A 1P6WA 1WAPA 1BYNA 4J5VA 1YEHH 1NOLA 4QOKA 1F6AA 4PBWD 4W9FC 4EDXA 3RWJB 1XZ0A 5DI8B 3X1FA 2L7UA 4FP8L 4YDNA 1KTRL 3FCGA 4UAHA 3LEVH 3ISRA 4A7TA 4KXZH 4PYHA 1B90A 1EXUB 4LARH 1H6EA 3EYVB 5AOZA 5SWSE 5DMKB 3ZDXE 1X5MA 5AVTB 1RMFL 5I23A 1NCHA 1UWFA 4N6RA 3TBWA 3MRPA 3OKNA 1XSOA 3HAEH 5MEQB 1AVAA 4QXTB 1N70A 3DIVA 1UWGL 4N0CC 2H3NB 4FHBD 4MX7B 3AREA 5CEXB 1JBJA 2B14A 4ZPTA 3LQZB 5SX4I 3GSXA 3K2KA 1AS8A 5CIPB 3C6LA 3LZPA 1CG9A 1OB0A 4QHMB 4OV6F 4HWEH 2TSAA 1XV8A 1ROWA 4IRSB 3SQOL 2XBZA 3F7PC 4KTGA 3BP5B 3ML8A 2P7TA 4YVUA 1L0YA 1S8DA 2FUQA 5KVGE 3SKNB 5KBKA 3RB7A 3MNWB 1O6TA 2VJ8A 4PP2B 4BH7B 4AYDC 5I76B 3BISA 2KMWA 1I1FA 1KB5H 4P5MA 4K3JL 5T1LB 4A6YH 2R4RH 1QR1B 1DE4A 3W39A 1B0GA 4M03A 4UT9A 4C57C 5IOPB 3SY0A 1NFKA 2XZCH 4I13B 3EYFB 1MWAB 1UASA 4XPHH 3S8FB 5BV7B 4WSKA 2PO6B 3CPUA 2RB8A 3IDYB 1JGIA 3A0OA 4P5KB 1JXGA 1YMHA 2DYSB 3G5VA 3NCXA 3GBNL 4X5WB 4KITB 2TRYA 3FAWA 1RKRA 5FM4A 4LNRB 3VWJB 4GXFA 4ELKA 2EABA 5D9SA 1IC5H 1HQ4A 2UYLA 1L6PA 3KJ4B 4CU6A 2JTDA 1R3HA 3VD1A 2AXGA 2XWBA 4NUJB 1CBVL 1AQKL 1AY1H 1BFVL 3RVUC 5C86A 3O3BB 5DZAA 3TVMB 3ROLB 5JTWA 4JFXA 4QPEA 4WI5A 5KVGL 1CD1B 3MTRA 4GW4A 4TS6A 3VD2A 1Z9SA 1BQHG 1W2KT 1T0NB 1EO8H 3V0DA 3G04A 5TK2A 3E38A 3FQYA 2DLGA 1ECYA 4P4RB 2VDRB 2K3TA 1FFNB 1J9TA 5C7ZA 2JJUA 4KZCA 4Y1AD 3LNEA 2UZXB 3NDZE 4Q7DA 1EGJH 1BVNT 3ENEA 3JWNC 4AKQA 1FO0L 1JZEA 3U1SL 4PJBA 3U0TB 5DJCB 2HFEA 4K3DH 4ODUB 4UYQA 2Z34A 5DJ6B 2Z8RA 4HEPA 3ZTJH 3DVGA 4R7LA 2Q8BL 3F12B 2ZP9A 4Y1AA 1I9IL 4L4VE 2P47B 3RYMA 1CDYA 2UZIL 3DI3B 4GO8A 2Q3XA 4X7CC 3B3IB 5JXAL 3A23A 4MKMA 4H8HA 4DTGL 3F58L 1A4JA 1HXKA 1U3HC 2IAMC 2CK0H 3MGTB 4Z3EA 5D5MA 5IMMB 5D2LA 4YWGH 3CH8A 4OLUH 4H1LA 1T5XB 4YHKH 4NUGL 1F58L 5IVXA 1CFTB 1LO5A 3QH3A 3W82A 5IBLD 3LZQA 4MCNA 3V2AR 1QSEB 1CFQB 5AVZB 3O6KL 1CICB 4IBQA 3IKCB 4POZC 4FGMA 5L88H 3POCA 3IDGB 5F7DB 4QXWA 3HBZA 3L3KA 3UC2A 2YMXL 3KBHE 2NNCA 4U4BA 5FGSA 5E6SB 5IBUB 4XO4A 4NQTA 1KCWA 3BFWA 1G7PA 2C9SA 5FW8A 3V0IA 1AYOA 2BSRB 4JHAL 4M7ZC 4XNMB 2HUHA 1GMIA 4U1JB 3RX9A 2XG5B 3GSVA 3CNKA 4E9TA 3D69B 1W6WA 1B6UA 4Q97A 3JUYA 4L37B 1MVYA 5DA0B 4LCIH 4WGVB 4CGTA 2DM7A 1XCQA 4UQ3A 4E2OA 3FUMA 3LX9A 1SLWA 4Q9RL 2NCMA 3K4ZA 2NCEA 3Q5TA 1R9FA 4ELME 4N20A 1RFDH 1A3QA 3JVGC 5JR1H 2IGTA 4KDTA 2BH0A 2VN6A 3NUKA 3PHQA 1ETZA 4RFNC 3RTQB 2X44D 3K6OA 3TBYB 1Z9OA 1RZ7L 4HK0A 2XV6B 1CLCA 1FIGH 4JZOB 4K3GA 1E0OB 3WG7B 1JYWA 5EC2A 2FZ3B 3GMLB 5I2IB 3LKRA 3BLBA 3V5HA 4P23D 3LV3A 3WBDA 4RA0C 5B39A 2DWEB 4BBWA 2QSCL 1XFPA 4PJAE 4N3UA 5JUEH 4U49A 5E9AA 4JO2L 5FCSH 5GS3A 1LDPH 1HQRB 3C5ZD 3BH9B 4L3ED 4PB9H 4RMSA 4JZNA 4S1RL 5ILTH 3TV3H 1IEBA 4HCRA 4XNQA 3RI5K 4RNRA 4G80A 4N8VB 2VMJA 1OSPL 1UQSB 3BH8A 1NFDF 2HWZL 3C5ZA 4WV1C 1UVQB 4ORGB 4O02A 4QT5A 5HHNB 3VB9A 5MEPA 4C58B 4EE2A 4G7QB 2E5EA 2J55A 1H3GA 3H42H 4DKAA 3FCTB 1KGUA 4E41A 2EEDA 1H3XA 2AJXH 5JOFB 5JXEC 4YDKL 4QTHA 5D7HA 3GHBL 3QEGL 3NZ8A 4WEBL 1AACA 3VI4B 2VR9A 4JM2B 5LO7A 4G3YL 2AJVL 2HVKB 3RHWF 5HYEA 4Y2LA 2YC1B 5GRVL 4IYKA 3JUZA 3ARTA 3DX8A 3VGEA 1A6UL 2J25A 1U8MB 5FYJH 3RWIA 2EQDA 3AGWA 2YXFA 5E8OB 3WI9A 4LCUA 5EO1B 2VAAA 3RGHA 3B7SA 2CALA 2XC8A 5T1MB 2XPGA 3CHOA 5BZDB 2BW5A 2CBMA 3QS2A 4LAQH 3KWTA 3RWEB 3AS3A 4LBEB 2Y2YA 4LF3A 5DD5L 1UG9A 5LWYL 1CF1A 2LU3A 4FXGA 1BQUA 2J2ZB 2Z4TA 1ZJAA 2NY5H 3LVEA 2AJZB 2DMCA 1QTSA 1ZVNA 3GMOB 3CFNA 4NO5B 3NACH 5HD8D 3FRUA 4MJ6A 5IB4A 3ZIYA 4CAGA 3SPIA 1RH8A 1QQDB 3JWOH 3K4DA 5IROD 1F1AA 5D7IE 5F7NC 3LZFL 3ELQA 3MRCB 3ME0A 5AVWB 4R26L 4AC2A 1U3ZA 4Y8AA 2NXZD 2VDPH 4MDIA 4APQA 3C6LC 5EA0L 5I5RA 1OZTG 4PJHB 3WOVA 3BD3A 2X9XA 3FB8B 3NJIA 3MYJA 5EU7E 5IG7B 3X13A 3IVKA 1M71B 3GSWB 1WS7A 5DTFB 4PB0H 1HCYA 4GSDH 4R83A 1T7VA 1ZV5A 4PRBA <