2DWTA

Cu-containing nitrite reductase at ph 6.0 with bound nitrite
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
329
structure length
329
Chain Sequence
LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title pH Dependence of Copper Geometry, Reduction Potential, and Nitrite Affinity in Nitrite Reductase
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 85
structure length 329
sequence length 329
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwtA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwtA02
1ZDSA 2VMJA 4G7SB 1SDDB 3V9CA 3KW7A 4NAJA 1AS6A 5B1KA 1SJMA 2FQGA 2BP0B 1WS7A 3QJSB 3NT0A 2VSMB 2FT8A 4G72B 3NSYA 3ABGA 4MFHA 1BYOA 4N4YB 1J9QA 1WA1X 3NJMA 1A3ZA 2WO2B 5PCYA 6PCYA 2PPEA 3FSVA 4DP8X 3EHBB 5I26A 4A66A 4PAZA 4E9SA 3H4FA 1HAUA 3DTUB 2CAKA 2AFNA 2GC7C 2IH8A 1NIEA 4HHWA 3DKHA 3PXLA 3UAAA 1NWOA 3S3BB 1J9RA 2IWKA 1SFDA 2MRYA 1CURA 1GY1A 2TSBA 3NP4A 3WKPA 1XB8A 2JXMA 2DWSA 3FU7B 4X4KA 1JERA 4HCGA 1SHXA 1PLAA 2YAMA 1A4CA 1OCOB 1OF0A 2WSDA 3FU9A 1BQ5A 2BW5A 3NJIA 9PCYA 3JTBA 1KBWA 2PLTA 5I6MA 2BW4A 1JVLA 2PP8A 5ANHA 3FYIB 1ASPA 8PAZA 1ILSA 3FU8A 2ZOOA 4E9VA 4WKXA 4BK5C 2YAEA 1AR1B 3BQVA 1AOZA 1ZDQA 2CJ3A 3NYKA 3IE9A 2XYBA 1SF3A 1YLBB 2XLLA 3T6VA 2ZONA 4E9WA 1ZV2A 1E30A 3IEAA 3QJUB 4BXVA 1NIFA 4QKTA 1PZBA 1AAJA 1PNCA 2HRGA 5I6PA 2IAAC 1PNDA 1NIBA 1ZIAA 2HX8A 1JZIA 4CSZA 3T6WA 3OD3A 1N68A 5I5MA 1E5YA 2PPFA 2HX7A 3S3CB 4AKQA 1PLCA 1VLXA 4A68A 5B1AB 1NDTA 1XMEB 4M3HA 3NJFA 5TK4A 4YSCA 4GP5B 2WO3B 4K9JA 1X9UA 3AG3B 2N0MA 2FQEA 4YVNA 5I28A 1MG2C 4QLWA 2PPAA 3MBWB 4P5RA 2A3TA 2QT6A 3HB3B 3NSDA 2FJSA 2IWFA 2UXTA 2AVFA 1ASQA 1BQRA 1URIA 1PCSA 3CDZA 3TBCA 4DPAX 1CC3A 1M57B 3OMAB 1AZBA 4JKNA 1JZHA 1UATA 3FQYA 5AFAA 3SBPA 3AZUA 1RZQA 5B1JC 1FFTB 4YSUA 2W8CA 4JHUA 2FTAA 1PZAA 5D4IA 2XXGA 4UF7C 4DPCX 4BWWA 1GYCA 1PF3A 1NICA 1OCCB 3WNJA 1OE3A 2PP7A 5B7EA 3NSCA 1V55B 3X1GA 4A2HA 4YSTA 4DP6X 2EILB 2Y69B 2FT7A 3PCYA 1SF5A 4M4RB 1CYWA 2VSKB 1OCRB 2XV2A 2GHZA 2VW4A 1JZJA 2BHFA 1ET8A 2GI0A 4N8UA 3FS9A 1X9RA 2HX9A 2ZWNA 5I6LA 1GSKA 4W1TA 3BVDB 2FNWA 1WA0X 4KNSA 1BQKA 4PCYA 4BDVA 4ZK8A 1M9WA 2OV0A 2XV3A 2OCCB 3OQRA 1DYZA 5B1JA 1L9TA 4E9YA 2H3XC 2BP0A 1QHQA 2MTAA 1CYXA 1RZPA 5TK2A 2BZCA 3TU6A 3QJQB 5A7EA 3OMNB 2YXWA 1A8ZA 1GY2A 4AI7A 3ERXA 2QPDB 3G5WA 4YSRA 1ILUA 2XX1A 1TEFA 1V10A 2UX7A 4Q8BA 2YQBA 4TXVB 1XB3A 4E9QA 5E9NA 1L9RA 2IDSA 1RCYA 1W6WA 4GXFA 1OV8A 1PY0A 1BEXA 1J9TA 3T9WA 2EIKB 4UANA 1HFUA 3D12B 4CSPA 3X1EA 1NPJA 1CUOA 2BP8B 1GS6X 1KDIA 1W8EA 1JXFA 1BXAA 1NZRA 1TU2A 1NINA 1EZLA 5FC9A 4DP7X 1AANA 2UXVA 2FQDA 3OMIB 1JVOA 2BWIA 1OOWA 2X88A 4AZUA 1AG6A 4HAKA 2P80D 2FWLB 2B08A 2YAFA 4A2GA 2DY2A 4KOCA 1JZEA 1A4BA 2DYSB 4GP4B 1MG3C 1J9SA 2FT6A 1GS8A 3PLYA 4KO5A 3QJTB 1KCWA 2J5WA 3EH4B 1AACA 2XX0A 3MX0B 1FA4A 4KOBA 3AG1B 1ETJA 2I85A 4HCIA 5F7AA 3FT0A 2IDUA 1E67A 1J5DA 1KBVA 2EINB 3H56A 1A65A 3UACA 3S8GB 3NJJA 3UAEA 3ZBMA 3KW8A 1GW0A 4KNUA 5I5IA 3T71A 3FQ2A 3NP3A 3AW5A 1AS8A 2E86A 1R1CA 1NIAA 2YAHA 3CVBA 4UAHA 3NJLA 2PPCA 1WA2X 5I5JA 2IDFA 3FPYA 3T6XA 3FQ1A 4G70B 3ZDWA 4AKOA 1AQ8A 1ET5A 4JHVA 1IUZA 3N55A 2EIMB 2PCYA 1JZGA 2AZUA 3ABMB 1MZYA 1OCZB 3GDCA 4KNTA 3PAUA 2QDWA 3QJRB 3QQXA 5I6OA 3FSWA 4BXSV 1WS8A 2IH9A 3FSAA 4F2EA 2CUAA 2ZXWB 3X2QB 4YVUA 3PPSA 2R7EA 1AZRA 2VN3A 5IY5B 1ADWA 2W88A 4BWUA 2PP9A 1J5CA 4FAAB 3IN0A 1SFHA 3FYEB 4BWTA 3UADA 4DP4X 2DV6A 1RKRA 1ID2A 2XU9A 3CZUB 3CVDA 3V9EA 3ZIYA 4HHGA 1BAWA 1AZCA 2CCWA 4AX3A 1AIZA 2NRDA 3JT2A 1PAZA 4F2FA 3SBRA 5D4JA 4AKPA 1DZ0A 3FSZA 4L0PB 4YL4A 3U25A 1OE2A 2HZHA 1SDDA 4A2DA 2IDQA 4E9XA 5LDUA 2GIMA 2XV0A 1BXUA 4NERA 2VM4A 3H4HA 5D4HA 2HXAA 3CG8A 4HIPA 1IBZA 1JXGA 4EF3A 4RH4A 2BZ7A 3SQRA 3TBBA 1PMYA 3EH5B 3UABA 3SBQA 1B3IA 4W9ZA 2I7OA 1JOIA 2VM3A 1TKWA 3QJVB 4G71B 3WG7B 4KO7A 2VW6A 5EHFA 4DP5X 2XWZA 3HEIB 3FPXA 1KV7A 4DP9X 2P80A 2HLEB 3FU7A 3QPKA 3WI9A 1TEGA 4FA7B 1BYPA 1SHWA 2BO0A 3AG2B 2I7SA 2DYRB 2EIJB 2PCFA 2DWTA 3ASNB 1MDAA 3S8FB 3IBOA 5B7FA 2H5UA 2RACA 2UX6A 5B7MA 4NB7A 2Y1AA 5AKRA 2J56A 2BP8A 2GC4C 2PPDA 4F7KA 1PZCA 2LLNA 2Q9OA 1QLEB 1L9QA 2IDTA 4GYBA 5I6NA 1NTDA 1L9SA 4DP0X 2TSAA 4DPBX 4GY4A 2JFCA 1KDJA 1ZIBA 1NIDA 1OE1A 1L9PA 2XUWA 1HAWA 2X87A 2GB2A 4YSQA 3ASOB 1T5KA 2J55A 3NSFA 1W6LA 1A4AA 1NPNA 3OM3B 3AG4B 1IBYA 5I6KA 2UXGA 4G7RB 3X1FA 2XVBA 3IN2A 3L45A 2YAOA 4HALA 1NWPA 3N2JA 2YAPA 5PAZA 4KO9A 3NJKA 4P5SA 2JKWA 4YSPA 3EF4A 1E65A 6PAZA 4YSDA 1ET7A 1IKOP 3WKQA 1SNRA 4YSEA 1ASOA 2YAQA 5B1BB 3UGEA 4YSSA 1XB6A 2Q5BA 1F56A 3NJNA 3PAZA 2FQFA 1EHKB 2QDVA 2YXVA 2B3IA 4A2FA 1AG0A 3ZX1A 1GS7A 1JXDA 1AS7A 2AZAA 3PAVA 3RYMA 1MZZA 4ENZA 4WTQA 3CDZB 3X1BA 1KYAA 3X1NA 3CVCA 4KO6A 3TASA 4GP8B 3C75A 4YSAA 3ABKB 1I53A 3ABLB 2J57A 4HCFA 3NJGA 1WAEA 3EH3B 1V54B 3GXUB 1M56B 1E5ZA 2QPEB 2VW7A 7PCYA 2HRHA 5F7BA 1KCBA 2H47C 2CALA 1PLBA 2OJ1A 3GYRA 1KGYE 2CBPA 2R7EB 2GBAA 1ZPUA 2UXFA 1FWXA 3DIVA 3T6ZA 2IWEA 1QNIA 2AANA 3AY2A 4E9RA 7PAZA 4G7QB 4Q89A 2BWDA 1GR7A 1N70A 2XXFA 1JZFA 5AZUA 1AZUA 2GSMB 1BXVA 4DP1X 5B3SB 3TA4D 3NJHA 1L9OA 4YSOA 3WNIA 4DP2X 4A67A 4A2EA 3S3DB 4E9TA 1IC0A 4HZ1A 3WIAA 1AZNA 4BDVB 2YARA
chains in the Genus database with same CATH superfamily
4XOBA 1D5XA 4R4NC 3N9GH 3BEWB 1YEFL 2RTTA 3PGDA 2MOGA 2QLYA 5CP3H 5E0QA 4FABH 2VO5A 2BP0B 3FN0L 5I1EH 3GZPA 4PJFA 1U8JA 3QAQA 1RLWA 2MCG1 4H1LH 1EFXD 3ABGA 1R3JA 4E0RA 1XGUB 3TEXA 1YJDL 1ZV5A 2EYTB 4ODTL 6PCYA 4R7DB 4XNAA 4DAGH 4XCYB 4B0MM 2J2ZB 1EDQA 1OIOA 5E99L 5JA9A 2A9DA 2W1NA 3DKHA 3N9GL 4G8GB 4JHWH 2NNFA 2ZXEB 4LF3A 4LGPB 2V5TA 5IBLC 2IADB 3D34A 3DGDA 4ZNCD 4FABL 3QZNA 3QXAA 4ZFGH 3CDGB 1XB8A 2DLIA 3G5YA 3QCUH 3CVHH 5I1EL 3PABA 4TQHA 2MCMA 1DO6A 4ONGH 3A21A 5HGAA 3X11A 1B0RB 1GGBH 1PX4A 4IEFB 3QFJD 1UFGA 1EEUA 4IJTA 4LKXA 1G7IB 1BQ5A 4JRXD 4AYBA 4DAGL 4RFNB 4LCWE 2PLTA 3SKNB 2IDCA 3ARBC 4JO5A 1IARB 1JVLA 3APDA 4JHWL 3BFWA 4G8IB 2J1ZA 1XD0A 1I1AD 4JM2A 1CTNA 1OHQA 1W0WB 2EDRA 1YMMA 2WBJB 5KYXB 4ZFGL 5EF0A 2BOBA 5IVXA 3QCUL 3CVHL 3V6OC 4ONGL 3PJSB 2Q3XA 3FOLB 1AGFA 2R8SH 3T0AA 1BP3B 3VMNA 3KBPA 3EJUA 1I8MB 3HAEH 1FL5B 2X0WA 5D1XA 5HYQA 4F9PA 3ULUD 1GYWA 4UT6A 3JYBA 2OXHB 3OD3A 4UMSA 3MRBA 1PAMA 5CGYD 4HF5H 3F3HA 5C09D 4XBPB 2JVUA 1MHHB 4X99A 4A6YB 1HZLA 1ZSDA 3SDYH 5E6YA 4LBEB 3CUPA 3NJXA 5I1JH 2R8SL 2WO3B 4Y2OA 3R4RA 5C3LD 1INQA 4Z3HA 1PU0A 4Y5VC 5J1AB 3QQ4A 4Z7WA 1ZLEA 2WSPA 1NAMH 3AU1B 4UTCA 2WNKA 2Z64C 3HLKA 1EHLH 5E94B 1U8KB 1FNGB 4HF5L 3FQWB 3D51A 1CG9B 3LN5A 5KS9F 3SDYL 3TBCA 2F53D 4M8UA 1M57B 5I1JL 2J25A 4YQXH 2V3DA 1W0VA 1RZQA 4XH2B 5B1JC 3HBZA 5JIPA 1FFOB 4Z7QE 3QDJA 1LL1A 4H2CA 5D4IA 1NAML 4OIBA 2F19H 5IFAH 1NBZB 2J1XA 4G83A 2YD4A 5BRZD 1EHLL 4G80A 3NSCA 4U1NA 2I25N 3UPRA 4A2HA 2BC4A 2MEJB 3O4LE 5F93C 2OSYA 5L8LB 4RWHA 2WLKA 3F7VA 1JRHH 5GGVY 1CDJA 4YQXL 1T0OA 3IM1A 1DVFD 3N85H 3U9PH 4ZFOA 2XV2A 2XQ0A 2P7TA 3BMVA 4PGEA 1KT2A 2F19L 1XR8A 1MWAA 5IFAL 1ET8A 3IVKA 3IU3A 2MJWA 2XIIA 4LPYA 1DVZA 2FIKB 5MHSD 3FT3B 1E9PA 4K94L 1ONQA 3OPZH 2VC2H 3UTPE 3UZQA 1JRHL 1E27A 1D5XB 4DUVA 1G7MA 1JYVA 4LSVH 1OP3K 1UJ3A 4PJ7F 5FCSH 4ETYA 4XMWA 3U9PL 3PGDB 4L1LA 5TK2A 1RZPA 4PJFB 4Y2DC 1R3JB 2HJKA 3UL4A 4E0RB 3CHXA 5A3IC 1KCSH 1BPLB 2LABA 2XTJC 3G5WA 5JR1H 4R0LA 1T80A 3RFRA 4GSXA 1JGIA 2HTLC 1A4JA 3OPZL 4XN1A 3RKPA 2VC2L 4LZKA 4WHCA 1UOLA 4LSVL 4E9QA 1F97A 5HHVH 3VI4B 3KYKH 5JHDB 12E8H 3QXAB 4UANA 1TG8A 2VLRD 2XG5B 3G5YB 4CC4C 2E4TA 3PABB 3TBYA 2R0ZH 2X6BA 3V52H 4LOEA 5HGAB 3X11B 3B34A 3VX1A 2AJXH 4DOHE 3DYOA 1KCSL 2YK1H 2Z8RA 4OI7A 3SDAA 1WF5A 5JR1L 4QPEA 4WO0A 4JNXA 2FJHA 2BS8A 3HW7A 2JKIS 1EZLA 2OMWA 5HHVL 1OAXH 4Z78B 2C3GA 3TN0C 3KYKL 3MJ7B 3AMLA 5F1SA 1PKQB 4JM2B 4PN6A 1MCEA 12E8L 1YMMB 2P5WE 4HH9A 2BOBB 1EVTC 4P23D 2WW8A 5IVXB 2FR4A 5GS2D 2Z31D 2R0ZL 3V52L 3MV01 3K2KA 3ARGC 3B7UX 1QP1A 4PW9A 5JMOC 2AJXL 1ZE3H 2YK1L 1AGFB 1Z3RA 2ZWYA 3K2MC 4A2GA 1JZEA 2V37A 2YBRA 4YBHA 5T3XD 1CXIA 1QOKA 5D1XB 1J0YA 4M7LH 4PRPE 1E42A 4UT6H 4JCMA 2H3KA 4KJWC 1OAXL 4JJOA 1F4WH 1MI5A 3K80A 1YEHH 3U30C 3R8QA 1IAII 2K6WA 1EA9C 1CFQA 3D6GA 4FC3E 1ZRUA 4X99B 3S8GB 3W0WA 3CFKB 1ZTXE 3E2HB 2IANE 2WYZA 3O45A 4Y2OB 5EUOB 4IRJA 4GINA 4FN0A 3QQ4B 4M7LL 4UT6L 1IQDB 5AAWC 3CPLA 1I1YA 3FQRA 1F4WL 2F1BA 3MBXH 3QUYA 1Y18A 3SO5A 3F2LA 5D55A 5C0EB 3WEXB 1GZHC 2LR4A 5CFAA 2DD8H 4OU3A 3LN5B 4OD3H 2PCYA 5C7XH 3QPXH 4OCYH 3PL6A 4JRYE 5IWLC 1AXIB 2QDWA 1W0VB 3PGCA 4JQIH 3VCLA 2IH9A 3S37X 3S5LG 5TJWK 3QDJB 1YEJH 1QFWI 4ANWA 3A67H 4H5SA 1MKFA 3MBXL 1NLDH 2E9GA 1U3JA 3JWDH 1T83C 4G80B 3BLBA 4QWWC 2OYMA 4U1NB 4ZOAA 5K69A 2DD8L 2XKUA 3WKYA 2BC4B 4OD3L 4GQ9H 3UPRB 2WXRA 1F2XK 5C7XL 3QPXL 3H0TA 3V9EA 2ZOUA 3F7VB 4OCYL 4OLZH 2F58H 1MVYA 2A6KB 4OI9A 4I3RH 4U3XA 1TZIA 2K4WA 2GG1A 3AAZA 3L2NA 4JQIL 1XX9C 2BY2A 4NXKA 5JPMC 1YEJL 5CKGA 2W92A 1MWAH 3A67L 4P57A 4S2SA 1KT2B 1XR8B 5C0BE 1EZVY 5LDUA 2ARJA 1NLDL 4MAYD 3IU3B 3JWDL 2GABA 5L0QB 3BQUC 3DPDA 3L4WA 4BUHA 1NUNB 4GQ9L 4JDZB 2QQNH 1EMTH 1ONQB 4ZX3A 3KYNA 3L81A 4IJ3C 4YXHH 3L4UA 4OLZL 4EF3A 1M42A 1E27B 2F58L 5FF6B 1G7MB 1QSEA 5AYUH 1UJ3B 4I3RL 3TBBA 4ZFOL 5T3ZH 2OJZH 1WK0A 5FM4A 3HC2A 1MWAL 5IGXH 4G71B 3QORD 3QUHA 1ED3A 4LSDA 4QXVA 4XE5B 3FPXA 3MU3A 4JFDD 2ZNXA 3IFLH 4PRDA 3TP4A 3VFSA 4R0LB 4GKZA 4GRLD 2BHUA 3JWNE 4YDNA 3QPKA 5G55A 2RJMA 1Q0EA 1EMTL 2MQ3A 1A4JB 4YXHL 2ZOKA 3S9DB 5AYUL 5JZ7D 2GVYA 2I7SA 2QQQA 2E7LA 2P24A 2OJZL 5T3ZL 2PCFA 3L7EA 3SN6N 5AOLA 2VR8A 1HKFA 1R75A 3S97C 5FEBA 4BINA 2RACA 5IGXL 1KTDA 3TBYB 2BIPA 3K8LA 3MRHA 4KRMB 5HHME 3QXWA 5C0CD 3Q48A 2PPDA 4LMQI 4PWEA 4YC2C 4HMEA 5IQNA 3IFLL 4YHYB 3U4AA 2GTZA 3H3BC 4ZMQA 2FJHB 3OLIA 4DPBX 1OWWA 1XH0A 4WFHD 2OMWB 1ZIBA 4JY6A 4JFED 1OLLA 4UUJB 3MUJA 1IEBA 4DESA 2OR9H 2FR4B 4Y16D 4ZQTA 2I9TB 3LB6D 3P9LA 4OZHF 4J8RB 5D2LF 4MJJA 1R19A 2UXGA 5SWZD 5EEXA 5AVRB 4YXKH 1H3XA 4N2FA 4UIMA 3Q8BA 1X9LA 4FULA 4OZIE 1E65A 3ZKXC 4OVUA 1MI5B 3HC4H 5ACZA 5DS8A 4NSKA 2H1LM 2VDOB 2OR9L 3L48A 4CL7A 3T09A 4DGYH 2EXWC 3MV7A 4OI8A 4GMTH 4QTIH 5GS3A 3U2SB 3W0WB 5JPNC 5AL0A 3G9AB 4PJ5A 1HZKA 3SSGA 3O45B 4YXKL 1KB3A 2DEXX 4IRJB 5AW5B 4CC0A 5DJCA 4ENEC 2QVKA 3VRJA 1QTSA 4TUOB 4ENZA 2Z35A 3T2LA 3KLLA 4UV4H 2X10A 3TASA 3ARFC 1I1YB 3FQRB 3HC4L 3AMKA 2BVPA 4F9LA 4LCCC 3QUYB 1Y18B 4ZXBA 4DGYL 3D39D 4ATTA 3BOVA 3DA0A 3J2PA 1KG0A 4GMTL 2YZ8A 4QTIL 1XZWA 1V54B 4POZD 3ECVA 4X6BA 3PL6B 5E0FA 5KSBA 2CXGA 1KMGA 3UCRA 2Y06H 3PGCB 1RPQA 3VCLB 1WC7A 4RGND 4CVXB 3ALXA 5MEQA 1UD2A 1T5XB 4KKCC 2EE6A 3GYRA 1PD1A 1JNJA 4XAKE 1K6QH 2ZG3A 3TS8A 4UV4L 4H5SB 4M6AA 5A6LA 2FH8A 2AJYH 3AY2A 1XGTA 3OZLA 3QUXD 4JPWH 4Z7UA 3VXQB 3RWFA 3IWVA 5A2FA 4I4WA 3AT8A 3H0TB 5B3SB 3BMWA 2P8MA 5EBGA 2D7QA 4PY8J 4POYA 5T1MA 2Y06L 3AAZB 2HUHA 4BK4A 4B53A 1BZOA 5L2JA 4N9OB 2A0LD 2VXSH 3D8MA 4P57B 4AEFA 4S2SB 1K6QL 2YWZA 4FA6A 1OPGL 1QFUH 3MUZ1 2ARJB 3I6SA 2DPKA 2AJYL 4JPWL 4HJIA 1KIRB 3ZRFC 4TYUA 3A23A 43CAA 4DO5A 2OTPA 5F1KC 1OWRM 3IDUA 4NQCA 2VSMB 2DKMA 3KYNB 5IVOA 5LHDA 4NWUH 2ZSVB 5CD5D 5DZNA 5PCYA 4GUCA 2EH8H 1N12A 2F74A 5FDYA 2VXSL 5D5MF 1GGUA 4KZEH 4YHOH 1T0MA 5CEZE 4B3VA 1QFUL 4LVNB 5JIHA 3MN8A 2JCCB 3VFSB 4PRDB 2HSIA 2WWKO 4Z7NE 3ZDYB 1MFVA 3ESMA 1UEYA 2ZOKB 4NWUL 2EDWA 4RISH 3T0EA 3D30A 1BLNA 5JO5A 5EC1A 1A64A 5JQ6H 2BVEA 4J2QA 2GBUA 2EH8L 2PCFB 1MQ8A 1T66C 4B9IA 5I1KH 3GJFK 5D2LA 2ZKXA 4KZEL 1KTDB 5AW3B 4MJIE 1QLRA 4YHOL 2DMGA 4XN9A 4QLRA 4QDGA 3WY2A 4DO4A 3LKRA 2IPUK 1Y7VA 3CXHJ 1GJWA 1PG7H 2K4AA 2OQJA 3UBGA 5D93B 2GTZB 2KLTA 4L0ZA 5IM7A 3IE9A 3WXVH 4RISL 1IM3A 4M62H 1YLBB 3D4GA 3H6JA 5JQ6L 3GMPA 4BXVA 5E5UB 1IEBB 1PZBA 5I1KL 4Z3TA 2HRGA 4QHLB 2WK2A 2R1XA 4V1DD 4URKA 4ZD3H 2AEQH 3NDZE 3HR6A 4Z7QF 3WLWD 4I18A 3SJVD 4CVZA 3TXAA 2F9BT 5D7EA 3QRGH 4LHUG 3CN3A 3DJRA 1PG7L 4UIMB 5JW4M 3L3HA 2AITA 5I8CA 3O9WD 1VLXA 4B5EA 4TNVF 3D25A 3WXVL 2DZEA 3BUIA 3HRZA 3IJ7A 4M62L 1KGCE 2MFNA 1OQOA 4K9JA 3B7YA 2IAMA 4CBZA 3FT1A 5ACZB 5DS8B 4NSKB 2Z34A 3RY6A 3MV11 1CVSC 1MCFA 4ZW7A 1OVZA 3MV7B 4FQ1H 5HDWA 3KM1A 3BPNB 2AEQL 4LPVA 4ZD3L 2A3TA 4PJ5B 4YEEA 3MRCB 3QRGL 4KJPC 1U3HD 4H8VA 1BIHA 1YZZA 4Y4FC 5CN1A 1T7YA 2NY6D 1CXKA 3ZE1E 5IHLB 3TEYA 2Z35B 1U93A 4MA1B 4PS3A 1EDHA 2EE3A 5JUEH 1YC7A 2PWHA 3II3A 4JEGB 2L3BA 3G08A 3IJHA 4ZXBB 5KW9H 3EFDH 3CFDA 1ZLVH 4FQ1L 1U95A 5ESVA 1W16A 3HPJB 3VXOA 3ISRA 5HY9B 4L2YA 5IVZB 4X6BB 3QUZC 3KPNA 3L54A 5KSBB 2A83A 1WFIA 3TBVA 2R83A 1WC7B 3X1GA 5MEQB 3PE9A 1VAHA 3RVTD 4LCWA 4FI7A 3VTMA 4N28A 3GEFA 3GMRA 4L5FH 4RAVB 5JUEL 2KHAA 3HG1A 2V5SA 1XGTB 3NRPA 4Z7UB 5IROA 5KW9L 4P5KA 4GFTB 4YBQD 1KXVA 3EG9A 4AH2B 3MOAH 2WVSA 3AUVA 3VD0A 2JKRM 3GEWB 2BNQB 2VZSA 2KL6A 4F24A 5DWUH 3CSPA 1KCLA 3S6CA 1NGPH 4MJ6A 5KJ4A 1YUKB 4ZFZA 4M6MH 3VXUD 2WKGA 3QXUA 5L2JB 1JPST 2JJVA 1A3RH 4DZ8A 1BQKA 4BDVA 5BPPA 4HCRH 1G9HA 4XMLH 4HWBA 1M9WA 4L5FL 1DL7H 4HT1H 2OCCB 4X0KA 3PRZA 4U3SB 5CJ8A 1KB9K 4U6XA 3WUWA 43CAB 1VFUA 1XEUA 4JPKH 4NN7B 3DGCR 4QRRD 4NQCB 1C8PA 3NZSA 4P49A 4OM0H 5GJTH 5DWUL 5K59F 1NGPL 4WTZG 4F8OA 4ZFFA 1P4LA 2R9HD 5I1LA 5IK3A 5F6IB 1CICA 1AYOA 1A3RL 2F74B 1DR9A 4HCRL 4TXVB 4XMLL 2IV9A 1T0MB 1DL7L 4FYRA 4ZQKA 4HT1L 2LU5A 5E4IA 3NTCH 1PJWA 3KL0A 5ETUA 4JG0H 1H3PH 5KSVA 4JPKL 4L9LC 4N0UB 1VADA 3TWCH 5JOFA 4OM0L 1DLFL 3QG6A 5GJTL 4XO3A 1KGJA 2BP8B 2QFPA 1BLNB 5JO5B 5EC1B 4WO4D 5DWPA 2N7SA 3T2NH 4G6FB 2E56A 3GKZA 4K5NA 1WISA 1TU2A 5DDHA 4NUJA 2B39A 1JF6A 3P9MB 1QLRB 4QRTA 4UZUA 4KQ0A 2VRKA 5H94A 3NTCL 4U49A 1F00I 3QAZC 5K1VA 5MEOB 4PJCB 1FSKB 1IE4A 3MBED 4JG0L 1H3PL 5AW0B 1JJUA 2OQJB 1J1XH 3TWCL 5IM7B 5JXAH 2CR6A 3O4LA 3Q9QA 1TCRA 3V4UH 5C2BH 2W0FB 5FYKH 2ICWJ 3GMPB 2YAFA 4JL2A 4ACPA 3VXNA 2DY2A 4KOCA 1MF2H 2X4RA 4WY7H 3T2NL 2D4FA 2VR6A 3GBML 2R1XB 1QZNA 1IZJA 2O72A 1ZVYA 3HHMA 4D7BA 1OP4A 3SKJH 4JB9H 2JQZA 4I18B 4CVZB 1RVFH 5I74C 2I85A 3L3HB 4AZ8A 4UM9B 5JHMA 3II2A 3KCWA 1J1XL 4X9IA 5DJDA 5JXAL 1DLHA 2H6UA 5C2BL 1QWNA 5FYKL 5JMRA 1CL7H 4P59L 1MF2L 4QRPE 4WY7L 1KYOK 3WXWH 1QEWA 3NGBC 1LJMA 2YAHA 5HPMA 2UUDK 3I9AA 5J0BA 2PPCA 3RKDC 3FQ1A 2NXZB 3SKJL 4JB9L 3TZVC 3TL5A 2COVD 4QHMA 1RVFL 3ZU8A 1ZLUK 4W6XB 4YHMH 2Z1PA 2ORBH 2EIMB 2JIXA 2EXSA 3KPPA 4PRHD 1RZ8A 1UTDA 1CL7L 3MJ6A 5MERA 3L5HA 3NACH 2JJWA 3L4YA 1H6EA 1YDPA 4G7VH 3WXWL 5T1JA 1NA8A 1VEOA 3N5AA 2Z8SA 1F2QA 1U95B 3PPSA 3TIEA 4GW5A 3VXOB 2CLZA 4HS3A 3U7WH 3WV0A 2R1WA 3KPNB 4HISA 4L1HA 2A83B 3OGOE 4YHML 3IN0A 3TBVB 4MSWA 2P49B 1RZIA 3FYEB 1KGIA 1T2XA 3U6XA 3VYOA 4KXZI 2VN6A 3G04A 1EQWA 3OZKA 4LCWB 1BBDH 4W4NA 4OD1H 3O41A 3HG1B 4Z18A 3NACL 1DSFH 2HVBA 4G7VL 1BVNT 1A22B 3FO1A 5HYJE 1MFCH 1DZ0A 2P5WA 5C0FA 5FGCB 4E9XA 4JL1A 3U7WL 5DK0A 4ZOCA 3GD1C 1U36A 3LKPA 3UJJH 1LNUB 3MYJA 1I31A 4LCYA 1A6WH 4NCC1 5DD5H 1BBDL 3HN5A 3ESNA 4PRPA 3ENEA 4OD1L 4YUEH 1LO3H 4X0KB 3RVWD 1DSFL 5E08H 4U6XB 3W9EA 1ZA3A 1MFCL 3AWEA 3MLTB 5F1IA 1TKWA 2D8KA 2YA1A 3QJVB 3BZEA 1DJWA 2N7BA 4HGMA 2XWZA 2ALAA 2EE9A 4JFFD 1NCNA 1P4LB 4OQTA 3UJJL 4M1CC 5IK3B 2IANA 5I1LB 2EIDA 4NC2B 1A6WL 2F5AH 1FLTX 5DD5L 2W9EH 4BFKA 1M7IA 4FQJH 4XWOD 4LLWA 4ZQKB 4YUEL 4PJHF 1LO3L 3GXTA 3CH1A 1AC6A 4WFGD 5E08L 2Z8WC 5BV7H 1I85C 5ETUB 2FWSA 2G2RA 1DDHA 1UVQA 1VADB 5CXPA 5CIPA 1AKPA 3NSXA 5JOFB 5KUKA 5JIDA 3L9RB 2XWCA 3FDWA 4G11A 2XQYA 3FTVA 1E90A 1HQRA 5INCA 5B21A 2AW2A 1E8YA 5C9JA 1JVKA 1QLEB 4JRYA 5E6RB 4FERA 1DE4A 1TU2B 1NTDA 4JVPA 3EJRA 2F5AL 4NUJB 5DDHB 2W9EL 4ZMLA 4HUXB 5AB2A 3HJEA 4FQJL 5CP7B 4QRTB 3DGGA 1WZAA 1MRCH 5CJQH 5H94B 2F15A 2J6WA 1U3YA 2Q2LA 1ECYA 4MXVE 5BV7L 4NKQB 5HDBE 3UAFA 3HS9A 4IBLT 1W6LA 3MCKA 3OM3B 3O4LB 3E1F1 3HZKB 2VZVA 2YD7A 4NJ9H 5E8PA 2BP5M 2XZAH 2GJJA 2ZKHH 2CJSA 5HHOD 3VXNB 3EH1A 2X4RB 4AMKH 3F05A 1JZ2A 4QIRA 3DWTA 3VQMA 4L37B 4O02A 1TQUA 3HE6D 1IAKA 4FFWC 3WKQA 5CJQL 5C0BA 1CLOH 3OAYH 4HJGA 5AVZB 5KAQF 3T6QC 3UGEA 4A7TA 5JOPD 4AZ8B 1L0QA 1UZ8A 4BD4A 5DJDB 4F33A 1CT8A 1DLHB 1KY7A 3QZWA 4L4JA 4NJ9L 4Q58C 4Z9KB 1CE6A 2V8MA 2XZAL 5C0AD 3D33A 4AWJC 1AQKH 1RHFA 4IKIA 2ZKHL 3RGVA 3V4VA 5IV2A 4AMKL 2NUPA 1UEMA 2Y7NA 2MQ0A 5HPMB 2ENSA 2VDPH 4WHYG 3X1BA 1E8XA 3FCSA 5FWQA 3T0DA 3V6FA 5GQBA 1CLOL 4GIAA 1A6AB 3ABLB 4HCFA 2ZXAA 4EZJA 1BREA 4QUOA 5T1DL 1WAEA 4WTXA 2WJ7A 3K72B 3KPPB 1QFHA 1RZ8B 2CBMA 2E46A 2V7HA 3HVDA 4RQQB 3TA3A 1AQKL 2P9RA 5MERB 1DVUA 3CCHA 3KPSD 2AKRA 3GHBH 4JKKA 1YDPB 3EXLA 1Z9SA 4CMHC 3ZTJH 1NCBH 1KGYE 5JW4Q 1LWHA 2VDPL 5DK3A 3P2TA 3IPBA 4HS3B 4N5UA 4YHKH 4NO2A 2R1WB 2D3JA 4ZUWA 4DOHB 4G7QB 5FHBH 2G4EA 4MSWB 1RZIB 4KV5F 3DOSB 2D31A 4P2QD 4Y88A 5T5NG 3G04B 5K39A 2QADC 5GS0H 1Y6NR 4IK6A 5AVUB 2CPUA 4A7GF 1ROCA 4A2EA 4N6RA 3GHBL 4HK0A 2BLFA 2F2HA 3EOBA 4QNPF 1NCBL 3A6OA 2P5WB 5D6DA 5C0FB 4M5ZH 3TFKC 4FZ8L 2A74A 5DK0B 4YHKL 2I60H 5HGGS 1THCA 2DH3A 4AYFA 4Z0XA 1YEGH 4HWZA 4N0YH 3MYJB 5FHBL 3ZHFA 3B9KC 4KX7A 3AT0A 2AI0H 3ILEA 1E0OB 2ZX9A 5EA0H 4LCYB 5KSAC 4F7TA 3S36H 5GS0L 4OZIA 4TQ8A 1JRHI 3PP4H 4MFHA 1O6SA 1Q9WA 4PRPB 1Q1PA 2FJGB 1T0PB 1QAWA 3AXLA 2WWKT 4E9SA 3T0VA 1HAUA 1ZA3B 3AWGA 4JFQA 4AQ8C 5F1IB 4M5ZL 3BZEB 1I1CA 4P46A 1C5DA 1A5FH 1UUSA 5IBUB 5J5EA 3U6RA 1NCWL 2I60L 4TNGA 4AENB 1ZTXH 2W0PA 4HEPA 4U4IA 5FA4B 1YEGL 4N0YL 5KVEE 4JRWA 2IANB 1I8KA 2NQ3A 4PFEA 5EA0L 1CI3M 5HVHB 3S36L 3PP4L 2AXGA 1HXMA 1M7IB 1M53A 4AV0A 2EUVA 2BVUA 4LLWB 3VAEA 5CILH 2WWNA 3CH1B 4E5XA 2BW5A 1GXEA 3KPMB 5I1IH 1U2HA 3MNDA 3CXDH 1DDHB 1UVQB 5ANHA 1ASPA 5CIPB 1A5FL 1WUZA 2O6PA 4PG2C 2KBGA 4YXLH 1I8IA 1ZTXL 1HQRB 2A6JA 5INCB 3GSVA 3R06A 3TNMA 1C7TA 2YAEA 1F4XH 3F01A 4FXTA 1AOZA 2NYZA 2HG5A 4Q6IB 2YSSA 2O1AA 3RNKA 1CXFA 4DH2A 1CJYA 1HESA 3ZZ1A 5CILL 3DGGB 2EICA 4D9QE 5I1IL 2CR3A 1OB1B 3CXDL 3MCKB 4GKSA 4GUOA 4AXWA 5DZ9A 5IBUG 5AOZA 1XH1A 2NQCA 4YXLL 5E8PB 4LRNH 3ZE0E 5D7KD 1F4XL 1GRWA 4O02H 4D9RE 2KZWA 3PXJA 5KYYB 1NDTA 1EFQA 2QTVA 5C0ND 1WVZA 1S3KH 5IW3A 3NJFA 2CIKB 5TK4A 5AD0A 4IBSA 5C0BB 4XP9H 5C3IA 1REIA 1X9UA 2G9HA 3DVGA 1F3JB 1GVIA 1T5WA 4KHTH 4QLWA 3DX7B 4M02A 4F33B 1QPKA 3QZWB 2FD6H 1CE6B 3V4VH 1AIFA 4LRNL 2UXTA 1FHGA 3RGVB 2GFBB 5IV2B 4O02L 3C5ZA 3BVUA 5IIEB 1S3KL 3FCSB 2HWZH 4WV1A 1F5WA 5GGRY 5C08B 3V6FB 1P0SE 4XP9L 5EPMA 4W9KC 1Z3GL 3V7AG 3IDMA 3WKNA 5G2NA 4KHTL 3QFGA 5LXVA 3X14B 3BSZH 3GSUB 4A7GA 2FD6L 5JHBA 5M7QA 3RFZA 2HT2D 4L4VE 3TA3B 4U7MA 3R7RA 3V4VL 3APNA 2YRLA 1UA3A 2Q3ZA 3AXIA 3HOGA 2AKRB 3FONA 1Z9SB 4KDVA 3ESVF 3FCBA 4MCNA 32C2A 2BOLA 3TJPA 4MJIA 5HHMB 4ZUWB 3WTYA 4Y9FA 1OCRB 3HS0A 4MQ7A 2V3EA 3TJHC 1OT4A 4C83A 2BHFA 1A1OB 1GC1C 3BSZL 5K39B 3PQYD 1E9OA 2WSKA 1OW0C 3D2TA 1UADC 4NQUA 2IBZY 1JZ7A 2HMIC 3RB7A 1R3HB 3MRKA 4HK0B 2XI9A 3EOBB 3KNBA 1LO2H 4GW1A 4PCYA 5AALA 2N1KA 5AZ2H 5DQ9A 2A74B 3G6DH 3VXME 2BDNH 4PS7A 3P2DA 2L4OA 4Z0XB 1G1CA 2KS0A 4HWZB 3ULSA 4G59C 3RVXD 2OI9C 4F7TB 2WINA 4OZIB 1OY3B 5BMFH 1Q9WB 2X4NA 2KDGA 2HT3D 2UWEE 4JG1H 4DK3A 4DQAA 1LO2L 1UXSA 2Y9RT 4PREA 4JFQB 4Q8BA 5AZ2L 4IHOA 4NO0D 5C0IA 4P46B 1C5DB 1SDYA 5K1NA 3U6RB 2VERA 4RBPH 2BDNL 4GEJA 1AO7D 2H9GA 3RX9A 1T0NA 3WJLC 4PPTA 2WTRB 1I8KB 2NY1D 4APQA 4DHLA 2AXGB 1HXMB 5BMFL 5HBBA 1KDIA 1LK3H 1PZ2A 3GXDA 4JG1L 2XBDA 3FO9A 4J7RA 4E5XB 1BXAA 2FYYA 3OQ3B 3OWEA 3LKOA 2WYTA 4UQEA 4HOWA 2IGLA 5K9OA 1U8IA 2K7PA 1F4AA 4X5WA 1BZDA 5SX5K 3DX8B 2GEQA 2VXQA 1I8IB 4D3CH 5HJDA 5LQBH 3ZL1A 3VDAA 1ND0A 3TNMB 4JGNA 5M94B 1K5WA 5F7EH 5FYKU 2J8OA 2HG5B 2HA1A 2X2JA 2VE6A 2YFOA 4YK4B 5T8IA 3MLWH 5TH2B 1B6DA 2NTFA 1LK3L 1F3DH 5BW7C 1HH9A 3V95A 5AYQA 5H4ZA 1I7RB 2X1QA 3RDTA 5JHDD 4O5LH 4UB0H 1TETH 1A6ZA 2AK4B 2OMTA 3MACH 3BGAA 2DI9A 4AXWB 1KB5B 2PO6B 4HJ0D 2DM4A 4D3CL 3ATBA 5HVFB 5LQBL 3RTLA 5KVDE 3HHSA 4J3OF 1HSBB 5D1ZA 3OKEA 4Z77A 2A6DA 1LXMA 1OP5K 4PEEA 3ZUCA 2OZ4A 2UV3A 3BGFB 3MLWL 4N90E 4U7SA 5IG7B 5AD0B 3LRKA 3KPOA 1INEH 1YJDC 5SV3A 2X1OA 3DVGB 4FCAA 3MUHL 4JK0D 1M7XA 4O5LL 1T5WB 1TETL 3MACL 4UB0L 3SO3C 3ZJAA 4JM0A 1NFAA 1LO0H 2FHBA 2VDRH 1B6UA 5C0DB 2WYIA 4PP1D 4AIZA 4MHHI 1OAKL 3FU5A 1UWGH 1BQHB 4KVNH 4P2RD 4MKMA 4XGZA 4QY8A 5E51A 3ZTNH 1OCZB 2YD9A 3C5ZB 5DQDH 4WV1B 5D1XD 4U1GB 4HJTA 4LPTA 1INEL 5EPMB 3AC0A 3BYYA 2X4QA 4PY8I 4BUQA 4DEUA 3IDMB 2VZ3A 3AJ7A 4H0GA 3RZWA 5IHHA 4Z7NB 4MHHG 1LO0L 3NSJA 2PXYD 2VDRL 4GKNB 4PSRA 2JV6A 4KVNL 3NJVA 1UWGL 4FAAB 5DMKB 1TJIH 4C54A 5AKSA 3FONB 2K78A 2VQ1A 1BG9A 2AQ3A 5A2IH 5C6TH 3ZTNL 1FZJB 1ID2A 1X5AA 1SMDA 3CVDA 1HNYA 5DQDL 3ELAT 2OKMA 4NX0A 4MJIB 4XNZB 3QO0A 2X6MA 4H26B 4LPXA 2NRDA 5J3HC 1XGRB 3SGKA 4RFNC 3VA2C 3QWQB 2ROYA 4LOUD 4MQ7B 5D4JA 1NCJA 4NT6A 4CGUB 3MJ8A 1OE2A 4JMXA 1E9OB 2YN3A 5EU4B 4A2DA 1UOWA 3KWWA 4K3DH 2WBJC 1NKOA 3MRKB 2HVKA 1E4JA 1TJIL 4A2MA 3KNBB 4GW1B 5D7IE 3VYPA 5C6TL 4BE6A 4KDTC 3ECBA 5T33H 5IF0B 1J5HA 2L8AA 2FGZA 4YPJA 4YN3A 1EZVX 1JOIA 3ULSB 3TBTA 4UQIM 4KUCD 5CBEB 3K6SB 4UT7H 3WG7B 4NOBA 2ZOLB 2H2PC 4MXVF 5C0GA 2WINB 4IKNA 4AVIA 2XKNA 1OF2A 2X4NB 4K3DL 1N10A 2XA3A 1NFIA 1USZA 2ADYA 2P80A 3WCYA 1UXSB 4PREB 4QRPA 1S4IA 3CC5A 3PHQA 5T33L 4XVJH 1XR9A 2H9GB 2Z7UA 1T0NB 2F61A 4HOXA 3CU7A 1TZ8A 4K7FA 4UT7L 1J1OH 4WWPA 1JZDC 4APQB 4WWKA 3ZE1B 3UMTA 3N43F 5I8OH 1PZDA 4FLOA 3FO9B 4RDQG 3LH8A 5L2KE 3LKOB 4KKBD 1L9SA 4QHUA 3PV6A 1U8IB 4X5WB 5DYOA 5K9OB 1T03H 2VXQH 3EKCA 3WNLA 4XVJL 2EDNA 3NCFB 1CXLA 1ND0B 3FQTB 3IT8D 1TQCB 2QGDA 4OJCA 1J1OL 3K8KA 4FQQA 5T1LA 1BJ1J 1QSFE 2HFTA 4BUGA 3MR9B 3T3ME 2NTFB 5I8OL 3N04A 2B5IB 4PJ9C 1HH9B 4P5SA 1NMCB 2O93L 4OUUB 3FRPG 3B43A 3RDTB 5HYJA 2OMTB 4NFCA 4K94C 2VXQL 1T03L 3QEHA 4QT5A 4Y5XA 2VN5A 3HHSB 5D1ZB 2BSSA 4Z77B 2AAAA 5JYLA 2A6DB 1GMIA 4HIIA 4JGUA 5GGRA 3O2VH 1C1EH 4WGWB 4A2FA 2WLMA 1I9RL 5T1KD 2F08A 4HFWA 2NQDA 4XAWH 3JT0A 4Y4KC 3RWEA 3HAEG 4Z95H 3ZMNA 7FABH 3MV9D 3X1NA 2KLRA 1DBAH 3GSXA 3QI9B 4FYTA 3IMTA 1MCPH 1EJOH 2QVMA 4AIZB 3HC0B 2R69A 5FX3A 4FLRA 4XGZB 4TQPA 4QY8B 3RWDB 5INDA 1NEPA 1C1EL 2DKUA 1OALA 4CC1A 2H6PB 5DO2C 2A9MH 1IGTA 4XO8A 4WWNA 2W94A 3F04A 3IJ9A 3GZQA 1FF5A 2ERJC 4XAWL 2BIHA 3K0YA 4M48H 4NOFA 3IJYB 1RP8A 1DVSA 4Z95L 5KYUA 3BIBX 7FABL 3GINA 3LVEA 1UT1A 1CD8A 1DBAL 4GLRH 1FWXA 4AJ0A 4BSVA 3Q1EA 4ZW8A 1MCPL 1EJOL 3BT2H 1QRNB 1MUJB 3OLGA 3UEZA 4BELD 4E9RA 3MREB 4MVBC 1O9VA 1IV8A 2P28B 2VQ1B 1AZUA 1BXVA 4PVMA 1JYNA 2A9ML 3NJHA 2CPCA 3QO0B 5C70A 3GSQA 3HE7D 4M48L 2AEPH 1TLMA 4J3WA 4FQXD 2E4FA 1SLVA 5F7DA 1EV2E 3UYPA 3DVNB 1J8HE 1NCIA 3BT2L 2D0HA 3KWWB 4Y1SA 4JM2C 3PIQB 1J86A 4M93B 2PR9A 2IQAA 4L3EB 2C9XA 3BUPA 3ECBB 5EZIH 1ZE3C 2FIRT 4OTXH 2AEPL 4PJ8A 4WSJA 2WIMA 3K2UH 1CK0H 4NI3A 3H42H 3K6NA 1ZGLP 4F9PC 4I2XE 4HXAH 5AZEH 4R7NA 2IWKA 3CX5J 3MCLH 5SWSB 1ADQH 3S5ZA 3FMGH 1QTYT 2FHFA 4QRPB 1RY7B 2VDNH 3MLXH 4W6WB 4ZO6A 4PI0A 3FUFA 3P02A 3KGTA 3PHQB 4XPAL 4BKTC 4IDJH 2VABB 1OCOB 4NM4H 1Z0MA 5EZIL 4OTXL 4PUBH 3MXVH 3EYQD 4C47A 3WN5A 3CV5A 3VQ1C 2BW4A 3IJSA 1VFBA 1CK0L 2PP8A 3H42L 1I4FA 3IMSA 3K2UL 4K7FB 4S11A 5G5DA 4UCFA 5AZEL 2KYIA 1ILSA 3WTUA 1XFPA 1IBGH 2MQCA 4CU7A 1TVHA 2XHNA 3MCLL 3JV6B 3PXHA 4NIYE 2YFNA 4M00A 1ADQL 3FMGL 1TNNA 3SDXF 1JP5A 2CJ3A 3D4ZA 4HA1A 2VDNL 2RMNA 3MLXL 3PV6B 4J3OH 5DYOB 1K8DA 4P9HH 4IDJL 3CSFA 4NM4L 1ZV2A 4PUBL 3QFJE 2FO8A 3MXVL 5ECJE 1KENH 4JRXE 4YHLL 1N2RA 5D7JA 3BVNA 4LHUD 5DJAA 5I8EB 3QDMB 1BXXA 3JWOH 4DSYA 1JZIA 3R4DA 4FQQB 4NAQA 5T1LB 3EGSA 5I5MA 3SCMB 1IBGL 2YD5A 1RI8A 2XWDA 4BZ2A 1MFAH 1TR7A 2AXFB 3R1GH 4LPUA 3F7LA 4KI1A 3QHTC 4WI6A 2OZNA 2OSWA 2XV6B 4IRSD 4P9HL 5JW3H 4DT2A 3L3JA 2O61A 2IJ0C 4GB9A 3DOHA 1KENL 3BIKA 3ZMEA 3WTSA 4P5MA 1XF3B 1MG2C 2G5UA 5GGRB 2YEQA 3JWOL 1HK6A 4P5RA 4XMPH 1DQJA 3QEUA 3ULUE 1TSHA 2QT6A 3HB3B 1CDHA 2X2HA 4MWFA 3SY0A 2FJSA 4HFWB 4C4BA 4BCZA 1MFAL 3IU4H 2CU9A 3P0GB 3AQXA 3R1GL 5L0QC 1YVLA 4ODXA 5C09E 4FNPA 2YEVB 3WY4A 4HGWA 1RUKH 4PW3A 2VR9A 4PRAA 4UNVA 5JW3L 4ZFQA 1BF2A 4W4OA 3PWUA 1UJ3C 2R69H 5E5LA 2YUVA 3M6DA 3QQ9D 1UA6H 2ZTBA 5KZCD 4FQHA 4AEIH 5IB1A 5FFOA 1IAIM 4XMPL 4MB4A 3L7FA 1VRSA 1IX2A 1UACH 3JVGA 3QCTH 3BUDA 1PF3A 1CL7I 3CU1A 3IU4L 3NG5A 2ALWA 4R0LC 2UY7A 5KYUB 1RUKL 2UWEF 3BH9A 4BGDA 1E2WA 2F53E 3D0LB 5A2BA 1OQXA 2R69L 1IJ9A 4HPYH 1KCRH 3S4SB 1UA6L 2GHZA 4HOMA 3VD5A 4AEIL 4M9OA 3V5HA 3Q7JA 1I7UB 4N8UA 4PLKC 1UACL 3QCTL 3FS9A 1N19A 4LRIA 3SDAC 2EDLA 5BRZE 1SXAA 4UU9A 4WCYH 5HDBB 5AAPA 3B5TA 1QFWM 1XHHA 3F7RA 4ZXBD 5F7DB 4HPYL 5ABDE 4GMSH 2H3XC 2IQAB 2A5UA 4N22A 5EFIB 1BVZA 2EVGA 3RWJA 4AVJA 1BEYL 1X4ZA 4MQXD 1RV6X 1KCVL 4MXQD 4YDMA 1NCOA 1XIWD 4IBVA 2X89A 3ZRSA 1F42A 2UZYB 3OMNB 3EOYG 4NPYA 2YUWA 5CR1A 4OZ4B 1BAGA 4KH9A 5MHSE 2PW2A 4WCYL 5IHBA 2H0JA 1AD0A 3LHPH 4QOKD 4DTGH 5DJYA 1K4CB 1OV8A 5BUGA 4GMSL 2BNQD 3T9WA 5KVGE 3KS0H 4OFIA 4IGBD 3SDCB 5HYIA 5FWRA 5MEND 3W11D 3RVVD 1OL0A 5IW1A 1U8LA 2AHIA 4PHXA 1C9SA 3ZW3A 2B3RA 3ECUA 5AW9B 1LK2A 3ATFA 1HVXA 4N2DA 4IRJC 3WN5B 1WWCA 1VFBB 3TX4A 3M7OA 3W3BA 3Q05A 3LHPL 4DTGL 2XFXA 2UXVA 3QJHB 4NP9A 5BVPH 4KRPB 4H25A 3T8XA 3H2WA 3QUYC 4L4VA 1H3GA 4TUUA 5KBNC 2VLRE 5GGTA 5J8OA 3OHMB 4U2YA 4YIQA 1OARH 4TNWF 1K8DB 3DO7A 4J1UA 4BKLA 4EI5D 3PL6C 2XDHA 1OSPH 2B08A 2QSVA 5A2CA 1HYSD 4OFYD 1N2RB 4FXLA 4KO5A 3BVNB 5FB8A 4HWUA 5DJAB 4G6KH 5J12C 5BVPL 1TO4A 4L48A 2D03H 4LVHC 4BZ2H 2APVA 2J5LB 1S7QB 1DUYB 3WMQA 1XCQA 2JH2A 3KH3A 1E67A 3BT0A 2K7QA 3H56A 3O2DH 3GXIA 3NJJA 3ZBMA 4G6FD 1VSCA 2VDMB 1OARL 1AR1D 2FJUB 5G4OA 1P84K 3KS0J 1OSPL 4YBLB 1LILA 3L3JB 4U1IA 2O61B 3FQ2A 2AQQA 1IGJA 2ATPA 2BWQA 3VXMA 3BIKB 1Q90A 3VI3F 3SOTA 4P5MB 4UAHA 4GAAA 2EVHA 1Q9KA 3TO2A 5T3XE 2VDLH 4G6KL 4HKZA 5K9QI 3MRDA 5CGBA 2VDLB 3GM8A 3RILA 4BZ2L 2D03L 4MWFB 1BMGA 3NK3A 3SY0B 4RMUA 2GSGA 4ODXB 4KBPA 1FZKB 3CNKA 4RSVA 3O2DL 5D7LA 4OAWA 2P5PA 1YO4A 2VAJA 3NZ8B 4HGWB 4PRAB 3MCYA 3S35X 4JRFA 3PAUA 3PWUB 1VZHA 4YHNA 5FO2A 1RJCA 4N8VG 5EF3A 2CUAA 2ZXCA 4FQHB 4OGZA 1PZ5A 5IB1B 2Q10A 2VDLL 2YA0A 4JFXA 2Y7QA 5IY5B 5ICZB 3L7FB 3P3TA 2CUMA 4UM9D 3TPUA 4LVNC 4BWUA 1SFHA 3CXFA 4UV7H 5BOPA 2EDTA 2CUHA 1PX8A 2UY7B 1Z2KA 1R24A 2DQFA 2AJSH 1OXYA 4HV8A 1YPZB 2FK9A 3BH9B 1BAWA 5C0JA 3BP7A 4U6VH 4UZGA 2EVFA 2H1XA 1AIZA 4M4RA 4YE4H 1VB9A 4IIQA 2E7LC 3JT2A 4GKOA 2CRZA 3DO4A 4K5OA 3RX7A 3ILQD 3S96A 1JNHA 1TYJA 4WRLA 4L0PB 3OKDB 4R9HA 1UWXH 1UKQA 1H9VA 5B22A 2CK0H 1BOGA 1BXUA 2AAVA 3KLSA 2N56A 4TULH 4UV7L 2WLHA 4TLTA 5DZPA 1ETA1 4UU9B 3EFOA 2AJSL 4KTGA 3GT6A 4U6VL 2TAAA 3NQKA 3UABA 4YE4L 3SBQA 1KYFA 4W9ZA 1OP9A 4N20A 2Y4SA 4KJQD 3RWGA 3BCDA 3ZE0B 1EHXA 3N91A 4IRZH 3RWJB 2E47A 2VW6A 3D69A 2WXNA 2CK0L 4TULL 1CB4A 1AQMA 2VUYA 3HG1D 1BJMA 2PW2B 1BYPA 1G7JB 3RE0A 5GZOA 4QCIA 1K5NA 3A24A 2J72A 3T77B 1AD0B 1H3TA 3UJTH 3HN3A 5LVEA 2NY2B 3UDWA 5HHPA 4E41D 5LGJB 1NMAH 2H5UA 4MMXA 1LD9A 1ZJAA 2IBBA 4IRZL 2QGBA 2NY3C 3AXHA 4JCLA 1U8LB 4XRCA 5IW1B 2WZ0A 5D6CB 5CSZB 3KMDA 4MZ2A 4X6CE 1LK2B 2XN9D 4RMRA 5IOKA 4JFDE 3FRUA 1MW2A 1A6VH 4L18A 4ERSH 3UJTL 4MA1C 4UOJA 2PNDA 5FM5M 2H0EA 4H25B 4MLSA 4X8CA 4F9LC 1D2PA 4L4VB 3T8XB 1NMAL 3ASOB 3PJNA 5IEKA 2E74C 4TSAH 3KBEA 2CBTA 2P1YA 4YIQB 1O7SA 3DO7B 4J1UB 4XI5D 1DJYA 1HJBC 4KXBA 3I74A 2GKIA 4P4RA 4UBDC 3UGXA 3H1ZA 3VDCA 3HI1A 1A6VL 3JBG7 5E56A 5FB8B 4ERSL 3PWJA 1NGYA 2JJSA 4WFHE 1OGAB 4ZS6D 2WB7A 3CFBB 1BAFH 4JFEE 2JK5A 4HKBA 4Z1PA 1XCQB 4TSAL 5D7IA 3ZXAC 3LPGA 3U0TA 3SDDD 1UURA 4TTDD 5SWZE 3H2PA 4U1IB 1TENA 1IGJB 2AQNA 2ATPB 2WNWA 4PVNA 3VXMB 2EDMA 5JW5B 1HH6A 2HTKD 4HXBH 1X5JA 3E6FA 3W5NA 5E4AA 4JAMA 2CDGA 5F9WB 5IBTH 3MRDB 3ROOB 2HJFA 4MLIA 4O00A 1PIFA 1BAFL 1AGDA 4LNVA 2G2PA 2GSGB 2Q6WA 4ZW3A 1J0ZA 2H2SD 2I07B 4PRBA 1G7PA 4LPCA 3EH3B 5D7LB 1E5ZA 5EG6C 2HRHA 1JNNH 4IOFC 3FH7A 5F0PB 1RK7A 3HCVA 3JUZA 4L05A 1RSFA 5F6IC 4N2HA 3CK0H 1PLBA 1UD3A 3O4OC 3GS7A 4NZ8A 1PZ5B 2FVNA 5D1QB 4HXBL 1FJ1B 5IBTL 3LH2H 2Y7QB 3KPRD 2WD0A 3TPUB 4Z7OE 2QLVB 3PYCA 1KLUA 3CC1A 5CEYA 1IGMH 3LNGA 3NCMA 4H2AA 1NOAA 2EUWA 3D39E 1R24B 2DQFB 3ZYIA 5L2KA 4HV8B 2EDYA 1HE8A 4WJKB 1OM9A 3BP7B 1JNNL 4DWHA 4HC1A 3T0EC 5IQ9A 4XB8A 4JN2B 1B9KA 3CK0L 4AIXA 3IRPX 1JNHB 4RGNE 1MH5A 2ICWB 1GAFH 3DSFH 3GRBA 2J44A 3IRZA 4IBUA 3LH2L 4GW4A 2Y0SA 2OSLA 1AKJA 4Y89A 1AS6A 1BOGB 1QSFA 5GJSH 4NHUB 1FSKC 1IGML 1TIUA 1N6UA 3NSYA 4JE4B 2Q7YA 3JV5A 2E9BA 4GFXA 3OTTA 2OYPA 4D0DA 4NYLA 3UTTB 1C5CH 4TOYH 4UQDA 5EBMB 4XNDA 1PS3A 1T1ZB 2NYKA 3DTUB 3RWGB 4FMVA 4RRPM 1GAFL 1P2CA 3DSFL 4FL4B 3ZVVA 4I18C 2EKJA 5GJSL 2YGNA 3KPQA 3ZTEA 2NXYC 4K0OA 5HD8C 5HHQB 2CHXA 1XL4A 4U6TA 3MRQB 4HMDA 4DEPC 1JERA 3BAJA 1K5NB 5CSBA 3FQUA 3HRZC 1C5CL 3MJ9A 4TOYL 3ZKMD 3FU9A 9PCYA 5HDQH 2IAMC 2Z7WA 1YNTA 4S1SH 4WGKA 3BZ4A 3D4CA 5HHPB 5L4IA 3RY6C 3VH8G 4Y9EA 2DYPA 2WQXA 4MMXB 2Q8BH 2J12B 4B9GA 2NXZC 2PMZA 4XRCB 1ERNA 3B3IA 4YE0A 1RFDH 5TE4H 4LCUA 2FWOA 4PWIA 3ULUF 3CDFA 1XWVA 1QX1A 3FRUB 4H8WH 1YY8A 2COQA 5JHLA 3QDGD 4ZMNA 5HDQL 1FVCB 3CX2A 4S1SL 5FHAH 4NQTA 2NW2B 3QS2A 2Q8BL 5IEKB 1NBVH 1R3KB 2HX8A 3QS3A 3EIFA 2EDKA 2Q2EB 2BSED 1EJ8A 3L6FA 5DVMA 2IIJA 1RFDL 1P4UA 5TE4L 2PABA 1JHKH 2FATH 3GBLA 2EAEA 4YO0A 4H8WL 4C56B 1Q4NX 3PWJB 4PJAE 2SEBA 1NGYB 5F0JB 4R2GB 2NNCA 5FYLH 3B2PA 4S0HA 2WCSA 2VL4A 4PCKA 3P4NA 5A43C 1J8HA 1JYWA 3C60A 2JK5B 5FHAL 5IROC 4HKBB 1KXVC 2WXPA 5DD0H 1NBVL 2OULB 4V1DE 4OCNC 3D48R 3D18A 1YEIH 3N41B 3SJVE 4BK5A 1JHKL 4IK7A 1YYMH 2FATL 4B9KC 3EO1A 3LYRA 4TTGA 2X2UA 1PCSA 3CDZA 4EI0A 1HH6B 5EORH 3H9SB 3E6FB 1WV7T 3KR3H 2DW5A 4JAMB 2CDGB 4WDIA 5FYLL 2V33A 2YKLH 2HJFB 5AVQB 3V79C 4KHXH 4I2XA 3RQ3A 1ZWIA 1AGDB 4D0CA 5DHVA 4P2OB 5DRWA 1U8QB 1BV8A 4JLRA 1CWVA 2Q6WB 1GZPA 5DD0L 4PRBB 1G7PB 1FO0A 5ESAA 5GRUH 4TLUA 2ITDA 1YEIL 2QR0A 2R1YB 4ABWA 3HCVB 2WKLA 5E4EB 1EFXA 2C3XA 4FFYH 5DMIH 1YYML 1J18A 1I75A 1CICC 2BVQB 5KJRH 5J11C 4CAGA 1JCVA 1G9MH 4LVOB 5EORL 3ULVD 3KR3L 4JHBA 4CRPA 4NRYA 2YKLL 2O6FA 2X4SA 1B0WA 4KHXL 4M8RA 4X5XA 3ZYOA 3L9YA 4B6ZA 3C2SA 3VD1A 4UQAA 1KLUB 3AQZA 3LKNA 5CEYB 5BV7C 5E8DH 3IMVA 1JZJA 3RGVD 5L2KB 5GRUL 1N67A 1DUZA 4U1KB 1GGCH 3INUH 5CM1A 5IQ9B 1ECZA 1NLBH 4FFYL 5DMIL 2DAVA 3DMMD 1ACYH 1RERA 3QFJA 5C08D 5KJRL 4K2UH 4KNSA 2C9UA 2DWEB 1G9ML 3G5VA 2DRUA 3OQRA 4GW4B 4U33A 2OSLB 4GAFB 5IJDC 3N44B 4PTUA 3QJFA 6CGTA 3RP1A 2PUQT 4IS6B 1FH5H 5BZZA 3T3MB 2IBZX 1HEJC 3ECWA 1I1AA 1J8SA 3FU3A 5EOTA 3TU6A 5DC2A 5HHXH 4XP6H 2Q7YB 3OB0H 2W60A 4HC1L 4LEOA 2LTQB 1GGCL 1YN7A 3INUL 4NYLB 3TT1H 1URZA 1A8ZA 1NLBL 3QA3A 1BMZA 5H37H 3UTQA 5DJ0B 3UC2A 3VM7A 1ACYL 3PG2A 1CF8H 4K2UL 3TEZA 1PDKB 3VXUE 4UQ3A 1P2CB 4IMLA 4OJFH 1L9RA 2NCMA 5H2BA 3SKOA 1E7VA 3VXRB 1FH5L 1XQ4A 2OMNA 1HFUA 3ZTCC 1DP0A 4X42A 1RHHA 5HHXL 4XP6L 2JWYA 2P52A 3CN0A 4QRRE 3BUQA 4QRSB 5C09A 3FQUB 2DQTH 2WCGA 4FXKB 4QYOB 4R97B 5DFTA 3TT1L 3MO1A 2YGVA 1CF8L 2B59A 2EP6A 3BZ4B 3WUWG 4ONFH 4RWYH 4AM0Q 2YPLB 1JWSB 4JFSA 4P4KB 3EHBD 3HG2A 3R7QA 4OJFL 5DHYA 4LSRH 2ODIA 3CZLA 3VSUA 3WO3B 2J73A 3FJTA 3B3IB 2ZAIA 3BH4A 4LCUB 3MODH 2OMYA 2X88A 4N0CD 25C8H 4FYQA 5HI5D 1OSEA 2YS4A 4KAQH 4HBQA 2DQTL 2F0CA 1P7KB 3WIFA 4GRWE 2F53A 4ZUVB 1BF8A 2M26A 5EBLA 2DYSB 2NLJA 4ONFL 2Q1EA 1Y0LA 2WXQA 3Q1SL 4RWYL 1X5IA 2LU4A 2AP2A 4LSRL 3EH4B 1ZT7B 3QT2A 3E8VA 1F6LL 3L6FB 4G6AD 2GCYA 3MODL 3EUUA 5F7AA 1UM6H 1I3VA 4YO0B 1CGYA 5HGDA 1I8UA 5BRZA 25C8L 2OTWA 3I6GA 1A65A 3UACA 3PREA 4KAQL 4M5TA 2SEBB 4BYHA 3B8YA 5GS0C 1ZGLM 2R29H 4KNUA 4NKMB 3T71A 1I9EA 1CD0A 1BFOA 1J8HB 2CRMA 3C60B 3NCYP 4OUOA 4WWID 5IQ7H 1WA2X 1DVFA 3RIAK 3FPYA 1N7MH 1YG9A 4EIZC 4X5PA 1AQ8A 3D18B 3FFCD 1PTZA 4QJ5B 5K9QG 4ELMB 4X7DC 4X98B 1UM6L 3BAXA 3EO1B 3LZLA 1JZGA 2AZUA 3GDCA 4PY7A 4OZFA 4WDIB 2R29L 2K0RA 3QJRB 2AK4D 5DHVH 1ZWIB 3DIFA 3FSWA 1KZYA 2PO6D 4D0CB 5DRWB 3JV0A 4DGIH 4JLRB 5IQ7L 1FO0H 2H45A 1GZPB 1N7ML 1QUNA 5ESAB 2AS5M 4YZWA 2QR0B 4MB3A 3GXFA 4DGUA 1HCFX 3MFGB 5HYSB 3MI6A 5IKCB 2M2DA 3VX0A 5E7FA 1LQBC 1KXQE 4M1GH 4YLBA 4NRYB 4PRHE 4XPGH 2X4SB 4X5XB 4M7ZC 5DA4A 3CMGA 4PI2A 4DGIL 1JYXA 3DX4A 5CCKH 5E24E 5I0YA 1FO0L 2AQSA 1XF4A 3DDGA 2ZWSA 4YJZL 2AXHA 1DUZB 1NEZA 2VLRA 4W9HC 4DUXA 5L88H 4Y9GA 3HS8A 1Z9MA 3JUYA 4JY4A 3W56A 2WWMD 4O2EA 4QTHA 5B3JE 3QFJB 3RJQB 3LKQA 3ZTJG 4Z7VB 4WUUB 2APWA 2EYRA 4GLRI 3FUNA 4M1GL 3G5VB 4AT6A 4XPGL 2FO1A 4PTUB 4PYGA 4KTDH 1F8TH 3QJFB 1VKXA 1IKFH 1A8JH 2XVLA 1I1AB 5EOTB 3ECQA 3BE1H 1E28B 4X0NA 3VRIA 1JSYA 3B37A 3KJ6H 3G9VA 2W60B 1J8RA 3GGWA 4LEOB 4P23A 5LNEA 3ZQWA 2Z31A 1YN7B 2E27H 5L88L 2QELA 4OF6A 1NJ9B 3IF1A 2CUIA 5I19H 2VAAA 3H7LA 3ZY7A 3WI9A 4G1EB 1OTUD 2EEDA 4MJID 4ODWA 4FA7B 2BO0A 4UQ3B 4BBWA 4IMLB 1WTLA 3B2XA 3FTYA 2WVVB 4YNYA 5IHWA 3ULUH 2ZX8A 5CINH 2XVGA 5H2BB 4KTDL 1F8TL 3OR7B 4WEEA 1K3IA 3I6KA 1IKFL 1DBMH 5B39A 3E1ZA 3TO4D 3NQIA 5SV4A 3BE1L 1EZSA 3KJ6L 1RIVH 3NRFA 2E27L 1UB5A 5AVXB 4M03A 5I19L 1L9QA 3FT2A 3MO1B 4JFFE 1II4E 2B59B 3ZT6A 2P8PA 3CHRA 1QR1A 4G8FB 1MHPH 2LFEA 4GY4A 3GJFA 5DHYB 5LBGA 3M17A 1I82A 3ULUL 1ES0A 3UPCA 3LHAA 1R47A 5CINL 1CI5A 1TJGH 3KYOA 3M1BA 3LQZA 4FQ2H 4WFGE 1DBML 2UYLB 4ELKB 3UBFA 3WS6A 3OKNA 1Q0YH 1NPUA 3SQOL 1JXJA 2XKSA 2HLFC 1RIVL 3JWNC 5CJXA 4QAWA 2X7LA 3EYUH 4I0KA 3L45A 3LNEA 4NLHA 3ARZA 3TA3C 4I7ZC 4CDHA 3WIFB 2F53B 1PG7X 4MS8C 2JKWA 2PYED 4KTYA 4GT0A 2P5EE 1Y0LB 3MOBH 3RUGE 1MHPL 4FE9A 1J0KA 4W93A 4XNQB 3HJ0A 3ZKQD 4BRVA 1KJVA 5EC2A 2DQ6A 3GSNH 1TJGL 2Y23A 1FNEB 1G7HA 4FQ2L 2GCYB 3S34H 3RL1A 4XZ4A 1Q0YL 1MJ8H 4JUTA 5KANG 5BRZB 2OTWB 3I6GB 3BWAA 2B3IA 4MJ4A 1M05A 3EYUL 3KDPB 3ZX1A 3V4LA 1KLFA 3DJ9A 1CVRA 1D2OA 5A2LH 1PSKH 2CRIA 4O51A 5HHOE 3MOBL 5EH1A 5D6DC 2OJEA 3OAZH 2NNXA 3CVCA 4M29A 1XSIA 2A74C 3GSNL 2NNAA 4YSAA 3RURA 3S34L 3VWJD 3VE0A 3RZCD 4MAYA 1A47A 1MJ8L 3QXDA 3CFJA 5JOPE 2ZX6A 4M9PA 4PY7B 3DX3A 2QPEB 4OZFB 4X8XA 3WL9A 3G3LA 2AJ3B 4R7VA 3WNNA 1OB0A 2H47C 5E1HB 2CALA 5C0AE 1QHOA 4FG2A 1PSKL 2FH6A 2OJ1A 3K5RA 4QXUH 5D1ZD 1BFSA 4P46C 4JFVA 3L3GA 3QORA 4P2YA 3WN6A 5E2WH 2V3FA 1DJXA 4UM8A 3DRTA 4M56A 2EC8A 4X6CA 4FTDA 3Q8FA 1LYQA 4JFDA 4U1JA 4DP1X 5DMYA 1JWUA 3U2JA 4GRLA 5KVFE 5KOMC 4XBEL 2V9QA 4YSOA 5BRQA 2K8QA 4ZDHA 4FP8H 1JPEA 3WFZA 5FECA 3QNFA 4F37F 2PWGA 3FCTA 3KPSE 3QI9D 4XE0A 1XF4B 3TONA 3V0DA 4AUUA 5F97E 4QXUL 1FIGH 3WNKA 3D85D 3GLEA 3N40P 1XGPA 2VLRB 1MCNA 4NAJA 5E2WL 2P47B 2QEJA 4JY4B 1A4KA 4QTHB 5B1CA 2C7UB 1I3UA 3QULA 4TUKH 1VZGA 5TFSH 5AVVB 2GJ6D 3WKMH 1AVAA 3OF6D 4P2QE 2EYRB 1MCJA 3EADA 4J27A 1IU1A 4FD0A 5CGTA 4M5SA 3ZE2F 4FP8L 5K33A 2VSCA 3II1A 4PWJA 1VKXB 4YZFF 4JFEA 1QRND 1NIEA 4DJMA 4XCCH 1FIGL 3PXLA 5LNGA 3VRIB 5GS2H 4TNEA 4Y16A 3GGWB 2X40A 1U8MB 1VENA 3UERA 3LTVA 3FU0A 4MMZA 3O6FA 2VAAB 1BZ7A 4TUKL 4TVPD 1YA5A 5SWZA 3WD5H 1J1PH 4ODWB 5TFSL 1PY9A 3WKML 5EIIB 5T3XH 2VUKA 1SHXA 4BZ1A 3L9EA 1A7OH 4YNYB 5IB2A 2C1OB 4U6HA 2FBRA 3G6JE 5B39B 4JVWA 3RZCA 1R5IA 5FYJH 4XCCL 3TYFA 3MRPA 1I8AA 4YHIA 4ZG1A 4D9LH 4L3ED 1QNZH 2MHAA 3D0VB 4OH2A 3WD5L 5L4MA 3OKLB 3TVMD 2P8PB 1C08A 1J1PL 1QR1B 4KK8D 3UC0H 3BJ91 5T3XL 4C4KO 5I8KH 2NMSA 3GJFB 1BQLH 2LU7A 3C5ZC 1A7OL 4ABUA 4YS4A 4AGQA 4JO8A 2OM5A 1LMKA 1QKZH 4GS7B 1SN2A 1TPXB 4EEEA 3K81A 3M1BB 3TURA 3LQZB 3U2IA 2IAAC 5FYJL 3OKNB 3BVVA 4ZZKA 3B5HA 5SWSD 3D39A 4MGXA 3RHWF 3WHXA 1SOXA 3RY5A 1BD2D 4D9LL 4ESKA 3RFZC 1QNZL 4HW6A 1VESA 5TQ0H 2QSCH 3WS3B 2JE8A 3MYZA 3UC0L 2BY3A 3GSOA 5I8KL 2H7WA 1BQLL 1WZ1H 2VXVH 5GRYA 1KJVB 5IR1A 5EC2B 1QKZL 4XNZC 4UIKH 5CEXA 1QBAA 5I28A 3HS0C 3RL1B 4AJVA 3QUXA 4BHUI 4GG6E 4E36A 1M05B 5KAQG 4KZ0A 4ODSH 3NSDA 3F7KA 1KLFB 3A22A 1ZXKA 1L6ZA 3US1A 5TQ0L 4RA3A 1BQRA 2QSCL 4O51B 3FULA 3DO3A 5D7KE 2R2EA 3QIBA 1WZ1L 2OJEB 2IG2H 2VXVL 4EN2A 3FQYA 3RWIA 2NDGA 3SBPA 3GMNA 3QDMD 3BN9C 1GOHA 2NNAB 4UIKL 3LNDA 2QQKH 2NY7H 3UO1H 1QSZA 1UXWA 2FTAA 3SCMD 3VE0B 4MAYB 3E8UH 2UVFA 1X3DA 4BGLA 3CFJB 1IC4H 3LSOA 4O9HH 2FSDA 2XY1A 3WL9B 4PWHA 4EKXA 4TN9A 2X5PA 2X6VA 4ODSL 3B2VH 3BISA 3MKGA 4OJAA 2XTSA 1THAA 3H8NA 4M5YH 3O3EA 3C5SA 3OAUH 1G7LA 2IG2L 1D6VH 2VXTH 4WI0B 1KBBA 1M7DA 5F9OH 3WSQH 3L3GB 1FCGA 3QORB 1NH6A 3V4PH 2AJZA 2QQKL 2NY7L 2XIBA 3T2QA 3UO1L 3EFFA 3POHA 5CZXC 4UM8B 3DRTB 3E8UL 3HB3D 1B0GA 1IC4L 2X6CA 3LZOA 4O9HL 3ETBF 4JFDB 4U1JB 4GRLB 4APQC 3GLZA 3STZB 3FUKA 3B2VL 1QACA 4ZDHB 5FECB 4WNQA 3ARYA 3PUCA 2AJUH 1E3XA 1ROWA 3CDCA 4IW4C 4M5YL 3FCTB 3GLDA 3ZIMA 1ZHBB 1BVKA 2VL5A 4F1SA 1KCUH 3OAUL 3IKCA 1D6VL 2VXTL 4JO3H 5LBSA 5F9OL 3WSQL 4D7PA 1XGPB 4YL9A 2VISA 3V5KA 3VD9A 3V4PL 1W72A 1NCHA 3M8OH 2BP3A 3QULB 2IWGA 1D9KB 1TQCC 3VGFA 5F0LB 1QPPA 5CCGE 3Q3GA 3PQYE 4PJAA 1JTPA 3N3EA 3ZGIA 3ERXA 2AJUL 4QAMB 1N64H 1WD9A 4EVNB 1S9YA 4GAYA 4RETB 1FNLA 1V10A 1D5ZB 1CFSA 4JFEB 1NMCC 3AS3A 3AY4A 5D2NE 2XRAH 3U6XS 3RDTC 1KCUL 2C3HA 4JO3L 5ABAA 4GSRA 1SUJA 2IDSA 3PHOA 3DOIA 4LSSH 4QJ3B 4Y16B 1EAOA 4GXFA 1L3WA 4V1DA 4F8QA 1PY0A 1BEXA 1LP9B 1KXHA 4MMZB 3O6FB 2EIKB 3IMUA 1BZ7B 3M8OL 5SWZB 4AVHA 4DIXA 1Z9PA 2J8UE 1RPUA 3ME0A 4BZ1H 5T3ZD 3I2CH 1HS6A 1T04A 1FLRH 3O9WA 5IB2B 4M61B 4Z5RB 1N64L 5C9KA 4U6HB 1JHLH 5EN2A 3IDXH 3I02A 3IGAA 2XRAL 4MNQB 2ZWLT 3ARXA 1R5IB 4RMWA 4NNXB 5FC9A 1RK0A 3UAJD 3MRPB 2ZSWA 4FFVC 4LSSL 4FG0A 1SY6H 4YHIB 5ALBH 1LEIB 2O5NA 3ZDXF 1U3NA 2MHAB 1S7TA 4AEEA 1AO7E 2WBKA 5ITFA 1PJ9A 3JTSB 4N68A 1WP6A 1U3HA 4BZ1L 4IBQA 3I2CL 4PJEF 4WNSA 1BM7A 2FWLB 1IQWH 3OMZA 1DEDA 1JHLL 2PETA 4LOVA 3IDXL 1W0YT 4EBQH 4Z7OB 2A4EA 3GMOA 3QJTB 3VGHA 1XSJA 1KGXA 2OP4H 2QMKA 3H54A 4QR7A 2NY5C 4PJDB 3D39B 5ALBL 1SY6L 3SDCD 2H32H 1A7QH 2DOCA 2WQAA 3BI9X 3TIDA 3TCTA 5ICYA 5DFWH 3LV3B 1RAMA 4KVPA 1DN0A 3MNMA 5JXED 4YDLB 5IR1B 1IQWL 1Y6KR 4ZUUA 5FUOH 4FADA 3EO9H 4HMCA 3C08H 1UFUA 2RQ8A 4G42A 5CSGA 4EBQL 7TAAA 2FJFA 4KRPD 3M88A 3T6XA 2OP4L 3K1KC 3MMEA 5F7NC 5JHDE 3VI4E 1HEZA 1FVDA 4G82A 3LEVH 1DVTA 1A7QL 3HMWH 4FNSA 2NYYC 3KHOA 4TV3A 2O6DA 1R0AH 2OL3A 3LRMA 4M93C 3KGRA 3RI5F 3N55A 3CQPA 1HHIB 1XGZA 2Z0UA 3QIBB 3VXUA 3EDFA 3GXMA 4X4XA 5I30H 3RWIB 2JLLA 5FUOL 1DQKA 1MXGA 4JDEB 3GMNB 3EO9L 1ZLUH 3C08L 4HSQA 4AOFA 1SOKA 4AYID 3UBHA 4NQED 3ALPA 1MOEA 5I6XC 1PKQE 4NP4L 3LEVL 4GIOA 2MH4A 3HMWL 4QRRA 3HZYA 3VXPA 1R0AL 2C4FU 5H35A 2X44D 2ISDA 3O3EB 4P2RE 4PR5A 2B16A 3C5SB 1G7LB 2WLIA 5I30L 2YXMA 4MNHB 3TTYA 4CADB 1FBIH 4EDXA 2AJZB 5CO1A 5KUMA 1JGVH 1HL5A 3SBRA 1B0GB 1NGQH 3HPLA 3BD5A 2ETWA 4WWKC 5I66A 2XZZA 3OX8A 3FFOA 3EUDA 4YDVB 4R96A 4WO4A 2VL5B 1V7NH 1IBZA 1UCBH 1KTJA 4R3SA 3IKCB 2NOYA 5EUOE 3V6ZA 5BZDA 1WZLA 4J3OC 1W72H 2VISB 1FBIL 1PY4A 2A9BA 2YD0A 1F6FB 1MJ7H 4HKJA 3U79A 3D87B 2VLLB 2VM3A 1GHFH 2CCLA 3KLAA 3F00A 3GSRA 3MBEA 1NGQL 4KK9D 3UIYA 4HS6A 3JWOC 2ITCB 3OG6B 1JHTB 4PJAB 1SXSA 5JIIA 1PW3A 5DI8B 4GAYB 4H8UA 3FU7A 1CFSB 5EU5A 1AHMA 3CFQA 1V7NL 1MNNA 1UCBL 5AWNH 1MFMA 3S36X 4XCFH 1YEDA 3ARDB 3D3VA 4Q6YA 1W72L 2E7BA 4V1DB 1L5GB 2Z1KA 3T0WA 2W5PA 4Y5XC 4LNRB 2DWTA 1MJ7L 4GG8B 3IBOA 1KZQA 1GHFL 4U3CA 5J4MA 1EO5A 5ECGA 5A1AA 2VLJB 2VH5H 1T04B 4GJTB 4L23A 1ACXA 2OMXB 3Q6FA 4FTVD 2EO7A 4HJJH 4BEIA 5CGMA 2C5DC 1CS6A 2UZIH 5KOVC 3PWNA 4ZMTA 1WBZA 5DO8A 1N4XH 3I02B 3F58H 1S8DB 3IGAB 5ADPH 1CO1A 2GSIA 5AWNL 1KDJA 4K3EH 5CJOH 3DI2B 1RK0B 4XCFL 3TNNA 2ZSWB 4ILDA 2HJLA 1JV5B 4F15B 1U58A 2NY4C 2D4DA 5FXCH 1S7TB 1VFMA 2AMUA 3ESPA 3DI3B 2N4IA 2J55A 4XXDA 5ITFB 2J20A 2RA1A 4GO9A 4ODUB 2VH5L 1X6LA 2G2NA 2YAOA 2NY6B 4GQQA 1KXQA 2Q20A 2E9IA 4HJJL 3BPOB 4PRHA 2UZIL 4KO9A 1OCWH 3HR5A 5C71A 3DPBA 3F58L 5ADPL 3GMOB 2XXMB 4K3EL 4WW1A 1UD6A 5CJOL 4KKLD 4YSDA 4B5ZA 1SBSH 3SZ6A 1ANUA 4UYPA 3QIUB 4PJXF 5LLIC 2LFGA 2V5YA 4JZNB 5D96C 3NJNA 1AI1H 2FQFA 2QDVA 3BLKA 3MBWA 1A3QA 2QKIA 2CKBA 1DN0B 4J3OG 4MAUH 1BVOA 5SWQA 4NNPH 1AS7A 1OCWL 4LB8A 4YFDB 4G42B 4CILA 2R0KH 3EGDB 2NY0B 3I3DA 3CZKA 2FJFB 3LEYH 3MMEB 3Q2LA 5IHZA 5CWSA 4KO6A 1SBSL 4JJ5A 3LKSB 1HEZB 1VJSA 1FAKT 4ZT1A 1R5WA 1U91A 4HX1A 2OL3B 1KJMA 1AI1L 3JZYA 4LAJH 3K71A 1SLUA 2VW7A 4X6DB 3VXUB 4MAUL 4N2LA 4X4XB 3SE8H 4NNPL 5TDPB 1SHSA 3SYPA 5DLMH 1CFVH 1RMFH 4I0PD 1P4IH 1OGAD 1HSAA 2R0KL 3MRGA 5HXMA 4PJ8C 4GPVA 3LEYL 3POCA 2R2BA 2ZYSA 1FFPB 3MV9E 4FHKA 4AYEC 4QRRB 4K3JH 3VXPB 2Y3NA 3HA0A 5H35B 4EUPH 3SPCA 5BS0D 4R4FH 2XXFA 1KIQB 4JFFA 4PR5B 4XVUD 3RWCA 5EF1A 2N1TE 5E1GA 3MLRH 3DETD 1G6VK 5E9DE 3CSGA 3SE8L 5EDSA 5IB4B 4L8SA 5DLML 5IW6A 1CFVL 1RMFL 4EDXB 4E9TA 2ZUWA 1P4IL 2DIJA 5TTRA 3WN5C 4LFHG 4FG6D 4NQVB 4TQEH 4W6YB 1WAAE 4R8WH 2CZNA 1ID5I 1SM3H 1YUHB 3HPLB 2D2OA 3MLVH 3DHMA 3NEEA 3G6JF 3QH3B 4J8QA 3VM5A 2BVOA 4K3JL 5D7LD 4CU6A 5I66B 4UWQB 1WS7A 2APTA 1SJHA 4R4FL 3OX8B 4GRWB 3QPQD 4R96B 5MI0B 4WO4B 1MIEH 4JDTH 1U30A 4R3SB 3MLRL 2P5EA 3RUGA 4W9JC 5BZDB 3V6ZB 4OV5A 3UPAA 4G3YH 4WI2A 5D1QD 1TUPA 2CAKA 1G6RB 1NGWA 4KDWA 4RGMB 5HYFA 3OJDB 5D7JC 1G9NC 3KLAB 4R8WL 3MBEB 3PHAA 3C8DA 1SM3L 2D7TH 3MLVL 4HS6B 3U83A 5F7HA 3ETBJ 4R6UA 5C97A 4H88L 1PQZA 3WKPA 4BQCA 1YN6A 1LM8V 1MDTA 2Y6SC 2J5LC 3GUTA 4N24A 4YPGA 3FU7B 3Q01A 2R23B 1MIEL 1KYUA 4JDTL 2ILLA 5F88B 1UXMA 5HHOA 1U8HA 3IWUA 1A4CA 1HXYA 1UGKA 1YEDB 4KH2A 2AEIT 3D3VB 4G3YL 1OAUH 1UOVA 4OBRA 5FYJU 4AY0A 2D3NA 3P4OA 3HE6A 3PPEA 5EO0A 4Q0XH 4FNQA 2WTOA 5I6MA 4C4KT 2K3TA 3UIZA 1T21A 4O2FA 2D7TL 1SGKA 4N0RA 3HI5H 3A4DA 1DQLH 5IJVA 3BWZA 3VFGH 5C0AA 3UTTD 1EEYA 5DEZA 1WBZB 2N01B 1A9BA 1P5UA 4R7XA 2GSIB 4XCEA 2W9LA 3EJYD 1E3FA 1I3RA 3TNNB 1SF3A 1SZNA 4W4OC 3ZTDC 1OAUL 1ZA6A 4KI5D 4FRWA 4XHJC 1FG2A 1PNCA 4Q0XL 4ECNA 4XBMA 3KGUA 4HU2A 3E0GA 4KROD 1DQIA 4YFLF 3HI5L 1DQLL 4XNUH 4AQ1A 3JVGC 3EYSH 3HZ3A 4PRHB 3VFGL 3HR5B 4WSKA 5HHNA 3DPBB 3FOMB 3KPSA 4WW1B 4IDLA 3ESOA 1NBYB 2ROXA 3EH2A 4G43A 3TOPA 4DGVH 4G9DB 2O5XH 3CSBA 2PPAA 4XPTH 4BFIA 5FYKD 3MBWB 2CKBH 3TT3H 2JCCE 2EDDA 3ETSA 1MCWM 2CKBB 2QKIB 2YPKB 4XNUL 1QRKA 5KSUA 4P2QA 3EYSL 5SWQB 4CMMA 3WEAA 1KPUB 5LO7A 5FO7A 4LRIC 1ASQA 2W38A 1URIA 1A14H 3D2UD 3NA9H 3QEQ